BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13578_g1_i1 len=1436 path=[1:0-1089 1091:1090-1435]

Length=1436
                                                                      Score     E

emb|CDP17887.1|  unnamed protein product                                651   0.0      
gb|EYU21968.1|  hypothetical protein MIMGU_mgv1a004214mg                645   0.0      
ref|XP_011081956.1|  PREDICTED: 3-ketoacyl-CoA synthase 10              639   0.0      
ref|XP_007012476.1|  3-ketoacyl-CoA synthase 10                         631   0.0      
gb|KHG14239.1|  3-ketoacyl-CoA synthase 10 -like protein                630   0.0      
gb|AAL67993.1|  fiddlehead-like protein                                 630   0.0      Gossypium hirsutum [American cotton]
gb|AGK30017.1|  3-ketoacyl-CoA synthase 8                               629   0.0      
ref|XP_009777333.1|  PREDICTED: 3-ketoacyl-CoA synthase 10              626   0.0      
gb|EPS63712.1|  hypothetical protein M569_11072                         625   0.0      
ref|XP_003522322.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         622   0.0      
ref|XP_009404183.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         620   0.0      
ref|XP_002516167.1|  acyltransferase, putative                          620   0.0      Ricinus communis
ref|XP_009362990.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         620   0.0      
ref|XP_010273876.1|  PREDICTED: 3-ketoacyl-CoA synthase 10              618   0.0      
ref|XP_008351945.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         619   0.0      
ref|XP_009594847.1|  PREDICTED: 3-ketoacyl-CoA synthase 10              617   0.0      
ref|XP_008452803.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    617   0.0      
ref|XP_004291247.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         617   0.0      
emb|CAC84082.1|  putative beta-ketoacyl-CoA synthase                    616   0.0      Antirrhinum majus [garden snapdragon]
ref|XP_004141352.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         616   0.0      
ref|XP_007222372.1|  hypothetical protein PRUPE_ppa004011mg             615   0.0      
ref|XP_007136914.1|  hypothetical protein PHAVU_009G084500g             615   0.0      
ref|XP_011019306.1|  PREDICTED: 3-ketoacyl-CoA synthase 10              615   0.0      
ref|XP_003526086.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         615   0.0      
ref|XP_006361525.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         615   0.0      
ref|XP_010939879.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         614   0.0      
ref|XP_008800450.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         613   0.0      
ref|XP_004245205.1|  PREDICTED: 3-ketoacyl-CoA synthase 10              613   0.0      
gb|ABU75309.2|  fiddlehead-like protein                                 613   0.0      Pisum sativum [garden pea]
ref|XP_004168381.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         612   0.0      
ref|XP_002282234.1|  PREDICTED: 3-ketoacyl-CoA synthase 10              610   0.0      Vitis vinifera
ref|XP_010049293.1|  PREDICTED: 3-ketoacyl-CoA synthase 10              610   0.0      
ref|XP_008220603.1|  PREDICTED: 3-ketoacyl-CoA synthase 10              611   0.0      
ref|XP_002309451.1|  beta-ketoacyl-CoA synthase family protein          610   0.0      Populus trichocarpa [western balsam poplar]
gb|KDP34003.1|  hypothetical protein JCGZ_07574                         608   0.0      
ref|XP_006474532.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         608   0.0      
ref|XP_010098399.1|  3-ketoacyl-CoA synthase 10                         607   0.0      
ref|XP_008377531.1|  PREDICTED: 3-ketoacyl-CoA synthase 10              607   0.0      
gb|KDO73681.1|  hypothetical protein CISIN_1g009313mg                   606   0.0      
ref|XP_009117027.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         606   0.0      
emb|CDX77038.1|  BnaC04g38330D                                          605   0.0      
ref|XP_009359048.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         605   0.0      
gb|AAF73978.1|AF214500_1  fiddlehead protein                            603   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010417407.1|  PREDICTED: 3-ketoacyl-CoA synthase 10 isofor...    604   0.0      
ref|XP_010417409.1|  PREDICTED: 3-ketoacyl-CoA synthase 10 isofor...    604   0.0      
ref|XP_003603250.1|  3-ketoacyl-CoA synthase                            603   0.0      
emb|CDY11498.1|  BnaA09g40640D                                          603   0.0      
ref|XP_010937298.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         603   0.0      
dbj|BAJ34066.1|  unnamed protein product                                603   0.0      
emb|CDX76724.1|  BnaC08g33100D                                          603   0.0      
ref|XP_010472653.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         603   0.0      
ref|XP_006408789.1|  hypothetical protein EUTSA_v10001951mg             603   0.0      
emb|CDY35309.1|  BnaA04g15380D                                          602   0.0      
ref|XP_002880771.1|  predicted protein                                  602   0.0      
ref|XP_009140735.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    601   0.0      
ref|XP_010429645.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         601   0.0      
ref|NP_180193.1|  3-ketoacyl-CoA synthase 10                            601   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAF73976.1|AF214496_1  fiddlehead protein                            601   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAF73980.1|AF214504_1  fiddlehead protein                            601   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KFK32520.1|  hypothetical protein AALP_AA6G253600                    599   0.0      
ref|XP_006452943.1|  hypothetical protein CICLE_v10007953mg             598   0.0      
ref|XP_008782856.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         598   0.0      
ref|XP_010527059.1|  PREDICTED: 3-ketoacyl-CoA synthase 10              598   0.0      
gb|AAF73979.1|AF214502_1  fiddlehead protein                            597   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006293899.1|  hypothetical protein CARUB_v10022892mg             593   0.0      
ref|XP_004501406.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         590   0.0      
ref|XP_006843898.1|  hypothetical protein AMTR_s00007p00267760          587   0.0      
ref|XP_009390873.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         584   0.0      
gb|AAO47729.1|  fiddlehead-like protein                                 580   0.0      Tropaeolum majus
ref|XP_010692949.1|  PREDICTED: 3-ketoacyl-CoA synthase 10              572   0.0      
ref|XP_002468397.1|  hypothetical protein SORBIDRAFT_01g045150          567   0.0      Sorghum bicolor [broomcorn]
ref|XP_009380021.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         565   0.0      
ref|XP_008677051.1|  PREDICTED: LOC100283031 isoform X1                 565   0.0      
ref|XP_004960826.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         561   0.0      
gb|ABK24632.1|  unknown                                                 560   0.0      Picea sitchensis
ref|XP_003558663.1|  PREDICTED: 3-ketoacyl-CoA synthase 10              550   0.0      
gb|EAY88792.1|  hypothetical protein OsI_10265                          548   0.0      Oryza sativa Indica Group [Indian rice]
gb|EEE58439.1|  hypothetical protein OsJ_09660                          547   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|ABG35745.1|  putative FIDDLEHEAD very long chain fatty acid co...    545   0.0      Hordeum vulgare [barley]
ref|NP_001049170.1|  Os03g0181500                                       545   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|AAN65442.1|  Putative fiddlehead-like protein                        546   0.0      Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ87894.1|  predicted protein                                      543   0.0      
gb|AAF73977.1|AF214498_1  fiddlehead protein                            515   2e-177   Arabidopsis thaliana [mouse-ear cress]
gb|KHN37223.1|  3-ketoacyl-CoA synthase 10                              514   1e-176   
ref|NP_001149405.1|  LOC100283031                                       493   8e-166   Zea mays [maize]
gb|KDO73370.1|  hypothetical protein CISIN_1g038123mg                   489   3e-165   
ref|XP_006474655.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         487   2e-164   
gb|ABF94313.1|  fiddlehead, putative, expressed                         486   4e-164   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006453152.1|  hypothetical protein CICLE_v10008053mg             485   6e-164   
gb|EMT17854.1|  3-ketoacyl-CoA synthase 10                              481   3e-161   
ref|XP_011019936.1|  PREDICTED: 3-ketoacyl-CoA synthase 15-like         477   1e-160   
ref|XP_006408788.1|  hypothetical protein EUTSA_v10001951mg             473   2e-160   
ref|XP_011010254.1|  PREDICTED: 3-ketoacyl-CoA synthase 15-like         475   1e-159   
gb|EPS61363.1|  hypothetical protein M569_13435                         473   3e-159   
ref|XP_002530372.1|  acyltransferase, putative                          473   4e-159   Ricinus communis
gb|AAF73981.1|AF214506_1  fiddlehead protein                            459   4e-156   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010067615.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         464   3e-155   
ref|XP_006594591.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         456   2e-152   
ref|XP_006649502.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    454   7e-152   
ref|XP_002273798.1|  PREDICTED: 3-ketoacyl-CoA synthase 15-like         454   8e-152   Vitis vinifera
ref|XP_011078170.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         454   9e-152   
emb|CBI20747.3|  unnamed protein product                                449   2e-151   
ref|XP_003547147.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         451   2e-150   
gb|AAF73974.1|AF214492_1  fiddlehead protein                            445   3e-150   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007148156.1|  hypothetical protein PHAVU_006G184900g             451   3e-150   
gb|ABF94314.1|  fiddlehead, putative, expressed                         447   3e-150   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010669633.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         450   4e-150   
gb|AAP74371.1|  FAE1                                                    448   6e-149   Marchantia polymorpha
gb|KDO84579.1|  hypothetical protein CISIN_1g010193mg                   446   2e-148   
ref|XP_003536202.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         446   3e-148   
ref|XP_008444712.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          446   3e-148   
gb|AAO48425.1|  beta-ketoacyl-CoA-synthase                              446   5e-148   Marchantia polymorpha
ref|XP_004152699.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          444   9e-148   
ref|XP_001757568.1|  predicted protein                                  444   9e-148   
ref|XP_006435002.1|  hypothetical protein CICLE_v10000889mg             443   3e-147   
ref|XP_003555524.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         443   4e-147   
ref|XP_007222865.1|  hypothetical protein PRUPE_ppa004284mg             442   6e-147   
ref|XP_008224608.1|  PREDICTED: 3-ketoacyl-CoA synthase 15              440   4e-146   
gb|AFK40996.1|  unknown                                                 435   4e-146   
ref|XP_010539905.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               440   4e-146   
ref|XP_002960812.1|  hypothetical protein SELMODRAFT_437285             439   4e-146   
ref|XP_010248169.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          440   5e-146   
gb|KFK44079.1|  hypothetical protein AALP_AA1G213300                    440   5e-146   
ref|XP_006304681.1|  hypothetical protein CARUB_v10011929mg             439   7e-146   
emb|CDX81929.1|  BnaC08g36720D                                          439   8e-146   
ref|XP_010243778.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               439   9e-146   
ref|XP_010459615.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          439   1e-145   
ref|XP_006409460.1|  hypothetical protein EUTSA_v10022654mg             438   2e-145   
ref|XP_008377297.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          438   2e-145   
ref|XP_006416504.1|  hypothetical protein EUTSA_v10007370mg             438   2e-145   
ref|XP_007143888.1|  hypothetical protein PHAVU_007G110500g             438   2e-145   
emb|CDY21665.1|  BnaA09g44160D                                          438   2e-145   
ref|XP_010548056.1|  PREDICTED: 3-ketoacyl-CoA synthase 9-like          438   3e-145   
ref|XP_010255306.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          438   3e-145   
ref|XP_009117539.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               438   3e-145   
ref|NP_173376.1|  3-ketoacyl-CoA synthase 4                             438   3e-145   Arabidopsis thaliana [mouse-ear cress]
gb|KHN05051.1|  3-ketoacyl-CoA synthase 11                              436   3e-145   
ref|XP_007145927.1|  hypothetical protein PHAVU_007G279500g             438   4e-145   
ref|XP_006846574.1|  hypothetical protein AMTR_s00018p00245180          438   4e-145   
gb|KDP38510.1|  hypothetical protein JCGZ_04435                         437   4e-145   
gb|EYU28278.1|  hypothetical protein MIMGU_mgv1a004859mg                437   5e-145   
ref|XP_002890341.1|  hypothetical protein ARALYDRAFT_472173             437   5e-145   
ref|XP_001758798.1|  predicted protein                                  437   9e-145   
ref|XP_001778803.1|  predicted protein                                  437   9e-145   
ref|XP_006299088.1|  hypothetical protein CARUB_v10015226mg             436   1e-144   
ref|XP_007200967.1|  hypothetical protein PRUPE_ppa004500mg             436   1e-144   
ref|XP_008236905.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          436   1e-144   
ref|XP_002884160.1|  hypothetical protein ARALYDRAFT_900287             436   2e-144   
ref|XP_010104374.1|  3-ketoacyl-CoA synthase 4                          436   2e-144   
ref|XP_010477163.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          436   2e-144   
ref|XP_004289669.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          435   2e-144   
ref|XP_003536489.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         436   2e-144   
ref|XP_002284986.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              435   2e-144   Vitis vinifera
ref|XP_010498362.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               435   3e-144   
ref|NP_001267518.1|  uncharacterized protein LOC100797855               435   3e-144   
ref|XP_011081914.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              434   5e-144   
ref|XP_009627040.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               434   6e-144   
gb|AAP74370.1|  FAE3                                                    435   8e-144   Marchantia polymorpha
emb|CDP07508.1|  unnamed protein product                                434   1e-143   
ref|XP_009378513.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          434   1e-143   
ref|XP_007160751.1|  hypothetical protein PHAVU_001G014100g             434   1e-143   
ref|XP_009334788.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         434   1e-143   
ref|XP_008796071.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         434   1e-143   
gb|KFK41268.1|  hypothetical protein AALP_AA2G107900                    433   2e-143   
ref|XP_010516877.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    433   2e-143   
ref|XP_009760261.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               433   2e-143   
ref|XP_003631663.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               432   3e-143   
ref|XP_010925903.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          431   3e-143   
ref|XP_010489197.1|  PREDICTED: 3-ketoacyl-CoA synthase 9-like          432   3e-143   
ref|NP_179223.1|  3-ketoacyl-CoA synthase 9                             432   3e-143   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002963631.1|  hypothetical protein SELMODRAFT_79947              433   3e-143   
ref|XP_010467354.1|  PREDICTED: 3-ketoacyl-CoA synthase 9-like          432   3e-143   
ref|XP_003637542.1|  Beta-ketoacyl-CoA synthase                         433   3e-143   
ref|XP_009792392.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         432   4e-143   
ref|XP_002974719.1|  hypothetical protein SELMODRAFT_101692             433   4e-143   
ref|XP_003519009.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         432   4e-143   
ref|XP_003549437.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          432   4e-143   
ref|XP_004507452.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          432   4e-143   
ref|XP_011083903.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               432   5e-143   
ref|XP_011037520.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          432   6e-143   
dbj|BAJ93555.1|  predicted protein                                      432   6e-143   
ref|XP_004245214.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         431   7e-143   
ref|XP_004234025.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         432   7e-143   
gb|KEH42797.1|  3-ketoacyl-CoA synthase-like protein                    432   8e-143   
ref|XP_002529366.1|  acyltransferase, putative                          431   1e-142   Ricinus communis
ref|XP_004495403.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         431   1e-142   
ref|XP_010048253.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         431   1e-142   
emb|CDY29431.1|  BnaA06g13650D                                          430   1e-142   
gb|KDP32347.1|  hypothetical protein JCGZ_13272                         431   2e-142   
gb|AGH32920.1|  ketoacyl-CoA synthase                                   431   2e-142   
gb|KDP46259.1|  hypothetical protein JCGZ_10099                         430   2e-142   
ref|XP_006341948.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          431   3e-142   
gb|AFK39024.1|  unknown                                                 431   3e-142   
gb|AHX25587.1|  3-ketoacyl-CoA synthase 11                              430   4e-142   
ref|XP_003606927.1|  3-ketoacyl-CoA synthase                            429   4e-142   
ref|XP_009364915.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          430   4e-142   
ref|XP_006847589.1|  hypothetical protein AMTR_s00014p00234760          430   4e-142   
ref|XP_008357196.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          430   4e-142   
ref|XP_009149432.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               429   5e-142   
ref|XP_007013326.1|  3-ketoacyl-CoA synthase                            429   5e-142   
ref|XP_006475774.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         429   5e-142   
ref|XP_002510394.1|  acyltransferase, putative                          429   5e-142   Ricinus communis
ref|XP_006451014.1|  hypothetical protein CICLE_v10007916mg             429   7e-142   
gb|ABS18382.1|  3-ketoacyl-CoA synthase                                 429   9e-142   Eranthis hyemalis
gb|KDO80366.1|  hypothetical protein CISIN_1g008975mg                   430   9e-142   
ref|XP_004965965.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         429   9e-142   
ref|XP_004238271.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               429   1e-141   
ref|XP_006451013.1|  hypothetical protein CICLE_v10007916mg             429   2e-141   
ref|XP_007223150.1|  hypothetical protein PRUPE_ppa004354mg             428   2e-141   
ref|XP_002313793.1|  hypothetical protein POPTR_0009s11940g             428   2e-141   Populus trichocarpa [western balsam poplar]
gb|AGK30005.1|  3-ketoacyl-CoA synthase                                 428   2e-141   
ref|XP_007204837.1|  hypothetical protein PRUPE_ppa004269mg             428   2e-141   
ref|XP_009614092.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         428   2e-141   
ref|XP_004170552.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         428   2e-141   
ref|XP_007154946.1|  hypothetical protein PHAVU_003G160400g             428   2e-141   
ref|XP_010028602.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          428   3e-141   
gb|EYU34550.1|  hypothetical protein MIMGU_mgv1a004667mg                428   3e-141   
emb|CDO99138.1|  unnamed protein product                                428   3e-141   
ref|XP_008388058.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          427   3e-141   
ref|XP_009365554.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          427   3e-141   
ref|XP_002324276.1|  hypothetical protein POPTR_0018s01300g             427   3e-141   Populus trichocarpa [western balsam poplar]
ref|XP_009758872.1|  PREDICTED: 3-ketoacyl-CoA synthase 1               428   3e-141   
ref|XP_001753137.1|  predicted protein                                  427   4e-141   
ref|XP_008242707.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              427   4e-141   
ref|XP_011091085.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              427   4e-141   
ref|XP_009601634.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         427   4e-141   
ref|XP_006656205.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         427   5e-141   
ref|XP_003571537.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              427   5e-141   
dbj|BAJ94420.1|  predicted protein                                      427   5e-141   
ref|XP_006361008.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like          427   5e-141   
ref|XP_007013801.1|  3-ketoacyl-CoA synthase                            427   6e-141   
ref|XP_011048431.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          427   6e-141   
gb|AGK29994.1|  3-ketoacyl-CoA synthase 4                               426   6e-141   
ref|XP_002305431.1|  hypothetical protein POPTR_0004s16290g             426   9e-141   Populus trichocarpa [western balsam poplar]
ref|XP_004498007.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         426   1e-140   
ref|XP_008219888.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         426   1e-140   
gb|AGK29996.1|  3-ketoacyl-CoA synthase 18                              426   1e-140   
gb|KHG01499.1|  3-ketoacyl-CoA synthase 11 -like protein                426   1e-140   
ref|XP_007017550.1|  3-ketoacyl-CoA synthase 4                          426   2e-140   
ref|XP_010474700.1|  PREDICTED: 3-ketoacyl-CoA synthase 1               426   2e-140   
ref|XP_010690872.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               425   3e-140   
ref|XP_010932851.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         426   3e-140   
ref|XP_010054134.1|  PREDICTED: 3-ketoacyl-CoA synthase 1               427   3e-140   
gb|AGK29991.1|  3-ketoacyl-CoA synthase 7                               425   3e-140   
ref|XP_010530834.1|  PREDICTED: 3-ketoacyl-CoA synthase 9 isoform X1    425   3e-140   
ref|XP_009779614.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         425   3e-140   
ref|XP_009374066.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              425   3e-140   
ref|XP_009606335.1|  PREDICTED: 3-ketoacyl-CoA synthase 1               426   3e-140   
gb|EMT15934.1|  3-ketoacyl-CoA synthase 11                              425   3e-140   
ref|XP_009348198.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         425   3e-140   
emb|CDY26665.1|  BnaA06g13570D                                          424   3e-140   
ref|XP_002282403.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               425   3e-140   Vitis vinifera
gb|AGK29995.1|  3-ketoacyl-CoA synthase 17                              426   4e-140   
ref|XP_010692792.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         424   4e-140   
ref|XP_008378462.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          424   4e-140   
emb|CDO97044.1|  unnamed protein product                                425   5e-140   
ref|XP_010548057.1|  PREDICTED: 3-ketoacyl-CoA synthase 9-like          423   5e-140   
ref|XP_010263648.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          424   6e-140   
ref|XP_002264721.1|  PREDICTED: 3-ketoacyl-CoA synthase 1               425   7e-140   Vitis vinifera
ref|XP_010254302.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         424   7e-140   
ref|XP_003524525.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         424   8e-140   
ref|XP_011088406.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          423   8e-140   
ref|XP_010251878.1|  PREDICTED: 3-ketoacyl-CoA synthase 1               424   9e-140   
ref|XP_004485786.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         423   9e-140   
ref|XP_009381261.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         424   9e-140   
gb|KDO49072.1|  hypothetical protein CISIN_1g010687mg                   423   9e-140   
gb|AGK29990.1|  3-ketoacyl-CoA synthase 11                              424   1e-139   
ref|XP_006450506.1|  hypothetical protein CICLE_v10008045mg             424   1e-139   
ref|XP_010924276.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          424   1e-139   
gb|EMT24470.1|  3-ketoacyl-CoA synthase 11                              424   1e-139   
ref|XP_010480647.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like          424   1e-139   
ref|XP_006306361.1|  hypothetical protein CARUB_v10012263mg             424   1e-139   
ref|XP_008805392.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          424   1e-139   
ref|XP_007042184.1|  3-ketoacyl-CoA synthase 4                          423   1e-139   
ref|XP_011026502.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         423   1e-139   
ref|XP_008361241.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              423   2e-139   
ref|XP_006423278.1|  hypothetical protein CICLE_v10028243mg             423   2e-139   
ref|XP_009385808.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         423   2e-139   
ref|XP_004248096.1|  PREDICTED: 3-ketoacyl-CoA synthase 1               424   2e-139   
ref|XP_009804708.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         423   2e-139   
ref|XP_009601391.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...    423   2e-139   
dbj|BAJ98276.1|  predicted protein                                      423   2e-139   
ref|XP_007136167.1|  hypothetical protein PHAVU_009G023600g             423   2e-139   
ref|XP_006483306.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         422   2e-139   
ref|XP_009601390.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...    423   3e-139   
ref|XP_010102812.1|  3-ketoacyl-CoA synthase 11                         422   3e-139   
dbj|BAE98925.1|  putative fatty acid elongase 3-ketoacyl-CoA synt...    423   3e-139   
ref|NP_171620.2|  3-ketoacyl-CoA synthase 1                             423   4e-139   
gb|AAC99312.1|  fatty acid elongase 3-ketoacyl-CoA synthase 1           422   4e-139   
emb|CDY46211.1|  BnaA07g03590D                                          422   4e-139   
ref|XP_009121221.1|  PREDICTED: 3-ketoacyl-CoA synthase 9               422   4e-139   
gb|AGK29993.1|  3-ketoacyl-CoA synthase 10                              422   4e-139   
ref|XP_011019752.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              422   4e-139   
gb|ACQ41892.1|  3-ketoacyl-CoA synthase                                 422   4e-139   
ref|XP_002308642.1|  hypothetical protein POPTR_0006s26530g             422   4e-139   
ref|XP_007051450.1|  3-ketoacyl-CoA synthase 1                          422   5e-139   
emb|CDP03396.1|  unnamed protein product                                422   5e-139   
ref|NP_001056354.1|  Os05g0568000                                       422   5e-139   
ref|NP_001056391.1|  Os05g0574600                                       422   5e-139   
ref|XP_008800742.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          419   6e-139   
gb|EAY99126.1|  hypothetical protein OsI_21086                          422   6e-139   
ref|XP_007034926.1|  3-ketoacyl-CoA synthase                            422   6e-139   
gb|ABX10440.1|  3-ketoacyl-CoA synthase 10                              422   8e-139   
ref|XP_009630522.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          421   8e-139   
ref|XP_004160061.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          421   8e-139   
ref|XP_009347466.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         421   1e-138   
ref|XP_008792115.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         421   1e-138   
ref|XP_006293527.1|  hypothetical protein CARUB_v10024547mg             421   1e-138   
emb|CDX71278.1|  BnaC07g05570D                                          421   1e-138   
ref|XP_011086329.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         421   1e-138   
ref|XP_002889383.1|  3-ketoacyl-CoA synthase 1                          421   1e-138   
ref|XP_010914942.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         421   1e-138   
ref|XP_002509491.1|  acyltransferase, putative                          421   2e-138   
ref|XP_008385932.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              421   2e-138   
ref|XP_011015110.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         420   2e-138   
ref|XP_007218983.1|  hypothetical protein PRUPE_ppa003977mg             421   2e-138   
ref|XP_006655600.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          419   2e-138   
ref|NP_180232.1|  3-ketoacyl-CoA synthase 11                            420   2e-138   
gb|EPS60765.1|  hypothetical protein M569_14036                         420   2e-138   
ref|XP_002284751.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              420   2e-138   
ref|XP_010557584.1|  PREDICTED: 3-ketoacyl-CoA synthase 11 isofor...    420   3e-138   
ref|XP_002453517.1|  hypothetical protein SORBIDRAFT_04g007190          421   3e-138   
ref|XP_004247624.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         420   3e-138   
ref|XP_006841272.1|  hypothetical protein AMTR_s00135p00117490          419   3e-138   
ref|XP_009407649.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         420   3e-138   
ref|XP_009394797.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         420   3e-138   
ref|XP_009782317.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          420   4e-138   
ref|XP_006398946.1|  hypothetical protein EUTSA_v10013296mg             419   4e-138   
ref|XP_010557583.1|  PREDICTED: 3-ketoacyl-CoA synthase 11 isofor...    419   4e-138   
ref|XP_006854931.1|  hypothetical protein AMTR_s00052p00130070          420   6e-138   
ref|XP_010533183.1|  PREDICTED: 3-ketoacyl-CoA synthase 11 isofor...    419   6e-138   
ref|XP_002878994.1|  hypothetical protein ARALYDRAFT_901443             419   6e-138   
ref|XP_009607438.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         419   7e-138   
ref|XP_008785403.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         419   8e-138   
gb|EMS50435.1|  3-ketoacyl-CoA synthase 4                               418   1e-137   
ref|XP_004287376.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         419   1e-137   
ref|XP_003549787.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         418   1e-137   
ref|XP_009341963.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          418   1e-137   
gb|EAY99068.1|  hypothetical protein OsI_21025                          418   1e-137   
gb|AFW81175.1|  acyltransferase                                         418   1e-137   
gb|EYU21941.1|  hypothetical protein MIMGU_mgv1a004813mg                418   1e-137   
ref|XP_006418385.1|  hypothetical protein EUTSA_v10007351mg             419   1e-137   
gb|KEH37969.1|  3-ketoacyl-CoA synthase-like protein                    418   2e-137   
emb|CDP04806.1|  unnamed protein product                                418   2e-137   
ref|XP_009336207.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               415   2e-137   
ref|XP_008233066.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like          419   2e-137   
ref|XP_002301436.2|  fatty acid elongase 3-ketoacyl-CoA synthase ...    418   2e-137   
ref|XP_010683564.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         418   3e-137   
ref|NP_001130522.1|  uncharacterized protein LOC100191621               417   3e-137   
ref|XP_002441534.1|  hypothetical protein SORBIDRAFT_09g028860          417   3e-137   
ref|XP_011025387.1|  PREDICTED: 3-ketoacyl-CoA synthase 1               417   3e-137   
gb|ACY78677.1|  fatty acid elongase                                     417   3e-137   
ref|XP_006362163.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         417   4e-137   
ref|XP_003567862.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               417   4e-137   
ref|XP_011027418.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         417   5e-137   
ref|XP_006375382.1|  hypothetical protein POPTR_0014s10010g             417   5e-137   
ref|XP_010670713.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         417   5e-137   
ref|XP_008796426.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         417   5e-137   
ref|XP_006356047.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         417   5e-137   
gb|ABF94316.1|  fiddlehead, putative, expressed                         413   5e-137   
ref|XP_002312562.1|  hypothetical protein POPTR_0008s15990g             417   5e-137   
gb|KHN15129.1|  3-ketoacyl-CoA synthase 11                              415   5e-137   
ref|XP_010528551.1|  PREDICTED: 3-ketoacyl-CoA synthase 15              416   5e-137   
ref|XP_009406296.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          417   6e-137   
ref|XP_006654826.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         417   6e-137   
ref|XP_009380079.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          416   6e-137   
ref|XP_004146292.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         416   6e-137   
gb|KHN08518.1|  3-ketoacyl-CoA synthase 15                              412   7e-137   
ref|XP_002321310.2|  very-long-chain fatty acid condensing enzyme...    417   7e-137   
ref|XP_009390357.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          416   7e-137   
gb|KFK42502.1|  hypothetical protein AALP_AA1G001800                    416   8e-137   
ref|XP_008352048.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         416   8e-137   
ref|XP_008802438.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          415   1e-136   
ref|XP_010249963.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         416   1e-136   
gb|AGK29992.1|  3-ketoacyl-CoA synthase 19                              416   1e-136   
ref|XP_009356268.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               415   1e-136   
ref|XP_004306622.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like          417   1e-136   
ref|XP_010542792.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like          416   1e-136   
ref|XP_009779121.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          416   1e-136   
ref|XP_008464980.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              416   1e-136   
ref|XP_008391016.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like i...    416   2e-136   
ref|XP_010916172.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          415   2e-136   
ref|XP_009801870.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         415   2e-136   
ref|XP_002437234.1|  hypothetical protein SORBIDRAFT_10g023290          416   2e-136   
gb|KHG21958.1|  3-ketoacyl-CoA synthase 11 -like protein                416   2e-136   
ref|XP_010417808.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              415   2e-136   
ref|XP_010066726.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               414   3e-136   
gb|ABV60087.1|  beta-ketoacyl-CoA synthase                              416   3e-136   
ref|XP_009767720.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         415   3e-136   
ref|XP_009349773.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         415   3e-136   
gb|KDP40263.1|  hypothetical protein JCGZ_02261                         415   3e-136   
ref|XP_010688098.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              415   3e-136   
ref|XP_009390849.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          414   3e-136   
ref|XP_010049954.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              415   3e-136   
gb|EPS63750.1|  hypothetical protein M569_11032                         414   3e-136   
ref|XP_009595982.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         415   3e-136   
ref|XP_010926125.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          414   3e-136   
ref|XP_009391408.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               414   4e-136   
ref|XP_004961143.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         415   5e-136   
ref|XP_004293205.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          414   5e-136   
ref|XP_010274236.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         414   5e-136   
ref|XP_004513574.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         414   5e-136   
ref|XP_010925263.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         414   6e-136   
gb|EPS57140.1|  hypothetical protein M569_17681                         413   6e-136   
gb|KHG17042.1|  3-ketoacyl-CoA synthase 17 -like protein                414   6e-136   
ref|XP_010313709.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...    414   6e-136   
gb|ACR36808.1|  unknown                                                 414   7e-136   
ref|XP_004251585.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...    413   8e-136   
gb|AGK29988.1|  3-ketoacyl-CoA synthase 1                               414   8e-136   
gb|AFW79234.1|  hypothetical protein ZEAMMB73_025891                    414   8e-136   
ref|XP_010918127.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         414   9e-136   
ref|XP_010254814.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          413   1e-135   
dbj|BAF98214.1|  CM0216.300.nc                                          413   1e-135   
ref|XP_010265151.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          413   1e-135   
ref|XP_010522896.1|  PREDICTED: 3-ketoacyl-CoA synthase 1 isoform X1    414   1e-135   
gb|AAG28600.1|AF247134_1  fatty acid elongase 1-like protein            413   1e-135   
gb|EAY84941.1|  hypothetical protein OsI_06307                          414   1e-135   
ref|XP_006444749.1|  hypothetical protein CICLE_v10019672mg             414   1e-135   
gb|ACZ51240.1|  3-ketoacyl-CoA synthase                                 413   1e-135   
ref|XP_011100666.1|  PREDICTED: 3-ketoacyl-CoA synthase 1               414   1e-135   
ref|NP_001046250.1|  Os02g0205500                                       413   1e-135   
ref|XP_002283935.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              414   1e-135   
ref|XP_009594431.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    413   1e-135   
ref|XP_003609222.1|  Beta-ketoacyl-coa synthase family protein          413   1e-135   
gb|ACC60973.1|  beta-ketoacyl-CoA synthase                              412   1e-135   
emb|CDP02779.1|  unnamed protein product                                412   2e-135   
ref|XP_010098974.1|  3-ketoacyl-CoA synthase 11                         413   2e-135   
ref|XP_002529975.1|  acyltransferase, putative                          413   2e-135   
gb|AGK30000.1|  3-ketoacyl-CoA synthase 5                               412   2e-135   
ref|NP_001057996.1|  Os06g0598800                                       413   2e-135   
ref|XP_009122553.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              412   2e-135   
gb|KHN46008.1|  3-ketoacyl-CoA synthase 11                              412   2e-135   
gb|AGK29989.1|  3-ketoacyl-CoA synthase 2                               413   2e-135   
ref|XP_009337302.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         414   2e-135   
ref|XP_008363965.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like          413   2e-135   
emb|CCW28736.1|  putative 3-Oxoacyl-[acyl-carrier-protein (ACP)] ...    412   3e-135   
gb|EAZ01557.1|  hypothetical protein OsI_23590                          412   3e-135   
emb|CDX70186.1|  BnaA10g25350D                                          412   3e-135   
ref|XP_009416553.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          413   3e-135   
ref|XP_004299082.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          412   3e-135   
ref|XP_008339680.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               412   3e-135   
ref|XP_010263663.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          411   3e-135   
ref|XP_003522916.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...    412   4e-135   
ref|XP_008775195.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    411   4e-135   
ref|XP_009348991.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         412   5e-135   
ref|XP_006353644.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         412   5e-135   
gb|AFW87109.1|  putative fatty acid elongase isoform 1                  412   5e-135   
emb|CDX98800.1|  BnaC09g50350D                                          412   5e-135   
ref|NP_001151591.1|  fatty acid elongase                                412   6e-135   
ref|XP_010473048.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...    411   6e-135   
ref|XP_007044356.1|  3-ketoacyl-CoA synthase 6                          411   6e-135   
ref|XP_009351389.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like          412   6e-135   
ref|XP_003626601.1|  3-ketoacyl-CoA synthase                            412   7e-135   
ref|XP_004951508.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         422   8e-135   
ref|XP_009366618.1|  PREDICTED: 3-ketoacyl-CoA synthase 1               412   8e-135   
gb|KHN13761.1|  3-ketoacyl-CoA synthase 11                              410   1e-134   
ref|XP_006842379.1|  hypothetical protein AMTR_s00079p00192440          409   1e-134   
ref|XP_008368384.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         411   1e-134   
ref|XP_009389417.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          410   2e-134   
ref|XP_009356269.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          410   2e-134   
ref|XP_004241809.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         410   2e-134   
ref|XP_002984006.1|  hypothetical protein SELMODRAFT_445717             409   2e-134   
dbj|BAJ94797.1|  predicted protein                                      411   2e-134   
ref|XP_001756180.1|  predicted protein                                  410   2e-134   
ref|XP_008389290.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          409   2e-134   
gb|AGK29999.1|  3-ketoacyl-CoA synthase 13                              409   3e-134   
ref|XP_007138322.1|  hypothetical protein PHAVU_009G199000g             410   3e-134   
ref|XP_009356710.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          409   3e-134   
ref|XP_004508544.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...    409   3e-134   
ref|XP_004508545.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...    409   4e-134   
ref|XP_004497096.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          409   4e-134   
emb|CDO99137.1|  unnamed protein product                                409   4e-134   
ref|NP_001266579.1|  fatty acid elongase                                409   5e-134   
ref|XP_002892201.1|  hypothetical protein ARALYDRAFT_470398             409   5e-134   
ref|XP_004494857.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like          410   5e-134   
ref|XP_009112385.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    409   6e-134   
ref|XP_003637030.1|  Beta-ketoacyl-CoA synthase                         410   6e-134   
emb|CBI38944.3|  unnamed protein product                                409   7e-134   
ref|XP_010432405.1|  PREDICTED: probable 3-ketoacyl-CoA synthase 2      407   7e-134   
ref|XP_002960134.1|  hypothetical protein SELMODRAFT_75021              408   7e-134   
ref|XP_002283730.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               408   8e-134   
ref|XP_003593580.1|  3-ketoacyl-CoA synthase                            408   8e-134   
ref|XP_004296609.1|  PREDICTED: 3-ketoacyl-CoA synthase 17-like         409   9e-134   
gb|AGT15995.1|  fatty acid elongase                                     409   9e-134   
ref|XP_008376209.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    409   9e-134   
ref|XP_010910111.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          408   1e-133   
ref|XP_001757962.1|  predicted protein                                  408   1e-133   
ref|XP_006284916.1|  hypothetical protein CARUB_v10006212mg             407   1e-133   
emb|CDY47457.1|  BnaA09g08660D                                          404   1e-133   
ref|XP_010088926.1|  3-ketoacyl-CoA synthase 4                          407   1e-133   
ref|XP_006378369.1|  hypothetical protein POPTR_0010s09020g             408   1e-133   
ref|XP_001753229.1|  predicted protein                                  409   1e-133   
ref|XP_010233110.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         414   1e-133   
ref|XP_002517035.1|  acyltransferase, putative                          408   2e-133   
gb|KDP29403.1|  hypothetical protein JCGZ_18324                         407   2e-133   
ref|XP_008243224.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               407   2e-133   
ref|XP_004233492.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          407   2e-133   
gb|ACC95444.1|  beta-ketoacyl-CoA synthase                              407   2e-133   
ref|XP_006346917.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          407   3e-133   
ref|XP_003531926.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          406   4e-133   



>emb|CDP17887.1| unnamed protein product [Coffea canephora]
Length=531

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/465 (70%), Positives = 390/465 (84%), Gaps = 8/465 (2%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E HLLSTEI+NRGIE SGPDAG+LTFSVRVRRRLPDFVQSV LKYVKLGY+Y+IN+ + L
Sbjct  4     EQHLLSTEIVNRGIESSGPDAGSLTFSVRVRRRLPDFVQSVNLKYVKLGYHYLINHGIYL  63

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A TVPLL +VF  E+GS+ R E++W K+W+++ G D   V  SL G+L FTLS++F+SKP
Sbjct  64    A-TVPLLVLVFSAELGSLSR-EELWRKLWDSTTGYDLATVVASL-GVLVFTLSVFFLSKP  120

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
              PIYL+DFAC +P DDLKVTK+QFI++ARKSG F+E +LE+ KR++ESSGIGDETY+PKS
Sbjct  121   RPIYLLDFACYRPHDDLKVTKEQFIEMARKSGKFNEASLEFQKRIVESSGIGDETYVPKS  180

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             I  PE    +   R EAS ++F A+D++ EKT+IR +D+GILVVNC+ FNPTPSLSAMII
Sbjct  181   IMSPENTATMKEGRAEASMVMFGALDELFEKTKIRPKDVGILVVNCSIFNPTPSLSAMII  240

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGMGCSAGII+LDLARD+L +NPN YA+VVSTE+V   WY G  RS
Sbjct  241   NHYKMRGNILSFNLGGMGCSAGIISLDLARDMLHSNPNSYAVVVSTEMVGFNWYPGKERS  300

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             M+IPNCFFR GCSAVLLSNRRRDY  AKYRL+HIVRTH+GA DR+FRS+YQEED +R KG
Sbjct  301   MMIPNCFFRMGCSAVLLSNRRRDYARAKYRLEHIVRTHKGADDRSFRSVYQEEDDQRFKG  360

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGA-----KTKPYIPD  1297
             LKISK+LVE+G +ALK NITTLGPLVLP +EQLYFF TLI R LFG+       KPYIPD
Sbjct  361   LKISKNLVEIGADALKTNITTLGPLVLPFSEQLYFFATLIWRHLFGSGRGSQPEKPYIPD  420

Query  1298  YTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             Y +AFEHFC++AASK +LDEL+RNL LSE+NME SRATLHRFGNT
Sbjct  421   YKLAFEHFCVHAASKTVLDELQRNLELSEKNMETSRATLHRFGNT  465



>gb|EYU21968.1| hypothetical protein MIMGU_mgv1a004214mg [Erythranthe guttata]
Length=539

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/471 (68%), Positives = 393/471 (83%), Gaps = 9/471 (2%)
 Frame = +2

Query  38    NMAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvIN  217
             NMA  E  LLSTEI+NRGIE SGPDAG++TFSVRVRRRLPDFV SV LKYVKLGY+Y+IN
Sbjct  3     NMAGGEQELLSTEIVNRGIESSGPDAGSMTFSVRVRRRLPDFVNSVNLKYVKLGYHYLIN  62

Query  218   NWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIY  397
             + + LA T+P+L +VFG EVGS+ R E++W KIW+ + G D   V ++ L L  FTLS+Y
Sbjct  63    HGVYLA-TIPVLVLVFGAEVGSLRR-EELWRKIWDTTAGYDLASV-VAFLALFVFTLSVY  119

Query  398   FMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDET  577
             FMS+P  IYL+DFAC KP+DD KVTK++FI++ARKSG FDE++LE+ +R+LESSGIGDET
Sbjct  120   FMSRPRSIYLLDFACFKPTDDFKVTKEEFIELARKSGKFDEESLEFQRRILESSGIGDET  179

Query  578   YIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSL  757
             Y+PKSIG PE    +   R EAS +IF A+D++ EKT++R +D+G+LV+NC+ FNPTPSL
Sbjct  180   YVPKSIGSPENTATMKEGRAEASAVIFGALDELFEKTQVRPKDVGVLVLNCSLFNPTPSL  239

Query  758   SAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYS  937
             SAM+INHYKM+ NI+S NLGGMGCSAG+IA+DLARD+L+ANP+ YA+VVSTE+V   WY 
Sbjct  240   SAMVINHYKMRGNILSFNLGGMGCSAGVIAVDLARDMLQANPSSYAVVVSTEMVGYNWYP  299

Query  938   GNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDV  1117
             G  RSMLIPNC+FR GCSAVLLSNRRRDY  AKYRL+HIVRTH+GA DR+FRSIYQ+ED 
Sbjct  300   GKDRSMLIPNCYFRMGCSAVLLSNRRRDYGRAKYRLEHIVRTHKGADDRSFRSIYQDEDG  359

Query  1118  ERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGA------KT  1279
             E+ KG+KISKDLVE+GG+A+K NITTLGPLVLPL+EQL FF TLI + LFG         
Sbjct  360   EKFKGIKISKDLVEIGGDAIKTNITTLGPLVLPLSEQLLFFSTLIWKLLFGGGGGNSPPA  419

Query  1280  KPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             KPYIPDY +AFEHFC++AASK +LDEL+RNL+LS++N+EASRA LHRFGNT
Sbjct  420   KPYIPDYKLAFEHFCLHAASKTVLDELQRNLKLSDENLEASRAVLHRFGNT  470



>ref|XP_011081956.1| PREDICTED: 3-ketoacyl-CoA synthase 10 [Sesamum indicum]
Length=533

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/465 (68%), Positives = 388/465 (83%), Gaps = 8/465 (2%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+NRGIE SGPDAG++TFSVRVRRRLPDFVQSV LKYVKLGY+Y+IN+ + L
Sbjct  4     EQDLLSTEIVNRGIESSGPDAGSMTFSVRVRRRLPDFVQSVNLKYVKLGYHYLINHGIYL  63

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L +VFG EVGS+ R E++W KIW+++ G D   V ++ L L  FT+S+YFMS+P
Sbjct  64    A-TIPVLVLVFGAEVGSLSR-EELWRKIWDSTAGYDLATV-VAFLALFVFTISVYFMSRP  120

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               IYL+DFAC KPSDD KVT+DQFI++ARKSG FDE +LE+ +R+L+SSGIGDETYIPKS
Sbjct  121   RSIYLLDFACYKPSDDFKVTRDQFIELARKSGKFDEASLEFQRRILQSSGIGDETYIPKS  180

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             IG PE    +   R EA+ ++F A+D++ EK  +R +D+GILVVNC+ FNPTPSLSAM+I
Sbjct  181   IGSPENTATMKEGRAEAATVVFGALDELFEKCNVRPKDVGILVVNCSLFNPTPSLSAMVI  240

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGMGCSAG+IA+DLARD+L+ANPN YA+VVSTE+V   WY G  RS
Sbjct  241   NHYKMRGNILSFNLGGMGCSAGVIAVDLARDMLQANPNNYAVVVSTEMVGYNWYPGKDRS  300

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             MLIPNC+FR GC+A+LLSNR RD+R AKYRL+HIVRTH+GA  R+FRSIYQEED E+ KG
Sbjct  301   MLIPNCYFRMGCAAMLLSNRHRDHRRAKYRLEHIVRTHKGADIRSFRSIYQEEDSEKFKG  360

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFG-----AKTKPYIPD  1297
             +KISKDLVE+GG+A+K NITTLGPLVLP +EQL FF TL+ + LFG       TKPYIPD
Sbjct  361   IKISKDLVEIGGDAIKTNITTLGPLVLPFSEQLLFFSTLVWKILFGNGAKSQSTKPYIPD  420

Query  1298  YTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             Y +AFEHFC++AASK +LDEL+RNL+LS++N+EASRA LHRFGNT
Sbjct  421   YKLAFEHFCVHAASKTVLDELQRNLKLSDKNLEASRAALHRFGNT  465



>ref|XP_007012476.1| 3-ketoacyl-CoA synthase 10 [Theobroma cacao]
 gb|EOY30095.1| 3-ketoacyl-CoA synthase 10 [Theobroma cacao]
Length=554

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/483 (65%), Positives = 390/483 (81%), Gaps = 13/483 (3%)
 Frame = +2

Query  11    NFQKKTSKLNMAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyv  190
             N      +LNMA+ E  LLSTEI+NRGIE SGP+AG+L FSVRVRRRLPDF+QSV LKYV
Sbjct  10    NHHSNVFRLNMARSEQDLLSTEIVNRGIESSGPNAGSLAFSVRVRRRLPDFLQSVNLKYV  69

Query  191   klgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLG  370
             KLGY+Y+I++ + LA T+P+L +VF  EVGS+ R E++W K+WE++   D   V +S   
Sbjct  70    KLGYHYLISHGIYLA-TIPVLVLVFSAEVGSLSR-EELWEKLWEDARY-DLATV-LSFFA  125

Query  371   LLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRML  550
             +  FT+S+YFMS+P  IYL+DFAC +P+DDLKVTKDQFI+IARKSG FDE +LE+ KR+L
Sbjct  126   VFVFTVSVYFMSRPRSIYLIDFACYRPNDDLKVTKDQFIEIARKSGKFDEGSLEFQKRIL  185

Query  551   ESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNC  730
             +SSGIGDETY+PK++   E    +   R EAS ++F A+D++ EKTRIR +D+G+LVVNC
Sbjct  186   KSSGIGDETYVPKALMSSENCATMKEGRLEASTVMFGALDELFEKTRIRPKDVGVLVVNC  245

Query  731   NTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVST  910
             + FNPTPSLSAMIINHYKM+ NI+S NLGGMGCSAGIIA+DLARD+L+ANPN YA+VVST
Sbjct  246   SIFNPTPSLSAMIINHYKMRGNILSYNLGGMGCSAGIIAVDLARDMLQANPNNYAVVVST  305

Query  911   EIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAF  1090
             E+V   WY G  RSML+PNCFFR GCSA+L+SNRRRDYR AKYRL+H+VRTH+GA DR+F
Sbjct  306   EMVGYNWYPGRVRSMLVPNCFFRMGCSAILMSNRRRDYRRAKYRLEHLVRTHKGADDRSF  365

Query  1091  RSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFG  1270
             RS+YQEED    KGLK+SKDL+E+GG+ALK NITTLGPLVLP +EQL FF TL+ R  FG
Sbjct  366   RSVYQEEDEHGFKGLKVSKDLMEIGGDALKTNITTLGPLVLPFSEQLLFFGTLVWRHFFG  425

Query  1271  A---------KTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRF  1423
                        +KPYIPDY +AFEHFC++AASK +LDEL++NL LSE+NMEASR TLHRF
Sbjct  426   GDNSKASLSPSSKPYIPDYKLAFEHFCVHAASKTVLDELQKNLELSEKNMEASRMTLHRF  485

Query  1424  GNT  1432
             GNT
Sbjct  486   GNT  488



>gb|KHG14239.1| 3-ketoacyl-CoA synthase 10 -like protein [Gossypium arboreum]
Length=535

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/473 (67%), Positives = 385/473 (81%), Gaps = 13/473 (3%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             MA+ E  LLSTEI+NRGIE SGP+AG+LTFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+
Sbjct  1     MARNEQDLLSTEIVNRGIESSGPNAGSLTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINH  60

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYF  400
              + LA T+P+L +VF  EVGS+ R E++W K+WE++   D   V +S   +  FT+S+YF
Sbjct  61    GIYLA-TIPVLVLVFSAEVGSLSR-EELWKKLWEDARY-DLATV-LSFFAVFVFTVSVYF  116

Query  401   MSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETY  580
             MS+P  IYL+DFAC +P DDLKVTKDQFI++AR SG FDE +LE+ K++L+SSGIGDETY
Sbjct  117   MSRPRSIYLIDFACYRPHDDLKVTKDQFIELARASGKFDEASLEFQKKILKSSGIGDETY  176

Query  581   IPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLS  760
             +PK I   E    +   R EAS ++F A+D++ EKTRIR +D+G+LVVNC+ FNPTPSLS
Sbjct  177   VPKVIMSKENCATMKEGRLEASTVMFGALDELFEKTRIRPKDVGVLVVNCSIFNPTPSLS  236

Query  761   AMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSG  940
             AMIINHYKM+ NI+S NLGGMGCSAGIIA+DLARD+L+ANPN YA+VVSTE+V   WY G
Sbjct  237   AMIINHYKMRGNILSYNLGGMGCSAGIIAVDLARDMLQANPNNYAVVVSTEMVGYNWYPG  296

Query  941   NHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVE  1120
               RSML+PNCFFR GCSAVLLSNRRRDYR AKYRL+H+VRTH+GA DR+FRSIYQEED +
Sbjct  297   RDRSMLVPNCFFRMGCSAVLLSNRRRDYRRAKYRLEHLVRTHKGADDRSFRSIYQEEDEQ  356

Query  1121  RIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGA---------  1273
               KGLK+SKDL+E+GG+ALK NITTLGPLVLP +EQL+FF TLI R  FG          
Sbjct  357   GFKGLKVSKDLMEIGGDALKTNITTLGPLVLPFSEQLFFFATLIWRHFFGGDKSKTSLSP  416

Query  1274  KTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
              +KPYIPDY +AFEHFC++AASK +LDEL++NL LSE NMEASR TLHRFGNT
Sbjct  417   SSKPYIPDYKLAFEHFCVHAASKTVLDELQKNLELSENNMEASRMTLHRFGNT  469



>gb|AAL67993.1| fiddlehead-like protein [Gossypium hirsutum]
Length=535

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/473 (67%), Positives = 384/473 (81%), Gaps = 13/473 (3%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             MA+ E  LLSTEI+NRGIE SGP+AG+LTFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+
Sbjct  1     MARNEQDLLSTEIVNRGIESSGPNAGSLTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINH  60

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYF  400
              + LA T+P+L +VF  EVGS+ R E++W K+WE++   D   V +S   +  FT+S+YF
Sbjct  61    GIYLA-TIPVLVLVFSAEVGSLSR-EELWKKLWEDARY-DLATV-LSFFAVFVFTVSVYF  116

Query  401   MSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETY  580
             MS+P  IYL+DFAC +P DDLKVTKDQFI++AR SG FDE +LE+ K++L+SSGIGDETY
Sbjct  117   MSRPRSIYLIDFACYRPHDDLKVTKDQFIELARASGKFDEASLEFQKKILKSSGIGDETY  176

Query  581   IPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLS  760
             +PK I   E    +   R EAS ++F A+D++ EKTRIR +D+G+LVVNC+ FNPTPSLS
Sbjct  177   VPKVIMSKENCATMKEGRLEASTVMFGALDELFEKTRIRPKDVGVLVVNCSIFNPTPSLS  236

Query  761   AMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSG  940
             AMIINHYKM+ NI+S NLGGMGCSAGIIA+DLARD+L+ANPN YA+VVSTE+V   WY G
Sbjct  237   AMIINHYKMRGNILSYNLGGMGCSAGIIAVDLARDMLQANPNNYAVVVSTEMVGYNWYPG  296

Query  941   NHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVE  1120
               RSML+PNCFFR GCSAVLLSNRRRDYR AKYRL+H+VRTH+GA DR+FRSIYQEED +
Sbjct  297   RDRSMLVPNCFFRMGCSAVLLSNRRRDYRRAKYRLEHLVRTHKGADDRSFRSIYQEEDEQ  356

Query  1121  RIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGA---------  1273
               KGLK+SKDL E+GG+ALK NITTLGPLVLP +EQL+FF TLI R  FG          
Sbjct  357   GFKGLKVSKDLTEIGGDALKTNITTLGPLVLPFSEQLFFFATLIWRHFFGGDKSKTSLSP  416

Query  1274  KTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
              +KPYIPDY +AFEHFC++AASK +LDEL++NL LSE NMEASR TLHRFGNT
Sbjct  417   SSKPYIPDYKLAFEHFCVHAASKTVLDELQKNLELSENNMEASRMTLHRFGNT  469



>gb|AGK30017.1| 3-ketoacyl-CoA synthase 8 [Gossypium raimondii]
Length=535

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/473 (67%), Positives = 385/473 (81%), Gaps = 13/473 (3%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             MA+ E  LLSTEI+NRGIE SGP+AG+LTFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+
Sbjct  1     MARNEQDLLSTEIVNRGIESSGPNAGSLTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINH  60

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYF  400
              + LA T+P+L +VF  EVGS+ R E++W K+WE++   D   V +S   +  FT+S+YF
Sbjct  61    GIYLA-TIPVLVLVFSAEVGSLSR-EELWKKLWEDARY-DLATV-LSFFAVFVFTVSVYF  116

Query  401   MSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETY  580
             MS+P  IYL+DFAC +P DDLKVTKDQFI++AR SG FDE +LE+ K++L+SSGIGDETY
Sbjct  117   MSRPRSIYLIDFACYRPHDDLKVTKDQFIELARASGKFDEASLEFQKKILKSSGIGDETY  176

Query  581   IPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLS  760
             +PK I   E    +   R EAS ++F A+D++ EKTRIR +D+G+LVVNC+ FNPTPSLS
Sbjct  177   VPKVIMSKENCATMKEGRLEASTVMFGALDELFEKTRIRPKDVGVLVVNCSIFNPTPSLS  236

Query  761   AMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSG  940
             AMIINHYKM+ NI+S NLGGMGCSAGIIA+DLARD+L+ANPN YA+VVS+E+V   WY G
Sbjct  237   AMIINHYKMRGNILSYNLGGMGCSAGIIAVDLARDMLQANPNNYAVVVSSEMVGYNWYPG  296

Query  941   NHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVE  1120
               RSML+PNCFFR GCSAVLLSNRRRDYR AKYRL+H+VRTH+GA DR+FRSIYQEED +
Sbjct  297   RDRSMLVPNCFFRMGCSAVLLSNRRRDYRRAKYRLEHLVRTHKGADDRSFRSIYQEEDEQ  356

Query  1121  RIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGA---------  1273
               KGLK+SKDL+E+GG+ALK NITTLGPLVLP +EQL+FF TLI R  FG          
Sbjct  357   GFKGLKVSKDLMEIGGDALKTNITTLGPLVLPFSEQLFFFATLIWRHFFGGDKSKTSLSP  416

Query  1274  KTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
              +KPYIPDY +AFEHFC++AASK +LDEL++NL LSE NMEASR TLHRFGNT
Sbjct  417   SSKPYIPDYKLAFEHFCVHAASKTVLDELQKNLELSENNMEASRMTLHRFGNT  469



>ref|XP_009777333.1| PREDICTED: 3-ketoacyl-CoA synthase 10 [Nicotiana sylvestris]
Length=541

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/482 (67%), Positives = 381/482 (79%), Gaps = 26/482 (5%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             MA+EEH LLSTEI+NRGI     D G+ TFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+
Sbjct  1     MAREEH-LLSTEIVNRGIS----DGGSQTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINH  55

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYF  400
              + LA TVP+L +VF  EVGS+ R E++W K+W+N+   D   V +S + L  FTLS+Y 
Sbjct  56    GIYLA-TVPVLVLVFSAEVGSLSR-EELWRKVWDNAACYDLATV-LSFVALFVFTLSLYI  112

Query  401   MSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETY  580
             MSKP PIYL+DFAC KPSDDLKVTK+QFI++ARKSG FDE +LE+ KR+LESSGIGDETY
Sbjct  113   MSKPRPIYLLDFACYKPSDDLKVTKEQFIELARKSGKFDEPSLEFQKRILESSGIGDETY  172

Query  581   IPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLS  760
             +PK IG  E    +   R EAS ++F A+D++ EKT+IR +D+GILVVNC+ FNPTPSLS
Sbjct  173   VPKVIGSSENTATMKEGRAEASMVMFGALDELFEKTKIRPKDVGILVVNCSIFNPTPSLS  232

Query  761   AMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSG  940
             AMIINHYKM+ NI+S NLGGMGCSAGIIALDLARD+L+ANPN YA+VVS E+V   WY G
Sbjct  233   AMIINHYKMRGNILSFNLGGMGCSAGIIALDLARDMLQANPNSYAVVVSAEMVGFNWYPG  292

Query  941   NHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVE  1120
               RSMLIPNCFFR GCSA+LLSNRRRDYR AKY L+HIVRTH+ + DRAFR IYQEED +
Sbjct  293   KERSMLIPNCFFRMGCSALLLSNRRRDYRRAKYSLEHIVRTHKASNDRAFRCIYQEEDSQ  352

Query  1121  RIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGA---------  1273
             R KGL+ISKDLVEVGG+ALK NITTLGPLVLPL+EQL+FF  L+ R LFG          
Sbjct  353   RYKGLRISKDLVEVGGDALKTNITTLGPLVLPLSEQLFFFGNLVWRHLFGNKNNNNNNNN  412

Query  1274  ---------KTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFG  1426
                        KPYIPDY +AFEHFC  AASK +LDEL+RNL LSE NMEASRATLHRFG
Sbjct  413   AKGNSTSQLANKPYIPDYKLAFEHFCFYAASKTVLDELQRNLELSENNMEASRATLHRFG  472

Query  1427  NT  1432
             NT
Sbjct  473   NT  474



>gb|EPS63712.1| hypothetical protein M569_11072 [Genlisea aurea]
Length=535

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/470 (66%), Positives = 389/470 (83%), Gaps = 10/470 (2%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             MA EE HL STEI+NRGIE SGP+AG++TFSVRVRRRLPDF+ SVKLKYVKLGY+Y+IN+
Sbjct  1     MAGEEDHL-STEIVNRGIESSGPNAGSMTFSVRVRRRLPDFLNSVKLKYVKLGYHYLINH  59

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYF  400
              + LA TVP+L +VFG +VGS+ R E++W +IW+++ G D   V +  L L   T+S+YF
Sbjct  60    AVYLA-TVPVLVLVFGAQVGSLSR-EELWRRIWDSAAGYDLATV-VGFLALFVLTVSVYF  116

Query  401   MSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETY  580
             MS+P PIYL+DFAC KPSDDLKVT ++FI +ARKSG FDE++L++ +R+L++SGIGDETY
Sbjct  117   MSRPRPIYLLDFACYKPSDDLKVTAEEFIGLARKSGKFDEESLQFQRRLLQTSGIGDETY  176

Query  581   IPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLS  760
             +PKSIG       +   R EA+ +IF A+D++ EKT +R +D+G+LVVNC+ FNPTPSLS
Sbjct  177   VPKSIGSSANTATMKEGREEAATVIFGALDELFEKTNVRPKDVGVLVVNCSIFNPTPSLS  236

Query  761   AMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSG  940
             AM+INHYKM+ NI+S NLGGMGCSAG+IA+DLARD+L+ANPN YA+VVSTE+V   WY G
Sbjct  237   AMVINHYKMRGNILSFNLGGMGCSAGVIAVDLARDMLQANPNNYAVVVSTEMVGYNWYPG  296

Query  941   NHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVE  1120
                SMLIPNC+FR GCSAVLLSNRRRD+R AKYRL+HIVRTH+GA DR+FR+IYQEED E
Sbjct  297   KDNSMLIPNCYFRMGCSAVLLSNRRRDFRRAKYRLEHIVRTHKGADDRSFRTIYQEEDPE  356

Query  1121  RIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGA------KTK  1282
             + KGLKIS+DL+EV G+A+K NITTLGPLVLPL+EQL FF TL+ R L GA       TK
Sbjct  357   KFKGLKISRDLIEVAGDAIKTNITTLGPLVLPLSEQLLFFSTLLWRLLSGAGTSSSQPTK  416

Query  1283  PYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             PYIPDY +AFEHFC++AASK  LDEL++NL+LSE ++EASRATLHRFGNT
Sbjct  417   PYIPDYKLAFEHFCMHAASKTALDELQKNLKLSETHLEASRATLHRFGNT  466



>ref|XP_003522322.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Glycine max]
 gb|KHN29660.1| 3-ketoacyl-CoA synthase 10 [Glycine soja]
Length=536

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/473 (66%), Positives = 383/473 (81%), Gaps = 13/473 (3%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             MA  E  L S EI+NRGIEPSGP+AG+LTFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+
Sbjct  1     MANNERDLFSAEIVNRGIEPSGPNAGSLTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINH  60

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYF  400
              + L  T+P+L VVF  EVGS+ + E +W K+WE++   D   V ++  G+  FTLS+YF
Sbjct  61    GIYLF-TIPVLLVVFSAEVGSLSK-EDLWKKLWEDARY-DLATV-LASFGVFVFTLSVYF  116

Query  401   MSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETY  580
             MS+P PIYL+DFAC KP D+LKV+++Q +++ARKSG FDE +LE+ KRML SSGIGDETY
Sbjct  117   MSRPRPIYLIDFACYKPDDELKVSREQLMEVARKSGKFDEASLEFQKRMLMSSGIGDETY  176

Query  581   IPKS-IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSL  757
             IPK+ I   E    +   R EAS ++F A+D++ EKTR+R +D+G+LVVNC+ FNPTPSL
Sbjct  177   IPKAVIASTENTATMKEGRAEASMVMFGALDELFEKTRVRPKDVGVLVVNCSIFNPTPSL  236

Query  758   SAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYS  937
             SAMIINHYKM+ NI+S NLGGMGCSAGII +DLA+DIL+ANPN YA+VVSTE+V   WY 
Sbjct  237   SAMIINHYKMRGNILSYNLGGMGCSAGIIGVDLAKDILQANPNNYAVVVSTEMVGYNWYQ  296

Query  938   GNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDV  1117
             G  RSMLIPN FFR GCSAVLLSNRRRDY  AKYRL+HIVRTH+GA DR+FR +YQEED 
Sbjct  297   GKDRSMLIPNSFFRMGCSAVLLSNRRRDYSRAKYRLEHIVRTHKGADDRSFRCVYQEEDE  356

Query  1118  ERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKT------  1279
             +++KGLKISKDL+E+GG+ALK NITTLGPLVLP +EQL FF TL+ R LFG+K       
Sbjct  357   QKLKGLKISKDLIEIGGDALKTNITTLGPLVLPFSEQLLFFSTLVWRHLFGSKNDGNSPS  416

Query  1280  --KPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
               KPYIPDY +AFEHFC++AASK +LDEL+RNL LS++N+EASR TLHRFGNT
Sbjct  417   MKKPYIPDYKLAFEHFCVHAASKTILDELQRNLELSDKNIEASRMTLHRFGNT  469



>ref|XP_009404183.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Musa acuminata subsp. 
malaccensis]
Length=532

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/468 (66%), Positives = 380/468 (81%), Gaps = 12/468 (3%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             EH LLSTEI+NRGIE SGPDAG+ TFSVRVRRRLPDF+QSV LKYVKLGY+Y+I++ + L
Sbjct  4     EHTLLSTEIVNRGIEASGPDAGSPTFSVRVRRRLPDFLQSVNLKYVKLGYHYLISHAVYL  63

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L VVF  EVGS+ R E++W K+WE +   D   V ++   +L FT+++YFMSKP
Sbjct  64    A-TIPVLVVVFSAEVGSLSR-EELWRKMWEETS-YDLATV-LAFFSVLAFTIAVYFMSKP  119

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
              PIYLVDFAC +PSDDLK +  +FI++ARKSG FDE++L +  R+L+SSGIGDETY+PKS
Sbjct  120   RPIYLVDFACYRPSDDLKASNAEFIEMARKSGKFDEESLSFQSRILKSSGIGDETYVPKS  179

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             +        +   R EAS  +F A+D++ EK R+R +D+G+LVVNC+ FNPTPSLSAMI+
Sbjct  180   VFSTGNCATMKEGRAEASMAMFSALDELFEKCRVRPKDVGVLVVNCSLFNPTPSLSAMIV  239

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGMGCSAGIIALDLARD+L+ANP+ YA+VVSTE VS TWY+G +RS
Sbjct  240   NHYKMRGNILSYNLGGMGCSAGIIALDLARDMLQANPSSYAVVVSTEAVSFTWYTGRNRS  299

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             MLIPNCFFR GCSAVLLSNRRRD+R AKYRL+HIVRTH+GA DR+FR +YQEED +RIKG
Sbjct  300   MLIPNCFFRMGCSAVLLSNRRRDFRRAKYRLEHIVRTHKGADDRSFRCVYQEEDDQRIKG  359

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLF--------GAKTKPY  1288
             L IS+DL+EVGG ALKANITTLGPLVLP +EQL FF TL+ R LF         A TKPY
Sbjct  360   LSISRDLMEVGGHALKANITTLGPLVLPFSEQLLFFATLLHRHLFSKPADSANAAATKPY  419

Query  1289  IPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             IPDY +AFEHFCI+AASK +LD L+ NL L +++MEASRA LHRFGNT
Sbjct  420   IPDYKLAFEHFCIHAASKAVLDALQNNLELEDRHMEASRAALHRFGNT  467



>ref|XP_002516167.1| acyltransferase, putative [Ricinus communis]
 gb|EEF46169.1| acyltransferase, putative [Ricinus communis]
Length=532

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/468 (66%), Positives = 385/468 (82%), Gaps = 12/468 (3%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+NRGIE SGP+AG+LTFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+ + L
Sbjct  4     ERDLLSTEIVNRGIESSGPNAGSLTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINHAIYL  63

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L +VF  EVGS+ R E++W K+WE++   D   V +S  G+L FT+S YFMS+P
Sbjct  64    A-TIPVLVLVFSAEVGSLSR-EELWRKLWEDARY-DLATV-LSFFGVLVFTVSAYFMSRP  119

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               IYL+DFAC +P DDLKVTKDQF+++ RKSG +DE +LE+ KR+L+SSGIGDETYIPK+
Sbjct  120   RSIYLLDFACYRPHDDLKVTKDQFMEMLRKSGKYDEASLEFQKRILQSSGIGDETYIPKA  179

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             +   E    +   R EAS +IF A+D++ EKTR+R +D+G+LVVNC+ FNPTPSLSAM+I
Sbjct  180   VMLQENCTTMKEGRLEASSVIFGALDELFEKTRVRPKDVGVLVVNCSIFNPTPSLSAMVI  239

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGMGCSAGIIA+DLARD+L+ANPN  A+VVSTE+V   WY G  RS
Sbjct  240   NHYKMRGNILSYNLGGMGCSAGIIAVDLARDMLQANPNNIAVVVSTEMVGYNWYPGKERS  299

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             M+IPNCFFR GCSAVLLSNRRRDYR AKYRL+HIVRTH+GA DR+FRS+YQ+ED ++ KG
Sbjct  300   MMIPNCFFRMGCSAVLLSNRRRDYRRAKYRLEHIVRTHKGADDRSFRSVYQDEDEQKFKG  359

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAK--------TKPY  1288
             LK+SK+L+E+GG+ALK NITTLGPLVLP +EQL FF +L+ R+LFG K         KPY
Sbjct  360   LKVSKELMEIGGDALKTNITTLGPLVLPFSEQLIFFVSLVYRQLFGNKKGSLSSPSAKPY  419

Query  1289  IPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             IPDY +AFEHFC++ ASK++LDE++RNL LSE+NMEASR  LHRFGNT
Sbjct  420   IPDYKLAFEHFCVHGASKVVLDEIQRNLELSEKNMEASRMALHRFGNT  467



>ref|XP_009362990.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Pyrus x bretschneideri]
Length=561

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/471 (66%), Positives = 384/471 (82%), Gaps = 15/471 (3%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+NRG+E SGP+AG+LTFSVRVRRRLPDF+QSV LKYVKLGY+++IN+ + L
Sbjct  30    EQDLLSTEIVNRGVESSGPNAGSLTFSVRVRRRLPDFLQSVNLKYVKLGYHHLINHAIYL  89

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L +VF  EVGS+ R E++W K+W+++   D   V +   G+  FTLS+YFMS+P
Sbjct  90    A-TIPVLVLVFSAEVGSLSR-EELWKKLWDDARY-DLATV-LGFFGVFVFTLSVYFMSRP  145

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               IYLVDFAC +P+DDLKV+K+QFI++ARKSG FDE +LE+ KR+L SSG+GDET IPKS
Sbjct  146   RSIYLVDFACFRPNDDLKVSKEQFIEVARKSGKFDEASLEFQKRILNSSGLGDETCIPKS  205

Query  593   -IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMI  769
              I   E    +   R EAS ++F A+D++ EKTR+R +D+G+LVVNC+ FNPTPSLSAMI
Sbjct  206   VIMSTENTATMKEGRAEASMVMFGALDELFEKTRVRPKDVGVLVVNCSIFNPTPSLSAMI  265

Query  770   INHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHR  949
             INHYKM+ NI+S NLGGMGCSAGIIA+DLARD+L+ANPN YA+VVSTEIV   WY GN R
Sbjct  266   INHYKMRGNILSYNLGGMGCSAGIIAVDLARDMLQANPNNYAVVVSTEIVGYNWYPGNDR  325

Query  950   SMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIK  1129
             SMLIPNCFFR GCSAVLLSNRRRDY  AKYRL+HIVRTH+GA DR+FR +YQEED +R+K
Sbjct  326   SMLIPNCFFRMGCSAVLLSNRRRDYHRAKYRLEHIVRTHKGADDRSFRCVYQEEDEQRLK  385

Query  1130  GLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLF----------GAKT  1279
             GLKISKDL+E+GG+ALK NITTLGPLVLP +EQL FF TL+ R LF           ++ 
Sbjct  386   GLKISKDLIEIGGDALKTNITTLGPLVLPFSEQLLFFATLVSRHLFSSGGTSELSLASRK  445

Query  1280  KPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             +PYIPD+ +AFE FC++AASK +LDEL+RNL LSE+NMEASR TLHRFGNT
Sbjct  446   RPYIPDFKLAFERFCVHAASKTVLDELQRNLELSEENMEASRMTLHRFGNT  496



>ref|XP_010273876.1| PREDICTED: 3-ketoacyl-CoA synthase 10 [Nelumbo nucifera]
Length=526

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/462 (67%), Positives = 382/462 (83%), Gaps = 6/462 (1%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+NRG+E SGPDAG+LTFSVRVRRRLPDFVQSV LKYVKLGY+Y+IN+ +  
Sbjct  4     EQALLSTEIVNRGVESSGPDAGSLTFSVRVRRRLPDFVQSVNLKYVKLGYHYLINHAVYF  63

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L ++   +VGS+ R E++W K+WE +   D   V ++ LG+L FT+S+YFMS+P
Sbjct  64    A-TIPVLVLLLSAQVGSLSR-EELWRKLWEETS-YDLATV-LAFLGVLVFTVSLYFMSRP  119

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
              PIYLVDFAC KPSDDLKV+K  FI++ARKSG FDE +LE+  ++L++SG+GDETYIPK+
Sbjct  120   RPIYLVDFACYKPSDDLKVSKQDFIELARKSGKFDEASLEFQSQILKNSGMGDETYIPKA  179

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             +  PE    +   R EA+ +IF A+D++ +K RIR +D+G+LVVNC+ FNPTPSLSAMII
Sbjct  180   VMQPENCATMKEGRAEAATVIFGAMDELFDKCRIRPKDVGVLVVNCSLFNPTPSLSAMII  239

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGMGCSAGIIALDLARD+L+AN N YA+VVSTE+V+  WY G  RS
Sbjct  240   NHYKMRGNILSFNLGGMGCSAGIIALDLARDMLQANSNCYAVVVSTEMVTFNWYPGRRRS  299

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             MLIPNCFFR GCSAVLLSNRRRD+R AKY L+HIVRTH+GA DR+FR++YQEED ++ KG
Sbjct  300   MLIPNCFFRMGCSAVLLSNRRRDFRRAKYSLEHIVRTHKGADDRSFRAVYQEEDEQKFKG  359

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAK--TKPYIPDYTI  1306
             L IS+DL+EVGG+ALK NITTLGPLVLP +EQL FF TLI R++FG    +KPYIPDY +
Sbjct  360   LSISRDLLEVGGDALKTNITTLGPLVLPFSEQLLFFGTLIWRQVFGGSKASKPYIPDYKL  419

Query  1307  AFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             AFEHFCI AASK +LDEL+RNL LS+ NMEASR TLHRFGNT
Sbjct  420   AFEHFCIMAASKNVLDELQRNLELSDDNMEASRMTLHRFGNT  461



>ref|XP_008351945.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Malus domestica]
Length=541

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/471 (66%), Positives = 383/471 (81%), Gaps = 15/471 (3%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+NRG+E SGP+AG+LTFSVRVRRRLPDF+QSV LKYVKLGY+++IN+ + L
Sbjct  10    EQDLLSTEIVNRGVESSGPNAGSLTFSVRVRRRLPDFLQSVNLKYVKLGYHHLINHAIYL  69

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L +VF  EVGS+ R E++W K+W+++   D   V +   G+  FTLS+Y MS+P
Sbjct  70    A-TIPVLVLVFSAEVGSLSR-EELWKKLWDDARY-DLATV-LGFFGVFVFTLSVYLMSRP  125

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               IYLVDFAC +P+DDLKV+K+QFI++ARKSG FDE +LE+ KR+L SSG+GDETYIPKS
Sbjct  126   RSIYLVDFACFRPNDDLKVSKEQFIEVARKSGKFDEASLEFQKRILNSSGLGDETYIPKS  185

Query  593   -IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMI  769
              I   E    +   R EAS ++F A+D++ EKTR+R +D+G+LVVNC+ FNPTPSLSAMI
Sbjct  186   VIMSTENTATMKEGRAEASMVMFGALDELFEKTRVRPKDVGVLVVNCSIFNPTPSLSAMI  245

Query  770   INHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHR  949
             INHYKM+ NI+S NLGGMGCSAGIIA+DLARD+L+ANPN YA+VVSTE V   WY G+ R
Sbjct  246   INHYKMRGNILSYNLGGMGCSAGIIAVDLARDMLQANPNNYAVVVSTESVGYNWYPGSDR  305

Query  950   SMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIK  1129
             SMLIPNCFFR GCSAVLLSNRRRDY  AKYRL+HIVRTH+GA DR+FR +YQEED +R+K
Sbjct  306   SMLIPNCFFRLGCSAVLLSNRRRDYHRAKYRLEHIVRTHKGADDRSFRCVYQEEDEQRLK  365

Query  1130  GLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLF----------GAKT  1279
             GLKISKDL+E+GG+ALK NITTLGPLVLP +EQL FF TL+ R LF           ++ 
Sbjct  366   GLKISKDLIEIGGDALKTNITTLGPLVLPFSEQLLFFSTLVSRHLFSSEGTSELSLASRK  425

Query  1280  KPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             +PYIPD+ +AFE FC++AASK +LDEL+RNL LSE+NMEASR TLHRFGNT
Sbjct  426   RPYIPDFKLAFERFCVHAASKTVLDELQRNLELSEENMEASRMTLHRFGNT  476



>ref|XP_009594847.1| PREDICTED: 3-ketoacyl-CoA synthase 10 [Nicotiana tomentosiformis]
Length=536

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/477 (67%), Positives = 378/477 (79%), Gaps = 21/477 (4%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             MA+EEH LLSTEI+NRGI     D G+  FSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+
Sbjct  1     MAREEH-LLSTEIVNRGIS----DGGSQKFSVRVRRRLPDFLQSVNLKYVKLGYHYLINH  55

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYF  400
              + LA TVP+L +VF  EVGS+ R E++W K+W+N+   D   V +S + L  FTLS+Y 
Sbjct  56    GIYLA-TVPVLVLVFSAEVGSLSR-EELWRKVWDNAACYDLATV-LSFVALFAFTLSLYI  112

Query  401   MSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETY  580
             MSKP PIYL+DFAC KPSDDLKVTK++FI++ RKSG FDE +LE+ KR+LESSGIGDETY
Sbjct  113   MSKPRPIYLLDFACYKPSDDLKVTKEEFIELVRKSGKFDEPSLEFKKRILESSGIGDETY  172

Query  581   IPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLS  760
             +PK IG  E    +   R EAS ++F A+D++ EKT+IR +D+G+LVVNC+ FNPTPSLS
Sbjct  173   VPKVIGSSENTATMKEGRAEASMVMFGALDELFEKTKIRPKDVGVLVVNCSIFNPTPSLS  232

Query  761   AMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSG  940
             AMIINHYKM+ NI+S NLGGMGCSAGIIALDLARD+L+ANPN YA+VVS E+V   WY G
Sbjct  233   AMIINHYKMRGNILSFNLGGMGCSAGIIALDLARDMLQANPNNYAVVVSAEMVGFNWYPG  292

Query  941   NHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVE  1120
               RSMLIPNCFFR GCSA+LLSNRRRDY  AKY L+HIVRTH+ + DRAFR IYQEED +
Sbjct  293   KERSMLIPNCFFRMGCSALLLSNRRRDYHRAKYSLEHIVRTHKASNDRAFRCIYQEEDSQ  352

Query  1121  RIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGA---------  1273
             R KGL+ISKDLVEV G+ALK NITTLGPLVLPL+EQL+FF  L+ R LFG          
Sbjct  353   RYKGLRISKDLVEVAGDALKTNITTLGPLVLPLSEQLFFFGNLVWRHLFGNKNNNAKGNS  412

Query  1274  ----KTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
                   KPYIPDY +AFEHFC+ AASK +LDEL+RNL+LSE NMEAS ATLHRFGNT
Sbjct  413   NSQLANKPYIPDYKLAFEHFCVYAASKTVLDELQRNLQLSENNMEASLATLHRFGNT  469



>ref|XP_008452803.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA synthase 10 [Cucumis 
melo]
Length=531

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/467 (66%), Positives = 380/467 (81%), Gaps = 11/467 (2%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E HLLSTEI+NRGIE SGP+AG+LTFSVRVRRRLPDF+ SV LKYVKLGY+Y+IN+ + L
Sbjct  4     EQHLLSTEIVNRGIESSGPNAGSLTFSVRVRRRLPDFLNSVNLKYVKLGYHYLINHAIYL  63

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A TVP+L +VF  EVGS+ R E++W K+WE++   D   V +S   L  FTLS+YFMS+P
Sbjct  64    A-TVPVLVLVFSAEVGSLSR-EELWRKLWEDAR-YDLATV-LSFFALFVFTLSVYFMSRP  119

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               IYL+DF+C +PSD+ KV+K++FI++ARKSG FDE +LE+ KR+L+SSGIGDETYIPKS
Sbjct  120   RSIYLIDFSCFRPSDEFKVSKEEFIELARKSGKFDEGSLEFQKRILQSSGIGDETYIPKS  179

Query  593   -IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMI  769
              I   +    +   R EAS ++F A+D+  EKTRIR +D+G+LVVNC+ FNPTPSLSAMI
Sbjct  180   VIASADNCATMKEGRAEASAVMFGALDEXFEKTRIRPKDVGVLVVNCSIFNPTPSLSAMI  239

Query  770   INHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHR  949
             INHYKM+ NI+S NLGGMGCSAGIIA+DLARD+L++NPN YA+VVSTE+V   WY G  R
Sbjct  240   INHYKMRGNILSYNLGGMGCSAGIIAIDLARDMLQSNPNNYAVVVSTEVVGYNWYQGRDR  299

Query  950   SMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIK  1129
             SMLIPNCFFR GCSAV+LSNRRRDY  AKYRL+H+VRTH+GA DR+FR +YQEED +  K
Sbjct  300   SMLIPNCFFRMGCSAVILSNRRRDYHRAKYRLEHVVRTHKGADDRSFRCVYQEEDEQGFK  359

Query  1130  GLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKT------KPYI  1291
             GLK+SKDL+E+GGEALK NITTLGPLVLP +EQL FF TL+ R+ F + +      KPYI
Sbjct  360   GLKVSKDLMEIGGEALKTNITTLGPLVLPFSEQLLFFATLVWRQFFSSGSGVMNPKKPYI  419

Query  1292  PDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             PDY  AFEHFC++AASK +L+EL+RNL LSE NMEASR TLHRFGNT
Sbjct  420   PDYKQAFEHFCVHAASKGVLNELQRNLELSESNMEASRMTLHRFGNT  466



>ref|XP_004291247.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Fragaria vesca subsp. 
vesca]
Length=540

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/478 (65%), Positives = 387/478 (81%), Gaps = 17/478 (4%)
 Frame = +2

Query  35    LNMAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvI  214
             ++MA E   LLSTEI+N GIE SGP+AG+LTFSVRVRRRLPDF+QSV LKYVKLGY+++I
Sbjct  3     VDMASE-RDLLSTEIVNNGIESSGPNAGSLTFSVRVRRRLPDFLQSVNLKYVKLGYHHLI  61

Query  215   NNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSI  394
             NN + LA T+P+L +VF  EVGS+ R E++W K+W ++   D   V +   G+  FTLS+
Sbjct  62    NNAIYLA-TIPILVLVFSAEVGSLSR-EELWKKLWFDAR-YDLATV-LGFFGVFVFTLSV  117

Query  395   YFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDE  574
             YFMS+P  IYL+DFAC +PSDDLKV+K+QFI++ARKSG FDE++LE+  R+L SSG+G+E
Sbjct  118   YFMSRPRSIYLIDFACFRPSDDLKVSKEQFIELARKSGKFDEQSLEFQARILNSSGLGNE  177

Query  575   TYIPKS-IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTP  751
             TYIPKS I   E    +   R EAS ++F A+D++ EKT++R +D+G+LVVNC+ FNPTP
Sbjct  178   TYIPKSVITSTENTATMKEGRAEASLVMFGALDELFEKTKVRPKDVGVLVVNCSIFNPTP  237

Query  752   SLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATW  931
             SLSAMIINHYKM+ NI+S NLGGMGCSAGIIA+DLARD+L+ANPN YA+VVSTE V   W
Sbjct  238   SLSAMIINHYKMRGNILSYNLGGMGCSAGIIAVDLARDMLQANPNNYAVVVSTETVGYNW  297

Query  932   YSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEE  1111
             Y G+ RSML+PNCFFR GCSAVLLSNRRRDY  AKYRL+HIVRTH+GA DR+FR +YQEE
Sbjct  298   YPGSDRSMLVPNCFFRMGCSAVLLSNRRRDYHRAKYRLEHIVRTHKGADDRSFRCVYQEE  357

Query  1112  DVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLF--------  1267
             D +R+KGLKISK+LVE+GGEALK NITTLGPLVLP +EQL FF TL+ R LF        
Sbjct  358   DEQRLKGLKISKELVEIGGEALKTNITTLGPLVLPFSEQLLFFATLVSRHLFNKEGSQLS  417

Query  1268  ---GAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
                G +++PYIPD+ +AFE FC++AASK +LDEL+RNL LSE+NMEASR TLHRFGNT
Sbjct  418   LSSGKQSRPYIPDFKLAFERFCVHAASKTVLDELQRNLELSEENMEASRMTLHRFGNT  475



>emb|CAC84082.1| putative beta-ketoacyl-CoA synthase [Antirrhinum majus]
Length=526

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/465 (66%), Positives = 380/465 (82%), Gaps = 13/465 (3%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E H+LSTEI+NRGIE     AGA+TFSVRVRRRLPDF+ SV LKYVKLGY+Y+IN+ + L
Sbjct  4     EQHMLSTEIVNRGIE-----AGAMTFSVRVRRRLPDFLNSVNLKYVKLGYHYLINHGIYL  58

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P++ +VFG EVGS+ + E++W +IW+++ G D   V +  L +  FT+S+YFMS+P
Sbjct  59    A-TIPVIILVFGAEVGSLSK-EEMWKRIWDSTAGYDLATV-LVFLAVFVFTISVYFMSRP  115

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               IYL+DFAC KPSDDLKVTK++FI++ARKSG F E +LE+ KR+L+SSGIGDETY+PKS
Sbjct  116   RSIYLLDFACYKPSDDLKVTKEEFIELARKSGKFTESSLEFKKRILQSSGIGDETYVPKS  175

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             I   E    +   R EAS +IF A+D++ EKT IR +D+G+LVVNC+ FNPTPSLSAM+I
Sbjct  176   IASSENTATMKEGRTEASAVIFGALDELFEKTHIRPKDVGVLVVNCSIFNPTPSLSAMVI  235

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGMGCSAGI+A+DLARD+L ANPN YA+VVSTEIV   WY GN RS
Sbjct  236   NHYKMRGNILSFNLGGMGCSAGIVAVDLARDMLEANPNSYAVVVSTEIVGYNWYPGNERS  295

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             MLIPNC+FR GCSAVLLSNRRRDY  AKYRL+HIVRTH+GA DR+FRS+YQEED +  KG
Sbjct  296   MLIPNCYFRMGCSAVLLSNRRRDYGRAKYRLEHIVRTHKGADDRSFRSVYQEEDSQTFKG  355

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGA-----KTKPYIPD  1297
             +K+SKDLVE+GGEA+K NITTLGPLVLP +EQL FF TL+ + + G+      + PYIPD
Sbjct  356   IKVSKDLVEIGGEAIKTNITTLGPLVLPFSEQLLFFSTLVWKLMSGSGANSMSSNPYIPD  415

Query  1298  YTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             Y +AFEHFC++AASK +LDEL+RNL LS++N+EASRA LHRFGNT
Sbjct  416   YKLAFEHFCMHAASKTVLDELQRNLELSDKNLEASRAVLHRFGNT  460



>ref|XP_004141352.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Cucumis sativus]
 gb|KGN55394.1| hypothetical protein Csa_4G649640 [Cucumis sativus]
Length=531

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/467 (66%), Positives = 381/467 (82%), Gaps = 11/467 (2%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E HLLSTEI+NRGIE SGP+AG+LTFSVRVRRRLPDF+ SV LKYVKLGY+Y+IN+ + L
Sbjct  4     EQHLLSTEIVNRGIESSGPNAGSLTFSVRVRRRLPDFLNSVNLKYVKLGYHYLINHAIYL  63

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A TVP+L +VF  EVGS+ R E++W K+WE++   D   V +S   L  FTLS+YFMS+P
Sbjct  64    A-TVPVLVLVFSAEVGSLSR-EELWRKLWEDAR-YDLATV-LSFFALFVFTLSVYFMSRP  119

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               IYL+DF+C +PSD+ KV+K++FI++ARKSG FDE +LE+ KR+L+S+GIGDETYIPKS
Sbjct  120   RSIYLIDFSCFRPSDEFKVSKEEFIELARKSGKFDEGSLEFQKRILQSAGIGDETYIPKS  179

Query  593   -IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMI  769
              I   +    +   R EAS ++F A+D++ EKTRIR +D+G+LVVNC+ FNPTPSLSAMI
Sbjct  180   VIASADNCATMKEGRAEASAVMFGALDELFEKTRIRPKDVGVLVVNCSIFNPTPSLSAMI  239

Query  770   INHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHR  949
             INHYKM+ NI+S NLGGMGCSAGIIA+DLARD+L++NPN YA+VVSTE+V   WY G  R
Sbjct  240   INHYKMRGNILSYNLGGMGCSAGIIAIDLARDMLQSNPNNYAVVVSTEVVGYNWYQGRDR  299

Query  950   SMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIK  1129
             SMLIPNCFFR GCSAV+LSNRRRDY  AKYRL+H+VRTH+GA DR+FR +YQEED +  K
Sbjct  300   SMLIPNCFFRMGCSAVILSNRRRDYHRAKYRLEHVVRTHKGADDRSFRCVYQEEDEQGFK  359

Query  1130  GLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKT------KPYI  1291
             GLK+SKDL+E+GGEALK NITTLGPLVLP +EQL FF TL+ R+ F + +      KPYI
Sbjct  360   GLKVSKDLMEIGGEALKTNITTLGPLVLPFSEQLLFFATLVWRQFFSSGSGVMNPKKPYI  419

Query  1292  PDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             PDY  AFEHFC++AASK +L+EL+RNL LSE NMEASR TLHRFGNT
Sbjct  420   PDYKQAFEHFCVHAASKGVLNELQRNLELSESNMEASRMTLHRFGNT  466



>ref|XP_007222372.1| hypothetical protein PRUPE_ppa004011mg [Prunus persica]
 gb|EMJ23571.1| hypothetical protein PRUPE_ppa004011mg [Prunus persica]
Length=535

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/471 (66%), Positives = 383/471 (81%), Gaps = 15/471 (3%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+NRGIE SGP+AG+LTFSVRVRRRLPDF+QSV LKYVKLGY+++IN+ + L
Sbjct  4     ERDLLSTEIVNRGIESSGPNAGSLTFSVRVRRRLPDFLQSVNLKYVKLGYHHLINHAIYL  63

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L +VF  EVGS+ R E++W K+W+++   D   V +   G+  FTLS+YFMS+P
Sbjct  64    A-TIPVLVLVFSAEVGSLSR-EELWKKLWDDAR-YDLATV-LGFFGVFVFTLSVYFMSRP  119

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               IYLVDFAC +P DDLKV+KDQFI++ARKSG F+E++LE+ KR+L SSG+GDETYIPKS
Sbjct  120   RSIYLVDFACYRPHDDLKVSKDQFIEVARKSGKFNEESLEFQKRILNSSGLGDETYIPKS  179

Query  593   -IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMI  769
              I   E    +   R EAS ++F A+D++ EKTR+R +DIG+LVVNC+ FNPTPSLSAMI
Sbjct  180   VITSTENTATMKEGRAEASAVMFGALDELFEKTRVRPKDIGVLVVNCSIFNPTPSLSAMI  239

Query  770   INHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHR  949
             INHYKM+ NI+S NLGGMGCSAGIIA+DLARD+L+A+PN YA+VVSTE+V   WY G+ R
Sbjct  240   INHYKMRGNILSYNLGGMGCSAGIIAVDLARDMLQAHPNNYAVVVSTEMVGYNWYPGSDR  299

Query  950   SMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIK  1129
             SMLIPNCFFR GCSAVLLSNRRRDY  AKYRL+HIVRTH+GA DR+FR +YQEED  R+K
Sbjct  300   SMLIPNCFFRMGCSAVLLSNRRRDYHRAKYRLEHIVRTHKGADDRSFRCVYQEEDENRLK  359

Query  1130  GLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLF----------GAKT  1279
             GLKISK+LVE+GG+ALK NITTLGPLVLP +EQL FF TL+ R LF           +  
Sbjct  360   GLKISKELVEIGGDALKTNITTLGPLVLPFSEQLLFFATLVSRHLFSGGGTSQPSLSSGK  419

Query  1280  KPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             +PYIPD+ +AFE FC++AASK +LDEL++NL LSE+NMEASR TLHRFGNT
Sbjct  420   RPYIPDFKLAFERFCVHAASKTVLDELQKNLELSEENMEASRMTLHRFGNT  470



>ref|XP_007136914.1| hypothetical protein PHAVU_009G084500g [Phaseolus vulgaris]
 gb|ESW08908.1| hypothetical protein PHAVU_009G084500g [Phaseolus vulgaris]
Length=534

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/469 (65%), Positives = 382/469 (81%), Gaps = 13/469 (3%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  L S EI+NRGIE SGP+AG+LTFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+ + L
Sbjct  4     ERDLFSAEIVNRGIESSGPNAGSLTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINHGIYL  63

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
               T+P+L VVF  EVGS+ + E +W K+WE++   D   V ++  G+  FTLS+YFMS+P
Sbjct  64    L-TIPVLLVVFSAEVGSLSK-EDLWKKLWEDARY-DLATV-LASFGVFVFTLSVYFMSRP  119

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
              PIYL+DFAC KP D+LKV++++ +++ARKSG FDE +L + KRML SSGIGDETYIPK+
Sbjct  120   RPIYLIDFACYKPDDELKVSREELMEVARKSGKFDEGSLNFQKRMLMSSGIGDETYIPKA  179

Query  593   I-GCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMI  769
             +    E    +   R EAS ++F A+D++ EKTR+R +D+G+LVVNC+ FNPTPSLSAMI
Sbjct  180   VVASTENTATMKEGRAEASMVMFGALDELFEKTRVRPKDVGVLVVNCSIFNPTPSLSAMI  239

Query  770   INHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHR  949
             INHYKM+ NI+S NLGGMGCSAG+IA+DLA+DIL+ANPN YA+VVSTE+V   WY G  R
Sbjct  240   INHYKMRGNILSYNLGGMGCSAGVIAVDLAKDILQANPNNYAVVVSTEMVGYNWYQGKDR  299

Query  950   SMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIK  1129
             SMLIPNCFFR GCSAV+LSNRRRDY  AKYRL+HIVRTH+GA DR+FR +YQEED +++K
Sbjct  300   SMLIPNCFFRMGCSAVMLSNRRRDYSRAKYRLEHIVRTHKGADDRSFRCVYQEEDEQKLK  359

Query  1130  GLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKT--------KP  1285
             GLKISKDL+E+GG+ALK NITTLGPLVLP +EQL FF TL+ R LFG+KT        KP
Sbjct  360   GLKISKDLIEIGGDALKTNITTLGPLVLPFSEQLLFFGTLVWRHLFGSKTDGSSPSMKKP  419

Query  1286  YIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             YIPDY +AFEHFC++AASK +LDEL+RNL LS++N+EASR TLHRFGNT
Sbjct  420   YIPDYKLAFEHFCVHAASKTILDELQRNLELSDKNIEASRMTLHRFGNT  468



>ref|XP_011019306.1| PREDICTED: 3-ketoacyl-CoA synthase 10 [Populus euphratica]
Length=533

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/468 (66%), Positives = 382/468 (82%), Gaps = 12/468 (3%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+  G+E SGP+AG+LTFSVRVR+RLPDF+QSV LKYVKLGY+Y+IN+ + L
Sbjct  4     ERDLLSTEIVKHGVESSGPNAGSLTFSVRVRKRLPDFLQSVNLKYVKLGYHYLINHAIYL  63

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L +VF  EVGS+ R E++W K+W+++   D   V ++  G+L FT+S++FMS+P
Sbjct  64    A-TIPVLVLVFSAEVGSLSR-EELWKKLWQDARY-DLATV-LASFGVLVFTVSVHFMSRP  119

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               IYL+DFAC +P DDLKVT++QFI+ ARKSG FDE +LE+  R+L+SSG+GDETYIPK+
Sbjct  120   RSIYLIDFACYRPDDDLKVTREQFIEQARKSGKFDEASLEFQSRILKSSGLGDETYIPKA  179

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             I   E    +   R EAS ++F A+D++ EKTR+R +D+GILVVNC+ FNPTPSLSAMII
Sbjct  180   IMSHENCATMKEGRFEASTVMFGALDELFEKTRVRPKDVGILVVNCSIFNPTPSLSAMII  239

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGMGCSAGIIA+DLARD+L+ANPN YA+VVSTE+V   WY G  RS
Sbjct  240   NHYKMRGNILSFNLGGMGCSAGIIAVDLARDMLQANPNNYAVVVSTEMVGYNWYPGRDRS  299

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             MLIPNCFFR GCSAVLLSNRRRD+RHAKYRL+HIVRTH+GA DR+FR IYQ+ED ++ KG
Sbjct  300   MLIPNCFFRMGCSAVLLSNRRRDFRHAKYRLEHIVRTHKGADDRSFRCIYQDEDEQKFKG  359

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAK--------TKPY  1288
             LK+SKDLVE+GGEALK NITTLGPLVLP +EQL FF TLI R L G           KPY
Sbjct  360   LKVSKDLVEIGGEALKTNITTLGPLVLPFSEQLLFFITLIWRHLSGKSNGSPSSPPAKPY  419

Query  1289  IPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             IPDY +AFEHFC++AASK +LDEL+RNL LSE+NMEASR TLHRFGNT
Sbjct  420   IPDYKLAFEHFCVHAASKTVLDELQRNLELSEKNMEASRMTLHRFGNT  467



>ref|XP_003526086.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Glycine max]
Length=535

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/469 (66%), Positives = 381/469 (81%), Gaps = 13/469 (3%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  L S EI+NRGIE SGP+AG+LTFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+ + L
Sbjct  4     ERDLFSAEIVNRGIESSGPNAGSLTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINHGIYL  63

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
               T+P+L VVF  EVGS+ + E +W K+WE++   D   V ++  G+  FTLS+YFMS+P
Sbjct  64    F-TIPVLLVVFSAEVGSLSK-EDLWKKLWEDARY-DLATV-LASFGVFVFTLSVYFMSRP  119

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
              PIYL+DFAC KP D+LKV+++Q +++ARKSG FDE +LE+ KRML SSGIGDETYIPK+
Sbjct  120   RPIYLIDFACYKPDDELKVSREQLMEVARKSGKFDEASLEFQKRMLMSSGIGDETYIPKA  179

Query  593   I-GCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMI  769
             +    E    +   RGEAS ++F A+D++ EK+R+R +D+G+LVVNC+ FNPTPSLSAMI
Sbjct  180   VVASTENTATMKEGRGEASMVMFGALDELFEKSRVRPKDVGVLVVNCSIFNPTPSLSAMI  239

Query  770   INHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHR  949
             INHYKM+ NI+S NLGGMGCSAGII +DLA+DIL+ANPN YA+VVSTE+V   WY G  R
Sbjct  240   INHYKMRGNILSYNLGGMGCSAGIIGVDLAKDILQANPNNYAVVVSTEMVGYNWYQGKDR  299

Query  950   SMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIK  1129
             SMLIPN FFR GCSAVLLSNRRRDY  AKYRL+HIVRTH+GA DR+FR +YQEED +++K
Sbjct  300   SMLIPNSFFRMGCSAVLLSNRRRDYSRAKYRLEHIVRTHKGADDRSFRCVYQEEDEQKLK  359

Query  1130  GLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKT--------KP  1285
             GLKISKDL+E+GG+ALK NITTLGPLVLP +EQL FF TL+ R LFG+K         KP
Sbjct  360   GLKISKDLIEIGGDALKTNITTLGPLVLPFSEQLLFFATLVWRHLFGSKNGGNSPSMKKP  419

Query  1286  YIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             YIPDY +AFEHFC++AASK +LDEL+RNL LS++N+EASR TLHRFGNT
Sbjct  420   YIPDYKLAFEHFCVHAASKTILDELQRNLELSDKNIEASRMTLHRFGNT  468



>ref|XP_006361525.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Solanum tuberosum]
Length=540

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/481 (66%), Positives = 382/481 (79%), Gaps = 25/481 (5%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             MA+EEH LLST+I+NRGI     D G+ TFSVRV+RRLPDF+QSV LKYVKLGY+Y+I +
Sbjct  1     MAREEH-LLSTDIVNRGIS----DEGSQTFSVRVQRRLPDFLQSVNLKYVKLGYHYLIKH  55

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYF  400
              + LA  +P+L +VF  EVGS+ R E++W K+W+++   D   V +S + L  FT+S+Y 
Sbjct  56    GIYLA-ILPVLVLVFSAEVGSLSR-EELWRKVWDSTTRYDLATV-LSFVALFVFTISLYI  112

Query  401   MSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETY  580
             MSKP PIYL+DFAC KPSDDLKVTK+QFI++AR SG F+E +LE+ KR+LESSGIGDETY
Sbjct  113   MSKPRPIYLLDFACYKPSDDLKVTKEQFIELARNSGKFNESSLEFQKRILESSGIGDETY  172

Query  581   IPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLS  760
             +PKSIG  E    +   R EAS ++F A+D++ EKT+IR +D+G+LVVNC+ FNPTPSLS
Sbjct  173   VPKSIGSSENTATMKEGRFEASTVMFGALDELFEKTKIRPKDVGVLVVNCSIFNPTPSLS  232

Query  761   AMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSG  940
             AMIINHYKM+ NI+S NLGGMGCSAGIIALDLARD+L+ANPN YA+V+S E+V   WY G
Sbjct  233   AMIINHYKMRGNILSFNLGGMGCSAGIIALDLARDMLQANPNNYAIVISGEMVGYNWYPG  292

Query  941   NHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVE  1120
             N RSMLIPNCFFR GCSA+LLSNRRRDY  AKY L+HIVRTH+ + DRAFR IYQEED +
Sbjct  293   NERSMLIPNCFFRMGCSALLLSNRRRDYHRAKYSLEHIVRTHKASNDRAFRCIYQEEDSQ  352

Query  1121  RIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKT-------  1279
             R KGLKISKDLVEVGG+ALK NITTLGPLVLPL+EQL+FF  L+ R LFG K        
Sbjct  353   RYKGLKISKDLVEVGGDALKTNITTLGPLVLPLSEQLFFFGNLVWRHLFGNKNAKTNNNN  412

Query  1280  ----------KPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGN  1429
                       KPYIPDY +AFEHFC+ AASK +LDEL+RNL LSE+NMEASRATLHRFGN
Sbjct  413   NNNSQQANNIKPYIPDYKLAFEHFCVYAASKTVLDELQRNLELSEENMEASRATLHRFGN  472

Query  1430  T  1432
             T
Sbjct  473   T  473



>ref|XP_010939879.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Elaeis guineensis]
Length=525

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/461 (67%), Positives = 384/461 (83%), Gaps = 5/461 (1%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             EH LLSTEI+NRG+E SGPDAG+ TFS+RVRRRLPDF+QSV LKYVKLGY+Y+I++ + L
Sbjct  4     EHTLLSTEIVNRGVEASGPDAGSPTFSIRVRRRLPDFLQSVNLKYVKLGYHYLISHGIYL  63

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L VVF  EVGS+ R E++W K+WE +   D   V ++  G+L FT+S+YFMS+P
Sbjct  64    A-TIPVLVVVFSAEVGSLSR-EELWRKVWEETSY-DLATV-LAFFGVLVFTVSVYFMSRP  119

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
              PIYLVDFAC +PSDDLK ++++FI++ARKSG FDE+++ +  R+L+SSGIGDETY+PKS
Sbjct  120   RPIYLVDFACYRPSDDLKASREEFIELARKSGKFDEESIAFQSRILKSSGIGDETYVPKS  179

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             I  P     +   R EAS ++F A+D++ EK R+R +D+GILVVNC+ FNPTPSLSAMI+
Sbjct  180   IFSPGNCATMKEGRAEASMVMFGALDELFEKCRVRPKDVGILVVNCSLFNPTPSLSAMIV  239

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGMGCSAGIIALDLARD+L+ANPN YA+VVSTE VS TWY+G +RS
Sbjct  240   NHYKMRGNILSYNLGGMGCSAGIIALDLARDMLQANPNNYAVVVSTEAVSFTWYTGRNRS  299

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             MLIPNCFFR GCSAVLLSNRRRD+R AKYRL+HIVRTH+GA  R+FR +YQEED +RIKG
Sbjct  300   MLIPNCFFRMGCSAVLLSNRRRDFRRAKYRLEHIVRTHKGADSRSFRCVYQEEDEQRIKG  359

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLI-RRKLFGAKTKPYIPDYTIA  1309
             L IS+DL+EVGG ALK NITTLGPLVLP +EQL FF  L+ RR+   + +KPYIPDY +A
Sbjct  360   LSISRDLMEVGGHALKTNITTLGPLVLPFSEQLLFFAALLFRRRSSSSDSKPYIPDYKLA  419

Query  1310  FEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             FEHFC++AASK +LDEL+RNL LS ++MEASRA LHRFGNT
Sbjct  420   FEHFCMHAASKAVLDELQRNLELSNRHMEASRAVLHRFGNT  460



>ref|XP_008800450.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Phoenix dactylifera]
Length=527

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/463 (67%), Positives = 384/463 (83%), Gaps = 7/463 (2%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             EH LLSTEI+NRG+E SGPDAG+ TFSVRVRRRLPDF+QSV LKYVKLGY+Y+I++ + L
Sbjct  4     EHTLLSTEIVNRGVEASGPDAGSPTFSVRVRRRLPDFLQSVNLKYVKLGYHYLISHGIYL  63

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L VVFG EVGS+ R E++W K+WE +   D   V ++  G+L FT+S+YFMS+P
Sbjct  64    A-TIPVLVVVFGAEVGSLSR-EELWRKVWEETSY-DLATV-LAFFGVLVFTVSVYFMSRP  119

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
              PIYLVDFAC +PSDDLKV++++FI++ARKSG FDE++L +  R+L+SSG+GDETY+PKS
Sbjct  120   RPIYLVDFACYRPSDDLKVSREEFIELARKSGKFDEESLAFQSRLLKSSGVGDETYVPKS  179

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             I        +   R EAS ++F A+D++ EK R+R +D+GILVVNC+ FNPTPSLSAMI+
Sbjct  180   IFTTGNCATMKEGRAEASMVMFGALDELFEKCRVRPKDVGILVVNCSLFNPTPSLSAMIV  239

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGMGCSAGII+LDLARD+L+A+PN YA+VVSTE VS TWY+G +RS
Sbjct  240   NHYKMRGNILSYNLGGMGCSAGIISLDLARDMLQASPNNYAVVVSTEAVSFTWYTGRNRS  299

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             MLIPNCFFR GCSAVLLSNRRRD+R AKYRL+HIVRTH+GA  R+FR +YQEED +RIKG
Sbjct  300   MLIPNCFFRMGCSAVLLSNRRRDFRRAKYRLEHIVRTHKGADTRSFRCVYQEEDEQRIKG  359

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLI---RRKLFGAKTKPYIPDYT  1303
             L IS+DL+EVGG ALK NITTLGPLVLP +EQL FF  L+   R     + +KPYIPDY 
Sbjct  360   LSISRDLMEVGGHALKTNITTLGPLVLPFSEQLLFFAALLFRRRSSSSSSDSKPYIPDYK  419

Query  1304  IAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             +AFEHFC++AASK +LDEL+RNL LS+++MEASRA LHRFGNT
Sbjct  420   LAFEHFCMHAASKAVLDELQRNLELSDRHMEASRAVLHRFGNT  462



>ref|XP_004245205.1| PREDICTED: 3-ketoacyl-CoA synthase 10 [Solanum lycopersicum]
Length=535

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/476 (66%), Positives = 378/476 (79%), Gaps = 20/476 (4%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             MA+EEH LLSTEI+NRGI     D G+ TFSVRVRRRLPDF+QSV LKYVKLGY+Y+I +
Sbjct  1     MAREEH-LLSTEIVNRGIS----DEGSQTFSVRVRRRLPDFLQSVNLKYVKLGYHYLIKH  55

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYF  400
              + LA  +P+L +VF  E+GS+ R E++W ++W+++   D   V +S + L  FT+S+Y 
Sbjct  56    GIYLA-ILPVLVLVFSAEIGSLSR-EELWRRVWDSTTRYDLATV-LSFVALFVFTISLYI  112

Query  401   MSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETY  580
             MSKP PIYL+DFAC KPSDDLKVTK+QFI++AR SG FDE +LE+ KR+LE SGIGDE+Y
Sbjct  113   MSKPKPIYLLDFACYKPSDDLKVTKEQFIELARNSGKFDESSLEFKKRILECSGIGDESY  172

Query  581   IPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLS  760
             +P+SIG  E    +   R EAS ++F A+D++ EK +IR +D+G+LVVNC+ FNPTPSLS
Sbjct  173   VPRSIGSSENTATMKEGRYEASTVMFGALDELFEKAKIRPKDVGVLVVNCSIFNPTPSLS  232

Query  761   AMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSG  940
             AMIINHYKM+ NI+S NLGGMGCSAGIIALDLARD+L+ANPN YA+VVS E+V   WY G
Sbjct  233   AMIINHYKMRGNILSFNLGGMGCSAGIIALDLARDMLQANPNNYAIVVSGEMVGYNWYPG  292

Query  941   NHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVE  1120
               RSMLIPNCFFR GCSA+LLSNRRRDY  AKY L+HIVRTH+ + DRAFR IYQEED E
Sbjct  293   KQRSMLIPNCFFRMGCSALLLSNRRRDYHRAKYSLEHIVRTHKASNDRAFRCIYQEEDSE  352

Query  1121  RIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKT-------  1279
               KGLKISKDLVEVGG+ALK NITTLGPLVLPL+EQL+FF  L+ R LFG K        
Sbjct  353   HYKGLKISKDLVEVGGDALKTNITTLGPLVLPLSEQLFFFGNLVWRHLFGNKNAKTNNSQ  412

Query  1280  -----KPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
                  KPYIPDY +AFEHFC+ AASK +LDEL+RNL LSE+NMEASRATLHRFGNT
Sbjct  413   QANNIKPYIPDYKLAFEHFCVYAASKTVLDELQRNLELSEENMEASRATLHRFGNT  468



>gb|ABU75309.2| fiddlehead-like protein [Pisum sativum]
Length=548

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/477 (65%), Positives = 380/477 (80%), Gaps = 17/477 (4%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             MA  E  + S EI+NRGIE SGP+AG+LTFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+
Sbjct  9     MATNERDMFSAEIVNRGIESSGPNAGSLTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINH  68

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYF  400
              + L  TVP+L +VF  EVG++ + E +W KIWE++   D   V +S L +  FT S+YF
Sbjct  69    GVFLF-TVPILLLVFSAEVGTLSK-EDLWKKIWEDAS-YDLASV-LSSLAVFVFTFSLYF  124

Query  401   MSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETY  580
             MSKP PIYLVDF+C +P D+LKV++DQFI++AR SG FD+++LE+ KR++ SSGIGDETY
Sbjct  125   MSKPRPIYLVDFSCYQPDDELKVSRDQFIELARSSGKFDKESLEFQKRIVMSSGIGDETY  184

Query  581   IPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLS  760
             IPKSI   E    +   R EAS ++F A+D++ EKT IR +D+G+LVVNC+ FNPTPSLS
Sbjct  185   IPKSIASSENTATMKEGRAEASMVMFGALDELFEKTGIRPKDVGVLVVNCSIFNPTPSLS  244

Query  761   AMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSG  940
             AMIINHYKM+ NI+S NLGGMGCSAGIIA+DLARDIL++NP+ YA+VVSTE+V   WY G
Sbjct  245   AMIINHYKMRGNILSYNLGGMGCSAGIIAVDLARDILQSNPSNYAVVVSTEMVGFNWYQG  304

Query  941   NHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVE  1120
               RSMLIPNCFFR GCSAVLLSNRRRDY  AKYRL+HIVRTH+GA DR+FR +YQEED +
Sbjct  305   KERSMLIPNCFFRMGCSAVLLSNRRRDYSRAKYRLEHIVRTHKGADDRSFRCVYQEEDDQ  364

Query  1121  RIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGA---------  1273
             + KG+KISKDL+E+GGEALK NITTLGPLVLP +EQL FF TL+ R LFG          
Sbjct  365   KFKGIKISKDLIEIGGEALKTNITTLGPLVLPFSEQLIFFATLVWRNLFGGGKKSDKNSS  424

Query  1274  ----KTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
                   KPYIP+Y +AFEHFC++AASK +LDEL++NL LS++NMEASR TLHRFGNT
Sbjct  425   SSSSSNKPYIPNYKLAFEHFCVHAASKAILDELQKNLELSDKNMEASRMTLHRFGNT  481



>ref|XP_004168381.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Cucumis sativus]
Length=531

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/467 (66%), Positives = 381/467 (82%), Gaps = 11/467 (2%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E HLLSTEI+NRGIE SGP+AG+LTFSVRVRRRLPDF+ SV LKYVKLGY+Y+IN+ + L
Sbjct  4     EQHLLSTEIVNRGIESSGPNAGSLTFSVRVRRRLPDFLNSVNLKYVKLGYHYLINHAIYL  63

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A TVP+L +VF  EVGS+ R E++W K+WE++   D   V +S   L  FTLS+YFMS+P
Sbjct  64    A-TVPVLVLVFSAEVGSLSR-EELWRKLWEDAR-YDLATV-LSFFALFVFTLSVYFMSRP  119

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               IYL+DF+C +PSD+ KV+K++FI++ARKSG FDE +LE+ KR+L+S+GIGDETYIPKS
Sbjct  120   RSIYLIDFSCFRPSDEFKVSKEEFIELARKSGKFDEGSLEFQKRILQSAGIGDETYIPKS  179

Query  593   -IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMI  769
              I   +    +   R EAS ++F A+D++ EKTRIR +D+G+LVVNC+ FNPTPSLSAMI
Sbjct  180   VIASADNCATMKEGRAEASAVMFGALDELFEKTRIRPKDVGVLVVNCSIFNPTPSLSAMI  239

Query  770   INHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHR  949
             INHYKM+ NI+S NLGGMGCSAGIIA+DLARD+L++NPN YA+VVSTE+V   WY G  R
Sbjct  240   INHYKMRGNILSYNLGGMGCSAGIIAIDLARDMLQSNPNNYAVVVSTEVVGYNWYQGRDR  299

Query  950   SMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIK  1129
             SMLIPNCFFR GCSAV+LSNRRRDY  AKYRL+H+VRTH+GA DR+FR +YQEED +  K
Sbjct  300   SMLIPNCFFRMGCSAVILSNRRRDYHRAKYRLEHVVRTHKGADDRSFRCVYQEEDEQGFK  359

Query  1130  GLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKT------KPYI  1291
             GLK+SKDL+E+GGEALK NITTLGPLVLP +EQL FF TL+ R+ F + +      KPYI
Sbjct  360   GLKVSKDLMEIGGEALKTNITTLGPLVLPFSEQLLFFATLVWRQFFSSGSGVMNPKKPYI  419

Query  1292  PDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             PDY  AFEHFC++AASK +L+EL+RNL LSE +MEASR TLHRFG+T
Sbjct  420   PDYKQAFEHFCVHAASKGVLNELQRNLELSESSMEASRMTLHRFGST  466



>ref|XP_002282234.1| PREDICTED: 3-ketoacyl-CoA synthase 10 [Vitis vinifera]
Length=530

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/466 (65%), Positives = 375/466 (80%), Gaps = 10/466 (2%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E HLL+TEI+NRGIE SGP+AG+ TFSVRVRRRLPDFVQSV LKYVKLGY+Y+IN+ + L
Sbjct  4     EQHLLATEIVNRGIESSGPNAGSQTFSVRVRRRLPDFVQSVNLKYVKLGYHYLINHAIYL  63

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L +VF  EVGS+ + E++W K+WE++   D   V +   G+  FTLS+Y MS+P
Sbjct  64    A-TIPVLVLVFSAEVGSLNK-EELWKKLWEDARY-DLATV-LGFFGVFVFTLSVYIMSRP  119

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               IYL+DFAC KP DDLK++K Q I+  R+SG  DE ++E+ KR+L SSGIGDETYIPK+
Sbjct  120   RSIYLIDFACFKPHDDLKLSKQQLIEAVRRSGKHDEASIEFQKRILMSSGIGDETYIPKA  179

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             +   E    +   R EA  ++F A+D++ EKTR+R +D+G+LVVNC+ FNPTPSLSAMII
Sbjct  180   VMAGENCATMKEGRAEAGMVMFGALDELFEKTRVRPKDVGVLVVNCSIFNPTPSLSAMII  239

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGMGCSAG+IALDLARD+L +NPN YA+VVSTE+V   WY G  RS
Sbjct  240   NHYKMRGNILSFNLGGMGCSAGVIALDLARDMLESNPNNYAVVVSTEMVGYNWYPGKERS  299

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             M+IPNCFFR GCSA+LLSNRR DYRHAKYRL+HIVRTH+GA DR+FR +YQEED ER KG
Sbjct  300   MIIPNCFFRMGCSALLLSNRRSDYRHAKYRLEHIVRTHKGADDRSFRCVYQEEDSERFKG  359

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFG------AKTKPYIP  1294
             L++SKDL+E+GG+ALK NITTLGPLVLP +EQL FF TL+ R LFG        TKPYIP
Sbjct  360   LRVSKDLIEIGGDALKTNITTLGPLVLPFSEQLLFFATLVWRNLFGHGGPQQPPTKPYIP  419

Query  1295  DYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             DY +AFEHFC++AASK +LDEL+RNL LS+ N+EASR TLHRFGNT
Sbjct  420   DYKLAFEHFCVHAASKTVLDELQRNLGLSDSNVEASRMTLHRFGNT  465



>ref|XP_010049293.1| PREDICTED: 3-ketoacyl-CoA synthase 10 [Eucalyptus grandis]
 gb|KCW81820.1| hypothetical protein EUGRSUZ_C03177 [Eucalyptus grandis]
Length=530

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/469 (65%), Positives = 376/469 (80%), Gaps = 9/469 (2%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             M   E HLL+TEI++RGI+ SGP+AG+ TFSVRVRRRLPDFVQSV LKYV+LGY+Y+I++
Sbjct  1     MPSSEQHLLATEIVDRGIKSSGPNAGSPTFSVRVRRRLPDFVQSVNLKYVRLGYHYLISH  60

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYF  400
              + LA T+P+L +VFG EVGS+ R E++W K+WE++   D   V +S  G+  FTLS+YF
Sbjct  61    GVYLA-TIPVLVLVFGAEVGSLSR-EELWRKLWEDARD-DLATV-LSFFGVFVFTLSVYF  116

Query  401   MSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETY  580
             MS+P  IYLVDFAC KP DDL+VTK Q ID A +S  FDE  +E+ +R+L +SGIGDETY
Sbjct  117   MSRPRSIYLVDFACYKPHDDLQVTKAQLIDHAIRSKKFDESTIEFQRRILHASGIGDETY  176

Query  581   IPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLS  760
             +PK I   E    +   R EAS ++F A+D++ EKTR+R +D+G+LVVNC+ FNPTPSLS
Sbjct  177   VPKPILAGENCATMKEGRAEASTVMFGALDELFEKTRVRPKDVGVLVVNCSIFNPTPSLS  236

Query  761   AMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSG  940
             AMIINHYKM+ NI+S NLGGMGCSAGIIA+DLARD+L+ NPN YA+VVS E+V   WY G
Sbjct  237   AMIINHYKMRGNILSYNLGGMGCSAGIIAVDLARDMLQGNPNNYAVVVSAEMVGYNWYQG  296

Query  941   NHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVE  1120
               RSM++PNCFFR GCSAVLLSNRRRD+  AKYRL+H+VRTH+GA DR+FR +YQEED +
Sbjct  297   KERSMILPNCFFRMGCSAVLLSNRRRDFHRAKYRLEHVVRTHKGADDRSFRCVYQEEDEQ  356

Query  1121  RIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKT-----KP  1285
             R KGL++SKDLVE+GGEALK NITTLGPLVLP +EQL FF  L+RR LFG  +     KP
Sbjct  357   RFKGLRVSKDLVEIGGEALKTNITTLGPLVLPFSEQLLFFAALLRRHLFGDGSQPYPKKP  416

Query  1286  YIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             YIPDY +AFEHFC++AASK +LDEL+RNL LSE NMEASR TLHRFGNT
Sbjct  417   YIPDYKLAFEHFCVHAASKTVLDELQRNLGLSEGNMEASRMTLHRFGNT  465



>ref|XP_008220603.1| PREDICTED: 3-ketoacyl-CoA synthase 10 [Prunus mume]
Length=542

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/471 (66%), Positives = 381/471 (81%), Gaps = 15/471 (3%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+NRGIE SGP+AG+LTFSVRVRRRLPDF+QSV LKYVKLGY+++IN+ + L
Sbjct  11    ERDLLSTEIVNRGIESSGPNAGSLTFSVRVRRRLPDFLQSVNLKYVKLGYHHLINHAIYL  70

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L +VF  EVGS+ + E++W K+W+++   D   V +   G+  FTLS+YFMS+P
Sbjct  71    A-TIPVLVLVFSAEVGSLSK-EELWKKLWDDARY-DLATV-LGFFGVFVFTLSVYFMSRP  126

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               IYLVDFAC +P DDLKV+KDQFI+ ARKSG F+E++LE+ KR+L SSG+GDETYIPKS
Sbjct  127   RSIYLVDFACYRPHDDLKVSKDQFIEAARKSGKFNEESLEFQKRILNSSGLGDETYIPKS  186

Query  593   -IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMI  769
              I   E    +   R EAS ++F A++++ EKTR+R +DIG+LVVNC+ FNPTPSLSAMI
Sbjct  187   VIASTENAATMKEGRAEASAVMFGALNELFEKTRVRPKDIGVLVVNCSIFNPTPSLSAMI  246

Query  770   INHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHR  949
             IN YKM+ NI+S NLGGMGCSAGIIA+DLARD+L+ANPN YA+VVSTE+V   WY G+ R
Sbjct  247   INRYKMRGNILSYNLGGMGCSAGIIAVDLARDMLQANPNNYAVVVSTEMVGYNWYPGSDR  306

Query  950   SMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIK  1129
             SMLIPNCFFR GCSAVLLSNRRRDY  AKYRL+HIVRTH+GA DR+FR +YQEED  R+K
Sbjct  307   SMLIPNCFFRMGCSAVLLSNRRRDYHRAKYRLEHIVRTHKGADDRSFRCVYQEEDENRLK  366

Query  1130  GLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAK----------T  1279
             GLKISK+LVE+GG+ALK NITTLGPLVLP +EQL FF TL+ R LF  +           
Sbjct  367   GLKISKELVEIGGDALKTNITTLGPLVLPFSEQLLFFATLVSRHLFSGRGTSQPSLLSGK  426

Query  1280  KPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             +PYIPD+ +AFE FC++AASK +LDEL++NL LSE+NMEASR TLHRFGNT
Sbjct  427   RPYIPDFKLAFERFCVHAASKTVLDELQKNLELSEENMEASRMTLHRFGNT  477



>ref|XP_002309451.1| beta-ketoacyl-CoA synthase family protein [Populus trichocarpa]
 gb|EEE92974.1| beta-ketoacyl-CoA synthase family protein [Populus trichocarpa]
Length=533

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/468 (66%), Positives = 381/468 (81%), Gaps = 12/468 (3%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+  G+E SGP+AG+ TFSVRVR+RLPDF+QSV LKYVKLGY+Y+IN+ + L
Sbjct  4     ERDLLSTEIVKHGVESSGPNAGSPTFSVRVRKRLPDFLQSVNLKYVKLGYHYLINHAIYL  63

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L +VF  EVGS+ R E++W K+W+++   D   V ++  G+L FT+S++FMS+P
Sbjct  64    A-TIPVLVLVFSAEVGSLSR-EELWKKLWQDARY-DLATV-LASFGVLVFTVSVHFMSRP  119

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               IYL+DFAC +P DDLKVT++QFI+ ARKSG FDE +LE+  R+L+SSG+GDETYIPK+
Sbjct  120   RSIYLIDFACYRPDDDLKVTREQFIEQARKSGKFDEASLEFQNRILKSSGLGDETYIPKA  179

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             I   E    +   R EAS ++F A+D++ EKTR+R +D+GILVVNC+ FNPTPSLSAMII
Sbjct  180   IMSHENCATMKEGRFEASTVMFGALDELFEKTRVRPKDVGILVVNCSVFNPTPSLSAMII  239

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGMGCSAGIIA+DLARD+L+ANPN YA+VVSTE+V   WY G  RS
Sbjct  240   NHYKMRGNILSFNLGGMGCSAGIIAVDLARDMLQANPNNYAVVVSTEMVGYNWYPGRDRS  299

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             MLIPNCFFR GCSAVLLSNRRRD+RHAKYRL+HIVRTH+GA DR+FR IYQ+ED ++ KG
Sbjct  300   MLIPNCFFRMGCSAVLLSNRRRDFRHAKYRLEHIVRTHKGADDRSFRCIYQDEDEQKFKG  359

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAK--------TKPY  1288
             LK+SKDLV++GGEALK NITTLGPLVLP +EQL FF TLI R L G           KPY
Sbjct  360   LKVSKDLVQIGGEALKTNITTLGPLVLPFSEQLLFFTTLIWRHLSGKSNGSPSSPPAKPY  419

Query  1289  IPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             IPDY +AFEHFC++AASK +LDEL+RNL LSE+N+EASR TLHRFGNT
Sbjct  420   IPDYKLAFEHFCVHAASKTVLDELQRNLELSEKNIEASRMTLHRFGNT  467



>gb|KDP34003.1| hypothetical protein JCGZ_07574 [Jatropha curcas]
Length=542

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/475 (64%), Positives = 381/475 (80%), Gaps = 20/475 (4%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+NRGIE +GP+AG+LTFSVRVRRRLPDF+QSV LKYV LGY+Y+IN+ + L
Sbjct  4     ERDLLSTEIVNRGIESTGPNAGSLTFSVRVRRRLPDFLQSVNLKYVMLGYHYLINHAIYL  63

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVN-MSLLGLLGFTLSIYFMSK  409
             A T+P+L +VF  EVGS+ R E++W K+WE++    + +V  +S  G+  FT+S YFMSK
Sbjct  64    A-TIPVLVLVFSAEVGSLSR-EELWKKLWEDA---RYDLVTVLSFFGVFVFTVSAYFMSK  118

Query  410   PMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPK  589
             P  IYLVDF+C +P+DDLKV+KD+ +++AR +G +DE  L++ KR+L+SSGIGDETYIPK
Sbjct  119   PRSIYLVDFSCYRPNDDLKVSKDELMEMARMTGKYDEATLQFQKRILQSSGIGDETYIPK  178

Query  590   SIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMI  769
             ++   E    +   R EAS ++F A+D++ EKTR+R +DIG+LVVNC+ FNPTPSLSAM+
Sbjct  179   AVMSQENCATMKEGRFEASTVMFGALDELFEKTRVRPKDIGVLVVNCSIFNPTPSLSAMV  238

Query  770   INHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHR  949
             INHYKM+ NI+S NLGGMGCSAGIIA+DLARD+L+ANPN YA+VVSTE+V   WY G  R
Sbjct  239   INHYKMRGNILSYNLGGMGCSAGIIAVDLARDMLQANPNNYAVVVSTEMVGYNWYQGRER  298

Query  950   SMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIK  1129
             SM+I NCFFR GCSAVLLSNRRRDYR AKYRL+HIVRTH+GA DR+FR IYQEED ++ K
Sbjct  299   SMMISNCFFRMGCSAVLLSNRRRDYRRAKYRLEHIVRTHKGADDRSFRCIYQEEDGQKFK  358

Query  1130  GLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLF--------------  1267
             GLK+SKDL+E+GGEALK NITTLGPLVLP +EQL FF TL+   LF              
Sbjct  359   GLKVSKDLIEIGGEALKTNITTLGPLVLPFSEQLLFFATLVWSHLFGNKNKNNTNGASPS  418

Query  1268  GAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
              + +KPYIPDY +AFEHFC++AASK +LDE++RNL LS++NMEASR TLHRFGNT
Sbjct  419   PSSSKPYIPDYKLAFEHFCVHAASKTVLDEIQRNLELSDKNMEASRMTLHRFGNT  473



>ref|XP_006474532.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Citrus sinensis]
Length=537

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/476 (64%), Positives = 383/476 (80%), Gaps = 16/476 (3%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             MA+ E  LLSTEI+NRGIE SGP+AG+LTFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+
Sbjct  1     MARSERDLLSTEIVNRGIESSGPNAGSLTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINH  60

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYF  400
              + LA T+P+L +VF  EVGS+ R E++W K+WE++   D   V +   G+  FTLS+YF
Sbjct  61    AIYLA-TIPVLLLVFSAEVGSLSR-EELWEKLWEDTRH-DLASV-LGFFGVFAFTLSVYF  116

Query  401   MSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETY  580
             MS+P  +YLVDFAC +PSDDLKVT++QFI++A K    DE +L++ +R+++SSGIGDETY
Sbjct  117   MSRPRSVYLVDFACYRPSDDLKVTREQFIEVAGKWSKSDEASLDFQRRIMKSSGIGDETY  176

Query  581   IPKSI-GCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSL  757
             IPK +    E    + + R EAS ++F A+D++ EKT++R +D+GILVVNC+ FNPTPSL
Sbjct  177   IPKVVMSAEENCMTMKHGRLEASMVMFGALDELFEKTKVRPKDVGILVVNCSIFNPTPSL  236

Query  758   SAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYS  937
             SAMIINHYKM+ NI+S NLGGMGCSAG+I +DLARD+L+ANPN YA+VVSTE+V   WY+
Sbjct  237   SAMIINHYKMRGNIISYNLGGMGCSAGVIGVDLARDMLQANPNNYAVVVSTEMVGYNWYA  296

Query  938   GNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDV  1117
             G  RSM+IPNCFFR GCSA+L+SNRRRDY  AKYRLQ IVRTH GA DR+FRS+YQEED 
Sbjct  297   GRDRSMMIPNCFFRMGCSAILMSNRRRDYHRAKYRLQLIVRTHTGADDRSFRSVYQEEDE  356

Query  1118  ERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFG---------  1270
             +  +GLK+SK+++E+GG+ALK NITTLGPLVLP +EQL+FF TL+ R LF          
Sbjct  357   QGFRGLKVSKNIMEIGGDALKTNITTLGPLVLPFSEQLFFFATLVWRHLFSGSADKSRSS  416

Query  1271  --AKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
               A TKPYIPDY +AFEHFC++AASK +LDEL++NL LSE+NMEASR TLHRFGNT
Sbjct  417   SLASTKPYIPDYKLAFEHFCVHAASKTVLDELQKNLELSEKNMEASRMTLHRFGNT  472



>ref|XP_010098399.1| 3-ketoacyl-CoA synthase 10 [Morus notabilis]
 gb|EXB74923.1| 3-ketoacyl-CoA synthase 10 [Morus notabilis]
Length=542

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/477 (65%), Positives = 380/477 (80%), Gaps = 21/477 (4%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+NRGIE SGP+AG+ TFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+ + L
Sbjct  4     ERDLLSTEIVNRGIESSGPNAGSPTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINHAIYL  63

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L +VF  EVGS+ + E++W K+WE++   D   V +   G+  F LS+YFMS+P
Sbjct  64    A-TIPVLVLVFSAEVGSLSK-EELWKKLWEDTR-YDLATV-LGFFGVFVFALSVYFMSRP  119

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               IYLVDFA  +P DD KVTKD+FI++ARKSG FDE +LE+  R+L SSGIGDETY+P+S
Sbjct  120   RSIYLVDFASFRPKDDFKVTKDEFIELARKSGKFDEASLEFQMRILHSSGIGDETYVPRS  179

Query  593   -IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMI  769
              I   E    +   R EAS ++F A+D++ EKTR+R +D+GILVVNC+ FNPTPSLSAMI
Sbjct  180   VIASGENTATMKEGRAEASAVMFGALDELFEKTRLRPKDVGILVVNCSIFNPTPSLSAMI  239

Query  770   INHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHR  949
             INHYKM+ NI+S NLGGMGCSAG+IA++LARD+L+ANPN YA+VVSTE+V   WYSG  R
Sbjct  240   INHYKMRGNILSYNLGGMGCSAGVIAVELARDMLQANPNNYAVVVSTEMVGYNWYSGKDR  299

Query  950   SMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIK  1129
             SMLIPNCFFR GCSAVLLSNRRRDYRHAKYRL+HIVRTH+GA DR+FR +YQEED + +K
Sbjct  300   SMLIPNCFFRMGCSAVLLSNRRRDYRHAKYRLEHIVRTHKGADDRSFRCVYQEEDEQGLK  359

Query  1130  GLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFG-------------  1270
             GLK+SKD+VE+GG+ALK NITTLGPLVLPL+EQL FF TL+   L G             
Sbjct  360   GLKVSKDVVEIGGDALKTNITTLGPLVLPLSEQLLFFATLVWTHLLGGRVVGAKGSSQPS  419

Query  1271  ---AKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
                A  KPYIPDY +AFEHFC++AASK +LDEL+RNL LSE+++EASR TLHRFGNT
Sbjct  420   LSPATKKPYIPDYKLAFEHFCVHAASKRVLDELQRNLGLSERHVEASRMTLHRFGNT  476



>ref|XP_008377531.1| PREDICTED: 3-ketoacyl-CoA synthase 10 [Malus domestica]
Length=541

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/471 (65%), Positives = 380/471 (81%), Gaps = 15/471 (3%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+NRG+E SGP+AG+LTFSVRV+RRLPDF+QSV LKYVKLGY+++IN+ + L
Sbjct  10    EQDLLSTEIVNRGVESSGPNAGSLTFSVRVQRRLPDFLQSVNLKYVKLGYHHLINHAIYL  69

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L +VF  EVGS+ R E++W K+W++ G  D   V +   G+  FTLS+YFMS+P
Sbjct  70    A-TIPVLVLVFSAEVGSLSR-EELWKKLWDD-GRYDLATV-LGFFGVFVFTLSVYFMSRP  125

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               IYLVDFAC +P+DDLK +K+QFI++ARKSG F+E +LE+ KR+L SSG+GDETYIPKS
Sbjct  126   RSIYLVDFACFQPNDDLKASKEQFIEVARKSGKFNEASLEFQKRILNSSGLGDETYIPKS  185

Query  593   -IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMI  769
              I   E    +   R EAS ++F A+D++ EKTR+R +D+G+LVVNC+ FNPTPSLSAMI
Sbjct  186   VIMSTENTATMKEGRAEASMVMFGALDELFEKTRVRPKDVGVLVVNCSIFNPTPSLSAMI  245

Query  770   INHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHR  949
             INHYKM+ NI+S NLGGMGCSAGIIA+DLARDIL+ANPN YA+VVSTE V   WY G+ R
Sbjct  246   INHYKMRGNILSYNLGGMGCSAGIIAVDLARDILQANPNNYAVVVSTECVGYNWYPGSDR  305

Query  950   SMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIK  1129
             SML+ NCFFR GCSAVLLSNRRRDY  AKYRL+H+VRTH+GA DR+FR +YQEED + +K
Sbjct  306   SMLVANCFFRMGCSAVLLSNRRRDYHRAKYRLEHVVRTHKGADDRSFRCVYQEEDEKGLK  365

Query  1130  GLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLF----------GAKT  1279
             GLKISKDL+E+GGEALK NITTLGPLVLP +EQL FF TL+ R LF           ++ 
Sbjct  366   GLKISKDLIEIGGEALKTNITTLGPLVLPFSEQLLFFATLVSRHLFSGGGTSVLSLASRK  425

Query  1280  KPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             +PYIPD+ +AFE F ++AASK +LDEL+RNL LSE+NMEASR TLHRFGNT
Sbjct  426   RPYIPDFKLAFEGFXVHAASKTVLDELQRNLELSEENMEASRMTLHRFGNT  476



>gb|KDO73681.1| hypothetical protein CISIN_1g009313mg [Citrus sinensis]
Length=537

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/476 (64%), Positives = 383/476 (80%), Gaps = 16/476 (3%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             MA+ E  LLSTEI+NRGIE SGP+AG+LTFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+
Sbjct  1     MARSERDLLSTEIVNRGIESSGPNAGSLTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINH  60

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYF  400
              + LA T+P+L +VF  EVGS+ R E++W K+WE++   D   V +   G+  FTLS+YF
Sbjct  61    AIYLA-TIPVLLLVFSAEVGSLSR-EELWEKLWEDTRH-DLASV-LGFFGVFVFTLSVYF  116

Query  401   MSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETY  580
             MS+P  +YLVDFAC +PSDDLKVT++QFI++A K    DE +L++ +R+++SSGIGDETY
Sbjct  117   MSRPRSVYLVDFACYRPSDDLKVTREQFIEVAGKWSKSDEASLDFQRRIMKSSGIGDETY  176

Query  581   IPKSI-GCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSL  757
             IPK +    E    + + R EAS ++F A+D++ EKT++R +D+GILVVNC+ FNPTPSL
Sbjct  177   IPKVVMSAEENCMTMKHGRLEASMVMFGALDELFEKTKVRPKDVGILVVNCSIFNPTPSL  236

Query  758   SAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYS  937
             SAMIINHYKM+ NI+S NLGGMGCSAG+I +DLARD+L+ANPN YA+VVSTE+V   WY+
Sbjct  237   SAMIINHYKMRGNIISYNLGGMGCSAGVIGVDLARDMLQANPNNYAVVVSTEMVGYNWYA  296

Query  938   GNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDV  1117
             G  RSM+IPNCFFR GCSA+L+SNRRRDY  AKYRLQ IVRTH GA DR+FRS+YQEED 
Sbjct  297   GRDRSMMIPNCFFRMGCSAILMSNRRRDYHRAKYRLQLIVRTHTGADDRSFRSVYQEEDE  356

Query  1118  ERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFG---------  1270
             +  +GLK+SK+++E+GG+ALK NITTLGPLVLP +EQL+FF TL+ R LF          
Sbjct  357   QGFRGLKVSKNIMEIGGDALKTNITTLGPLVLPFSEQLFFFATLVWRHLFSGSADKSRSS  416

Query  1271  --AKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
               A TKPYIPDY +AFEHFC++AASK +LDEL++NL LSE+NMEASR TLHRFGNT
Sbjct  417   SLASTKPYIPDYKLAFEHFCVHAASKTVLDELQKNLELSEKNMEASRMTLHRFGNT  472



>ref|XP_009117027.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Brassica rapa]
Length=547

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/486 (63%), Positives = 382/486 (79%), Gaps = 30/486 (6%)
 Frame = +2

Query  44    AKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNW  223
             +  E  LLSTEI+NRGIEPSGP+AG+ TFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+ 
Sbjct  3     SSNEQDLLSTEIVNRGIEPSGPNAGSPTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINHA  62

Query  224   LCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFM  403
             + LA T+P+L +VFG EVGS+ R E++W K+W+     D   V +   G+   T+ +YFM
Sbjct  63    VYLA-TIPVLVLVFGAEVGSLSR-EEIWNKLWDY----DIATV-IGFFGVFVLTVCVYFM  115

Query  404   SKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYI  583
             S+P  +YL+DFAC KPSD+LKVT+++FID+ARKSG FDE+ L + KR+L++SG+GDETY+
Sbjct  116   SRPRSVYLIDFACYKPSDELKVTREEFIDLARKSGKFDEETLGFKKRILQASGLGDETYV  175

Query  584   PKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSA  763
             P+SI   + I  +   R EAS +IF A+D++ EKTR++ +D+G+LVVNC+ FNPTPSLSA
Sbjct  176   PRSISSSDNITTMKEGREEASMVIFGALDELFEKTRVKPKDVGVLVVNCSIFNPTPSLSA  235

Query  764   MIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGN  943
             M+INHYKM+ NI+S NLGGMGCSAGIIALDLARD+L++NPN YA+VVSTE+V   WY G 
Sbjct  236   MVINHYKMRGNILSYNLGGMGCSAGIIALDLARDMLQSNPNSYAVVVSTEMVGYNWYVGR  295

Query  944   HRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVER  1123
              +SM+IPNCFFR GCSAV+LSNRRRD+RHAKYRL+HIVRTH+ A DR+FRS+YQEED + 
Sbjct  296   DKSMVIPNCFFRMGCSAVMLSNRRRDFRHAKYRLEHIVRTHKAADDRSFRSVYQEEDEQG  355

Query  1124  IKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLF------------  1267
              KGLKIS+DL+EVGGEALK NITTLGPLVLP +EQL FF  L+RR               
Sbjct  356   FKGLKISRDLMEVGGEALKTNITTLGPLVLPFSEQLLFFAALLRRTFSPATKTITSSSTT  415

Query  1268  ----GAK-------TKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATL  1414
                 GAK       +KPYIPDY +AFEHFC +AASK +LDEL++NL LSE+NMEASR TL
Sbjct  416   AKTNGAKSSSSSDLSKPYIPDYKLAFEHFCFHAASKAVLDELQKNLGLSEENMEASRMTL  475

Query  1415  HRFGNT  1432
              RFGNT
Sbjct  476   QRFGNT  481



>emb|CDX77038.1| BnaC04g38330D [Brassica napus]
Length=532

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/468 (65%), Positives = 380/468 (81%), Gaps = 15/468 (3%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+NRGIEPSGP+AG+ TFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+ + L
Sbjct  6     EQDLLSTEIVNRGIEPSGPNAGSPTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINHAVYL  65

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L +VF  EVGS + GE++W K+W+     D   V +   G+   T+ +YFMS+P
Sbjct  66    A-TIPVLVLVFSAEVGS-LSGEEIWKKLWDY----DIATV-IGFFGVFVLTVCVYFMSRP  118

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               +YL+DFAC KPSD+LKVT+++FID+ARKSG FDE+ L + KR+L++SGIGDETY+P+S
Sbjct  119   RSVYLIDFACFKPSDELKVTREEFIDLARKSGKFDEEILGFKKRILQASGIGDETYVPRS  178

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             I   E    +   R EAS +IF A+D++ EKTR++ +D+G+LVVNC+ FNPTPSLSAM+I
Sbjct  179   ISSSENTTTMKEGREEASMMIFGALDELFEKTRVKPKDVGVLVVNCSIFNPTPSLSAMVI  238

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGMGCSAGIIA+DLARD+L++NPN YA+VVSTE+V   WY G  +S
Sbjct  239   NHYKMRGNILSYNLGGMGCSAGIIAVDLARDMLQSNPNSYAVVVSTEMVGYNWYVGRDKS  298

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             M+IPNCFFR GCSAV+LSNRRRD+RHAKYRL+HIVRTH+ A DR+FRS+YQEED +  KG
Sbjct  299   MVIPNCFFRMGCSAVMLSNRRRDFRHAKYRLEHIVRTHKAADDRSFRSVYQEEDEQGFKG  358

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLI-RRKLFGAK-------TKPY  1288
             LKIS+DL+EVGGEALK NITTLGPLVLP +EQL FF  LI   K+ GAK       +KPY
Sbjct  359   LKISRDLMEVGGEALKTNITTLGPLVLPFSEQLLFFAALIPTAKINGAKSSSSSDLSKPY  418

Query  1289  IPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             IPDY +AFEHFC +AASK +L+EL++NL LS++NMEAS+ TLHRFGNT
Sbjct  419   IPDYKLAFEHFCFHAASKAVLEELQKNLGLSDENMEASKMTLHRFGNT  466



>ref|XP_009359048.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Pyrus x bretschneideri]
Length=541

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/471 (64%), Positives = 381/471 (81%), Gaps = 15/471 (3%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+NRG+E SGP+AG+ TFSVRV+RRLPDF+QSV LKYVKLGY+++IN+ + L
Sbjct  10    EQDLLSTEIVNRGVESSGPNAGSPTFSVRVQRRLPDFLQSVNLKYVKLGYHHLINHAIYL  69

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L +VF  EVGS+ R E++W K+W+++   D   V +   G+  FTLS++ MS+P
Sbjct  70    A-TIPVLVLVFSAEVGSLSR-EELWKKLWDDARY-DLATV-LGFFGVFVFTLSVHIMSRP  125

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               IYLVDFAC +P+DDLKV+K+QFI++ARKSG FDE +LE+ KR+L SSG+GDETY+PKS
Sbjct  126   RSIYLVDFACFRPNDDLKVSKEQFIEVARKSGKFDEASLEFQKRILNSSGLGDETYVPKS  185

Query  593   I-GCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMI  769
             I    E    + + R EAS ++F A+D++ EKTR+R +D+G+LVVNC+ FNPTPSLSAMI
Sbjct  186   IIMSTENTATMKDGRAEASMVMFGALDELFEKTRVRPKDVGVLVVNCSIFNPTPSLSAMI  245

Query  770   INHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHR  949
             INHYK++ NI+S NLGGMGCSAGIIA+DLARDIL+ANPN YA+VVSTE V   WY G+ R
Sbjct  246   INHYKLRGNILSYNLGGMGCSAGIIAVDLARDILQANPNNYAVVVSTECVGYNWYPGSDR  305

Query  950   SMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIK  1129
             SML+ NCFFR GCSAVLLSNRRRDY HAKYRL+ +VRTH+GA DR+FR +YQEED +R+K
Sbjct  306   SMLVANCFFRMGCSAVLLSNRRRDYHHAKYRLEQVVRTHKGADDRSFRCVYQEEDEKRLK  365

Query  1130  GLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLF----------GAKT  1279
             GLKISKDL+E+GGEALK NITTLGPLVLP +EQL FF TL+ R LF           +  
Sbjct  366   GLKISKDLIEIGGEALKTNITTLGPLVLPFSEQLLFFATLVSRYLFSGEGSSMLSLASSK  425

Query  1280  KPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             +PYIPD+ +AFE FC++AASK +LDEL+RNL L+E+NMEASR TLHRFGNT
Sbjct  426   RPYIPDFKLAFECFCVHAASKTVLDELQRNLELNEENMEASRMTLHRFGNT  476



>gb|AAF73978.1|AF214500_1 fiddlehead protein [Arabidopsis thaliana]
Length=508

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/486 (62%), Positives = 379/486 (78%), Gaps = 33/486 (7%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+NRGIEPSGP+AG+ TFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+ + L
Sbjct  6     EQDLLSTEIVNRGIEPSGPNAGSPTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINHAVYL  65

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L +VF  EVGS+ R E++W K+W+     D   V +   G+   T  +YFMS+P
Sbjct  66    A-TIPVLVLVFSAEVGSLSR-EEIWKKLWDY----DLATV-IGFFGVFVLTACVYFMSRP  118

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               +YL+DFAC KPSD+ KVTK++FI++ARKSG FDE+ L + KR+L++SGIGDETY+P+S
Sbjct  119   RSVYLIDFACYKPSDEHKVTKEEFIELARKSGKFDEETLGFKKRILQASGIGDETYVPRS  178

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             I   E I  +   R EAS +IF A+D++ EKTR++ +D+G+LVVNC+ FNPTPSLSAM+I
Sbjct  179   ISSSENITTMKEGREEASTVIFGALDELFEKTRVKPKDVGVLVVNCSIFNPTPSLSAMVI  238

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGMGCSAGIIA+DLARD+L++NPN YA+VVSTE+V   WY G+ +S
Sbjct  239   NHYKMRGNILSYNLGGMGCSAGIIAIDLARDMLQSNPNSYAVVVSTEMVGYNWYVGSDKS  298

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             M+IPNCFFR GCSAV+LSNRRRD+RHAKYRL+HIVRTH+ A DR+FRS+YQEED +  KG
Sbjct  299   MVIPNCFFRMGCSAVMLSNRRRDFRHAKYRLEHIVRTHKAADDRSFRSVYQEEDEQGFKG  358

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAK------------  1276
             LKIS+DL+EVGGEALK NITTLGPLVLP +EQL FF  L+RR    A             
Sbjct  359   LKISRDLMEVGGEALKTNITTLGPLVLPFSEQLLFFAALLRRTFSPAAKTSTTTSFSTSA  418

Query  1277  --------------TKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATL  1414
                           +KPYIPDY +AFEHFC +AASK++L+EL++NL LSE+NMEASR TL
Sbjct  419   TAKTNGIKSSSSDLSKPYIPDYKLAFEHFCFHAASKVVLEELQKNLGLSEENMEASRMTL  478

Query  1415  HRFGNT  1432
             HRFGNT
Sbjct  479   HRFGNT  484



>ref|XP_010417407.1| PREDICTED: 3-ketoacyl-CoA synthase 10 isoform X1 [Camelina sativa]
 ref|XP_010417408.1| PREDICTED: 3-ketoacyl-CoA synthase 10 isoform X2 [Camelina sativa]
Length=550

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/486 (63%), Positives = 383/486 (79%), Gaps = 33/486 (7%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+NRGIEPSGP+AG+ TFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+ + L
Sbjct  6     EQDLLSTEIVNRGIEPSGPNAGSPTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINHAVYL  65

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L +VF  EVGS+ R E++W K+W+     D   V +  +G+   T  +YFMS+P
Sbjct  66    A-TIPVLVLVFSAEVGSLSR-EEIWKKLWDY----DLATV-IGFIGVFVLTACVYFMSRP  118

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               +YL+DFAC KPSD+LKVTK++FI++ARKSG FDE+ L + KR+L++SGIGDETY+P+S
Sbjct  119   RSVYLIDFACYKPSDELKVTKEEFIELARKSGKFDEETLGFKKRILQASGIGDETYVPRS  178

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             I   E I  +   R EAS +IF A+D++ EKTR++ +D+G+LVVNC+ FNPTPSLSAM+I
Sbjct  179   ISSSENITTMKEGREEASTVIFGALDELFEKTRVKPKDVGVLVVNCSIFNPTPSLSAMVI  238

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGMGCSAGIIA+DLARD+L++NPN YA+VVSTE+V   WY G+ +S
Sbjct  239   NHYKMRGNILSYNLGGMGCSAGIIAVDLARDMLQSNPNSYAVVVSTEMVGYNWYVGSDKS  298

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             M+IPNCFFR GCSAV+LSNRRRD+RHAKYRL+HIVRTH+ A DR+FRS+YQEED +  KG
Sbjct  299   MVIPNCFFRMGCSAVMLSNRRRDFRHAKYRLEHIVRTHKAADDRSFRSVYQEEDEQGFKG  358

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRR------------------  1258
             LKIS+DL+EVGGEALK NITTLGPLVLP +EQL FF  L+RR                  
Sbjct  359   LKISRDLMEVGGEALKTNITTLGPLVLPFSEQLLFFAALLRRTFSPAAKTSTTTSFSSSV  418

Query  1259  --KLFGAK------TKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATL  1414
               K  G K      +KPYIPDY +AFEHFC +AASK++L+EL++NL LSE+NMEASR TL
Sbjct  419   TAKTNGTKSSSSDVSKPYIPDYKLAFEHFCFHAASKVVLEELQKNLGLSEENMEASRMTL  478

Query  1415  HRFGNT  1432
             HRFGNT
Sbjct  479   HRFGNT  484



>ref|XP_010417409.1| PREDICTED: 3-ketoacyl-CoA synthase 10 isoform X3 [Camelina sativa]
Length=550

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/486 (63%), Positives = 383/486 (79%), Gaps = 33/486 (7%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+NRGIEPSGP+AG+ TFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+ + L
Sbjct  6     EQDLLSTEIVNRGIEPSGPNAGSPTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINHAVYL  65

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L +VF  EVGS+ R E++W K+W+     D   V +  +G+   T  +YFMS+P
Sbjct  66    A-TIPVLVLVFSAEVGSLSR-EEIWKKLWDY----DLATV-IGFIGVFVLTACVYFMSRP  118

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               +YL+DFAC KPSD+LKVTK++FI++ARKSG FDE+ L + KR+L++SGIGDETY+P+S
Sbjct  119   RSVYLIDFACYKPSDELKVTKEEFIELARKSGKFDEETLGFKKRILQASGIGDETYVPRS  178

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             I   E I  +   R EAS +IF A+D++ EKTR++ +D+G+LVVNC+ FNPTPSLSAM+I
Sbjct  179   ISSSENITTMKEGREEASTVIFGALDELFEKTRVKPKDVGVLVVNCSIFNPTPSLSAMVI  238

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGMGCSAGIIA+DLARD+L++NPN YA+VVSTE+V   WY G+ +S
Sbjct  239   NHYKMRGNILSYNLGGMGCSAGIIAVDLARDMLQSNPNSYAVVVSTEMVGYNWYVGSDKS  298

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             M+IPNCFFR GCSAV+LSNRRRD+RHAKYRL+HIVRTH+ A DR+FRS+YQEED +  KG
Sbjct  299   MVIPNCFFRMGCSAVMLSNRRRDFRHAKYRLEHIVRTHKAADDRSFRSVYQEEDEQGFKG  358

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRR------------------  1258
             LKIS+DL+EVGGEALK NITTLGPLVLP +EQL FF  L+RR                  
Sbjct  359   LKISRDLMEVGGEALKTNITTLGPLVLPFSEQLLFFAALLRRTFSPAAKTSTTTSFSSSV  418

Query  1259  --KLFGAK------TKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATL  1414
               K  G K      +KPYIPDY +AFEHFC +AASK++L+EL++NL LSE+NMEASR TL
Sbjct  419   TAKTNGTKSSSSDISKPYIPDYKLAFEHFCFHAASKVVLEELQKNLGLSEENMEASRMTL  478

Query  1415  HRFGNT  1432
             HRFGNT
Sbjct  479   HRFGNT  484



>ref|XP_003603250.1| 3-ketoacyl-CoA synthase [Medicago truncatula]
 gb|AES73501.1| 3-ketoacyl-CoA synthase-like protein [Medicago truncatula]
Length=537

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/474 (64%), Positives = 378/474 (80%), Gaps = 14/474 (3%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             MA  E  + S EI+NRGIE SGP+AG+LTFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+
Sbjct  1     MATNEGDMFSAEIVNRGIESSGPNAGSLTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINH  60

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYF  400
              + L  T+P+L VVF  EVGS+ + E +W KIWE++   D   V +S L +  FT ++YF
Sbjct  61    GVYLF-TIPILLVVFSAEVGSLSK-EDLWKKIWEDAT-YDLASV-LSSLAVFVFTFTLYF  116

Query  401   MSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETY  580
             MS+P PIYL+DFAC +P D+LKV+++Q I++ARKSG FDE +LE+ KR++ SSGIGDETY
Sbjct  117   MSRPRPIYLIDFACYQPDDELKVSREQLIELARKSGKFDEGSLEFQKRIVMSSGIGDETY  176

Query  581   IPKS-IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSL  757
             IP+S I   E    +   R EAS ++F A+D++ EKT IR +D+G+LVVNC+ FNPTPSL
Sbjct  177   IPRSVISSSENTATMKEGRAEASMVMFGALDELFEKTGIRPKDVGVLVVNCSIFNPTPSL  236

Query  758   SAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYS  937
             SAMIINHYKM+ NI+S NLGGMGCSAGIIA+DLARDIL++NP  YA+VVSTE+V   WY 
Sbjct  237   SAMIINHYKMRGNILSYNLGGMGCSAGIIAVDLARDILQSNPGNYAVVVSTEMVGFNWYQ  296

Query  938   GNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDV  1117
             G  RSMLIPNCFFR GCSAVLLSNRRRD+  AKYRL+HIVRTH+GA DR+FR +YQEED 
Sbjct  297   GKERSMLIPNCFFRMGCSAVLLSNRRRDFGRAKYRLEHIVRTHKGADDRSFRCVYQEEDD  356

Query  1118  ERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFG---------  1270
             ++ KG+KISKDL+E+GGEALK NITTLGPLVLP +EQL FF TL+ R  FG         
Sbjct  357   QKFKGIKISKDLIEIGGEALKTNITTLGPLVLPFSEQLIFFATLVWRNWFGGGKSDKNSP  416

Query  1271  AKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             +  KPYIP+Y +AFEHFC++AASK +LDEL++NL LS++NMEASR TLHRFGNT
Sbjct  417   SSNKPYIPNYKLAFEHFCVHAASKTILDELQKNLELSDKNMEASRMTLHRFGNT  470



>emb|CDY11498.1| BnaA09g40640D [Brassica napus]
Length=548

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/487 (63%), Positives = 383/487 (79%), Gaps = 31/487 (6%)
 Frame = +2

Query  44    AKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNW  223
             +  E  LLSTEI+NRGIEPSGP+AG+ TFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+ 
Sbjct  3     SSNEQDLLSTEIVNRGIEPSGPNAGSPTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINHA  62

Query  224   LCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFM  403
             + LA T+P+L +VFG EVGS+ R E++W K+W+     D   V +   G+   T+ +YFM
Sbjct  63    VYLA-TIPVLVLVFGAEVGSLSR-EEIWNKLWDY----DIATV-IGFFGVFVLTVCVYFM  115

Query  404   SKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYI  583
             S+P  +YL+DFAC KPSD+LKVT+++FID+ARKSG FDE+ L + KR+L++SG+GDETY+
Sbjct  116   SRPRSVYLIDFACYKPSDELKVTREEFIDLARKSGKFDEETLGFKKRILQASGLGDETYV  175

Query  584   PKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSA  763
             P+SI   + I  +   R EAS +IF A+D++ EKTR++ +D+G+LVVNC+ FNPTPSLSA
Sbjct  176   PRSISSSDNITTMKEGREEASMVIFGALDELFEKTRVKPKDVGVLVVNCSIFNPTPSLSA  235

Query  764   MIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILR-ANPNRYALVVSTEIVSATWYSG  940
             M+INHYKM+ NI+S NLGGMGCSAGIIALDLARD+L+ +NPN YA+VVSTE+V   WY G
Sbjct  236   MVINHYKMRGNILSYNLGGMGCSAGIIALDLARDMLQSSNPNSYAVVVSTEMVGYNWYVG  295

Query  941   NHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVE  1120
               +SM+IPNCFFR GCSAV+LSNRRRD+RHAKYRL+HIVRTH+ A DR+FRS+YQEED +
Sbjct  296   RDKSMVIPNCFFRMGCSAVMLSNRRRDFRHAKYRLEHIVRTHKAADDRSFRSVYQEEDEQ  355

Query  1121  RIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRR--------------  1258
               KGLKIS+DL+EVGGEALK NITTLGPLVLP +EQL FF  L+RR              
Sbjct  356   GFKGLKISRDLMEVGGEALKTNITTLGPLVLPFSEQLLFFAALLRRTFSPAAKTVTSSST  415

Query  1259  --KLFGAK-------TKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRAT  1411
               K  GAK       +KPYIPDY +AFEHFC +AASK +LDEL++NL LSE+NMEASR T
Sbjct  416   TAKTNGAKSSSSSDLSKPYIPDYKLAFEHFCFHAASKAVLDELQKNLGLSEENMEASRMT  475

Query  1412  LHRFGNT  1432
             L RFGNT
Sbjct  476   LQRFGNT  482



>ref|XP_010937298.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Elaeis guineensis]
Length=527

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/463 (65%), Positives = 383/463 (83%), Gaps = 7/463 (2%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             EH LLSTEI+NRGIE +GPDAG+ TFSVRVRRRLPDF+QSV LKYVKLGY+Y+I++ + L
Sbjct  4     EHILLSTEIVNRGIEATGPDAGSPTFSVRVRRRLPDFLQSVNLKYVKLGYHYLISHGIYL  63

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L V+F  EVGS+ R E++W K+ + +   D   V ++  G+L FT+S+YFMS+P
Sbjct  64    A-TIPVLVVLFSAEVGSLSR-EELWQKVRDETS-YDLATV-LAFFGVLVFTVSVYFMSRP  119

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
              PIYL+DFAC +PSDDLKV++++F+++ARKSG FDE++L +  R+L++SGIGD+TY+PKS
Sbjct  120   RPIYLIDFACYRPSDDLKVSREEFMELARKSGKFDEESLAFQSRILKTSGIGDDTYVPKS  179

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             I  P K   +   R EAS ++F A+D++ EK  +R +++GILVVNC+ FNPTPSLSAMI+
Sbjct  180   IFSPGKCATMKEGRAEASMVMFGALDELFEKCGVRPKEVGILVVNCSLFNPTPSLSAMIV  239

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGMGCSAGIIALDLARD+L++NPN YA+VVSTE VS  WY+G +RS
Sbjct  240   NHYKMRGNILSYNLGGMGCSAGIIALDLARDMLQSNPNNYAVVVSTEAVSFAWYTGRNRS  299

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             MLIPNCFFR GCSAVLLSNRRRD+R AKYRL+HIVRTH+GA DR+FR +YQEED +RIKG
Sbjct  300   MLIPNCFFRMGCSAVLLSNRRRDFRRAKYRLEHIVRTHRGADDRSFRCVYQEEDEQRIKG  359

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLI---RRKLFGAKTKPYIPDYT  1303
             L +S+DL+EVGG ALK NITTLGPLVLP +EQL FF  L+   R     A +KPYIPDY 
Sbjct  360   LSLSRDLMEVGGHALKTNITTLGPLVLPFSEQLLFFAALLFRCRSSNSAAASKPYIPDYK  419

Query  1304  IAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             +AFEHFC++AASK++LDEL+RNL L +++MEASRA LHRFGNT
Sbjct  420   LAFEHFCMHAASKVVLDELQRNLELGDRHMEASRAVLHRFGNT  462



>dbj|BAJ34066.1| unnamed protein product [Thellungiella halophila]
Length=547

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/483 (63%), Positives = 380/483 (79%), Gaps = 30/483 (6%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+N GIEPSGP+AG+ TFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+ + L
Sbjct  6     EQDLLSTEIVNCGIEPSGPNAGSPTFSVRVRRRLPDFLQSVSLKYVKLGYHYLINHAVYL  65

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L +VF  EVGS+ R E++W K+W+     D   V +   G+   T+ +YFMS+P
Sbjct  66    A-TIPVLVLVFSAEVGSLSR-EEIWRKLWDY----DLATV-IGFFGVFVLTICVYFMSRP  118

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               +YL+DFAC KPSD+LKVTK++FID+ARKSG FDE+ L + KR+LE+SG+GDETY+P+S
Sbjct  119   RSVYLIDFACYKPSDELKVTKEEFIDLARKSGKFDEETLGFKKRILEASGVGDETYVPRS  178

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             I   E I  +   R EAS +IF A+D++ EKTR++ +D+G+LVVNC+ FNPTPSLSAM+I
Sbjct  179   ISSSENITTMKEGREEASMVIFGALDELFEKTRVKPKDVGVLVVNCSIFNPTPSLSAMVI  238

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHY+M+ NI+S NLGGMGCSAGIIA+DLARD+L++NPN YA+VVSTE+V   WY G  +S
Sbjct  239   NHYRMRGNILSYNLGGMGCSAGIIAVDLARDMLQSNPNSYAVVVSTEMVGYNWYVGRDKS  298

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             M+IPNCFFR GCSAV+LSNRRRD+RHAKYRL+HIVRTH+ A DR+FRS+YQEED +  KG
Sbjct  299   MVIPNCFFRMGCSAVMLSNRRRDFRHAKYRLEHIVRTHKAADDRSFRSVYQEEDEQGFKG  358

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLF---------------  1267
             LKIS+DL+EVGGEALK NITTLGPLVLP +EQL FF  L+RR                  
Sbjct  359   LKISRDLMEVGGEALKTNITTLGPLVLPFSEQLLFFAALLRRTFSPAAKTTTSSSSATAK  418

Query  1268  --GAK------TKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRF  1423
               GAK      +KPYIPDY +AFEHFC +AASK +L+EL++NL LSE+NMEASR TLHRF
Sbjct  419   TNGAKSSSSDISKPYIPDYKLAFEHFCFHAASKTVLEELQKNLGLSEENMEASRMTLHRF  478

Query  1424  GNT  1432
             GNT
Sbjct  479   GNT  481



>emb|CDX76724.1| BnaC08g33100D [Brassica napus]
Length=547

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/486 (63%), Positives = 380/486 (78%), Gaps = 30/486 (6%)
 Frame = +2

Query  44    AKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNW  223
             +  E  LLSTEI+NRGIEPSGP+AG+ TFSVRVRRRLPDF+QSV LKY KLGY+Y+IN+ 
Sbjct  3     SSNEQDLLSTEIVNRGIEPSGPNAGSPTFSVRVRRRLPDFLQSVNLKYEKLGYHYLINHA  62

Query  224   LCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFM  403
             + LA T+P+L +VFG EVGS+ R E +W K+W+ +     G  ++ +L     T+ +YFM
Sbjct  63    VYLA-TIPVLVLVFGAEVGSLSRDE-IWKKLWDYNIATVVGFFSVFVL-----TVCVYFM  115

Query  404   SKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYI  583
             S+P  +YL+DFAC KPSD+LKVT+++FID+ARKSG FDE+ L + KR+L++SGIGDETY+
Sbjct  116   SRPRSVYLIDFACYKPSDELKVTREEFIDLARKSGKFDEETLGFKKRILQASGIGDETYV  175

Query  584   PKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSA  763
             P+SI   E I  +   R EAS +IF A+D++ EKTR++ +D+G+LVVNC+ FNPTPSLSA
Sbjct  176   PRSISSSENITTMKEGREEASMVIFGALDELFEKTRVKPKDVGVLVVNCSIFNPTPSLSA  235

Query  764   MIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGN  943
             M+INHYKM+ NI+S NLGGMGCSAGIIALDLARD+L++NPN YA+VVSTE+V   WY G 
Sbjct  236   MVINHYKMRGNIISYNLGGMGCSAGIIALDLARDMLQSNPNSYAVVVSTEMVGYNWYVGR  295

Query  944   HRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVER  1123
              +S +IPNCFFR GCSAV+LSNRRRD+RHAKYRL+HIVRTH+ A DR+FRS+YQEED + 
Sbjct  296   DKSRVIPNCFFRMGCSAVMLSNRRRDFRHAKYRLEHIVRTHKAADDRSFRSVYQEEDEQG  355

Query  1124  IKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLF------------  1267
              KGLKIS+DL+EVGGEALK NITTLGPLVLP +EQL FF  L+RR               
Sbjct  356   YKGLKISRDLMEVGGEALKTNITTLGPLVLPFSEQLLFFAALLRRTFSPAAKTVTSSSTT  415

Query  1268  ----GAKT-------KPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATL  1414
                 GAK+       KPYIPDY +AFEHFC +AASK +LDEL++NL LSE+NMEASR TL
Sbjct  416   SKTNGAKSSSSSDLFKPYIPDYKLAFEHFCFHAASKAVLDELQKNLGLSEENMEASRMTL  475

Query  1415  HRFGNT  1432
              RFGNT
Sbjct  476   QRFGNT  481



>ref|XP_010472653.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Camelina sativa]
Length=550

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/486 (63%), Positives = 381/486 (78%), Gaps = 33/486 (7%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+NRGIEPSGP+AG+ TFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+   L
Sbjct  6     EQDLLSTEIVNRGIEPSGPNAGSPTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINHAFYL  65

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L ++F  EVGS+ R E++W K+W+     D   V    +G+   T  +YFMS+P
Sbjct  66    A-TIPVLVLIFSAEVGSLSR-EEIWKKLWDY----DLATVT-GFIGVFVLTACVYFMSRP  118

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               +YL+DFAC KPSD+LKVTK++FI++ARKSG FDE+ L + KR+L++SGIGDETY+P+S
Sbjct  119   RSVYLIDFACYKPSDELKVTKEEFIELARKSGKFDEETLGFKKRILQASGIGDETYVPRS  178

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             I   E I  +   R EAS +IF A+D++ EKTR++ +D+G+LVVNC+ FNPTPSLSAM+I
Sbjct  179   ISSSENITTMKEGREEASTVIFGALDELFEKTRVKPKDVGVLVVNCSIFNPTPSLSAMVI  238

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGMGCSAGIIA+DLARD+L++NPN YA+VVSTE+V   WY G+ +S
Sbjct  239   NHYKMRGNILSYNLGGMGCSAGIIAVDLARDMLQSNPNSYAVVVSTEMVGYNWYVGSDKS  298

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             M+IPNCFFR GCSAV+LSNRRRD+RHAKYRL+HIVRTH+ A DR+FRS+YQEED +  KG
Sbjct  299   MVIPNCFFRMGCSAVMLSNRRRDFRHAKYRLEHIVRTHKAADDRSFRSVYQEEDEQGFKG  358

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRR------------------  1258
             LKIS+DL+EVGGEALK NITTLGPLVLP +EQL FF  L+RR                  
Sbjct  359   LKISRDLMEVGGEALKTNITTLGPLVLPFSEQLLFFAALLRRTFSPAAKTSTTTSFSSSV  418

Query  1259  --KLFGAK------TKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATL  1414
               K  G K      +KPYIPDY +AFEHFC +AASK++L+EL++NL LSE+NMEASR TL
Sbjct  419   TAKTNGTKSSSSDVSKPYIPDYKLAFEHFCFHAASKVVLEELQKNLGLSEENMEASRMTL  478

Query  1415  HRFGNT  1432
             HRFGNT
Sbjct  479   HRFGNT  484



>ref|XP_006408789.1| hypothetical protein EUTSA_v10001951mg [Eutrema salsugineum]
 gb|ESQ50242.1| hypothetical protein EUTSA_v10001951mg [Eutrema salsugineum]
Length=547

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/483 (63%), Positives = 380/483 (79%), Gaps = 30/483 (6%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+N GIEPSGP+AG+ TFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+ + L
Sbjct  6     EQDLLSTEIVNCGIEPSGPNAGSPTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINHAVYL  65

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L +VF  EVGS+ R E++W K+W+     D   V +   G+   T+ +YFMS+P
Sbjct  66    A-TIPVLVLVFSAEVGSLSR-EEIWRKLWDY----DLATV-IGFFGVFVLTICVYFMSRP  118

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               +YL+DFAC KPSD+LKVTK++FID+ARKSG FDE+ L + KR+LE+SG+GDETY+P+S
Sbjct  119   RSVYLIDFACYKPSDELKVTKEEFIDLARKSGKFDEETLGFKKRILEASGVGDETYVPRS  178

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             I   E I  +   R EAS +IF A+D++ EKTR++ +D+G+LVVNC+ FNPTPSLSAM+I
Sbjct  179   ISSSENITTMKEGREEASMVIFGALDELFEKTRVKPKDVGVLVVNCSIFNPTPSLSAMVI  238

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHY+M+ NI+S NLGGMGCSAGIIA+DLARD+L++NPN YA+VVSTE+V   WY G  +S
Sbjct  239   NHYRMRGNILSYNLGGMGCSAGIIAVDLARDMLQSNPNSYAVVVSTEMVGYNWYVGRDKS  298

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             M+IPNCFFR GCSAV+LSNRRRD+RHAKYRL+HIVRTH+ A DR+FRS+YQEED +  KG
Sbjct  299   MVIPNCFFRMGCSAVMLSNRRRDFRHAKYRLEHIVRTHKAADDRSFRSVYQEEDEQGFKG  358

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLF---------------  1267
             LKIS+DL+EVGGEALK NITTLGPLVLP +EQL FF  L+RR                  
Sbjct  359   LKISRDLMEVGGEALKTNITTLGPLVLPFSEQLLFFAALLRRTFSPAAKTTTSSSSATAK  418

Query  1268  --GAK------TKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRF  1423
               GAK      +KPYIPDY +AFEHFC +AASK +L+EL++NL LSE+NMEASR TLHRF
Sbjct  419   TNGAKSSSSDISKPYIPDYKLAFEHFCFHAASKTVLEELQKNLGLSEENMEASRMTLHRF  478

Query  1424  GNT  1432
             GNT
Sbjct  479   GNT  481



>emb|CDY35309.1| BnaA04g15380D [Brassica napus]
Length=549

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/485 (63%), Positives = 383/485 (79%), Gaps = 32/485 (7%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+NRGIEPSGP+AG+ TFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+ + L
Sbjct  6     EQDLLSTEIVNRGIEPSGPNAGSPTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINHAVYL  65

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L +VF  EVGS+ R E++W K+W+     D   V +   G+   T+ +YFMS+P
Sbjct  66    A-TIPVLVLVFSAEVGSLSR-EEIWKKLWDY----DLATV-IGFFGVFVLTVCVYFMSRP  118

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               +YL+DFAC KPSD+LKVT+++FID+ARKSG FDE+ L + KR+L++SGIGDETY+P+S
Sbjct  119   RSVYLIDFACFKPSDELKVTREEFIDLARKSGKFDEEILGFKKRILQASGIGDETYVPRS  178

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             I   E I  +   R EAS +IF A+D++ EKTR++ +D+G+LVVNC+ FNPTPSLSAM+I
Sbjct  179   ISSSENITTMKEGREEASMMIFGALDELFEKTRVKPKDVGVLVVNCSIFNPTPSLSAMVI  238

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGMGCSAGIIA+DLARD+L++NPN YA+VVSTE+V   WY G  +S
Sbjct  239   NHYKMRGNILSYNLGGMGCSAGIIAIDLARDMLQSNPNSYAVVVSTEMVGYNWYVGRDKS  298

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             M+IPNCFFR GCSAV+LSNRRRD+RHAKYRL+HIVRTH+ A DR+FRS+YQEED +  KG
Sbjct  299   MVIPNCFFRMGCSAVMLSNRRRDFRHAKYRLEHIVRTHKAADDRSFRSVYQEEDEQGFKG  358

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRR------------------  1258
             LKIS+DL+EVGGEALK NITTLGPLVLP +EQL FF  LIRR                  
Sbjct  359   LKISRDLMEVGGEALKTNITTLGPLVLPFSEQLLFFAALIRRTFSPAAKTTTTTSSSATA  418

Query  1259  KLFGAK-------TKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLH  1417
             K+ GAK       +KPYIPDY +AFEHFC +AASK +L+EL++NL LS++NMEAS+ TLH
Sbjct  419   KINGAKSSSSSDLSKPYIPDYKLAFEHFCFHAASKAVLEELQKNLGLSDENMEASKMTLH  478

Query  1418  RFGNT  1432
             RFGNT
Sbjct  479   RFGNT  483



>ref|XP_002880771.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57030.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=550

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/486 (63%), Positives = 380/486 (78%), Gaps = 33/486 (7%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+NRGIEPSGP+AG+ TFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+ + L
Sbjct  6     EQDLLSTEIVNRGIEPSGPNAGSPTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINHAVYL  65

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L +VF  EVGS+ R E++W K+W+     D   V +   G+   T  +YFMS+P
Sbjct  66    A-TIPVLVLVFSAEVGSLSR-EEIWKKLWDY----DLATV-IGFFGVFVLTACVYFMSRP  118

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               +YL+DFAC KPSD+LKVTK++FI++ARKSG FDE+ L + KR+L++SGIGDETY+P+S
Sbjct  119   RSVYLIDFACYKPSDELKVTKEEFIELARKSGKFDEETLGFKKRILQASGIGDETYVPRS  178

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             I   E I  +   R EAS +IF A+D++ EKTR++ +D+G+LVVNC+ FNPTPSLSAM+I
Sbjct  179   ISSSENITTMKEGREEASTVIFGALDELFEKTRVKPKDVGVLVVNCSIFNPTPSLSAMVI  238

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGMGCSAGIIA+DLARD+L++NPN YA+VVSTE+V   WY G  +S
Sbjct  239   NHYKMRGNILSYNLGGMGCSAGIIAVDLARDMLQSNPNSYAVVVSTEMVGYNWYVGRDKS  298

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             M+IPNCFFR GCSAV+LSNRRRD+RHAKYRL+HIVRTH+ A DR+FRS+YQEED +  KG
Sbjct  299   MVIPNCFFRMGCSAVMLSNRRRDFRHAKYRLEHIVRTHKAADDRSFRSVYQEEDEQGFKG  358

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRR------------------  1258
             LKIS+DL EVGGEALK NITTLGPLVLP +EQL FF  L+RR                  
Sbjct  359   LKISRDLTEVGGEALKTNITTLGPLVLPFSEQLLFFAALLRRTFSPATKTSTTTSFSTSA  418

Query  1259  --KLFGAK------TKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATL  1414
               K  G K      +KPYIPDY +AFEHFC +AASK++L+EL++NL LSE+NMEASR TL
Sbjct  419   TAKTNGIKSSSSDLSKPYIPDYKLAFEHFCFHAASKVVLEELQKNLGLSEENMEASRMTL  478

Query  1415  HRFGNT  1432
             HRFGNT
Sbjct  479   HRFGNT  484



>ref|XP_009140735.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA synthase 10-like 
[Brassica rapa]
Length=549

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/485 (63%), Positives = 383/485 (79%), Gaps = 32/485 (7%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+NRGIEPSGP+AG+ TFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+ + L
Sbjct  6     EQDLLSTEIVNRGIEPSGPNAGSPTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINHAVYL  65

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L +VF  EVGS+ R E++W K+W+     D   V +   G+   T+ +YFMS+P
Sbjct  66    A-TIPVLVLVFSAEVGSLSR-EEIWKKLWDY----DLATV-IGFFGVFVLTVCVYFMSRP  118

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               +YL+DFAC KPSD+LKVT+++FID+ARKSG F+E+ L + KR+L++SGIGDETY+P+S
Sbjct  119   RSVYLIDFACFKPSDELKVTREEFIDLARKSGKFEEEILXFKKRILQASGIGDETYVPRS  178

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             I   E I  +   R EAS +IF A+D++ EKTR++ +D+G+LVVNC+ FNPTPSLSAM+I
Sbjct  179   ISSSENITTMKEGREEASMMIFGALDELFEKTRVKPKDVGVLVVNCSIFNPTPSLSAMVI  238

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGMGCSAGIIA+DLARD+L++NPN YA+VVSTE+V   WY G  +S
Sbjct  239   NHYKMRGNILSYNLGGMGCSAGIIAVDLARDMLQSNPNSYAVVVSTEMVGYNWYVGRDKS  298

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             M+IPNCFFR GCSAV+LSNRRRD+RHAKYRL+HIVRTH+ A DR+FRS+YQEED +  KG
Sbjct  299   MVIPNCFFRMGCSAVMLSNRRRDFRHAKYRLEHIVRTHKAADDRSFRSVYQEEDEQGFKG  358

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRR------------------  1258
             LKIS+DL+EVGGEALK NITTLGPLVLP +EQL FF  LIRR                  
Sbjct  359   LKISRDLMEVGGEALKTNITTLGPLVLPFSEQLLFFAALIRRTFSPAAKTTTTTSSSATA  418

Query  1259  KLFGAK-------TKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLH  1417
             K+ GAK       +KPYIPDY +AFEHFC +AASK +L+EL++NL LS++NMEAS+ TLH
Sbjct  419   KINGAKSSSSSDLSKPYIPDYKLAFEHFCFHAASKAVLEELQKNLGLSDENMEASKMTLH  478

Query  1418  RFGNT  1432
             RFGNT
Sbjct  479   RFGNT  483



>ref|XP_010429645.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Camelina sativa]
Length=550

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/486 (62%), Positives = 380/486 (78%), Gaps = 33/486 (7%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+NRGIEPSGP+AG+ TFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+ + L
Sbjct  6     EQDLLSTEIVNRGIEPSGPNAGSPTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINHAVYL  65

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L +VF  EVGS+ R E +W K+W+     D   V +  +G+   T  +YFMS+P
Sbjct  66    A-TIPVLVLVFSAEVGSLSRKE-IWNKLWDY----DLATV-IGFIGVFVLTACVYFMSRP  118

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               +YL+DFAC KPSD+LKVTK++FI++ARKSG FDE+ L + KR+L++SGIGDETY+P+S
Sbjct  119   RSVYLIDFACYKPSDELKVTKEEFIELARKSGKFDEETLGFKKRILQASGIGDETYVPRS  178

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             I   E I  +   R EAS +IF A+D++ EKTR++ +D+G+LVVNC+ FNPTPSLSAM+I
Sbjct  179   ISSSENITTMKEGREEASTVIFGALDELFEKTRVKPKDVGVLVVNCSIFNPTPSLSAMVI  238

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGMGCSAGII +DLARD+L++NPN YA+VVSTE+V   WY G+ +S
Sbjct  239   NHYKMRGNILSYNLGGMGCSAGIIGVDLARDMLQSNPNSYAVVVSTEMVGYNWYVGSDKS  298

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             M+IPNCFFR GCSAV+LSNRRRD+RHAKYRL+HIVRTH+ A DR+FRS+YQEED +  KG
Sbjct  299   MVIPNCFFRMGCSAVMLSNRRRDFRHAKYRLEHIVRTHKAADDRSFRSVYQEEDEQGFKG  358

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLF---------------  1267
             LKIS+DL+EVGGEALK NITTLGPLVLP +EQL FF  L+RR                  
Sbjct  359   LKISRDLMEVGGEALKTNITTLGPLVLPFSEQLLFFAALLRRTFSPAAKTSTTTSSSSSV  418

Query  1268  -----GAK------TKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATL  1414
                  G K      +KPYIPDY +AFEHFC +AASK++L+EL++NL LSE+NMEASR TL
Sbjct  419   TAKTNGTKSSSSDISKPYIPDYKLAFEHFCFHAASKVVLEELQKNLGLSEENMEASRMTL  478

Query  1415  HRFGNT  1432
             HRFGNT
Sbjct  479   HRFGNT  484



>ref|NP_180193.1| 3-ketoacyl-CoA synthase 10 [Arabidopsis thaliana]
 sp|Q570B4.2|KCS10_ARATH RecName: Full=3-ketoacyl-CoA synthase 10; Short=KCS-10; AltName: 
Full=Protein FIDDLEHEAD; AltName: Full=Very long-chain fatty 
acid condensing enzyme 10; Short=VLCFA condensing enzyme 
10 [Arabidopsis thaliana]
 gb|AAF73973.1|AF214490_1 fiddlehead protein [Arabidopsis thaliana]
 gb|AAG60062.1|AF337910_1 putative beta-ketoacyl-CoA synthase FIDDLEHEAD [Arabidopsis thaliana]
 gb|AAC14526.1| beta-ketoacyl-CoA synthase (FIDDLEHEAD) [Arabidopsis thaliana]
 emb|CAA09311.1| fiddlehead protein [Arabidopsis thaliana]
 gb|AAK62618.1| At2g26250/T1D16.11 [Arabidopsis thaliana]
 gb|AAN31115.1| At2g26250/T1D16.11 [Arabidopsis thaliana]
 gb|AAN86193.1| putative beta-ketoacyl-CoA synthase FIDDLEHEAD [Arabidopsis thaliana]
 gb|AEC07813.1| 3-ketoacyl-CoA synthase 10 [Arabidopsis thaliana]
Length=550

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/486 (62%), Positives = 379/486 (78%), Gaps = 33/486 (7%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+NRGIEPSGP+AG+ TFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+ + L
Sbjct  6     EQDLLSTEIVNRGIEPSGPNAGSPTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINHAVYL  65

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L +VF  EVGS+ R E++W K+W+     D   V +   G+   T  +YFMS+P
Sbjct  66    A-TIPVLVLVFSAEVGSLSR-EEIWKKLWDY----DLATV-IGFFGVFVLTACVYFMSRP  118

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               +YL+DFAC KPSD+ KVTK++FI++ARKSG FDE+ L + KR+L++SGIGDETY+P+S
Sbjct  119   RSVYLIDFACYKPSDEHKVTKEEFIELARKSGKFDEETLGFKKRILQASGIGDETYVPRS  178

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             I   E I  +   R EAS +IF A+D++ EKTR++ +D+G+LVVNC+ FNPTPSLSAM+I
Sbjct  179   ISSSENITTMKEGREEASTVIFGALDELFEKTRVKPKDVGVLVVNCSIFNPTPSLSAMVI  238

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGMGCSAGIIA+DLARD+L++NPN YA+VVSTE+V   WY G+ +S
Sbjct  239   NHYKMRGNILSYNLGGMGCSAGIIAIDLARDMLQSNPNSYAVVVSTEMVGYNWYVGSDKS  298

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             M+IPNCFFR GCSAV+LSNRRRD+RHAKYRL+HIVRTH+ A DR+FRS+YQEED +  KG
Sbjct  299   MVIPNCFFRMGCSAVMLSNRRRDFRHAKYRLEHIVRTHKAADDRSFRSVYQEEDEQGFKG  358

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAK------------  1276
             LKIS+DL+EVGGEALK NITTLGPLVLP +EQL FF  L+RR    A             
Sbjct  359   LKISRDLMEVGGEALKTNITTLGPLVLPFSEQLLFFAALLRRTFSPAAKTSTTTSFSTSA  418

Query  1277  --------------TKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATL  1414
                           +KPYIPDY +AFEHFC +AASK++L+EL++NL LSE+NMEASR TL
Sbjct  419   TAKTNGIKSSSSDLSKPYIPDYKLAFEHFCFHAASKVVLEELQKNLGLSEENMEASRMTL  478

Query  1415  HRFGNT  1432
             HRFGNT
Sbjct  479   HRFGNT  484



>gb|AAF73976.1|AF214496_1 fiddlehead protein [Arabidopsis thaliana]
Length=550

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/486 (62%), Positives = 379/486 (78%), Gaps = 33/486 (7%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+NRGIEPSGP+AG+ TFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+ + L
Sbjct  6     EQDLLSTEIVNRGIEPSGPNAGSPTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINHAVYL  65

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L +VF  EVGS+ R E++W K+W+     D   V +   G+   T  +YFMS+P
Sbjct  66    A-TIPVLVLVFSAEVGSLSR-EEIWKKLWDY----DLATV-IGFFGVFVLTACVYFMSRP  118

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               +YL+DFAC KPSD+ KVTK++FI++ARKSG FDE+ L + KR+L++SGIGDETY+P+S
Sbjct  119   RSVYLIDFACYKPSDEHKVTKEEFIELARKSGKFDEETLGFKKRILQASGIGDETYVPRS  178

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             I   E I  +   R EAS +IF A+D++ EKTR++ +D+G+LVVNC+ FNPTPSLSAM+I
Sbjct  179   ISSSENITTMKEGREEASTVIFGALDELFEKTRVKPKDVGVLVVNCSIFNPTPSLSAMVI  238

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGMGCSAGIIA+DLARD+L++NPN YA+VVSTE+V   WY G+ +S
Sbjct  239   NHYKMRGNILSYNLGGMGCSAGIIAIDLARDMLQSNPNSYAVVVSTEMVGYNWYVGSDKS  298

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             M+IPNCFFR GCSAV+LSNRRRD+RHAKYRL+HIVRTH+ A DR+FRS+YQEED +  KG
Sbjct  299   MVIPNCFFRMGCSAVMLSNRRRDFRHAKYRLEHIVRTHKAADDRSFRSVYQEEDEQGFKG  358

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAK------------  1276
             LKIS+DL+EVGGEALK NITTLGPLVLP +EQL FF  L+RR    A             
Sbjct  359   LKISRDLMEVGGEALKTNITTLGPLVLPFSEQLLFFAALLRRTFSPAAKTSTTTSFSTSA  418

Query  1277  --------------TKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATL  1414
                           +KPYIPDY +AFEHFC +AASK++L+EL++NL LSE+NMEASR TL
Sbjct  419   TAKTNGIKSSSSDLSKPYIPDYKLAFEHFCFHAASKVVLEELQKNLGLSEENMEASRMTL  478

Query  1415  HRFGNT  1432
             HRFGNT
Sbjct  479   HRFGNT  484



>gb|AAF73980.1|AF214504_1 fiddlehead protein [Arabidopsis thaliana]
Length=550

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/486 (62%), Positives = 379/486 (78%), Gaps = 33/486 (7%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+NRGIEPSGP+AG+ TFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+ + L
Sbjct  6     EQDLLSTEIVNRGIEPSGPNAGSPTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINHAVYL  65

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L +VF  EVGS+ R E++W K+W+     D   V +   G+   T  +YFMS+P
Sbjct  66    A-TIPVLVLVFSAEVGSLSR-EEIWKKLWDY----DLATV-IGFFGVFVLTACVYFMSRP  118

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               +YL+DFAC KPSD+ KVTK++FI++ARKSG FDE+ L + KR+L++SGIGDETY+P+S
Sbjct  119   RSVYLIDFACYKPSDEHKVTKEEFIELARKSGKFDEETLGFKKRILQASGIGDETYVPRS  178

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             I   E I  +   R EAS +IF A+D++ EKTR++ +D+G+LVVNC+ FNPTPSLSAM+I
Sbjct  179   ISSSENITTMKEGREEASTVIFGALDELFEKTRVKPKDVGVLVVNCSIFNPTPSLSAMVI  238

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGMGCSAGIIA+DLARD+L++NPN YA+VVSTE+V   WY G+ +S
Sbjct  239   NHYKMRGNILSYNLGGMGCSAGIIAIDLARDMLQSNPNSYAVVVSTEMVGYNWYVGSDKS  298

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             M+IPNCFFR GCSAV+LSNRRRD+RHAKYRL+HIVRTH+ A DR+FRS+YQEED +  KG
Sbjct  299   MVIPNCFFRMGCSAVMLSNRRRDFRHAKYRLEHIVRTHKAADDRSFRSVYQEEDEQGFKG  358

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAK------------  1276
             LKIS+DL+EVGGEALK NITTLGPLVLP +EQL FF  L+RR    A             
Sbjct  359   LKISRDLMEVGGEALKTNITTLGPLVLPFSEQLLFFAALLRRTFSPAAKTSTTTSFSTSA  418

Query  1277  --------------TKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATL  1414
                           +KPYIPDY +AFEHFC +AASK++L+EL++NL LSE+NMEASR TL
Sbjct  419   TAKTNGIKSSSSDLSKPYIPDYKLAFEHFCFHAASKVVLEELQKNLGLSEENMEASRMTL  478

Query  1415  HRFGNT  1432
             HRFGNT
Sbjct  479   HRFGNT  484



>gb|KFK32520.1| hypothetical protein AALP_AA6G253600 [Arabis alpina]
Length=547

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/483 (62%), Positives = 378/483 (78%), Gaps = 30/483 (6%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+NRGIEPSGP+AG+ TFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+ + L
Sbjct  6     EQDLLSTEIVNRGIEPSGPNAGSPTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINHAVYL  65

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L +VF  EVGS+ R E++W K+W+       G        +   T+ +YFMS+P
Sbjct  66    A-TIPVLVLVFSAEVGSLSR-EEIWKKLWDYDLATFIG-----FFAVFVLTVCVYFMSRP  118

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               +YL+DF+C KPSD+LKVT+++FID+ARKSG FDE+ L + KR+L++SGIGDETY+P+S
Sbjct  119   RSVYLIDFSCFKPSDELKVTREEFIDLARKSGKFDEETLSFKKRILQASGIGDETYVPRS  178

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             I   E I  +   R EAS++IF A+D++ EKTR++ +D+G+LVVNC+ FNPTPSLSAM+I
Sbjct  179   ISSSENITTMKEGREEASRVIFGALDELFEKTRVKPKDVGVLVVNCSIFNPTPSLSAMVI  238

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGMGCSAGIIA+DLARD+L++NPN YA+VVSTE+V   WY G  +S
Sbjct  239   NHYKMRGNILSYNLGGMGCSAGIIAVDLARDMLQSNPNSYAVVVSTEMVGYNWYVGRDKS  298

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             M+IPNCFFR G SAV+LSNRRRD+RHAKYRL+HIVRTH+ A DR+FRS+YQEED +  KG
Sbjct  299   MVIPNCFFRMGSSAVMLSNRRRDFRHAKYRLEHIVRTHKAADDRSFRSVYQEEDEQGFKG  358

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRR-----------------K  1261
             LKISKDL+EVGGEALK NITTLGPLVLP +EQ+ FF  L+RR                 K
Sbjct  359   LKISKDLMEVGGEALKTNITTLGPLVLPFSEQILFFAALLRRTFSPAVKSTTTNGHATAK  418

Query  1262  LFGAK------TKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRF  1423
               G K      +KPYIPDY +AFEHFC +AASK +L+EL++NL LSE+NMEASR TLHRF
Sbjct  419   TNGIKSSSSDLSKPYIPDYKLAFEHFCFHAASKTVLEELQKNLGLSEENMEASRMTLHRF  478

Query  1424  GNT  1432
             GNT
Sbjct  479   GNT  481



>ref|XP_006452943.1| hypothetical protein CICLE_v10007953mg [Citrus clementina]
 gb|ESR66183.1| hypothetical protein CICLE_v10007953mg [Citrus clementina]
Length=537

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/476 (63%), Positives = 381/476 (80%), Gaps = 16/476 (3%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             MA+ E  LLSTEI+NRGIE SGP+AG+LTFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+
Sbjct  1     MARSERDLLSTEIVNRGIESSGPNAGSLTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINH  60

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYF  400
              + LA T+P+L +VF  EVGS+ R E++W K+WE++   D   V +   G+  FTLS+YF
Sbjct  61    AIYLA-TIPVLLLVFSAEVGSLSR-EELWEKLWEDTRH-DLASV-LGFFGVFVFTLSVYF  116

Query  401   MSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETY  580
             MS+P  +YLVDFAC +P DDLKVT++QFI++A K    DE +L++ +R+++SSGIGDETY
Sbjct  117   MSRPRSVYLVDFACYRPPDDLKVTREQFIEVAGKWSKSDEASLDFQRRIMKSSGIGDETY  176

Query  581   IPKSI-GCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSL  757
             IPK +    E    + + R EAS ++F A+D++ +KT++R +D+GILVVNC+ FNPTPSL
Sbjct  177   IPKVVMSAEENCMTMKHGRLEASMVMFGALDELFKKTKVRPKDVGILVVNCSIFNPTPSL  236

Query  758   SAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYS  937
             SAMIINHYKM+ NI+S NLGGMGCSAG+I +DLARD+L+AN N YA+VVSTE+V   WY+
Sbjct  237   SAMIINHYKMRGNIISYNLGGMGCSAGVIGVDLARDMLQANHNNYAVVVSTEMVGYNWYA  296

Query  938   GNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDV  1117
             G  RSM+IPNCFFR GCSA+L+SNRRRDY  AKYRLQ IVRTH GA DR+FRS+YQEED 
Sbjct  297   GRDRSMMIPNCFFRMGCSAILMSNRRRDYHRAKYRLQLIVRTHTGADDRSFRSVYQEEDE  356

Query  1118  ERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFG---------  1270
             +  +GLK+SK+++E+GG+ALK NITTLGPLVLP +EQL+FF TL+ R LF          
Sbjct  357   QGFRGLKVSKNIMEIGGDALKTNITTLGPLVLPFSEQLFFFATLVWRHLFSGSADKSRSS  416

Query  1271  --AKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
               A TKPYIPDY +AFEHFC++AASK +LDEL++NL LSE+NMEASR TLHRFGNT
Sbjct  417   SLASTKPYIPDYKLAFEHFCVHAASKTVLDELQKNLELSEKNMEASRMTLHRFGNT  472



>ref|XP_008782856.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Phoenix dactylifera]
Length=527

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/463 (66%), Positives = 380/463 (82%), Gaps = 7/463 (2%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             EH LLSTEI+NRG+E SGPDAG+ TFSVRVRRRLPDF+QSV LKYVKLGY+Y+I++ + L
Sbjct  4     EHILLSTEIVNRGVEASGPDAGSPTFSVRVRRRLPDFLQSVNLKYVKLGYHYLISHGIYL  63

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L VVF  EVGS+ R E++W K+WE +   D   V ++  G+L FT S+YFMS+P
Sbjct  64    A-TIPVLVVVFSAEVGSLSR-EELWKKVWEETSY-DLATV-LAFFGVLVFTASVYFMSRP  119

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
              PIYL+DFAC +PSDDLKV++++F+++ARKSG FDE++L +  R+L+SSGIGDET +P+S
Sbjct  120   RPIYLIDFACYRPSDDLKVSREEFVELARKSGKFDEESLAFQSRILKSSGIGDETCVPRS  179

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             I  P     +   R EAS ++F A+D++ EK R+R +++GILVVNC+ FNPTPSLSAMI+
Sbjct  180   IFSPGNCATMKEGRAEASMVMFGALDELFEKCRVRPKEVGILVVNCSLFNPTPSLSAMIV  239

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGMGCSAGIIALDLARD+L+ANPN YA+VVSTE VS  WY+G +RS
Sbjct  240   NHYKMRGNILSYNLGGMGCSAGIIALDLARDMLQANPNNYAVVVSTEAVSFAWYTGRNRS  299

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             MLIPNCFFR GCSAVLLSNRRRD+R AKYRL+HIVRTH+GA DR+FR + QEED  RIKG
Sbjct  300   MLIPNCFFRMGCSAVLLSNRRRDFRRAKYRLEHIVRTHKGADDRSFRCVCQEEDERRIKG  359

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTL---IRRKLFGAKTKPYIPDYT  1303
             L +S+DL+EVGG ALK NITTLGPLVLP +EQL FF  L    R     A +KPYIPDY 
Sbjct  360   LSLSRDLMEVGGHALKTNITTLGPLVLPFSEQLLFFAFLLFRCRSSNSAANSKPYIPDYK  419

Query  1304  IAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             +AFEHFC++AASK++LDEL+RNL LS+++MEASRA LHRFGNT
Sbjct  420   LAFEHFCMHAASKVVLDELQRNLELSDRHMEASRAVLHRFGNT  462



>ref|XP_010527059.1| PREDICTED: 3-ketoacyl-CoA synthase 10 [Tarenaya hassleriana]
Length=542

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/478 (63%), Positives = 375/478 (78%), Gaps = 25/478 (5%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+NRGIEPSGP+AG+ TFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+ + L
Sbjct  6     EQDLLSTEIVNRGIEPSGPNAGSPTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINHAVYL  65

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L +VF  EVGS+ R E++W K+W+     D   V +   G+   T+ +YF+S+P
Sbjct  66    A-TIPVLVLVFSAEVGSLSR-EELWKKLWDY----DLATV-IGFFGVFVLTVCVYFLSRP  118

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               +YL+DFAC KP D+LKVTK++F+++ARKS  FDE+ L ++ R+L+SSGIGDETY+PKS
Sbjct  119   RSVYLIDFACYKPPDELKVTKEEFVELARKSTKFDEETLSFMSRILKSSGIGDETYVPKS  178

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             I  PE I  +   R EAS +IF A+D++ EKTR++ +DIG+LVVNC+ FNPTPSLSAM+I
Sbjct  179   ISLPENISTMKEGRLEASTVIFGALDELFEKTRVKPKDIGVLVVNCSIFNPTPSLSAMVI  238

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGMGCSAGIIA+DLARD+L++ PN +ALVVSTE+V   WY+G  RS
Sbjct  239   NHYKMRGNILSYNLGGMGCSAGIIAVDLARDMLQSCPNSHALVVSTEMVGYNWYAGKDRS  298

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             MLIPNCFFR GCSAVLLSNRRRD+R AKYRL+HIVRTH+GA DR+FRS+YQEED +  KG
Sbjct  299   MLIPNCFFRMGCSAVLLSNRRRDFRRAKYRLEHIVRTHKGADDRSFRSVYQEEDEQGFKG  358

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKT-----------  1279
             LKISKDL+EVGGEALK NITTL PLVLP +EQL FF  L+RRK     T           
Sbjct  359   LKISKDLMEVGGEALKTNITTLSPLVLPFSEQLLFFAALLRRKTLSPATETASSVLAKSS  418

Query  1280  -------KPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
                    KPYIPDY +AFEHFC +AAS+ +L+EL++NL LS  NMEASR TLHRFGNT
Sbjct  419   SSASSANKPYIPDYKLAFEHFCFHAASRTVLNELEKNLGLSGDNMEASRMTLHRFGNT  476



>gb|AAF73979.1|AF214502_1 fiddlehead protein [Arabidopsis thaliana]
Length=550

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/486 (62%), Positives = 378/486 (78%), Gaps = 33/486 (7%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+NRGIEPSGP+AG+ TFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+ + L
Sbjct  6     EQDLLSTEIVNRGIEPSGPNAGSPTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINHAVYL  65

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L +VF  EVGS+ R E++W K+W+     D   V +   G+   T  +YFMS+P
Sbjct  66    A-TIPVLVLVFSAEVGSLSR-EEIWKKLWDY----DLATV-IGFFGVFVLTACVYFMSRP  118

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               +YL+DFAC KPSD+ KVTK++FI++ARKSG FDE+ L + KR+L++SGIGDETY+P+S
Sbjct  119   RSVYLIDFACYKPSDEHKVTKEEFIELARKSGKFDEETLGFKKRILQASGIGDETYVPRS  178

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             I   E I  +   R EAS +IF A+D++ EKTR++ +D+G+LVVNC+ FNPTPSLSAM+I
Sbjct  179   ISSSENITTMKEGREEASTVIFGALDELFEKTRVKPKDVGVLVVNCSIFNPTPSLSAMVI  238

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGM CSAGIIA+DLARD+L++NPN YA+VVSTE+V   WY G+ +S
Sbjct  239   NHYKMRGNILSYNLGGMRCSAGIIAIDLARDMLQSNPNSYAVVVSTEMVGYNWYVGSDKS  298

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             M+IPNCFFR GCSAV+LSNRRRD+RHAKYRL+HIVRTH+ A DR+FRS+YQEED +  KG
Sbjct  299   MVIPNCFFRMGCSAVMLSNRRRDFRHAKYRLEHIVRTHKAADDRSFRSVYQEEDEQGFKG  358

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAK------------  1276
             LKIS+DL+EVGGEALK NITTLGPLVLP +EQL FF  L+RR    A             
Sbjct  359   LKISRDLMEVGGEALKTNITTLGPLVLPFSEQLLFFAALLRRTFSPAAKTSTTTSFSTSA  418

Query  1277  --------------TKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATL  1414
                           +KPYIPDY +AFEHFC +AASK++L+EL++NL LSE+NMEASR TL
Sbjct  419   TAKTNGIKSSSSDLSKPYIPDYKLAFEHFCFHAASKVVLEELQKNLGLSEENMEASRMTL  478

Query  1415  HRFGNT  1432
             HRFGNT
Sbjct  479   HRFGNT  484



>ref|XP_006293899.1| hypothetical protein CARUB_v10022892mg, partial [Capsella rubella]
 gb|EOA26797.1| hypothetical protein CARUB_v10022892mg, partial [Capsella rubella]
Length=579

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/488 (62%), Positives = 377/488 (77%), Gaps = 35/488 (7%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+NRGIEPSGP+AG+ TFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+ + L
Sbjct  33    EQDLLSTEIVNRGIEPSGPNAGSPTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINHAVYL  92

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L +VF  EVGS+ R E +W K+ +     D   V +    +   T  +YFMS+P
Sbjct  93    A-TIPVLVLVFSAEVGSLSRDE-IWKKLLDY----DLATV-IGFFCVFVLTACVYFMSRP  145

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               +YL+DFAC KPSD+LKVTK++FI++ARKSG FDE+ L + KR+L++SGIGDETY+P+S
Sbjct  146   RSVYLIDFACYKPSDELKVTKEEFIELARKSGKFDEETLGFKKRILQASGIGDETYVPRS  205

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             I   E I  +   R EAS +IF A+D++ EKTR++ +D+G+LVVNC+ FNPTPSLSAM+I
Sbjct  206   ISSSENITTMKEGREEASTVIFGALDELFEKTRVKPKDVGVLVVNCSIFNPTPSLSAMVI  265

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGMGCSAGII LDLARD+L++NPN YA+VVSTE+V   WY G+ +S
Sbjct  266   NHYKMRGNILSYNLGGMGCSAGIIGLDLARDMLQSNPNSYAVVVSTEMVGYNWYVGHDKS  325

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             M+IPNCFFR GCSAV+LSNRRRD+RHAKYRL+HIVRTH+ A DR+FRS++QEED +  KG
Sbjct  326   MVIPNCFFRMGCSAVMLSNRRRDFRHAKYRLEHIVRTHKAADDRSFRSVHQEEDEQGFKG  385

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKL---------------F  1267
             LKIS+DL+EVGGEALK NITTLGPLVLP +EQL FF  L+RR                  
Sbjct  386   LKISRDLMEVGGEALKTNITTLGPLVLPFSEQLLFFAALLRRTFSPAAKTSTTTSFSSSL  445

Query  1268  GAKT-------------KPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRA  1408
              AKT             KPYIPDY +AFEHFC +AASK++L+EL++NL LSE+NMEASR 
Sbjct  446   NAKTNGTTTKSSSSDLSKPYIPDYKLAFEHFCFHAASKVVLEELQKNLGLSEENMEASRM  505

Query  1409  TLHRFGNT  1432
             TLHRFGNT
Sbjct  506   TLHRFGNT  513



>ref|XP_004501406.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Cicer arietinum]
Length=538

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/475 (65%), Positives = 380/475 (80%), Gaps = 15/475 (3%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             MA  E  + S EI+NRGIE +GP+AG+LTFSVRVR+RLPDF+QSV LKYVKLGY+Y+IN+
Sbjct  1     MANNERDMFSAEIVNRGIESTGPNAGSLTFSVRVRKRLPDFLQSVNLKYVKLGYHYLINH  60

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYF  400
              + L  T+P+L VVF  EVGS+ R + +W K+WE++   D   V +S + LL FTL++YF
Sbjct  61    GVYLF-TIPILVVVFSAEVGSLSRKD-LWKKLWEDAT-YDLASV-LSSIALLLFTLTLYF  116

Query  401   MSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETY  580
             MS+P PIYL+DFAC +P  +LKV+++QFI++ARKSG FDE++L + KR++ SSGIGDETY
Sbjct  117   MSRPRPIYLIDFACYQPHHELKVSREQFIELARKSGKFDEESLNFQKRIVMSSGIGDETY  176

Query  581   IPKS-IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSL  757
             IPKS I   E    +   R EAS ++F A+D++ EKT IR +D+G+LVVNC+ FNPTPSL
Sbjct  177   IPKSLISSTENTATMKEGRAEASMVMFGALDELFEKTGIRPKDVGVLVVNCSIFNPTPSL  236

Query  758   SAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYS  937
             SAMIINHYKM+ NI+S NLGGMGCSAGII++DLARDIL+ANP  YA+VVSTE V   WY 
Sbjct  237   SAMIINHYKMRGNILSYNLGGMGCSAGIISVDLARDILQANPGNYAVVVSTEAVGFNWYQ  296

Query  938   GNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDV  1117
             G  RSMLIPNCFFR GCSAVLLSNRRRDY  AKYRL+HIVRTH+GA DR+FR +YQEED 
Sbjct  297   GKQRSMLIPNCFFRMGCSAVLLSNRRRDYTRAKYRLEHIVRTHKGADDRSFRCVYQEEDE  356

Query  1118  ERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAK-------  1276
             ++ KGLKISKDL+E+GGEALK NITTLGPLVLP +EQ+ FF TL+ R LFG K       
Sbjct  357   QKFKGLKISKDLIEIGGEALKTNITTLGPLVLPFSEQILFFTTLVWRHLFGGKKSDGNST  416

Query  1277  ---TKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
                 KPYIP+Y +AFEHFC++AASK +LDEL++NL LS++NMEASR TLHRFGNT
Sbjct  417   SSSKKPYIPNYKLAFEHFCVHAASKQILDELQKNLELSDKNMEASRMTLHRFGNT  471



>ref|XP_006843898.1| hypothetical protein AMTR_s00007p00267760 [Amborella trichopoda]
 gb|ERN05573.1| hypothetical protein AMTR_s00007p00267760 [Amborella trichopoda]
Length=529

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/464 (65%), Positives = 378/464 (81%), Gaps = 7/464 (2%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E   LSTEI+NRG+E SGPDAG+LTFSVRVRRRLPDF+ SV LKYVKLGY+Y+IN+ + L
Sbjct  4     EQAFLSTEIVNRGVEASGPDAGSLTFSVRVRRRLPDFLNSVNLKYVKLGYHYLINHAVYL  63

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             + T+P+L +VF  E+GS +R E +W K+WE     D   V ++ LG L FT+S+YFMS+P
Sbjct  64    S-TIPVLVLVFSAEIGS-LRREDLWSKVWEEPPRYDLATV-LAFLGALVFTVSVYFMSRP  120

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
              P+YLVDFAC +PSD+LKV+K++FI++ARKSG FDE +LE+  ++L+ SG+GDETY+PK+
Sbjct  121   RPVYLVDFACYRPSDELKVSKEEFIELARKSGKFDEASLEFQSKILKFSGLGDETYVPKA  180

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             IGCPE    +   R EAS ++F  +D++ +  R+R +D+GILVVNC+ FNPTPSLSAMI+
Sbjct  181   IGCPENTATMKEGRAEASTVMFGVLDELFQSCRVRPKDVGILVVNCSLFNPTPSLSAMIV  240

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGMGCSAGI ALDLA+D+L+ANPN  A+VVSTEIVS +WYSGN RS
Sbjct  241   NHYKMRGNILSFNLGGMGCSAGIAALDLAQDMLQANPNNLAVVVSTEIVSYSWYSGNKRS  300

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             ML+PNCFFR GC+ +LLSNRRRD R +KYRL+HIVRTH+GA DR+FR + QEED +R+KG
Sbjct  301   MLLPNCFFRMGCAGMLLSNRRRDSRRSKYRLEHIVRTHKGADDRSFRCVMQEEDDQRLKG  360

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLF----GAKTKPYIPDY  1300
             L +SKDLVEVGG ALKANITTLGPLVLP +EQL FF +L+   L     G  TKPYIPDY
Sbjct  361   LSVSKDLVEVGGHALKANITTLGPLVLPFSEQLLFFASLVWSYLTNKGKGKATKPYIPDY  420

Query  1301  TIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
              +AFEHFC+ A+SK +LDEL+RNL LS++NMEASR TLHRFGNT
Sbjct  421   KLAFEHFCMQASSKAILDELQRNLELSDRNMEASRMTLHRFGNT  464



>ref|XP_009390873.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Musa acuminata subsp. 
malaccensis]
Length=537

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/466 (65%), Positives = 377/466 (81%), Gaps = 10/466 (2%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             EH LLSTEI+NRG+E SGPDAG+ TFSVRVRRRLPDF+QSV LKYVKLGY+Y+I++    
Sbjct  10    EHTLLSTEIVNRGVEASGPDAGSPTFSVRVRRRLPDFLQSVNLKYVKLGYHYLISH-AVY  68

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
               TVP+L VVF  EVGS+ R E +W K+WE +   D   V ++  G+L FT+++YFMSKP
Sbjct  69    LVTVPVLVVVFSAEVGSLTR-EALWRKVWEETS-YDLATV-LAFFGVLAFTVAVYFMSKP  125

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
              PIYLVDFAC +PSDDLKV+ ++F+++ARKSG FDE++L +  R+L++SGIGDE+Y+P+S
Sbjct  126   RPIYLVDFACYRPSDDLKVSNEEFVELARKSGKFDEESLAFQSRILKNSGIGDESYVPRS  185

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             I  P     +   R EAS  +F A+D++ +K R+R +D+G+LVVNC+ FNPTPSLSAMI+
Sbjct  186   IFSPGNCATMKEGRAEASMAMFGALDELFQKCRVRPKDVGVLVVNCSLFNPTPSLSAMIV  245

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+  I+S NLGGMGCSAG++ALDLARD+L+ANP+ YA+VVSTE VS TWY+G++RS
Sbjct  246   NHYKMRGTILSYNLGGMGCSAGVVALDLARDMLQANPSSYAVVVSTEAVSFTWYAGSNRS  305

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             MLIPNCFFR GCSAVLLSNRRRD+R AKYRL+HIVRTH+GA +R+FR +YQEED +RIKG
Sbjct  306   MLIPNCFFRMGCSAVLLSNRRRDFRRAKYRLEHIVRTHKGADERSFRCVYQEEDQQRIKG  365

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLF------GAKTKPYIP  1294
             L IS+DL+EVGG ALK NITTLGPLVLP +EQL FF TL+ R  F         TKPYIP
Sbjct  366   LSISRDLMEVGGHALKVNITTLGPLVLPFSEQLLFFATLLYRYPFPKPTTTTTTTKPYIP  425

Query  1295  DYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             DY +AFEHFCI+AASK +LD L+ NL L +++MEASRA LHRFGNT
Sbjct  426   DYKLAFEHFCIHAASKAVLDALQTNLELEDRHMEASRAALHRFGNT  471



>gb|AAO47729.1| fiddlehead-like protein [Tropaeolum majus]
 gb|AAP14903.1| fiddlehead-like protein [Tropaeolum majus]
Length=538

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/477 (63%), Positives = 375/477 (79%), Gaps = 17/477 (4%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             MA  E  LLSTEI+NRGIE SGP+AG+LTFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+
Sbjct  1     MATNEQDLLSTEIVNRGIESSGPNAGSLTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINH  60

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYF  400
              + L  T+P+L ++F  EVG++ + E++W K+W  +   D   V    +  +  TL++YF
Sbjct  61    GIYLV-TIPILVLLFSAEVGTLTK-EEMWNKLWHETRY-DLVTVLAFFVVFVF-TLAVYF  116

Query  401   MSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETY  580
             MS+P  IYL+DFAC +  DDLKVTK +FI+ ARKSG FDE +L++ +R+LESSGIGDETY
Sbjct  117   MSRPRSIYLIDFACYRAHDDLKVTKAEFIEQARKSGKFDEASLDFQQRILESSGIGDETY  176

Query  581   IPKSIGCPE-KIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSL  757
             IPKS+   E     ++  R EA+ ++F+A+D++ EKT++R +D+G+LVVNC+ FNPTPSL
Sbjct  177   IPKSVMSTEVNSSTMSEGRLEATTVMFDALDELFEKTKVRPKDVGVLVVNCSIFNPTPSL  236

Query  758   SAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYS  937
             SAMIINHYKM+ NI+S NLGGMGCSAGII +DLARD+L ANPN YA+VVSTE+V   WY 
Sbjct  237   SAMIINHYKMRGNILSYNLGGMGCSAGIIGVDLARDMLEANPNNYAVVVSTEMVGYNWYP  296

Query  938   GNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDV  1117
             G  RSMLIPNC+FR GCSAVLLSNRR DYR AKY LQH+VRTH+GA DR+FR IYQEED 
Sbjct  297   GQDRSMLIPNCYFRMGCSAVLLSNRRGDYRRAKYSLQHLVRTHKGADDRSFRCIYQEEDE  356

Query  1118  ERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGA--------  1273
             E  KGLK+SK+L+E+GG+ALK NITTLGPLVLP +EQL FF TLI R L G         
Sbjct  357   EGYKGLKVSKELMEIGGDALKTNITTLGPLVLPFSEQLIFFATLIWRNLLGTDPNKNKTS  416

Query  1274  ----KTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
                  +KPYIPDY +AFEHFC++AASK++LDEL++NL LS+ NMEASR TLHRFGNT
Sbjct  417   KQSLSSKPYIPDYKLAFEHFCVHAASKIVLDELQKNLELSDDNMEASRMTLHRFGNT  473



>ref|XP_010692949.1| PREDICTED: 3-ketoacyl-CoA synthase 10 [Beta vulgaris subsp. vulgaris]
Length=547

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/492 (60%), Positives = 372/492 (76%), Gaps = 45/492 (9%)
 Frame = +2

Query  44    AKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLP--DFVQSvklkyvklgyyyvIN  217
              +EE  LLSTEI+NRG +         TFSVRVRRRLP  DFV SV LKYVKLGY+Y+IN
Sbjct  6     TREEQRLLSTEIVNRGTD---------TFSVRVRRRLPLPDFVNSVNLKYVKLGYHYLIN  56

Query  218   NWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIY  397
             + + LA T+P+L +VF  EVGS+ R E +W K+W+     D   + ++  G+  FTLS+Y
Sbjct  57    HAIYLA-TIPVLVLVFSAEVGSLSRQE-LWNKLWDY----DLATI-LASFGVFVFTLSVY  109

Query  398   FMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDET  577
             FMS+P PIYL+DFAC KPSD+LKV+K++FI++AR+SG FDE+ L++ +R+L+SSGIGDET
Sbjct  110   FMSRPRPIYLLDFACYKPSDELKVSKEEFIEMARQSGKFDEETLQFKRRILDSSGIGDET  169

Query  578   YIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSL  757
             Y+PKSI     I  +   R EAS +IF A+D++ EKTRIR +D+G+LVVNC+ FNPTPSL
Sbjct  170   YVPKSITSKNNITTMKEGREEASMVIFGALDELFEKTRIRPKDVGVLVVNCSIFNPTPSL  229

Query  758   SAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYS  937
             SAMIINHYKM+ NI+S NLGGMGCSA +IALDLARD+L+ANPN +A+VVSTE+V   WY 
Sbjct  230   SAMIINHYKMRGNILSYNLGGMGCSASVIALDLARDMLQANPNNFAVVVSTEMVGFNWYP  289

Query  938   GNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDV  1117
             G  RSMLIPNCFFR GCSA LLSNRRRD+  AKYRL+H+VRTH+GA DR+FRS+YQEED 
Sbjct  290   GCDRSMLIPNCFFRMGCSAALLSNRRRDFPRAKYRLEHVVRTHKGADDRSFRSVYQEEDE  349

Query  1118  ERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGA--------  1273
             +  KGLK+S++L+E+GG+A+K NITTLGPLVLP++EQL FF TL++R L G         
Sbjct  350   QGFKGLKVSRELMEIGGDAIKTNITTLGPLVLPVSEQLLFFSTLVKRHLLGGGKKEDQRN  409

Query  1274  -------------------KTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNME  1396
                                 +KPYIPDY +AFEHFC++AASK +LDEL+RNL LS+ NME
Sbjct  410   STASTTISSSSSSSRTSAASSKPYIPDYKLAFEHFCVHAASKTVLDELQRNLELSDSNME  469

Query  1397  ASRATLHRFGNT  1432
              SR TL RFGNT
Sbjct  470   PSRMTLQRFGNT  481



>ref|XP_002468397.1| hypothetical protein SORBIDRAFT_01g045150 [Sorghum bicolor]
 gb|EER95395.1| hypothetical protein SORBIDRAFT_01g045150 [Sorghum bicolor]
Length=543

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/480 (60%), Positives = 368/480 (77%), Gaps = 20/480 (4%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             MA+EE  LLSTEI+NRG+EPSGPDAG+ TFSVRVRRRLPDF+QSV LKYV+LGY+Y+I++
Sbjct  1     MAREEQALLSTEIMNRGVEPSGPDAGSPTFSVRVRRRLPDFLQSVNLKYVRLGYHYLISH  60

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYF  400
              + LA T+P++ +V G EVGS+ R E +W K+W      D   V ++ L +L FT+S+Y 
Sbjct  61    GVYLA-TIPVIVLVCGAEVGSLSRDE-LWRKVW-GEATYDLATV-LAFLAVLAFTISVYI  116

Query  401   MSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETY  580
             MS+P P+YL+DFAC KP+D+LKV+K +FID+ARKSG FDE +L +  R+L  SGIGDE+Y
Sbjct  117   MSRPRPVYLIDFACYKPADELKVSKAEFIDLARKSGKFDEDSLAFQSRLLAKSGIGDESY  176

Query  581   IPKSIGCPE-KIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSL  757
             +P+ +  P      +   R EAS  +F A+D++ +K R+R +D+G+LVVNC+ FNPTPSL
Sbjct  177   MPRCVFEPNANCATMKEGRAEASTAMFAALDELFDKCRVRPKDVGVLVVNCSLFNPTPSL  236

Query  758   SAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYS  937
             SAMI+NHYKM+ NI+S NLGGMGCSAG+IA+DLARD+L+A+    A+VVSTE VS TWY 
Sbjct  237   SAMIVNHYKMRGNILSYNLGGMGCSAGVIAIDLARDMLQASGAGLAVVVSTEAVSFTWYP  296

Query  938   GNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDV  1117
             G  RSMLIPN FFR GC+AVLLSNRRRD+  AKY+L+H+VRTH+GA DRAFRS+YQEED 
Sbjct  297   GKRRSMLIPNAFFRAGCAAVLLSNRRRDFHRAKYQLEHVVRTHKGADDRAFRSVYQEEDE  356

Query  1118  ERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTK-----  1282
             +RIKGL IS+DL+EVGG ALK NITTLGPLVLP +EQL FF  ++ R LF +K       
Sbjct  357   QRIKGLSISRDLLEVGGHALKTNITTLGPLVLPFSEQLLFFAGVLFRHLFPSKASTPPPP  416

Query  1283  ----------PYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
                       PYIPD+  AFEHFC++AAS+ +L+ L+ NL L   ++EASRA LHRFGNT
Sbjct  417   TTPGDASAAAPYIPDFKRAFEHFCMHAASRDVLEHLQSNLGLRNSDLEASRAALHRFGNT  476



>ref|XP_009380021.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Musa acuminata subsp. 
malaccensis]
Length=525

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/466 (62%), Positives = 357/466 (77%), Gaps = 15/466 (3%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             EH LLS EI+NRGIE SGPDAG+ TFSVRVRRRLPDF+QSV L YVKLGY  ++ +    
Sbjct  4     EHALLSAEIVNRGIESSGPDAGSPTFSVRVRRRLPDFLQSVNLNYVKLGYRNLVGH-AVY  62

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
              ATVPLL VV     GS+ R E +W K WE +   D     ++ L  L FT+++YFM KP
Sbjct  63    WATVPLLAVV-----GSLSR-EALWRKAWEETSY-DLAT-QLAFLVALAFTVAVYFMWKP  114

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
              PIYL+DFAC +PSDDLKV+ ++FI++ARKSG F+E++L +  R+L+SSGIGDETY+PKS
Sbjct  115   RPIYLLDFACYRPSDDLKVSNEEFIELARKSGKFNEESLAFQSRILKSSGIGDETYVPKS  174

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             I  P     +   R EAS  +  A+D++ +K R+R +DIGILVVNC+ FNPTPSLSAMI+
Sbjct  175   IFSPGNCATMTEGRAEASTAMISALDELFDKCRVRPKDIGILVVNCSLFNPTPSLSAMIL  234

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGMGCSAG+IALDLARD+LRANP+ YA+VVSTE VS TWY+G +RS
Sbjct  235   NHYKMRSNILSYNLGGMGCSAGVIALDLARDMLRANPSSYAVVVSTEAVSFTWYTGRNRS  294

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             MLIPNCFFR GCSAVLLSNRRRD+R AKYRL+HIVRTH+G   R+FR +YQEED ER K 
Sbjct  295   MLIPNCFFRMGCSAVLLSNRRRDFRRAKYRLEHIVRTHKGGDGRSFRCVYQEEDEERKKC  354

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLF------GAKTKPYIP  1294
             L IS+DL+EVGG ALKA+ITT  P V+P +EQL F  TL  R L        A TKPYI 
Sbjct  355   LCISRDLMEVGGHALKAHITTFAPRVIPFSEQLLFVATLFYRHLLPKKTADSAGTKPYIA  414

Query  1295  DYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             +Y +AFEH C++A SK +LD L++NLRL +++MEAS ATLHRFGNT
Sbjct  415   EYKLAFEHLCVHAGSKAVLDALQKNLRLEDRHMEASLATLHRFGNT  460



>ref|XP_008677051.1| PREDICTED: LOC100283031 isoform X1 [Zea mays]
 gb|ACN25771.1| unknown [Zea mays]
 tpg|DAA43707.1| TPA: hypothetical protein ZEAMMB73_279168 [Zea mays]
Length=543

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/480 (59%), Positives = 368/480 (77%), Gaps = 20/480 (4%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             MA+EE  LLSTEI+NRG+EPSGPDAG+  FSVRVRRRLPDF+QSV LKYV+LGY+Y+I++
Sbjct  1     MAREEQALLSTEIVNRGVEPSGPDAGSPAFSVRVRRRLPDFLQSVNLKYVRLGYHYLISH  60

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYF  400
              + LA T+P++ +V G E+GS+ R E +W K+W      D   V ++ L +L FT+S+Y 
Sbjct  61    GVYLA-TIPVIVLVCGAELGSLSRDE-LWRKVW-GEATYDLATV-LAFLAVLAFTISVYI  116

Query  401   MSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETY  580
             MS+P P+YL+DFAC KP+D+LKV+K +FID+ARKSG FDE +L +  R+L  SGIGDE+Y
Sbjct  117   MSRPRPVYLIDFACYKPADELKVSKAEFIDLARKSGKFDEDSLAFQSRLLAKSGIGDESY  176

Query  581   IPKSIGCPE-KIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSL  757
             +P+ +  P      +   R EAS  +F A+D++ +K R+R +D+G+LVVNC+ FNPTPSL
Sbjct  177   MPRCVFEPNASCATMKEGRAEASTAMFAALDELFDKCRVRPKDVGVLVVNCSLFNPTPSL  236

Query  758   SAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYS  937
             SAMI+NHYKM+ NI+S NLGGMGCSAG+IA+DLARD+L+A+    A+VVSTE VS TWY 
Sbjct  237   SAMIVNHYKMRGNILSYNLGGMGCSAGVIAIDLARDMLQASGAGLAVVVSTEAVSFTWYP  296

Query  938   GNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDV  1117
             G  RSMLIPN FFR GC+AVLLSNRRRD+  AKY+L+H+VRTH+GA DRAFRS+YQEED 
Sbjct  297   GKRRSMLIPNAFFRAGCAAVLLSNRRRDFHRAKYQLEHVVRTHKGADDRAFRSVYQEEDE  356

Query  1118  ERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTK-----  1282
             +RIKGL IS+DL+EVGG ALK NITTLGPLVLP +EQL FF  ++ R LF +K       
Sbjct  357   QRIKGLSISRDLLEVGGHALKTNITTLGPLVLPFSEQLLFFAGVLFRHLFPSKASTPAPP  416

Query  1283  ----------PYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
                       PYIPD+  AFEHFC++AAS+ +L+ L+ NL L + ++EASRA LHRFGNT
Sbjct  417   TTPGDASAAAPYIPDFKRAFEHFCMHAASRDVLEHLQSNLGLRDADLEASRAALHRFGNT  476



>ref|XP_004960826.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Setaria italica]
 ref|XP_004985484.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Setaria italica]
Length=542

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/480 (60%), Positives = 369/480 (77%), Gaps = 21/480 (4%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             MA+E+  LLSTEI+NRG+EPSGPDAG+ TFSVRVRRRLPDF+QSV LKYV+LGY+Y+I++
Sbjct  1     MAREQA-LLSTEIVNRGVEPSGPDAGSPTFSVRVRRRLPDFLQSVNLKYVRLGYHYLISH  59

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYF  400
              + LA T+P++ +V G EVGS+ R E +W K+W      D   V ++ L +L FT+S+Y 
Sbjct  60    GVYLA-TIPVIVLVCGAEVGSLSRDE-LWNKVW-GEATYDLATV-LAFLAVLAFTISVYI  115

Query  401   MSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETY  580
             MS+P P+YL+DFAC KP+D+LKV+K +FID+ARKSG FDE +L +  R+L  SGIGDE+Y
Sbjct  116   MSRPRPVYLIDFACYKPADELKVSKAEFIDLARKSGKFDEDSLAFQSRLLAKSGIGDESY  175

Query  581   IPKSIGCPE-KIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSL  757
             +P+ +  P      +   R EAS  +F A+D++ +K R+R +D+G+LVVNC+ FNPTPSL
Sbjct  176   MPRCVFEPNVNCATMKEGRAEASTAMFAALDELFDKCRVRPKDVGVLVVNCSLFNPTPSL  235

Query  758   SAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYS  937
             SAMI+NHYKM+ NI+S NLGGMGCSAG+IA+DLARD+L+A+    A+VVSTE VS TWY 
Sbjct  236   SAMIVNHYKMRGNILSYNLGGMGCSAGVIAIDLARDMLQASGAGLAVVVSTEAVSFTWYP  295

Query  938   GNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDV  1117
             G  RSMLIPN FFR GC+AVLLSNRRRD+  AKY+L+H+VRTH+GA DRAFRS+YQEED 
Sbjct  296   GKRRSMLIPNAFFRAGCAAVLLSNRRRDFHRAKYQLEHVVRTHKGADDRAFRSVYQEEDE  355

Query  1118  ERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAK-------  1276
             +RIKGL IS+DL+EVGG ALK NITTLGPLVLP +EQL FF  ++ R LF +K       
Sbjct  356   QRIKGLSISRDLLEVGGHALKTNITTLGPLVLPFSEQLLFFAGVLFRHLFPSKTSTPPPA  415

Query  1277  --------TKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
                       PYIPD+  AFEHFC++AAS+ +L+ L+ NL L + ++EASRA LHRFGNT
Sbjct  416   TTPGDASAAAPYIPDFKRAFEHFCMHAASRDVLEHLQSNLGLRDGDLEASRAALHRFGNT  475



>gb|ABK24632.1| unknown [Picea sitchensis]
Length=530

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/466 (61%), Positives = 369/466 (79%), Gaps = 9/466 (2%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             MAKE+   LSTEI+N+G++ SGP+AG+LTFSVRVRRRLPDF+QSV LKYVKLGY+Y+I++
Sbjct  1     MAKEQA-FLSTEIVNQGVQESGPNAGSLTFSVRVRRRLPDFLQSVNLKYVKLGYHYLISH  59

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNM-SLLGLLGFTLSIY  397
              + L  +VP+L + F  E+GS+ + + +W ++WE    P F +  M +  G   F L +Y
Sbjct  60    AVYLF-SVPVLLLAFSAEIGSLSQ-QDLW-RLWEQ---PHFDLTTMLTFSGATVFMLCLY  113

Query  398   FMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDET  577
             FMS+P  +YLVDFAC KPSD+LKV+K++FI +A+KSG FD+ +LE+ KR+LE SG+GDET
Sbjct  114   FMSQPRSVYLVDFACFKPSDELKVSKEEFISLAKKSGHFDDASLEFQKRILERSGVGDET  173

Query  578   YIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSL  757
             Y+PK++  P     +   R EA  ++F A+D++ EK ++R +D+GILVVNC+ FNPTPSL
Sbjct  174   YLPKAVMGPGLCSTMKEGRAEAEMVMFGALDELFEKCKVRPKDVGILVVNCSLFNPTPSL  233

Query  758   SAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYS  937
             SAMIINHYKM+ NI+S NLGGMGCSAGII+LDLARD+L+A+PN YA+VVSTE+++  WY+
Sbjct  234   SAMIINHYKMRGNILSFNLGGMGCSAGIISLDLARDMLQAHPNSYAIVVSTEMITFNWYT  293

Query  938   GNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDV  1117
             G  RSML+PNCFFR G +A+LLSN+RRD R AKY L HIVRTH+GA DR+FR +YQ+ED 
Sbjct  294   GAERSMLMPNCFFRMGGAAILLSNKRRDRRRAKYSLSHIVRTHKGADDRSFRCVYQQEDD  353

Query  1118  ERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGA-KTKPYIP  1294
             +R KGL +SKDL+E+GG ALKANITTLGPLVLPL+EQL F  TLI RK+      KPYIP
Sbjct  354   KRKKGLSVSKDLLEIGGHALKANITTLGPLVLPLSEQLLFLATLIGRKVLKMDHVKPYIP  413

Query  1295  DYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             D+ +AFEHFCI+A  K +LDEL+ NL L+ ++ME SR TLHRFGNT
Sbjct  414   DFKLAFEHFCIHAGGKTILDELQNNLGLTNKHMEPSRMTLHRFGNT  459



>ref|XP_003558663.1| PREDICTED: 3-ketoacyl-CoA synthase 10 [Brachypodium distachyon]
Length=544

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/476 (60%), Positives = 370/476 (78%), Gaps = 19/476 (4%)
 Frame = +2

Query  50    EEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLC  229
             EE  LLSTEI+NRG+EPSGPDAG+ TFSVRVRRRLPDF+QSV LKYV+LGY Y++++ + 
Sbjct  6     EEQALLSTEIVNRGVEPSGPDAGSPTFSVRVRRRLPDFLQSVNLKYVRLGYRYMLSHGVY  65

Query  230   LAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSK  409
             LA T+P++ +V G EVGS+ R E +W K+W+ +   D   V ++ L +L FT+S+Y MS+
Sbjct  66    LA-TIPVIVLVCGAEVGSLSRDE-LWRKVWDEATY-DLATV-LAFLAVLAFTISVYIMSR  121

Query  410   PMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPK  589
             P PIYL+DFA  KP ++LKV+K +FID+ARKSG FDE++L +  R+L  SGIGDE+Y+P+
Sbjct  122   PRPIYLIDFATYKPPEELKVSKAEFIDLARKSGKFDEESLAFQSRLLAKSGIGDESYMPR  181

Query  590   SIGCPE-KIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAM  766
              +  P+     +   R EAS  +F A+D++ +K R+R +D+G+LVVNC+ FNPTPSLSAM
Sbjct  182   CVFQPDANCATMKEGRAEASAAMFAALDELFDKCRVRPKDVGVLVVNCSLFNPTPSLSAM  241

Query  767   IINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNH  946
             I+NHYKM+ NI+S NLGGMGCSAG+I++DLARD+L+A+    A+VVSTE VS TWY+G  
Sbjct  242   IVNHYKMRGNILSYNLGGMGCSAGVISIDLARDMLQASGAGLAVVVSTEAVSFTWYAGKR  301

Query  947   RSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERI  1126
             RSMLIPN FFR GC+AVLLSNRRRD+  AKY+L+HIVRTH+GA DR+FRS+YQEED +RI
Sbjct  302   RSMLIPNAFFRAGCAAVLLSNRRRDFHRAKYQLEHIVRTHKGADDRSFRSVYQEEDEQRI  361

Query  1127  KGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTK--------  1282
             KGL IS+DLVEVGG ALK NITTLGPLVLP +EQL FF  ++ R L+ +KT         
Sbjct  362   KGLAISRDLVEVGGHALKTNITTLGPLVLPFSEQLLFFAGVLFRHLYPSKTSSAQVAGEA  421

Query  1283  ------PYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
                   PYIPD+  AFEHFC++AAS+ +L+ L+RNL L + ++EASRA LHRFGNT
Sbjct  422   DSAAAAPYIPDFKRAFEHFCMHAASRDVLEHLQRNLGLRDADLEASRAALHRFGNT  477



>gb|EAY88792.1| hypothetical protein OsI_10265 [Oryza sativa Indica Group]
Length=542

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/480 (60%), Positives = 371/480 (77%), Gaps = 21/480 (4%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             MA+E+  LLSTEI+NRG+EPSGPDAG+ TFSVRVRRRLPDF+QSV LKYV+LGY+Y+I++
Sbjct  1     MAREQA-LLSTEIVNRGVEPSGPDAGSPTFSVRVRRRLPDFLQSVNLKYVRLGYHYLISH  59

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYF  400
              + LA T+P++ +V G EVGS+ R E +W K+W      D   V ++ L +L FT+S+Y 
Sbjct  60    GVYLA-TIPVIVLVCGAEVGSLSRDE-LWRKVW-GEATYDLATV-LAFLAVLAFTISVYI  115

Query  401   MSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETY  580
             MS+P P+YL+DFAC KP+D+LKV+K +FID+ARKSG FDE +L +  R+L  SGIGDE+Y
Sbjct  116   MSRPRPVYLIDFACYKPADELKVSKAEFIDLARKSGKFDEDSLAFQSRLLAKSGIGDESY  175

Query  581   IPKSIGCP-EKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSL  757
             +P+ +  P      +   R EAS  +F A+D++ +K R+R +D+G+LVVNC+ FNPTPSL
Sbjct  176   MPRCVFEPGTNCATMKEGRAEASAAMFAALDELFDKCRVRPKDVGVLVVNCSLFNPTPSL  235

Query  758   SAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYS  937
             SAMI+NHYKM+ NI+S NLGGMGCSAG+IA+DLARD+L+A+    A+VVSTE VS TWY+
Sbjct  236   SAMIVNHYKMRGNILSYNLGGMGCSAGVIAVDLARDMLQASGAGLAVVVSTEAVSFTWYA  295

Query  938   GNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDV  1117
             G  RSMLIPN FFR GC+AVLLSNRRRD+  AKY+L+HIVRTH+GA DR+FRS+YQEED 
Sbjct  296   GKRRSMLIPNAFFRAGCAAVLLSNRRRDFHRAKYQLEHIVRTHKGADDRSFRSVYQEEDE  355

Query  1118  ERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTK-----  1282
             +RIKGL IS+DLVEVGG ALK NITTLGPLVLP +EQ+ FF  ++ R LF +KT      
Sbjct  356   QRIKGLSISRDLVEVGGHALKTNITTLGPLVLPFSEQILFFAGVLFRHLFPSKTSAPPPP  415

Query  1283  ----------PYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
                       PYIPD+  AFEHFC++AAS+ +L+ L+ NL L + ++EASRA LHRFGNT
Sbjct  416   SADGDASAAAPYIPDFKRAFEHFCMHAASRDVLEHLQGNLGLRDGDLEASRAALHRFGNT  475



>gb|EEE58439.1| hypothetical protein OsJ_09660 [Oryza sativa Japonica Group]
Length=576

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/480 (60%), Positives = 370/480 (77%), Gaps = 21/480 (4%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             MA+E+  LL TEI+NRG+EPSGPDAG+ TFSVRVRRRLPDF+QSV LKYV+LGY+Y+I++
Sbjct  1     MAREQA-LLLTEIVNRGVEPSGPDAGSPTFSVRVRRRLPDFLQSVNLKYVRLGYHYLISH  59

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYF  400
              + LA T+P++ +V G EVGS+ R E +W K+W      D   V ++ L +L FT+S+Y 
Sbjct  60    GVYLA-TIPVIVLVCGAEVGSLSRDE-LWRKVW-GEATYDLATV-LAFLAVLAFTISVYI  115

Query  401   MSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETY  580
             MS+P P+YL+DFAC KP+D+LKV+K +FID+ARKSG FDE +L +  R+L  SGIGDE+Y
Sbjct  116   MSRPRPVYLIDFACYKPADELKVSKAEFIDLARKSGKFDEDSLAFQSRLLAKSGIGDESY  175

Query  581   IPKSIGCP-EKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSL  757
             +P+ +  P      +   R EAS  +F A+D++ +K R+R +D+G+LVVNC+ FNPTPSL
Sbjct  176   MPRCVFEPGTNCATMKEGRAEASAAMFAALDELFDKCRVRPKDVGVLVVNCSLFNPTPSL  235

Query  758   SAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYS  937
             SAMI+NHYKM+ NI+S NLGGMGCSAG+IA+DLARD+L+A+    A+VVSTE VS TWY+
Sbjct  236   SAMIVNHYKMRGNILSYNLGGMGCSAGVIAVDLARDMLQASGAGLAVVVSTEAVSFTWYA  295

Query  938   GNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDV  1117
             G  RSMLIPN FFR GC+AVLLSNRRRD+  AKY+L+HIVRTH+GA DR+FRS+YQEED 
Sbjct  296   GKRRSMLIPNAFFRAGCAAVLLSNRRRDFHRAKYQLEHIVRTHKGADDRSFRSVYQEEDE  355

Query  1118  ERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTK-----  1282
             +RIKGL IS+DLVEVGG ALK NITTLGPLVLP +EQ+ FF  ++ R LF +KT      
Sbjct  356   QRIKGLSISRDLVEVGGHALKTNITTLGPLVLPFSEQILFFAGVLFRHLFPSKTSAPPPP  415

Query  1283  ----------PYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
                       PYIPD+  AFEHFC++AAS+ +L+ L+ NL L + ++EASRA LHRFGNT
Sbjct  416   SADGDASAAAPYIPDFKRAFEHFCMHAASRDVLEHLQGNLGLRDGDLEASRAALHRFGNT  475



>gb|ABG35745.1| putative FIDDLEHEAD very long chain fatty acid condensing enzyme 
FDH;1 [Hordeum vulgare]
 gb|ABV22580.1| fiddlehead [Hordeum vulgare subsp. vulgare]
 gb|ABV22581.1| fiddlehead [Hordeum vulgare subsp. vulgare]
 gb|ABV22587.1| fiddlehead [Hordeum vulgare subsp. vulgare]
Length=540

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/480 (59%), Positives = 372/480 (78%), Gaps = 23/480 (5%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             MA+EE   LSTEI+NRG+EPSGPDAG+ TFSVRVRRRLPDF+QSV LKYV+LGY+Y++++
Sbjct  1     MAREE---LSTEIVNRGVEPSGPDAGSPTFSVRVRRRLPDFLQSVNLKYVRLGYHYLLSH  57

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYF  400
              + LA T+P++ +V G EVGS+ R E +W K+W+ +   D   V ++ L +L FT+S+Y 
Sbjct  58    GVYLA-TIPVIVLVCGAEVGSLSRDE-LWRKVWDEAT-YDLATV-LAFLAVLAFTISVYI  113

Query  401   MSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETY  580
             MS+P PIYL+DFA  KP+D+LKV+K +FID+ARKSG FDE++L +  R+L  SGIGDE+Y
Sbjct  114   MSRPRPIYLIDFATYKPADELKVSKAEFIDLARKSGKFDEESLAFQARLLAKSGIGDESY  173

Query  581   IPKSIGCPE-KIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSL  757
             +P+ +  P+     +   R EAS  +F A+D++ +K R+R +D+G+LVVNC+ FNPTPSL
Sbjct  174   MPRCVFQPDANCATMKEGRAEASAAMFAALDELFDKCRVRPKDVGVLVVNCSLFNPTPSL  233

Query  758   SAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYS  937
             SAMI+NHYKM+ NI+S NLGGMGCSAG+I++DLARD+L+A+    A+VVSTE VS TWY+
Sbjct  234   SAMIVNHYKMRGNILSYNLGGMGCSAGVISIDLARDMLQASGAGLAVVVSTEAVSFTWYA  293

Query  938   GNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDV  1117
             G  RSMLIPN FFR G +AVLLSNRRRD+R AKY+L+H+VRTH+GA DRAFRS+YQEED 
Sbjct  294   GKRRSMLIPNAFFRAGAAAVLLSNRRRDFRRAKYQLEHVVRTHKGADDRAFRSVYQEEDE  353

Query  1118  ERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFG---------  1270
             +RIKGL IS+DLVEVGG ALK NITTLGPLVLP +EQL FF  ++ R L+          
Sbjct  354   QRIKGLSISRDLVEVGGHALKTNITTLGPLVLPFSEQLLFFAGVLFRHLYPSKTSTPPPP  413

Query  1271  ------AKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
                   +   PYIPD+  AFEHFC++AAS+ +L+ L+RNL L + ++EASRA LHRFGNT
Sbjct  414   AANGDTSAAAPYIPDFKRAFEHFCMHAASRDVLEHLQRNLGLRDADLEASRAALHRFGNT  473



>ref|NP_001049170.1| Os03g0181500 [Oryza sativa Japonica Group]
 gb|ABF94315.1| fiddlehead, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF11084.1| Os03g0181500 [Oryza sativa Japonica Group]
 dbj|BAG87863.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94008.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87571.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99590.1| unnamed protein product [Oryza sativa Japonica Group]
Length=542

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/480 (60%), Positives = 370/480 (77%), Gaps = 21/480 (4%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             MA+E+  LL TEI+NRG+EPSGPDAG+ TFSVRVRRRLPDF+QSV LKYV+LGY+Y+I++
Sbjct  1     MAREQA-LLLTEIVNRGVEPSGPDAGSPTFSVRVRRRLPDFLQSVNLKYVRLGYHYLISH  59

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYF  400
              + LA T+P++ +V G EVGS+ R E +W K+W      D   V ++ L +L FT+S+Y 
Sbjct  60    GVYLA-TIPVIVLVCGAEVGSLSRDE-LWRKVW-GEATYDLATV-LAFLAVLAFTISVYI  115

Query  401   MSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETY  580
             MS+P P+YL+DFAC KP+D+LKV+K +FID+ARKSG FDE +L +  R+L  SGIGDE+Y
Sbjct  116   MSRPRPVYLIDFACYKPADELKVSKAEFIDLARKSGKFDEDSLAFQSRLLAKSGIGDESY  175

Query  581   IPKSIGCP-EKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSL  757
             +P+ +  P      +   R EAS  +F A+D++ +K R+R +D+G+LVVNC+ FNPTPSL
Sbjct  176   MPRCVFEPGTNCATMKEGRAEASAAMFAALDELFDKCRVRPKDVGVLVVNCSLFNPTPSL  235

Query  758   SAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYS  937
             SAMI+NHYKM+ NI+S NLGGMGCSAG+IA+DLARD+L+A+    A+VVSTE VS TWY+
Sbjct  236   SAMIVNHYKMRGNILSYNLGGMGCSAGVIAVDLARDMLQASGAGLAVVVSTEAVSFTWYA  295

Query  938   GNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDV  1117
             G  RSMLIPN FFR GC+AVLLSNRRRD+  AKY+L+HIVRTH+GA DR+FRS+YQEED 
Sbjct  296   GKRRSMLIPNAFFRAGCAAVLLSNRRRDFHRAKYQLEHIVRTHKGADDRSFRSVYQEEDE  355

Query  1118  ERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTK-----  1282
             +RIKGL IS+DLVEVGG ALK NITTLGPLVLP +EQ+ FF  ++ R LF +KT      
Sbjct  356   QRIKGLSISRDLVEVGGHALKTNITTLGPLVLPFSEQILFFAGVLFRHLFPSKTSAPPPP  415

Query  1283  ----------PYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
                       PYIPD+  AFEHFC++AAS+ +L+ L+ NL L + ++EASRA LHRFGNT
Sbjct  416   SADGDASAAAPYIPDFKRAFEHFCMHAASRDVLEHLQGNLGLRDGDLEASRAALHRFGNT  475



>gb|AAN65442.1| Putative fiddlehead-like protein [Oryza sativa Japonica Group]
Length=595

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/480 (60%), Positives = 370/480 (77%), Gaps = 21/480 (4%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             MA+E+  LL TEI+NRG+EPSGPDAG+ TFSVRVRRRLPDF+QSV LKYV+LGY+Y+I++
Sbjct  54    MAREQA-LLLTEIVNRGVEPSGPDAGSPTFSVRVRRRLPDFLQSVNLKYVRLGYHYLISH  112

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYF  400
              + LA T+P++ +V G EVGS+ R E +W K+W      D   V ++ L +L FT+S+Y 
Sbjct  113   GVYLA-TIPVIVLVCGAEVGSLSRDE-LWRKVW-GEATYDLATV-LAFLAVLAFTISVYI  168

Query  401   MSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETY  580
             MS+P P+YL+DFAC KP+D+LKV+K +FID+ARKSG FDE +L +  R+L  SGIGDE+Y
Sbjct  169   MSRPRPVYLIDFACYKPADELKVSKAEFIDLARKSGKFDEDSLAFQSRLLAKSGIGDESY  228

Query  581   IPKSIGCP-EKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSL  757
             +P+ +  P      +   R EAS  +F A+D++ +K R+R +D+G+LVVNC+ FNPTPSL
Sbjct  229   MPRCVFEPGTNCATMKEGRAEASAAMFAALDELFDKCRVRPKDVGVLVVNCSLFNPTPSL  288

Query  758   SAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYS  937
             SAMI+NHYKM+ NI+S NLGGMGCSAG+IA+DLARD+L+A+    A+VVSTE VS TWY+
Sbjct  289   SAMIVNHYKMRGNILSYNLGGMGCSAGVIAVDLARDMLQASGAGLAVVVSTEAVSFTWYA  348

Query  938   GNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDV  1117
             G  RSMLIPN FFR GC+AVLLSNRRRD+  AKY+L+HIVRTH+GA DR+FRS+YQEED 
Sbjct  349   GKRRSMLIPNAFFRAGCAAVLLSNRRRDFHRAKYQLEHIVRTHKGADDRSFRSVYQEEDE  408

Query  1118  ERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTK-----  1282
             +RIKGL IS+DLVEVGG ALK NITTLGPLVLP +EQ+ FF  ++ R LF +KT      
Sbjct  409   QRIKGLSISRDLVEVGGHALKTNITTLGPLVLPFSEQILFFAGVLFRHLFPSKTSAPPPP  468

Query  1283  ----------PYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
                       PYIPD+  AFEHFC++AAS+ +L+ L+ NL L + ++EASRA LHRFGNT
Sbjct  469   SADGDASAAAPYIPDFKRAFEHFCMHAASRDVLEHLQGNLGLRDGDLEASRAALHRFGNT  528



>dbj|BAJ87894.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=540

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/480 (59%), Positives = 371/480 (77%), Gaps = 23/480 (5%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             MA+EE   LSTEI+NRG+EPS PDAG+ TFSVRVRRRLPDF+QSV LKYV+LGY+Y++++
Sbjct  1     MAREE---LSTEIVNRGVEPSVPDAGSPTFSVRVRRRLPDFLQSVNLKYVRLGYHYLLSH  57

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYF  400
              + LA T+P++ +V G EVGS+ R E +W K+W+ +   D   V ++ L +L FT+S+Y 
Sbjct  58    GVYLA-TIPVIVLVCGAEVGSLSRDE-LWRKVWDEATY-DLATV-LAFLAVLAFTISVYI  113

Query  401   MSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETY  580
             MS+P PIYL+DFA  KP+D+LKV+K +FID+ARKSG FDE++L +  R+L  SGIGDE+Y
Sbjct  114   MSRPRPIYLIDFATYKPADELKVSKAEFIDLARKSGKFDEESLAFQSRLLAKSGIGDESY  173

Query  581   IPKSIGCPE-KIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSL  757
             +P+ +  P+     +   R EAS  +F A+D++ +K R+R +D+G+LVVNC+ FNPTPSL
Sbjct  174   MPRCVFQPDANCATMKEGRAEASAAMFAALDELFDKCRVRPKDVGVLVVNCSLFNPTPSL  233

Query  758   SAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYS  937
             SAMI+NHYKM+ NI+S NLGGMGCSAG+I++DLARD+L+A+    A+VVSTE VS TWY+
Sbjct  234   SAMIVNHYKMRGNILSYNLGGMGCSAGVISIDLARDMLQASGAGLAVVVSTEAVSFTWYA  293

Query  938   GNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDV  1117
             G  RSMLIPN FFR G +AVLLSNRRRD+R AKY+L+H+VRTH+GA DRAFRS+YQEED 
Sbjct  294   GKRRSMLIPNAFFRAGAAAVLLSNRRRDFRRAKYQLEHVVRTHKGADDRAFRSVYQEEDE  353

Query  1118  ERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFG---------  1270
             +RIKGL IS+DLVEVGG ALK NITTLGPLVLP +EQL FF  ++ R L+          
Sbjct  354   QRIKGLSISRDLVEVGGHALKTNITTLGPLVLPFSEQLLFFAGVLFRHLYPSKTSTPPPP  413

Query  1271  ------AKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
                   +   PYIPD+  AFEHFC++AAS+ +L+ L+RNL L + ++EASRA LHRFGNT
Sbjct  414   AANGDTSAAAPYIPDFKRAFEHFCMHAASRDVLEHLQRNLGLRDADLEASRAALHRFGNT  473



>gb|AAF73977.1|AF214498_1 fiddlehead protein [Arabidopsis thaliana]
Length=389

 Score =   515 bits (1327),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 255/391 (65%), Positives = 322/391 (82%), Gaps = 7/391 (2%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+NRGIEPSGP+AG+ TFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+ + L
Sbjct  6     EQDLLSTEIVNRGIEPSGPNAGSPTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINHAVYL  65

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L +VF  EVGS+ R E++W K+W+     D   V +   G+   T  +YFMS+P
Sbjct  66    A-TIPVLVLVFSAEVGSLSR-EEIWKKLWDY----DLATV-IGFFGVFVLTACVYFMSRP  118

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               +YL+DFAC KPSD+ KVTK++FI++ARKSG FDE+ L + KR+L++SGIGDETY+P+S
Sbjct  119   RSVYLIDFACYKPSDEHKVTKEEFIELARKSGKFDEETLGFKKRILQASGIGDETYVPRS  178

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             I   E I  +   R EAS +IF A+D++ EKTR++ +D+G+LVVNC+ FNPTPSLSAM+I
Sbjct  179   ISSSENITTMKEGREEASTVIFGALDELFEKTRVKPKDVGVLVVNCSIFNPTPSLSAMVI  238

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGMGCSAGIIA+DLARD+L++NPN YA+VVSTE+V   WY G+ +S
Sbjct  239   NHYKMRGNILSYNLGGMGCSAGIIAIDLARDMLQSNPNSYAVVVSTEMVGYNWYVGSDKS  298

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             M+IPNCFFR GCSAV+LSNRRRD+RHAKYRL+HIVRTH+ A DR+FRS+YQEED +  KG
Sbjct  299   MVIPNCFFRMGCSAVMLSNRRRDFRHAKYRLEHIVRTHKAADDRSFRSVYQEEDEQGFKG  358

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTE  1225
             LKIS+DL+EVGGEALK NITTLGPLVLP +E
Sbjct  359   LKISRDLMEVGGEALKTNITTLGPLVLPFSE  389



>gb|KHN37223.1| 3-ketoacyl-CoA synthase 10 [Glycine soja]
Length=420

 Score =   514 bits (1325),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 240/353 (68%), Positives = 293/353 (83%), Gaps = 9/353 (3%)
 Frame = +2

Query  401   MSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETY  580
             MS+P PIYL+DFAC KP D+LKV+++Q +++ARKSG FDE +LE+ KRML SSGIGDETY
Sbjct  1     MSRPRPIYLIDFACYKPDDELKVSREQLMEVARKSGKFDEASLEFQKRMLMSSGIGDETY  60

Query  581   IPKSI-GCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSL  757
             IPK++    E    +   RGEAS ++F A+D++ EK+R+R +D+G+LVVNC+ FNPTPSL
Sbjct  61    IPKAVVASTENTATMKEGRGEASMVMFGALDELFEKSRVRPKDVGVLVVNCSIFNPTPSL  120

Query  758   SAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYS  937
             SAMIINHYKM+ NI+S NLGGMGCSAGII +DLA+DIL+ANPN YA+VVSTE+V   WY 
Sbjct  121   SAMIINHYKMRGNILSYNLGGMGCSAGIIGVDLAKDILQANPNNYAVVVSTEMVGYNWYQ  180

Query  938   GNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDV  1117
             G  RSMLIPN FFR GCSAVLLSNRRRDY  AKYRL+HIVRTH+GA DR+FR +YQEED 
Sbjct  181   GKDRSMLIPNSFFRMGCSAVLLSNRRRDYSRAKYRLEHIVRTHKGADDRSFRCVYQEEDE  240

Query  1118  ERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKT------  1279
             +++KGLKISKDL+E+GG+ALK NITTLGPLVLP +EQL FF TL+ R LFG+K       
Sbjct  241   QKLKGLKISKDLIEIGGDALKTNITTLGPLVLPFSEQLLFFATLVWRHLFGSKNGGNSPS  300

Query  1280  --KPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
               KPYIPDY +AFEHFC++AASK +LDEL+RNL LS++N+EASR TLHRFGNT
Sbjct  301   MKKPYIPDYKLAFEHFCVHAASKTILDELQRNLELSDKNIEASRMTLHRFGNT  353



>ref|NP_001149405.1| LOC100283031 [Zea mays]
 gb|ACG35345.1| fiddlehead-like protein [Zea mays]
Length=598

 Score =   493 bits (1270),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 247/397 (62%), Positives = 318/397 (80%), Gaps = 5/397 (1%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             MA+EE  LLSTEI+NRG+EPSGPDAG+  FSVRVRRRLPDF+QSV LKYV+LGY+Y+I++
Sbjct  1     MAREEQALLSTEIVNRGVEPSGPDAGSPAFSVRVRRRLPDFLQSVNLKYVRLGYHYLISH  60

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYF  400
              + LA T+P++ +V G E+GS+ R E +W K+W  +   D   V ++ L +L FT+S+Y 
Sbjct  61    GVYLA-TIPVIVLVCGAELGSLSRDE-LWRKVWGEATY-DLATV-LAFLAVLAFTISVYI  116

Query  401   MSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETY  580
             MS+P P+YL+DFAC KP+D+LKV+K +FID+ARKSG FDE +L +  R+L  SGIGDE+Y
Sbjct  117   MSRPRPVYLIDFACYKPADELKVSKAEFIDLARKSGKFDEDSLAFQSRLLAKSGIGDESY  176

Query  581   IPKSIGCPE-KIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSL  757
             +P+ +  P      +   R EAS  +F A+D++ +K R+R +D+G+LVVNC+ FNPTPSL
Sbjct  177   MPRCVFEPNASCATMKEGRAEASTAMFAALDELFDKCRVRPKDVGVLVVNCSLFNPTPSL  236

Query  758   SAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYS  937
             SAMI+NHYKM+ NI+S NLGGMGCSAG+IA+DLARD+L+A+    A+VVSTE VS TWY 
Sbjct  237   SAMIVNHYKMRGNILSYNLGGMGCSAGVIAIDLARDMLQASGAGLAVVVSTEXVSFTWYP  296

Query  938   GNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDV  1117
             G  RSMLIPN FFR GC+AVLLSNRRRD+  AKY+L+H+VRTH+GA DRAFRS+YQEED 
Sbjct  297   GKRRSMLIPNAFFRAGCAAVLLSNRRRDFHRAKYQLEHVVRTHKGADDRAFRSVYQEEDE  356

Query  1118  ERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQ  1228
             +RIKGL IS+DL+EVGG ALK NITTLGPLVLP +EQ
Sbjct  357   QRIKGLSISRDLLEVGGHALKTNITTLGPLVLPFSEQ  393



>gb|KDO73370.1| hypothetical protein CISIN_1g038123mg [Citrus sinensis]
Length=508

 Score =   489 bits (1258),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 252/461 (55%), Positives = 340/461 (74%), Gaps = 16/461 (3%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             EH LLS EI+NRG+E SGP AG+L+FSVRV+RRLPDF+ SV LKYV+LGY Y++++ + L
Sbjct  4     EHELLSPEIVNRGVENSGPYAGSLSFSVRVQRRLPDFLNSVNLKYVRLGYGYLLSHGVYL  63

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVN-MSLLGLLGFTLSIYFMSK  409
                 P+L V+FG ++G +   + +          P F   + + L GLLG    IY  + 
Sbjct  64    IPA-PILIVIFGAQIGKLTFSDLL----------PTFDTTDAVFLFGLLGILAYIYLETT  112

Query  410   PMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPK  589
             P  IYLVDFAC +P ++LK++K +FI+ AR+SG F++ +LE+ +R++++SG+GDETY+P+
Sbjct  113   PCWIYLVDFACYRPPNELKISKKEFIEQARESGNFNDASLEFKQRIIKNSGLGDETYLPR  172

Query  590   SIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMI  769
             ++ CP     L + R EA+ ++F AID +L  T+IR +DI +LVVNC   N TPSLSAM+
Sbjct  173   AVFCPGYRPNLKDGREEAAMVLFGAIDDLLAATKIRPKDIRVLVVNCGVLNTTPSLSAMV  232

Query  770   INHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHR  949
             INHYK++ NI S NLGGMGCSAGIIA+DLA+D+L A P  YALVVSTE+VS TWY GN  
Sbjct  233   INHYKLRHNINSFNLGGMGCSAGIIAIDLAKDLLNAYPGSYALVVSTEVVSNTWYGGNEV  292

Query  950   SMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIK  1129
              ML+PNCFFR G +AVLLS+ R D   +KY  + +VRTH+G  +R+F+ ++ +ED E  +
Sbjct  293   DMLLPNCFFRMGAAAVLLSSCRLDKWRSKYEFKQLVRTHKGMDNRSFKCMHLKEDAEGRQ  352

Query  1130  GLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIA  1309
             GL +SKD++EVGG ALKANITTLGPLVLP++EQ++FF  L+ +K    KTKPYIPDY  A
Sbjct  353   GLSVSKDMIEVGGHALKANITTLGPLVLPVSEQVHFFTNLLLKK----KTKPYIPDYKQA  408

Query  1310  FEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             FEH CI A SK +LDE+++NL L+E+ MEASR TL RFGNT
Sbjct  409   FEHICILATSKKVLDEIQKNLELTEELMEASRKTLERFGNT  449



>ref|XP_006474655.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like, partial [Citrus sinensis]
Length=510

 Score =   487 bits (1253),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 252/467 (54%), Positives = 343/467 (73%), Gaps = 17/467 (4%)
 Frame = +2

Query  35    LNMAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvI  214
             ++MA+E H LLS EI+NRG+E SGP AG+L+FSVRV+RRLPDF+ SV L YV+LGY Y++
Sbjct  1     ISMARE-HKLLSPEIVNRGVENSGPYAGSLSFSVRVQRRLPDFLNSVNLNYVRLGYGYLL  59

Query  215   NNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVN-MSLLGLLGFTLS  391
             ++ + L    P+L V+FG ++G +   + +          P F   + + L GLLG    
Sbjct  60    SHGVYLIPA-PILIVIFGAQIGKLTFSDLL----------PTFDTTDAVFLFGLLGILAY  108

Query  392   IYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGD  571
             IY  + P  IYLVDFAC +P ++LK++K +FI+ AR+SG F++ +LE+ +R++++SG+GD
Sbjct  109   IYLETTPCWIYLVDFACYRPPNELKISKKEFIEQARESGNFNDASLEFKQRIIKNSGLGD  168

Query  572   ETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTP  751
             ETY+P+++ CP     L + R EA+ ++F AID +L  T+IR +DI +LVVNC   N TP
Sbjct  169   ETYLPRAVFCPGYRPNLKDGREEAAMVLFGAIDDLLAATKIRPKDIRVLVVNCGVLNTTP  228

Query  752   SLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATW  931
             SLSAM+INHYK++ NI S NLGGMGCSAGIIA+DLA+D+L A P  YALVVSTE+VS TW
Sbjct  229   SLSAMVINHYKLRHNINSFNLGGMGCSAGIIAIDLAKDLLNAYPGSYALVVSTEVVSNTW  288

Query  932   YSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEE  1111
             Y GN   ML+PNCFFR G +AVLLS+ R D   +KY  + +VRTH+G  +R+F+ ++ +E
Sbjct  289   YGGNEVDMLLPNCFFRMGAAAVLLSSCRLDKWRSKYEFKQLVRTHKGMDNRSFKCMHLKE  348

Query  1112  DVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYI  1291
             D E  +GL +SK+++EVGG ALKANITTLGPLVLP++EQ++FF  L+ +K    KTKPYI
Sbjct  349   DAEGRQGLSVSKEMIEVGGHALKANITTLGPLVLPVSEQVHFFTNLLLKK----KTKPYI  404

Query  1292  PDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             PDY  AFEH CI A SK +LDE+ +NL L+E+ MEASR TL RFGNT
Sbjct  405   PDYKQAFEHICILATSKKVLDEIHQNLELTEELMEASRKTLERFGNT  451



>gb|ABF94313.1| fiddlehead, putative, expressed [Oryza sativa Japonica Group]
Length=512

 Score =   486 bits (1251),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 241/415 (58%), Positives = 313/415 (75%), Gaps = 19/415 (5%)
 Frame = +2

Query  236   ATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPM  415
             AT+P++ +V G EVGS+ R E +W K+W      D   V ++ L +L FT+S+Y MS+P 
Sbjct  34    ATIPVIVLVCGAEVGSLSRDE-LWRKVW-GEATYDLATV-LAFLAVLAFTISVYIMSRPR  90

Query  416   PIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSI  595
             P+YL+DFAC KP+D+LKV+K +FID+ARKSG FDE +L +  R+L  SGIGDE+Y+P+ +
Sbjct  91    PVYLIDFACYKPADELKVSKAEFIDLARKSGKFDEDSLAFQSRLLAKSGIGDESYMPRCV  150

Query  596   GCP-EKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
               P      +   R EAS  +F A+D++ +K R+R +D+G+LVVNC+ FNPTPSLSAMI+
Sbjct  151   FEPGTNCATMKEGRAEASAAMFAALDELFDKCRVRPKDVGVLVVNCSLFNPTPSLSAMIV  210

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGMGCSAG+IA+DLARD+L+A+    A+VVSTE VS TWY+G  RS
Sbjct  211   NHYKMRGNILSYNLGGMGCSAGVIAVDLARDMLQASGAGLAVVVSTEAVSFTWYAGKRRS  270

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             MLIPN FFR GC+AVLLSNRRRD+  AKY+L+HIVRTH+GA DR+FRS+YQEED +RIKG
Sbjct  271   MLIPNAFFRAGCAAVLLSNRRRDFHRAKYQLEHIVRTHKGADDRSFRSVYQEEDEQRIKG  330

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTK----------  1282
             L IS+DLVEVGG ALK NITTLGPLVLP +EQ+ FF  ++ R LF +KT           
Sbjct  331   LSISRDLVEVGGHALKTNITTLGPLVLPFSEQILFFAGVLFRHLFPSKTSAPPPPSADGD  390

Query  1283  -----PYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
                  PYIPD+  AFEHFC++AAS+ +L+ L+ NL L + ++EASRA LHRFGNT
Sbjct  391   ASAAAPYIPDFKRAFEHFCMHAASRDVLEHLQGNLGLRDGDLEASRAALHRFGNT  445



>ref|XP_006453152.1| hypothetical protein CICLE_v10008053mg [Citrus clementina]
 gb|ESR66392.1| hypothetical protein CICLE_v10008053mg [Citrus clementina]
Length=508

 Score =   485 bits (1249),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 250/461 (54%), Positives = 338/461 (73%), Gaps = 16/461 (3%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             EH LLS EI+NRG+E SGP AG+L+FSVRV+RRLPDF+ SV L YV+LGY Y++++ + L
Sbjct  4     EHKLLSPEIVNRGVENSGPYAGSLSFSVRVQRRLPDFLNSVNLNYVRLGYGYLLSHGVYL  63

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVN-MSLLGLLGFTLSIYFMSK  409
                 P+L V+FG ++G +   + +          P F   + + L GLLG    IY  + 
Sbjct  64    IPA-PILIVIFGAQIGKLTFSDLL----------PTFDTTDAVFLFGLLGILAYIYLETT  112

Query  410   PMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPK  589
             P  IYLVDFAC +P ++LK++K +FI+ AR+SG F++ +LE+ +R++++SG+GDETY+P+
Sbjct  113   PCWIYLVDFACYRPPNELKISKKEFIEQARESGNFNDASLEFKQRIIKNSGLGDETYLPR  172

Query  590   SIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMI  769
             ++ CP     L + R EA+ ++F AID +L  T+IR +DI +LVVNC   N TPSLSAM+
Sbjct  173   AVFCPGYRPNLKDGREEAAMVLFGAIDDLLAATKIRPKDIRVLVVNCGVLNTTPSLSAMV  232

Query  770   INHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHR  949
             INHYK++ NI S NLGGMGCSAGIIA+DLA+D+L A P  YALVVSTE+VS TWY GN  
Sbjct  233   INHYKLRHNINSFNLGGMGCSAGIIAIDLAKDLLNAYPGSYALVVSTEVVSNTWYGGNEV  292

Query  950   SMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIK  1129
              ML+PNCFFR G +AVLLS+ R D   +KY  + +VRTH+G  +R+F+ ++ +ED E  +
Sbjct  293   DMLLPNCFFRMGAAAVLLSSCRLDKWRSKYEFKQLVRTHKGMDNRSFKCMHLKEDAEGRQ  352

Query  1130  GLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIA  1309
             GL +SK+++EVGG ALKANITTLGPLVLP++EQ++FF  L+ +K    KTKPYIPDY  A
Sbjct  353   GLSVSKEMIEVGGHALKANITTLGPLVLPVSEQVHFFTNLLLKK----KTKPYIPDYKQA  408

Query  1310  FEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             FEH CI A SK +LDE+ +NL L+E+ MEASR TL RFGNT
Sbjct  409   FEHICILATSKKVLDEIHQNLELTEELMEASRKTLERFGNT  449



>gb|EMT17854.1| 3-ketoacyl-CoA synthase 10 [Aegilops tauschii]
Length=561

 Score =   481 bits (1237),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 239/416 (57%), Positives = 315/416 (76%), Gaps = 20/416 (5%)
 Frame = +2

Query  236   ATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPM  415
             AT+P++ +V G EVGS+ R E +W K+W+ +   D   V ++ L +L FT+S+Y MS+P 
Sbjct  82    ATIPVIVLVCGAEVGSLSRDE-LWRKVWDEAT-YDLATV-LAFLAVLAFTISVYIMSRPR  138

Query  416   PIYLVDFACCKPSDDLKV-TKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
             PIYL+DFA  KP+D+LKV +K +FID+ARKSG FDE++L +  R+L  SGIGDE+Y+P+ 
Sbjct  139   PIYLIDFATYKPADELKVVSKAEFIDLARKSGKFDEESLAFQARLLAKSGIGDESYMPRC  198

Query  593   IGCPE-KIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMI  769
             +  P+     +   R EAS  +F A+D++ +K R+R +D+G+LVVNC+ FNPTPSLSAMI
Sbjct  199   VFQPDANCATMKEGRAEASAAMFAALDELFDKCRVRPKDVGVLVVNCSLFNPTPSLSAMI  258

Query  770   INHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHR  949
             +NHYKM+ NI+S NLGGMGCSAG+I++DLARD+L+A+    A+VVSTE VS TWY+G  R
Sbjct  259   VNHYKMRGNILSYNLGGMGCSAGVISIDLARDMLQASGAGLAVVVSTEAVSFTWYAGKRR  318

Query  950   SMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIK  1129
             SMLIPN FFR G +AVLLSNRRRD+R AKY+L+H+VRTH+GA DRAFRS+YQEED +RIK
Sbjct  319   SMLIPNAFFRAGAAAVLLSNRRRDFRRAKYQLEHVVRTHKGADDRAFRSVYQEEDEQRIK  378

Query  1130  GLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFG-------------  1270
             GL IS+DLVEVGG ALK NITTLGPLVLP +EQL FF  ++ R L+              
Sbjct  379   GLSISRDLVEVGGHALKTNITTLGPLVLPFSEQLLFFAGVLFRHLYPSQPSTPPPPAANG  438

Query  1271  --AKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
               +   PYIPD+  AFEHFC++AAS+ +L+ L+RNL L + ++EASRA LHRFGNT
Sbjct  439   DTSAAAPYIPDFKRAFEHFCMHAASRDVLEHLQRNLGLRDADLEASRAALHRFGNT  494



>ref|XP_011019936.1| PREDICTED: 3-ketoacyl-CoA synthase 15-like [Populus euphratica]
Length=509

 Score =   477 bits (1228),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 249/460 (54%), Positives = 334/460 (73%), Gaps = 13/460 (3%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+NRGIE SGP AG+L FSVRVRR LPDF+ SV LKYVKLGY Y+++  +  
Sbjct  4     EQELLSTEIVNRGIENSGPYAGSLNFSVRVRRGLPDFLNSVNLKYVKLGYSYLLSP-VFY  62

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
               T P+L V+F  ++G +         IW++       +  + ++GLL   + IY    P
Sbjct  63    FLTAPVLMVIFSAQIGKLF--------IWQDFCPKCDPIDALFIVGLLSLIIYIYLYLSP  114

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
                YLVDFAC +P ++LK++KD+FI++A+KSG F+   +E+ +R L++SGIGDETY+P+ 
Sbjct  115   RSTYLVDFACYRPPNELKISKDEFIELAKKSGKFNGAAIEFQRRALKNSGIGDETYMPRI  174

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             +  P     L + R EA+ ++F A+D +L  T+IR +DI IL+VNC   N TPSLS+M+I
Sbjct  175   VFQPGHKITLKDGREEAAMVMFGAVDDLLAATKIRPKDIKILIVNCGILNTTPSLSSMVI  234

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYK++ +I + NLGGMGC+AGIIA+DLA+D+L A P  YALVVSTE VS TWYSGN  +
Sbjct  235   NHYKLRHDIQNFNLGGMGCAAGIIAIDLAKDLLNAYPGCYALVVSTEAVSYTWYSGNDMN  294

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             ML+PNCFFR G +A+LLS+ R D   +KY L+ +VRTH+G  +R+F+SI+  ED ER +G
Sbjct  295   MLLPNCFFRLGAAAMLLSSCRLDRWQSKYELKQLVRTHKGMDNRSFKSIHLREDAERKQG  354

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAF  1312
             L +SKDLVEVGG ALKANITTLGPLVLP++EQ++FF  L    LF  K +PYIP+Y +AF
Sbjct  355   LSVSKDLVEVGGHALKANITTLGPLVLPVSEQVHFFTNL----LFKKKNRPYIPNYKLAF  410

Query  1313  EHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             EH CI A SK +LDE+++NL L+E+ MEAS+ TL RFGNT
Sbjct  411   EHVCILATSKKVLDEIQKNLELTEEYMEASKKTLERFGNT  450



>ref|XP_006408788.1| hypothetical protein EUTSA_v10001951mg [Eutrema salsugineum]
 gb|ESQ50241.1| hypothetical protein EUTSA_v10001951mg [Eutrema salsugineum]
Length=421

 Score =   473 bits (1217),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 223/347 (64%), Positives = 277/347 (80%), Gaps = 23/347 (7%)
 Frame = +2

Query  461   LKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGE  640
             ++VTK++FID+ARKSG FDE+ L + KR+LE+SG+GDETY+P+SI   E I  +   R E
Sbjct  9     VQVTKEEFIDLARKSGKFDEETLGFKKRILEASGVGDETYVPRSISSSENITTMKEGREE  68

Query  641   ASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGG  820
             AS +IF A+D++ EKTR++ +D+G+LVVNC+ FNPTPSLSAM+INHY+M+ NI+S NLGG
Sbjct  69    ASMVIFGALDELFEKTRVKPKDVGVLVVNCSIFNPTPSLSAMVINHYRMRGNILSYNLGG  128

Query  821   MGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVL  1000
             MGCSAGIIA+DLARD+L++NPN YA+VVSTE+V   WY G  +SM+IPNCFFR GCSAV+
Sbjct  129   MGCSAGIIAVDLARDMLQSNPNSYAVVVSTEMVGYNWYVGRDKSMVIPNCFFRMGCSAVM  188

Query  1001  LSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALK  1180
             LSNRRRD+RHAKYRL+HIVRTH+ A DR+FRS+YQEED +  KGLKIS+DL+EVGGEALK
Sbjct  189   LSNRRRDFRHAKYRLEHIVRTHKAADDRSFRSVYQEEDEQGFKGLKISRDLMEVGGEALK  248

Query  1181  ANITTLGPLVLPLTEQLYFFQTLIRRKLF-----------------GAK------TKPYI  1291
              NITTLGPLVLP +EQL FF  L+RR                    GAK      +KPYI
Sbjct  249   TNITTLGPLVLPFSEQLLFFAALLRRTFSPAAKTTTSSSSATAKTNGAKSSSSDISKPYI  308

Query  1292  PDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             PDY +AFEHFC +AASK +L+EL++NL LSE+NMEASR TLHRFGNT
Sbjct  309   PDYKLAFEHFCFHAASKTVLEELQKNLGLSEENMEASRMTLHRFGNT  355



>ref|XP_011010254.1| PREDICTED: 3-ketoacyl-CoA synthase 15-like [Populus euphratica]
Length=509

 Score =   475 bits (1222),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 249/460 (54%), Positives = 333/460 (72%), Gaps = 13/460 (3%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+NRGIE SGP AG+L FSVRVRR LPDF+ SV LKYVKLGY Y+++  +  
Sbjct  4     EQELLSTEIVNRGIENSGPYAGSLNFSVRVRRGLPDFLNSVNLKYVKLGYSYLLSP-VFY  62

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
               T P+L V+F  ++G +         IW +       +  + ++GLL   + IY    P
Sbjct  63    FLTAPVLMVIFSAQIGKLF--------IWRDFCLKCDPIDALFIVGLLSLIIYIYLYLSP  114

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
                YLVDFAC +P ++LK++KD+FI++A+KSG F+   +E+ +R L++SGIGDETY+P+ 
Sbjct  115   RSTYLVDFACYRPPNELKISKDEFIELAKKSGKFNGAAIEFQRRALKNSGIGDETYMPRI  174

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             +  P     L + R EA+ ++F A+D +L  T+IR +DI IL+VNC   N TPSLS+M+I
Sbjct  175   VFQPGHKITLKDGREEAAMVMFGAVDDLLAATKIRPKDIKILIVNCGILNTTPSLSSMVI  234

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYK++ +I + NLGGMGC+AGIIA+DLA+D+L A P  YALVVSTE VS TWYSGN  +
Sbjct  235   NHYKLRHDIQNFNLGGMGCAAGIIAIDLAKDLLNAYPGCYALVVSTEAVSYTWYSGNDMN  294

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             ML+PNCFFR G +A+LLS+ R D   +KY L+ +VRTH+G  +R+F+SI+  ED ER +G
Sbjct  295   MLLPNCFFRLGAAAMLLSSCRLDRWRSKYELKQLVRTHKGMDNRSFKSIHLREDAERKQG  354

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAF  1312
             L +SKDLVEVGG ALKANITTLGPLVLP++EQ++FF  L    LF  K +PYIP+Y +AF
Sbjct  355   LSVSKDLVEVGGHALKANITTLGPLVLPVSEQVHFFTNL----LFKKKNRPYIPNYKLAF  410

Query  1313  EHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             EH CI A SK +LDE+++NL L+E+ MEAS+ TL RFGNT
Sbjct  411   EHVCILATSKKVLDEIQKNLELTEEYMEASKKTLERFGNT  450



>gb|EPS61363.1| hypothetical protein M569_13435, partial [Genlisea aurea]
Length=501

 Score =   473 bits (1218),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 258/443 (58%), Positives = 328/443 (74%), Gaps = 14/443 (3%)
 Frame = +2

Query  119   ALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGE  298
             A++FSVRVRRRLPDF+QSVKLKYVKLGY+Y++ + L L   VPL  ++        + G 
Sbjct  1     AMSFSVRVRRRLPDFLQSVKLKYVKLGYHYLLTHGLYLF-LVPLFLLI-------AIPGA  52

Query  299   KVWGKIWENSGGPDFGVVNMSL-LGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTK  475
             +   +I  +  G    V N+ L L  L F+  +Y  S+P P+YL+DFAC +P+DD KV+K
Sbjct  53    EELRRIILDGAGDYHHVTNVVLALSALVFSAYVYLASRPCPVYLLDFACYRPTDDCKVSK  112

Query  476   DQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLI  655
              +FI +A KSG FD+ +LE+ +R+LESSG+GDETY+ KSI   E        R EAS +I
Sbjct  113   KEFIHLASKSGGFDDDSLEFQRRILESSGLGDETYLRKSIFALETTATTEEGRAEASAVI  172

Query  656   FEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSA  835
             F A+D++ E TRIR  D+GIL+V+C+ FNPTPSLSA IINHYK++ NI+S  LGGMGCSA
Sbjct  173   FGALDELFETTRIRPSDVGILIVSCSIFNPTPSLSAFIINHYKIRGNILSFTLGGMGCSA  232

Query  836   GIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRR  1015
              I+ALDLA D+L++NPNRYA+VVSTE+ +  +Y G  RSMLIPNC+FR GCSAVLLSN R
Sbjct  233   SIVALDLALDLLQSNPNRYAVVVSTEMAAYNFYRGKERSMLIPNCYFRMGCSAVLLSNHR  292

Query  1016  RDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITT  1195
             RD R AKY L+HIVRTH+G++DR+FRS  Q  D ER+KGL++SKDL+E+GGEALK NITT
Sbjct  293   RDRRRAKYSLEHIVRTHKGSEDRSFRSTQQTHDKERVKGLRMSKDLMEIGGEALKTNITT  352

Query  1196  LGPLVLPLTEQLYFFQTLIRRKLFGAKTKP-----YIPDYTIAFEHFCINAASKMLLDEL  1360
             L PLVLP++EQL FF +LIR    G  T       YIPDY +AFEHFC++A SK +LDEL
Sbjct  353   LSPLVLPISEQLLFFSSLIREFFSGKGTDSSSFNLYIPDYKLAFEHFCLHAPSKSVLDEL  412

Query  1361  KRNLRLSEQNMEASRATLHRFGN  1429
             +RNL L+  NME SRA LHRFGN
Sbjct  413   QRNLNLTNNNMEPSRAVLHRFGN  435



>ref|XP_002530372.1| acyltransferase, putative [Ricinus communis]
 gb|EEF32005.1| acyltransferase, putative [Ricinus communis]
Length=503

 Score =   473 bits (1217),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 252/460 (55%), Positives = 330/460 (72%), Gaps = 19/460 (4%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+NRGIE     AG+L FSVRVRRRLPDF+ SV LKYVKLGY Y++++    
Sbjct  8     EQDLLSTEIVNRGIE-----AGSLNFSVRVRRRLPDFLNSVNLKYVKLGYAYLLSHSFYF  62

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
               + P+L ++F V +G V          WE+       +  + LLG+L   + IY    P
Sbjct  63    L-SAPILILIFSVALGKVT---------WEDFCPKCDPIDALFLLGVLALIIYIYLDLTP  112

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
                +LVDFAC +P D LK++K++FI +ARKSG FD+  +E+ +R L++SGIGDETY+P+S
Sbjct  113   TSTFLVDFACFRPPDHLKISKEEFIQLARKSGKFDQTAIEFQQRALKNSGIGDETYMPRS  172

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             +  P     L + R EA+ +IF A+D +L  T++R +DI ILVVNC   N TPSLSAM+I
Sbjct  173   VFQPGFKTNLKDGREEAAMVIFGAVDDLLATTKVRTKDIRILVVNCGILNTTPSLSAMVI  232

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYK++ NI S NLGGMGC+AGI+A+DLARD+L A P  YALVVSTE+VS TWYSG  + 
Sbjct  233   NHYKLRHNINSFNLGGMGCAAGIVAIDLARDLLNAYPGSYALVVSTEVVSYTWYSGIDQD  292

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             ML+PN FFR G +A+LLS+RR D   +KY L+ +VRTH+G  +R+F+SI+ +ED E  +G
Sbjct  293   MLLPNFFFRMGAAAMLLSSRRLDRWRSKYELKQLVRTHKGMDNRSFKSIHLKEDKEGRQG  352

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAF  1312
             L +SK+++EV G ALKANITTLGPLVLP++EQ+ FF  L    LF  KTKPYIPDY +AF
Sbjct  353   LSVSKEVIEVAGHALKANITTLGPLVLPVSEQVQFFTNL----LFKKKTKPYIPDYKLAF  408

Query  1313  EHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             EH CI AASK  LDEL++NL L+++ M+ASR TL RFGNT
Sbjct  409   EHVCIYAASKKGLDELQKNLELTDEYMDASRKTLQRFGNT  448



>gb|AAF73981.1|AF214506_1 fiddlehead protein [Arabidopsis thaliana]
Length=352

 Score =   459 bits (1182),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 227/354 (64%), Positives = 290/354 (82%), Gaps = 7/354 (2%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+NRGIEPSGP+AG+ TFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+ + L
Sbjct  6     EQDLLSTEIVNRGIEPSGPNAGSPTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINHAVYL  65

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L +VF  EVGS+ R E++W K+W+     D   V +   G+   T  +YFMS+P
Sbjct  66    A-TIPVLVLVFSAEVGSLSR-EEIWKKLWDY----DLATV-IGFFGVFVLTACVYFMSRP  118

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               +YL+DFAC KPSD+ KVTK++FI++ARKSG FDE+ L + KR+L++SGIGDETY+P+S
Sbjct  119   RSVYLIDFACYKPSDEHKVTKEEFIELARKSGKFDEETLGFKKRILQASGIGDETYVPRS  178

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             I   E I  +   R EAS +IF A+D++ EKTR++ +D+G+LVVNC+ FNPTPSLSAM+I
Sbjct  179   ISSSENITTMKEGREEASTVIFGALDELFEKTRVKPKDVGVLVVNCSIFNPTPSLSAMVI  238

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGMGCSAGIIA+DLARD+L++NPN YA+VVSTE+V   WY G+ +S
Sbjct  239   NHYKMRGNILSYNLGGMGCSAGIIAIDLARDMLQSNPNSYAVVVSTEMVGYNWYVGSDKS  298

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEED  1114
             M+IPNCFFR GCSAV+LSNRRRD+RHAKYRL+HIVRTH+ A DR+FRS+YQEED
Sbjct  299   MVIPNCFFRMGCSAVMLSNRRRDFRHAKYRLEHIVRTHKAADDRSFRSVYQEED  352



>ref|XP_010067615.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Eucalyptus grandis]
 gb|KCW65776.1| hypothetical protein EUGRSUZ_G03137 [Eucalyptus grandis]
Length=516

 Score =   464 bits (1193),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 242/465 (52%), Positives = 336/465 (72%), Gaps = 14/465 (3%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             MA+ +  L STEI+NRGIE SGP AG++  SVRVRR LPDF+ SV LKYVKLGY+Y+I++
Sbjct  1     MARVDRELFSTEIVNRGIEDSGPYAGSVNISVRVRRALPDFLSSVDLKYVKLGYHYLISS  60

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLG-LLGFTLSIY  397
                  A  P+L  + GVE+G V+         W+ S  P+  + +   +G +LG  L +Y
Sbjct  61    GFYYVAA-PVLCGILGVEIGKVI--------AWKYSS-PESCLFDTVAVGVMLGLVLYVY  110

Query  398   FMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDET  577
                 P   YLVDFAC +P D+ K++K++FI++ARKSG + +  + + + +L+ SGIGDET
Sbjct  111   LGLVPRSTYLVDFACFRPPDEFKISKEEFIELARKSGKYSDGAIVFQEGVLKRSGIGDET  170

Query  578   YIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSL  757
             Y+P+++  PE    L + R EAS +I   +D++L  T+++ +DIGILVVNC   +PTPSL
Sbjct  171   YLPRAVFRPEPTITLKDGREEASMVIHGVVDELLSATKVQPQDIGILVVNCGFLSPTPSL  230

Query  758   SAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYS  937
             SAM+INHYK++++I S NLGGMGC+AG+IA+DLARD+L A+P RYALVVSTE VS TWY 
Sbjct  231   SAMLINHYKLRQDIHSFNLGGMGCAAGVIAVDLARDLLAAHPGRYALVVSTEAVSYTWYD  290

Query  938   GNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDV  1117
             GN   ML+PNCFFR G +AVLLS+   D   +KY L+ +VRTH+GA++R+FR I+ +ED 
Sbjct  291   GNDFDMLLPNCFFRMGAAAVLLSSCHLDRWRSKYELKQLVRTHKGAEERSFRCIHMKEDT  350

Query  1118  ERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPD  1297
                +GL +SKD++ +GG ALK NITTLGPLVLP++EQL+FF   + +K     +KPY+P+
Sbjct  351   RGARGLSVSKDVIGIGGNALKDNITTLGPLVLPVSEQLHFFNNFLFKK---ETSKPYLPN  407

Query  1298  YTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             Y +AFEH CI A S+ +LDE+++NL L+++ MEASR TL RFGNT
Sbjct  408   YKLAFEHVCILATSRKVLDEIQKNLDLTDEYMEASRRTLERFGNT  452



>ref|XP_006594591.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Glycine max]
Length=509

 Score =   456 bits (1173),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 244/464 (53%), Positives = 328/464 (71%), Gaps = 14/464 (3%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             M+K+     STEI+ RG+E SGP+AG L+FSV+V+ RLPDF+ SV LKYVKLGY Y+I++
Sbjct  1     MSKDREEF-STEIVQRGVENSGPNAGFLSFSVKVKPRLPDFLSSVNLKYVKLGYGYLISH  59

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYF  400
                     P L   F   +G        W  ++E  G  +   ++    GLLG  L  Y 
Sbjct  60    -RLYLLLAPPLLAAFIARIGKF-----TWQDLYEKYGFIEILFIS----GLLGLMLYFYI  109

Query  401   MSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETY  580
                P   YL+DF+C +PSD+ K++K +FI++A+KSG F++  +E+ +R+L+ SGIGDETY
Sbjct  110   DLTPGSTYLLDFSCFRPSDECKISKAEFIELAKKSGNFNDTAIEFQERVLKKSGIGDETY  169

Query  581   IPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLS  760
             +PK +  P     LN+ R E S ++F AI  +L  T+++ +DI IL+VNC   N TPSLS
Sbjct  170   LPKRVFHPGYRNSLNDGRQEVSMVMFGAIKDLLAATKVKPKDIRILIVNCGILNTTPSLS  229

Query  761   AMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSG  940
             +MI+NH+K++ +I S NLGGMGC+AGI A+DLA+D+L A P  YALVVSTE VS+TWYSG
Sbjct  230   SMIVNHFKLRHDIHSFNLGGMGCAAGITAIDLAKDLLDAYPRTYALVVSTEAVSSTWYSG  289

Query  941   NHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVE  1120
             N   ML+PNCFFR G +A++LSN   D   AKY L+ +VRTH+G  +R+++SI+Q ED E
Sbjct  290   NDIGMLLPNCFFRMGAAAIMLSNFHLDRWCAKYELKQLVRTHKGMNNRSYKSIHQREDSE  349

Query  1121  RIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDY  1300
               KG+ +SKD++EVGG ALKANITTLGPLVLP++EQL+FF  LI +K    KTKPYIPDY
Sbjct  350   GRKGISVSKDVIEVGGHALKANITTLGPLVLPVSEQLHFFTNLIFKK---RKTKPYIPDY  406

Query  1301  TIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
              +AFEH CI A SK +LDE+++NL L+E+ MEASR TL RFGNT
Sbjct  407   KLAFEHMCILATSKKVLDEIQKNLELTEEYMEASRKTLERFGNT  450



>ref|XP_006649502.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA synthase 10-like 
[Oryza brachyantha]
Length=478

 Score =   454 bits (1167),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 248/464 (53%), Positives = 326/464 (70%), Gaps = 55/464 (12%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             MA+E+  LLSTEI+NRG+EPSGPDAG+ TFSVRVRRRLPDF+QSV LKYV+LGY+Y+I++
Sbjct  1     MAREQA-LLSTEIVNRGVEPSGPDAGSPTFSVRVRRRLPDFLQSVNLKYVRLGYHYLISH  59

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYF  400
              + LA T+P++ +V G EVGS+ R E +W K+W      D   V ++ L +L FT+S+Y 
Sbjct  60    GVYLA-TIPVIVLVCGAEVGSLSRDE-LWRKVW-GEATYDLATV-LAFLAVLAFTISVYI  115

Query  401   MSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETY  580
             MS+P P+YL+DFAC KP+D+LKV+K +F+D+ARKSG FDE +L +  R+L  SGIGDE+Y
Sbjct  116   MSRPRPVYLIDFACYKPADELKVSKAEFVDLARKSGKFDEDSLAFQSRLLAKSGIGDESY  175

Query  581   IPKSIGCP-EKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSL  757
             +P+ +  P      +   R EAS  +F A+D++ +K R+R +D+G+LVVNC+ FNPTPSL
Sbjct  176   MPRCVFEPGTNCATMKEGRAEASAAMFAALDELFDKCRVRPKDVGVLVVNCSLFNPTPSL  235

Query  758   SAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYS  937
             SAMI+NHYKM+ NI+S NLGGMGCSAG+IA+DLARD+L+A+    A+VVSTE VS TWY+
Sbjct  236   SAMIVNHYKMRGNILSYNLGGMGCSAGVIAVDLARDMLQASGAGLAVVVSTEAVSFTWYA  295

Query  938   GNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDV  1117
             G  RSMLIPN FFR GC+AVLLSNRRRD+  AKY+L+HIVRTH+GA DR+FRS+YQEED 
Sbjct  296   GKRRSMLIPNAFFRAGCAAVLLSNRRRDFHRAKYQLEHIVRTHKGADDRSFRSVYQEEDE  355

Query  1118  ERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPD  1297
             +RIKGL                                                   IPD
Sbjct  356   QRIKGLSX-------------------------------------------------IPD  366

Query  1298  YTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGN  1429
             +  AFEHFC++AAS+ +L+ L+ NL L   ++EASRA L R G 
Sbjct  367   FKRAFEHFCMHAASRDVLEHLQSNLGLRNGDLEASRAALPRSGT  410



>ref|XP_002273798.1| PREDICTED: 3-ketoacyl-CoA synthase 15-like [Vitis vinifera]
Length=506

 Score =   454 bits (1169),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 242/464 (52%), Positives = 327/464 (70%), Gaps = 15/464 (3%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             MA      LSTEI+NRGI  SGP AG+L+FSVRVRR LPDF+ SV LKYVKLGY Y+I++
Sbjct  1     MASHNQEHLSTEIVNRGIADSGPYAGSLSFSVRVRRGLPDFLNSVNLKYVKLGYGYLISH  60

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYF  400
                   T P++ V+FG ++G +          W++       +  + ++GLL   L I+ 
Sbjct  61    GFYFL-TAPVVLVIFGAQIGKL---------TWDDFCLKCDLMNALFMMGLLSLILYIHL  110

Query  401   MSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETY  580
               KP   YLVDFAC +P D+LK +K++FI++ARKSG FD+  +E+ +R+L++SGIGDETY
Sbjct  111   DLKPRSTYLVDFACYRPPDELKTSKEKFIELARKSGNFDDVAIEFQQRVLKNSGIGDETY  170

Query  581   IPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLS  760
             +P  I      + L + R EA+ ++F A++++L  T+I+ +DI IL+VNC   N TPSLS
Sbjct  171   LPTGIFHAGHRRTLKDGREEAAMVMFGAVNELLAATKIKIKDIRILIVNCGMLNTTPSLS  230

Query  761   AMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSG  940
             AM++NH+K+   + S NLGGMGC+AG+IA+DLARD+L A    YALVVSTE VS +WYSG
Sbjct  231   AMLVNHFKLGHYVQSFNLGGMGCAAGVIAIDLARDLLNAYRGSYALVVSTEAVSYSWYSG  290

Query  941   NHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVE  1120
                 ML+PNCFFR G +A+LLSN   D   +KY L+ +VRTH+G  +R+F+SI  +ED E
Sbjct  291   KDIHMLLPNCFFRMGAAAMLLSNCHLDRWRSKYELKQLVRTHKGMDNRSFKSILLKEDGE  350

Query  1121  RIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDY  1300
               +GL +SKD+VEVG  ALK NITTLGPLVLP +EQL+FF TL+        +KPYIP+Y
Sbjct  351   GKQGLSVSKDVVEVGSHALKDNITTLGPLVLPFSEQLHFFTTLLFH-----NSKPYIPNY  405

Query  1301  TIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
              +AFEH CI A SK +LDE+++NL+L+E+ MEASR TL RFGNT
Sbjct  406   KLAFEHVCILATSKQVLDEIQKNLKLTEEYMEASRRTLERFGNT  449



>ref|XP_011078170.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Sesamum indicum]
Length=511

 Score =   454 bits (1169),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 237/460 (52%), Positives = 323/460 (70%), Gaps = 13/460 (3%)
 Frame = +2

Query  56    HHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLA  235
                LS EI +RGI+ SGPDAG+ +FSVRV R LPDF+ SV LK+VKLGY Y+IN+ + L 
Sbjct  7     QEFLSPEIFDRGIKQSGPDAGSPSFSVRVHRGLPDFLSSVNLKHVKLGYGYLINHGMYLT  66

Query  236   ATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNM-SLLGLLGFTLSIYFMSKP  412
               V +L V FG ++G +          W+     ++  +NM  LLG L   + +     P
Sbjct  67    G-VSILLVAFGTQIGKL---------TWDVCSFKNYNSMNMIPLLGFLCLLVYVCLDLTP  116

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
                YLVDFAC  P ++ K+TK+++I++A+KSG F++ ++++  R+L++SG+GDETY+P+ 
Sbjct  117   RSTYLVDFACYLPPNEFKITKEEYIELAKKSGQFNDTSIKFQWRVLKNSGLGDETYLPRV  176

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             +  P   + L   R EA+  +FE +D++L  T IR++DI ILVVNC   N TPSLSAM++
Sbjct  177   VFQPGYKRNLKQGREEAAAAMFEVVDELLAATDIRSKDIRILVVNCGVLNTTPSLSAMLV  236

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             N YK+   I S NLGGMGC+AGI A+DLA D+L A P  YAL+VSTE++ +TWY GN   
Sbjct  237   NRYKLSHRIQSFNLGGMGCAAGINAVDLADDLLNAYPGSYALIVSTEVIGSTWYGGNELD  296

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKG  1132
             ML+PNCF R G +AVLLSNRRRD   +KY L+ +VRTH+   +R+F+SI  +ED E  +G
Sbjct  297   MLLPNCFLRMGAAAVLLSNRRRDRWRSKYELKQLVRTHKAMDERSFKSIQLKEDSEGKEG  356

Query  1133  LKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAF  1312
             L +SKD++E GG ALKANITTLGPLVLP++EQ YFF++L+ +K   +  KPYIPDY +AF
Sbjct  357   LSVSKDVIEQGGNALKANITTLGPLVLPVSEQFYFFKSLLFKKT--STDKPYIPDYKLAF  414

Query  1313  EHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             EH CI A SK LLDE++ NL L+++ MEASR TL RFGNT
Sbjct  415   EHACILATSKKLLDEIQNNLELTDEYMEASRKTLERFGNT  454



>emb|CBI20747.3| unnamed protein product [Vitis vinifera]
Length=377

 Score =   449 bits (1154),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 213/344 (62%), Positives = 261/344 (76%), Gaps = 32/344 (9%)
 Frame = +2

Query  401   MSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETY  580
             MS+P  IYL+DFAC KP DDLK++K Q I+  R+SG  DE ++E+ KR+L SSGIGDETY
Sbjct  1     MSRPRSIYLIDFACFKPHDDLKLSKQQLIEAVRRSGKHDEASIEFQKRILMSSGIGDETY  60

Query  581   IPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLS  760
             IPK++   E    +   R EA  ++F A+D++ EKTR+R +D+G+LVVNC+ FNPTPSLS
Sbjct  61    IPKAVMAGENCATMKEGRAEAGMVMFGALDELFEKTRVRPKDVGVLVVNCSIFNPTPSLS  120

Query  761   AMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSG  940
             AMIINHYKM+ NI+S NLGGMGCSAG+IALDLARD+L +NPN YA+VVSTE+V   WY G
Sbjct  121   AMIINHYKMRGNILSFNLGGMGCSAGVIALDLARDMLESNPNNYAVVVSTEMVGYNWYPG  180

Query  941   NHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVE  1120
               RSM+IPNCFFR GCSA+LLSNRR DYRHAKYRL+HIVRTH+GA DR+FR +YQEED E
Sbjct  181   KERSMIIPNCFFRMGCSALLLSNRRSDYRHAKYRLEHIVRTHKGADDRSFRCVYQEEDSE  240

Query  1121  RIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDY  1300
             R KGL++SKDL+E+GG+ALK NITTLGPL                               
Sbjct  241   RFKGLRVSKDLIEIGGDALKTNITTLGPL-------------------------------  269

Query  1301  TIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
              +AFEHFC++AASK +LDEL+RNL LS+ N+EASR TLHRFGNT
Sbjct  270   -LAFEHFCVHAASKTVLDELQRNLGLSDSNVEASRMTLHRFGNT  312



>ref|XP_003547147.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Glycine max]
Length=509

 Score =   451 bits (1159),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 244/465 (52%), Positives = 328/465 (71%), Gaps = 16/465 (3%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             M+KE     STEI+ RG+E SGP+AG+L+FSV+VR RLPDF+ SV LKYVKLGY Y+I++
Sbjct  1     MSKESEEF-STEIVQRGVENSGPNAGSLSFSVKVRPRLPDFLSSVNLKYVKLGYGYLISH  59

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLL-GLLGFTLSIY  397
                     P L  VF   +G        W  ++E      +G++ +  +  LL   L  Y
Sbjct  60    -RLYLLLAPPLLAVFIARIGKF-----TWQDLYEK-----YGLIEVLFISALLCLMLYFY  108

Query  398   FMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDET  577
                 P   YL+DF+C  PS++ K++K +FI +A+KS  F+E  +E+ +R+L+ SGIGDET
Sbjct  109   ADLTPGSTYLLDFSCFLPSNEYKISKAEFIQLAKKSRNFNETAIEFQERVLKKSGIGDET  168

Query  578   YIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSL  757
             Y+PK +  P     LN+ R E S ++F AI  +L  T+++ +DI IL+VNC   N TPSL
Sbjct  169   YLPKGVFRPGYRNSLNDGRQEVSMVMFGAIKDLLAATKVKPKDIRILIVNCGILNTTPSL  228

Query  758   SAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYS  937
             S+MI+NH+K++ +I S NLGGMGC+AGI A+DLA+D+L A P  YALVVSTE VS+TWYS
Sbjct  229   SSMIVNHFKLRHDIHSFNLGGMGCAAGITAIDLAKDLLDAYPRTYALVVSTEAVSSTWYS  288

Query  938   GNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDV  1117
             GN   ML+PNCFFR G +A++LSN   D   AKY L+ +VRTH+G  +R+++SI+Q+ED 
Sbjct  289   GNDIDMLLPNCFFRMGAAAIMLSNFCLDRWRAKYELKQLVRTHKGMDNRSYKSIHQKEDS  348

Query  1118  ERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPD  1297
             E  KG+ +SKD++EVGG ALKANITTLGPLVLP++EQL+FF  LI +K    KTKPYIPD
Sbjct  349   EGRKGISVSKDVIEVGGHALKANITTLGPLVLPVSEQLHFFTNLIFKK---KKTKPYIPD  405

Query  1298  YTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             Y +AFEH CI A SK +LDE+++NL L+E+ MEASR TL RFGNT
Sbjct  406   YKLAFEHMCILATSKKVLDEIQKNLELTEEYMEASRKTLERFGNT  450



>gb|AAF73974.1|AF214492_1 fiddlehead protein [Arabidopsis thaliana]
 gb|AAF73975.1|AF214494_1 fiddlehead protein [Arabidopsis thaliana]
Length=351

 Score =   445 bits (1144),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 221/347 (64%), Positives = 283/347 (82%), Gaps = 7/347 (2%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCL  232
             E  LLSTEI+NRGIEPSGP+AG+ TFSVRVRRRLPDF+QSV LKYVKLGY+Y+IN+ + L
Sbjct  6     EQDLLSTEIVNRGIEPSGPNAGSPTFSVRVRRRLPDFLQSVNLKYVKLGYHYLINHAVYL  65

Query  233   AATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKP  412
             A T+P+L +VF  EVGS+ R E++W K+W+     D   V +   G+   T  +YFMS+P
Sbjct  66    A-TIPVLVLVFSAEVGSLSR-EEIWKKLWDY----DLATV-IGFFGVFVLTACVYFMSRP  118

Query  413   MPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKS  592
               +YL+DFAC KPSD+ KVTK++FI++ARKSG FDE+ L + KR+L++SGIGDETY+P+S
Sbjct  119   RSVYLIDFACYKPSDEHKVTKEEFIELARKSGKFDEETLGFKKRILQASGIGDETYVPRS  178

Query  593   IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMII  772
             I   E I  +   R EAS +IF A+D++ EKTR++ +D+G+LVVNC+ FNPTPSLSAM+I
Sbjct  179   ISSSENITTMKEGREEASTVIFGALDELFEKTRVKPKDVGVLVVNCSIFNPTPSLSAMVI  238

Query  773   NHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRS  952
             NHYKM+ NI+S NLGGMGCSAGIIA+DLARD+L++NPN YA+VVSTE+V   WY G+ +S
Sbjct  239   NHYKMRGNILSYNLGGMGCSAGIIAIDLARDMLQSNPNSYAVVVSTEMVGYNWYVGSDKS  298

Query  953   MLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFR  1093
             M+IPNCFFR GCSAV+LSNRRRD+RHAKYRL+HIVRTH+ A DR+FR
Sbjct  299   MVIPNCFFRMGCSAVMLSNRRRDFRHAKYRLEHIVRTHKAADDRSFR  345



>ref|XP_007148156.1| hypothetical protein PHAVU_006G184900g [Phaseolus vulgaris]
 gb|ESW20150.1| hypothetical protein PHAVU_006G184900g [Phaseolus vulgaris]
Length=509

 Score =   451 bits (1159),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 241/466 (52%), Positives = 332/466 (71%), Gaps = 18/466 (4%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             M+KE     STEI+ RG+E SGP+AG+++FSVRVR RLPDF+ SV LKYVKLGY Y+I++
Sbjct  1     MSKESEDF-STEIVQRGVENSGPNAGSISFSVRVRPRLPDFLSSVNLKYVKLGYGYLISH  59

Query  221   WLCLAATVPLLTVVFGVEVGSVMR-GEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIY  397
              L L    P       +  G V R G   W  +++      +G++++  +  L F L  +
Sbjct  60    RLYLLLAPP-------LLAGFVARIGNFTWHDLYDK-----YGLIDILFISALLFILLYF  107

Query  398   FMS-KPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDE  574
             ++   P   YL+DF+C +PS++ K++K +FI++A+KSG F++   E+ +R+L+ SG+GDE
Sbjct  108   YIDFTPGSTYLLDFSCFRPSNEYKISKAEFIELAKKSGNFNDATTEFQERVLKKSGMGDE  167

Query  575   TYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPS  754
             TY+PK +  P     L + R E S ++F AI+ +L  T+++A+DI IL+VNC   N TPS
Sbjct  168   TYLPKGVFRPGYRNSLKDGREEVSMVMFGAINDLLAATKVKAKDITILIVNCGILNTTPS  227

Query  755   LSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWY  934
             LS+MI+NH+K++ +I S NLGGMGC AGI A+DLA+D+L A P  YALVVSTE VS+TWY
Sbjct  228   LSSMIVNHFKLRHDIHSFNLGGMGCGAGITAIDLAKDLLDAYPRTYALVVSTEAVSSTWY  287

Query  935   SGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEED  1114
             +GN   M +PNCFFR G +A++LSN R D   AKY L+ +VRTH+G  +R+++SI+Q ED
Sbjct  288   TGNDIEMQLPNCFFRMGAAAIMLSNFRLDKWRAKYELKQLVRTHKGMDNRSYKSIHQRED  347

Query  1115  VERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIP  1294
              E  KGL +SKD++EVGG ALKANITTLGPLVLP++EQ +FF  LI +K    K KPYIP
Sbjct  348   SEGRKGLCVSKDIIEVGGHALKANITTLGPLVLPVSEQFHFFTNLILKK---KKAKPYIP  404

Query  1295  DYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             DY +AFEH CI A SK +LDE+++NL L+E+ MEASR TL RFGNT
Sbjct  405   DYKLAFEHMCILATSKKVLDEIQKNLELTEEYMEASRKTLERFGNT  450



>gb|ABF94314.1| fiddlehead, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAG87864.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94009.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87572.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99591.1| unnamed protein product [Oryza sativa Japonica Group]
Length=427

 Score =   447 bits (1151),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 219/360 (61%), Positives = 279/360 (78%), Gaps = 16/360 (4%)
 Frame = +2

Query  401   MSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETY  580
             MS+P P+YL+DFAC KP+D+LKV+K +FID+ARKSG FDE +L +  R+L  SGIGDE+Y
Sbjct  1     MSRPRPVYLIDFACYKPADELKVSKAEFIDLARKSGKFDEDSLAFQSRLLAKSGIGDESY  60

Query  581   IPKSIGCP-EKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSL  757
             +P+ +  P      +   R EAS  +F A+D++ +K R+R +D+G+LVVNC+ FNPTPSL
Sbjct  61    MPRCVFEPGTNCATMKEGRAEASAAMFAALDELFDKCRVRPKDVGVLVVNCSLFNPTPSL  120

Query  758   SAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYS  937
             SAMI+NHYKM+ NI+S NLGGMGCSAG+IA+DLARD+L+A+    A+VVSTE VS TWY+
Sbjct  121   SAMIVNHYKMRGNILSYNLGGMGCSAGVIAVDLARDMLQASGAGLAVVVSTEAVSFTWYA  180

Query  938   GNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDV  1117
             G  RSMLIPN FFR GC+AVLLSNRRRD+  AKY+L+HIVRTH+GA DR+FRS+YQEED 
Sbjct  181   GKRRSMLIPNAFFRAGCAAVLLSNRRRDFHRAKYQLEHIVRTHKGADDRSFRSVYQEEDE  240

Query  1118  ERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTK-----  1282
             +RIKGL IS+DLVEVGG ALK NITTLGPLVLP +EQ+ FF  ++ R LF +KT      
Sbjct  241   QRIKGLSISRDLVEVGGHALKTNITTLGPLVLPFSEQILFFAGVLFRHLFPSKTSAPPPP  300

Query  1283  ----------PYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
                       PYIPD+  AFEHFC++AAS+ +L+ L+ NL L + ++EASRA LHRFGNT
Sbjct  301   SADGDASAAAPYIPDFKRAFEHFCMHAASRDVLEHLQGNLGLRDGDLEASRAALHRFGNT  360



>ref|XP_010669633.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Beta vulgaris subsp. 
vulgaris]
Length=512

 Score =   450 bits (1158),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 241/458 (53%), Positives = 322/458 (70%), Gaps = 16/458 (3%)
 Frame = +2

Query  65    LSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATV  244
              ST+I+N G++  GP AG+L FS++VRR LP+F+ SV LKYVKLGY YVIN+   +   V
Sbjct  8     FSTDIVNTGVQDVGPYAGSLNFSIKVRRGLPNFLNSVNLKYVKLGYQYVINHGFYIL-IV  66

Query  245   PLLTVVFGVEVGSVMRGEKVWGKIWENSG-GPDFGVVNMSLLGLLGFTLSIYF-MSKPMP  418
             P + +    ++G +         IW++   G DF  V M  LGLL     +Y     P P
Sbjct  67    PFVAIFCSAQLGKL---------IWDDYDLGYDFSSVIM-FLGLLYLVHLVYVKFLLPRP  116

Query  419   IYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIG  598
             I+LVDFAC  P  +LKV+K++F+++ARKSG FDEK L + ++ ++ SGIGDETY+PK+I 
Sbjct  117   IFLVDFACYCPPKELKVSKEKFMELARKSGNFDEKTLRFQEKAIKLSGIGDETYLPKTIF  176

Query  599   CPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINH  778
              P   K L   R EA+ +IF A+D +L  T+I+ +DI IL+VNC+T N TPSLSAM+INH
Sbjct  177   HPGFNKNLKESREEAAMVIFGAVDDLLAATKIKPKDISILIVNCSTLNTTPSLSAMVINH  236

Query  779   YKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSML  958
             YK+K NI S NLGGMGC+AG +A+DLA+D+L   P  YALVVSTEIVS TWY+G    M+
Sbjct  237   YKLKNNIQSFNLGGMGCAAGTVAIDLAQDLLNVYPGSYALVVSTEIVSHTWYTGKDLDMM  296

Query  959   IPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLK  1138
             +PNCF R G +A+LLSNRR     AKY L+ +VRTH+G  +++F SIY +ED E   G+ 
Sbjct  297   LPNCFLRMGGAAMLLSNRRFARFKAKYELKQVVRTHKGIDNKSFNSIYLKEDEEGKLGIS  356

Query  1139  ISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEH  1318
             +SKD++E+GG A+KANITTLGPLVLP  EQ  FF TL+ +      ++PYIP+Y  AF+H
Sbjct  357   VSKDVLEIGGHAVKANITTLGPLVLPFAEQFQFFTTLLFK---NNSSRPYIPNYKQAFDH  413

Query  1319  FCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             FCI A SK +LDE ++NL L++++MEASR TL RFGNT
Sbjct  414   FCILATSKKVLDEFEKNLELTKEHMEASRKTLERFGNT  451



>gb|AAP74371.1| FAE1 [Marchantia polymorpha]
Length=527

 Score =   448 bits (1152),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 233/454 (51%), Positives = 330/454 (73%), Gaps = 14/454 (3%)
 Frame = +2

Query  92    IEPSGPDAGALTFSVRV------RRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLL  253
             + PS  +  ++    RV      RRRLPDF+QSV LKYVKLGY+Y+I + L +   +PLL
Sbjct  10    MHPSPSEQHSMLHGERVAVQINSRRRLPDFLQSVNLKYVKLGYHYLITH-LVILLFIPLL  68

Query  254   TVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLL-GLLGFTLSIYFMSKPMPIYLV  430
               V  +EVG  M  E++W ++W N     F +V++ +   LL F +++Y MS+P P+YLV
Sbjct  69    LAV-TLEVGR-MGPEEMW-QLWVNL---QFNLVSVLICSALLVFGVTVYVMSRPRPVYLV  122

Query  431   DFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEK  610
             D+AC  P+++ +V    F+D + KSG FDE+ LE+ +++LE SG+G+ET++P S+     
Sbjct  123   DYACHLPAENTRVKFSLFMDHSEKSGFFDERALEFQRKILERSGLGEETHLPVSLHRLPA  182

Query  611   IKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMK  790
                +   R EA +++F A+D++ EKT+++ +DIGILVVNC+ FNPTPSLSAMI+N Y M+
Sbjct  183   NANMAEARNEAEEVMFGALDELFEKTKVKPKDIGILVVNCSLFNPTPSLSAMIVNKYHMR  242

Query  791   RNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNC  970
              NI + NLGGMGCSAG+I++DLA+D+L+ +   YA+VVSTE ++  WY GN RSMLIPNC
Sbjct  243   GNIRTYNLGGMGCSAGVISIDLAKDMLQVHGGTYAIVVSTENITQNWYYGNRRSMLIPNC  302

Query  971   FFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKD  1150
              FR G +A+LLSN+R + R AKY+L H VRTH+GA D+ FR +YQEED +   G+ +SKD
Sbjct  303   LFRVGGAAILLSNKRSEKRRAKYQLVHTVRTHKGADDKCFRCVYQEEDEKNFMGVSLSKD  362

Query  1151  LVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCIN  1330
             L+ + G+ALK NITTLGPLVLPL+EQL FF  L+ RK+F  K KPYIPD+ +AF+HFCI+
Sbjct  363   LMAIAGDALKTNITTLGPLVLPLSEQLLFFGILVARKVFNMKVKPYIPDFKLAFDHFCIH  422

Query  1331  AASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             A  + ++DEL++NL+L++ ++E SR TLHRFGNT
Sbjct  423   AGGRAVIDELEKNLQLTKDHVEPSRMTLHRFGNT  456



>gb|KDO84579.1| hypothetical protein CISIN_1g010193mg [Citrus sinensis]
Length=515

 Score =   446 bits (1148),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 230/457 (50%), Positives = 330/457 (72%), Gaps = 19/457 (4%)
 Frame = +2

Query  92    IEPSGP-----DAGALTFSVRVR--RRLPDFVQSvklkyvklgyyyvINNWLCLAATVPL  250
             +E SGP       G     VR++  RRLPDF+QSV LKYVKLGY+Y+I+N L L   +PL
Sbjct  1     MEQSGPTYDSGSGGGAPVGVRIQHNRRLPDFLQSVNLKYVKLGYHYLISNLLTLC-FIPL  59

Query  251   LTVVFGVEVGSVMRGE--KVWGKIWENSGGPDFGVVNMSLL-GLLGFTLSIYFMSKPMPI  421
             + ++  ++V  +   +  ++W  +        F +V++ +   +L F L+++ M++P P+
Sbjct  60    I-IITSIQVSEMNIDDLRQLWIHL-------QFNLVSVVICSAILVFGLTVFIMTRPRPV  111

Query  422   YLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGC  601
             YLVD++C KP  +LK + D+F++ ++ +G FDE +LE+ +++LE SG+G+ETY P+++  
Sbjct  112   YLVDYSCYKPPHNLKASYDKFMEHSKLTGDFDESSLEFQRKILERSGLGEETYFPEAMHA  171

Query  602   PEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHY  781
                   +   R EA Q+++ A+D +   T +  +DIGILVVNC+ FNPTPSLSAMI+N Y
Sbjct  172   IPPKPSMAAAREEAEQVMYGALDNLFSNTNVNPKDIGILVVNCSLFNPTPSLSAMIVNKY  231

Query  782   KMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLI  961
             +++ NI S NLGGMGCSAG+IA+DLA+D+L+ N N YA+VVSTE ++  WY GN +SMLI
Sbjct  232   RLRGNIRSYNLGGMGCSAGVIAVDLAKDLLQVNWNTYAVVVSTENITQNWYFGNKKSMLI  291

Query  962   PNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKI  1141
             PNC FR GCSAVLLSN+R+D R AKYRL HIVRTH+GA D+AFR +YQE+D +   G+ +
Sbjct  292   PNCLFRVGCSAVLLSNKRKDRRQAKYRLVHIVRTHKGADDKAFRCVYQEQDDQGKTGVSL  351

Query  1142  SKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHF  1321
             SK+L+ + G ALK NITTLGP+VLP++EQL FF TL+ +KLF    KPYIPD+ +AF+HF
Sbjct  352   SKELMAIAGGALKTNITTLGPVVLPVSEQLLFFATLVIKKLFNRNVKPYIPDFKLAFDHF  411

Query  1322  CINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             CI+A  + ++DEL++NL+L   ++EASR TLHRFGNT
Sbjct  412   CIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNT  448



>ref|XP_003536202.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like [Glycine max]
 gb|KHN30556.1| 3-ketoacyl-CoA synthase 11 [Glycine soja]
Length=517

 Score =   446 bits (1147),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 235/445 (53%), Positives = 327/445 (73%), Gaps = 10/445 (2%)
 Frame = +2

Query  107   PDAGALTF--SVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVG  280
             P +G ++   S + RR+LP+F+ SV+LKYVKLGY+Y+I+N + L   +PLL V     + 
Sbjct  6     PGSGTVSVEASSQERRKLPNFLLSVRLKYVKLGYHYLISNAMYLL-LIPLLGVA-SAHLS  63

Query  281   SVMRGEKVWGKIWENSGGPDFGVVNMSLLG-LLGFTLSIYFMSKPMPIYLVDFACCKPSD  457
             ++   + V  ++WEN     F +V+++L   L+ F ++ YFMS+P  +YLVDFAC KP  
Sbjct  64    TISYQDVV--QLWENL---KFNLVSVTLCSSLIVFLVTFYFMSRPRGVYLVDFACYKPEP  118

Query  458   DLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRG  637
             D   T++ F+  + ++G F E+NL + K++LE SG+G +TY+P +I        +   R 
Sbjct  119   DCTCTREIFMHRSVETGVFSEENLAFQKKILERSGLGQKTYLPPAILSIPPNPCMAEARK  178

Query  638   EASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLG  817
             EA Q++F AID++LEKT ++A+DIGILVVNC+ FNPTPSLSAMI+NHYK++ NI S NLG
Sbjct  179   EAEQVMFGAIDQLLEKTGVKAKDIGILVVNCSLFNPTPSLSAMIVNHYKLRGNIQSYNLG  238

Query  818   GMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAV  997
             GMGCSAG+I++DLA+ +L+ +PN YALVVS E ++  WY GN+RSML+ NC FR G +AV
Sbjct  239   GMGCSAGLISIDLAKQLLQVHPNSYALVVSMENITLNWYFGNNRSMLVSNCLFRMGGAAV  298

Query  998   LLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEAL  1177
             LLSN+  D R AKY+L H VRTH+GA DR++  ++QEED ++  G+ +SKDL+ V GEAL
Sbjct  299   LLSNKSSDRRRAKYQLIHTVRTHKGADDRSYGCVFQEEDEKKTIGVALSKDLMAVAGEAL  358

Query  1178  KANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDE  1357
             K NITTLGPLVLP++EQL FF TL+ RK+F  K KPYIPD+ +AFEHFCI+A  + +LDE
Sbjct  359   KTNITTLGPLVLPMSEQLLFFATLVARKVFKMKIKPYIPDFKLAFEHFCIHAGGRAVLDE  418

Query  1358  LKRNLRLSEQNMEASRATLHRFGNT  1432
             L++NL LS+ +ME SR TL+RFGNT
Sbjct  419   LEKNLELSDWHMEPSRMTLNRFGNT  443



>ref|XP_008444712.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Cucumis melo]
Length=514

 Score =   446 bits (1146),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 235/453 (52%), Positives = 328/453 (72%), Gaps = 8/453 (2%)
 Frame = +2

Query  80    INRGIEPSGPDAGALTFSVRVRR--RLPDFVQSvklkyvklgyyyvINNWLCLAATVPLL  253
             ++RG     P +G+ T ++R++   RLPDF+QSV LKYVKLGY+Y+I+N L L   VPL+
Sbjct  1     MDRGGPSPAPTSGSGTGALRIQHSTRLPDFLQSVNLKYVKLGYHYLISNLLTLC-IVPLI  59

Query  254   TVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVD  433
              V   +EV S M  + V   +W +       V+  S + + G  L++Y M++P P+YLVD
Sbjct  60    AVTL-IEV-SQMNLDDV-RHLWFHLQYNLVSVIICSTVMVFG--LTVYTMTRPRPVYLVD  114

Query  434   FACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKI  613
             ++C +P+DDLK    +F++ +R +G FD+ +LE+ +++LE SG+G+ETY+P+++ C    
Sbjct  115   YSCYRPADDLKAPFHRFMEHSRLTGDFDDSSLEFQRKILERSGLGEETYVPEAMHCIPPT  174

Query  614   KKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKR  793
               +   R EA Q++F A+DK+   T ++ +DIGILVVNC+ FNPTPSLSAMI+N YK++ 
Sbjct  175   PSMAAAREEAEQVMFGALDKLFANTNVKPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRG  234

Query  794   NIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCF  973
             NI S NLGGMGCSAG+IA+DLA+D+L+ + N  A+VVSTE ++  WY GN +SMLIPNC 
Sbjct  235   NIRSFNLGGMGCSAGVIAVDLAKDLLQVHRNTLAVVVSTENITQNWYFGNKKSMLIPNCL  294

Query  974   FRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDL  1153
             FR G SAVLLSN+  D R AKYRL HIVRTH+GA D+AFR +YQE+D     G+ +SKDL
Sbjct  295   FRVGGSAVLLSNKSADRRRAKYRLIHIVRTHRGADDKAFRCVYQEQDDVGKTGVSLSKDL  354

Query  1154  VEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINA  1333
             + + G ALK NITTLGPLVLP++EQL FF TL+ +K F    KPYIPD+ +AF+HFCI+A
Sbjct  355   MAIAGGALKTNITTLGPLVLPISEQLLFFATLLVKKFFNGNVKPYIPDFKLAFDHFCIHA  414

Query  1334  ASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
               + ++DEL++NL+L   ++EASR TLHRFGNT
Sbjct  415   GGRAVIDELEKNLQLLPIHVEASRMTLHRFGNT  447



>gb|AAO48425.1| beta-ketoacyl-CoA-synthase [Marchantia polymorpha]
Length=537

 Score =   446 bits (1147),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 235/447 (53%), Positives = 325/447 (73%), Gaps = 8/447 (2%)
 Frame = +2

Query  95    EPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVE  274
             E   P  G    S+++R RLPDF+ SV LKYVKLGY+YVI + L L   VPLL VV   E
Sbjct  25    EAVNPADGNAAVSIKIRTRLPDFLNSVNLKYVKLGYHYVITHALYLL-MVPLLMVV-AAE  82

Query  275   VGSVMRGEKVWGKIWENSGGPDFGVVNMSLL-GLLGFTLSIYFMSKPMPIYLVDFACCKP  451
              G +  G + +G++WE      F +V++ +  G L F  ++YFMS+P P+YLVDFAC KP
Sbjct  83    FGRL--GHEDFGQLWEQL---QFNLVSVLVCSGTLVFGGTLYFMSRPHPVYLVDFACYKP  137

Query  452   SDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNI  631
              D+ KVT++ F++ +R +G F+EK+LE+ +++LE SG+G +TY+P ++        ++  
Sbjct  138   IDERKVTREIFMECSRITGNFNEKSLEFQRKILERSGLGQDTYLPPAVLRVPPNPNMHEA  197

Query  632   RGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTN  811
             R EA  ++F A+D++ EKT ++ +++GILVVNC+ FNPTPSLSAMI+NHYKM+ NI S N
Sbjct  198   RLEAETVMFGALDELFEKTGVKPKEVGILVVNCSLFNPTPSLSAMIVNHYKMRGNIKSLN  257

Query  812   LGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCS  991
             LGGMGCSAG+I++DLARD+L+ + + YA+VVS E ++  WY GN RS ++ NC FR G +
Sbjct  258   LGGMGCSAGVISIDLARDLLQVHNSTYAVVVSMENITLNWYMGNDRSKMLSNCIFRMGGA  317

Query  992   AVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGE  1171
             A+LLSN+ ++ R AKY L H VRTH+GA  + F  + QEED E   G+ +S+DL+ V G+
Sbjct  318   AILLSNKMKERRRAKYELVHTVRTHKGADPKCFSCVVQEEDDEGKIGVSLSRDLMGVAGD  377

Query  1172  ALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLL  1351
             ALKANITTLGPLVLPL+EQ+ FF TL+ RKLF  K KPYIPD+ +AFEHFCI+A  + +L
Sbjct  378   ALKANITTLGPLVLPLSEQILFFATLVGRKLFKMKIKPYIPDFKLAFEHFCIHAGGRAVL  437

Query  1352  DELKRNLRLSEQNMEASRATLHRFGNT  1432
             DEL++NL L+E +ME SR TL+RFGNT
Sbjct  438   DELEKNLNLTEWHMEPSRMTLYRFGNT  464



>ref|XP_004152699.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Cucumis sativus]
 gb|KGN62598.1| hypothetical protein Csa_2G361630 [Cucumis sativus]
Length=514

 Score =   444 bits (1143),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 235/453 (52%), Positives = 328/453 (72%), Gaps = 8/453 (2%)
 Frame = +2

Query  80    INRGIEPSGPDAGALTFSVRVRR--RLPDFVQSvklkyvklgyyyvINNWLCLAATVPLL  253
             ++RG     P +G+ T ++R++   RLPDF+QSV LKYVKLGY+Y+I+N L L   VPL+
Sbjct  1     MDRGGPTPVPTSGSGTGALRIQHSTRLPDFLQSVNLKYVKLGYHYLISNLLTLC-IVPLI  59

Query  254   TVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVD  433
              V   +EV S M  + V   +W +       V+  S + + G  L++Y M++P P+YLVD
Sbjct  60    AVTL-IEV-SQMNLDDV-RHLWFHLQYNLVSVIICSTVMVFG--LTVYTMTRPRPVYLVD  114

Query  434   FACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKI  613
             ++C +P+DDLK    +F++ +R +G FD+ +LE+ +++LE SG+G+ETY+P+++ C    
Sbjct  115   YSCYRPADDLKAPFHRFMEHSRLTGDFDDSSLEFQRKILERSGLGEETYVPEAMHCIPPT  174

Query  614   KKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKR  793
               +   R EA Q++F A+DK+   T ++ +DIGILVVNC+ FNPTPSLSAMI+N YK++ 
Sbjct  175   PSMAAAREEAEQVMFGALDKLFASTNVKPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRG  234

Query  794   NIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCF  973
             NI S NLGGMGCSAG+IA+DLA+D+L+ + N  A+VVSTE ++  WY GN +SMLIPNC 
Sbjct  235   NIRSFNLGGMGCSAGVIAVDLAKDMLQVHRNTLAVVVSTENITQNWYFGNKKSMLIPNCL  294

Query  974   FRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDL  1153
             FR G SAVLLSN+  D R AKYRL HIVRTH+GA D+AFR +YQE+D     G+ +SKDL
Sbjct  295   FRVGGSAVLLSNKSADRRRAKYRLIHIVRTHRGADDKAFRCVYQEQDDVGKTGVSLSKDL  354

Query  1154  VEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINA  1333
             + + G ALK NITTLGPLVLP++EQL FF TL+ +K F    KPYIPD+ +AF+HFCI+A
Sbjct  355   MAIAGGALKTNITTLGPLVLPISEQLLFFATLLVKKFFNGNVKPYIPDFKLAFDHFCIHA  414

Query  1334  ASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
               + ++DEL++NL+L   ++EASR TLHRFGNT
Sbjct  415   GGRAVIDELEKNLQLLPIHVEASRMTLHRFGNT  447



>ref|XP_001757568.1| predicted protein [Physcomitrella patens]
 gb|EDQ77625.1| predicted protein [Physcomitrella patens]
Length=519

 Score =   444 bits (1143),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 231/442 (52%), Positives = 323/442 (73%), Gaps = 8/442 (2%)
 Frame = +2

Query  110   DAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVM  289
             +A  ++  V  RRRLPDF+QSV LKYVKLGY+Y+I + L L     LL ++  +E G  M
Sbjct  13    EAERVSVHVSPRRRLPDFLQSVNLKYVKLGYHYLITHLLTLLFIPLLLAIL--LEAGR-M  69

Query  290   RGEKVWGKIWENSGGPDFGVVN-MSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLK  466
               E +W ++WEN     F +V+ ++   LL F  ++YFMS+P PI+LVDFAC  P + L+
Sbjct  70    GPEDLW-QLWENL---QFNLVSVIACSALLVFVGTVYFMSRPRPIFLVDFACYLPDEKLQ  125

Query  467   VTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEAS  646
             V+   F++  R +G FDEK++E+ +++LE SG+G +TY+P ++        +   R EA 
Sbjct  126   VSVPLFMERTRLAGFFDEKSMEFQEKILERSGLGAKTYLPAAMHSLPPCPSMKAAREEAE  185

Query  647   QLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMG  826
             Q++F  +D++ EKT+I+ +D+G+LVVNC+ FNPTPSLSAMI+N Y M+ NI + NLGGMG
Sbjct  186   QVMFGCLDELFEKTKIKPKDVGVLVVNCSLFNPTPSLSAMIVNKYHMRGNIRTYNLGGMG  245

Query  827   CSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLS  1006
             CSAG+IA+DLARD+L+ + N YA+VVSTE ++  WY GN RSMLIPNC FR G +A+LLS
Sbjct  246   CSAGVIAIDLARDMLQVHGNTYAIVVSTENITQNWYFGNRRSMLIPNCLFRVGGAAILLS  305

Query  1007  NRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKAN  1186
             N+RRD   +KY+L H+VRTH+GA D+ +  +YQE+D +   G+ +SKDL+ + GE LKAN
Sbjct  306   NKRRDGSRSKYQLNHVVRTHKGADDKCYNCVYQEQDEQGNMGVSLSKDLMAIAGETLKAN  365

Query  1187  ITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKR  1366
             ITTLGPLVLPL+EQL FF TL+ RK+F  K KPYIPD+ +AF+HFCI+A  + ++DEL++
Sbjct  366   ITTLGPLVLPLSEQLLFFSTLVARKVFNMKVKPYIPDFKLAFDHFCIHAGGRAVIDELEK  425

Query  1367  NLRLSEQNMEASRATLHRFGNT  1432
             NL+L+  + E SR TLHRFGNT
Sbjct  426   NLQLTPGHCEPSRMTLHRFGNT  447



>ref|XP_006435002.1| hypothetical protein CICLE_v10000889mg [Citrus clementina]
 gb|ESR48242.1| hypothetical protein CICLE_v10000889mg [Citrus clementina]
Length=515

 Score =   443 bits (1139),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 230/457 (50%), Positives = 328/457 (72%), Gaps = 19/457 (4%)
 Frame = +2

Query  92    IEPSGP-----DAGALTFSVRVR--RRLPDFVQSvklkyvklgyyyvINNWLCLAATVPL  250
             +E SGP       G     VR++  RRLPDF+QSV LKYVKLGY+Y+I+N L L   +PL
Sbjct  1     MEQSGPTYDSGSGGGAPVGVRIQHNRRLPDFLQSVNLKYVKLGYHYLISNLLTLC-FIPL  59

Query  251   LTVVFGVEVGSVMRGE--KVWGKIWENSGGPDFGVVNMSLL-GLLGFTLSIYFMSKPMPI  421
             + ++  ++V  +   +  ++W  +        F +V++ +   +L F L+++ M++P P+
Sbjct  60    I-IITSIQVSEMNIDDLRQLWIHL-------QFNLVSVVICSAILVFGLTVFIMTRPRPV  111

Query  422   YLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGC  601
             YLVD++C KP  +LK + D+F++ ++ +G FDE +LE+ + +LE SG+G+ETY P+++  
Sbjct  112   YLVDYSCYKPPHNLKASYDKFMEHSKLTGDFDESSLEFQRNILERSGLGEETYFPEAMHA  171

Query  602   PEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHY  781
                   +   R EA Q+++ A+D +   T +  +DIGILVVNC+ FNPTPSLSAMI+N Y
Sbjct  172   IPPKPSMAAAREEAEQVMYGALDNLFSNTNVNPKDIGILVVNCSLFNPTPSLSAMIVNKY  231

Query  782   KMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLI  961
             +++ NI S NLGGMGCSAG+IA+DLA+D+L+ N N YA+VVSTE ++  WY GN +SMLI
Sbjct  232   RLRGNIRSYNLGGMGCSAGVIAVDLAKDLLQVNWNTYAVVVSTENITQNWYFGNKKSMLI  291

Query  962   PNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKI  1141
             PNC FR GCSAVLLSN+ +D R AKYRL HIVRTH+GA D+AFR +YQE+D +   G+ +
Sbjct  292   PNCLFRVGCSAVLLSNKGKDRRRAKYRLVHIVRTHKGADDKAFRCVYQEQDDQGKTGVSL  351

Query  1142  SKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHF  1321
             SK+L+ + G ALK NITTLGPLVLP++EQL FF TL+ +KLF    KPYIPD+ +AF+HF
Sbjct  352   SKELMAIAGGALKTNITTLGPLVLPVSEQLLFFATLVIKKLFNRNVKPYIPDFKLAFDHF  411

Query  1322  CINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             CI+A  + ++DEL++NL+L   ++EASR TLHRFGNT
Sbjct  412   CIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNT  448



>ref|XP_003555524.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Glycine max]
Length=517

 Score =   443 bits (1139),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 232/445 (52%), Positives = 328/445 (74%), Gaps = 10/445 (2%)
 Frame = +2

Query  107   PDAGALTF--SVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVG  280
             P +G ++   S + RR+LP+F+ SV+LKYVKLGY+Y+I+N + L   +PLL V     + 
Sbjct  6     PGSGTVSVEASSQERRKLPNFLLSVRLKYVKLGYHYLISNAMYLL-LIPLLGVA-SAYLS  63

Query  281   SVMRGEKVWGKIWENSGGPDFGVVNMSLLG-LLGFTLSIYFMSKPMPIYLVDFACCKPSD  457
             ++   + V  ++WEN     F +++++L   L+ F ++ YFMS+P  +YLVDFAC KP  
Sbjct  64    TISYQDVV--QLWENL---KFNLLSVTLCSSLIVFLVTFYFMSRPRGVYLVDFACYKPEP  118

Query  458   DLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRG  637
             +   T++ F++ + ++G F E+NL + K++LE SG+G +TY+P +I        +   R 
Sbjct  119   ECTCTREIFMNRSVETGVFSEENLAFQKKILERSGLGQKTYLPPAILSVPSNPCMAEARK  178

Query  638   EASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLG  817
             EA Q++F AID++LEKT ++A+DIGILVVNC+ FNPTPSLSAMI+NHYK++ NI S NLG
Sbjct  179   EAEQVMFGAIDQLLEKTGVKAKDIGILVVNCSLFNPTPSLSAMIVNHYKLRGNIQSYNLG  238

Query  818   GMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAV  997
             GMGCSAG+I++DLA+ +L+ +PN YALVVS E ++  WY GN+RSML+ NC FR G +AV
Sbjct  239   GMGCSAGLISIDLAKQLLQVHPNSYALVVSMENITLNWYFGNNRSMLVSNCLFRMGGAAV  298

Query  998   LLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEAL  1177
             LLSN+  D R AKY+L H VRTH+GA D+++  ++QEED ++  G+ +SKDL+ V GEAL
Sbjct  299   LLSNKSSDRRRAKYQLIHTVRTHKGADDKSYGCVFQEEDEKKTIGVALSKDLMAVAGEAL  358

Query  1178  KANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDE  1357
             K NITTLGPLVLP++EQL FF TL+ RK+F  K KPYIPD+ +AFEHFCI+A  + +LDE
Sbjct  359   KTNITTLGPLVLPMSEQLLFFATLVARKVFKMKIKPYIPDFKLAFEHFCIHAGGRAVLDE  418

Query  1358  LKRNLRLSEQNMEASRATLHRFGNT  1432
             L++NL LS+ +ME SR TL+RFGNT
Sbjct  419   LEKNLELSDWHMEPSRMTLNRFGNT  443



>ref|XP_007222865.1| hypothetical protein PRUPE_ppa004284mg [Prunus persica]
 ref|XP_008220808.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Prunus mume]
 gb|EMJ24064.1| hypothetical protein PRUPE_ppa004284mg [Prunus persica]
Length=518

 Score =   442 bits (1138),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 225/447 (50%), Positives = 322/447 (72%), Gaps = 12/447 (3%)
 Frame = +2

Query  101   SGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVG  280
             SG  AG +   +   RRLPDF+QSV LKYVKLGY+Y+I+N L L   +PL+ V   +E  
Sbjct  14    SGSTAGQVGVQIHQTRRLPDFLQSVNLKYVKLGYHYLISNLLTLC-FIPLIIVTL-IEAS  71

Query  281   S--VMRGEKVWGKIWENSGGPDFGVVNMSLL-GLLGFTLSIYFMSKPMPIYLVDFACCKP  451
                +   +++W  +        + +V++ +   +L F L++Y M++P P+YLVD+AC +P
Sbjct  72    QMDLYDIQQLWLHL-------QYNLVSVIICSAVLVFGLTVYIMTRPRPVYLVDYACYRP  124

Query  452   SDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNI  631
              D LK    +F++ +R +  FD+ +LE+ +++LE SG+G+ETY+P+++        +   
Sbjct  125   PDHLKAPYHRFMEHSRLTQDFDDSSLEFQRKILERSGLGEETYVPEAMHYIPPRPSMAAA  184

Query  632   RGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTN  811
             R EA Q+++ A+D +   T ++ +DIGILVVNC+ FNPTPSLSAMI+N YK++ NI S N
Sbjct  185   REEAEQVMYGALDNLFANTHVKPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSFN  244

Query  812   LGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCS  991
             LGGMGCSAG+IA DLA+D+L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR GCS
Sbjct  245   LGGMGCSAGVIAADLAKDLLQIHRNTYAIVVSTENITQNWYFGNKKSMLIPNCLFRVGCS  304

Query  992   AVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGE  1171
             AVLLSN+  D+R AKY+L H+VRTH+GA D+AFR +YQE+D +   G+ +SKDL+ + G 
Sbjct  305   AVLLSNKSADWRRAKYKLVHVVRTHRGADDKAFRCVYQEQDDKGKTGVSLSKDLMAIAGG  364

Query  1172  ALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLL  1351
             ALK NITTLGP+VLP++EQL FF +L+ +KLF A  KPYIPD+ +AF+HFCI+A  + ++
Sbjct  365   ALKTNITTLGPIVLPISEQLLFFSSLVVKKLFNANVKPYIPDFKLAFDHFCIHAGGRAVI  424

Query  1352  DELKRNLRLSEQNMEASRATLHRFGNT  1432
             DEL++NL+L   ++EASR TLHRFGNT
Sbjct  425   DELEKNLQLLPIHVEASRMTLHRFGNT  451



>ref|XP_008224608.1| PREDICTED: 3-ketoacyl-CoA synthase 15 [Prunus mume]
Length=515

 Score =   440 bits (1132),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 239/465 (51%), Positives = 325/465 (70%), Gaps = 14/465 (3%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             MA+E+      EI N+G E  GP+ G+ + SV+VR+RLPDF+ SV LKYV+LGY Y+I++
Sbjct  1     MAREQEQF-PAEIENQGSENLGPNGGSSSVSVKVRQRLPDFLGSVNLKYVELGYSYLISH  59

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVN-MSLLGLLGFTLSIY  397
              L     VP+L V+   E+G          K+ +    P   + + + +L LLGF L I+
Sbjct  60    RLYFL-IVPVLIVLCSAEIG----------KLKDLFPNPKCELTDALFILVLLGFILYIF  108

Query  398   FMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDET  577
                 P   YLVDFAC +P D+LK++K++FI++AR SG F++  +++ KR+L+SSGIG ET
Sbjct  109   LDLAPRSTYLVDFACYRPPDELKISKEEFIELARNSGNFNDAAIDFQKRVLKSSGIGQET  168

Query  578   YIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSL  757
             Y+P+ +  P+    L + R EA+ ++F AI+ +   T+IR +DI ILVVNC   N TPSL
Sbjct  169   YMPRVVFHPDYKISLKDGREEAAMVMFGAINDLFRATKIRPKDIRILVVNCGVLNTTPSL  228

Query  758   SAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYS  937
             S+M+INH+K++ NI S NLGGMGC+AGIIA+DLA+D+L A P  YALVVSTE V  TWY 
Sbjct  229   SSMVINHFKLRPNIQSFNLGGMGCAAGIIAIDLAKDLLNAYPGTYALVVSTEAVCYTWYK  288

Query  938   GNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDV  1117
             GN   ML+ NCFFR G +A+LLS+ R D   AKY L+ +VRTH+G  +R+F SI+ +ED 
Sbjct  289   GNDFDMLLSNCFFRMGAAAMLLSSSRLDRWRAKYELKQLVRTHKGMDERSFESIHLKEDA  348

Query  1118  ERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPD  1297
             +  +G+ +SKD+VEVGG ALKANITTLGPLVLP++EQ +F   L+ RK      KPYIPD
Sbjct  349   KGTQGVSVSKDVVEVGGHALKANITTLGPLVLPVSEQFHFLTDLLFRKK-KTNYKPYIPD  407

Query  1298  YTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             Y +AFEH CI AAS  +LDE+++NL L+E+ MEASR TL RFGNT
Sbjct  408   YKLAFEHVCILAASNKVLDEIQKNLELTEEYMEASRKTLERFGNT  452



>gb|AFK40996.1| unknown [Medicago truncatula]
Length=371

 Score =   435 bits (1118),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 206/303 (68%), Positives = 246/303 (81%), Gaps = 10/303 (3%)
 Frame = +2

Query  554   SSGIGDETYIPKS-IGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNC  730
             SSGIGDETYIP+S I   E    +   R EAS ++F A+D++ EKT IR +D+G+LVVNC
Sbjct  2     SSGIGDETYIPRSVISSSENTATMKEGRAEASMVMFGALDELFEKTGIRPKDVGVLVVNC  61

Query  731   NTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVST  910
             + FNPTPSLSAMIINHYKM+ NI+S NLGGMGCSAGIIA+DLARDIL++NP  YA+VVST
Sbjct  62    SIFNPTPSLSAMIINHYKMRGNILSYNLGGMGCSAGIIAVDLARDILQSNPGNYAVVVST  121

Query  911   EIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAF  1090
             E+V   WY G  RSMLIPNCFFR GCSAVLLSNRRRD+  AKYRL+HIVRTH+GA DR+F
Sbjct  122   EMVGFNWYQGKERSMLIPNCFFRMGCSAVLLSNRRRDFGRAKYRLEHIVRTHKGADDRSF  181

Query  1091  RSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFG  1270
             R +YQEED ++ KG+KISKDL+E+GGEALK NITTLGPLVLP +EQL FF TL+ R  FG
Sbjct  182   RCVYQEEDDQKFKGIKISKDLIEIGGEALKTNITTLGPLVLPFSEQLIFFATLVWRNWFG  241

Query  1271  ---------AKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRF  1423
                      +  KPYIP+Y +AFEHFC++AASK +LDEL++NL LS++NMEASR TLHRF
Sbjct  242   GGKSDKNSPSSNKPYIPNYKLAFEHFCVHAASKTILDELQKNLELSDKNMEASRMTLHRF  301

Query  1424  GNT  1432
             GNT
Sbjct  302   GNT  304



>ref|XP_010539905.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Tarenaya hassleriana]
Length=514

 Score =   440 bits (1132),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 228/437 (52%), Positives = 317/437 (73%), Gaps = 12/437 (3%)
 Frame = +2

Query  131   SVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGE--KV  304
              +R  RRLPDF+QSV LKYVKLGY+Y+I+N L L    PL+ VV  VE   +   +  ++
Sbjct  20    QIRQTRRLPDFLQSVNLKYVKLGYHYLISNLLALC-LFPLI-VVISVEASQMNPDDLRQL  77

Query  305   WGKIWENSGGPDFGVVNMSLL-GLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQ  481
             W  +        + +V++ +   +L F L++Y M++P P+YLVD++C +P D LK   ++
Sbjct  78    WVHL-------QYNLVSIIICSAILVFGLTVYVMTRPRPVYLVDYSCYRPPDHLKAPFNR  130

Query  482   FIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFE  661
             F++ +R +G F+E  LE+ +++LE SG+G+ETY+P+++ C      +   R EA Q++F 
Sbjct  131   FMEHSRLTGDFEESALEFQRKILERSGLGEETYVPEAMHCIPPRPSMAAAREEAEQVMFG  190

Query  662   AIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGI  841
             A+D +   T +  +DIGILVVNC+ FNPTPSLSAMI+N YK++ NI S NLGGMGCSAGI
Sbjct  191   ALDNLFSNTNVNPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGI  250

Query  842   IALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRD  1021
             IA+DLA+D+L+ + N YA+VVSTE ++  WY GN ++MLIPNC FR G SAVLLSN+ RD
Sbjct  251   IAVDLAKDLLQVHRNTYAVVVSTENITQNWYFGNKKAMLIPNCLFRVGGSAVLLSNKSRD  310

Query  1022  YRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLG  1201
              R AKY+L H+VRTH+GA D+AFR +YQE+D     G+ +SKDL+ + GE LK NITTLG
Sbjct  311   RRRAKYQLVHVVRTHRGADDKAFRCVYQEQDDTGRTGVSLSKDLMAIAGETLKTNITTLG  370

Query  1202  PLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLS  1381
             PLVLP++EQL FF TLI +KL   K KPYIPD+ +AF+HFCI+A  + ++DEL++NL+L 
Sbjct  371   PLVLPISEQLLFFVTLIMKKLSKGKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLL  430

Query  1382  EQNMEASRATLHRFGNT  1432
               ++EASR TLHRFGNT
Sbjct  431   PVHVEASRMTLHRFGNT  447



>ref|XP_002960812.1| hypothetical protein SELMODRAFT_437285 [Selaginella moellendorffii]
 ref|XP_002983857.1| hypothetical protein SELMODRAFT_445704 [Selaginella moellendorffii]
 gb|EFJ14869.1| hypothetical protein SELMODRAFT_445704 [Selaginella moellendorffii]
 gb|EFJ38351.1| hypothetical protein SELMODRAFT_437285 [Selaginella moellendorffii]
Length=500

 Score =   439 bits (1130),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 228/433 (53%), Positives = 319/433 (74%), Gaps = 8/433 (2%)
 Frame = +2

Query  137   RVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKI  316
             RVR RLPDF+QSV+LKYVKLGY YV++  L +   VPL+ +V   E+G  +  + +W K+
Sbjct  6     RVRSRLPDFLQSVRLKYVKLGYLYVVSRAL-IFLLVPLMLLV-AAEIGR-LGIDDIW-KL  61

Query  317   WENSGGPDFGVVN-MSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDI  493
             WE+     F +V+ ++  G L F  ++YFMS+P P+YLVDFAC KP D+ K +K  F++ 
Sbjct  62    WEHL---QFNLVSVLACSGALVFAATLYFMSRPRPVYLVDFACYKPDDERKCSKATFMER  118

Query  494   ARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDK  673
             +  SG F++  LE+ K++LE SG+G++TY+P+++        +   R EA  ++F AID+
Sbjct  119   STLSGAFNDTTLEFQKKILERSGLGEDTYLPEAVMNVPPNPCMREARKEAEIVMFGAIDE  178

Query  674   VLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALD  853
             +L KT ++ +DIG+LVVNC+ FNPTPSLSAMI+NHY+M+ NI S NLGGMGCSAG+I++D
Sbjct  179   LLAKTGVKPKDIGVLVVNCSLFNPTPSLSAMIVNHYRMRGNITSLNLGGMGCSAGVISID  238

Query  854   LARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHA  1033
             LA+D+L+ + N YALVVS E ++  WY GN RSML+PNC FR G +A+LLSN+R   R A
Sbjct  239   LAKDLLQVHTNTYALVVSMENITLNWYFGNERSMLVPNCLFRMGGAAILLSNKRSARRRA  298

Query  1034  KYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVL  1213
             KY L H VRTH+GA ++ F+ +YQ+ED +   G+ +S+DL+ V G+ALK NITTLGPLVL
Sbjct  299   KYELVHTVRTHKGADEKCFQCVYQQEDDKGTVGVSLSRDLMAVAGDALKTNITTLGPLVL  358

Query  1214  PLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNM  1393
             PL+EQ+ FF TL  RK+   K +PYIPD+ +AFEHFCI+A  + +LDEL++NL+LS  +M
Sbjct  359   PLSEQIMFFFTLFARKVLKMKVRPYIPDFKLAFEHFCIHAGGRAVLDELEKNLQLSPWHM  418

Query  1394  EASRATLHRFGNT  1432
             E SR TL+R+GNT
Sbjct  419   EPSRMTLYRWGNT  431



>ref|XP_010248169.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Nelumbo nucifera]
Length=518

 Score =   440 bits (1131),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 227/433 (52%), Positives = 318/433 (73%), Gaps = 6/433 (1%)
 Frame = +2

Query  134   VRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGK  313
             ++  RRLPDF+QSV LKYVKLGY+Y++++ L L   +PL+ V+  VEVG  M  E V  +
Sbjct  25    IKPSRRLPDFLQSVNLKYVKLGYHYLMSHLLTLC-LIPLMAVIM-VEVGQ-MNPEDV-RQ  80

Query  314   IWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDI  493
             +W +       V+  S   + G TL  Y M++P P+YLVD++C +P   L+V  DQF++ 
Sbjct  81    LWLHLQYNLVSVIVCSAFLVFGSTL--YIMTRPRPVYLVDYSCYRPPSRLQVRSDQFMEH  138

Query  494   ARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDK  673
             +R +G FD+ +LE+ ++++E SG+GDETY+P+++        +   R EA Q++F A+D 
Sbjct  139   SRLTGDFDDASLEFQRKIVERSGLGDETYVPEAMHYLPPRPSMAAAREEAEQVMFGALDN  198

Query  674   VLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALD  853
             +   T ++ +DIGILVVNC+ FNPTPSLSAMI+N YK++ NI S NLGGMGCSAG+IA+D
Sbjct  199   LFANTSVKPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVD  258

Query  854   LARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHA  1033
             LA+D+L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR G +AVLLSN+  D R +
Sbjct  259   LAKDLLQVHRNTYAVVVSTENITQNWYFGNRKSMLIPNCLFRVGGAAVLLSNKSADRRRS  318

Query  1034  KYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVL  1213
             KY+L H+VRTH+GA+D AFR +YQE+D     G+ +SKDL+ + G ALK NITTLGPLVL
Sbjct  319   KYKLVHVVRTHKGAEDTAFRCVYQEQDDAGKVGVSLSKDLMAIAGGALKTNITTLGPLVL  378

Query  1214  PLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNM  1393
             P++EQL FF TL+ +KLF AK KPYIPD+ +AF+HFCI+A  + ++DEL++NL+L   ++
Sbjct  379   PISEQLLFFXTLVAKKLFNAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLMPVHV  438

Query  1394  EASRATLHRFGNT  1432
             EASR +LHRFGNT
Sbjct  439   EASRMSLHRFGNT  451



>gb|KFK44079.1| hypothetical protein AALP_AA1G213300 [Arabis alpina]
Length=515

 Score =   440 bits (1131),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 230/435 (53%), Positives = 315/435 (72%), Gaps = 10/435 (2%)
 Frame = +2

Query  134   VRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGK  313
             +R  RRLPDF+QSV LKYVKLGY+Y+I+N L L    PL  V+    V +     +   +
Sbjct  22    IRQTRRLPDFLQSVNLKYVKLGYHYLISNLLTLC-LFPLAVVI---SVQASQTNPEDLKQ  77

Query  314   IWENSGGPDFGVVNMSLL-GLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFID  490
             +W +     + +V++ +   +L F L++Y M++P P+YLVDF+C  P D LK    +F++
Sbjct  78    LWIHL---QYNLVSIIICSAILVFGLTVYVMTRPRPVYLVDFSCYLPQDHLKAPFTRFME  134

Query  491   IARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIG-CPEKIKKLNNIRGEASQLIFEAI  667
              +R +G FD+  LE+ +++LE SG+G+ TY+P+++   P KI  +   R EA Q++F A+
Sbjct  135   HSRLTGDFDDSALEFQRKILERSGLGEHTYLPEAMHHVPPKIS-MAAAREEAEQVMFGAL  193

Query  668   DKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIA  847
             D +   T +  +DIGILVVNC+ FNPTPSLSAMI+N YK++ NI S NLGGMGCSAG+IA
Sbjct  194   DNLFANTNVNPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIA  253

Query  848   LDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYR  1027
             +DLA+D+L  + N YA+VVSTE ++  WY GN +SMLIPNC FR G SAVLLSN+ RD R
Sbjct  254   VDLAKDMLLVHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSRDKR  313

Query  1028  HAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPL  1207
              AKYRL H+VRTH+GA D+AFR +YQE+D     G+ +SKDL+ + GE LK NITTLGPL
Sbjct  314   RAKYRLVHVVRTHRGADDKAFRCVYQEQDDTGRTGVSLSKDLMAIAGETLKTNITTLGPL  373

Query  1208  VLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQ  1387
             VLP++EQ+ FF TL+ +KLF  K KPYIPD+ +AFEHFCI+A  + ++DEL++NL+LS  
Sbjct  374   VLPISEQILFFMTLVVKKLFNGKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPV  433

Query  1388  NMEASRATLHRFGNT  1432
             ++EASR TLHRFGNT
Sbjct  434   HVEASRMTLHRFGNT  448



>ref|XP_006304681.1| hypothetical protein CARUB_v10011929mg [Capsella rubella]
 gb|EOA37579.1| hypothetical protein CARUB_v10011929mg [Capsella rubella]
Length=512

 Score =   439 bits (1130),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 233/452 (52%), Positives = 323/452 (71%), Gaps = 15/452 (3%)
 Frame = +2

Query  89    GIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFG  268
             G   SG D G++   +R  RRLPDF+QSV LKYVKLGY+Y+I+N L L    PL  VV  
Sbjct  5     GESRSGGD-GSVGVQIRQARRLPDFLQSVNLKYVKLGYHYLISNLLTLC-LFPL-AVVIS  61

Query  269   VEVGSVMRGE--KVWGKIWENSGGPDFGVVNMSLL-GLLGFTLSIYFMSKPMPIYLVDFA  439
             VE       +  ++W  +        + +V++ +    L F L++Y M++P P+YLVDF+
Sbjct  62    VEASQTNPDDLKQLWIHL-------QYNLVSIIICSAFLVFGLTVYVMTRPRPVYLVDFS  114

Query  440   CCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIG-CPEKIK  616
             C  P D LK    +F++ ++ +G FD+ +LE+ +++LE SG+G++TY+P+++   P +I 
Sbjct  115   CYLPPDHLKAPYSRFMEHSKLTGDFDDSSLEFQRKILERSGLGEDTYVPEAMHYVPPRIS  174

Query  617   KLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRN  796
              +   R EA Q++F A+D +   T +  +DIGILVVNC+ FNPTPSLSAMI+N YK++ N
Sbjct  175   -MAAARKEAEQVMFGALDNLFADTNVNPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGN  233

Query  797   IVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFF  976
             I S NLGGMGCSAG+IA+DLA+D+L  + N YA+VVSTE ++  WY GN +SMLIPNC F
Sbjct  234   IRSYNLGGMGCSAGVIAVDLAKDMLLVHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLF  293

Query  977   RTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLV  1156
             R G SAVLLSN+ +D R +KYRL H+VRTH+GA D+AFR +YQE+D     G+ +SKDL+
Sbjct  294   RVGGSAVLLSNKSKDKRRSKYRLVHVVRTHRGADDKAFRCVYQEQDDTGRTGVSLSKDLM  353

Query  1157  EVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAA  1336
              + GE LK NITTLGPLVLP++EQ+ FF TL+ +KLF  K KPYIPD+ +AFEHFCI+A 
Sbjct  354   AIAGETLKTNITTLGPLVLPISEQILFFVTLVVKKLFNGKVKPYIPDFKLAFEHFCIHAG  413

Query  1337  SKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
              + ++DEL++NL+LS  ++EASR TLHRFGNT
Sbjct  414   GRAVIDELEKNLQLSPVHVEASRMTLHRFGNT  445



>emb|CDX81929.1| BnaC08g36720D [Brassica napus]
Length=510

 Score =   439 bits (1129),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 230/441 (52%), Positives = 318/441 (72%), Gaps = 10/441 (2%)
 Frame = +2

Query  116   GALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRG  295
             G++   +R  R LPDF+QSV LKYVKLGY+Y+I+N   LA  +  L VV  VE       
Sbjct  11    GSVGVQIRQTRILPDFLQSVNLKYVKLGYHYLISN--LLALCLLPLAVVISVEASQTDPE  68

Query  296   E--KVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKV  469
             +  ++W  +  N       V  ++   +L F L++Y M++P PIYLVDF+C  P D LKV
Sbjct  69    DLRQLWIHLQYNL------VSIIACSAVLVFGLTVYVMTRPRPIYLVDFSCYLPPDRLKV  122

Query  470   TKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQ  649
                +F++ +  +G FDE +LE+ +++LE SG+G++TY+P+++        +   R EA Q
Sbjct  123   PVSRFMNHSTLTGDFDESSLEFQRKILERSGLGEDTYLPEAMHHVPPTISMAAAREEAEQ  182

Query  650   LIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGC  829
             ++F A+DK+   T ++A+DIG+LVVNC+ FNPTPSLSAMI+N YK++ NI S NLGGMGC
Sbjct  183   VMFGALDKLFTNTNVKAKDIGVLVVNCSLFNPTPSLSAMIVNKYKLRGNIRSYNLGGMGC  242

Query  830   SAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSN  1009
             SAG+IA+DLA+D+L  + N YA+VVSTE ++  WY GN ++MLIPNC FR G SAVLLSN
Sbjct  243   SAGVIAVDLAKDMLLVHRNTYAVVVSTENITQNWYFGNKKAMLIPNCLFRVGGSAVLLSN  302

Query  1010  RRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANI  1189
             + RD R +KYRL H+VRTH+GA D+AFR +YQE+D  R  G+ +SK+L+ + GE LK NI
Sbjct  303   KSRDKRRSKYRLSHVVRTHRGADDKAFRCVYQEQDDTRRTGVSLSKELMAIAGETLKTNI  362

Query  1190  TTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRN  1369
             TTLGPLVLP++EQ+ FF TL+ +KLF  K KPYIPD+ +AFEHFCI+A  + ++DEL++N
Sbjct  363   TTLGPLVLPISEQILFFLTLVVKKLFNGKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKN  422

Query  1370  LRLSEQNMEASRATLHRFGNT  1432
             L+LS  ++EASR TLHRFGNT
Sbjct  423   LQLSPVHVEASRMTLHRFGNT  443



>ref|XP_010243778.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Nelumbo nucifera]
Length=518

 Score =   439 bits (1130),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 227/433 (52%), Positives = 318/433 (73%), Gaps = 6/433 (1%)
 Frame = +2

Query  134   VRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGK  313
             ++  RRLPDF+QSV LKYVKLGY+Y++++ L L   +PL+ V+  VEVG  M  E V  +
Sbjct  25    IKPSRRLPDFLQSVNLKYVKLGYHYLMSHLLTLC-LIPLMAVIM-VEVGQ-MNPEDV-RQ  80

Query  314   IWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDI  493
             +W +       V+  S   + G TL  Y M++P P+YLVD++C +P   L+V  DQF++ 
Sbjct  81    LWLHLQYNLVSVIVCSAFLVFGSTL--YIMTRPRPVYLVDYSCYRPPSRLQVRSDQFMEH  138

Query  494   ARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDK  673
             +R +G FD+ +LE+ ++++E SG+GDETY+P+++        +   R EA Q++F A+D 
Sbjct  139   SRLTGDFDDASLEFQRKIVERSGLGDETYVPEAMHYLPPRPSMAAAREEAEQVMFGALDN  198

Query  674   VLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALD  853
             +   T ++ +DIGILVVNC+ FNPTPSLSAMI+N YK++ NI S NLGGMGCSAG+IA+D
Sbjct  199   LFANTSVKPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVD  258

Query  854   LARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHA  1033
             LA+D+L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR G +AVLLSN+  D R +
Sbjct  259   LAKDLLQVHRNTYAVVVSTENITQNWYFGNRKSMLIPNCLFRVGGAAVLLSNKSADRRRS  318

Query  1034  KYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVL  1213
             KY+L H+VRTH+GA+D AFR +YQE+D     G+ +SKDL+ + G ALK NITTLGPLVL
Sbjct  319   KYKLVHVVRTHKGAEDTAFRCVYQEQDDAGKVGVSLSKDLMAIAGGALKTNITTLGPLVL  378

Query  1214  PLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNM  1393
             P++EQL FF TL+ +KLF AK KPYIPD+ +AF+HFCI+A  + ++DEL++NL+L   ++
Sbjct  379   PISEQLLFFVTLVAKKLFNAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLMPVHV  438

Query  1394  EASRATLHRFGNT  1432
             EASR +LHRFGNT
Sbjct  439   EASRMSLHRFGNT  451



>ref|XP_010459615.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Camelina sativa]
Length=518

 Score =   439 bits (1129),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 232/435 (53%), Positives = 318/435 (73%), Gaps = 10/435 (2%)
 Frame = +2

Query  134   VRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGK  313
             +R  RRLPDF+QSV LKYVKLGY+Y+I+N L L    PL  VV  VE  S M  E +  +
Sbjct  25    IRQTRRLPDFLQSVNLKYVKLGYHYLISNLLTLC-LFPL-AVVISVE-ASQMNPEDL-KQ  80

Query  314   IWENSGGPDFGVVNMSLL-GLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFID  490
             +W +     + +V++ +   +L F L++Y M++P P+YLVDF+C  P D LK    +F++
Sbjct  81    LWIHL---QYNLVSIIICSAVLVFGLTVYVMTRPRPVYLVDFSCYLPPDHLKAPYSRFME  137

Query  491   IARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIG-CPEKIKKLNNIRGEASQLIFEAI  667
              +R +G FD+  LE+ +++LE SG+G++TY+P+++   P +I  +   R EA Q++F A+
Sbjct  138   HSRLTGDFDDSALEFQRKILERSGLGEDTYVPEAMHHVPARIS-MAAAREEAEQVMFGAL  196

Query  668   DKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIA  847
             D +     +  +DIGILVVNC+ FNPTPSLSAMI+N YK++ NI S NLGGMGCSAG+IA
Sbjct  197   DNLFANANVNPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSYNLGGMGCSAGVIA  256

Query  848   LDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYR  1027
             +DLA+D+L  + N YA+VVSTE ++  WY GN +SMLIPNC FR G SAVLLSN+ RD R
Sbjct  257   VDLAKDMLLVHRNTYAVVVSTENMTQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSRDKR  316

Query  1028  HAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPL  1207
              +KYRL H+VRTH+GA D+AFR +YQE+D     G+ +SKDL+ + GE LK NITTLGPL
Sbjct  317   RSKYRLVHVVRTHRGADDKAFRCVYQEQDDTGRTGVSLSKDLMAIAGETLKTNITTLGPL  376

Query  1208  VLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQ  1387
             VLP++EQ+ FF TL+ +KLF  K KPYIPD+ +AFEHFCI+A  + ++DEL++NL+LS  
Sbjct  377   VLPISEQILFFMTLVVKKLFNGKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPV  436

Query  1388  NMEASRATLHRFGNT  1432
             ++EASR TLHRFGNT
Sbjct  437   HVEASRMTLHRFGNT  451



>ref|XP_006409460.1| hypothetical protein EUTSA_v10022654mg [Eutrema salsugineum]
 gb|ESQ50913.1| hypothetical protein EUTSA_v10022654mg [Eutrema salsugineum]
Length=510

 Score =   438 bits (1127),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 228/454 (50%), Positives = 328/454 (72%), Gaps = 18/454 (4%)
 Frame = +2

Query  92    IEPSGPDAGALTFSVRVR-----RRLPDFVQSvklkyvklgyyyvINNW--LCLAATVPL  250
             +E + P  G    SV++R     R+LP+F+QSV +KYVKLGY+Y+I +   LCL   VPL
Sbjct  1     MEAAEPVNGG---SVQIRNENGSRKLPNFLQSVNMKYVKLGYHYLITHLFKLCL---VPL  54

Query  251   LTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLV  430
             + V+F  E+  +   +    ++W +        + +S L + G T  ++ M++P  +YLV
Sbjct  55    MAVLF-TEISRLTPDDLY--QLWLHLQYNLVAFILLSALAVFGST--VFIMTRPRSVYLV  109

Query  431   DFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEK  610
             D++C  P + LKV   +F+D ++    F++ +LE+ +++LE SG+G+ETY+P+++ C   
Sbjct  110   DYSCYLPPESLKVKYQKFMDHSKLIEDFNDSSLEFQRKILERSGLGEETYLPEALHCIPP  169

Query  611   IKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMK  790
                +   R EA Q++F ++DK+ E TRI  RDIG+LVVNC+ FNPTPSLSAMI+N YK++
Sbjct  170   TPTMVAARQEAEQVMFGSLDKLFENTRINPRDIGVLVVNCSLFNPTPSLSAMIVNKYKLR  229

Query  791   RNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNC  970
              NI S NLGGMGCSAG+IA+DLA+D+L+ + N YA+VVSTE ++  WY GN ++MLIPNC
Sbjct  230   GNIKSFNLGGMGCSAGVIAIDLAKDMLQVHRNTYAVVVSTENITQNWYFGNRKAMLIPNC  289

Query  971   FFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKD  1150
              FR G +AVLLSN+ RD R +KY+L H VRTH+GA ++AF  +YQE+D     G+ +SKD
Sbjct  290   LFRVGGTAVLLSNKSRDRRRSKYKLVHTVRTHKGADEKAFNCVYQEQDDNGKTGVSLSKD  349

Query  1151  LVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCIN  1330
             L+ + GEALKANITTLGPLVLP++EQ+ FF TL+ +KLF AK KPYIPD+ +AF+HFCI+
Sbjct  350   LMAIAGEALKANITTLGPLVLPISEQILFFATLVAKKLFNAKLKPYIPDFKLAFDHFCIH  409

Query  1331  AASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             A  + ++DEL++NL+LSE+++EASR TLHRFGNT
Sbjct  410   AGGRAVIDELEKNLQLSERHVEASRMTLHRFGNT  443



>ref|XP_008377297.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Malus domestica]
Length=506

 Score =   438 bits (1126),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 228/433 (53%), Positives = 313/433 (72%), Gaps = 6/433 (1%)
 Frame = +2

Query  134   VRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGK  313
             ++  RRLPDF+Q+V LKYVKLGY+Y+I + L L   VPL+ VV  V   S M  + +  +
Sbjct  13    IQQSRRLPDFLQTVNLKYVKLGYHYLITHLLTLC-LVPLMAVV--VIEASQMNPDDI-HQ  68

Query  314   IWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDI  493
             +W         V+  S + + G T  +Y M++P  +YLVD++C KP   L+V   QF++ 
Sbjct  69    LWLQLQYNLVSVIIFSAMVVFGST--VYIMTRPRSVYLVDYSCYKPPSHLQVRYQQFMEH  126

Query  494   ARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDK  673
             ++ +G FDE +LE+ +++LE SG+G+ETY+P+++        +   R EA Q+IF A+D 
Sbjct  127   SKLTGDFDESSLEFQRKILERSGLGEETYVPEAMHYIPPRPSMAAAREEAEQVIFGALDN  186

Query  674   VLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALD  853
             +   T ++ +DIGILVVNC+ FNPTPSLSAMI+N YK++ NI S NLGGMGCSAG+IA+D
Sbjct  187   LFANTNVKPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVD  246

Query  854   LARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHA  1033
             LA+D+L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR G SAVLLSN+  D+R A
Sbjct  247   LAKDMLQIHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSMDWRRA  306

Query  1034  KYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVL  1213
             KY+L H+VRTH GA D+AFR +YQE+D     G+ +SKDL+ + G ALK NITTLGPLVL
Sbjct  307   KYKLVHVVRTHCGADDKAFRCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVL  366

Query  1214  PLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNM  1393
             PL+EQL FF TL+ +KLF AK KPYIPD+ +AF+HFCI+A  + ++DEL++NL+L   ++
Sbjct  367   PLSEQLLFFVTLVAKKLFNAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHV  426

Query  1394  EASRATLHRFGNT  1432
             EASR TLHRFGNT
Sbjct  427   EASRMTLHRFGNT  439



>ref|XP_006416504.1| hypothetical protein EUTSA_v10007370mg [Eutrema salsugineum]
 gb|ESQ34857.1| hypothetical protein EUTSA_v10007370mg [Eutrema salsugineum]
Length=520

 Score =   438 bits (1127),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 227/435 (52%), Positives = 313/435 (72%), Gaps = 10/435 (2%)
 Frame = +2

Query  134   VRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGK  313
             +R  RRLPDF+QSV LKYVKLGY+Y+I+N L L     L  +   + V +         +
Sbjct  27    IRQTRRLPDFLQSVNLKYVKLGYHYLISNLLTLC----LFPLAVAISVEASQMNPDDLRQ  82

Query  314   IWENSGGPDFGVVNMSLL-GLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFID  490
             +W +     + +V++ +   +L F L++Y M++P P+YLVDF+C  P D LK    +F+D
Sbjct  83    LWIHL---QYNLVSIIICSAILVFGLTVYVMTRPRPVYLVDFSCYLPPDHLKAPFTRFMD  139

Query  491   IARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIG-CPEKIKKLNNIRGEASQLIFEAI  667
              +R +G FD+  LE+ +++LE SG+G++TY+P+++   P +I  +   R EA Q++F A+
Sbjct  140   HSRLTGDFDDSALEFQRKILERSGLGEDTYVPEAMHYVPPRIS-MAAAREEAEQVMFGAL  198

Query  668   DKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIA  847
             D +   T +  +DIGILVVNC+ FNPTPSLSAMI+N YK++ NI S NLGGMGCSAG+IA
Sbjct  199   DNLFANTNVNPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSYNLGGMGCSAGVIA  258

Query  848   LDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYR  1027
             +DLA+D+L  +   YA+VVSTE ++  WY GN +SMLIPNC FR G SAVLLSN+ RD R
Sbjct  259   VDLAKDMLLVHRKTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSRDKR  318

Query  1028  HAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPL  1207
              AKYRL H+VRTH+GA D+AFR +YQE+D     G+ +SKDL+ + GE LK NITTLGPL
Sbjct  319   RAKYRLVHVVRTHRGADDKAFRCVYQEQDDTGRTGVSLSKDLMAIAGETLKTNITTLGPL  378

Query  1208  VLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQ  1387
             VLP++EQ+ FF TL+ +KLF  K KPYIPD+ +AFEHFCI+A  + ++DEL++NL+LS  
Sbjct  379   VLPISEQILFFMTLVAKKLFNGKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPV  438

Query  1388  NMEASRATLHRFGNT  1432
             ++EASR TLHRFGNT
Sbjct  439   HVEASRMTLHRFGNT  453



>ref|XP_007143888.1| hypothetical protein PHAVU_007G110500g [Phaseolus vulgaris]
 gb|ESW15882.1| hypothetical protein PHAVU_007G110500g [Phaseolus vulgaris]
Length=516

 Score =   438 bits (1127),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 231/433 (53%), Positives = 315/433 (73%), Gaps = 12/433 (3%)
 Frame = +2

Query  143   RRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVG--SVMRGEKVWGKI  316
             RR+LP+F+ SV+LKYVKLGY+Y+I+N + L     LL  + GV     S +  + V  ++
Sbjct  19    RRKLPNFLLSVRLKYVKLGYHYLISNAMYL-----LLIPLIGVASAHLSTLSYQDV-AQL  72

Query  317   WENSGGPDFGVVNMSLLG-LLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDI  493
             WEN     F +V++++   L+ F ++ YFMS+P  +YLVDFAC KP  D   T++ F+D 
Sbjct  73    WENL---KFNLVSVTVCSSLIVFLVTFYFMSRPRGVYLVDFACYKPEQDCNCTRETFMDR  129

Query  494   ARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDK  673
             + K+G F E+NL + K+++E SG+G +T +P SI        +   R EA Q++F AID+
Sbjct  130   SIKTGVFSEENLSFQKKIIERSGLGQKTCLPTSILSVPPNPCMAEARKEAEQVMFGAIDQ  189

Query  674   VLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALD  853
             +L KT ++A DIGILVVNC+ FNPTPSLSAMI+NHYK++ NI S NLGGMGCSAG+I++D
Sbjct  190   LLAKTGVKANDIGILVVNCSLFNPTPSLSAMIVNHYKLRGNIQSYNLGGMGCSAGLISID  249

Query  854   LARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHA  1033
             LA+ +L+ +PN YALVVS E ++  WY GN+RSML+ NC FR G +AVLLSNR  D R A
Sbjct  250   LAKQLLQVHPNSYALVVSMENITLNWYFGNNRSMLVSNCLFRMGGAAVLLSNRSSDRRRA  309

Query  1034  KYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVL  1213
             KY+L H VRTH+GA D+++  ++QEED  +  G+ +SKDL+ V GEALK NITTLGPLVL
Sbjct  310   KYQLIHTVRTHKGADDKSYGCVFQEEDESKNIGVSLSKDLMAVAGEALKTNITTLGPLVL  369

Query  1214  PLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNM  1393
             P++EQL FF TL+ RK+   K KPYIPD+ +AFEHFCI+A  + +LDEL++NL LS+ +M
Sbjct  370   PMSEQLLFFATLVARKVLKTKIKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLELSDWHM  429

Query  1394  EASRATLHRFGNT  1432
             E SR TL+RFGNT
Sbjct  430   EPSRMTLNRFGNT  442



>emb|CDY21665.1| BnaA09g44160D [Brassica napus]
Length=510

 Score =   438 bits (1126),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 231/441 (52%), Positives = 318/441 (72%), Gaps = 10/441 (2%)
 Frame = +2

Query  116   GALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRG  295
             G++   +R  R LPDF+QSV LKYVKLGY+YVI+N   LA  +  L VV  VEV      
Sbjct  11    GSVGVQIRQTRILPDFLQSVNLKYVKLGYHYVISN--LLALCLLPLAVVISVEVSQTDPE  68

Query  296   E--KVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKV  469
             +  ++W  +  N       V  ++   +L F L++Y M++P PIYLVDF+C  P D LKV
Sbjct  69    DLRQLWIHLQYNL------VSIIACSAVLVFGLTVYVMTRPRPIYLVDFSCYLPPDHLKV  122

Query  470   TKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQ  649
                +F++ +  +G FDE +LE+ +++LE SG+G++TY+P+++        +   R EA Q
Sbjct  123   PVSRFMNHSTLTGDFDESSLEFQRKILERSGLGEDTYLPEAMHHVPPTISMAAAREEAEQ  182

Query  650   LIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGC  829
             ++F A+DK+   T ++A+DIG+LVVNC+ FNPTPSLSAMI+N YK++ NI S NLGGMGC
Sbjct  183   VMFGALDKLFANTNVKAKDIGVLVVNCSLFNPTPSLSAMIVNKYKLRGNIRSYNLGGMGC  242

Query  830   SAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSN  1009
             SAG+IA+DLA+D+L  + N YA+VVSTE ++  WY GN ++MLIPNC FR G SAVLLSN
Sbjct  243   SAGVIAVDLAKDMLLVHRNTYAVVVSTENITQNWYFGNKKAMLIPNCLFRVGGSAVLLSN  302

Query  1010  RRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANI  1189
             + RD R +KYRL H+VRTH+GA D+AFR +YQE+D     G+ +SK+L+ + GE LK NI
Sbjct  303   KSRDKRRSKYRLSHVVRTHRGADDKAFRCVYQEQDDTGRTGVSLSKELMAIAGETLKTNI  362

Query  1190  TTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRN  1369
             TTLGPLVLP++EQ+ FF TL+ +KLF  K KPYIPD+ +AFEHFCI+A  + ++DEL++N
Sbjct  363   TTLGPLVLPISEQILFFVTLVVKKLFNGKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKN  422

Query  1370  LRLSEQNMEASRATLHRFGNT  1432
             L+LS  ++EASR TLHRFGNT
Sbjct  423   LQLSPVHVEASRMTLHRFGNT  443



>ref|XP_010548056.1| PREDICTED: 3-ketoacyl-CoA synthase 9-like [Tarenaya hassleriana]
Length=509

 Score =   438 bits (1126),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 226/442 (51%), Positives = 322/442 (73%), Gaps = 19/442 (4%)
 Frame = +2

Query  131   SVRVR-----RRLPDFVQSvklkyvklgyyyvINN-W-LCLAATVPLLTVVFGVEVGSVM  289
             SVR+R     R+LP+F+QSV +KYVKLGY+ +I + W LCL   VPL+ VV   E   + 
Sbjct  10    SVRIRTRDGTRKLPNFLQSVNMKYVKLGYHCLITHMWKLCL---VPLIAVV-ATEASRLS  65

Query  290   RGE--KVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDL  463
               +   +W  +  N     FG+V  S    L F  +++ M++P P+YLVD++C KP  +L
Sbjct  66    LDDLRHLWLHLQYNL----FGIVVFS--AALAFGSTVFIMTRPRPVYLVDYSCYKPPSNL  119

Query  464   KVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEA  643
              V   +F++ +R    FD+ +LE+ +++++ SG+G+ET++P+++ C      +   R EA
Sbjct  120   VVNFQKFMNHSRLIEDFDDSSLEFQRKIIQRSGLGEETHLPEALQCIPPNSTMAAAREEA  179

Query  644   SQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGM  823
              Q++F A+D +LE T+I  RDIGILVVNC+ FNPTPSLSAMI+N YK++ NI S NLGGM
Sbjct  180   EQVMFGALDNLLENTKISPRDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIKSYNLGGM  239

Query  824   GCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLL  1003
             GCSAG+IA+DLA+D+L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR G SA+LL
Sbjct  240   GCSAGVIAIDLAKDLLQVHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGSAILL  299

Query  1004  SNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKA  1183
             SN+  D RH+KY+L H VRTH+GA D+AF+ ++QE+D +   G+ +SKDL+ + GEALK 
Sbjct  300   SNKPSDRRHSKYKLIHTVRTHKGADDKAFKCVHQEQDGKGKTGVSLSKDLMAIAGEALKT  359

Query  1184  NITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELK  1363
             NITTLGPLVLP++EQ+ FF TL+ +KLF AK KPYIPD+ +AFEHFC++A  + ++DEL+
Sbjct  360   NITTLGPLVLPISEQIIFFMTLVAKKLFNAKIKPYIPDFKLAFEHFCVHAGGRAVIDELE  419

Query  1364  RNLRLSEQNMEASRATLHRFGN  1429
             +NL+LS+ ++EAS+ TLHRFGN
Sbjct  420   KNLQLSDTHVEASKMTLHRFGN  441



>ref|XP_010255306.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Nelumbo nucifera]
Length=523

 Score =   438 bits (1127),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 228/433 (53%), Positives = 313/433 (72%), Gaps = 6/433 (1%)
 Frame = +2

Query  134   VRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGK  313
             +R  RRLPDF+QSV LKYVKLGY+Y++++ L L   +PL+ ++  V+ G  M  E    +
Sbjct  30    IRQSRRLPDFLQSVNLKYVKLGYHYLVSHLLTLC-LIPLMAMII-VQAGQ-MNPEDA-RQ  85

Query  314   IWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDI  493
             +W +       V+  S   + G TL  Y M++P P+YLVD+AC +P    +V   +F++ 
Sbjct  86    LWLHLQYNLVSVIVCSAFLVFGSTL--YVMTRPRPVYLVDYACYRPPSHFQVRPQKFMEH  143

Query  494   ARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDK  673
             +R  G FDE +LE+ +++LE SG+GDETY+P+++ C      +   R EA Q++F A+D 
Sbjct  144   SRLIGDFDEASLEFQRKILERSGLGDETYLPEAMHCLPPRPSMAAAREEAEQVMFGALDT  203

Query  674   VLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALD  853
             +   T ++ +DIGILVVNC+ FNPTPSLSAMIIN YK++ NI S NLGGMGCSAG+IA+D
Sbjct  204   LFANTSVKPKDIGILVVNCSLFNPTPSLSAMIINKYKLRGNIRSFNLGGMGCSAGVIAVD  263

Query  854   LARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHA  1033
             LA+D+L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR G +AVLLSN+  D R A
Sbjct  264   LAKDMLQVHGNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGAAVLLSNKSADRRRA  323

Query  1034  KYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVL  1213
             KY+L H+VRTH+GA D+AFR +YQEED     G+ +SKDL+ + G ALK NITTLGPLVL
Sbjct  324   KYKLVHVVRTHRGADDKAFRCVYQEEDDAGKVGVSLSKDLMAIAGGALKINITTLGPLVL  383

Query  1214  PLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNM  1393
             P++EQL FF TL+ +KLF +K KPYIPD+ +AFEHFCI+A  + ++DEL++NL L   ++
Sbjct  384   PISEQLLFFATLVVKKLFNSKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLHLMPVHV  443

Query  1394  EASRATLHRFGNT  1432
             EASR +LHRFGNT
Sbjct  444   EASRMSLHRFGNT  456



>ref|XP_009117539.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Brassica rapa]
Length=511

 Score =   438 bits (1126),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 231/441 (52%), Positives = 318/441 (72%), Gaps = 10/441 (2%)
 Frame = +2

Query  116   GALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRG  295
             G++   +R  R LPDF+QSV LKYVKLGY+YVI+N   LA  +  L VV  VEV      
Sbjct  12    GSVGVQIRQTRILPDFLQSVNLKYVKLGYHYVISN--LLALCLLPLAVVISVEVSQTDPE  69

Query  296   E--KVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKV  469
             +  ++W  +  N       V  ++   +L F L++Y M++P PIYLVDF+C  P D LKV
Sbjct  70    DLRQLWIHLQYNL------VSIIACSAVLVFGLTVYVMTRPRPIYLVDFSCYLPPDHLKV  123

Query  470   TKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQ  649
                +F++ +  +G FDE +LE+ +++LE SG+G++TY+P+++        +   R EA Q
Sbjct  124   PVSRFMNHSTLTGDFDESSLEFQRKILERSGLGEDTYLPEAMHHVPPTISMAAAREEAEQ  183

Query  650   LIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGC  829
             ++F A+DK+   T ++A+DIG+LVVNC+ FNPTPSLSAMI+N YK++ NI S NLGGMGC
Sbjct  184   VMFGALDKLFANTNVKAKDIGVLVVNCSLFNPTPSLSAMIVNKYKLRGNIRSYNLGGMGC  243

Query  830   SAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSN  1009
             SAG+IA+DLA+D+L  + N YA+VVSTE ++  WY GN ++MLIPNC FR G SAVLLSN
Sbjct  244   SAGVIAVDLAKDMLLVHRNTYAVVVSTENITQNWYFGNKKAMLIPNCLFRVGGSAVLLSN  303

Query  1010  RRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANI  1189
             + RD R +KYRL H+VRTH+GA D+AFR +YQE+D     G+ +SK+L+ + GE LK NI
Sbjct  304   KSRDKRRSKYRLSHVVRTHRGADDKAFRCVYQEQDDTGRTGVSLSKELMAIAGETLKTNI  363

Query  1190  TTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRN  1369
             TTLGPLVLP++EQ+ FF TL+ +KLF  K KPYIPD+ +AFEHFCI+A  + ++DEL++N
Sbjct  364   TTLGPLVLPISEQILFFVTLVVKKLFNGKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKN  423

Query  1370  LRLSEQNMEASRATLHRFGNT  1432
             L+LS  ++EASR TLHRFGNT
Sbjct  424   LQLSPVHVEASRMTLHRFGNT  444



>ref|NP_173376.1| 3-ketoacyl-CoA synthase 4 [Arabidopsis thaliana]
 sp|Q9LN49.1|KCS4_ARATH RecName: Full=3-ketoacyl-CoA synthase 4; Short=KCS-4; AltName: 
Full=Very long-chain fatty acid condensing enzyme 4; Short=VLCFA 
condensing enzyme 4 [Arabidopsis thaliana]
 gb|AAF79428.1|AC025808_10 F18O14.21 [Arabidopsis thaliana]
 gb|ACE79746.1| At1g19440 [Arabidopsis thaliana]
 gb|AEE29852.1| 3-ketoacyl-CoA synthase 4 [Arabidopsis thaliana]
Length=516

 Score =   438 bits (1126),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 231/435 (53%), Positives = 319/435 (73%), Gaps = 10/435 (2%)
 Frame = +2

Query  134   VRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGK  313
             +R  R LPDF+QSV LKYVKLGY+Y+I+N L L    PL  VV  VE  S M  + +  +
Sbjct  23    IRQTRMLPDFLQSVNLKYVKLGYHYLISNLLTLC-LFPL-AVVISVE-ASQMNPDDL-KQ  78

Query  314   IWENSGGPDFGVVNMSLL-GLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFID  490
             +W +     + +V++ +   +L F L++Y M++P P+YLVDF+C  P D LK    +F++
Sbjct  79    LWIHL---QYNLVSIIICSAILVFGLTVYVMTRPRPVYLVDFSCYLPPDHLKAPYARFME  135

Query  491   IARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIG-CPEKIKKLNNIRGEASQLIFEAI  667
              +R +G FD+  LE+ +++LE SG+G++TY+P+++   P +I  +   R EA Q++F A+
Sbjct  136   HSRLTGDFDDSALEFQRKILERSGLGEDTYVPEAMHYVPPRIS-MAAAREEAEQVMFGAL  194

Query  668   DKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIA  847
             D +   T ++ +DIGILVVNC+ FNPTPSLSAMI+N YK++ NI S NLGGMGCSAG+IA
Sbjct  195   DNLFANTNVKPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSYNLGGMGCSAGVIA  254

Query  848   LDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYR  1027
             +DLA+D+L  + N YA+VVSTE ++  WY GN +SMLIPNC FR G SAVLLSN+ RD R
Sbjct  255   VDLAKDMLLVHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSRDKR  314

Query  1028  HAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPL  1207
              +KYRL H+VRTH+GA D+AFR +YQE+D     G+ +SKDL+ + GE LK NITTLGPL
Sbjct  315   RSKYRLVHVVRTHRGADDKAFRCVYQEQDDTGRTGVSLSKDLMAIAGETLKTNITTLGPL  374

Query  1208  VLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQ  1387
             VLP++EQ+ FF TL+ +KLF  K KPYIPD+ +AFEHFCI+A  + ++DEL++NL+LS  
Sbjct  375   VLPISEQILFFMTLVVKKLFNGKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPV  434

Query  1388  NMEASRATLHRFGNT  1432
             ++EASR TLHRFGNT
Sbjct  435   HVEASRMTLHRFGNT  449



>gb|KHN05051.1| 3-ketoacyl-CoA synthase 11 [Glycine soja]
Length=471

 Score =   436 bits (1122),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 206/375 (55%), Positives = 284/375 (76%), Gaps = 4/375 (1%)
 Frame = +2

Query  311   KIWENSGGPDFGVVNMSLLG-LLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFI  487
             ++WEN     F +V+++L   L+ F ++ YFMS+P  +YLVDFAC KP  +   T++ F+
Sbjct  26    QLWENL---KFNLVSVTLCSSLIVFLVTFYFMSRPRGVYLVDFACYKPEPECTCTREIFM  82

Query  488   DIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAI  667
             + + ++G F E+NL + K++LE SG+G +TY+P +I        +   R EA Q++F AI
Sbjct  83    NRSVETGVFSEENLAFQKKILERSGLGQKTYLPPAILSVPSNPCMAEARKEAEQVMFGAI  142

Query  668   DKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIA  847
             D++LEKT ++A+DIGILVVNC+ FNPTPSLSAMI+NHYK++ NI S NLGGMGCSAG+I+
Sbjct  143   DQLLEKTGVKAKDIGILVVNCSLFNPTPSLSAMIVNHYKLRGNIQSYNLGGMGCSAGLIS  202

Query  848   LDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYR  1027
             +DLA+ +L+ +PN YALVVS E ++  WY GN+RSML+ NC FR G +AVLLSN+  D R
Sbjct  203   IDLAKQLLQVHPNSYALVVSMENITLNWYFGNNRSMLVSNCLFRMGGAAVLLSNKSSDRR  262

Query  1028  HAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPL  1207
              AKY+L H VRTH+GA D+++  ++QEED ++  G+ +SKDL+ V GEALK NITTLGPL
Sbjct  263   RAKYQLIHTVRTHKGADDKSYGCVFQEEDEKKTIGVALSKDLMAVAGEALKTNITTLGPL  322

Query  1208  VLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQ  1387
             VLP++EQL FF TL+ RK+F  K KPYIPD+ +AFEHFCI+A  + +LDEL++NL LS+ 
Sbjct  323   VLPMSEQLLFFATLVARKVFKMKIKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLELSDW  382

Query  1388  NMEASRATLHRFGNT  1432
             +ME SR TL+RFGNT
Sbjct  383   HMEPSRMTLNRFGNT  397



>ref|XP_007145927.1| hypothetical protein PHAVU_007G279500g [Phaseolus vulgaris]
 gb|ESW17921.1| hypothetical protein PHAVU_007G279500g [Phaseolus vulgaris]
Length=519

 Score =   438 bits (1126),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 228/445 (51%), Positives = 325/445 (73%), Gaps = 11/445 (2%)
 Frame = +2

Query  107   PDAGALTF-SVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGS  283
             P+ G++   S + R +LP+F+ SV+LKYVKLGY+YVI+N + L     +L  +FG+    
Sbjct  9     PNRGSVNVESAKGRNKLPNFLLSVRLKYVKLGYHYVISNAMYL-----MLIPLFGIASTH  63

Query  284   VMR-GEKVWGKIWENSGGPDFGVVNMSLLG-LLGFTLSIYFMSKPMPIYLVDFACCKPSD  457
             +     K + ++WEN     F +V++++   L+ F  ++YFM++P  +YLVDFAC KP  
Sbjct  64    LTTLSIKDFLQLWENL---KFNLVSVTVCSSLMVFLATLYFMTRPRGVYLVDFACYKPHV  120

Query  458   DLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRG  637
             D   T++ F++ +  +G+F E+NL + K++LE SG+G +TY+P ++        +   R 
Sbjct  121   DCTCTRETFVEKSGLTGSFSEENLSFQKKILERSGLGQKTYLPPAVLSLPPNPCMAEARK  180

Query  638   EASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLG  817
             EA +++F AID++L KT ++A+DIGILVVNC+ FNPTPSLSAMI+NHYK++ N++S NLG
Sbjct  181   EAEEVMFGAIDQLLAKTGVKAKDIGILVVNCSLFNPTPSLSAMIVNHYKLRGNVLSYNLG  240

Query  818   GMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAV  997
             GMGCSAG+I++DLA+ +L+ +PN YALVVS E ++  WY GN+RSML+ NC FR G +A+
Sbjct  241   GMGCSAGLISIDLAKQLLQVHPNSYALVVSMENITLNWYFGNNRSMLVSNCLFRMGGAAI  300

Query  998   LLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEAL  1177
             LLSNR  D R AKY+L H VRTH+GA+D+++  ++QEED  +  G+ +SKDL+ V GEAL
Sbjct  301   LLSNRSGDRRRAKYQLVHTVRTHKGAEDKSYGCVFQEEDETKRVGVALSKDLMAVAGEAL  360

Query  1178  KANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDE  1357
             K NITTLGPLVLP++EQL FF TL+ RK+   K KPYIPD+ +AFEHFCI+A  + +LDE
Sbjct  361   KTNITTLGPLVLPMSEQLLFFGTLVARKVLKMKIKPYIPDFKLAFEHFCIHAGGRAVLDE  420

Query  1358  LKRNLRLSEQNMEASRATLHRFGNT  1432
             L++NL LSE +ME SR TLHRFGNT
Sbjct  421   LEKNLELSEWHMEPSRMTLHRFGNT  445



>ref|XP_006846574.1| hypothetical protein AMTR_s00018p00245180 [Amborella trichopoda]
 gb|ERN08249.1| hypothetical protein AMTR_s00018p00245180 [Amborella trichopoda]
Length=539

 Score =   438 bits (1127),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 231/464 (50%), Positives = 324/464 (70%), Gaps = 12/464 (3%)
 Frame = +2

Query  53    EHHLLSTEIINRGIEPSGPDAGALT---FSVRVRRRLPDFVQSvklkyvklgyyyvINNW  223
             E   L+ E+  R     GPD  A +     +++R++LPDF+QSVKLKYVKLGY Y++++ 
Sbjct  7     EKERLTAEMAFRD-RTDGPDREAFSGQAIVIKIRQKLPDFLQSVKLKYVKLGYGYLMSHG  65

Query  224   LCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVN-MSLLGLLGFTLSIYF  400
             L L   +PLL   FG    +V  G       W N     F +V  M    +L F L++Y 
Sbjct  66    LYLT-VIPLL---FGALFQAVRFGRHPVLGFWSNLC---FDLVTAMGCTVVLIFVLTLYL  118

Query  401   MSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETY  580
             + +P P+YLVDFAC KP D+ K++  +F+D+  K+G F+++ + + KR+   SG+GDETY
Sbjct  119   VKRPRPVYLVDFACYKPVDNRKISTAEFLDMTEKNGAFEDETIAFQKRITMRSGVGDETY  178

Query  581   IPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLS  760
             +P+ I        +   R EA +++F AID + E+T +R RDIG+L+VNC+ FNPTPSLS
Sbjct  179   LPQGITSKPPNLCVREARLEAEEVMFGAIDALFERTGVRPRDIGVLIVNCSLFNPTPSLS  238

Query  761   AMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSG  940
             AMI+NHYKM+ +I S NLGGMGCSAG+I++DLA+D+L+A+PN YA+VVSTE ++  WY G
Sbjct  239   AMIVNHYKMRSDIKSFNLGGMGCSAGLISIDLAQDMLQAHPNTYAVVVSTENITLNWYFG  298

Query  941   NHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVE  1120
             N RSML+ NC FR GC+AVLLSNR  D R +KY L H VRTH+ + D +++ ++Q ED  
Sbjct  299   NDRSMLLCNCIFRMGCAAVLLSNRGHDKRRSKYELVHTVRTHKASDDNSYQCVFQREDSR  358

Query  1121  RIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDY  1300
                G+ ++++L+ V G+ALK NITTLGPLVLPL+EQL FF TL+ RK+   K KPYIP++
Sbjct  359   GTVGVSLARELMAVAGDALKTNITTLGPLVLPLSEQLLFFFTLMARKVLKKKVKPYIPNF  418

Query  1301  TIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
              +AFEHFCI+A  + +LDE+++NL+LS+ +ME SR TLHRFGNT
Sbjct  419   KLAFEHFCIHAGGRAVLDEIQKNLQLSDSHMEPSRMTLHRFGNT  462



>gb|KDP38510.1| hypothetical protein JCGZ_04435 [Jatropha curcas]
Length=502

 Score =   437 bits (1124),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 227/432 (53%), Positives = 314/432 (73%), Gaps = 12/432 (3%)
 Frame = +2

Query  146   RRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGE--KVWGKIW  319
             RRLPDF+QSV LKYVKLGY+Y+I+N L L   +PL+ VV  +E   +   +   +W  + 
Sbjct  13    RRLPDFLQSVNLKYVKLGYHYLISNLLTLC-FIPLI-VVTSIEASQMNLDDLRHLWLHL-  69

Query  320   ENSGGPDFGVVNMSLL-GLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIA  496
                    + +V++ +    L F L++Y M++P P+YLVD+AC +  D LK   DQF++ +
Sbjct  70    ------QYNLVSIIICSAFLVFGLTVYIMTRPRPVYLVDYACYRAPDHLKAPFDQFMEHS  123

Query  497   RKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKV  676
             R +G FDE +LE+ +++LE SG+G+ETY+P+++        +   R EA Q++F A+D +
Sbjct  124   RLTGDFDESSLEFQRKILERSGLGEETYVPEAMHYIPPRPSMAAAREEAEQVMFGALDNL  183

Query  677   LEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDL  856
                T +  ++IGILVVNC+ FNPTPSLSAMI+N YK++ NI S NLGGMGCSAG+IA+DL
Sbjct  184   FANTNVNPKNIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDL  243

Query  857   ARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAK  1036
             A+D+L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR G SAVLLSN+  D   +K
Sbjct  244   AKDLLQVHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSGDKNRSK  303

Query  1037  YRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLP  1216
             Y+L H+VRTH+GA DRAFR +YQE+D     G+ +SKDL+ + GEALKANITTLGPLVLP
Sbjct  304   YKLVHVVRTHRGADDRAFRCVYQEQDGAGKTGVSLSKDLMAIAGEALKANITTLGPLVLP  363

Query  1217  LTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNME  1396
             ++EQL FF TL+ +KLF  K KPYIPD+ +AF+HFCI+A  + ++DEL++NL+L   ++E
Sbjct  364   ISEQLLFFATLVVKKLFNKKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHVE  423

Query  1397  ASRATLHRFGNT  1432
             ASR TLHRFGNT
Sbjct  424   ASRMTLHRFGNT  435



>gb|EYU28278.1| hypothetical protein MIMGU_mgv1a004859mg [Erythranthe guttata]
Length=507

 Score =   437 bits (1124),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 234/473 (49%), Positives = 322/473 (68%), Gaps = 32/473 (7%)
 Frame = +2

Query  41    MAKEEHHLLSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINN  220
             MA+     LS EI+NRGI     ++G+ +FSV+V R LPDF+ SV LKYV+LGY Y+IN+
Sbjct  1     MARRREEYLSPEIVNRGIN----NSGSPSFSVKVNRGLPDFLSSVNLKYVRLGYRYLINH  56

Query  221   WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLG-------  379
                 A  +P+L V+ G ++G +          W+       GV ++    L+        
Sbjct  57    GKYFA-VLPVLLVIIGTQIGKLT---------WD-------GVFSLEYYNLVNTLLLSGF  99

Query  380   --FTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLE  553
                 + +Y    P   YLVDFAC  P ++LK+T +++I++A+KSG F++  +E+ +++L+
Sbjct  100   LSLFVYVYLDLTPRSTYLVDFACYLPPNELKITNEEYIELAKKSGQFNDAAIEFQQQVLK  159

Query  554   SSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCN  733
             +SGIGDETY+P+ I  P   K L + R EA+ L+F A++ +   T IR +DI IL+VNC 
Sbjct  160   NSGIGDETYLPRVIFQPNYRKDLGDGREEAAMLMFGAVEDLFAATGIRPKDIRILIVNCG  219

Query  734   TFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTE  913
               N TPSLSAMIIN YK+   I S N+GGMGC+AGI A+DLA D+L A P  YA++VSTE
Sbjct  220   VLNTTPSLSAMIINRYKLSHTIQSFNIGGMGCAAGITAVDLANDLLNAYPGSYAMIVSTE  279

Query  914   IVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFR  1093
             +VS TWY GN   ML+PNCF R G +A+LLSNRR D   +KY+L+ +VRTH+G  +R+FR
Sbjct  280   VVSFTWYGGNEMDMLLPNCFLRMGAAAILLSNRRLDRWRSKYQLKQLVRTHKGTDERSFR  339

Query  1094  SIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGA  1273
             SI  +ED +R +GL +SKD++EVGG ALKANITTLGPLVLPL EQ +FF++L+  K    
Sbjct  340   SIQLKEDSQRKQGLSVSKDVIEVGGHALKANITTLGPLVLPLLEQFHFFKSLLFNKT--G  397

Query  1274  KTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
              +KPYIPDY +AFEH CI A SK +LDE+++NL L+++ MEASR TL RFGNT
Sbjct  398   SSKPYIPDYKLAFEHVCILATSKKVLDEIQKNLDLTDEYMEASRKTLARFGNT  450



>ref|XP_002890341.1| hypothetical protein ARALYDRAFT_472173 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66600.1| hypothetical protein ARALYDRAFT_472173 [Arabidopsis lyrata subsp. 
lyrata]
Length=515

 Score =   437 bits (1125),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 231/435 (53%), Positives = 318/435 (73%), Gaps = 10/435 (2%)
 Frame = +2

Query  134   VRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGK  313
             +R  R LPDF+QSV LKYVKLGY+Y+I+N L L    PL  VV  VE  S M  + +  +
Sbjct  22    IRQTRMLPDFLQSVNLKYVKLGYHYLISNLLTLC-LFPL-AVVISVE-ASQMNPDDL-KQ  77

Query  314   IWENSGGPDFGVVNMSLL-GLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFID  490
             +W +     + +V++ +   +L F L++Y M++P P+YLVDF+C  P D LK    +FI+
Sbjct  78    LWIHL---QYNLVSIIICSAILVFGLTVYVMTRPRPVYLVDFSCYLPPDHLKAPYARFIE  134

Query  491   IARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIG-CPEKIKKLNNIRGEASQLIFEAI  667
              +R +G FD+  LE+ +++LE SG+G++TY+P+++   P +I  +   R EA Q++F A+
Sbjct  135   HSRLTGDFDDSALEFQRKILERSGLGEDTYVPEAMHFVPPRIS-MAAAREEAEQVMFGAL  193

Query  668   DKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIA  847
             D +   T +  +DIGILVVNC+ FNPTPSLSAMI+N YK++ NI S NLGGMGCSAG+IA
Sbjct  194   DNLFANTSVNPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSYNLGGMGCSAGVIA  253

Query  848   LDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYR  1027
             +DLA+D+L  + N YA+VVSTE ++  WY GN +SMLIPNC FR G SAVLLSN+ RD R
Sbjct  254   VDLAKDMLLVHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSRDKR  313

Query  1028  HAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPL  1207
              +KYRL H+VRTH+GA D+AFR +YQE+D     G+ +SKDL+ + GE LK NITTLGPL
Sbjct  314   RSKYRLVHVVRTHRGADDKAFRCVYQEQDDTGRTGVSLSKDLMAIAGETLKTNITTLGPL  373

Query  1208  VLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQ  1387
             VLP++EQ+ FF TL+ +KLF  K KPYIPD+ +AFEHFC++A  + ++DEL++NL+LS  
Sbjct  374   VLPISEQILFFMTLVVKKLFNGKVKPYIPDFKLAFEHFCVHAGGRAVIDELEKNLQLSPV  433

Query  1388  NMEASRATLHRFGNT  1432
             ++EASR TLHRFGNT
Sbjct  434   HVEASRMTLHRFGNT  448



>ref|XP_001758798.1| predicted protein [Physcomitrella patens]
 gb|EDQ76304.1| predicted protein [Physcomitrella patens]
Length=519

 Score =   437 bits (1123),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 223/437 (51%), Positives = 316/437 (72%), Gaps = 6/437 (1%)
 Frame = +2

Query  122   LTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEK  301
             ++  +  RRRLPDF+QSV LKYVKLGY+Y+I + L L     +LT++  +E G +  G  
Sbjct  17    VSVQITPRRRLPDFLQSVNLKYVKLGYHYLITHLLTLLFIPLVLTIL--LEAGRM--GPD  72

Query  302   VWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQ  481
                ++W+N       V+  S L + G T  +YFMS+P  I+LVDFAC  P + L+V    
Sbjct  73    DLRQLWDNLRFNLVSVITCSALLVFGGT--VYFMSRPRSIFLVDFACYLPDERLQVPIPL  130

Query  482   FIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFE  661
             F++  R +G FDEK+L++ +++LE SG+G +TY+P ++        +   R EA Q++F 
Sbjct  131   FMERTRMAGFFDEKSLDFQQKILERSGLGPKTYLPAAMHELPPCPSMKAAREEAEQVMFG  190

Query  662   AIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGI  841
              +D++ EKT I+ +D+GILVVNC+ FNPTPSLSAMI+N Y M+ NI + N+GGMGCSAG+
Sbjct  191   CLDELFEKTSIKPKDVGILVVNCSLFNPTPSLSAMIVNKYHMRGNIRTYNMGGMGCSAGV  250

Query  842   IALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRD  1021
             IA+DLA+D+L+ N + YA+VVSTE ++  WY GN RSMLIPNC FR G +A+LLSN+R+D
Sbjct  251   IAIDLAKDMLQINGSTYAIVVSTENITQNWYFGNRRSMLIPNCLFRVGGAAILLSNKRKD  310

Query  1022  YRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLG  1201
              R +KY+L H+VRTH+GA D+ +  +YQE+D +   G+ +SKDL+ + GE LKANITTLG
Sbjct  311   ARRSKYKLNHVVRTHKGADDKCYNCVYQEQDQQGNMGVSLSKDLMAIAGETLKANITTLG  370

Query  1202  PLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLS  1381
             PLVLPL+EQL FF +L+ RK+F  K KPYIPD+ +AF+HFCI+A  + ++DEL++NL+L+
Sbjct  371   PLVLPLSEQLLFFTSLVTRKVFNMKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLT  430

Query  1382  EQNMEASRATLHRFGNT  1432
              ++ E SR TLHRFGNT
Sbjct  431   PEHCEPSRMTLHRFGNT  447



>ref|XP_001778803.1| predicted protein [Physcomitrella patens]
 gb|EDQ56389.1| predicted protein [Physcomitrella patens]
Length=532

 Score =   437 bits (1124),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 228/435 (52%), Positives = 314/435 (72%), Gaps = 10/435 (2%)
 Frame = +2

Query  134   VRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGE--KVW  307
             +RVR+RLPDF+QSV LKYVKLGY+YV+ +   L   V  L +   VE G + R +  ++W
Sbjct  34    IRVRQRLPDFLQSVNLKYVKLGYHYVVTH--ALFLLVLPLLLAVAVEFGRLGRDDILQLW  91

Query  308   GKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFI  487
               +  N       V  ++  G L F  ++YFMS+P P+YLVDF+C KP D+ KVT   FI
Sbjct  92    DHLQYNL------VSVLACSGALVFVATLYFMSRPRPVYLVDFSCYKPEDERKVTMQTFI  145

Query  488   DIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAI  667
               + ++G FDEK+LE+ K+++E SG+G ETY+P+++        +   R EA Q++F A+
Sbjct  146   QRSIEAGKFDEKSLEFQKKIIERSGLGQETYLPRAVVSAPPNPCMKEARLEAEQVMFGAL  205

Query  668   DKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIA  847
             D++ EKT ++ +DIG+LVVNC+ FNPTPSLSAMI+NHYKM+ NI S NLGGMGCSAG+IA
Sbjct  206   DELFEKTGVKPKDIGVLVVNCSLFNPTPSLSAMIVNHYKMRGNIQSLNLGGMGCSAGVIA  265

Query  848   LDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYR  1027
             +DLA+D+L+ +   YA+VVS E ++  WY GN RS L+ NC FR G +A++LSN+R + R
Sbjct  266   IDLAKDLLQVHGGSYAIVVSMENITLNWYFGNDRSKLVSNCIFRMGGAAIMLSNKRSERR  325

Query  1028  HAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPL  1207
              AKY L H VRTH+GA ++ FR ++QEED E   G+ +S++L+ V G+ALKANITTLGPL
Sbjct  326   RAKYELVHTVRTHKGADEKCFRCVFQEEDSEGTMGVSLSRELMGVAGDALKANITTLGPL  385

Query  1208  VLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQ  1387
             VLPL+EQL FF TL+ RK    K KPYIPD+ +AF+HFCI+A  + +LDE+++NL LS+ 
Sbjct  386   VLPLSEQLLFFATLVARKFLNMKVKPYIPDFKLAFDHFCIHAGGRAVLDEIEKNLSLSQW  445

Query  1388  NMEASRATLHRFGNT  1432
             +ME SR TL+RFGNT
Sbjct  446   HMEPSRMTLYRFGNT  460



>ref|XP_006299088.1| hypothetical protein CARUB_v10015226mg [Capsella rubella]
 gb|EOA31986.1| hypothetical protein CARUB_v10015226mg [Capsella rubella]
Length=511

 Score =   436 bits (1122),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 222/432 (51%), Positives = 319/432 (74%), Gaps = 10/432 (2%)
 Frame = +2

Query  143   RRRLPDFVQSvklkyvklgyyyvINNW--LCLAATVPLLTVVFGVEVGSVMRGEKVWGKI  316
             RR+LP+F+QSV +KYVKLGY+Y+I +   LCL   VPL+ V+  V   S +  + ++ +I
Sbjct  21    RRKLPNFLQSVNMKYVKLGYHYLITHLFKLCL---VPLMAVL--VTEISRLTTDDLY-QI  74

Query  317   WENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIA  496
             W +        + +S L + G T  +Y MS+P  +YLVD++C  P + L+V   +F+D +
Sbjct  75    WLHLQYNLVAFIFLSALAVFGST--VYIMSRPRSVYLVDYSCYLPPESLQVNYQKFMDHS  132

Query  497   RKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKV  676
             +    F+E +LE+ +++LE SG+G+ETY+P+++ C      +   R EA Q++F A+DK+
Sbjct  133   KLIEDFNESSLEFQRKILERSGLGEETYLPEALHCIPPRPTMMAAREEAEQVMFGALDKL  192

Query  677   LEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDL  856
              E T+I  RDIG+LVVNC+ FNPTPSLSAMI+N YK++ N+ S NLGGMGCSAG+IA+DL
Sbjct  193   FENTKINPRDIGVLVVNCSLFNPTPSLSAMIVNKYKLRGNVKSFNLGGMGCSAGVIAIDL  252

Query  857   ARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAK  1036
             A+D+L+ + N YA+V+STE ++  WY GN ++MLIPNC FR G SA+LLSN+ +D R +K
Sbjct  253   AKDMLQVHRNTYAVVISTENITQNWYFGNKKAMLIPNCLFRVGGSAILLSNKGKDRRRSK  312

Query  1037  YRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLP  1216
             Y+L H VRTH+GA ++AF  +YQE+D     G+ +SKDL+ + GEALKANITTLGPLVLP
Sbjct  313   YKLVHTVRTHKGAVEKAFNCVYQEQDDNGKTGVSLSKDLMAIAGEALKANITTLGPLVLP  372

Query  1217  LTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNME  1396
             ++EQ+ FF TL+ +KLF AK KPYIPD+ +AF+HFCI+A  + ++DEL++NL+LS+ ++E
Sbjct  373   ISEQILFFMTLVTKKLFNAKLKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLSQTHVE  432

Query  1397  ASRATLHRFGNT  1432
             ASR TLHRFGNT
Sbjct  433   ASRMTLHRFGNT  444



>ref|XP_007200967.1| hypothetical protein PRUPE_ppa004500mg [Prunus persica]
 gb|EMJ02166.1| hypothetical protein PRUPE_ppa004500mg [Prunus persica]
Length=506

 Score =   436 bits (1122),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 231/455 (51%), Positives = 319/455 (70%), Gaps = 18/455 (4%)
 Frame = +2

Query  68    STEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVP  247
             S  I+N G++            +   RRLPDF+QSV LKYVKLGY+Y+I + L L  +VP
Sbjct  3     SEPIVNGGVQ------------IHQSRRLPDFLQSVNLKYVKLGYHYLITHLLTLC-SVP  49

Query  248   LLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYL  427
             L+ VV  V   S M  + +   +W         V+  S + + G T  +Y M++P  +YL
Sbjct  50    LMAVV--VIQASQMNPDDI-HHLWLQLQYNLVSVIIFSAVIVFGST--VYIMTRPRSVYL  104

Query  428   VDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPE  607
             VD++C KP   L+V   QF++ ++ +G FDE +LE+ +++LE SG+G+ETY+P+++    
Sbjct  105   VDYSCYKPPSHLQVRFQQFMEHSKLTGDFDESSLEFQRKILERSGLGEETYVPEAMHYLP  164

Query  608   KIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKM  787
                 +   R EA Q+IF A+D +   T ++ +DIGILVVNC+ FNPTPSLSAMI+N YK+
Sbjct  165   PRPSMAAAREEAEQVIFGALDNLFANTNVKPKDIGILVVNCSLFNPTPSLSAMIVNKYKL  224

Query  788   KRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPN  967
             + NI S NLGGMGCSAG+IA+DLA+++L+ + N YA+VVSTE ++  WY GN +SMLIPN
Sbjct  225   RGNIRSFNLGGMGCSAGVIAVDLAKEMLQVHGNAYAVVVSTENITQNWYFGNKKSMLIPN  284

Query  968   CFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISK  1147
             C FR G +AVLLSN+  D R AKY+L H+VRTH+GA D+AFR +YQE+D     G+ +SK
Sbjct  285   CLFRVGGAAVLLSNKSLDRRRAKYKLVHVVRTHRGADDKAFRCVYQEQDNTGKTGVSLSK  344

Query  1148  DLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCI  1327
             DL+ + G ALK NITTLGPLVLPL+EQL FF TL+ +KLF AK KPYIPD+ +AF+HFCI
Sbjct  345   DLMAIAGGALKTNITTLGPLVLPLSEQLLFFATLVAKKLFNAKVKPYIPDFKLAFDHFCI  404

Query  1328  NAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             +A  + ++DEL++NL+L   ++EASR TLHRFGNT
Sbjct  405   HAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNT  439



>ref|XP_008236905.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Prunus mume]
Length=506

 Score =   436 bits (1121),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 231/455 (51%), Positives = 319/455 (70%), Gaps = 18/455 (4%)
 Frame = +2

Query  68    STEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVP  247
             S  I+N G++            +   RRLPDF+QSV LKYVKLGY+Y+I + L L  +VP
Sbjct  3     SEPIVNGGVQ------------IHQSRRLPDFLQSVNLKYVKLGYHYLITHLLTLC-SVP  49

Query  248   LLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYL  427
             ++ VV  V   S M  + +   +W         V+  S + + G T  +Y M++P  +YL
Sbjct  50    IMAVV--VIQASQMNLDDI-HHLWLQLQYNLVSVIIFSAVIVFGST--VYIMTRPRSVYL  104

Query  428   VDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPE  607
             VD++C KP   L+V   QF++ ++ +G FDE +LE+ +++LE SG+G+ETY+P+++    
Sbjct  105   VDYSCYKPPSHLQVRFQQFMEHSKLTGDFDESSLEFQRKILERSGLGEETYVPEAMHYIP  164

Query  608   KIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKM  787
                 +   R EA Q+IF A+D +   T ++ +DIGILVVNC+ FNPTPSLSAMI+N YK+
Sbjct  165   PRPSMAAAREEAEQVIFGALDNLFANTNVKPKDIGILVVNCSLFNPTPSLSAMIVNKYKL  224

Query  788   KRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPN  967
             + NI S NLGGMGCSAG+IA+DLA+++L+ + N YA+VVSTE ++  WY GN +SMLIPN
Sbjct  225   RGNIRSFNLGGMGCSAGVIAVDLAKEMLQVHGNTYAVVVSTENITQNWYFGNKKSMLIPN  284

Query  968   CFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISK  1147
             C FR G +AVLLSNR  D R AKY+L H+VRTH+GA D+AFR +YQE+D     G+ +SK
Sbjct  285   CLFRVGGAAVLLSNRSLDRRRAKYKLVHVVRTHRGADDKAFRCVYQEQDDAGKTGVSLSK  344

Query  1148  DLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCI  1327
             DL+ + G ALK NITTLGPLVLPL+EQL FF TL+ +KLF AK KPYIPD+ +AF+HFCI
Sbjct  345   DLMAIAGGALKTNITTLGPLVLPLSEQLLFFATLVAKKLFNAKVKPYIPDFKLAFDHFCI  404

Query  1328  NAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             +A  + ++DEL++NL+L   ++EASR TLHRFGNT
Sbjct  405   HAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNT  439



>ref|XP_002884160.1| hypothetical protein ARALYDRAFT_900287 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60419.1| hypothetical protein ARALYDRAFT_900287 [Arabidopsis lyrata subsp. 
lyrata]
Length=511

 Score =   436 bits (1121),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 223/432 (52%), Positives = 318/432 (74%), Gaps = 10/432 (2%)
 Frame = +2

Query  143   RRRLPDFVQSvklkyvklgyyyvINNW--LCLAATVPLLTVVFGVEVGSVMRGEKVWGKI  316
             RR+LP+F+QSV +KYVKLGY+Y+I +   LCL   VPL+ V+  V   S +  + ++ +I
Sbjct  21    RRKLPNFLQSVNMKYVKLGYHYLITHLFKLCL---VPLMAVL--VTEISRLTTDDLY-QI  74

Query  317   WENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIA  496
             W +        + +S L + G T  +Y MS+P  +YLVD++C  P + L+V   +F+D +
Sbjct  75    WLHLQYNLVAFIFLSALAIFGST--VYIMSRPRSVYLVDYSCYLPPESLQVKYQKFMDHS  132

Query  497   RKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKV  676
             +    F+E +LE+ +++LE SG+G+ETY+P+++ C      +   R EA Q++F A+DK+
Sbjct  133   KLIEDFNESSLEFQRKILERSGLGEETYLPEALHCIPPRPTMMAAREEAEQVMFGALDKL  192

Query  677   LEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDL  856
              E T I  RDIG+LVVNC+ FNPTPSLSAMI+N YK++ N+ S NLGGMGCSAG+IA+DL
Sbjct  193   FENTEINPRDIGVLVVNCSLFNPTPSLSAMIVNKYKLRGNVKSFNLGGMGCSAGVIAIDL  252

Query  857   ARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAK  1036
             A+D+L+ + N YA+VVSTE ++  WY GN ++MLIPNC FR G SA+LLSN+ +D R +K
Sbjct  253   AKDMLQVHRNTYAVVVSTENITQNWYFGNKKAMLIPNCLFRVGGSAILLSNKGKDRRRSK  312

Query  1037  YRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLP  1216
             Y+L H VRTH+GA ++AF  +YQE+D     G+ +SKDL+ + GEALKANITTLGPLVLP
Sbjct  313   YKLVHTVRTHKGAVEKAFNCVYQEQDDYGKTGVSLSKDLMAIAGEALKANITTLGPLVLP  372

Query  1217  LTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNME  1396
             ++EQ+ FF TL+ +KLF AK KPYIPD+ +AF+HFCI+A  + ++DEL++NL+LS+ ++E
Sbjct  373   ISEQILFFMTLVTKKLFNAKLKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLSQTHVE  432

Query  1397  ASRATLHRFGNT  1432
             ASR TLHRFGNT
Sbjct  433   ASRMTLHRFGNT  444



>ref|XP_010104374.1| 3-ketoacyl-CoA synthase 4 [Morus notabilis]
 gb|EXB99937.1| 3-ketoacyl-CoA synthase 4 [Morus notabilis]
Length=513

 Score =   436 bits (1120),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 225/435 (52%), Positives = 316/435 (73%), Gaps = 10/435 (2%)
 Frame = +2

Query  134   VRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGE--KVW  307
             ++  RRLPDF+QSV LKYVKLGY+Y+I+N L L   VPL+ V   +E   +  G+  ++W
Sbjct  20    IQQSRRLPDFLQSVNLKYVKLGYHYLISNLLTLC-FVPLIIVTL-IEASQMDLGDLRQLW  77

Query  308   GKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFI  487
               +  N       V+  S   ++G  L++Y M++P P+YLVD++C +  D+LK   D+F+
Sbjct  78    LHLQYNL----VSVIICSSFLVVG--LTVYIMTRPRPVYLVDYSCYRAPDNLKAPFDRFM  131

Query  488   DIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAI  667
               +  +G FD+ +LE+ +++LE SG+G+ETY+P+++        +   R EA Q++F A+
Sbjct  132   THSELTGDFDDSSLEFQRKILERSGLGEETYVPEAMHFIPPRPSMAAAREEAEQVMFGAL  191

Query  668   DKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIA  847
             D +   T ++ +DIGILVVNC+ FNPTPSLSAMI+N YK++ NI S NLGGMGCSAG+IA
Sbjct  192   DNLFANTNVKPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIA  251

Query  848   LDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYR  1027
             +DLA+D+L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR G +AVLLSN+  D R
Sbjct  252   VDLAKDLLQVHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGAAVLLSNKSMDRR  311

Query  1028  HAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPL  1207
              AKYRL H+VRTH+GA D+AFR +YQE+D     G+ +SKDL+ + G ALK NITTLGPL
Sbjct  312   RAKYRLVHVVRTHKGADDKAFRCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPL  371

Query  1208  VLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQ  1387
             VLP++EQL FF TL+ +K F A  KPYIPD+ +AF+HFCI+A  + ++DEL++NL+LS+ 
Sbjct  372   VLPISEQLLFFATLVVKKFFNADVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLSQV  431

Query  1388  NMEASRATLHRFGNT  1432
             ++EASR TLHRFGNT
Sbjct  432   HVEASRMTLHRFGNT  446



>ref|XP_010477163.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Camelina sativa]
Length=517

 Score =   436 bits (1120),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 227/437 (52%), Positives = 316/437 (72%), Gaps = 14/437 (3%)
 Frame = +2

Query  134   VRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGE--KVW  307
             +R  RRLPDF+QSV LKYVKLGY+Y+I+N L L    PL  VV  VE       +  ++W
Sbjct  24    IRQTRRLPDFLQSVNLKYVKLGYHYLISNLLTLC-LFPL-AVVISVEASQTNPNDLKQLW  81

Query  308   GKIWENSGGPDFGVVNMSLL-GLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQF  484
               +        + +V++ +   +L F L++Y M++P P+YLVDF+C  P D LK    +F
Sbjct  82    IHL-------QYNLVSIIICSAVLVFGLTVYVMTRPRPVYLVDFSCYLPPDHLKAPYSRF  134

Query  485   IDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIG-CPEKIKKLNNIRGEASQLIFE  661
             ++ ++ +G FD+  LE+ +++LE SG+G++TY+P+++   P +I  +   R EA Q++F 
Sbjct  135   MEHSKLTGDFDDSALEFQRKILERSGLGEDTYVPEAMHHVPPRIS-MAAAREEAEQVMFG  193

Query  662   AIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGI  841
             A+D +     +  +DIGILVVNC+ FNPTPSLSAMI+N YK++ NI S NLGGMGCSAG+
Sbjct  194   ALDNLFANANVNPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSYNLGGMGCSAGV  253

Query  842   IALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRD  1021
             IA+DLA+D+L  + N YA+VVSTE ++  WY GN +SMLIPNC FR G SAVLLSN+ RD
Sbjct  254   IAVDLAKDMLLVHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSRD  313

Query  1022  YRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLG  1201
              R +KY+L H+VRTH+GA D+AFR +YQE+D     G+ +SKDL+ + GE LK NITTLG
Sbjct  314   KRRSKYKLVHVVRTHRGADDKAFRCVYQEQDDTGRTGVSLSKDLMAIAGETLKTNITTLG  373

Query  1202  PLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLS  1381
             PLVLP++EQ+ FF TL+ +KLF +K KPYIPD+ +AFEHFCI+A  + ++DEL++NL+LS
Sbjct  374   PLVLPISEQILFFMTLVVKKLFNSKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLS  433

Query  1382  EQNMEASRATLHRFGNT  1432
               ++EASR TLHRFGNT
Sbjct  434   PVHVEASRMTLHRFGNT  450



>ref|XP_004289669.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Fragaria vesca subsp. 
vesca]
Length=509

 Score =   435 bits (1119),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 231/456 (51%), Positives = 320/456 (70%), Gaps = 14/456 (3%)
 Frame = +2

Query  65    LSTEIINRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATV  244
             +S+E ++ G        GA    +   RRLPDF+ SV LKYVKLGY+Y+I N L L   +
Sbjct  1     MSSESVDHG--------GAQNIQIHQGRRLPDFLNSVNLKYVKLGYHYLITNLLKLC-LI  51

Query  245   PLLTVVFGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIY  424
             PL+ ++  V   S M  + +  ++W         V+  S   +L F  ++Y M++P  +Y
Sbjct  52    PLMALI--VIEASQMNPDDI-HQLWLQLQYNLVSVIVFS--AVLVFGSTVYIMTRPRSVY  106

Query  425   LVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCP  604
             LVD++C K  D LKV   +F+D +R +G FDE +LE+ +++LE SG+G+ETY+P+++   
Sbjct  107   LVDYSCYKAPDHLKVKYQKFMDHSRLTGDFDESSLEFQRKILERSGLGEETYLPEAMHFI  166

Query  605   EKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYK  784
                  +   R EA Q+IF A+D +   T ++ +DIGILVVNC+ FNPTPSLSAMI+N YK
Sbjct  167   PPRPTMAAAREEAEQVIFGALDNLFANTNVKPKDIGILVVNCSLFNPTPSLSAMIVNKYK  226

Query  785   MKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIP  964
             ++ NI S NLGGMGCSAG+IA+DLA+D+L+ + N YA+VVSTE ++  WY GN +SMLIP
Sbjct  227   LRGNIRSFNLGGMGCSAGVIAIDLAKDMLQVHRNTYAVVVSTENITQNWYFGNKKSMLIP  286

Query  965   NCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKIS  1144
             NC FR G SAVLLSN+  D R AKY+L H+VRTH+GA D+AFR +YQE+D     G+ +S
Sbjct  287   NCLFRVGGSAVLLSNKSLDRRRAKYKLVHVVRTHKGADDKAFRCVYQEQDDIGKTGVSLS  346

Query  1145  KDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFC  1324
             K+L+ + G ALK NITTLGPLVLPL+EQL FF TL+ +KLF AK KPYIPD+ +AF+HFC
Sbjct  347   KELMAIAGGALKTNITTLGPLVLPLSEQLLFFATLVAKKLFNAKVKPYIPDFKLAFDHFC  406

Query  1325  INAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             I+A  + ++DEL++NL+L   ++E+SR TLHRFGNT
Sbjct  407   IHAGGRAVIDELEKNLQLLPVHVESSRMTLHRFGNT  442



>ref|XP_003536489.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Glycine max]
Length=517

 Score =   436 bits (1120),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 228/431 (53%), Positives = 317/431 (74%), Gaps = 8/431 (2%)
 Frame = +2

Query  143   RRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWE  322
             R++LP+FV SV+LKYVKLGY+YVI+N + L   +PL+       + ++   E V  ++WE
Sbjct  20    RKKLPNFVVSVRLKYVKLGYHYVISNAMYLM-LIPLIGTA-SAHLSTISMKELV--RLWE  75

Query  323   NSGGPDFGVVNMSLLG-LLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIAR  499
             N     F +V+++L   L+ F  ++YFMS+P  +YLVDFAC KP  D K T++ F++ + 
Sbjct  76    NL---KFDLVSVTLCSSLMVFLGTLYFMSRPRGVYLVDFACYKPDVDCKCTREIFVERSG  132

Query  500   KSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVL  679
              +G+F E+NL + K++LE SG+G +TY+P +I        +   R EA Q++F AID++L
Sbjct  133   LTGSFTEENLSFQKKILERSGLGQKTYLPPAILSLPPKPCMAAAREEAEQVMFGAIDQLL  192

Query  680   EKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLA  859
              KT ++A+DIGILVVNC+ FNPTPSLSAMI+NHYK++ N+ S NL GMGCSA +I++DLA
Sbjct  193   AKTGVKAKDIGILVVNCSLFNPTPSLSAMIVNHYKLRGNVFSYNLAGMGCSASLISIDLA  252

Query  860   RDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKY  1039
             + +L+ +PN YALVVS E ++  WY GN+RSML+ NC FR G +A+LLSNR  D R AKY
Sbjct  253   KHLLQVHPNSYALVVSMENITLNWYFGNNRSMLVSNCLFRMGGAAILLSNRSGDRRRAKY  312

Query  1040  RLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPL  1219
             +L H VRTH+GA D+++  ++QEED  +  G+ +SKDL+ V GEALK NITTLGPLVLP+
Sbjct  313   QLVHTVRTHKGADDKSYSCVFQEEDETKRIGVALSKDLMAVAGEALKTNITTLGPLVLPM  372

Query  1220  TEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEA  1399
             +EQL FF TL+ RK+F  K KPYIPD+ +AFEHFCI+A  + +LDEL++NL LS+ +ME 
Sbjct  373   SEQLLFFATLVARKVFKMKIKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLELSDWHMEP  432

Query  1400  SRATLHRFGNT  1432
             SR TL+RFGNT
Sbjct  433   SRMTLYRFGNT  443



>ref|XP_002284986.1| PREDICTED: 3-ketoacyl-CoA synthase 11 [Vitis vinifera]
 emb|CAN67313.1| hypothetical protein VITISV_014119 [Vitis vinifera]
Length=511

 Score =   435 bits (1119),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 221/430 (51%), Positives = 310/430 (72%), Gaps = 8/430 (2%)
 Frame = +2

Query  146   RRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWEN  325
             R LPDF +SVKLKYVKLGY+Y+I + + L  +  ++ +   +   S+     +W  +   
Sbjct  17    RNLPDFKKSVKLKYVKLGYHYLITHGMYLFLSPLVVVIAAQLSTFSLQDLHDLWDHL---  73

Query  326   SGGPDFGVVNMSLLG-LLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARK  502
                  F ++++ L   LL F  ++YF+++P P+YLVDFAC KP +  K T+  F+D ++ 
Sbjct  74    ----RFNLISVILCSTLLVFLSTLYFLTRPRPVYLVDFACYKPEESRKCTRKIFMDQSQM  129

Query  503   SGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLE  682
             +G+F E +LE+ +++LE SG+G+ TY+P+++        +   R EA+ ++F A+D++  
Sbjct  130   TGSFTESSLEFQRKILEKSGLGESTYLPEAVLNIPPNPSMQEARKEAATVMFGALDQLFA  189

Query  683   KTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLAR  862
             KT ++ +DIGILVVNC+ FNPTPSLSAM+INHYK++ NI+S NLGGMGCSAG+I++DLA+
Sbjct  190   KTSLKPKDIGILVVNCSLFNPTPSLSAMVINHYKLRGNIISYNLGGMGCSAGLISIDLAK  249

Query  863   DILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYR  1042
             D+L+ +PN YALV+S E ++  WY GN RSML+ NC FR G +AVLLSN+  D R +KYR
Sbjct  250   DLLQVHPNSYALVISMENITLNWYFGNQRSMLVSNCLFRMGGAAVLLSNKSSDRRRSKYR  309

Query  1043  LQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLT  1222
             L H VRTH+GA D+ F  + QEED E   G+ +SKDL+ V G+ALK NITTLGPLVLP++
Sbjct  310   LVHTVRTHKGADDKCFACVTQEEDAEGKVGVSLSKDLMGVAGDALKTNITTLGPLVLPMS  369

Query  1223  EQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEAS  1402
             EQL FF TLI RKLF  K KPYIPD+ +AFEHFCI+A  + +LDEL++NL LS+ +ME S
Sbjct  370   EQLLFFATLIGRKLFKMKLKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLHLSDWHMEPS  429

Query  1403  RATLHRFGNT  1432
             R TL+RFGNT
Sbjct  430   RMTLYRFGNT  439



>ref|XP_010498362.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Camelina sativa]
Length=516

 Score =   435 bits (1119),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 230/435 (53%), Positives = 317/435 (73%), Gaps = 10/435 (2%)
 Frame = +2

Query  134   VRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGK  313
             +R  RRLPDF+QSV LKYVKLGY+Y+I+N L L    P   VV  VE  S M  + +  +
Sbjct  23    IRQTRRLPDFLQSVNLKYVKLGYHYLISNLLTLC-LFPF-AVVISVE-ASQMNPDDL-KQ  78

Query  314   IWENSGGPDFGVVNMSLL-GLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFID  490
             +W +     + +V++ +   +L F L++Y M++P P+YLVDF+C  P D LK    +F++
Sbjct  79    LWIHL---QYNLVSIIICSAVLVFGLTVYVMTRPRPVYLVDFSCYLPPDHLKAPYARFME  135

Query  491   IARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIG-CPEKIKKLNNIRGEASQLIFEAI  667
              +R +G FD+  LE+ +++LE SG+G++TY+P+++   P +I  +   R EA Q++F A+
Sbjct  136   HSRLTGDFDDSALEFQRKILERSGLGEDTYVPEAMHHVPARIS-MAAAREEAEQVMFGAL  194

Query  668   DKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIA  847
             D +     +  +DIGILVVNC+ FNPTPSLSAMI+N YK++ NI S NLGGMGCSAG+IA
Sbjct  195   DNLFANANVNPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSYNLGGMGCSAGVIA  254

Query  848   LDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYR  1027
             +DLA+D+L  + N YA+VVSTE ++  WY GN +SMLIPNC FR G SAVLLSN+ RD R
Sbjct  255   VDLAKDMLLVHRNTYAVVVSTENMTQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSRDKR  314

Query  1028  HAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPL  1207
              +KYRL H+VRTH+GA D+AFR +YQE+D     G+ +SKDL+ + GE LK NITTLGPL
Sbjct  315   RSKYRLVHVVRTHRGADDKAFRCVYQEQDDTGRTGVSLSKDLMAIAGETLKTNITTLGPL  374

Query  1208  VLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQ  1387
             VLP++EQ+ FF TL+ +KLF  K KPYIPD+ +AFEHFCI+A  + ++DEL++NL+LS  
Sbjct  375   VLPISEQILFFMTLVVKKLFNGKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPV  434

Query  1388  NMEASRATLHRFGNT  1432
             ++EASR TLHRFGNT
Sbjct  435   HVEASRMTLHRFGNT  449



>ref|NP_001267518.1| uncharacterized protein LOC100797855 [Glycine max]
 gb|AFY23861.1| 3-ketoacyl-CoA synthase [Glycine max]
Length=510

 Score =   435 bits (1119),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 224/446 (50%), Positives = 317/446 (71%), Gaps = 10/446 (2%)
 Frame = +2

Query  101   SGPDAGALTFSVRVRRR--LPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVE  274
             SG +  A+   ++ + R  LPDF+QSV LKYVKLGY+Y+I+N + L   VPL+ V   ++
Sbjct  6     SGEEEAAVGVQIQQKSRMVLPDFLQSVNLKYVKLGYHYLISNLVTLF-LVPLILVTL-IQ  63

Query  275   VGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPS  454
             V        +W  +  N       +  ++   +L F L++Y ++ P P+YL+D AC +P+
Sbjct  64    VSQTTDLRHLWLHLQYNL------LTILTCSAVLVFGLTLYAVTCPRPVYLLDSACFRPA  117

Query  455   DDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIR  634
             D LK     F+D +R +G F+E +LE+ +++LE SG+G+ETY+P ++        +   R
Sbjct  118   DHLKAPFRSFMDHSRLTGDFEESSLEFQRKILERSGLGEETYVPDAMHSIPPQPSMAAAR  177

Query  635   GEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNL  814
              EA Q++F A+D + + T I+ +DIGIL+VNC+ FNPTPSLS+MI+N YK++ NI S NL
Sbjct  178   AEAEQVMFGALDNLFQSTNIKPKDIGILIVNCSLFNPTPSLSSMIVNKYKLRGNIRSFNL  237

Query  815   GGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSA  994
             GGMGCSAG+IA+DLA+D+L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR GCS 
Sbjct  238   GGMGCSAGVIAVDLAKDLLQVHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGCSV  297

Query  995   VLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEA  1174
             +LLSN+  D R AKYRL H+VRTH+GA D+AFR +YQE+D     G+ +SKDL+ + G A
Sbjct  298   LLLSNKPADRRRAKYRLVHVVRTHRGADDKAFRCVYQEQDDAGKTGVSLSKDLMAIAGGA  357

Query  1175  LKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLD  1354
             LK NITTLGPLVLP++EQL FF TL+ +KLF A  KPYIPD+ +AF+HFCI+A  + ++D
Sbjct  358   LKTNITTLGPLVLPISEQLLFFVTLLMKKLFKADVKPYIPDFKLAFDHFCIHAGGRAVID  417

Query  1355  ELKRNLRLSEQNMEASRATLHRFGNT  1432
             EL++NL+L  +++EASR TLHRFGNT
Sbjct  418   ELEKNLQLLPEHVEASRMTLHRFGNT  443



>ref|XP_011081914.1| PREDICTED: 3-ketoacyl-CoA synthase 11 [Sesamum indicum]
Length=511

 Score =   434 bits (1117),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 220/430 (51%), Positives = 315/430 (73%), Gaps = 8/430 (2%)
 Frame = +2

Query  146   RRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWEN  325
             R+LPDF QSVKLKYVKLGY+Y+I + + L  +  ++ +   V   S+     +W  +   
Sbjct  17    RKLPDFKQSVKLKYVKLGYHYLITHGMYLFLSPLVVVIAAQVSTFSLQDLYVLWDHL---  73

Query  326   SGGPDFGVVNMSLL-GLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARK  502
                  F ++++ +   LL F  ++YF+++P P+YLV+F+C KP+DD K T+  F++ +R 
Sbjct  74    ----RFNLISVIVCSALLVFLSTVYFLTRPRPVYLVNFSCYKPNDDRKCTRQIFMERSRL  129

Query  503   SGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLE  682
             +GTF E+NLE+ +++LE SG+G+ TY+P+++        +   R EA  ++F AID++L 
Sbjct  130   TGTFTEENLEFQRKILERSGLGESTYLPEAVLRVPPNPCMAEARKEAETVMFGAIDELLA  189

Query  683   KTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLAR  862
             KT ++ +DIGIL+VNC+ FNPTPSLSAM+INHYK++ NI+S NLGGMGCSAG+I++DLA+
Sbjct  190   KTSLKPKDIGILIVNCSLFNPTPSLSAMVINHYKLRGNIISYNLGGMGCSAGLISIDLAK  249

Query  863   DILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYR  1042
             D+L+ +PN YALV+S E ++  WY GN RSML+ NC FR G +A+LLSN+R DY  +KYR
Sbjct  250   DLLQVHPNTYALVISMENITLNWYFGNERSMLVSNCLFRMGGAAILLSNKRSDYWRSKYR  309

Query  1043  LQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLT  1222
             L H VRTH+G+ D+ F  + Q ED +   G+ +SKDL+ V G+ALK NITTLGPLVLP++
Sbjct  310   LVHTVRTHKGSDDKCFSCVTQMEDSKGKIGVALSKDLMAVAGDALKTNITTLGPLVLPMS  369

Query  1223  EQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEAS  1402
             EQL FF TL+ +KLF  K KPYIPD+ +AFEHFCI+A  + +LDEL++NL+LS+ +ME S
Sbjct  370   EQLLFFATLVGKKLFKMKLKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLQLSDWHMEPS  429

Query  1403  RATLHRFGNT  1432
             R TL+RFGNT
Sbjct  430   RMTLYRFGNT  439



>ref|XP_009627040.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Nicotiana tomentosiformis]
Length=516

 Score =   434 bits (1117),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 225/450 (50%), Positives = 319/450 (71%), Gaps = 17/450 (4%)
 Frame = +2

Query  89    GIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFG  268
             G EP G         ++  RRLPDF+QSV LKYVKLGY+Y+I+N L L   +P++ V+  
Sbjct  15    GDEPVG-------VQIQQSRRLPDFLQSVNLKYVKLGYHYLISNLLTLC-LIPVMAVIL-  65

Query  269   VEVGSVMRGE--KVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFAC  442
             +E   +   +  ++W  +  N       V  +    +L F  ++Y M++P P+YLVD++C
Sbjct  66    IEASQMNPDDIRQLWLHLKYNL------VFVIICSAVLVFGSTVYIMTRPRPVYLVDYSC  119

Query  443   CKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKL  622
              K  D+LK   ++F+  +R +G FDE +LE+ +++LE SG+GDETY+P+++        +
Sbjct  120   YKAPDELKAPYERFMQHSRLTGDFDESSLEFQRKILERSGLGDETYVPEAMHYLPPQPSM  179

Query  623   NNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIV  802
                RGEA Q++F A+D +   T ++ +DIG+LVVNC+ FNPTPSLSAMI+N YK++ NI 
Sbjct  180   QAARGEAEQVMFGALDNLFANTSVKPKDIGVLVVNCSLFNPTPSLSAMIVNKYKLRGNIR  239

Query  803   STNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRT  982
             S NLGGMGCSAG+IA+DLA+D+L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR 
Sbjct  240   SFNLGGMGCSAGVIAVDLAKDMLQVHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRV  299

Query  983   GCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEV  1162
             G +AVLLSN+  D R AKY+L H+VRTH+GA D+AFR +YQE+D     G+ +SKDL+ +
Sbjct  300   GGAAVLLSNKSVDRRRAKYKLVHVVRTHRGADDKAFRCVYQEQDDAGKTGVSLSKDLMAI  359

Query  1163  GGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASK  1342
              G ALK NITTLGPLVLP++EQL FF TLI +K+     KPYIPD+ +AF+HFCI+A  +
Sbjct  360   AGGALKTNITTLGPLVLPISEQLLFFATLIIKKICNKHVKPYIPDFKLAFDHFCIHAGGR  419

Query  1343  MLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
              ++DEL++NL+L++ ++EASR TLHRFGNT
Sbjct  420   AVIDELEKNLQLTQVHVEASRMTLHRFGNT  449



>gb|AAP74370.1| FAE3 [Marchantia polymorpha]
Length=529

 Score =   435 bits (1118),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 221/436 (51%), Positives = 318/436 (73%), Gaps = 5/436 (1%)
 Frame = +2

Query  125   TFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKV  304
             T ++ +R+RLPDF+QSV +KYVKLGY+Y+I + + L  T+P   +V   E+G +   E++
Sbjct  31    TVAIGIRQRLPDFLQSVNMKYVKLGYHYLITHAMFLL-TLPAFFLV-AAEIGRLGH-ERI  87

Query  305   WGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQF  484
             + ++W +       ++  S   + G TL  YFMS+P P+YLV+FAC +P + LKV+KD F
Sbjct  88    YRELWTHLHLNLVSIMACSSALVAGATL--YFMSRPRPVYLVEFACYRPDERLKVSKDFF  145

Query  485   IDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEA  664
             +D++R++G F   ++++  ++ + SG+GDETY+P +I        +   R EA+ ++F A
Sbjct  146   LDMSRRTGLFSSSSMDFQTKITQRSGLGDETYLPPAILASPPNPCMREAREEAAMVMFGA  205

Query  665   IDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGII  844
             +D++ E+T ++ ++IG+LVVNC+ FNPTPS+SAMI+NHY M+ NI S NLGGMGCSAG+I
Sbjct  206   LDELFEQTGVKPKEIGVLVVNCSLFNPTPSMSAMIVNHYHMRGNIKSLNLGGMGCSAGLI  265

Query  845   ALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDY  1024
             ++DLARD+L+ + N YA+VVSTE ++  WY G+ RS L+ NC FR G +AVLLSN+RR+ 
Sbjct  266   SIDLARDLLQVHGNTYAVVVSTENITLNWYFGDDRSKLMSNCIFRMGGAAVLLSNKRRER  325

Query  1025  RHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGP  1204
             R AKY L H VRTH+GA D+ FR +YQEED     G+ +S++L+ V G ALKANITTLGP
Sbjct  326   RRAKYELLHTVRTHKGADDKCFRCVYQEEDSTGSLGVSLSRELMAVAGNALKANITTLGP  385

Query  1205  LVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSE  1384
             LVLPL+EQ+ FF +L+ RK    K KPYIPD+ +AFEHFCI+A  + +LDEL++NL L+E
Sbjct  386   LVLPLSEQILFFASLVARKFLNMKMKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLDLTE  445

Query  1385  QNMEASRATLHRFGNT  1432
              +ME SR TL+RFGNT
Sbjct  446   WHMEPSRMTLYRFGNT  461



>emb|CDP07508.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   434 bits (1116),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 222/445 (50%), Positives = 321/445 (72%), Gaps = 6/445 (1%)
 Frame = +2

Query  98    PSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEV  277
             P+   +  +   ++  RRLPDF+QSV LKYVKLGY+Y+I++ L L   VP++ ++  +E 
Sbjct  13    PTARTSARVGVQIQQSRRLPDFLQSVNLKYVKLGYHYLISHLLTLC-LVPVMIIIL-IE-  69

Query  278   GSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSD  457
              S M  + +  ++W +       V+  S   +L F  ++Y M++P P+YLVD+ C +  D
Sbjct  70    ASQMNPDDI-RQLWLHLQYNLVSVITCS--AILVFGSTVYIMTRPRPVYLVDYFCYRAPD  126

Query  458   DLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRG  637
             +LK   + F++ +R +G FDE +L++ +++LE SG+GDETY+P+++        +   R 
Sbjct  127   ELKAPFESFMEHSRLTGDFDESSLQFQRKILERSGLGDETYVPEAMHFVPPRPSMQAARE  186

Query  638   EASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLG  817
             EA Q++F A+D +   T+++A+DIGILVVNC+ FNPTPSLSAMI+N YK++ NI S NLG
Sbjct  187   EAEQVMFGALDNLFANTKVKAKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLG  246

Query  818   GMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAV  997
             GMGCSAG+IA+DLA+D+L+ + N YA+VVSTE ++  WY GN ++MLIPNC FR G +AV
Sbjct  247   GMGCSAGVIAVDLAKDLLQVHRNTYAVVVSTENITQNWYFGNKKAMLIPNCLFRVGGAAV  306

Query  998   LLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEAL  1177
             LLSN+  D R AKYRL H+VRTH+G+ D+AFR +YQE+D     G+ +SKDL+ + G AL
Sbjct  307   LLSNKSVDRRRAKYRLVHVVRTHRGSDDKAFRCVYQEQDDAGKTGVTLSKDLMAIAGGAL  366

Query  1178  KANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDE  1357
             K NITTLGPLVLP++EQL FF TL+ +KLF    KPYIPD+ +AF+HFCI+A  + ++DE
Sbjct  367   KTNITTLGPLVLPISEQLLFFATLVLKKLFQKNIKPYIPDFKLAFDHFCIHAGGRAVIDE  426

Query  1358  LKRNLRLSEQNMEASRATLHRFGNT  1432
             L++NL+L  +++EASR TLHRFGNT
Sbjct  427   LEKNLQLLPEHVEASRMTLHRFGNT  451



>ref|XP_009378513.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Pyrus x bretschneideri]
Length=506

 Score =   434 bits (1115),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 227/433 (52%), Positives = 311/433 (72%), Gaps = 6/433 (1%)
 Frame = +2

Query  134   VRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGK  313
             ++  RRLPDF+Q+V LKYVKLGY+Y+I + L L   VPL+ VV  V   S M  + +  +
Sbjct  13    IQQSRRLPDFLQTVNLKYVKLGYHYLITHLLTLC-LVPLMAVV--VIEASQMNPDDI-HQ  68

Query  314   IWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDI  493
             +W         V+  S + + G T  +Y M++P  +YLVD++C KP   L+V   QF++ 
Sbjct  69    LWLQLQYNLVSVIIFSAMVVFGST--VYIMTRPRSVYLVDYSCYKPPSHLQVRYQQFMEH  126

Query  494   ARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDK  673
             ++ +G FDE +LE+ +++LE SG+G+ETY+P+++        +   R EA Q+IF A+D 
Sbjct  127   SKLTGDFDESSLEFQRKILERSGLGEETYVPEAMHYIPPRPSMAAAREEAEQVIFGALDN  186

Query  674   VLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALD  853
             +   T ++ +D GILVVNC+ FNPTPSLSAMI+N YK++ NI S NLGGMGCSAG+IA+D
Sbjct  187   LFANTNVKPKDFGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVD  246

Query  854   LARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHA  1033
             LA+D+L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR G SAVLLSN+  D R A
Sbjct  247   LAKDMLQIHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSVDRRRA  306

Query  1034  KYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVL  1213
             KY+L H+VRTH GA D+AFR +YQE+D     G+ +SKDL+ + G ALK NITTLGPLVL
Sbjct  307   KYKLVHVVRTHCGADDKAFRCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVL  366

Query  1214  PLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNM  1393
             PL+EQL FF TL+ +KLF AK KPYIPD+ +AF+HFCI+A  + ++DEL++NL+L   ++
Sbjct  367   PLSEQLLFFVTLVAKKLFNAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHV  426

Query  1394  EASRATLHRFGNT  1432
             EASR TLHRFGNT
Sbjct  427   EASRMTLHRFGNT  439



>ref|XP_007160751.1| hypothetical protein PHAVU_001G014100g [Phaseolus vulgaris]
 gb|ESW32745.1| hypothetical protein PHAVU_001G014100g [Phaseolus vulgaris]
Length=511

 Score =   434 bits (1115),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 220/432 (51%), Positives = 311/432 (72%), Gaps = 8/432 (2%)
 Frame = +2

Query  137   RVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKI  316
             + R  LPDF+QSV LKYVKLGY+Y+I+N L L   VPL+ V   ++V        +W  +
Sbjct  21    QTRMALPDFLQSVNLKYVKLGYHYLISNLLTLF-LVPLILVTL-IQVSQTTDLHHLWLHL  78

Query  317   WENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIA  496
               N       +  ++   +L F L++Y +++P  +YL+D AC +P++ LK     F+D +
Sbjct  79    QYNL------LTILTCSAVLVFGLTLYAVTRPRAVYLLDSACFRPAEHLKAPFRSFMDHS  132

Query  497   RKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKV  676
             R +G F+E +L++ +++LE SG+G+ETY+P+++        +   R EA Q++F A+D +
Sbjct  133   RLTGDFEESSLDFQRKILERSGLGEETYVPEAMHSIPPQPSMAAARAEAEQVMFGALDNL  192

Query  677   LEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDL  856
                T ++ +DIGIL+VNC+ FNPTPSLSAMI+N YK++ NI S NLGGMGCSAG+IA+DL
Sbjct  193   FHNTSLKPKDIGILIVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDL  252

Query  857   ARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAK  1036
             A+D+L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR GCSA+LLSN+  D R AK
Sbjct  253   AKDLLQVHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGCSALLLSNKPADRRRAK  312

Query  1037  YRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLP  1216
             YRL H+VRTH+GA D+AFR +YQE+D     G+ +SKDL+ + G ALK NITTLGPLVLP
Sbjct  313   YRLVHVVRTHRGADDKAFRCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLP  372

Query  1217  LTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNME  1396
             ++EQL FF TL+ +KLF A  KPYIPD+ +AF+HFCI+A  + ++DEL++NL+L  +++E
Sbjct  373   ISEQLLFFVTLLMKKLFKADVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLRSEHVE  432

Query  1397  ASRATLHRFGNT  1432
             ASR TLHRFGNT
Sbjct  433   ASRMTLHRFGNT  444



>ref|XP_009334788.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Pyrus x bretschneideri]
Length=515

 Score =   434 bits (1115),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 221/429 (52%), Positives = 307/429 (72%), Gaps = 8/429 (2%)
 Frame = +2

Query  149   RLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENS  328
             +LPDF QSVKLKYVKLGY+Y+I + + L  +   +  V  +   S+     +W  +    
Sbjct  22    KLPDFKQSVKLKYVKLGYHYLITHGMYLFLSPLFVLTVAQLSTFSLQDLHDLWDHL----  77

Query  329   GGPDFGVVNMSLLG-LLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKS  505
                 F ++++ L   LL F L++YF S+P P+YLVDF+C KP D  KVT+  F++ +   
Sbjct  78    ---RFNLISVVLCSTLLVFLLTLYFFSRPWPVYLVDFSCYKPEDARKVTRQIFMNCSHSI  134

Query  506   GTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEK  685
             GTF E+NL + +++LE SG+G+ TY+P+++        +   R EA  ++F A+D++ EK
Sbjct  135   GTFTEENLAFQRKILERSGLGESTYLPEAVIRVPPNPCMAEARKEAEMVMFGALDQLFEK  194

Query  686   TRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARD  865
             T I+ +DIGIL+VNC+ FNPTPSLSAMIINHY+++ NI+S NLGGMGCSAG+I++DLA+D
Sbjct  195   TYIKPKDIGILIVNCSLFNPTPSLSAMIINHYRLRGNIISYNLGGMGCSAGLISIDLAKD  254

Query  866   ILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRL  1045
             +LR +PN YALV+S E ++  WY GN RSML+ NC FR G +A+LLSN+  D R +KY+L
Sbjct  255   LLRVHPNTYALVISMENITLNWYFGNDRSMLVSNCLFRMGGAAILLSNKWSDRRRSKYQL  314

Query  1046  QHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTE  1225
              H VRTH+G+ D+ F  + Q+ED     G+ +SKDL+ V G+ALK NITTLGPLVLP++E
Sbjct  315   VHTVRTHKGSDDKCFSCVTQQEDFAGKIGVSLSKDLMAVAGDALKTNITTLGPLVLPMSE  374

Query  1226  QLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASR  1405
             QL FF TL+ RKL   K KPYIPD+ +AFEHFCI+A  + +LDEL++NL+LS+ +ME SR
Sbjct  375   QLLFFATLVGRKLLKMKVKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLQLSDHHMEPSR  434

Query  1406  ATLHRFGNT  1432
              TLHRFGNT
Sbjct  435   MTLHRFGNT  443



>ref|XP_008796071.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Phoenix dactylifera]
Length=519

 Score =   434 bits (1115),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 229/458 (50%), Positives = 325/458 (71%), Gaps = 20/458 (4%)
 Frame = +2

Query  80    INRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTV  259
             ++R ++ S  +  ++  S   + +LP+F+QSVKLKYVKLGY+Y+I+N + L   +P+L V
Sbjct  1     MSRRMDSSEGNGTSVQTSPDRKHKLPNFLQSVKLKYVKLGYHYLISNAMYLL-LIPILAV  59

Query  260   VFGVEVGSVMRGEK--VWGKIWENSGGPDFGVVNMSLLGLLGFTLS-----IYFMSKPMP  418
             V    + S+  G+   +W  +        F +V      LLG TL+     +YFM++P P
Sbjct  60    VL-THLSSLTVGDLHLLWNHL-------RFNLVAT----LLGLTLTASLATLYFMTRPRP  107

Query  419   IYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIG  598
             +YLVDF+C KP D  K T++ F++ + ++G F E+NL + K++LE SG+G  TY P ++ 
Sbjct  108   VYLVDFSCYKPDDARKCTRELFMERSAQAGVFTEENLAFQKKILERSGLGQSTYFPDAVL  167

Query  599   CPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINH  778
                    +   R EA  ++F AID++LEKT+++A+DIGILVVNC+ FNPTPSLSAM++NH
Sbjct  168   NVPPNPCMAEARKEAEMVMFGAIDELLEKTKVKAKDIGILVVNCSLFNPTPSLSAMVVNH  227

Query  779   YKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSML  958
             YK++ NI+S NLGGMGCSAG+I++DLA+ +L+   N YALVVS E ++  WY GN+RSML
Sbjct  228   YKLRGNIISYNLGGMGCSAGLISIDLAKQLLQVQRNSYALVVSMENITLNWYLGNNRSML  287

Query  959   IPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLK  1138
             + NC FR G +A+LL+NRR D   +KY+L H VRTH+GA DRA+  ++QEED     G+ 
Sbjct  288   LSNCLFRMGGAAILLTNRRSDRHRSKYQLIHTVRTHKGADDRAYNCVFQEEDSSGTTGVA  347

Query  1139  ISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEH  1318
             +SKDL+ V GEALK NITTLGPLVLP++EQL F  TL+ +K+F  K KPYIPD+ +AFEH
Sbjct  348   LSKDLMAVAGEALKTNITTLGPLVLPMSEQLLFLFTLVGKKIFKMKLKPYIPDFKLAFEH  407

Query  1319  FCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             FCI+A  + +L+EL++NL+LSE +ME SR TL+RFGNT
Sbjct  408   FCIHAGGRAVLEELEKNLQLSEWHMEPSRMTLYRFGNT  445



>gb|KFK41268.1| hypothetical protein AALP_AA2G107900 [Arabis alpina]
Length=514

 Score =   433 bits (1114),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 225/442 (51%), Positives = 324/442 (73%), Gaps = 16/442 (4%)
 Frame = +2

Query  131   SVRVR------RRLPDFVQSvklkyvklgyyyvINNW--LCLAATVPLLTVVFGVEVGSV  286
             SV++R      R+LP+F+QSV +KYVKLGY+Y+I +   LCL   +PL+ V F  E+ S 
Sbjct  14    SVQIRNDHKSSRKLPNFLQSVNMKYVKLGYHYLITHLFKLCL---IPLMAV-FITEI-SR  68

Query  287   MRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLK  466
             +  E ++ +IW +        + +S L + G T  ++ M++P  +YLVD++C  P  +L+
Sbjct  69    LTPEDLY-QIWLHLQYNLIAFIILSALAVFGST--VFIMTRPRSVYLVDYSCYLPPTNLQ  125

Query  467   VTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEAS  646
             V+  +F+D +R    F++ +LE+ +++LE SG+G+ETY+P+++ C      +   R EA 
Sbjct  126   VSYQKFMDHSRLIDDFNDSSLEFQRKILERSGLGEETYLPEALHCIPPRPTMVEARQEAE  185

Query  647   QLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMG  826
             Q++F A+DK+ E T+I  RDIG+LVVNC+ FNPTPSLSAMI+N YK++ N+ S NLGGMG
Sbjct  186   QVMFGALDKLFENTKINPRDIGVLVVNCSLFNPTPSLSAMIVNKYKLRGNVKSFNLGGMG  245

Query  827   CSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLS  1006
             CSAG+IA+DLA+D+L+ + N YA+VVSTE ++  WY GN ++MLIPNC FR G SA+LLS
Sbjct  246   CSAGVIAIDLAKDMLQVHRNTYAVVVSTENITQNWYFGNKKAMLIPNCLFRVGGSAILLS  305

Query  1007  NRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKAN  1186
             N+  D R +KY+L H VRTH+GA ++AF  +YQEED     G+ +SK+L+ + GEALKAN
Sbjct  306   NKSGDRRRSKYKLVHTVRTHKGAIEKAFNCVYQEEDDNGKTGVSLSKELMAIAGEALKAN  365

Query  1187  ITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKR  1366
             ITTLGPLVLP++EQ+ FF TL+ +KLF AK KPYIPD+ +AF+HFCI+A  + ++DEL++
Sbjct  366   ITTLGPLVLPISEQILFFATLVTKKLFNAKLKPYIPDFKLAFDHFCIHAGGRAVIDELEK  425

Query  1367  NLRLSEQNMEASRATLHRFGNT  1432
             NL+LSE ++EASR TLHRFGNT
Sbjct  426   NLQLSETHVEASRMTLHRFGNT  447



>ref|XP_010516877.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA synthase 9-like 
[Camelina sativa]
Length=511

 Score =   433 bits (1113),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 222/432 (51%), Positives = 317/432 (73%), Gaps = 10/432 (2%)
 Frame = +2

Query  143   RRRLPDFVQSvklkyvklgyyyvINNW--LCLAATVPLLTVVFGVEVGSVMRGEKVWGKI  316
             R +LP+F+QSV +KYVKLGY+Y+I +   LCL   VPL+ V+  V   S +  E ++ +I
Sbjct  21    RPKLPNFLQSVNMKYVKLGYHYLITHLFKLCL---VPLMAVL--VTEISRLTTEDLY-QI  74

Query  317   WENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIA  496
             W +        + +S L + G T  +Y MS+P  +YLVD++C  P + L+V   +F+D +
Sbjct  75    WLHLQYNLVAFIFLSALAVFGST--VYIMSRPRSVYLVDYSCYLPPETLQVNYQKFMDHS  132

Query  497   RKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKV  676
             +    F+E +LE+ +++LE SG+G+ETY+P+++ C      +   R EA Q++F A+DK+
Sbjct  133   KLIEDFNESSLEFQRKILERSGLGEETYLPEALHCIPPRPTMMAAREEAEQVMFGALDKL  192

Query  677   LEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDL  856
              E T I  RDIG+LVVNC+ FNPTPSLSAMI+N YK++ N+ S NLGGMGCSAG+I++DL
Sbjct  193   FENTEINPRDIGVLVVNCSLFNPTPSLSAMIVNKYKLRGNVKSFNLGGMGCSAGVISIDL  252

Query  857   ARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAK  1036
             A+D+L+ + N YA+VVSTE ++  WY GN ++MLIPNC FR G SA+LLSN+ +D R +K
Sbjct  253   AKDMLQVHRNTYAVVVSTENITQNWYFGNKKAMLIPNCLFRVGGSAILLSNKGKDRRRSK  312

Query  1037  YRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLP  1216
             Y+L H VRTH+GA ++AF  +YQE+D     G+ +SKDL+ + GEALKANITTLGPLVLP
Sbjct  313   YKLVHTVRTHKGAVEKAFNCVYQEQDDNGKTGVSLSKDLMAIAGEALKANITTLGPLVLP  372

Query  1217  LTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNME  1396
             ++EQ+ FF TL+ +KLF AK KPYIPD+ +AF+HFCI+A  + ++DEL++NL+LS+ ++E
Sbjct  373   ISEQILFFMTLVTKKLFNAKLKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLSQTHVE  432

Query  1397  ASRATLHRFGNT  1432
             ASR TLHRFGNT
Sbjct  433   ASRMTLHRFGNT  444



>ref|XP_009760261.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Nicotiana sylvestris]
Length=516

 Score =   433 bits (1113),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 227/448 (51%), Positives = 319/448 (71%), Gaps = 13/448 (3%)
 Frame = +2

Query  89    GIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFG  268
             G EP G         ++  RRLPDF+QSV LKYVKLGY+Y+I+N L L   +P++ V+  
Sbjct  15    GAEPVG-------VQIQQSRRLPDFLQSVNLKYVKLGYHYLISNLLTLC-LIPVMAVIL-  65

Query  269   VEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCK  448
             +E  S M  + +   +W +       V+  S   +L F  ++Y M++P P+YLVD++C K
Sbjct  66    IE-ASQMNPDDI-RHLWLHLKYNLVSVIICS--AVLVFGSTVYIMTRPRPVYLVDYSCYK  121

Query  449   PSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNN  628
               D+LK   ++F+  +R +G FDE +LE+ +++LE SG+GDETY+P+++        +  
Sbjct  122   APDELKAPYERFMQHSRLTGDFDESSLEFQRKILERSGLGDETYVPEAMHHLPPQPSMQA  181

Query  629   IRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVST  808
              R EA Q++F A+D +   T ++ +DIGILVVNC+ FNPTPSLSAMI+N YK++ NI S 
Sbjct  182   AREEAEQVMFGALDNLFANTSVKPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSF  241

Query  809   NLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGC  988
             NLGGMGCSAG+IA+DLA+D+L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR G 
Sbjct  242   NLGGMGCSAGVIAVDLAKDMLQVHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGG  301

Query  989   SAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGG  1168
             +AVLLSN+  D R AKY+L H+VRTH+GA D+AFR +YQE+D     G+ +SKDL+ + G
Sbjct  302   AAVLLSNKSVDRRRAKYKLVHVVRTHRGADDKAFRCVYQEQDDAGKTGVSLSKDLMAIAG  361

Query  1169  EALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKML  1348
              ALK NITTLGPLVLP++EQL FF TLI +K+     KPYIPD+ +AF+HFCI+A  + +
Sbjct  362   GALKTNITTLGPLVLPISEQLLFFATLIIKKICNKHVKPYIPDFKLAFDHFCIHAGGRAV  421

Query  1349  LDELKRNLRLSEQNMEASRATLHRFGNT  1432
             +DEL++NL+L++ ++EASR TLHRFGNT
Sbjct  422   IDELEKNLQLTQVHVEASRMTLHRFGNT  449



>ref|XP_003631663.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Vitis vinifera]
Length=504

 Score =   432 bits (1112),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 223/442 (50%), Positives = 315/442 (71%), Gaps = 8/442 (2%)
 Frame = +2

Query  110   DAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVM  289
               G +   ++  R LPDF+QSV LKYVKLGY+Y+I + L L   +PL+ ++    V +  
Sbjct  3     SGGEVGVQIQQGRGLPDFLQSVNLKYVKLGYHYLITHLLTLC-LIPLMALII---VEASQ  58

Query  290   RGEKVWGKIWENSGGPDFGVVNMSLL-GLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLK  466
             +      ++W +     + +V++ +    L F  ++Y M++P  IYLVD+AC +P   L+
Sbjct  59    KNPDDIHQLWLHL---QYNLVSIIICSAFLVFGSTVYIMTRPRSIYLVDYACYRPPSHLQ  115

Query  467   VTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEAS  646
             V   QF++ +R +G FDE  LE+ +++LE SG+G+ETY+P+++        +   R EA 
Sbjct  116   VRYHQFMEHSRLTGDFDESALEFQRKILERSGLGEETYVPEAMHYIPPQPSMAAAREEAE  175

Query  647   QLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMG  826
             Q++F ++DK+   T ++ +DIGILVVNC+ FNPTPSLSAMI+N YK++ NI S NLGGMG
Sbjct  176   QVMFGSLDKLFANTNVKPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMG  235

Query  827   CSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLS  1006
             CSAG+IA+DLA+D+L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR G +AVLLS
Sbjct  236   CSAGVIAVDLAKDMLQVHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGAAVLLS  295

Query  1007  NRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKAN  1186
             N+  D R AKY+L H+VRTH+GA D+AFR +YQE+D     G+ +SKDL+ + G ALK N
Sbjct  296   NKSGDRRRAKYKLVHLVRTHRGADDKAFRCVYQEQDDAGKTGVSLSKDLMAIAGGALKTN  355

Query  1187  ITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKR  1366
             ITTLGPLVLP++EQL FF TL+ +KLF AK KPYIPD+ +AFEHFCI+A  + ++DEL++
Sbjct  356   ITTLGPLVLPISEQLLFFATLVAKKLFNAKVKPYIPDFKLAFEHFCIHAGGRAVIDELEK  415

Query  1367  NLRLSEQNMEASRATLHRFGNT  1432
             NL+L   ++EASR TLHRFGNT
Sbjct  416   NLQLLPSHVEASRMTLHRFGNT  437



>ref|XP_010925903.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Elaeis guineensis]
Length=465

 Score =   431 bits (1108),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 198/355 (56%), Positives = 270/355 (76%), Gaps = 0/355 (0%)
 Frame = +2

Query  368   GLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRM  547
               L F  ++Y M++P P+YLVD+AC +P D L+V    F++ +R  G F+E  LE+ +++
Sbjct  35    AFLVFGSTVYIMTRPRPVYLVDYACYRPPDRLQVRYRSFMEHSRLCGEFNEDALEFQRKI  94

Query  548   LESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVN  727
             LE SG+G+ETY+P+++        + N R EA Q++F A+D +   T ++ +DI ILVVN
Sbjct  95    LERSGLGEETYVPEAMHFLPPRPSMANAREEAQQVMFGALDALFRNTGVKPKDISILVVN  154

Query  728   CNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVS  907
             C+ FNPTPSLSAMI+NHYK++ NI S NLGGMGCSAG+IA+DLARD+L+A+ + YA+VVS
Sbjct  155   CSLFNPTPSLSAMIVNHYKLRSNIKSFNLGGMGCSAGVIAVDLARDLLQAHRSTYAVVVS  214

Query  908   TEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRA  1087
             TE ++  WY GN +SMLIPNC FR G +AVLLSNR  D R +KYRL H+VRTH+GA DRA
Sbjct  215   TENITQNWYFGNRKSMLIPNCLFRVGGAAVLLSNRSADRRRSKYRLVHVVRTHRGADDRA  274

Query  1088  FRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLF  1267
             FR +YQE+D +   G+ +SKDL+ + G ALK NITTLGPLVLP++EQL FF TL+ +KLF
Sbjct  275   FRCVYQEQDDQGKVGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLVAKKLF  334

Query  1268  GAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
              AK KPYIPD+ +AF+HFCI+A  + ++DEL++NL+L+  ++E SR TLHRFGNT
Sbjct  335   NAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLTPVHVEPSRMTLHRFGNT  389



>ref|XP_010489197.1| PREDICTED: 3-ketoacyl-CoA synthase 9-like [Camelina sativa]
Length=511

 Score =   432 bits (1112),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 222/432 (51%), Positives = 317/432 (73%), Gaps = 10/432 (2%)
 Frame = +2

Query  143   RRRLPDFVQSvklkyvklgyyyvINNW--LCLAATVPLLTVVFGVEVGSVMRGEKVWGKI  316
             R +LP+F+QSV +KYVKLGY+Y+I +   LCL   VPL+ V+  V   S +  E ++ +I
Sbjct  21    RPKLPNFLQSVNMKYVKLGYHYLITHLFKLCL---VPLMAVL--VTEISRLTTEDLY-QI  74

Query  317   WENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIA  496
             W +        + +S L + G T  +Y MS+P  +YLVD++C  P + L+V   +F+D +
Sbjct  75    WLHLQYNLVAFIFLSALAVFGST--VYIMSRPRSVYLVDYSCYLPPETLQVNYQKFMDHS  132

Query  497   RKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKV  676
             +    F+E +LE+ +++LE SG+G+ETY+P+++ C      +   R EA Q++F A+DK+
Sbjct  133   KLIEDFNESSLEFQRKILERSGLGEETYLPEALHCIPPRPTMMAAREEAEQVMFVALDKL  192

Query  677   LEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDL  856
              E T I  RDIG+LVVNC+ FNPTPSLSAMI+N YK++ N+ S NLGGMGCSAG+I++DL
Sbjct  193   FENTEINPRDIGVLVVNCSLFNPTPSLSAMIVNKYKLRGNVKSFNLGGMGCSAGVISIDL  252

Query  857   ARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAK  1036
             A+D+L+ + N YA+VVSTE ++  WY GN ++MLIPNC FR G SA+LLSN+ +D R +K
Sbjct  253   AKDMLQVHRNTYAVVVSTENITQNWYFGNKKAMLIPNCLFRVGGSAILLSNKGKDRRRSK  312

Query  1037  YRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLP  1216
             Y+L H VRTH+GA ++AF  +YQE+D     G+ +SKDL+ + GEALKANITTLGPLVLP
Sbjct  313   YKLVHTVRTHKGAVEKAFNCVYQEQDDNGKTGVSLSKDLMAIAGEALKANITTLGPLVLP  372

Query  1217  LTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNME  1396
             ++EQ+ FF TL+ +KLF AK KPYIPD+ +AF+HFCI+A  + ++DEL++NL+LS+ ++E
Sbjct  373   ISEQILFFMTLVTKKLFNAKLKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLSQTHVE  432

Query  1397  ASRATLHRFGNT  1432
             ASR TLHRFGNT
Sbjct  433   ASRMTLHRFGNT  444



>ref|NP_179223.1| 3-ketoacyl-CoA synthase 9 [Arabidopsis thaliana]
 sp|Q9SIX1.1|KCS9_ARATH RecName: Full=3-ketoacyl-CoA synthase 9; Short=KCS-9; AltName: 
Full=Very long-chain fatty acid condensing enzyme 9; Short=VLCFA 
condensing enzyme 9 [Arabidopsis thaliana]
 gb|AAD22309.1| putative beta-ketoacyl-CoA synthase [Arabidopsis thaliana]
 gb|AEC06480.1| 3-ketoacyl-CoA synthase 9 [Arabidopsis thaliana]
Length=512

 Score =   432 bits (1112),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 220/432 (51%), Positives = 319/432 (74%), Gaps = 10/432 (2%)
 Frame = +2

Query  143   RRRLPDFVQSvklkyvklgyyyvINNW--LCLAATVPLLTVVFGVEVGSVMRGEKVWGKI  316
             RR+LP+F+QSV +KYVKLGY+Y+I +   LCL   VPL+ V+  V   S +  + ++ +I
Sbjct  22    RRKLPNFLQSVNMKYVKLGYHYLITHLFKLCL---VPLMAVL--VTEISRLTTDDLY-QI  75

Query  317   WENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIA  496
             W +        + +S L + G T  +Y MS+P  +YLVD++C  P + L+V   +F+D +
Sbjct  76    WLHLQYNLVAFIFLSALAIFGST--VYIMSRPRSVYLVDYSCYLPPESLQVKYQKFMDHS  133

Query  497   RKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKV  676
             +    F+E +LE+ +++LE SG+G+ETY+P+++ C      +   R E+ Q++F A+DK+
Sbjct  134   KLIEDFNESSLEFQRKILERSGLGEETYLPEALHCIPPRPTMMAAREESEQVMFGALDKL  193

Query  677   LEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDL  856
              E T+I  RDIG+LVVNC+ FNPTPSLSAMI+N YK++ N+ S NLGGMGCSAG+I++DL
Sbjct  194   FENTKINPRDIGVLVVNCSLFNPTPSLSAMIVNKYKLRGNVKSFNLGGMGCSAGVISIDL  253

Query  857   ARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAK  1036
             A+D+L+ + N YA+VVSTE ++  WY GN ++MLIPNC FR G SA+LLSN+ +D R +K
Sbjct  254   AKDMLQVHRNTYAVVVSTENITQNWYFGNKKAMLIPNCLFRVGGSAILLSNKGKDRRRSK  313

Query  1037  YRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLP  1216
             Y+L H VRTH+GA ++AF  +YQE+D     G+ +SKDL+ + GEALKANITTLGPLVLP
Sbjct  314   YKLVHTVRTHKGAVEKAFNCVYQEQDDNGKTGVSLSKDLMAIAGEALKANITTLGPLVLP  373

Query  1217  LTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNME  1396
             ++EQ+ FF TL+ +KLF +K KPYIPD+ +AF+HFCI+A  + ++DEL++NL+LS+ ++E
Sbjct  374   ISEQILFFMTLVTKKLFNSKLKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLSQTHVE  433

Query  1397  ASRATLHRFGNT  1432
             ASR TLHRFGNT
Sbjct  434   ASRMTLHRFGNT  445



>ref|XP_002963631.1| hypothetical protein SELMODRAFT_79947 [Selaginella moellendorffii]
 gb|EFJ35502.1| hypothetical protein SELMODRAFT_79947 [Selaginella moellendorffii]
Length=534

 Score =   433 bits (1114),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 222/428 (52%), Positives = 316/428 (74%), Gaps = 8/428 (2%)
 Frame = +2

Query  152   LPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSG  331
             LPDF+QSV LKYVKLGY+Y++ + + L   VPL+  V  +EVG +  G +   ++W +  
Sbjct  42    LPDFLQSVNLKYVKLGYHYLVTHLITLT-LVPLMLGV-AIEVGRL--GPEDIHQLWIHL-  96

Query  332   GPDFGVVN-MSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSG  508
                F +V+ M+   LL F  ++YFMS+P  ++LVD+AC KPS +++V    F++ ++ SG
Sbjct  97    --KFNLVSVMTCSALLVFAATVYFMSRPRSVFLVDYACHKPSPNIRVPFASFMEHSKLSG  154

Query  509   TFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKT  688
             +FD+K+LE+ +R+LE SG+G++T +P ++        ++  R EA  ++F A+D++  KT
Sbjct  155   SFDDKSLEFQRRILERSGLGEQTALPPAMHYLPPRPSMDAARQEAETVMFSALDELFHKT  214

Query  689   RIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDI  868
              ++ +D+GILVVNC+ FNPTPSLSAMI+N YKM+ NI S NLGGMGCSAG+IA+DLA+D+
Sbjct  215   GVKPKDVGILVVNCSLFNPTPSLSAMIVNKYKMRGNIRSYNLGGMGCSAGVIAIDLAKDM  274

Query  869   LRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQ  1048
             L+ + N YA+VVSTE ++  WY GN RSMLIPNC FR G +A+LLSNRR D R AKY L 
Sbjct  275   LQVHGNDYAIVVSTENITQNWYFGNRRSMLIPNCLFRVGGAAMLLSNRRSDRRRAKYELL  334

Query  1049  HIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQ  1228
             H VRTH+GA D++FR +YQEED     G+ +SKDL+ + G+ALK NITT+GPLVLPL+EQ
Sbjct  335   HTVRTHKGADDKSFRCVYQEEDENSKMGVSLSKDLMAIAGQALKTNITTMGPLVLPLSEQ  394

Query  1229  LYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRA  1408
             + FF  L+ RK+F    KPYIPD+ +AF HFCI+A  + ++DEL++NL+L+ +++EASR 
Sbjct  395   IIFFSFLVARKVFKRAVKPYIPDFRLAFHHFCIHAGGRAVIDELEKNLQLTAEHVEASRM  454

Query  1409  TLHRFGNT  1432
             TL+RFGNT
Sbjct  455   TLYRFGNT  462



>ref|XP_010467354.1| PREDICTED: 3-ketoacyl-CoA synthase 9-like [Camelina sativa]
Length=511

 Score =   432 bits (1112),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 222/432 (51%), Positives = 317/432 (73%), Gaps = 10/432 (2%)
 Frame = +2

Query  143   RRRLPDFVQSvklkyvklgyyyvINNW--LCLAATVPLLTVVFGVEVGSVMRGEKVWGKI  316
             R +LP+F+QSV +KYVKLGY+Y+I +   LCL   VPL+ V+  V   S +  E ++ +I
Sbjct  21    RPKLPNFLQSVNIKYVKLGYHYLITHLFKLCL---VPLMAVL--VTEISRLTTEDLY-QI  74

Query  317   WENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIA  496
             W +        + +S L + G T  +Y MS+P  +YLVD++C  P + L+V   +F+D +
Sbjct  75    WLHLQYNLVAFIVLSALAVFGST--VYIMSRPRSVYLVDYSCYLPPETLQVNYQKFMDHS  132

Query  497   RKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKV  676
             +    F+E +LE+ +++LE SG+G+ETY+P+++ C      +   R EA Q++F A+DK+
Sbjct  133   KLIEDFNESSLEFQRKILERSGLGEETYLPEALHCIPPRPTMMAAREEAEQVMFGALDKL  192

Query  677   LEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDL  856
              E T I  RDIG+LVVNC+ FNPTPSLSAMI+N YK++ N+ S NLGGMGCSAG+I++DL
Sbjct  193   FENTEINPRDIGVLVVNCSLFNPTPSLSAMIVNKYKLRGNVKSFNLGGMGCSAGVISIDL  252

Query  857   ARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAK  1036
             A+D+L+ + N YA+VVSTE ++  WY GN ++MLIPNC FR G SA+LLSN+ +D R +K
Sbjct  253   AKDMLQVHRNTYAVVVSTENITQNWYFGNKKAMLIPNCLFRVGGSAILLSNKGKDRRRSK  312

Query  1037  YRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLP  1216
             Y+L H VRTH+GA ++AF  +YQE+D     G+ +SKDL+ + GEALKANITTLGPLVLP
Sbjct  313   YKLVHTVRTHKGAVEKAFNCVYQEQDDNGKTGVSLSKDLMAIAGEALKANITTLGPLVLP  372

Query  1217  LTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNME  1396
             ++EQ+ FF TL+ +KLF AK KPYIPD+ +AF+HFCI+A  + ++DEL++NL+LS+ ++E
Sbjct  373   ISEQILFFMTLVTKKLFNAKLKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLSQTHVE  432

Query  1397  ASRATLHRFGNT  1432
             ASR TLHRFGNT
Sbjct  433   ASRMTLHRFGNT  444



>ref|XP_003637542.1| Beta-ketoacyl-CoA synthase [Medicago truncatula]
 gb|KEH41035.1| 3-ketoacyl-CoA synthase-like protein [Medicago truncatula]
Length=521

 Score =   433 bits (1113),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 230/431 (53%), Positives = 318/431 (74%), Gaps = 8/431 (2%)
 Frame = +2

Query  143   RRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWE  322
             R +LP+F+ SVKLKYVKLGY+Y+I+N + L   +PLL V   V + +    + +  +I+E
Sbjct  23    RSKLPNFLISVKLKYVKLGYHYLISNAMYLV-LIPLLGVA-SVHLSTFSIKDLI--QIYE  78

Query  323   NSGGPDFGVVNMSL-LGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIAR  499
             N     F  V+M +   L+ F  ++YFMS+P  IYLVDFAC KP  DL+VT++ F++ + 
Sbjct  79    NL---KFNFVSMLICTSLVVFLATLYFMSRPRGIYLVDFACYKPQKDLQVTREIFVERSI  135

Query  500   KSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVL  679
              +  F E+ L + K++LE SG+G +TY+P +I        +   R EA +++F AID+VL
Sbjct  136   LTKAFTEETLSFQKKILERSGLGQKTYLPPAIMRVPPNPCMAEARKEAEEVMFGAIDEVL  195

Query  680   EKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLA  859
             +KT ++A+DIGILVVNC+ FNPTPSLSAMI+NHYK++ NI+S NLGGMGCSAG+I++DLA
Sbjct  196   QKTGVKAKDIGILVVNCSLFNPTPSLSAMIVNHYKLRGNILSYNLGGMGCSAGLISIDLA  255

Query  860   RDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKY  1039
             + +L+ +PN YALVVS E ++  WY GN RSML+PNC FR G +AVLLSN+ RD   +KY
Sbjct  256   KQLLQVHPNSYALVVSMENITLNWYFGNDRSMLVPNCLFRMGGAAVLLSNKPRDRLRSKY  315

Query  1040  RLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPL  1219
             +L H VRTH+GA ++++  ++QEED  +  G+ +SKDL+ V GEALK NITTLGPLVLP+
Sbjct  316   QLVHTVRTHKGADNKSYGCVFQEEDDTKQVGVSLSKDLMAVAGEALKTNITTLGPLVLPM  375

Query  1220  TEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEA  1399
             +EQL FF TL+ RK+F  K KPYIPD+ +AFEHFCI+A  + +LDEL++NL LS+ +ME 
Sbjct  376   SEQLLFFGTLVARKIFKMKIKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLDLSDWHMEP  435

Query  1400  SRATLHRFGNT  1432
             SR TL+RFGNT
Sbjct  436   SRMTLNRFGNT  446



>ref|XP_009792392.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Nicotiana sylvestris]
 ref|XP_009792393.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Nicotiana sylvestris]
Length=511

 Score =   432 bits (1112),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 216/432 (50%), Positives = 311/432 (72%), Gaps = 8/432 (2%)
 Frame = +2

Query  140   VRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIW  319
             + R+LPDF +SVKLKYVKLGY+ +I + + L  +  ++     +   S+     +W ++ 
Sbjct  15    ISRKLPDFKKSVKLKYVKLGYHCLITHGMYLFLSPLVVLTAAQLSTFSLNDLYVLWDQL-  73

Query  320   ENSGGPDFGVVNMSLLG-LLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIA  496
                    F ++++ +   LL F  ++YF ++P P+YLVDF+C KP D  K T++ F+D++
Sbjct  74    ------RFNLISVVICSTLLVFLSTLYFFTRPRPVYLVDFSCYKPIDARKCTRENFLDMS  127

Query  497   RKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKV  676
             +  GTF  +NLE+ ++++E SG+GD TY+P+++        +   R EA  ++F AID++
Sbjct  128   KSVGTFSNENLEFQRKIVEKSGLGDLTYLPEAVTQVPPNPCMAEARKEAEAVMFGAIDEL  187

Query  677   LEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDL  856
             L KT ++ +DIGILVVNC+ FNPTPSLSAMI+NHYK++ NI+S NLGGMGCSAG+I++DL
Sbjct  188   LAKTSVKPKDIGILVVNCSLFNPTPSLSAMIVNHYKLRGNIISYNLGGMGCSAGLISIDL  247

Query  857   ARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAK  1036
             A+D+L+  PN YALV+S E ++  WY GN +SML+PNC FR G +AVLLSN+R D R +K
Sbjct  248   AKDLLQVQPNTYALVLSMENITLNWYFGNEKSMLLPNCLFRMGGAAVLLSNKRSDRRRSK  307

Query  1037  YRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLP  1216
             Y+L H VRTH+G+ D+ F  +YQ ED  R  G+ +SK+L+ V G+ALK NITTLGPLVLP
Sbjct  308   YQLVHTVRTHKGSDDKCFTCVYQMEDSNREVGVSLSKELMSVAGDALKTNITTLGPLVLP  367

Query  1217  LTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNME  1396
             ++EQ  FF TL+ RKL   K +PYIPD+ +AFEHFCI+A  + +LDE+++NL+LS+ NME
Sbjct  368   MSEQFLFFSTLVGRKLLKMKIRPYIPDFKLAFEHFCIHAGGRAVLDEIEKNLQLSDWNME  427

Query  1397  ASRATLHRFGNT  1432
              SR TL+RFGNT
Sbjct  428   PSRMTLYRFGNT  439



>ref|XP_002974719.1| hypothetical protein SELMODRAFT_101692 [Selaginella moellendorffii]
 gb|EFJ24239.1| hypothetical protein SELMODRAFT_101692 [Selaginella moellendorffii]
Length=534

 Score =   433 bits (1114),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 222/428 (52%), Positives = 316/428 (74%), Gaps = 8/428 (2%)
 Frame = +2

Query  152   LPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSG  331
             LPDF+QSV LKYVKLGY+Y++ + + L   VPL+  V  +EVG +  G +   ++W +  
Sbjct  42    LPDFLQSVNLKYVKLGYHYLVTHLITLT-LVPLMLGV-AIEVGRL--GPEDIHQLWIHL-  96

Query  332   GPDFGVVN-MSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSG  508
                F +V+ M+   LL F  ++YFMS+P  ++LVD+AC KPS +++V    F++ ++ SG
Sbjct  97    --KFNLVSVMTCSALLVFAATVYFMSRPRSVFLVDYACHKPSPNIRVPFASFMEHSKLSG  154

Query  509   TFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKT  688
             +FD+K+LE+ +R+LE SG+G++T +P ++        ++  R EA  ++F A+D++  KT
Sbjct  155   SFDDKSLEFQRRILERSGLGEQTALPPAMHYLPPRPSMDAARQEAETVMFSALDELFHKT  214

Query  689   RIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDI  868
              ++ +D+GILVVNC+ FNPTPSLSAMI+N YKM+ NI S NLGGMGCSAG+IA+DLA+D+
Sbjct  215   GVKPKDVGILVVNCSLFNPTPSLSAMIVNKYKMRGNIRSYNLGGMGCSAGVIAIDLAKDM  274

Query  869   LRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQ  1048
             L+ + N YA+VVSTE ++  WY GN RSMLIPNC FR G +A+LLSNRR D R AKY L 
Sbjct  275   LQVHGNDYAIVVSTENITQNWYFGNRRSMLIPNCLFRVGGAAMLLSNRRSDRRRAKYELL  334

Query  1049  HIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQ  1228
             H VRTH+GA D++FR +YQEED     G+ +SKDL+ + G+ALK NITT+GPLVLPL+EQ
Sbjct  335   HTVRTHKGADDKSFRCVYQEEDENAKMGVSLSKDLMAIAGQALKTNITTMGPLVLPLSEQ  394

Query  1229  LYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRA  1408
             + FF  L+ RK+F    KPYIPD+ +AF HFCI+A  + ++DEL++NL+L+ +++EASR 
Sbjct  395   IIFFSFLVARKVFKRAVKPYIPDFRLAFHHFCIHAGGRAVIDELEKNLQLTAEHVEASRM  454

Query  1409  TLHRFGNT  1432
             TL+RFGNT
Sbjct  455   TLYRFGNT  462



>ref|XP_003519009.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Glycine max]
 gb|KHN15393.1| 3-ketoacyl-CoA synthase 11 [Glycine soja]
Length=521

 Score =   432 bits (1112),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 231/446 (52%), Positives = 325/446 (73%), Gaps = 11/446 (2%)
 Frame = +2

Query  107   PDAGALTF-SVRVRRR--LPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEV  277
             PD+G ++  S + +RR  LP+F+ SV+LKYVKLGY+YVI+N + L   +PLL +     +
Sbjct  9     PDSGTISVESAKEKRRNKLPNFLLSVRLKYVKLGYHYVISNAMYLL-LIPLLGIA-SAHL  66

Query  278   GSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLG-FTLSIYFMSKPMPIYLVDFACCKPS  454
              ++    K + ++WEN     F +V+++L   L  F  ++YFM++P  +YLVDFAC KP 
Sbjct  67    STL--SIKDFLQLWENL---KFNLVSVTLCSSLTVFLATLYFMTRPRGVYLVDFACYKPD  121

Query  455   DDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIR  634
              D   T++ F++ +  +G+F E+NL + K++LE SG+G +TY+P +I        +   R
Sbjct  122   VDCTCTREIFVERSGLTGSFSEENLSFQKKILERSGLGQKTYLPPAILSLPPRPCMAAAR  181

Query  635   GEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNL  814
              EA Q++F AID++L KT ++A+DIGILVVNC+ FNPTPSLSAMI+NHYK++ N+ S NL
Sbjct  182   EEAEQVMFGAIDQLLAKTGVKAKDIGILVVNCSLFNPTPSLSAMIVNHYKLRGNVFSYNL  241

Query  815   GGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSA  994
             GGMGCSAG+I++DLA+ +L+ +PN YALVVS E ++  WY GN+RSML+ NC FR G +A
Sbjct  242   GGMGCSAGLISIDLAKHLLQVHPNSYALVVSMENITLNWYFGNNRSMLVSNCLFRMGGAA  301

Query  995   VLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEA  1174
             +LLSNR  D   AKY+L H VRTH+GA D+++  ++QEED  +  G+ +SKDL+ V GEA
Sbjct  302   ILLSNRSGDRHRAKYQLVHTVRTHKGADDKSYGCVFQEEDETKRIGVALSKDLMAVAGEA  361

Query  1175  LKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLD  1354
             LK NITTLGPLVLP++EQL FF TL+ RK+F  K KPYIPD+ +AFEHFCI+A  + +LD
Sbjct  362   LKTNITTLGPLVLPMSEQLLFFATLVARKVFKMKIKPYIPDFKLAFEHFCIHAGGRAVLD  421

Query  1355  ELKRNLRLSEQNMEASRATLHRFGNT  1432
             EL++NL LS+ +ME SR TL+RFGNT
Sbjct  422   ELEKNLELSDWHMEPSRMTLNRFGNT  447



>ref|XP_003549437.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Glycine max]
Length=513

 Score =   432 bits (1112),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 223/441 (51%), Positives = 315/441 (71%), Gaps = 9/441 (2%)
 Frame = +2

Query  116   GALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLL--TVVFGVEVGSVM  289
             G +    R R  LPDF+QSV LKYVKLGY+Y+I+N + L   VPL+  T++   +   + 
Sbjct  13    GGVQIQHRSRMVLPDFLQSVNLKYVKLGYHYLISNLVTLF-LVPLILVTLIQVFQTTDID  71

Query  290   RGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKV  469
                 +W  +  N       +  ++   +L F L++Y +++P  +YL+D AC +P+D LK 
Sbjct  72    HLRHLWLHLQYNL------LTILTCSAVLVFGLTLYAVTRPRAVYLLDSACFRPADHLKA  125

Query  470   TKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQ  649
                 F+D +R +G F++ +LE+ +++LE SG+G+ETY+P+++        +   R EA Q
Sbjct  126   PFRSFMDHSRLTGDFEDSSLEFQRKILERSGLGEETYVPEAMHSIPPQPSMAAARAEAEQ  185

Query  650   LIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGC  829
             ++F A+DK+ + T I+ +DIGIL+VNC+ FNPTPSLSAMI+N YK++ NI S NLGGMGC
Sbjct  186   VMFGALDKLFQGTNIKPKDIGILIVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGC  245

Query  830   SAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSN  1009
             SAG+IA+DLA+D+L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR GCSA+LLSN
Sbjct  246   SAGVIAVDLAKDLLQVHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGCSALLLSN  305

Query  1010  RRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANI  1189
             +  D R AKYRL H+VRTH+GA D+AFR +YQE+D     G+ +SKDL+ + G ALK NI
Sbjct  306   KPADRRRAKYRLVHVVRTHRGADDKAFRCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNI  365

Query  1190  TTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRN  1369
             TTLGPLVLP++EQL FF TL+  KLF A  KPYIPD+ +AF+HFCI+A  + ++DEL++N
Sbjct  366   TTLGPLVLPISEQLLFFVTLLMNKLFKAGVKPYIPDFKLAFDHFCIHAGGRAVIDELEKN  425

Query  1370  LRLSEQNMEASRATLHRFGNT  1432
             L+L  +++EASR TLHRFGNT
Sbjct  426   LQLLPEHVEASRMTLHRFGNT  446



>ref|XP_004507452.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Cicer arietinum]
Length=505

 Score =   432 bits (1111),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 224/430 (52%), Positives = 315/430 (73%), Gaps = 6/430 (1%)
 Frame = +2

Query  143   RRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWE  322
             R  LPDF+QSV LKYVKLGY+Y+I + L L   +PL++V+  ++V S M  + +  ++W 
Sbjct  15    RLPLPDFLQSVNLKYVKLGYHYLITHLLTLC-LIPLMSVII-IQV-SQMNPQDI-HQLWL  70

Query  323   NSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARK  502
             +       V+  S + + G T  +Y M++P  +YLVDF+C KP  +L V   +F++ +R 
Sbjct  71    HLKYNLVSVIACSTILVFGST--VYIMTRPRSVYLVDFSCYKPPSNLSVKFTKFVEHSRL  128

Query  503   SGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLE  682
              G FDE +LE+ +++LE SG+G+ETY+P+++        + + R EA Q+++ A+D +  
Sbjct  129   KGDFDESSLEFQRKILERSGLGEETYLPEAMHQIPPTPSMASAREEAEQVMYGALDNLFA  188

Query  683   KTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLAR  862
              T+I+ +DIGILVVNC+ FNPTPSLSAMI+N YK++ NI S NLGGMGCSAG+IA+DLA+
Sbjct  189   NTKIKPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAIDLAK  248

Query  863   DILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYR  1042
             D+L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR G +AVLLSN+  D R AKY+
Sbjct  249   DMLQVHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGAAVLLSNKGSDRRRAKYK  308

Query  1043  LQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLT  1222
             L H+VRTH+GA D+AF+ +YQE+D     G+ +SKDL+ + G ALK NITTLGPLVLP++
Sbjct  309   LVHVVRTHKGADDKAFKCVYQEQDDVGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPVS  368

Query  1223  EQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEAS  1402
             EQL FF TL+ +KLF AK KPYIPD+ +AFEHFCI+A  + ++DEL++NL+L   ++EAS
Sbjct  369   EQLLFFTTLVVKKLFNAKAKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLLPMHVEAS  428

Query  1403  RATLHRFGNT  1432
             R TLHRFGNT
Sbjct  429   RMTLHRFGNT  438



>ref|XP_011083903.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Sesamum indicum]
Length=522

 Score =   432 bits (1112),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 228/438 (52%), Positives = 314/438 (72%), Gaps = 8/438 (2%)
 Frame = +2

Query  125   TFSVRVR--RRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGE  298
             T  VR+   RRLPDF+QSV LKYVKLGY+Y+I+N L L   VPL+ ++  VEV S M   
Sbjct  24    TVGVRIHHSRRLPDFLQSVNLKYVKLGYHYLISNLLTLC-LVPLMVIII-VEV-SQMNPN  80

Query  299   KVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKD  478
              V  ++W +       V+  S    L F  ++Y M++P P+YLVD++C +P D L    D
Sbjct  81    DV-RQLWLHLQYNLVSVIICS--AFLVFGSTVYIMNRPRPVYLVDYSCYRPPDSLMAPFD  137

Query  479   QFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIF  658
             +F++ +R  G FDE +LE+ +++LE SG+GDETY+P+++        +   R EA Q++F
Sbjct  138   RFMEHSRLQGDFDESSLEFQRKILERSGLGDETYVPEAMHFIPPRPSMQAAREEAEQVMF  197

Query  659   EAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAG  838
              A+D +   T ++ ++IG+LVVNC+ FNPTPSLSAMI+N YK++ NI S NLGGMGCSAG
Sbjct  198   GALDNLFANTNVKPKEIGVLVVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAG  257

Query  839   IIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRR  1018
             +IA+DLA+D+L+ + N YA+VVS E ++  WY GN +SMLIPNC FR G +AVLLSN+  
Sbjct  258   VIAVDLAKDMLQVHRNTYAVVVSMENITQNWYFGNKKSMLIPNCLFRVGGAAVLLSNKAG  317

Query  1019  DYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTL  1198
             D R AKY+L H+VRTH+GA D+AFR +YQE+D     G+ +SKDL+ + G ALK NITTL
Sbjct  318   DRRRAKYKLVHVVRTHKGADDKAFRCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNITTL  377

Query  1199  GPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRL  1378
             GPLVLP++EQL FF TL+ +KLF    KPYIPD+ +AF+HFCI+A  + ++DEL++NL+L
Sbjct  378   GPLVLPISEQLLFFATLVIKKLFNKNVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQL  437

Query  1379  SEQNMEASRATLHRFGNT  1432
                ++EASR TLHRFGNT
Sbjct  438   LPVHVEASRMTLHRFGNT  455



>ref|XP_011037520.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Populus euphratica]
Length=510

 Score =   432 bits (1110),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 221/433 (51%), Positives = 311/433 (72%), Gaps = 6/433 (1%)
 Frame = +2

Query  134   VRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGK  313
             +R  RRLPDF+QSV LKYVKLGY+Y+I + L L     +  V+F     +     ++W  
Sbjct  17    IRQSRRLPDFLQSVNLKYVKLGYHYLITHLLTLCFVPSIAFVIFQASQLNPNDIHQLWLH  76

Query  314   IWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDI  493
             +  N       V+  S+  + G T  +Y +++P  +YLVD+AC KP   L+V  +QF++ 
Sbjct  77    LQYNL----VSVIICSVFLVFGAT--VYIVTRPRSVYLVDYACYKPPAKLQVKYEQFMEH  130

Query  494   ARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDK  673
             ++ +G FD+ +LE+ +R+LE SG+G+ETY+P+++        +   R EA Q++F A+D 
Sbjct  131   SKLTGDFDDSSLEFQRRILERSGLGEETYVPEAMHYIPPRPSMAAAREEAEQVMFGALDI  190

Query  674   VLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALD  853
             +   T I+ +DIG+LVVNC+ FNPTPSLSAMI+N YK++ NI + NLGGMGCSAG+IA+D
Sbjct  191   LFANTNIKPKDIGVLVVNCSLFNPTPSLSAMIVNKYKLRGNIRTFNLGGMGCSAGVIAVD  250

Query  854   LARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHA  1033
             LA+D+L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR G SAVLLSN+ +D R A
Sbjct  251   LAKDMLQIHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKAKDRRRA  310

Query  1034  KYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVL  1213
             KY+L H+VRTH+GA D+AF+ +YQE+D     G+ +SKDL+ + G ALK NITTLGPLVL
Sbjct  311   KYKLVHVVRTHKGADDKAFKCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVL  370

Query  1214  PLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNM  1393
             P++EQL FF TL+ +KLF AK KPYIPD+ +AF+HFCI+A  + ++DEL++NL+L   ++
Sbjct  371   PISEQLLFFSTLVAKKLFNAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPIHV  430

Query  1394  EASRATLHRFGNT  1432
             EASR TLHRFGNT
Sbjct  431   EASRMTLHRFGNT  443



>dbj|BAJ93555.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=522

 Score =   432 bits (1111),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 223/445 (50%), Positives = 316/445 (71%), Gaps = 6/445 (1%)
 Frame = +2

Query  98    PSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEV  277
             P+G +AG    S    RRLPDF+QSV+LKYVKLGY+Y+I + + L  T PL+ V+  V +
Sbjct  9     PAGANAGERASSPSPSRRLPDFLQSVRLKYVKLGYHYLITHGMYLLLT-PLI-VLIAVHL  66

Query  278   GSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSD  457
              ++  G+     +W +       V+  S L  L F  ++YF+++P  +YLVDF C KP  
Sbjct  67    STLSPGDV--ADLWTHLRFNLLSVIACSTL--LVFLSTVYFLTRPRSVYLVDFGCYKPGP  122

Query  458   DLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRG  637
             + + ++D F+  ++ +G F E NL++ +++LE SG+G++TYIP ++        ++  R 
Sbjct  123   ERRCSRDTFMRCSKLTGNFTEANLDFQRKILERSGLGEDTYIPPALVTVPPNPSMDLARE  182

Query  638   EASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLG  817
             EA   +F AID +L KT ++ +DIGILVVNC+ FNPTPSLSAM++NHYK++ NI+S NLG
Sbjct  183   EAQVCMFGAIDNMLAKTGVKPKDIGILVVNCSLFNPTPSLSAMVVNHYKLRGNIISYNLG  242

Query  818   GMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAV  997
             GMGCSAG++++DLA+D+L+ +PN YA+VVSTE ++  WY GN+RSML+ NC FR GC+A+
Sbjct  243   GMGCSAGLLSIDLAKDLLQVHPNSYAMVVSTENITLNWYFGNNRSMLVSNCLFRMGCAAI  302

Query  998   LLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEAL  1177
             LLSN+R D R +KY L H VRTH+GA D+ F  + QEED     G+ +SKDL+ V G+AL
Sbjct  303   LLSNKRSDRRRSKYELVHTVRTHKGADDKCFSCVTQEEDDSGKVGVALSKDLMAVAGDAL  362

Query  1178  KANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDE  1357
             K NITTLGPLVLP +EQL F  TL+ +KLF  K KPYIPD+ +AFEHFCI+A  + +LDE
Sbjct  363   KTNITTLGPLVLPFSEQLLFMVTLVGKKLFKMKIKPYIPDFKLAFEHFCIHAGGRAVLDE  422

Query  1358  LKRNLRLSEQNMEASRATLHRFGNT  1432
             +++N+ L++ +ME SR TL RFGNT
Sbjct  423   IEKNMDLTDWHMEPSRMTLFRFGNT  447



>ref|XP_004245214.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Solanum lycopersicum]
 ref|XP_010325133.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Solanum lycopersicum]
Length=505

 Score =   431 bits (1109),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 217/430 (50%), Positives = 312/430 (73%), Gaps = 8/430 (2%)
 Frame = +2

Query  146   RRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWEN  325
             R LPDF QSVKLKYVKLGY+Y+I + + L  +  ++ +   +   S      +W ++   
Sbjct  11    RNLPDFKQSVKLKYVKLGYHYLITHGMYLFLSPLVVIIAAQLSTFSPNDFYVLWDQL---  67

Query  326   SGGPDFGVVNMSLLG-LLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARK  502
                  F ++++ +   LL F  ++YF+++P P+YLV+F+C KP D  K TK  F+++++ 
Sbjct  68    ----RFNLISVVICSTLLVFLSTVYFITRPSPVYLVNFSCYKPEDARKCTKGTFLEMSKS  123

Query  503   SGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLE  682
              GTF + NLE+ ++++E SG+GD TY+P+++        +   R EA  ++F AID++L 
Sbjct  124   VGTFSDGNLEFQRKIVERSGLGDSTYLPEAVTNVPPNPCMAEARKEAEAVMFGAIDELLA  183

Query  683   KTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLAR  862
             KT ++ +DIGILVVNC+ FNPTPSLSAMI+NHYK++ N++S NLGGMGCSAG+I++DLA+
Sbjct  184   KTSVKPKDIGILVVNCSLFNPTPSLSAMIVNHYKLRGNVISYNLGGMGCSAGLISIDLAK  243

Query  863   DILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYR  1042
             D+L+ +PN YALV+S E ++  WY GN +SML+PNC FR G +AVLLSN+R D + +KY+
Sbjct  244   DLLQVHPNTYALVLSMENITLNWYFGNEKSMLLPNCLFRMGGAAVLLSNKRSDKKRSKYQ  303

Query  1043  LQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLT  1222
             L H VRTH+GA D+ F  +YQ ED +   G+ +SK+L+ V G+ALK NITTLGPLVLP++
Sbjct  304   LVHTVRTHKGADDKCFTCVYQLEDSDGKVGVSLSKELMAVAGDALKTNITTLGPLVLPMS  363

Query  1223  EQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEAS  1402
             EQ  FF TL+ RKL  AK +PYIPD+ +AFEHFCI+A  + +LDEL++NL+LS+ +ME S
Sbjct  364   EQFLFFATLVGRKLLKAKIRPYIPDFKLAFEHFCIHAGGRAVLDELEKNLQLSDWHMEPS  423

Query  1403  RATLHRFGNT  1432
             R TLHRFGNT
Sbjct  424   RMTLHRFGNT  433



>ref|XP_004234025.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Solanum lycopersicum]
Length=519

 Score =   432 bits (1111),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 196/351 (56%), Positives = 272/351 (77%), Gaps = 0/351 (0%)
 Frame = +2

Query  380   FTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESS  559
             F  ++YFM++P  +YLVDF+C KP  D+  +K+ F++ ++++G F E+NL + K++LE S
Sbjct  94    FLGTLYFMTRPRKVYLVDFSCYKPKPDVMCSKETFMERSKQAGIFTEENLAFQKKILERS  153

Query  560   GIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTF  739
             G+G +TY P+++        +   R EA  ++F AID++L KTR++A+DIGILVVNC+ F
Sbjct  154   GLGQKTYFPEALLRVPAEPNMAEARKEAEMVMFGAIDELLAKTRVKAKDIGILVVNCSLF  213

Query  740   NPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIV  919
             NPTPSLSAMI+NHYK++ N++S NLGGMGCSAG+I++DLA+ +L+ NPN YALVVS E +
Sbjct  214   NPTPSLSAMIVNHYKLRGNVMSYNLGGMGCSAGLISIDLAKQLLQVNPNSYALVVSMENI  273

Query  920   SATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSI  1099
             +  WY GN+RSML+ NC FR G +A+LLSNR  D R +KY+L H VRTH+GA DR++  +
Sbjct  274   TLNWYFGNNRSMLVSNCIFRMGGAAILLSNRSTDRRRSKYQLIHTVRTHKGADDRSYGCV  333

Query  1100  YQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKT  1279
             +QEED ++  G+ +SKDL+ V GEALK NITTLGPLVLP++EQL FF TL+ RK+F  K 
Sbjct  334   FQEEDEKKEIGVALSKDLMAVAGEALKTNITTLGPLVLPMSEQLLFFMTLVARKIFKMKI  393

Query  1280  KPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             KPYIPD+ +AFEHFCI+A  + +LDEL++NL LS+ +ME SR TL+RFGNT
Sbjct  394   KPYIPDFKLAFEHFCIHAGGRAVLDELEKNLELSQWHMEPSRMTLYRFGNT  444



>gb|KEH42797.1| 3-ketoacyl-CoA synthase-like protein [Medicago truncatula]
Length=516

 Score =   432 bits (1110),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 226/435 (52%), Positives = 315/435 (72%), Gaps = 8/435 (2%)
 Frame = +2

Query  131   SVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWG  310
             S + RR+LP+F+ SV+LKYVKLGY+Y+I+  + L     LL  +FG    S       + 
Sbjct  13    SPQERRKLPNFLLSVRLKYVKLGYHYLISKAMYL-----LLIPLFGA--ASAHLSTISYH  65

Query  311   KIWENSGGPDFGVVNMSLL-GLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFI  487
              I +      F +V+++L   L+ F +++YFMS+P  +YLVDFAC KP  +   T++ F+
Sbjct  66    DIIQLYENLKFNLVSVTLCTSLMVFLVTLYFMSRPRGVYLVDFACYKPKQEYTCTREIFM  125

Query  488   DIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAI  667
             + +  +GTF ++NL + K++LE SG+G +TY+P +I        +   R EA +++F AI
Sbjct  126   NRSELTGTFSDENLAFQKKILERSGLGQKTYLPPAILSVPPNPCMAEARKEAEEVMFGAI  185

Query  668   DKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIA  847
             D++LEKT ++A+DIGILVVNC+ FNPTPSLSAMI+NHYK++ N+ S NLGGMGCSAG+I+
Sbjct  186   DELLEKTGVKAKDIGILVVNCSLFNPTPSLSAMIVNHYKLRGNVQSYNLGGMGCSAGLIS  245

Query  848   LDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYR  1027
             +DLA+ +L+ +PN YALVVS E ++  WY GN RSML+ NC FR G SA+LLSN+  D +
Sbjct  246   IDLAKQLLQVHPNSYALVVSMENITLNWYFGNDRSMLVSNCLFRMGGSAILLSNKASDSK  305

Query  1028  HAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPL  1207
              AKY+L H VRTH+GA DR++  ++QEED ++  G+ +SKDL+ V GEALK NITTLGPL
Sbjct  306   RAKYQLIHTVRTHKGADDRSYGCVFQEEDEKKSIGVSLSKDLMAVAGEALKTNITTLGPL  365

Query  1208  VLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQ  1387
             VLP++EQL FF TL+ RK F  K KPYIPD+ +AFEHFCI+A  + +LDEL++NL LS+ 
Sbjct  366   VLPMSEQLLFFATLVARKAFKMKIKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLDLSDW  425

Query  1388  NMEASRATLHRFGNT  1432
             +ME SR TL+RFGNT
Sbjct  426   HMEPSRMTLNRFGNT  440



>ref|XP_002529366.1| acyltransferase, putative [Ricinus communis]
 gb|EEF33033.1| acyltransferase, putative [Ricinus communis]
Length=498

 Score =   431 bits (1107),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 225/430 (52%), Positives = 312/430 (73%), Gaps = 8/430 (2%)
 Frame = +2

Query  146   RRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWEN  325
             R LPDF +SVKLKYVKLGY+Y+I + + L  +   L VV   ++ S    + ++  +WE+
Sbjct  17    RNLPDFKKSVKLKYVKLGYHYLITHAMYLFLSP--LVVVIAAQL-STFSMQDLY-TLWEH  72

Query  326   SGGPDFGVVNMSLLG-LLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARK  502
                  F ++++ +   LL F  ++YFM++P P+YLV+FAC KP +  K TK  F+D +R 
Sbjct  73    L---QFNLISVIVCSTLLVFLFTLYFMTRPRPVYLVNFACYKPEESRKCTKRIFMDQSRM  129

Query  503   SGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLE  682
             +GTF E+NL + +R+LE SG+GD TY+P+++        +   R EA  ++F  +D++L 
Sbjct  130   TGTFTEENLNFQQRILERSGLGDLTYLPEAVLNIPPNPSMQEARKEAETVMFGCVDELLA  189

Query  683   KTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLAR  862
             KT I+ +DIGIL+VNC+ FNPTPSLSAM+INHYK++ NIVS NLGGMGCSAG+I++ LA+
Sbjct  190   KTSIKPKDIGILIVNCSLFNPTPSLSAMVINHYKLRGNIVSFNLGGMGCSAGLISIALAK  249

Query  863   DILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYR  1042
             D+L+ +PN YALV+S E ++  WY GN RS L+ NC FR G +A+LLSN+R D R +KY+
Sbjct  250   DLLQVHPNSYALVISMENITLNWYFGNDRSKLVSNCLFRMGGAAILLSNKRSDRRKSKYQ  309

Query  1043  LQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLT  1222
             L H VRTH+GA D+ F  + QEED     G+ +SKDL+ V G+ALK NITTLGPLVLP++
Sbjct  310   LVHTVRTHKGADDKCFTCVTQEEDSNGKVGVTLSKDLMAVAGDALKTNITTLGPLVLPMS  369

Query  1223  EQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEAS  1402
             EQL FF TL+ +KLF  K KPYIPD+ +AFEHFCI+A  + +LDEL++NL+LSE +ME S
Sbjct  370   EQLLFFATLVGKKLFKMKIKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLQLSEWHMEPS  429

Query  1403  RATLHRFGNT  1432
             R TL+RFGNT
Sbjct  430   RMTLYRFGNT  439



>ref|XP_004495403.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Cicer arietinum]
Length=514

 Score =   431 bits (1109),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 200/365 (55%), Positives = 279/365 (76%), Gaps = 1/365 (0%)
 Frame = +2

Query  341   FGVVNMSLLG-LLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFD  517
             F +V+++L   L+ F +++YFMS+P  +YLVDFAC KP  D   T++ F+  +  +GTF 
Sbjct  77    FNLVSVTLCSSLMVFLVTLYFMSRPRGVYLVDFACYKPKQDYTCTREIFMHRSELTGTFS  136

Query  518   EKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIR  697
             ++NL + K+++E SG+G +TY+P +I        +   R EA +++F AID++LEKT ++
Sbjct  137   DENLAFQKKIIERSGLGQKTYLPPAILSVPPNPCMAEARKEAEEVMFGAIDELLEKTGVK  196

Query  698   ARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRA  877
             A+DIGIL+VNC+ FNPTPSLSAMI+NHYK++ NI S NLGGMGCSAG+I++DLA+ +L+ 
Sbjct  197   AKDIGILIVNCSLFNPTPSLSAMIVNHYKLRGNIQSYNLGGMGCSAGLISIDLAKQLLQV  256

Query  878   NPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIV  1057
             +PN YALVVS E ++  WY GN+RSML+ NC FR G SA+LLSN+  D + AKY+L H V
Sbjct  257   HPNSYALVVSMENITLNWYFGNNRSMLVSNCLFRMGGSAILLSNKTSDSKRAKYQLIHTV  316

Query  1058  RTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYF  1237
             RTH+GA D+++  ++QEED ++  G+ +SKDL+ V GEALK NITTLGPLVLP++EQL F
Sbjct  317   RTHKGADDKSYGCVFQEEDDKKTIGVSLSKDLMSVAGEALKTNITTLGPLVLPMSEQLLF  376

Query  1238  FQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLH  1417
             F TL+ RK+F  K KPYIPD+ +AFEHFCI+A  + +LDEL++NL LS+ +ME SR TL+
Sbjct  377   FATLVARKVFKMKIKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLDLSDWHMEPSRMTLY  436

Query  1418  RFGNT  1432
             RFGNT
Sbjct  437   RFGNT  441



>ref|XP_010048253.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Eucalyptus grandis]
 gb|KCW80459.1| hypothetical protein EUGRSUZ_C01804 [Eucalyptus grandis]
Length=511

 Score =   431 bits (1108),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 217/430 (50%), Positives = 313/430 (73%), Gaps = 8/430 (2%)
 Frame = +2

Query  146   RRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWEN  325
             R+LPDF QSVKLKYVKLGY+Y+I + + L  T  +  +   +   S+     +W  +   
Sbjct  17    RKLPDFKQSVKLKYVKLGYHYLITHGMYLFLTPIVAVIAAQLSTFSIKDLYDLWDHL---  73

Query  326   SGGPDFGVVNMSLLG-LLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARK  502
                  F ++++ L   LL F  ++YF+++P P+YLVDF+C KP ++ K ++  F++ ++ 
Sbjct  74    ----RFNLISVILCSTLLVFLSTLYFLTRPQPVYLVDFSCYKPDNERKCSRQIFMERSQS  129

Query  503   SGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLE  682
             +GTF E+NLE+ +++LE SG+G+ TY+P+++        +   R EA  ++F A+DK+ E
Sbjct  130   AGTFTEENLEFQRKILERSGLGESTYLPEAVLRVPPNPCMAEARKEAKMVMFGALDKLFE  189

Query  683   KTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLAR  862
             KT ++ +DIGIL+VNC+ FNPTPSLSAM+INHYK++ NI+S NLGGMGCSAG+I++DLA+
Sbjct  190   KTSLKPKDIGILIVNCSLFNPTPSLSAMVINHYKLRGNIISYNLGGMGCSAGLISIDLAK  249

Query  863   DILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYR  1042
             ++L+ +PN YALV+S E ++  WY GN RSML+ NC FR G +A+LLSN+R DY  +KY+
Sbjct  250   NLLQVHPNSYALVISMENITLNWYFGNERSMLVSNCLFRMGGAAILLSNKRSDYWRSKYK  309

Query  1043  LQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLT  1222
             L H VRTH+GA D+ F  I Q+ED     G+ +S+DL+ V G+ALK NITTLGPLVLP++
Sbjct  310   LVHTVRTHKGADDKCFSCITQKEDPTGRIGVSLSRDLMAVAGDALKTNITTLGPLVLPMS  369

Query  1223  EQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEAS  1402
             EQL FF TL+ +KLF  K KPYIPD+ +AFEHFCI+A  + +LDEL++NL+LS+ +ME S
Sbjct  370   EQLLFFATLVGKKLFKMKLKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLQLSDWHMEPS  429

Query  1403  RATLHRFGNT  1432
             R TL+RFGNT
Sbjct  430   RMTLYRFGNT  439



>emb|CDY29431.1| BnaA06g13650D [Brassica napus]
Length=484

 Score =   430 bits (1105),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 226/440 (51%), Positives = 311/440 (71%), Gaps = 11/440 (3%)
 Frame = +2

Query  116   GALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRG  295
             G++   +R  RRLPD++QSV LKYVKLGY+YVI+N L L      + +       SV   
Sbjct  8     GSVGVQIRQTRRLPDYLQSVNLKYVKLGYHYVISNLLTLCLLPLAVVI-------SVQTN  60

Query  296   EKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTK  475
                   +W +       ++  S   +L F L++Y M++P P+YLVDF+C  P D LK   
Sbjct  61    PDDLRHLWLHLQYNLVSIITCS--AILVFGLTVYVMTRPRPVYLVDFSCYLPPDHLKAPF  118

Query  476   DQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIG-CPEKIKKLNNIRGEASQL  652
              +F+  +R +G FD+  LE+ +++L+ SG+G++TY+P+ +   P +I  +   R EA Q+
Sbjct  119   SRFMAHSRLTGDFDDSALEFQRKILQRSGLGEDTYVPEGMHHVPPRIS-MAAAREEAEQV  177

Query  653   IFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCS  832
             +F A+D + EKT I  +DIGILVVNC+ FNPTPSLSAMI+N YK++ NI S NLGGMGCS
Sbjct  178   MFGALDSLFEKTNINPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSYNLGGMGCS  237

Query  833   AGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNR  1012
             AG+IA+DLA+D+L  +   YA+VVSTE ++  WY GN+++MLIPNC FR G SAVLLSN+
Sbjct  238   AGVIAVDLAKDMLLVHRKTYAVVVSTENITQNWYFGNNKAMLIPNCLFRVGGSAVLLSNK  297

Query  1013  RRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANIT  1192
               D R +KYRL H+VRTH+GA D+AFR +YQE+D     G+ +SKDL+ + GE LK NIT
Sbjct  298   SSDKRRSKYRLSHVVRTHRGADDKAFRCVYQEQDDTGRTGVSLSKDLMAIAGETLKTNIT  357

Query  1193  TLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNL  1372
             TLGPLVLP++EQ+ FF TL+ +KLF  K KPYIPD+ +AFEHFCI+A  + ++DEL++NL
Sbjct  358   TLGPLVLPISEQILFFTTLVVKKLFNGKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNL  417

Query  1373  RLSEQNMEASRATLHRFGNT  1432
             +LS  ++EASR TLHRFGNT
Sbjct  418   QLSPVHVEASRMTLHRFGNT  437



>gb|KDP32347.1| hypothetical protein JCGZ_13272 [Jatropha curcas]
Length=511

 Score =   431 bits (1107),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 224/429 (52%), Positives = 308/429 (72%), Gaps = 6/429 (1%)
 Frame = +2

Query  146   RRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWEN  325
             R LPDF +SVKLKYVKLGY+YVI + + L  +   L V+   ++ +    +  +  +WE+
Sbjct  17    RNLPDFKKSVKLKYVKLGYHYVITHGMYLFLSP--LVVLIAAQISTFSLQD--FYSLWEH  72

Query  326   SGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKS  505
                    VV  S+L  L F  ++YFMS+P P+YLV+F+C KP +  K TK  F+D +R +
Sbjct  73    LQYNLISVVCCSML--LVFLFTLYFMSRPRPVYLVNFSCYKPEESRKCTKRIFMDQSRMT  130

Query  506   GTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEK  685
             GTF E+NL + +R+LE SG+GD TY+P+++        +   R EA  ++F  +D +L K
Sbjct  131   GTFSEENLNFQQRILERSGLGDSTYLPEAVLNIPPNPSMQEARKEAEAVMFGCVDALLAK  190

Query  686   TRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARD  865
             T I+ +DIGIL+VNC+ FNPTPSLSAM+INHYK++ NIVS NLGGMGCSAG+I++ LA+D
Sbjct  191   TSIKPKDIGILIVNCSLFNPTPSLSAMVINHYKLRGNIVSYNLGGMGCSAGLISIALAKD  250

Query  866   ILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRL  1045
             +L+ +PN YALV+S E ++  WY GN RS L+ NC FR G +A+LLSN+R D R +KY+L
Sbjct  251   LLQVHPNSYALVISMENITLNWYFGNDRSKLVSNCLFRMGGAAILLSNKRSDRRRSKYQL  310

Query  1046  QHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTE  1225
              H VRTH+GA D+ F  + QEED     G+ +SKDL+ V G+ALK NITTLGPLVLP++E
Sbjct  311   VHTVRTHKGADDKCFSCVMQEEDSNGKVGVTLSKDLMAVAGDALKTNITTLGPLVLPMSE  370

Query  1226  QLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASR  1405
             QL FF TL+ +KLF  K KPYIPD+ +AFEHFCI+A  + +LDE+++NL+LS+ +ME SR
Sbjct  371   QLLFFATLVGKKLFKMKIKPYIPDFRLAFEHFCIHAGGRAVLDEIEKNLQLSDWHMEPSR  430

Query  1406  ATLHRFGNT  1432
              TL+RFGNT
Sbjct  431   MTLYRFGNT  439



>gb|AGH32920.1| ketoacyl-CoA synthase [Camellia chekiangoleosa]
Length=517

 Score =   431 bits (1108),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 223/429 (52%), Positives = 314/429 (73%), Gaps = 6/429 (1%)
 Frame = +2

Query  146   RRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWEN  325
             RRLPDF+QSV LKYVKLGY+YVI+N L L   +PL+ ++  V   S M  +++  ++W +
Sbjct  28    RRLPDFLQSVNLKYVKLGYHYVISNLLTLC-LIPLMAML--VLESSQMNPDEI-HQLWVH  83

Query  326   SGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKS  505
                    VV  S+  + G T  +Y M++P P+YLVD+AC +  D LK +  +F++ +R +
Sbjct  84    LQYNLLSVVICSVFLVFGST--VYIMTRPKPVYLVDYACYRAPDHLKASYHKFMNHSRLT  141

Query  506   GTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEK  685
             G FDE +LE+ +++LE SG+G+ETY P+++        +   R EA Q++F A+D +   
Sbjct  142   GDFDESSLEFQRKILERSGLGEETYFPEAMHSIPPRPSMAAARDEAEQVMFGALDNLFAN  201

Query  686   TRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARD  865
             T ++++DIG+LVVNC+ FNPTPSLSAMI+N YK++ N+ S NLGGMGCSAG+IA+DLA+D
Sbjct  202   TNVKSKDIGVLVVNCSLFNPTPSLSAMIVNKYKLRGNVRSFNLGGMGCSAGVIAVDLAKD  261

Query  866   ILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRL  1045
             +L+ + N  A+VVSTE ++  WY GN++SMLIPNC FR G SAVLLSN+  D R AKY+L
Sbjct  262   LLQIHRNTCAVVVSTENITQNWYFGNNKSMLIPNCLFRVGGSAVLLSNKSVDRRRAKYKL  321

Query  1046  QHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTE  1225
              H+VRTH+GA D+AFR +YQE+D     G+ +SKDL+ + G ALK NITTLGP+VLP++E
Sbjct  322   VHVVRTHKGADDKAFRCVYQEQDDVGKTGVSLSKDLMAIAGGALKTNITTLGPIVLPISE  381

Query  1226  QLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASR  1405
             QL FF TL+ +KLF    KPYIPD+T+AF+HFCI+A  + ++DEL++NL+L   ++EASR
Sbjct  382   QLLFFATLVVKKLFNKNIKPYIPDFTLAFDHFCIHAGGRAVIDELEKNLQLLPIHVEASR  441

Query  1406  ATLHRFGNT  1432
              TLHRFGNT
Sbjct  442   MTLHRFGNT  450



>gb|KDP46259.1| hypothetical protein JCGZ_10099 [Jatropha curcas]
Length=510

 Score =   430 bits (1106),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 223/436 (51%), Positives = 314/436 (72%), Gaps = 10/436 (2%)
 Frame = +2

Query  131   SVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGE--KV  304
              ++  RRLPDF+QSV LKYVKLGY+Y++++ L L   +PL+ V+  VE   +   +  ++
Sbjct  16    QIKQSRRLPDFLQSVNLKYVKLGYHYLMSHLLTLC-LIPLMAVII-VEASQLNPEDVHQL  73

Query  305   WGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQF  484
             W ++  N       V  +     +    ++Y M++P  +YLVD+AC KP   L+V   QF
Sbjct  74    WLQLQYNL------VTVIVCSVFVVVGSTVYIMTRPRSVYLVDYACYKPPPKLQVKFHQF  127

Query  485   IDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEA  664
             ++ ++ +G FDE +LE+ +++LE SG+G+ETY+P+++        +   R EA Q++F A
Sbjct  128   MEHSKLTGDFDESSLEFQRKILERSGLGEETYVPEAMHHIPPRPSMAAAREEAEQVMFGA  187

Query  665   IDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGII  844
             +D +   T I+ +DIGILVVNC+ FNPTPSLSAMIIN YK++ NI+S NLGGMGCSAG+I
Sbjct  188   LDILFANTNIKPKDIGILVVNCSLFNPTPSLSAMIINKYKLRGNILSFNLGGMGCSAGVI  247

Query  845   ALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDY  1024
             A+DL +D+L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR G +AVLLSN+  D 
Sbjct  248   AIDLTKDLLQIHRNSYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGAAVLLSNKSTDR  307

Query  1025  RHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGP  1204
             R AKY+L H+VRTH+GA D+AFR +YQE+D E   G+ +SKDL+ + G ALK NITTLGP
Sbjct  308   RRAKYKLVHLVRTHRGADDKAFRCVYQEQDDEGKTGVSLSKDLMAIAGGALKTNITTLGP  367

Query  1205  LVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSE  1384
             LVLP++EQL FF TL+ +KLF AK KPYIPD+ +AF+HFCI+A  + ++DEL++NL+L  
Sbjct  368   LVLPISEQLLFFATLVAKKLFNAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLP  427

Query  1385  QNMEASRATLHRFGNT  1432
              ++EASR TLHRFGNT
Sbjct  428   LHVEASRMTLHRFGNT  443



>ref|XP_006341948.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Solanum tuberosum]
Length=519

 Score =   431 bits (1107),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 223/433 (52%), Positives = 316/433 (73%), Gaps = 6/433 (1%)
 Frame = +2

Query  134   VRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGK  313
             ++  RRLPDF+QSV LKYVKLGY+Y+I++ L L   +P++ V+  VEV S M  + +  +
Sbjct  26    IQQSRRLPDFLQSVNLKYVKLGYHYLISHLLTLC-LIPVMAVIL-VEV-SQMNPDDI-RQ  81

Query  314   IWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDI  493
             +W +       V+  S   +L F  ++Y M++P P+YLVD++C K  + LK   ++F+  
Sbjct  82    LWLHLQYNLVSVIICS--AVLVFGSTVYIMTRPRPVYLVDYSCYKAPEHLKAPYERFMQH  139

Query  494   ARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDK  673
             +R +G FDE +LE+ +++LE SG+GDETY+P+++        +   R EA Q++F A+DK
Sbjct  140   SRLTGDFDESSLEFQRKILERSGLGDETYVPEAMHQLPPQPSMQAAREEAEQVMFGALDK  199

Query  674   VLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALD  853
             +   T ++ + IG+LVVNC+ FNPTPSLSAMI+N YK++ NI S NLGGMGCSAG+IA+D
Sbjct  200   LFANTSVKPKKIGVLVVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVD  259

Query  854   LARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHA  1033
             LA+D+L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR G SAVLLSN+  D R A
Sbjct  260   LAKDMLQVHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSMDRRRA  319

Query  1034  KYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVL  1213
             KY+L H VRTH+GA D+AFR +YQE+D     G+ +SKDL+ + G ALK NITTLGPLVL
Sbjct  320   KYKLVHAVRTHRGADDKAFRCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVL  379

Query  1214  PLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNM  1393
             P++EQL FF +LI +K+F    KPYIPD+ +AF+HFCI+A  + ++DEL++NL+L++ ++
Sbjct  380   PISEQLLFFGSLIIKKIFNKHIKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLTQVHV  439

Query  1394  EASRATLHRFGNT  1432
             EASR TLHRFGNT
Sbjct  440   EASRMTLHRFGNT  452



>gb|AFK39024.1| unknown [Medicago truncatula]
Length=521

 Score =   431 bits (1107),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 229/431 (53%), Positives = 318/431 (74%), Gaps = 8/431 (2%)
 Frame = +2

Query  143   RRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWE  322
             R +LP+F+ SVKLKYVKLGY+Y+I+N + L   +PLL V   V + +    + +  +I+E
Sbjct  23    RSKLPNFLISVKLKYVKLGYHYLISNAMYLV-LIPLLGVA-SVHLSTFSIKDLI--QIYE  78

Query  323   NSGGPDFGVVNMSL-LGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIAR  499
             N     F  V+M +   L+ F  ++YFMS+P  IYLVDFAC KP  DL+VT++ F++ + 
Sbjct  79    NL---KFNFVSMLICTSLVVFLATLYFMSRPRGIYLVDFACYKPQKDLQVTREIFVERSI  135

Query  500   KSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVL  679
              +  F E+ L + K++LE SG+G +TY+P +I        +   R EA +++F AID+VL
Sbjct  136   LTKAFTEETLSFQKKILERSGLGQKTYLPPAITRVPPNPCMAEARKEAEEVMFGAIDEVL  195

Query  680   EKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLA  859
             +KT ++A+DIGILVVNC+ FNPTPSLSAMI+NHYK++ +I+S NLGGMGCSAG+I++DLA
Sbjct  196   QKTGVKAKDIGILVVNCSLFNPTPSLSAMIVNHYKLRGSILSYNLGGMGCSAGLISIDLA  255

Query  860   RDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKY  1039
             + +L+ +PN YALVVS E ++  WY GN RSML+PNC FR G +AVLLSN+ RD   +KY
Sbjct  256   KQLLQVHPNSYALVVSMENITLNWYFGNDRSMLVPNCLFRMGGAAVLLSNKPRDRLRSKY  315

Query  1040  RLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPL  1219
             +L H VRTH+GA ++++  ++QEED  +  G+ +SKDL+ V GEALK NITTLGPLVLP+
Sbjct  316   QLVHTVRTHKGAGNKSYGCVFQEEDDTKQVGVSLSKDLMAVAGEALKTNITTLGPLVLPM  375

Query  1220  TEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEA  1399
             +EQL FF TL+ RK+F  K KPYIPD+ +AFEHFCI+A  + +LDEL++NL LS+ +ME 
Sbjct  376   SEQLLFFGTLVARKIFKMKIKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLDLSDWHMEP  435

Query  1400  SRATLHRFGNT  1432
             SR TL+RFGNT
Sbjct  436   SRMTLNRFGNT  446



>gb|AHX25587.1| 3-ketoacyl-CoA synthase 11 [Nicotiana tabacum]
Length=512

 Score =   430 bits (1105),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 221/447 (49%), Positives = 315/447 (70%), Gaps = 12/447 (3%)
 Frame = +2

Query  95    EPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVE  274
             +P  P   A ++S    R  PDF QSVKLKYVKLGY+Y+I + + L  +  ++     + 
Sbjct  5     KPEAPVNNAPSYS----RNFPDFKQSVKLKYVKLGYHYLITHGMYLFLSPLVVLTAAQLS  60

Query  275   VGSVMRGEKVWGKIWENSGGPDFGVVNMSLLG-LLGFTLSIYFMSKPMPIYLVDFACCKP  451
               S+     +W ++        F ++++ +   LL F  ++YF ++P P+YLVDF+C KP
Sbjct  61    TFSLNDLYVLWDQL-------RFNLISVVICSTLLVFLSTLYFFTRPRPVYLVDFSCYKP  113

Query  452   SDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNI  631
              D  K T++ F+D+++  GTF  +NLE+ ++++E SG+GD TY+P+++        +   
Sbjct  114   IDARKCTRENFLDMSKSVGTFSNENLEFQRKIVERSGLGDLTYLPEAVTQVPPNPCMAEA  173

Query  632   RGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTN  811
             R EA  ++F AID++L KT ++ +DIGILVVNC+ FNPTPSLSAMIINHYK + NI+S N
Sbjct  174   RKEAEAVMFGAIDELLAKTSVKPKDIGILVVNCSLFNPTPSLSAMIINHYKFRGNIISYN  233

Query  812   LGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCS  991
             LGGMGCSAG+I++DLA+D+L+  PN YALV+S E ++  WY GN +SML+PNC FR G +
Sbjct  234   LGGMGCSAGLISIDLAKDLLQVQPNTYALVLSMENITLNWYFGNEKSMLLPNCLFRMGGA  293

Query  992   AVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGE  1171
             AVLLSN+R D R +KY+L H VRTH+G+ D+ F  +YQ ED  R  G+ +SK+L+ V G+
Sbjct  294   AVLLSNKRSDRRRSKYQLVHTVRTHKGSDDKCFTCVYQMEDSNREVGVSLSKELMSVAGD  353

Query  1172  ALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLL  1351
             ALK NITTLGPLVLP++EQL FF TL+ RKL   K KPYIPD+ +AFEHFCI+A  + +L
Sbjct  354   ALKTNITTLGPLVLPMSEQLLFFATLVGRKLLKMKIKPYIPDFRLAFEHFCIHAGGRAVL  413

Query  1352  DELKRNLRLSEQNMEASRATLHRFGNT  1432
             DE+++NL+L++ +ME SR TL+R GNT
Sbjct  414   DEIEKNLQLTDWHMEPSRMTLYRLGNT  440



>ref|XP_003606927.1| 3-ketoacyl-CoA synthase [Medicago truncatula]
 gb|AES89124.1| 3-ketoacyl-CoA synthase [Medicago truncatula]
Length=504

 Score =   429 bits (1104),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 221/433 (51%), Positives = 313/433 (72%), Gaps = 6/433 (1%)
 Frame = +2

Query  134   VRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGK  313
             +   RRLPDF+QSV LKYVKLGY+Y+I + L L   +PL++V+  ++V  +   E    +
Sbjct  11    IHTNRRLPDFLQSVNLKYVKLGYHYLITHLLTLC-LIPLMSVII-IQVSQMNPNEI--HQ  66

Query  314   IWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDI  493
             +W +       ++  S   +L F  ++Y M++P  IYL+DF+C KP  +L V   +FI  
Sbjct  67    LWLHLKYNLVSIITCS--AILVFGSTVYIMTRPRSIYLIDFSCYKPPSNLAVKFTKFIQH  124

Query  494   ARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDK  673
             ++  G FDE +LE+ +++LE SG+G++TY+P+++        + + R EA Q+++ A+D 
Sbjct  125   SKLKGDFDESSLEFQRKILERSGLGEDTYLPEAMHKIPPTPCMASAREEAEQVMYGALDN  184

Query  674   VLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALD  853
             +   T+I+ +DIGILVVNC+ FNPTPSLSAMI+N YK++ NI S NLGGMGCSAG+IA+D
Sbjct  185   LFANTKIKPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAID  244

Query  854   LARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHA  1033
             LA+D+L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR G +AVLLSN+  D   A
Sbjct  245   LAKDMLQVHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGAAVLLSNKGCDRSRA  304

Query  1034  KYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVL  1213
             KY+L H+VRTH+GA D+AF+ +YQE+D     G+ +SKDL+ + G ALK NITTLGPLVL
Sbjct  305   KYKLVHVVRTHKGADDKAFKCVYQEQDDVGKTGVSLSKDLMAIAGGALKTNITTLGPLVL  364

Query  1214  PLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNM  1393
             P++EQL FF TL+ +K F AKTKPYIPD+ +AFEHFCI+A  + ++DEL++NL+L   ++
Sbjct  365   PVSEQLLFFTTLVIKKWFNAKTKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLMPDHV  424

Query  1394  EASRATLHRFGNT  1432
             EASR TLHRFGNT
Sbjct  425   EASRMTLHRFGNT  437



>ref|XP_009364915.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Pyrus x bretschneideri]
Length=516

 Score =   430 bits (1105),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 220/450 (49%), Positives = 320/450 (71%), Gaps = 12/450 (3%)
 Frame = +2

Query  92    IEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGV  271
             + P+    G +   +   RRLPDF+QSV LKYVKLGY+Y+I+N L L   +PL+ V   +
Sbjct  9     VAPAPGGDGQVGVQIHQNRRLPDFLQSVNLKYVKLGYHYLISNLLTLC-FIPLIIVTL-I  66

Query  272   EVGS--VMRGEKVWGKIWENSGGPDFGVVNMSLL-GLLGFTLSIYFMSKPMPIYLVDFAC  442
             E     +   +++W  +        + +V++ +   +L F L++Y M++P P+YLVD+AC
Sbjct  67    EASQMDIYDIQQLWLHL-------QYNLVSVIICSAVLVFGLTVYIMTRPRPVYLVDYAC  119

Query  443   CKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKL  622
              +P D LK    +F++ +R +  FD+ +LE+ +++LE SG+G+ETY+P+++        +
Sbjct  120   YRPPDHLKAPYQRFMEHSRLTQDFDDSSLEFQRKILERSGLGEETYVPEAMHYIPPRPSM  179

Query  623   NNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIV  802
                R EA Q+++ A+D +   T ++ +DIGILVVNC+ FNPTPSLSAMI+N YK++ NI 
Sbjct  180   AAARDEAEQVMYGALDNLFANTHVKPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIR  239

Query  803   STNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRT  982
             S NLGGMGCSAG+IA+DLA+D+L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR 
Sbjct  240   SFNLGGMGCSAGVIAVDLAKDLLQIHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRV  299

Query  983   GCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEV  1162
             G SAVLLSN+  D R AKY+L H+VRTH+GA D+AFR +YQE+D +   G+ +SKDL+ +
Sbjct  300   GGSAVLLSNKSVDRRRAKYKLVHVVRTHRGADDKAFRCVYQEQDDKGKTGVSLSKDLMAI  359

Query  1163  GGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASK  1342
              G ALK NITTLGP+VLP++EQL FF +++  KLF +  KPYIPD+ +AF+HFCI+A  +
Sbjct  360   AGGALKTNITTLGPIVLPISEQLLFFSSIVVNKLFKSNVKPYIPDFKLAFDHFCIHAGGR  419

Query  1343  MLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
              ++DEL++NL+L   ++EASR TLHRFGNT
Sbjct  420   AVIDELEKNLQLLPIHVEASRMTLHRFGNT  449



>ref|XP_006847589.1| hypothetical protein AMTR_s00014p00234760 [Amborella trichopoda]
 gb|ERN09170.1| hypothetical protein AMTR_s00014p00234760 [Amborella trichopoda]
Length=512

 Score =   430 bits (1105),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 201/355 (57%), Positives = 266/355 (75%), Gaps = 0/355 (0%)
 Frame = +2

Query  368   GLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRM  547
               L F  ++Y M++P PIYLVD+AC KP   LKV   QF++ ++ SG FDE  LE+ +++
Sbjct  86    AFLVFGSTVYIMTRPRPIYLVDYACYKPPSHLKVAFAQFMEHSKLSGKFDEPALEFQRKI  145

Query  548   LESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVN  727
             LE SG+G+ETY P ++        +   R EA Q++F A+DK+   TRIR +D+GIL+VN
Sbjct  146   LERSGLGEETYFPDAMHQLPPRLSMAAAREEAEQVMFGALDKLFSNTRIRPKDVGILIVN  205

Query  728   CNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVS  907
             C+ FNPTPSLSAMI+N YK++ NI S NLGGMGCSAG+IA+DLA+D+L+ + + YA+VVS
Sbjct  206   CSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAIDLAKDLLQVHGSTYAVVVS  265

Query  908   TEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRA  1087
             TE ++  WY GN RSMLIPNC FR G SAVLLSN+  D R +KY L H+VRTH+GA D+A
Sbjct  266   TENITQNWYFGNKRSMLIPNCLFRVGGSAVLLSNKSSDKRRSKYELVHVVRTHKGADDKA  325

Query  1088  FRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLF  1267
             FR +YQE+D     G+ +SKDL+ + G ALK NITTLGPLVLP++EQL FF TL+ +KL 
Sbjct  326   FRCVYQEQDETGKPGVSLSKDLMAIAGGALKTNITTLGPLVLPVSEQLLFFATLVAKKLL  385

Query  1268  GAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
              AK KPYIPD+ +AFEHFCI+A  + ++DEL++NL+L   ++EASR TLHRFGNT
Sbjct  386   NAKIKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLLPGHVEASRMTLHRFGNT  440



>ref|XP_008357196.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Malus domestica]
Length=516

 Score =   430 bits (1105),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 219/432 (51%), Positives = 315/432 (73%), Gaps = 12/432 (3%)
 Frame = +2

Query  146   RRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGS--VMRGEKVWGKIW  319
             RRLPDF+QSV LKYVKLGY+Y+I+N L L   +PL+ V   +E     +   +++W  + 
Sbjct  27    RRLPDFLQSVNLKYVKLGYHYLISNLLTLC-FIPLIIVTL-IEASQMDIYDIQQLWLHL-  83

Query  320   ENSGGPDFGVVNMSLL-GLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIA  496
                    + +V++ +   +L F L++Y M++P P+YLVD+AC +P D LK    +F++ +
Sbjct  84    ------QYNLVSVIICSAVLVFGLTVYIMTRPRPVYLVDYACYRPPDHLKAPYQRFMEHS  137

Query  497   RKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKV  676
             R +  FD+ +LE+ +++LE SG+G+ETY+P+++        +   R EA Q+++ A+D +
Sbjct  138   RLTQDFDDSSLEFQRKILERSGLGEETYVPEAMHYIPPRPSMAAAREEAEQVMYGALDNL  197

Query  677   LEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDL  856
                T ++ +DIGILVVNC+ FNPTPSLSAMI+N YK++ NI S NLGGMGCSAG+IA+DL
Sbjct  198   FANTHVKPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDL  257

Query  857   ARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAK  1036
             A+D+L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR G SAVLLSN+  D R AK
Sbjct  258   AKDLLQIHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSVDRRRAK  317

Query  1037  YRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLP  1216
             Y+L H+VRTH+GA D+AFR +YQE+D +   G+ +SKDL+ + G ALK NITTLGP+VLP
Sbjct  318   YKLVHVVRTHRGADDKAFRCVYQEQDDKGKTGVSLSKDLMAIAGGALKTNITTLGPIVLP  377

Query  1217  LTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNME  1396
             ++EQL FF +L+ +KLF +  KPYIPD+ +AF+HFCI+A  + ++DEL++NL+L   ++E
Sbjct  378   ISEQLLFFSSLVVKKLFKSNVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPXHVE  437

Query  1397  ASRATLHRFGNT  1432
             ASR TLHRFGNT
Sbjct  438   ASRMTLHRFGNT  449



>ref|XP_009149432.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Brassica rapa]
Length=506

 Score =   429 bits (1104),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 227/449 (51%), Positives = 315/449 (70%), Gaps = 12/449 (3%)
 Frame = +2

Query  92    IEPSGPDA-GALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFG  268
             ++ +G D  G++   +R  RRLPD++QSV LKYVKLGY+YVI+N L L      + +   
Sbjct  1     MDGAGDDGNGSVGVQIRQTRRLPDYLQSVNLKYVKLGYHYVISNLLTLCLLPLAVVI---  57

Query  269   VEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCK  448
                 SV         +W +       ++  S   +L F L++Y M++P P+YLVDF+C  
Sbjct  58    ----SVQASHDDLRHLWLHLQYNLVSIITCS--AILVFGLTVYVMTRPRPVYLVDFSCYL  111

Query  449   PSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIG-CPEKIKKLN  625
             P D LK    +F+  +R +G FD+  LE+ +++L+ SG+G++TY+P+ +   P +I  + 
Sbjct  112   PPDHLKAPFSRFMAHSRLTGDFDDSALEFQRKILQRSGLGEDTYVPEGMHHVPPRIS-MA  170

Query  626   NIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVS  805
               R EA Q++F A+D + E T I  +DIGILVVNC+ FNPTPSLSAMI+N YK++ NI S
Sbjct  171   AAREEAEQVMFGALDSLFENTNINPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRS  230

Query  806   TNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTG  985
              NLGGMGCSAG+IA+DLA+D+L  +   YA+VVSTE ++  WY GN+++MLIPNC FR G
Sbjct  231   YNLGGMGCSAGVIAVDLAKDMLLVHRKTYAVVVSTENITQNWYFGNNKAMLIPNCLFRVG  290

Query  986   CSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVG  1165
              SAVLLSN+  D R +KYRL H+VRTH+GA D+AFR +YQE+D     G+ +SKDL+ + 
Sbjct  291   GSAVLLSNKSSDKRRSKYRLSHVVRTHRGADDKAFRCVYQEQDDTGRTGVSLSKDLMAIA  350

Query  1166  GEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKM  1345
             GE LK NITTLGPLVLP++EQ+ FF TL+ +KLF  K KPYIPD+ +AFEHFCI+A  + 
Sbjct  351   GETLKTNITTLGPLVLPISEQILFFTTLVVKKLFNGKVKPYIPDFKLAFEHFCIHAGGRA  410

Query  1346  LLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             ++DEL++NL+LS  ++EASR TLHRFGNT
Sbjct  411   VIDELEKNLQLSPVHVEASRMTLHRFGNT  439



>ref|XP_007013326.1| 3-ketoacyl-CoA synthase [Theobroma cacao]
 gb|EOY30945.1| 3-ketoacyl-CoA synthase [Theobroma cacao]
Length=514

 Score =   429 bits (1104),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 220/430 (51%), Positives = 309/430 (72%), Gaps = 8/430 (2%)
 Frame = +2

Query  146   RRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWEN  325
             R LPDF +SVKLKYVKLGY+Y+I + + L  +  ++ +   +   S+     +W  +   
Sbjct  20    RNLPDFKKSVKLKYVKLGYHYLITHGMYLFLSPLVVVIAAQLSTFSIQDLYDLWEHL---  76

Query  326   SGGPDFGVVNMSLLG-LLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARK  502
                  + ++++ +   LL F  ++YF+++P P+YLV+FAC KP +  K TK  F+D +R 
Sbjct  77    ----QYNLISVIICSTLLVFLSTLYFLTRPRPVYLVNFACYKPEESRKCTKRIFMDQSRM  132

Query  503   SGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLE  682
             +GTF E+NLE+ +++LE SG+GD TY+P+++        +   R EA  ++F AID++L 
Sbjct  133   TGTFTEENLEFQRKILERSGLGDSTYLPEAVLNIPPNPSMQEARKEAEAVMFGAIDELLA  192

Query  683   KTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLAR  862
             KT ++ +DIGILVVNC+ FNPTPSLSAM+INHYK++ NI S NLGGMGCSAG+I++DLA+
Sbjct  193   KTAVKPKDIGILVVNCSLFNPTPSLSAMVINHYKLRGNIQSYNLGGMGCSAGLISIDLAK  252

Query  863   DILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYR  1042
             ++L+ +PN YALV+S E ++  WY GN RS L+ NC FR G +A+LLSN+R D R +KY 
Sbjct  253   NLLQVHPNSYALVISMENITLNWYFGNDRSKLVSNCLFRMGGAAILLSNKRSDRRRSKYE  312

Query  1043  LQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLT  1222
             L H VRTH+GA D+ F  + QEED     G+ +SKDL+ V G+ALK NITTLGPLVLP++
Sbjct  313   LVHTVRTHKGADDKCFSCVTQEEDSAGKVGVTLSKDLMAVAGDALKTNITTLGPLVLPMS  372

Query  1223  EQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEAS  1402
             EQL FF TL+ +KLF  K KPYIPD+ +AFEHFCI+A  + +LDEL++NL+LSE +ME S
Sbjct  373   EQLLFFGTLVGKKLFKMKVKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLQLSEWHMEPS  432

Query  1403  RATLHRFGNT  1432
             R TL+RFGNT
Sbjct  433   RMTLYRFGNT  442



>ref|XP_006475774.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Citrus sinensis]
 gb|KDO80367.1| hypothetical protein CISIN_1g008975mg [Citrus sinensis]
Length=512

 Score =   429 bits (1104),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 225/429 (52%), Positives = 310/429 (72%), Gaps = 6/429 (1%)
 Frame = +2

Query  146   RRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWEN  325
             R LPDF +SVKLKYVKLGY+Y+I + + L  + PL+ +V      S    + ++  +WE+
Sbjct  18    RNLPDFKKSVKLKYVKLGYHYLITHGMFLFLS-PLVVIV--AAQLSTFSFQDLY-DLWEH  73

Query  326   SGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKS  505
                    V+  S   LL F L++YF+++P P+YLVDF+C KP +  K TK  F+D +R +
Sbjct  74    LQYNLISVIICS--TLLVFLLTLYFLTRPRPVYLVDFSCYKPEESRKCTKRIFMDQSRMT  131

Query  506   GTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEK  685
             GTF E+NL++ K++LE SG+GD TY+P+++        +   R EA  ++F AID++  K
Sbjct  132   GTFTEENLQFQKKILERSGLGDSTYLPEAVLNIPPNPSMKEARKEAEAVMFGAIDELFAK  191

Query  686   TRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARD  865
             T ++ +DIGIL+VNC+ FNPTPSLSAM+INHYK++ NI+S NLGGMGCSAG+I++DLA +
Sbjct  192   TSVKPKDIGILIVNCSLFNPTPSLSAMVINHYKLRGNIISYNLGGMGCSAGLISIDLANN  251

Query  866   ILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRL  1045
             +L+ +PN YALV+S E ++  WY GN RS L+ NC FR G +A+LLSNR  D R +KYRL
Sbjct  252   LLQVHPNSYALVISMENITLNWYFGNDRSKLVSNCLFRMGGAAILLSNRFSDRRRSKYRL  311

Query  1046  QHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTE  1225
              H VRTH+GA D  F  + QEED E   G+ +SK+L+ V G+ALK NITTLGPLVLP++E
Sbjct  312   VHTVRTHKGADDNCFACVTQEEDSEGKVGVTLSKNLMAVAGDALKTNITTLGPLVLPMSE  371

Query  1226  QLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASR  1405
             QL FF TL+ +KLF  K KPYIPD+ +AFEHFCI+A  + +LDEL++NL+LS+ +ME SR
Sbjct  372   QLLFFATLVGKKLFKMKIKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLQLSDWHMEPSR  431

Query  1406  ATLHRFGNT  1432
              TL+RFGNT
Sbjct  432   MTLYRFGNT  440



>ref|XP_002510394.1| acyltransferase, putative [Ricinus communis]
 gb|EEF52581.1| acyltransferase, putative [Ricinus communis]
Length=502

 Score =   429 bits (1103),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 222/431 (52%), Positives = 313/431 (73%), Gaps = 10/431 (2%)
 Frame = +2

Query  146   RRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGE--KVWGKIW  319
             RRLPDF+QSV LKYVKLGY+Y+I+N L L   +PL+ ++  +E   +   +   +W  + 
Sbjct  13    RRLPDFLQSVNLKYVKLGYHYLISNLLTLC-FIPLI-IITSIEASQMNLDDLRHLWLHLQ  70

Query  320   ENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIAR  499
              N      G++  S    L F L++Y M++P P+YLVD++C +  D LK    +F++ ++
Sbjct  71    YNL----VGIIICS--AFLVFGLTVYIMTRPRPVYLVDYSCYRAPDHLKAPFGRFMEHSK  124

Query  500   KSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVL  679
              +G FDE +LE+ +++LE SG+G++TY+P+++        +   R EA Q++F A+D + 
Sbjct  125   LTGDFDESSLEFQRKILERSGLGEDTYVPEAMHYIPPRPSMAAAREEAEQVMFGALDNLF  184

Query  680   EKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLA  859
               T +  ++IGILVVNC+ FNPTPSLSA+I+N YK++ NI S NLGGMGCSAG+IA+DLA
Sbjct  185   ANTNVNPKNIGILVVNCSLFNPTPSLSAIIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLA  244

Query  860   RDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKY  1039
             +D+L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR G +AVLLSNR  D R AKY
Sbjct  245   KDLLQVHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGAAVLLSNRSVDRRRAKY  304

Query  1040  RLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPL  1219
             +L H+VRTH+GA D+AFR +YQE+D     G+ +SKDL+ + GEALKANITTLGPLVLP+
Sbjct  305   KLVHVVRTHRGADDKAFRCVYQEQDDAGKTGVSLSKDLMAIAGEALKANITTLGPLVLPI  364

Query  1220  TEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEA  1399
             +EQL FF TL+ +KLF  K KPYIPD+ +AF+HFCI+A  + ++DEL++NL+L   ++EA
Sbjct  365   SEQLLFFATLVVKKLFNKKMKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHVEA  424

Query  1400  SRATLHRFGNT  1432
             SR TLHRFGNT
Sbjct  425   SRMTLHRFGNT  435



>ref|XP_006451014.1| hypothetical protein CICLE_v10007916mg [Citrus clementina]
 gb|ESR64254.1| hypothetical protein CICLE_v10007916mg [Citrus clementina]
Length=512

 Score =   429 bits (1103),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 198/354 (56%), Positives = 269/354 (76%), Gaps = 0/354 (0%)
 Frame = +2

Query  371   LLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRML  550
             LL F L++YF+++P P+YLVDF+C KP +  K TK  F+D +R +GTF E+NL++ K++L
Sbjct  87    LLVFLLTLYFLTRPRPVYLVDFSCYKPEESRKCTKRIFMDQSRMTGTFTEENLQFQKKIL  146

Query  551   ESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNC  730
             E SG+GD TY+P+++        +   R EA  ++F AID++  KT ++ +DIGIL+VNC
Sbjct  147   ERSGLGDSTYLPEAVLNIPPNPSMKEARKEAEAVMFGAIDELFAKTSVKPKDIGILIVNC  206

Query  731   NTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVST  910
             + FNPTPSLSAM+INHYK++ NI+S NLGGMGCSAG+I++DLA ++L+ +PN YALV+S 
Sbjct  207   SLFNPTPSLSAMVINHYKLRGNIISYNLGGMGCSAGLISIDLANNLLQVHPNSYALVISM  266

Query  911   EIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAF  1090
             E ++  WY GN RS L+ NC FR G +A+LLSNR  D R +KYRL H VRTH+GA D  F
Sbjct  267   ENITLNWYFGNDRSKLVSNCLFRMGGAAILLSNRFSDRRRSKYRLVHTVRTHKGADDNCF  326

Query  1091  RSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFG  1270
               + QEED E   G+ +SK+L+ V G+ALK NITTLGPLVLP++EQL FF TL+ +KLF 
Sbjct  327   ACVTQEEDSEGKVGVTLSKNLMAVAGDALKTNITTLGPLVLPMSEQLLFFATLVGKKLFK  386

Query  1271  AKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
              K KPYIPD+ +AFEHFCI+A  + +LDEL++NL+LS+ +ME SR TL+RFGNT
Sbjct  387   MKIKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLQLSDWHMEPSRMTLYRFGNT  440



>gb|ABS18382.1| 3-ketoacyl-CoA synthase [Eranthis hyemalis]
Length=514

 Score =   429 bits (1103),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 224/433 (52%), Positives = 315/433 (73%), Gaps = 6/433 (1%)
 Frame = +2

Query  134   VRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGK  313
             ++  RRLPDF+QSV LKYVKLGY+Y+I + L L     ++ +V  VE G+    E +  +
Sbjct  21    IKQSRRLPDFLQSVNLKYVKLGYHYLITHLLTLLLIPLMVVIV--VE-GAQTNPEDL-RQ  76

Query  314   IWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDI  493
             +W +       V+  S+  + G T  +Y M++P P+YLVD+AC +P   L+V  DQF++ 
Sbjct  77    LWIHLQYNLVSVIVCSVFLVFGST--VYIMTRPRPVYLVDYACYRPPSHLRVKYDQFMEH  134

Query  494   ARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDK  673
             +R +G FDE +LE+ +++LE SG+G+ETY+P+++ C      +   R EA Q+++ A+D 
Sbjct  135   SRLTGDFDESSLEFQRKILERSGLGEETYVPEAMHCIPPKPSMATAREEAEQVMYGALDN  194

Query  674   VLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALD  853
             +   T ++ +DIGILVVNC+ FNPTPSLSAMI+N YK++ NI S NLGGMGCSAG+IA+D
Sbjct  195   LFANTSVKPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSYNLGGMGCSAGVIAID  254

Query  854   LARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHA  1033
             LA+D+L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR G SAVLLSN+  + R A
Sbjct  255   LAKDLLQIHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSVERRRA  314

Query  1034  KYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVL  1213
             KYRL H+VRTH+G+ ++AFR +YQE+D     G+ +SKDL+ + G ALK NITTLGPLVL
Sbjct  315   KYRLVHVVRTHRGSDEKAFRCVYQEQDDAGKVGVTLSKDLMAIAGGALKTNITTLGPLVL  374

Query  1214  PLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNM  1393
             P++EQL FF TL+ +KLF  K KPYIPD+ +AF+HFCI+A  + ++DEL++NL+L   ++
Sbjct  375   PISEQLLFFSTLVIKKLFNTKIKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPLHV  434

Query  1394  EASRATLHRFGNT  1432
             EASR TLHRFGNT
Sbjct  435   EASRMTLHRFGNT  447



>gb|KDO80366.1| hypothetical protein CISIN_1g008975mg [Citrus sinensis]
Length=547

 Score =   430 bits (1106),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 225/429 (52%), Positives = 310/429 (72%), Gaps = 6/429 (1%)
 Frame = +2

Query  146   RRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWEN  325
             R LPDF +SVKLKYVKLGY+Y+I + + L  + PL+ +V      S    + ++  +WE+
Sbjct  53    RNLPDFKKSVKLKYVKLGYHYLITHGMFLFLS-PLVVIV--AAQLSTFSFQDLY-DLWEH  108

Query  326   SGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKS  505
                    V+  S   LL F L++YF+++P P+YLVDF+C KP +  K TK  F+D +R +
Sbjct  109   LQYNLISVIICS--TLLVFLLTLYFLTRPRPVYLVDFSCYKPEESRKCTKRIFMDQSRMT  166

Query  506   GTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEK  685
             GTF E+NL++ K++LE SG+GD TY+P+++        +   R EA  ++F AID++  K
Sbjct  167   GTFTEENLQFQKKILERSGLGDSTYLPEAVLNIPPNPSMKEARKEAEAVMFGAIDELFAK  226

Query  686   TRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARD  865
             T ++ +DIGIL+VNC+ FNPTPSLSAM+INHYK++ NI+S NLGGMGCSAG+I++DLA +
Sbjct  227   TSVKPKDIGILIVNCSLFNPTPSLSAMVINHYKLRGNIISYNLGGMGCSAGLISIDLANN  286

Query  866   ILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRL  1045
             +L+ +PN YALV+S E ++  WY GN RS L+ NC FR G +A+LLSNR  D R +KYRL
Sbjct  287   LLQVHPNSYALVISMENITLNWYFGNDRSKLVSNCLFRMGGAAILLSNRFSDRRRSKYRL  346

Query  1046  QHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTE  1225
              H VRTH+GA D  F  + QEED E   G+ +SK+L+ V G+ALK NITTLGPLVLP++E
Sbjct  347   VHTVRTHKGADDNCFACVTQEEDSEGKVGVTLSKNLMAVAGDALKTNITTLGPLVLPMSE  406

Query  1226  QLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASR  1405
             QL FF TL+ +KLF  K KPYIPD+ +AFEHFCI+A  + +LDEL++NL+LS+ +ME SR
Sbjct  407   QLLFFATLVGKKLFKMKIKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLQLSDWHMEPSR  466

Query  1406  ATLHRFGNT  1432
              TL+RFGNT
Sbjct  467   MTLYRFGNT  475



>ref|XP_004965965.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Setaria italica]
Length=521

 Score =   429 bits (1103),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 220/429 (51%), Positives = 315/429 (73%), Gaps = 6/429 (1%)
 Frame = +2

Query  146   RRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWEN  325
             +RLPDF QSV+LKYVKLGY+Y+I++ + L  + PL+ +V  V++ +V    +    +WE 
Sbjct  24    QRLPDFQQSVRLKYVKLGYHYLISHGMYLLLS-PLMALV-AVQLSTV--SPRDLADLWEQ  79

Query  326   SGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKS  505
                    VV  S   LL F  ++YF+++P P+YL+DFAC KP  + K T++ F+  ++ +
Sbjct  80    LRFNLLSVVACS--TLLVFLSTVYFLTRPRPVYLLDFACYKPEPERKCTRETFMHCSKLT  137

Query  506   GTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEK  685
             G+F ++NLE+ +++LE SG+G++TY+P ++        ++  R EA  ++F AID++LEK
Sbjct  138   GSFTDENLEFQRKILERSGLGEDTYLPPAVLRVPPNPCMDEARNEARAVMFGAIDQLLEK  197

Query  686   TRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARD  865
             T +R +DIG+LVVNC+ FNPTPSLSAM++NHYK++ NIVS NLGGMGCSAG++++DLA+D
Sbjct  198   TGVRPKDIGVLVVNCSLFNPTPSLSAMVVNHYKLRGNIVSYNLGGMGCSAGLLSIDLAKD  257

Query  866   ILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRL  1045
             +L+ +PN YALV+S E ++  WY GN+RSML+ NC FR G +A+LLSN+R D R +KY L
Sbjct  258   LLQVHPNSYALVISMENITLNWYFGNNRSMLVSNCLFRMGGAAILLSNKRSDRRRSKYEL  317

Query  1046  QHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTE  1225
              H VRTH+GA D+ F  + QEED     G+ +SKDL+ V G+ALK NITTLGPLVLPL+E
Sbjct  318   VHTVRTHKGADDKCFGCVTQEEDEIGKIGVSLSKDLMAVAGDALKTNITTLGPLVLPLSE  377

Query  1226  QLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASR  1405
             QL F  TL+ +K+   K KPYIPD+ +AFEHFCI+A  + +LDEL++NL L++ +ME SR
Sbjct  378   QLLFMATLVAKKVLKMKIKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLELTDWHMEPSR  437

Query  1406  ATLHRFGNT  1432
              TL+RFGNT
Sbjct  438   MTLYRFGNT  446



>ref|XP_004238271.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Solanum lycopersicum]
Length=517

 Score =   429 bits (1103),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 224/448 (50%), Positives = 320/448 (71%), Gaps = 13/448 (3%)
 Frame = +2

Query  89    GIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFG  268
             G EP G         ++  RRLPDF+QSV LKYVKLGY+Y+I++ L L   +P++ V+  
Sbjct  16    GGEPVG-------VQIQQSRRLPDFLQSVNLKYVKLGYHYLISHLLTLC-LIPVMAVIL-  66

Query  269   VEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCK  448
             +E  S M  + +  ++W +       V+  S   +L F  ++Y M++P P+YL+D++C K
Sbjct  67    IE-ASQMNPDDI-RQLWLHLQYNLVSVIICS--AVLVFGSTVYIMTRPRPVYLIDYSCYK  122

Query  449   PSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNN  628
               + LK   ++F+  +R +G FDE +LE+ +++LE SG+GDETY+P+++        +  
Sbjct  123   APEHLKAPYERFMQHSRLTGDFDESSLEFQRKILERSGLGDETYVPEAMHQLPPQPSMQA  182

Query  629   IRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVST  808
              R EA Q++F A+DK+   T ++ + IG+LVVNC+ FNPTPSLSAMI+N YK++ NI S 
Sbjct  183   AREEAEQVMFGALDKLFANTSVKPKKIGVLVVNCSLFNPTPSLSAMIVNKYKLRGNIRSF  242

Query  809   NLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGC  988
             NLGGMGCSAG+IA+DLA+D+L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR G 
Sbjct  243   NLGGMGCSAGVIAVDLAKDMLQVHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGG  302

Query  989   SAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGG  1168
             SAVLLSN+  D R AKY+L H+VRTH+GA D+AFR +YQE+D     G+ +SKDL+ + G
Sbjct  303   SAVLLSNKSVDRRRAKYKLVHVVRTHRGADDKAFRCVYQEQDDAGKTGVSLSKDLMAIAG  362

Query  1169  EALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKML  1348
              ALK NITTLGPLVLP++EQL FF +LI +K+F    KPYIPD+ +AF+HFCI+A  + +
Sbjct  363   GALKTNITTLGPLVLPISEQLLFFGSLIIKKIFNKHIKPYIPDFKLAFDHFCIHAGGRAV  422

Query  1349  LDELKRNLRLSEQNMEASRATLHRFGNT  1432
             +DEL++NL+L++ ++EASR TLHRFGNT
Sbjct  423   IDELEKNLQLTQVHVEASRMTLHRFGNT  450



>ref|XP_006451013.1| hypothetical protein CICLE_v10007916mg [Citrus clementina]
 gb|ESR64253.1| hypothetical protein CICLE_v10007916mg [Citrus clementina]
Length=547

 Score =   429 bits (1104),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 198/354 (56%), Positives = 269/354 (76%), Gaps = 0/354 (0%)
 Frame = +2

Query  371   LLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRML  550
             LL F L++YF+++P P+YLVDF+C KP +  K TK  F+D +R +GTF E+NL++ K++L
Sbjct  122   LLVFLLTLYFLTRPRPVYLVDFSCYKPEESRKCTKRIFMDQSRMTGTFTEENLQFQKKIL  181

Query  551   ESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNC  730
             E SG+GD TY+P+++        +   R EA  ++F AID++  KT ++ +DIGIL+VNC
Sbjct  182   ERSGLGDSTYLPEAVLNIPPNPSMKEARKEAEAVMFGAIDELFAKTSVKPKDIGILIVNC  241

Query  731   NTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVST  910
             + FNPTPSLSAM+INHYK++ NI+S NLGGMGCSAG+I++DLA ++L+ +PN YALV+S 
Sbjct  242   SLFNPTPSLSAMVINHYKLRGNIISYNLGGMGCSAGLISIDLANNLLQVHPNSYALVISM  301

Query  911   EIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAF  1090
             E ++  WY GN RS L+ NC FR G +A+LLSNR  D R +KYRL H VRTH+GA D  F
Sbjct  302   ENITLNWYFGNDRSKLVSNCLFRMGGAAILLSNRFSDRRRSKYRLVHTVRTHKGADDNCF  361

Query  1091  RSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFG  1270
               + QEED E   G+ +SK+L+ V G+ALK NITTLGPLVLP++EQL FF TL+ +KLF 
Sbjct  362   ACVTQEEDSEGKVGVTLSKNLMAVAGDALKTNITTLGPLVLPMSEQLLFFATLVGKKLFK  421

Query  1271  AKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
              K KPYIPD+ +AFEHFCI+A  + +LDEL++NL+LS+ +ME SR TL+RFGNT
Sbjct  422   MKIKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLQLSDWHMEPSRMTLYRFGNT  475



>ref|XP_007223150.1| hypothetical protein PRUPE_ppa004354mg [Prunus persica]
 gb|EMJ24349.1| hypothetical protein PRUPE_ppa004354mg [Prunus persica]
Length=515

 Score =   428 bits (1101),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 220/429 (51%), Positives = 307/429 (72%), Gaps = 8/429 (2%)
 Frame = +2

Query  149   RLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENS  328
             +LPDF QSVKLKYVKLGY+Y+I + + L  +   +  V  +   S+     +W  +    
Sbjct  22    KLPDFKQSVKLKYVKLGYHYLITHGMYLFLSPLFVLTVAQLSTFSLQDLHDLWDHL----  77

Query  329   GGPDFGVVNMSLLG-LLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKS  505
                 F ++++ L   LL F L++YF+++P P+YLVDF+C KP D  K  +  F+D +   
Sbjct  78    ---RFNLISVVLCSTLLVFLLTLYFLTRPRPVYLVDFSCYKPEDARKCPRQIFMDRSHFI  134

Query  506   GTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEK  685
             GTF  +NLE+ +++LE SG+G+ TY+P+++        +   R EA  ++F A+D++ EK
Sbjct  135   GTFTGENLEFQRKILERSGLGESTYLPEAVIQVPPNPCMAEARKEAEMVMFGALDQLFEK  194

Query  686   TRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARD  865
             T I+ +DIGIL+VNC+ FNPTPSLSAM+INHYK++ NI+S NLGGMGCSAG+I++DLA+D
Sbjct  195   TSIKPKDIGILIVNCSLFNPTPSLSAMVINHYKLRGNIISYNLGGMGCSAGLISIDLAKD  254

Query  866   ILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRL  1045
             +LR +PN YALV+S E ++  WY GN RSML+ NC FR G +A+LLSN   D R +KY+L
Sbjct  255   LLRVHPNTYALVISMENITLNWYFGNDRSMLVSNCLFRMGGAAILLSNNGSDRRRSKYQL  314

Query  1046  QHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTE  1225
              H VRTH+GA D+ F  + Q+ED     G+ +SKDL+ V G+ALK NITTLGPLVLP++E
Sbjct  315   VHTVRTHKGADDKCFSCVTQKEDFAGKIGVSLSKDLMAVAGDALKTNITTLGPLVLPMSE  374

Query  1226  QLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASR  1405
             QL FF TL+ RKLF  K KPYIPD+ +AFEHFCI+A  + +LDEL++NL+LS+++ME SR
Sbjct  375   QLLFFATLVGRKLFKMKVKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLQLSDRHMEPSR  434

Query  1406  ATLHRFGNT  1432
              TL+RFGNT
Sbjct  435   MTLYRFGNT  443



>ref|XP_002313793.1| hypothetical protein POPTR_0009s11940g [Populus trichocarpa]
 gb|EEE87748.1| hypothetical protein POPTR_0009s11940g [Populus trichocarpa]
Length=510

 Score =   428 bits (1100),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 220/435 (51%), Positives = 314/435 (72%), Gaps = 10/435 (2%)
 Frame = +2

Query  134   VRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLT-VVFGVEVGSVMRGEKVWG  310
             +R  RRLPDF+ SV LK+VKLGY+Y+I + L L   VPL+  V+F     +     ++W 
Sbjct  17    IRQSRRLPDFLHSVNLKHVKLGYHYLITHLLTLC-LVPLMAFVIFQAFQLNPNDIHQLWL  75

Query  311   KIWENSGGPDFGVVNMSLL-GLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFI  487
              +        + +V++ +    L F  ++Y M++P  ++LVD+AC KP  +L+V  +QF+
Sbjct  76    HL-------QYNLVSVIICSAFLVFGATVYIMTRPRSLFLVDYACYKPPSNLQVKFEQFM  128

Query  488   DIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAI  667
             + +  +G FD+ +LE+ +++LE SG+G+ETY+P+++        +   R EA Q++F A+
Sbjct  129   EHSSLTGDFDDSSLEFQRKILERSGLGEETYVPEAMHYIPPRPSMAAAREEAQQVMFGAL  188

Query  668   DKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIA  847
             D +   T I+ +DIGILVVNC+ FNPTPSLSAMI+N YK++ NI S NLGGMGCSAG+IA
Sbjct  189   DVLFANTNIKPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIA  248

Query  848   LDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYR  1027
             +DLA+D+L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR G SAVLLSN+ +D R
Sbjct  249   VDLAKDMLQVHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKAKDKR  308

Query  1028  HAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPL  1207
              AKY+L H+VRTH+GA D+AF+ +YQE+D     G+ +SK+L+ + G ALK NITTLGPL
Sbjct  309   RAKYKLVHVVRTHKGADDKAFKCVYQEQDDAGKTGVSLSKELMAIAGGALKTNITTLGPL  368

Query  1208  VLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQ  1387
             VLP++EQL FF TL+ +KLF AK KPYIPD+ +AF+HFCI+A  + ++DEL++NL+L   
Sbjct  369   VLPISEQLLFFSTLVAKKLFNAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPI  428

Query  1388  NMEASRATLHRFGNT  1432
             ++EASR TLHRFGNT
Sbjct  429   HVEASRMTLHRFGNT  443



>gb|AGK30005.1| 3-ketoacyl-CoA synthase [Gossypium raimondii]
Length=515

 Score =   428 bits (1101),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 221/434 (51%), Positives = 312/434 (72%), Gaps = 8/434 (2%)
 Frame = +2

Query  134   VRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGK  313
             ++  RRLPDF+QSV LKYVKLGY+Y+I+N L L     +  +   V   ++    ++W  
Sbjct  22    IQQSRRLPDFLQSVNLKYVKLGYHYLISNLLTLCFIPAIAALSIQVSQMNLDDLRQLWLH  81

Query  314   IWENSGGPDFGVVNMSLL-GLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFID  490
             +        + +V++ +   +L F L++Y M++P P+YLVD++C +P D LK    +F++
Sbjct  82    L-------QYNLVSIIICSAILVFGLTVYIMTRPRPVYLVDYSCYRPPDHLKAPYGRFLE  134

Query  491   IARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAID  670
              +R +G FDE +LE+ +++LE SG+G+ETY+PK++        +   R EA +++F A+D
Sbjct  135   HSRLTGDFDESSLEFQRKILERSGLGEETYVPKAMHSIPPTPSMAAAREEAEEVMFGALD  194

Query  671   KVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIAL  850
              +   T +  +DIGILVVNC+ FNPTPSLSAMI+N YK++ NI S NLGGMGCSAG+IA+
Sbjct  195   TLFRNTNVSPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAV  254

Query  851   DLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRH  1030
             DLA+D+L+ + N YA+VVSTE ++  WY GN++SMLIPNC FR G SAVLLSN+  D R 
Sbjct  255   DLAKDLLQVHRNTYAVVVSTENITQNWYFGNNKSMLIPNCLFRVGGSAVLLSNKSNDRRR  314

Query  1031  AKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLV  1210
             AKY+L H+VRTH+GA D+AFR +YQE+D     G+ +SKDL+ + G ALK NITTLGPLV
Sbjct  315   AKYKLIHVVRTHRGADDKAFRCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLV  374

Query  1211  LPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQN  1390
             LP++EQL FF TL  +KLF A  KPYIPD+ +AF+HFCI+A  + ++DEL++NL+L   +
Sbjct  375   LPISEQLLFFTTLAVKKLFNASVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPIH  434

Query  1391  MEASRATLHRFGNT  1432
             +EASR TLHRFGNT
Sbjct  435   VEASRMTLHRFGNT  448



>ref|XP_007204837.1| hypothetical protein PRUPE_ppa004269mg [Prunus persica]
 gb|EMJ06036.1| hypothetical protein PRUPE_ppa004269mg [Prunus persica]
Length=519

 Score =   428 bits (1101),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 222/429 (52%), Positives = 305/429 (71%), Gaps = 6/429 (1%)
 Frame = +2

Query  146   RRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWEN  325
             R LPDF  SVKLKYVKLGY+ +I + + L  +   L VV   ++ +    +     +WE+
Sbjct  25    RNLPDFKNSVKLKYVKLGYHILITHGMYLFLSP--LVVVIAAQISTFSLQDLY--DLWEH  80

Query  326   SGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKS  505
                    V+  S   LL F  ++YF+++P P+YLV+F+C KP +  K TK  F+D ++ +
Sbjct  81    LQYNLISVIICS--TLLVFLSTVYFLTRPRPVYLVNFSCYKPEESRKCTKKIFMDQSQMT  138

Query  506   GTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEK  685
             GTF E+NL++ +R+LE SG+GD TY+P+++        +   R EA  ++F AID++  K
Sbjct  139   GTFTEENLQFQRRILERSGLGDSTYLPEAVLNIPPNPSMKEARKEAEAVMFGAIDELFAK  198

Query  686   TRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARD  865
             T ++ +DIGIL+VNC+ FNPTPSLSAM+INHY+++ NIVS NLGGMGCSAG+I++DLA++
Sbjct  199   TAVKPKDIGILIVNCSLFNPTPSLSAMVINHYQLRGNIVSYNLGGMGCSAGLISIDLAKN  258

Query  866   ILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRL  1045
             +L+ +PN YALV+S E ++  WY GN RS L+ NC FR G +A+LLSN+  D R +KYRL
Sbjct  259   LLQVHPNSYALVISMENITLNWYFGNDRSKLVSNCLFRMGGAAILLSNKSSDRRRSKYRL  318

Query  1046  QHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTE  1225
              H VRTH+GA D+ F  + QEED     G+ +SKDL+ V G+ALK NITTLGPLVLP++E
Sbjct  319   VHTVRTHKGADDKCFSCVTQEEDSNGKIGVTLSKDLMAVAGDALKTNITTLGPLVLPMSE  378

Query  1226  QLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASR  1405
             QL FF TLI RKLF  K KPYIPD+ +AFEHFCI+A  + +LDEL++NL LS+ +ME SR
Sbjct  379   QLLFFATLIGRKLFKRKIKPYIPDFRLAFEHFCIHAGGRAVLDELEKNLHLSDWHMEPSR  438

Query  1406  ATLHRFGNT  1432
              TLHRFGNT
Sbjct  439   MTLHRFGNT  447



>ref|XP_009614092.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Nicotiana tomentosiformis]
Length=510

 Score =   428 bits (1100),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 217/432 (50%), Positives = 312/432 (72%), Gaps = 9/432 (2%)
 Frame = +2

Query  140   VRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIW  319
             + R+LPDF QSVKLKYVKLGY+Y+I + + L  +  ++     +   S+     +W ++ 
Sbjct  15    ISRKLPDFKQSVKLKYVKLGYHYLITHGMYLFLSPLVVLTAAQLSTFSLNDHYVLWDQL-  73

Query  320   ENSGGPDFGVVNMSLLG-LLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIA  496
                    F ++++ +   LL F  ++YF ++P P+YLVDF+C KP D  K T++ F+D++
Sbjct  74    ------RFNLISVVICSTLLVFLSTLYFFTRPRPVYLVDFSCYKPIDARKCTRENFLDMS  127

Query  497   RKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKV  676
             +  GTF  +NLE+ ++++E SG+GD TY+P+++        +   R EA  ++F AID++
Sbjct  128   KSVGTFSNENLEFQRKIVERSGLGDLTYLPEAVTQVPPNPCMAEARKEAEAVMFGAIDEL  187

Query  677   LEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDL  856
             L KT ++ +DIGILVVNC+ FNPTPSLSAMIINHYK + NI+S NLGGMGCSAG+I++DL
Sbjct  188   LAKTSVKPKDIGILVVNCSLFNPTPSLSAMIINHYKFRGNIISYNLGGMGCSAGLISIDL  247

Query  857   ARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAK  1036
             A+D+L+ +PN YALV+S E ++  WY GN +SML+PNC FR G +AVLLSN+R D R +K
Sbjct  248   AKDLLQVHPNTYALVLSMENITLNWYFGNEKSMLLPNCLFRMGGAAVLLSNKRSD-RRSK  306

Query  1037  YRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLP  1216
             Y+L H VRTH+G+ D+ F  +YQ ED +   G+ +SK+L+ V G+ALK NITTLGPLVLP
Sbjct  307   YQLVHTVRTHKGSDDKCFTCVYQMEDSDGKVGVSLSKELMAVAGDALKTNITTLGPLVLP  366

Query  1217  LTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNME  1396
             ++EQ  FF TL+ RK+   K +PYIPD+ +AFEHFCI+A  + +LDE+++NL+LS+ NME
Sbjct  367   MSEQFLFFATLVGRKILKMKIRPYIPDFKLAFEHFCIHAGGRAVLDEIEKNLQLSDWNME  426

Query  1397  ASRATLHRFGNT  1432
              SR TL+RFGNT
Sbjct  427   PSRMTLYRFGNT  438



>ref|XP_004170552.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Cucumis sativus]
Length=513

 Score =   428 bits (1100),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 222/447 (50%), Positives = 315/447 (70%), Gaps = 9/447 (2%)
 Frame = +2

Query  95    EPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVE  274
             EP  P    L+      R LPDF +SVKLKYVKLGY+Y+I + + L  +  ++ +   + 
Sbjct  3     EPK-PSTPLLSTKAPSSRSLPDFKKSVKLKYVKLGYHYLITHGMYLFLSPLVVVIAAQLS  61

Query  275   VGSVMRGEKVWGKIWENSGGPDFGVVNMSLLG-LLGFTLSIYFMSKPMPIYLVDFACCKP  451
               S+    +VWG +        + +V++ L   LL F  ++YF+++P P+YLV+F+C KP
Sbjct  62    TFSLQDLYEVWGHL-------QYNLVSVILCSTLLVFLSTLYFLTRPRPVYLVNFSCYKP  114

Query  452   SDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNI  631
              +  K TK  F+D +  +GTF E+NL++ +++LE SG+GD TY+P+++        +   
Sbjct  115   DESRKCTKKIFMDQSHMTGTFTEENLQFQRKILERSGLGDSTYLPEAVLNIPPNPCMAEA  174

Query  632   RGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTN  811
             R EA  ++F AID++L KT ++ +DIGIL+VNC+ FNPTPSLSAM+INHYK++ NI+S N
Sbjct  175   RKEAEMVMFGAIDELLAKTSVKPKDIGILIVNCSLFNPTPSLSAMVINHYKLRGNIISYN  234

Query  812   LGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCS  991
             LGGMGCSAG+I++DLA+ +L+ +PN YALV+S E ++  WY GN RS L+ NC FR G +
Sbjct  235   LGGMGCSAGLISIDLAKQLLQVHPNSYALVISMENITLNWYFGNDRSKLVSNCLFRMGGA  294

Query  992   AVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGE  1171
             A+LLSNR  + R +KY+L H VRTH+GA D+ F  + QEED     G+ +SKDL+ V G+
Sbjct  295   AILLSNRTSERRRSKYQLIHTVRTHKGADDKCFSCVTQEEDSTGNIGVTLSKDLMAVAGD  354

Query  1172  ALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLL  1351
             ALK NITTLGPLVLP++EQL FF TL+ +KLF  K KPYIPD+ +AFEHFCI+A  + +L
Sbjct  355   ALKTNITTLGPLVLPMSEQLLFFGTLVGKKLFKMKIKPYIPDFKLAFEHFCIHAGGRAVL  414

Query  1352  DELKRNLRLSEQNMEASRATLHRFGNT  1432
             DEL++NL+LS+ +ME SR TL+RFGNT
Sbjct  415   DELEKNLQLSDWHMEPSRMTLYRFGNT  441



>ref|XP_007154946.1| hypothetical protein PHAVU_003G160400g [Phaseolus vulgaris]
 gb|ESW26940.1| hypothetical protein PHAVU_003G160400g [Phaseolus vulgaris]
Length=510

 Score =   428 bits (1100),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 224/432 (52%), Positives = 309/432 (72%), Gaps = 12/432 (3%)
 Frame = +2

Query  146   RRLPDFVQSvklkyvklgyyyvINN--WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIW  319
             R LPDF +S+KLKYVKLGY+Y+I +  +LCL   V L+         S    +  +  IW
Sbjct  16    RSLPDFKKSIKLKYVKLGYHYLITHGMYLCLTPLVVLIAAQL-----STFSFQDFY-DIW  69

Query  320   ENSGGPDFGVVNMSLLG-LLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIA  496
             E+     + ++++ L   LL F  ++YF+++P P+YLVDF+C KP +  + TK  FID +
Sbjct  70    EHL---QYNLISVILCSTLLVFLSTLYFLTRPRPVYLVDFSCYKPEESRQCTKRTFIDHS  126

Query  497   RKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKV  676
             R +G+F E+NLE+ +++LE SG+G+ TY+P+++        +   R EA  ++F AID++
Sbjct  127   RLTGSFTEENLEFQRKILERSGLGETTYLPEAVLNIPPNPSMKEARKEAEAVMFGAIDEL  186

Query  677   LEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDL  856
             L KT ++ +DIGIL+VNC+ FNPTPSLSAMI+NHYK++ NI S NLGGMGCSAG+I++DL
Sbjct  187   LAKTSVKPKDIGILIVNCSLFNPTPSLSAMIVNHYKLRGNIRSYNLGGMGCSAGLISIDL  246

Query  857   ARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAK  1036
             A+D+L+ANPN YALV+S E ++  WY GN RS L+ NC FR G +AVLLSN+  D R +K
Sbjct  247   AKDLLQANPNSYALVISMENITLNWYFGNDRSKLVSNCLFRMGGAAVLLSNKSSDRRRSK  306

Query  1037  YRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLP  1216
             YRL   VRTH+GA D+ F  + QEED     G+ +SKDL+ V G+ALK NITTLGPLVLP
Sbjct  307   YRLVTTVRTHKGADDKCFSCVTQEEDANGKIGVTLSKDLMAVAGDALKTNITTLGPLVLP  366

Query  1217  LTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNME  1396
              +EQL FF TL+ +K+F  K KPYIPD+ +AFEHFCI+A  + +LDEL++NL+LS  +ME
Sbjct  367   TSEQLLFFATLVGKKIFKMKIKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLQLSTWHME  426

Query  1397  ASRATLHRFGNT  1432
              SR TL+RFGNT
Sbjct  427   PSRMTLYRFGNT  438



>ref|XP_010028602.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Eucalyptus grandis]
Length=513

 Score =   428 bits (1100),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 219/433 (51%), Positives = 311/433 (72%), Gaps = 6/433 (1%)
 Frame = +2

Query  134   VRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGK  313
             +   RRLPDF+QSV LKYVKLGY+Y++ ++L L   VP + V+  +   S M  E++  +
Sbjct  20    IHQSRRLPDFLQSVNLKYVKLGYHYLMTHFLTLL-LVPSMAVI--IVQASQMNPEEI-NQ  75

Query  314   IWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDI  493
             +W +       V+  S    L F  ++Y MS+P  +YLVD++C KP + L+V   QF++ 
Sbjct  76    LWLHLKYNLVSVIICS--AFLVFGSTVYIMSRPRSVYLVDYSCYKPPEHLQVKFHQFMEH  133

Query  494   ARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDK  673
             ++ +G FDE +LE+ +++L  SG+G+ETY+P+++        +   R E+ Q+++ A+D 
Sbjct  134   SKLTGDFDESSLEFQRKILARSGLGEETYVPEAMHYLPPRPSMAAAREESEQVMYGALDN  193

Query  674   VLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALD  853
             +   T ++ +DIGILVVNC+ FNPTPSLSAMI+N YK++ NI S NLGGMGCSAG+IA+D
Sbjct  194   LFANTNVKPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIKSFNLGGMGCSAGVIAVD  253

Query  854   LARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHA  1033
             LA+D+L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR G +AVLLSN+  D R A
Sbjct  254   LAKDMLQVHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGAAVLLSNKSSDRRRA  313

Query  1034  KYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVL  1213
             KY+L H+VRTH+GA D+AFR +YQE+D     G+ +SKDL+ + G ALK NITTLGPLVL
Sbjct  314   KYKLVHVVRTHRGADDKAFRCVYQEQDDVGKTGVSLSKDLMAIAGGALKTNITTLGPLVL  373

Query  1214  PLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNM  1393
             P++EQL FF TL+ +K F AK KPYIPD+ +AF+HFCI+A  + ++DEL++NL+L   ++
Sbjct  374   PISEQLLFFATLVAKKFFNAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPSHV  433

Query  1394  EASRATLHRFGNT  1432
             EASR  LHRFGNT
Sbjct  434   EASRMALHRFGNT  446



>gb|EYU34550.1| hypothetical protein MIMGU_mgv1a004667mg [Erythranthe guttata]
Length=516

 Score =   428 bits (1100),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 227/452 (50%), Positives = 320/452 (71%), Gaps = 16/452 (4%)
 Frame = +2

Query  83    NRGIEPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVV  262
             +R IEP        T  + V R+LP+F+QS++LKYVKLGY+Y+I+N + L   +PLL + 
Sbjct  6     DRKIEPE-------TGRISVERKLPNFLQSIRLKYVKLGYHYLISNAMYLL-LIPLLAIS  57

Query  263   FGVEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLG-FTLSIYFMSKPMPIYLVDFA  439
                 V       +    +W+      F +V++ +   L  F  ++YFM++P  IYLVDFA
Sbjct  58    ---SVHLSTLTTQDLTLLWDQL---KFNLVSVLVCSTLTVFLCTLYFMTRPRKIYLVDFA  111

Query  440   CCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKK  619
             C KP  D+  +K+ F++ +R++G F  +NLE+ K++LE SG+G +TY P+++        
Sbjct  112   CYKPKPDVMCSKEMFMEKSRQTGIFTAENLEFQKKILERSGLGQKTYFPEALMRVPAEPN  171

Query  620   LNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNI  799
             +   R EA  ++F AID +L KT ++A+DIGILVVNC+ FNPTPSLSAM++NHYK++ NI
Sbjct  172   MAEARKEAELVMFGAIDDLLAKTGVKAKDIGILVVNCSLFNPTPSLSAMVVNHYKLRGNI  231

Query  800   VSTNLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFR  979
             +S NLGGMGCSAG+I++DLA+ +L+  PN  ALVVS E ++  WY GN+RSML+ NC FR
Sbjct  232   LSYNLGGMGCSAGLISIDLAKQLLQVQPNSLALVVSMENITLNWYFGNNRSMLVSNCIFR  291

Query  980   TGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVE  1159
              G +A+LLSN+  D R +KY+L H VRTH+GA D+++  ++QEED  +  G+ +SKDL+ 
Sbjct  292   MGGAAILLSNKPSDKRRSKYQLIHTVRTHRGADDKSYTCVFQEEDDTKQVGVALSKDLMA  351

Query  1160  VGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKT-KPYIPDYTIAFEHFCINAA  1336
             V GEALK NITTLGPLVLP++EQL FF TL+ RK+F  KT KPYIPD+ +AFEHFCI+A 
Sbjct  352   VAGEALKTNITTLGPLVLPMSEQLLFFVTLVARKVFKMKTIKPYIPDFKLAFEHFCIHAG  411

Query  1337  SKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
              + +LDEL++NL LSE +ME SR TL+R+GNT
Sbjct  412   GRAVLDELEKNLELSEWHMEPSRMTLYRYGNT  443



>emb|CDO99138.1| unnamed protein product [Coffea canephora]
Length=521

 Score =   428 bits (1100),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 229/445 (51%), Positives = 323/445 (73%), Gaps = 11/445 (2%)
 Frame = +2

Query  110   DAGALTFSVRVRRR---LPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVG  280
             D G ++     RR+   LP+F+ SV+LKYVKLGY+Y+I++ + L   +PLL VV  V + 
Sbjct  10    DTGRISVEGENRRKNNNLPNFLLSVRLKYVKLGYHYLISHAMYLM-VIPLLGVV-SVHLS  67

Query  281   SVMRGEKVWGKIWENSGGPDFGVVNMSLL-GLLGFTLSIYFMSKPMPIYLVDFACCKPSD  457
             +V   + V   +WE      F +V++ L   L+ F  ++YFM++P  +YLVDFAC KP  
Sbjct  68    TVTVEDLVL--LWEQL---RFNLVSVILCSALMVFLGTLYFMTRPRKVYLVDFACYKPGP  122

Query  458   DLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRG  637
             ++   K+ F++ ++++GTF E+NL + K++LE SG+G++TY P+++        +   R 
Sbjct  123   EVMCPKELFMERSKQAGTFSEENLAFQKKILERSGLGEKTYFPEALLQLPANPCMAEARK  182

Query  638   EASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLG  817
             EA  ++F AID++L KT ++A+DIGILVVNC+ F PTPSLSAMI+NHYK++ NI+S NLG
Sbjct  183   EAEMVMFGAIDQLLAKTGVKAKDIGILVVNCSLFCPTPSLSAMIVNHYKLRGNILSYNLG  242

Query  818   GMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAV  997
             GMGCSAG+I++DLA+ +L+  PN YALVVS E ++  WY GN+RSML+ NC FR G +A+
Sbjct  243   GMGCSAGLISIDLAKQLLQVQPNSYALVVSMENITLNWYFGNNRSMLVSNCIFRMGGAAI  302

Query  998   LLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEAL  1177
             LLSN+  D R +KY+L H VRTH+GA DR++  ++QEED  +  G+ +SKDL+ V GEAL
Sbjct  303   LLSNKSSDRRRSKYQLIHTVRTHKGADDRSYGCVFQEEDENKKVGVALSKDLMAVAGEAL  362

Query  1178  KANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDE  1357
             K NITTLGPLVLP++EQL FF TL+ RK+F  K KPYIPD+ +AF+HFCI+A  + +LDE
Sbjct  363   KTNITTLGPLVLPMSEQLLFFITLVGRKVFNMKIKPYIPDFKLAFDHFCIHAGGRAVLDE  422

Query  1358  LKRNLRLSEQNMEASRATLHRFGNT  1432
             L+RNL LSE +ME SR TL+RFGNT
Sbjct  423   LERNLDLSEWHMEPSRMTLYRFGNT  447



>ref|XP_008388058.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Malus domestica]
Length=516

 Score =   427 bits (1099),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 218/432 (50%), Positives = 314/432 (73%), Gaps = 12/432 (3%)
 Frame = +2

Query  146   RRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGS--VMRGEKVWGKIW  319
             RRLPDF+QSV LKYVKLGY+Y+I+N L L   +PL+ V   +E     +   +++W  + 
Sbjct  27    RRLPDFLQSVNLKYVKLGYHYLISNLLTLC-FIPLIIVTL-IEASQMDIHDIQQLWLHL-  83

Query  320   ENSGGPDFGVVNMSLL-GLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIA  496
                    + +V++ +   +L F L++Y M++P P+YLVD+AC +P D LK    +F++ +
Sbjct  84    ------QYNLVSVIICSAVLVFGLTVYIMTRPRPVYLVDYACYRPPDHLKAPYQRFMEHS  137

Query  497   RKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKV  676
             R +  FD+ +LE+ +++LE SG+G+ETY+P+++        +   R EA Q+++ A+D +
Sbjct  138   RLTQDFDDSSLEFQRKILERSGLGEETYVPEAMHYIPPRPSMAAARDEAEQVMYGALDNL  197

Query  677   LEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDL  856
                T ++ +DIGILVVNC+ FNPTPSLSAMI+N YK++ NI S NLGGMGCSAG+IA+DL
Sbjct  198   FANTHVKPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDL  257

Query  857   ARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAK  1036
             A+D+L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR G SAVLLSN+  D R AK
Sbjct  258   AKDLLQIHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSVDRRRAK  317

Query  1037  YRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLP  1216
             Y+L H+VRTH+GA D+AFR +YQE+D +   G+ +SKDL+ + G ALK NITTLGP+VLP
Sbjct  318   YKLVHVVRTHRGADDKAFRCVYQEQDEKGKTGVSLSKDLMAIAGGALKTNITTLGPIVLP  377

Query  1217  LTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNME  1396
             ++EQL FF +++  KLF +  KPYIPD+ +AF+HFCI+A  + ++DEL++NL+L   ++E
Sbjct  378   ISEQLLFFSSIVVNKLFKSNVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPIHVE  437

Query  1397  ASRATLHRFGNT  1432
             ASR TLHRFGNT
Sbjct  438   ASRMTLHRFGNT  449



>ref|XP_009365554.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Pyrus x bretschneideri]
Length=516

 Score =   427 bits (1099),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 218/432 (50%), Positives = 315/432 (73%), Gaps = 12/432 (3%)
 Frame = +2

Query  146   RRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGS--VMRGEKVWGKIW  319
             RRLPDF+QSV LKYVKLGY+Y+I+N L L   +PL+ V   +E     +   +++W  + 
Sbjct  27    RRLPDFLQSVNLKYVKLGYHYLISNILTLC-FIPLIIVTL-IEASQMDIYDIQQLWLHL-  83

Query  320   ENSGGPDFGVVNMSLL-GLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIA  496
                    + +V++ +   +L F L++Y +++P P+YLVD+AC +P D LK    +F++ +
Sbjct  84    ------QYNLVSVIICSAVLVFGLTVYIVTRPRPVYLVDYACYRPPDHLKAPYQRFMEHS  137

Query  497   RKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKV  676
             R +  FD+ +LE+ +++LE SG+G+ETY+P+++        +   R EA Q+++ A+D +
Sbjct  138   RLTQDFDDSSLEFQRKILERSGLGEETYVPEAMHYIPPRPSMAAAREEAEQVMYGALDNL  197

Query  677   LEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDL  856
                T ++ +DIGILVVNC+ FNPTPSLSAMI+N YK++ NI S NLGGMGCSAG+IA+DL
Sbjct  198   FANTHVKPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDL  257

Query  857   ARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAK  1036
             A+D+L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR G SAVLLSN+  D R AK
Sbjct  258   AKDLLQIHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSVDRRRAK  317

Query  1037  YRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLP  1216
             Y+L H+VRTH+GA D+AFR +YQE+D +   G+ +SKDL+ + G ALK NITTLGP+VLP
Sbjct  318   YKLVHVVRTHRGADDKAFRCVYQEQDDKGKTGVSLSKDLMAIAGGALKTNITTLGPIVLP  377

Query  1217  LTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNME  1396
             ++EQL FF +L+ +KLF +  KPYIPD+ +AF+HFCI+A  + ++DEL++NL+L   ++E
Sbjct  378   ISEQLLFFSSLVVKKLFNSNVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPIHVE  437

Query  1397  ASRATLHRFGNT  1432
             ASR TLHRFGNT
Sbjct  438   ASRMTLHRFGNT  449



>ref|XP_002324276.1| hypothetical protein POPTR_0018s01300g [Populus trichocarpa]
 gb|EEF02841.1| hypothetical protein POPTR_0018s01300g [Populus trichocarpa]
Length=512

 Score =   427 bits (1099),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 218/430 (51%), Positives = 310/430 (72%), Gaps = 8/430 (2%)
 Frame = +2

Query  146   RRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWEN  325
             R+LPDF QSVKLKYVKLGY+Y+I + + L  +  ++ +   +   S+     +W  +   
Sbjct  17    RKLPDFKQSVKLKYVKLGYHYLITHGMFLFLSPIVVVIAAQLSTFSIQDLHDLWDHL---  73

Query  326   SGGPDFGVVNMSLLG-LLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARK  502
                  F ++++ L   LL F L++YF+++P P+YLVDFAC KP D  K T+  F++ ++ 
Sbjct  74    ----KFNLISVILCSTLLVFLLTLYFLTRPRPVYLVDFACYKPEDSRKCTRKIFMERSQL  129

Query  503   SGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLE  682
             +G F E ++E+ +++LE SG+G+ TY+P+S+        +   R EA  ++F AID++LE
Sbjct  130   TGAFAETSMEFQRKILERSGLGESTYLPESVLRVPPNPCMAEARKEAEAVMFGAIDQLLE  189

Query  683   KTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLAR  862
             KT ++ +DIGIL+VNC+ FNPTPSLSAM+INHYK++ NI+S NLGGMGCSAG+I++DLA+
Sbjct  190   KTSVKPKDIGILIVNCSLFNPTPSLSAMVINHYKLRGNILSYNLGGMGCSAGLISIDLAK  249

Query  863   DILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYR  1042
              +L+ +PN YALVVSTE ++  WY GN +SML+ NC FR G +AVLLSN+R D+  +KY+
Sbjct  250   HLLQVHPNSYALVVSTENITLNWYFGNDKSMLLSNCLFRMGGAAVLLSNKRSDWWRSKYQ  309

Query  1043  LQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLT  1222
             L H VRT++GA D+ F  + Q+ED     G+ +SKDL+ V G+ALK NITTLGPLVLP++
Sbjct  310   LVHTVRTNKGADDKCFSCVTQQEDSTGKVGVSLSKDLMAVAGDALKTNITTLGPLVLPMS  369

Query  1223  EQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEAS  1402
             EQL FF TL+ +K F  K KPYIPD+ +AFEHFCI+A  + +LDEL+ NL LS+ +ME S
Sbjct  370   EQLLFFATLVGKKFFKMKLKPYIPDFKLAFEHFCIHAGGRAVLDELENNLHLSDWHMEPS  429

Query  1403  RATLHRFGNT  1432
             R TL+RFGNT
Sbjct  430   RMTLYRFGNT  439



>ref|XP_009758872.1| PREDICTED: 3-ketoacyl-CoA synthase 1 [Nicotiana sylvestris]
Length=532

 Score =   428 bits (1101),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 219/439 (50%), Positives = 309/439 (70%), Gaps = 13/439 (3%)
 Frame = +2

Query  134   VRVRRRLPDFVQSvklkyvklgyyyvIN--NWLCLAATVPLLTVVFGVEVG-SVMRGEKV  304
             +++RR+LPDF+QSVKLKYVKLGY Y  N  + L L   +P++T+      G  + R   +
Sbjct  27    IKIRRKLPDFLQSVKLKYVKLGYGYSCNPASLLLLVTVLPMVTLTLIQLTGLKLDRFSDI  86

Query  305   WGK---IWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTK  475
             W     + + S G       ++ L +L F L IY++ KP P+YLVDFAC KP D+ K++ 
Sbjct  87    WTSPTLLVDTSTG-------LAGLIVLFFFLGIYYVKKPRPVYLVDFACYKPEDERKMSV  139

Query  476   DQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLI  655
             D F+ +  ++G F ++ + + KR+ E SG+GDETY P+ I        +   R EA  ++
Sbjct  140   DSFLKMTEENGAFTDETIVFQKRISERSGLGDETYFPRGITSNPPNLCMKEARAEAEAVM  199

Query  656   FEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSA  835
             F A+D++  KT+++  +IGIL+VNC+ FNPTPSLS+MI+NHYK+K +I S NLGGMGCSA
Sbjct  200   FGALDQLFAKTKVKPEEIGILIVNCSLFNPTPSLSSMIVNHYKLKTDIKSYNLGGMGCSA  259

Query  836   GIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRR  1015
             G+I++DLA+ +L+ANPN YA+VVS E ++  WY GN RSML+ NC FR G +A+LLSN+ 
Sbjct  260   GLISIDLAKHLLKANPNTYAVVVSMENITLNWYFGNDRSMLLCNCIFRMGGAAMLLSNKS  319

Query  1016  RDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITT  1195
             RD   +KY L H VRTH+GA D ++  +YQ ED + + G+ ++++L+ V G+ALK NITT
Sbjct  320   RDRTRSKYELVHTVRTHKGADDNSYNCVYQREDDKGVIGVSLARELMAVAGDALKTNITT  379

Query  1196  LGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLR  1375
             LGPLVLPL+EQ  FF TL++RK+  AK KPYIPD+ +AFEHFCI+A  + +LDE++ NL 
Sbjct  380   LGPLVLPLSEQFRFFVTLVKRKMLKAKVKPYIPDFKLAFEHFCIHAGGRAVLDEIQNNLN  439

Query  1376  LSEQNMEASRATLHRFGNT  1432
             LS+ +ME SR TLHRFGNT
Sbjct  440   LSDWHMEPSRMTLHRFGNT  458



>ref|XP_001753137.1| predicted protein [Physcomitrella patens]
 gb|EDQ82178.1| predicted protein [Physcomitrella patens]
Length=519

 Score =   427 bits (1099),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 224/448 (50%), Positives = 321/448 (72%), Gaps = 7/448 (2%)
 Frame = +2

Query  92    IEPSGPDAGA-LTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFG  268
             I+ +   AG  ++  +  R RLPDF+QSV LKYVKLGY+Y+I + L L     LLT++  
Sbjct  6     IQEASMSAGERVSVQINPRNRLPDFLQSVNLKYVKLGYHYLITHLLTLLFVPLLLTIL--  63

Query  269   VEVGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCK  448
             +EVG +  G +   ++W+N       V+  S   LL F  +I+FMS P  I+LVDFAC  
Sbjct  64    LEVGRM--GPEDLRQLWDNLRFNLVSVITCS--ALLVFIGTIFFMSLPRAIFLVDFACYL  119

Query  449   PSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNN  628
             P + L+V    F++  R +G FDE+++E+ +++LE +G+G +TY+P ++        +  
Sbjct  120   PEEKLQVPIPLFMERTRLAGFFDERSMEFQEKILERAGLGPKTYLPAAMHAQPPCPSMKA  179

Query  629   IRGEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVST  808
              R EA Q++F  +D++ EKT+I+ +D+GILVVNC+ FNPTPSLSAMI+N Y+M+ NI + 
Sbjct  180   AREEAEQVMFGCLDELFEKTKIKPKDVGILVVNCSLFNPTPSLSAMIVNKYRMRGNIRTY  239

Query  809   NLGGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGC  988
             NLGGMGCSAG+I++DLA+D+L+ + N YA+VVSTE ++  WY GN RSMLIPNC FR G 
Sbjct  240   NLGGMGCSAGVISIDLAKDLLQVHGNSYAIVVSTENITQNWYFGNRRSMLIPNCLFRVGG  299

Query  989   SAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGG  1168
             SAVLLSN+ +D   +KY+L H+VRTH+GA D+ +  +YQE+D + I G+ +SKDL+ + G
Sbjct  300   SAVLLSNKLKDGSRSKYKLNHVVRTHKGADDKCYNCVYQEQDEQGILGVSLSKDLMAIAG  359

Query  1169  EALKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKML  1348
             E LK NITTLGPLVLP++EQL FF TL+ RK+F  K KPYIPD+ +AF+HFCI+A  + +
Sbjct  360   ETLKVNITTLGPLVLPISEQLLFFSTLVARKVFNLKVKPYIPDFKLAFDHFCIHAGGRAV  419

Query  1349  LDELKRNLRLSEQNMEASRATLHRFGNT  1432
             +DEL++NL+L+ ++ E SR TLHRFGN+
Sbjct  420   IDELEKNLQLTAEHCEPSRMTLHRFGNS  447



>ref|XP_008242707.1| PREDICTED: 3-ketoacyl-CoA synthase 11 [Prunus mume]
Length=519

 Score =   427 bits (1099),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 221/429 (52%), Positives = 305/429 (71%), Gaps = 6/429 (1%)
 Frame = +2

Query  146   RRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWEN  325
             R LPDF  SVKLKYVKLGY+ +I + + L  +   L VV   ++ +    +     +WE+
Sbjct  25    RNLPDFKNSVKLKYVKLGYHILITHGMYLFLSP--LVVVIAAQISTFSLQDLY--DLWEH  80

Query  326   SGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKS  505
                    V+  S   LL F  ++YF+++P P+YLV+F+C KP +  K TK  F+D ++ +
Sbjct  81    LQYNLISVIICS--TLLVFLSTVYFLTRPRPVYLVNFSCYKPEESRKCTKKIFMDQSQMT  138

Query  506   GTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEK  685
             GTF E+NL++ +R+LE SG+GD TY+P+++        +   R EA  ++F AID++  K
Sbjct  139   GTFTEENLQFQRRILERSGLGDSTYLPEAVLNIPPNPSMKEARKEAEAVMFGAIDELFTK  198

Query  686   TRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARD  865
             T ++ +DIGIL+VNC+ FNPTPSLSAM+INHY+++ NIVS NLGGMGCSAG+I++DLA++
Sbjct  199   TAVKPKDIGILIVNCSLFNPTPSLSAMVINHYQLRGNIVSYNLGGMGCSAGLISIDLAKN  258

Query  866   ILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRL  1045
             +L+ +PN YALV+S E ++  WY GN RS L+ NC FR G +A+LLSN+  D R +KYRL
Sbjct  259   LLQVHPNSYALVISMENITLNWYFGNDRSKLVSNCLFRMGGAAILLSNKSSDRRRSKYRL  318

Query  1046  QHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTE  1225
              H VRTH+GA D+ F  + QEED     G+ +SKDL+ V G+ALK NITTLGPLVLP++E
Sbjct  319   VHTVRTHKGADDKCFSCVTQEEDSNGKIGVTLSKDLMAVAGDALKTNITTLGPLVLPMSE  378

Query  1226  QLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASR  1405
             QL FF TL+ RKLF  K KPYIPD+ +AFEHFCI+A  + +LDEL++NL LS+ +ME SR
Sbjct  379   QLLFFATLVGRKLFKRKIKPYIPDFRLAFEHFCIHAGGRAVLDELEKNLHLSDWHMEPSR  438

Query  1406  ATLHRFGNT  1432
              TLHRFGNT
Sbjct  439   MTLHRFGNT  447



>ref|XP_011091085.1| PREDICTED: 3-ketoacyl-CoA synthase 11 [Sesamum indicum]
Length=524

 Score =   427 bits (1099),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 223/428 (52%), Positives = 316/428 (74%), Gaps = 8/428 (2%)
 Frame = +2

Query  152   LPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSG  331
             LP+F+QSV+LKYVKLGY+Y+I++ + L   VPLL ++  V + ++   + V   +W+   
Sbjct  31    LPNFLQSVRLKYVKLGYHYLISHAMYLF-LVPLLGIL-SVHLSTITTDDLVL--LWDQL-  85

Query  332   GPDFGVVNMSLL-GLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSG  508
                F +V++ +   L+ F  ++YFM++P  +YLVDFAC KP  ++  +K+ F++ +R +G
Sbjct  86    --KFNLVSVVICSALIVFLGTLYFMTRPRKVYLVDFACYKPKPEVMCSKEMFMEKSRAAG  143

Query  509   TFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKT  688
              F  +NLE+ KR+LE SG+G +TY P+++        +   R EA  ++F AID +L KT
Sbjct  144   IFTPENLEFQKRILERSGLGQKTYFPEALMRVPANPCMAEARKEAEMVMFGAIDDLLAKT  203

Query  689   RIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDI  868
              ++A+DIGILVVNC+ FNPTPSLSAMI+NHYK++ NI+S NLGGMGCSAG+I++DLA+ +
Sbjct  204   GVKAKDIGILVVNCSLFNPTPSLSAMIVNHYKLRGNILSYNLGGMGCSAGLISIDLAKQL  263

Query  869   LRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQ  1048
             L+ NPN YALVVS E ++  WY GN+RSML+ NC FR G +A+LLSN+  D R AKY+L 
Sbjct  264   LQVNPNSYALVVSMENITLNWYFGNNRSMLVSNCIFRMGGAAILLSNKPSDRRRAKYQLI  323

Query  1049  HIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQ  1228
             H VRTH+GA D+++  ++QEED  +  G+ +SKDL+ V GEALK NITTLGPLVLP++EQ
Sbjct  324   HTVRTHKGADDKSYGCVFQEEDDTKRVGVALSKDLMAVAGEALKTNITTLGPLVLPMSEQ  383

Query  1229  LYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRA  1408
             L FF TL+ RK+F  K KPYIPD+ +AF+HFCI+A  + +LDEL++NL LS+ +ME SR 
Sbjct  384   LLFFVTLVARKVFKMKIKPYIPDFKLAFDHFCIHAGGRAVLDELEKNLELSKWHMEPSRM  443

Query  1409  TLHRFGNT  1432
             TL+RFGNT
Sbjct  444   TLYRFGNT  451



>ref|XP_009601634.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like [Nicotiana tomentosiformis]
Length=517

 Score =   427 bits (1098),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 223/431 (52%), Positives = 318/431 (74%), Gaps = 12/431 (3%)
 Frame = +2

Query  149   RLPDFVQSvklkyvklgyyyvINN--WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWE  322
             +LP+F+ SVKLKYVKLGY+Y+I++  +LCL   VP+L  V  V + ++   E V  ++W 
Sbjct  21    KLPNFLLSVKLKYVKLGYHYLISHVMYLCL---VPILGAV-SVHLSTLTVEEVV--QLWN  74

Query  323   NSGGPDFGVVNMSLL-GLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIAR  499
                   F +V + L   L+ F  ++YFM++P  +YLVDF+C KP  D+   K+ F++ ++
Sbjct  75    QL---KFNLVTVILCSALMVFLATLYFMTRPRKVYLVDFSCYKPKPDVMCPKELFMERSK  131

Query  500   KSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVL  679
             ++G F ++NL + K++LE SG+G +TY P+++        +   R EA  ++F AID++L
Sbjct  132   QAGIFTDENLAFQKKILERSGLGQKTYFPEALLKVPPNPCMAEARKEAEMVMFGAIDELL  191

Query  680   EKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLA  859
             EKT ++A+DIGILVVNC+ FNPTPSLSAMI+NHYK++ NI+S NLGGMGCSAG+I++DLA
Sbjct  192   EKTGVKAKDIGILVVNCSLFNPTPSLSAMIVNHYKLRGNIMSYNLGGMGCSAGLISIDLA  251

Query  860   RDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKY  1039
             + +L+ +PN YALVVS E ++  WY GN+RSML+ NC FR G +A+LLSN+  D R +KY
Sbjct  252   KQMLQVHPNSYALVVSMENITLNWYFGNNRSMLVSNCIFRMGGAAILLSNKSSDRRRSKY  311

Query  1040  RLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPL  1219
             +L H VRTH+GA D+++  ++QEED  +  G+ +SKDL+ V GEALK NITTLGP+VLP+
Sbjct  312   QLIHTVRTHKGADDKSYSCVFQEEDDNKKIGVALSKDLMAVAGEALKTNITTLGPIVLPM  371

Query  1220  TEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEA  1399
             +EQL FF TL+ RK+F  K KPYIPD+ +AFEHFCI+A  + +LDEL++NL LS+ +ME 
Sbjct  372   SEQLLFFITLVARKVFKMKIKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLELSQWHMEP  431

Query  1400  SRATLHRFGNT  1432
             SR TL+RFGNT
Sbjct  432   SRMTLYRFGNT  442



>ref|XP_006656205.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Oryza brachyantha]
Length=519

 Score =   427 bits (1098),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 218/430 (51%), Positives = 314/430 (73%), Gaps = 6/430 (1%)
 Frame = +2

Query  143   RRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWE  322
             RRRLPDF QSV+LKYVKLGY+Y+I++ + L  + PL+ +V  V++ +V  G+     +WE
Sbjct  21    RRRLPDFQQSVRLKYVKLGYHYLISHGMYLLLS-PLMALV-AVQLSTVSPGD--LADLWE  76

Query  323   NSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARK  502
                     VV  S   LL F  ++YF+++P P+YL+DFAC KP  + K T++ F+  +  
Sbjct  77    QLRFNLLSVVACS--TLLVFLSTVYFLTRPRPVYLLDFACYKPEPERKCTRETFMRCSNL  134

Query  503   SGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLE  682
             +G+F + NL++ +++LE SG+G++TY+P ++        ++  R EA  ++F AID++LE
Sbjct  135   TGSFTDDNLDFQRKILERSGLGEDTYLPPAVLRVPPNPCMDEARKEARAVMFGAIDRLLE  194

Query  683   KTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLAR  862
             KT ++ +DIG+LVVNC+ FNPTPSLSAM++NHYK++ N++S NLGGMGCSAG++++DLA+
Sbjct  195   KTGVKPKDIGVLVVNCSLFNPTPSLSAMVVNHYKLRGNVISYNLGGMGCSAGLLSIDLAK  254

Query  863   DILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYR  1042
             D+L+ +P  YALV+S E ++  WY GN+RSML+ NC FR G +A+LLSN+R D R +KY 
Sbjct  255   DLLQVHPGSYALVISMENITLNWYFGNNRSMLVSNCLFRMGGAAILLSNKRSDRRRSKYE  314

Query  1043  LQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLT  1222
             L H VRTH+GA D+ F  + QEED     G+ +SKDL+ V G+ALK NITTLGPLVLPL+
Sbjct  315   LVHTVRTHKGANDKCFGCVTQEEDEVGKIGVSLSKDLMAVAGDALKTNITTLGPLVLPLS  374

Query  1223  EQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEAS  1402
             EQL F  TL+ +K+   K KPYIPD+ +AFEHFCI+A  + +LDEL++NL L++ +ME S
Sbjct  375   EQLLFLATLVAKKILKMKIKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLELTDWHMEPS  434

Query  1403  RATLHRFGNT  1432
             R TL+RFGNT
Sbjct  435   RMTLYRFGNT  444



>ref|XP_003571537.1| PREDICTED: 3-ketoacyl-CoA synthase 11 [Brachypodium distachyon]
Length=519

 Score =   427 bits (1098),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 221/429 (52%), Positives = 309/429 (72%), Gaps = 6/429 (1%)
 Frame = +2

Query  146   RRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWEN  325
             RRLPDF+QSV+LKYVKLGY+Y+I + + L  T PL+ +V  V + ++  GE     +W +
Sbjct  22    RRLPDFLQSVRLKYVKLGYHYLITHGMYLLLT-PLIVLV-AVHLSTLSPGEV--ADLWAH  77

Query  326   SGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKS  505
                    VV  S   LL F  ++YF+++P P+YLVDFAC KP  + + T+D F+  ++ +
Sbjct  78    LRFNLVSVVACS--TLLVFLSTVYFLTRPRPVYLVDFACYKPEPERRCTRDTFMRCSKLT  135

Query  506   GTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEK  685
             G F + NLE+ +++LE SG+G++TY+P S+        ++  R EA   +F AID +L K
Sbjct  136   GNFTDANLEFQRKILERSGLGEDTYLPPSLVSVPPNPSMDEARKEAQLCMFGAIDDMLAK  195

Query  686   TRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARD  865
             T ++ +DIGILVVNC+ FNPTPSLSAM++NHYK++ NI+S NLGGMGCSAG++++DLA+D
Sbjct  196   TGVKPKDIGILVVNCSLFNPTPSLSAMVVNHYKLRGNIISYNLGGMGCSAGLLSIDLAKD  255

Query  866   ILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRL  1045
             +L+ +PN YALVVSTE ++  WY GN+RSML+ NC FR G +A+LLSN+R D   +KY L
Sbjct  256   LLQVHPNSYALVVSTENMTLNWYFGNNRSMLVSNCLFRMGAAAILLSNKRSDRWRSKYEL  315

Query  1046  QHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTE  1225
              H VRTH+GA D+ F  + QEED +   G+ +SKDL+ V G+ALK NITTLGPLVLP +E
Sbjct  316   VHTVRTHKGADDKCFSCVTQEEDDDGKVGVALSKDLMAVAGDALKTNITTLGPLVLPFSE  375

Query  1226  QLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASR  1405
             QL F  TL+ +KL   K KPYIPD+ +AFEHFCI+A  + +LDE+++N+ L++ +ME SR
Sbjct  376   QLLFMLTLVGKKLLKMKIKPYIPDFKLAFEHFCIHAGGRAVLDEIEKNMDLTDWHMEPSR  435

Query  1406  ATLHRFGNT  1432
              TL RFGNT
Sbjct  436   MTLFRFGNT  444



>dbj|BAJ94420.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93057.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=522

 Score =   427 bits (1098),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 218/430 (51%), Positives = 315/430 (73%), Gaps = 8/430 (2%)
 Frame = +2

Query  146   RRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWEN  325
             R LPDF+QSV+LKYVKLGY+++I++ + L  + PL+ +V  V++ +V   +     +WE 
Sbjct  24    RLLPDFLQSVRLKYVKLGYHHLISHGMYLLLS-PLMALV-AVQLSTVSPSD--LADLWEQ  79

Query  326   SGGPDFGVVNMSLLG-LLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARK  502
                  F +V++ +   LL F  ++YF+++P P+YLVDFAC KP  + + T+  F+  +  
Sbjct  80    L---RFNLVSVVVCSTLLVFLSTVYFLTRPRPVYLVDFACYKPGPERRCTRQTFMRCSEA  136

Query  503   SGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLE  682
             +G+F + NL++ +++LE SG+G++TY+P ++        ++  R EAS ++F AID++LE
Sbjct  137   TGSFTDANLDFQRKILERSGLGEDTYLPPAVLRVPPNPCMDEARKEASTVMFGAIDQLLE  196

Query  683   KTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLAR  862
             KT +R +DIGILVVNC+ FNPTPSLSAM++NHY+++ N+VS NLGGMGCSAG++++DLA+
Sbjct  197   KTGVRPKDIGILVVNCSLFNPTPSLSAMVVNHYRLRGNVVSYNLGGMGCSAGLLSIDLAK  256

Query  863   DILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYR  1042
             D+L+ +PN YALV+S E ++  WY GN RSML+ NC FR G +A+LLSN+R D R +KY 
Sbjct  257   DLLQVHPNSYALVISMENITLNWYFGNDRSMLVSNCLFRMGGAAILLSNKRSDRRRSKYE  316

Query  1043  LQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLT  1222
             L H VRTH+GA D+ F  + Q+ED     G+ +SKDL+ V G+ALK NITTLGPLVLPL+
Sbjct  317   LVHTVRTHKGADDKCFGCVTQQEDDAGKVGVSLSKDLMAVAGDALKTNITTLGPLVLPLS  376

Query  1223  EQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEAS  1402
             EQL F  TL+ +K F  K KPYIPD+ +AFEHFCI+A  + +LDEL++NL L+E +ME S
Sbjct  377   EQLLFMATLVAKKAFKVKIKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLGLTEWHMEPS  436

Query  1403  RATLHRFGNT  1432
             R TL+RFGNT
Sbjct  437   RMTLYRFGNT  446



>ref|XP_006361008.1| PREDICTED: 3-ketoacyl-CoA synthase 1-like [Solanum tuberosum]
Length=535

 Score =   427 bits (1099),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 216/439 (49%), Positives = 310/439 (71%), Gaps = 10/439 (2%)
 Frame = +2

Query  134   VRVRRRLPDFVQSvklkyvklgyyyvIN--NWLCLAATVPLLTVVFGVEVGSVMRGEKVW  307
             +++R++LPDF+QSVKLKYVKLGY Y  N    L  A   P++T    +++ + ++ ++ +
Sbjct  27    IKIRQKLPDFLQSVKLKYVKLGYGYSCNPLTLLLFATIFPIVTFTL-IQLLTGLKLDRFY  85

Query  308   GKIWENSGGPDFGVVNMS--LLGL--LGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTK  475
               +   +  P   ++N S  L GL  L F L +Y++ KP P+YLVDFAC KP D+ K++ 
Sbjct  86    DTL---TSDPTLLIINTSTGLTGLIVLFFVLGVYYVKKPRPVYLVDFACYKPEDERKISV  142

Query  476   DQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLI  655
             D F+++   +G F+++ + + K++   SG+GDETY+PK I        +   R EA  ++
Sbjct  143   DSFLNMTEGNGAFEDETIVFQKKISHRSGLGDETYLPKGITSIPPNLNMKEARAEAEAVM  202

Query  656   FEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSA  835
             F A+D +  KT+I+  +IGIL+VNC+ FNPTPSLS+MI+NHYK+K +I S NLGGMGCSA
Sbjct  203   FGALDSLFSKTQIKPEEIGILIVNCSLFNPTPSLSSMIVNHYKLKTDIKSYNLGGMGCSA  262

Query  836   GIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRR  1015
             G+I++DLA+ +L+AN N YA+VVS E ++  WY GN RSML+ NC FR G +A+LLSN+ 
Sbjct  263   GLISIDLAKQLLKANQNSYAVVVSMENITLNWYFGNDRSMLLCNCIFRMGGAAMLLSNKS  322

Query  1016  RDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITT  1195
             +D   +KY L H VRTH+GA D ++  +YQ ED + + G+ ++++L+ V G+ALK NITT
Sbjct  323   KDRTRSKYELVHTVRTHKGADDNSYNCVYQREDDKGVVGVSLARELMAVAGDALKTNITT  382

Query  1196  LGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLR  1375
             LGP VLPLTEQ  FF TL++RKL  AK KPYIPD+ +AFEHFCI+A  + +LDE++ NL 
Sbjct  383   LGPSVLPLTEQFRFFMTLVKRKLLKAKVKPYIPDFKLAFEHFCIHAGGRAVLDEIQNNLS  442

Query  1376  LSEQNMEASRATLHRFGNT  1432
             LS+ +ME SR TLHRFGNT
Sbjct  443   LSDWHMEPSRMTLHRFGNT  461



>ref|XP_007013801.1| 3-ketoacyl-CoA synthase [Theobroma cacao]
 gb|EOY31420.1| 3-ketoacyl-CoA synthase [Theobroma cacao]
Length=505

 Score =   427 bits (1097),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 216/429 (50%), Positives = 312/429 (73%), Gaps = 8/429 (2%)
 Frame = +2

Query  149   RLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENS  328
             +LPDF QSVKLKYVKLGY+Y++ + + +  T  ++ +   +   S+    ++W  +    
Sbjct  12    KLPDFKQSVKLKYVKLGYHYLMTHGMYIFLTPLVVVIAAQLSTFSLQDLHELWDHL----  67

Query  329   GGPDFGVVNMSLLG-LLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKS  505
                 F ++++ L   LL F  ++YF+++P P+YLVDF+C KP+D  K T   F++ +  +
Sbjct  68    ---RFNLMSVILCSTLLVFLSTLYFLTRPRPVYLVDFSCYKPNDARKCTGQIFMERSVMT  124

Query  506   GTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEK  685
             GTF E+NLE+ +++LE SG+G+ TY+P+++        +   R EA  ++F A+D++ EK
Sbjct  125   GTFTEENLEFQRKILERSGLGESTYLPEAVIRVPPNPCMAEARKEAEAVMFGALDQLFEK  184

Query  686   TRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARD  865
             T ++ +D+GIL+VNC+ FNPTPSLSAM+INHYK++ NI+S NLGGMGCSAG+I++DLA+D
Sbjct  185   TSLKPKDVGILIVNCSLFNPTPSLSAMVINHYKLRGNIISYNLGGMGCSAGLISIDLAKD  244

Query  866   ILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRL  1045
             +L+A+ N YALV++ E ++  WY GN RSML+ NC FR G +A+LLSN+R D R +KYRL
Sbjct  245   LLQAHANSYALVITMENITLNWYFGNERSMLVSNCLFRMGGAAILLSNKRSDGRRSKYRL  304

Query  1046  QHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTE  1225
              H VRTH+GA D+ F  + Q+ED     G+ +SKDL+ V G+ALK NITTLGPLVLP++E
Sbjct  305   VHTVRTHKGADDKCFTCVTQKEDSTGRIGVSLSKDLMAVAGDALKTNITTLGPLVLPMSE  364

Query  1226  QLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASR  1405
             QL FF TL+ RKLF  K KPYIPD+ +AFEHFCI+A  + +LDEL++NL+LS+ +ME SR
Sbjct  365   QLLFFATLVARKLFKMKVKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLQLSDWHMEPSR  424

Query  1406  ATLHRFGNT  1432
              TL+RFGNT
Sbjct  425   MTLYRFGNT  433



>ref|XP_011048431.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Populus euphratica]
Length=510

 Score =   427 bits (1097),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 219/435 (50%), Positives = 314/435 (72%), Gaps = 10/435 (2%)
 Frame = +2

Query  134   VRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLT-VVFGVEVGSVMRGEKVWG  310
             +R  RRLPDF+ SV LK+VKLGY+Y+I + L L   VPL+  V+F     +     ++W 
Sbjct  17    IRQSRRLPDFLHSVNLKHVKLGYHYLITHLLTLC-LVPLMAFVIFQAFQLNPNDIHQLWL  75

Query  311   KIWENSGGPDFGVVNMSLL-GLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFI  487
              +        + +V++ +    L F  ++Y M++P  ++LVD+AC KP  +L+V  +QF+
Sbjct  76    HL-------QYNLVSVIICSAFLVFGATVYIMTRPRSLFLVDYACYKPPSNLQVKFEQFM  128

Query  488   DIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAI  667
             + +  +G FD+ +LE+ +++LE SG+G+ETY+P+++        +   R EA Q++F A+
Sbjct  129   EHSNLTGDFDDSSLEFQRKILERSGLGEETYVPEAMHYIPPRPSMAAAREEAQQVMFGAL  188

Query  668   DKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIA  847
             + +   T I+ +DIGILVVNC+ FNPTPSLSAMI+N YK++ NI S NLGGMGCSAG+IA
Sbjct  189   NVLFANTNIKPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIA  248

Query  848   LDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYR  1027
             +DLA+D+L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR G SAVLLSN+ +D R
Sbjct  249   VDLAKDMLQVHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKAKDKR  308

Query  1028  HAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPL  1207
              AKY+L H+VRTH+GA D+AF+ +YQE+D     G+ +SK+L+ + G ALK NITTLGPL
Sbjct  309   RAKYKLVHVVRTHKGADDKAFKCVYQEQDDAGKTGVSLSKELMAIAGGALKTNITTLGPL  368

Query  1208  VLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQ  1387
             VLP++EQL FF TL+ +KLF AK KPYIPD+ +AF+HFCI+A  + ++DEL++NL+L   
Sbjct  369   VLPISEQLLFFSTLVAKKLFNAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPI  428

Query  1388  NMEASRATLHRFGNT  1432
             ++EASR TLHRFGNT
Sbjct  429   HVEASRMTLHRFGNT  443



>gb|AGK29994.1| 3-ketoacyl-CoA synthase 4 [Gossypium raimondii]
Length=504

 Score =   426 bits (1096),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 224/435 (51%), Positives = 315/435 (72%), Gaps = 10/435 (2%)
 Frame = +2

Query  134   VRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVG--SVMRGEKVW  307
             +R R RLPDF+QSV LKYVKLGY+Y+I++ L L   +PL++V+  VE    S+    ++W
Sbjct  11    IRQRTRLPDFLQSVNLKYVKLGYHYLISHLLTLC-LIPLMSVIV-VEASRLSLDDVHQLW  68

Query  308   GKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFI  487
              ++  N     F V ++ L+    F  ++Y M++P  +YL+D++C  P   LKV   QF+
Sbjct  69    LQLQYNL--VSFIVFSVVLV----FGSTVYIMTRPRSVYLLDYSCYLPPSHLKVKYQQFM  122

Query  488   DIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAI  667
             + ++ +G FDE +LE+ +++LE SG+G+ET +P+++        +   R EA Q++F A+
Sbjct  123   EHSKLTGDFDESSLEFQRKILERSGLGEETCVPEAMHYLPPRPSMAAAREEAEQVMFGAL  182

Query  668   DKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIA  847
             DK+   T ++ RDIGILVVNC+ FNPTPSLSAMIIN YK++ NI S NLGGMGCSAG+IA
Sbjct  183   DKLFANTNVKPRDIGILVVNCSLFNPTPSLSAMIINKYKLRGNIRSFNLGGMGCSAGVIA  242

Query  848   LDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYR  1027
             +DLA+D+L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR G +AVLLSNR  D R
Sbjct  243   IDLAKDMLQVHRNSYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGAAVLLSNRSVDRR  302

Query  1028  HAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPL  1207
              +KY+L H+VRTH GA D+AF+ +YQE+D     G+ +SKDL+ + G ALK NITT+GPL
Sbjct  303   RSKYKLVHVVRTHCGANDKAFKCVYQEQDDNGKTGVSLSKDLMAIAGGALKTNITTMGPL  362

Query  1208  VLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQ  1387
             VLP++EQ+ FF TL+ +KLF AK KPYIPD+ +AF+HFCI+A  + ++DEL++NL+L   
Sbjct  363   VLPISEQILFFVTLVAKKLFNAKIKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPV  422

Query  1388  NMEASRATLHRFGNT  1432
             + EASR TLHRFGNT
Sbjct  423   HAEASRMTLHRFGNT  437



>ref|XP_002305431.1| hypothetical protein POPTR_0004s16290g [Populus trichocarpa]
 gb|EEE85942.1| hypothetical protein POPTR_0004s16290g [Populus trichocarpa]
Length=510

 Score =   426 bits (1096),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 223/435 (51%), Positives = 312/435 (72%), Gaps = 8/435 (2%)
 Frame = +2

Query  131   SVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLT-VVFGVEVGSVMRGEKVW  307
              +R  RRLPDF+QSV LKYVKLGY+Y+I + L L   VPL+  V+F     +     ++W
Sbjct  16    QIRQSRRLPDFLQSVNLKYVKLGYHYLITHLLTLC-FVPLIAFVIFQASQLNPNDIHQLW  74

Query  308   GKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFI  487
               +  N       V+  S+  + G T  +Y +++P  +YLVD+AC KP   L+V  +QF+
Sbjct  75    LHLQYNL----VSVIICSVFLVFGAT--VYIVTRPRSVYLVDYACYKPPAKLQVKYEQFM  128

Query  488   DIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAI  667
             + ++ +G FD+ +LE+ +R+LE SG+G+ETY P+++        +   R EA Q++F A+
Sbjct  129   EHSKLTGDFDDSSLEFQRRILERSGLGEETYAPEAMHYIPPRPSMAAAREEAEQVMFGAL  188

Query  668   DKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIA  847
             D +   T I+ +DIG+LVVNC+ FNPTPSLSAMI+N YK++ NI + NLGGMGCSAG+IA
Sbjct  189   DVLFANTNIKPKDIGVLVVNCSLFNPTPSLSAMIVNKYKLRGNIRTFNLGGMGCSAGVIA  248

Query  848   LDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYR  1027
             +DLA+D+L+ + N  A+VVSTE ++  WY GN +SMLIPNC FR G SAVLLSN+ +D R
Sbjct  249   VDLAKDMLQIHRNTCAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKAKDRR  308

Query  1028  HAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPL  1207
              AKY+L H+VRTH+GA D+AF+ +YQE+D     G+ +SKDL+ + G ALK NITTLGPL
Sbjct  309   RAKYKLVHVVRTHKGADDKAFKCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPL  368

Query  1208  VLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQ  1387
             VLP++EQL FF TL+ +KLF AK KPYIPD+ +AF+HFCI+A  + ++DEL++NL+L   
Sbjct  369   VLPISEQLLFFSTLVAKKLFNAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPI  428

Query  1388  NMEASRATLHRFGNT  1432
             ++EASR TLHRFGNT
Sbjct  429   HVEASRMTLHRFGNT  443



>ref|XP_004498007.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like [Cicer arietinum]
Length=502

 Score =   426 bits (1095),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 226/431 (52%), Positives = 315/431 (73%), Gaps = 8/431 (2%)
 Frame = +2

Query  143   RRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWE  322
             R +LP+F+ SVKLKYVKLGY+Y+I+N + L   +PLL VV    + +    + +  ++WE
Sbjct  5     RNKLPNFLLSVKLKYVKLGYHYLISNAMYLV-LIPLLGVV-STHLATFSLKDLI--QLWE  60

Query  323   NSGGPDFGVVNMSLLG-LLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIAR  499
                   F  V+++L   L+ F  ++YFMS+P  IYLVDFAC KP +D   T++ FI+ A 
Sbjct  61    IL---KFNFVSVTLCSSLIVFLATLYFMSRPRSIYLVDFACYKPQEDCICTRETFIEKAY  117

Query  500   KSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVL  679
               G F ++ L + K+++E SG+G +TY P S+        +   R EA +++F AID++L
Sbjct  118   LFGQFGDEILSFQKKIVERSGLGQKTYFPSSLMRVPPNYCMEEARKEAEEVMFGAIDELL  177

Query  680   EKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLA  859
             EKT ++A+DIGIL+VNC+ FNPTPSLSAM++NHYK++ NI+S NLGGMGCSAG+I++DLA
Sbjct  178   EKTGVKAKDIGILIVNCSLFNPTPSLSAMVVNHYKLRGNILSYNLGGMGCSAGLISIDLA  237

Query  860   RDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKY  1039
             + +L+ANPN YALVVS E ++   Y GN+RSML+ NC FR G +A+LLSN+  D R +KY
Sbjct  238   KHLLQANPNSYALVVSMENITLNLYLGNNRSMLVSNCLFRMGGAAILLSNKPSDRRRSKY  297

Query  1040  RLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPL  1219
             +L H VRTH+GA D+++  ++Q+ED  +  G+ +SKDL+ V GEALK NITTLGPLVLP+
Sbjct  298   QLVHTVRTHKGADDKSYGCVFQKEDDTKKVGVALSKDLMAVAGEALKTNITTLGPLVLPM  357

Query  1220  TEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEA  1399
             +EQL FF TL+ RK+F  K KPYIPD+ +AFEHFCI+A  + +LDEL++NL LSE +ME 
Sbjct  358   SEQLLFFVTLVGRKIFKMKIKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLDLSEWHMEP  417

Query  1400  SRATLHRFGNT  1432
             SR TL+RFGNT
Sbjct  418   SRMTLYRFGNT  428



>ref|XP_008219888.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Prunus mume]
Length=515

 Score =   426 bits (1095),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 196/354 (55%), Positives = 269/354 (76%), Gaps = 0/354 (0%)
 Frame = +2

Query  371   LLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEYLKRML  550
             LL F L++YF+++P P+YLVDF+C KP D  K ++  F+D +   GTF  +NLE+ +++L
Sbjct  90    LLVFLLTLYFLTRPRPVYLVDFSCYKPEDTRKCSRQIFMDRSHFIGTFTGENLEFQRKIL  149

Query  551   ESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGILVVNC  730
             E SG+G+ TY+P+++        +   R EA  ++F A+D++ EKT I+ +DIGIL+VNC
Sbjct  150   ERSGLGESTYLPEAVIQVPPNPCMAEARKEAEMVMFGALDQLFEKTSIKPKDIGILIVNC  209

Query  731   NTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYALVVST  910
             + FNPTPSLSAM+INHYK++ NI+S NLGGMGCSAG+I++DLA+D+LR +PN YALV+S 
Sbjct  210   SLFNPTPSLSAMVINHYKLRGNIISYNLGGMGCSAGLISIDLAKDLLRVHPNTYALVISM  269

Query  911   EIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAF  1090
             E ++  WY GN RSML+ NC FR G +A+LLSN   D R +KY+L H VRTH+GA D+ F
Sbjct  270   ENITLNWYFGNDRSMLVSNCLFRMGGAAILLSNNGSDRRRSKYQLVHTVRTHKGADDKCF  329

Query  1091  RSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIRRKLFG  1270
               + Q+ED     G+ +SKDL+ V G+ALK NITTLGPLVLP++EQL FF TL+ RKLF 
Sbjct  330   SCVTQKEDFAGKIGVSLSKDLMAVAGDALKTNITTLGPLVLPMSEQLLFFATLVGRKLFK  389

Query  1271  AKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
              K KPYIPD+ +AFEHFCI+A  + +LDEL++NL+LS+++ME SR TL+RFGNT
Sbjct  390   MKVKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLQLSDRHMEPSRMTLYRFGNT  443



>gb|AGK29996.1| 3-ketoacyl-CoA synthase 18 [Gossypium raimondii]
Length=515

 Score =   426 bits (1095),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 223/431 (52%), Positives = 314/431 (73%), Gaps = 10/431 (2%)
 Frame = +2

Query  146   RRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGE--KVWGKIW  319
             RRLPDF+QSV LKYVKLGY+Y+I+N L L   +PL+ V+  +E   +   +  ++W  + 
Sbjct  26    RRLPDFLQSVNLKYVKLGYHYLISNLLTLC-FIPLIAVI-SIEASQMNLDDLRQLWVHLQ  83

Query  320   ENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIAR  499
              N       ++  S   +L F L++Y M++P P+YLVD++C +  D LK    +F++ ++
Sbjct  84    YNLAS----IIICS--AILVFGLTVYIMTRPRPVYLVDYSCYRAPDHLKAPYGRFMEHSK  137

Query  500   KSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVL  679
              +G FDE +LE+ +++LE SG+G+ETY+PK++        +   R EA +++F A+D + 
Sbjct  138   LTGDFDESSLEFQRKILERSGLGEETYVPKAMHNIPPTPSMAAAREEAEEVMFGALDILF  197

Query  680   EKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLA  859
               T ++ +DIGILVVNC+ FNPTPSLSAMI+N YK++ NI S NLGGMGCSAG+IA+DLA
Sbjct  198   HNTNVKPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLA  257

Query  860   RDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKY  1039
             +D+L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR G SAVLLSN+ +D R AKY
Sbjct  258   KDMLQVHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSKDRRRAKY  317

Query  1040  RLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPL  1219
             +L H+VRTH+GA D+AFR +YQE+D     G+ +SKDL+ + G ALK NITTLGPLVLP+
Sbjct  318   KLIHVVRTHRGADDKAFRCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPI  377

Query  1220  TEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEA  1399
             +EQL FF TL+ +KLF A  KPYIPD+ +AF+HFCI+A  + ++DEL++NL+L   ++EA
Sbjct  378   SEQLLFFTTLVVKKLFNAGIKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPIHVEA  437

Query  1400  SRATLHRFGNT  1432
             SR TLHRFGNT
Sbjct  438   SRMTLHRFGNT  448



>gb|KHG01499.1| 3-ketoacyl-CoA synthase 11 -like protein [Gossypium arboreum]
Length=510

 Score =   426 bits (1094),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 226/444 (51%), Positives = 313/444 (70%), Gaps = 9/444 (2%)
 Frame = +2

Query  101   SGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVG  280
             S PD   +  S    R LPDF +SVKLKYVKLGY+Y+I + + L  T  ++ +   +   
Sbjct  4     SKPDQPLMPSS---SRNLPDFKKSVKLKYVKLGYHYLITHGMYLFLTPLVVIIAAQLSTF  60

Query  281   SVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDD  460
             SV    K    +WE+       V+  S   LL F  ++YF+++P P+YLV+FAC KP + 
Sbjct  61    SV----KDLFDLWEHLQYNLISVIICS--ALLVFLSTLYFLTRPRPVYLVNFACYKPEES  114

Query  461   LKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGE  640
              K TK  F+D ++ +GTF E+NL++ +R+LE SG+GD TY+P+++        ++  R E
Sbjct  115   RKCTKRMFVDQSQLTGTFTEENLQFQRRILERSGLGDSTYLPEAVLNIPPNPSMHEARKE  174

Query  641   ASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGG  820
             A  ++F AID++L KT ++ +DIGIL+VNC+ FNPTPSLSAM+INHYK++ NI S NLGG
Sbjct  175   AETVMFGAIDELLAKTSVKPKDIGILIVNCSLFNPTPSLSAMVINHYKLRGNIQSYNLGG  234

Query  821   MGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVL  1000
             MGCSAG+I++DLA+ +L+ +PN YALV+S E ++  WY GN RS L+ NC FR G +A+L
Sbjct  235   MGCSAGLISIDLAKHLLQVHPNSYALVISMENITLNWYFGNDRSKLVSNCLFRMGGAAIL  294

Query  1001  LSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALK  1180
             LSN+  D R +KY+L H VRTH+G+ D+ F  + QEED     G+ +SKDL+ V G+ALK
Sbjct  295   LSNKWSDKRRSKYQLVHTVRTHKGSDDKCFSCVTQEEDSIGKIGVTLSKDLMAVAGDALK  354

Query  1181  ANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDEL  1360
              NITTLGPLVLP++EQL FF TL+ +KLF  K KPYIPD+ +AFEHFCI+A  + +LDEL
Sbjct  355   TNITTLGPLVLPMSEQLLFFGTLVGKKLFKMKVKPYIPDFKLAFEHFCIHAGGRAVLDEL  414

Query  1361  KRNLRLSEQNMEASRATLHRFGNT  1432
             ++NL+LSE +ME SR TL+RFGNT
Sbjct  415   EKNLQLSEWHMEPSRMTLYRFGNT  438



>ref|XP_007017550.1| 3-ketoacyl-CoA synthase 4 [Theobroma cacao]
 gb|EOY14775.1| 3-ketoacyl-CoA synthase 4 [Theobroma cacao]
Length=515

 Score =   426 bits (1094),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 225/434 (52%), Positives = 320/434 (74%), Gaps = 8/434 (2%)
 Frame = +2

Query  134   VRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGK  313
             ++  RRLPDF+QSV LKYVKLGY+Y+I+N L L   +PL+ V+  +E GS M  + +  +
Sbjct  22    IQQSRRLPDFLQSVNLKYVKLGYHYLISNLLTLC-FIPLIAVI-SIE-GSQMNLDDL-RQ  77

Query  314   IWENSGGPDFGVVNMSLL-GLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFID  490
             +W +     + +V++ +   +L F L++Y M++P P+YLVD++C +  D LK    +F++
Sbjct  78    LWLHL---KYNLVSIIICSAILVFGLTVYIMTRPRPVYLVDYSCYRAPDHLKAPCGRFME  134

Query  491   IARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAID  670
              +R +G FDE +L++ +++LE SG+G+ETY+PK++        +   R EA +++F A+D
Sbjct  135   HSRLTGDFDESSLKFQRKILERSGLGEETYVPKAMHNIPPTPSMAAAREEAEEVMFGALD  194

Query  671   KVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIAL  850
              +   T +  +DIGILVVNC+ FNPTPSLSAMI+N YK++ NI S NLGGMGCSAG+IA+
Sbjct  195   ILFRNTNVNPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAV  254

Query  851   DLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRH  1030
             DLA+D+L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR G SAVLLSN+ +D R 
Sbjct  255   DLAKDLLQVHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSKDRRR  314

Query  1031  AKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLV  1210
             AKY+L H+VRTH+GA D+AFR +YQE+D     G+ +SKDL+ + G ALK NITTLGPLV
Sbjct  315   AKYKLIHVVRTHRGADDKAFRCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLV  374

Query  1211  LPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQN  1390
             LP++EQL FF TL+ +KLF A  KPYIPD+ +AF+HFCI+A  + ++DEL++NL+L   +
Sbjct  375   LPISEQLLFFTTLLVKKLFNASVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVH  434

Query  1391  MEASRATLHRFGNT  1432
             +EASR TLHRFGNT
Sbjct  435   VEASRMTLHRFGNT  448



>ref|XP_010474700.1| PREDICTED: 3-ketoacyl-CoA synthase 1 [Camelina sativa]
Length=528

 Score =   426 bits (1095),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/435 (48%), Positives = 302/435 (69%), Gaps = 5/435 (1%)
 Frame = +2

Query  134   VRVRRRLPDFVQSvklkyvklgyyyvIN--NWLCLAATVPLLTVVFGVEVGSVMRGEKVW  307
             +R+RRRLPD + SVKLKYVKLG +   N    L     +PL   V     G  +      
Sbjct  28    IRIRRRLPDLLTSVKLKYVKLGLHNSCNLTTILFFLIILPLAGTVLVQLTGLTL---DTL  84

Query  308   GKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFI  487
              ++W N      G   ++ L  L F L++Y  ++  PIYLVDF+C KP ++ K++ D F+
Sbjct  85    SELWSNQAVQLDGATRLACLVFLCFVLTLYVANRSKPIYLVDFSCYKPEEERKISVDSFL  144

Query  488   DIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAI  667
              +  ++G+F E  +E+ +R+   +G+GDETY+P+ I        ++  R EA  ++F A+
Sbjct  145   TMTEENGSFTEDTVEFQQRISSRAGLGDETYLPRGITSKPPKLNMSEARAEAEAVMFGAL  204

Query  668   DKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIA  847
             D + EKT I+  ++GIL+VNC+ FNPTPSLSAMI+NHYKM+ +I S NLGGMGCSAG+I+
Sbjct  205   DSLFEKTGIKPAEVGILIVNCSLFNPTPSLSAMIVNHYKMREDIKSYNLGGMGCSAGLIS  264

Query  848   LDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYR  1027
             +DLA ++L+ANPN YA+VVSTE ++  WY GN RSML+ NC FR G +A+LLSNRR+D +
Sbjct  265   IDLANNLLKANPNSYAVVVSTENITLNWYFGNDRSMLLCNCIFRMGGAAILLSNRRQDRK  324

Query  1028  HAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPL  1207
              +KY L ++VRTH+G+ D+ +  +YQ+ED     G+ ++++L+ V G+ALK NITTLGP+
Sbjct  325   KSKYSLVNVVRTHKGSDDKNYNCVYQKEDERGTIGVSLARELMSVAGDALKTNITTLGPM  384

Query  1208  VLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQ  1387
             VLPL+EQL F  +L++RK+F  K KPYIPD+ +AFEHFCI+A  + +LDE+++NL L + 
Sbjct  385   VLPLSEQLMFLISLVKRKMFKLKVKPYIPDFKLAFEHFCIHAGGRAVLDEVQKNLDLKDW  444

Query  1388  NMEASRATLHRFGNT  1432
             +ME SR TLHRFGNT
Sbjct  445   HMEPSRMTLHRFGNT  459



>ref|XP_010690872.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Beta vulgaris subsp. vulgaris]
Length=508

 Score =   425 bits (1093),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 221/429 (52%), Positives = 309/429 (72%), Gaps = 6/429 (1%)
 Frame = +2

Query  146   RRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWEN  325
             RRLPDF+QSV LKYVKLGY+Y++ + L L   +PL++V+  +   S M+ + V+  +W +
Sbjct  19    RRLPDFLQSVNLKYVKLGYHYLMTHLLTLC-LIPLMSVI--LIQASQMQYDDVY-HLWVH  74

Query  326   SGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKS  505
                  F V+    + + GFTL  Y M++P  IYLVDF+   P +  KV    F++ +R +
Sbjct  75    LKYNIFSVIICCTILVFGFTL--YIMTRPRSIYLVDFSLYYPPNKFKVKFSDFVEHSRLT  132

Query  506   GTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEK  685
             G F+E +L++ +++LE SG+G+ET +P+++        +   R E+ Q++F A++ +L  
Sbjct  133   GDFEESSLDFQRKILERSGLGEETVVPEAMHSIPPRPSMQAAREESEQVMFSALENLLSH  192

Query  686   TRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARD  865
             T I+ +DIGILVVNC+ FNPTPSLSAMI+N +K++ NI S NLGGMGCSAG+IA+DLA+D
Sbjct  193   TGIKTKDIGILVVNCSLFNPTPSLSAMIVNKFKLRGNIKSFNLGGMGCSAGVIAIDLAKD  252

Query  866   ILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRL  1045
             +L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR G S VLLSN+  D   AKYRL
Sbjct  253   MLQVHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGSVVLLSNKSIDRARAKYRL  312

Query  1046  QHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTE  1225
              H+VRTH+GA D+AF+ +YQE+D     G+ +SKDL+ + G+ALK NITTLGPLVLP++E
Sbjct  313   VHVVRTHRGADDKAFKCVYQEQDDVGKTGVSLSKDLMAIAGDALKTNITTLGPLVLPISE  372

Query  1226  QLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASR  1405
             QL FF TL+ RK F  K KPYIPD+ +AFEHFCI+A  + ++DEL++NL LS  ++EASR
Sbjct  373   QLLFFFTLVVRKFFNVKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLELSSVHVEASR  432

Query  1406  ATLHRFGNT  1432
              TLHRFGNT
Sbjct  433   MTLHRFGNT  441



>ref|XP_010932851.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Elaeis guineensis]
Length=521

 Score =   426 bits (1094),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 197/359 (55%), Positives = 270/359 (75%), Gaps = 5/359 (1%)
 Frame = +2

Query  371   LLGFTLS-----IYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGTFDEKNLEY  535
             LLG TL+     +YFM++P PIYL+DFAC KP D  K T++ F++ + ++G F E+NL +
Sbjct  89    LLGLTLTASLATLYFMTRPRPIYLLDFACYKPDDARKCTRELFMERSAQAGVFTEENLAF  148

Query  536   LKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTRIRARDIGI  715
              K++LE SG+G  TY P ++        +   R EA  ++F AID++LEKT+++A+DIGI
Sbjct  149   QKKILERSGLGQSTYFPDAVLNVPPNPCMAEARKEAEMVMFGAIDELLEKTKVKAKDIGI  208

Query  716   LVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDILRANPNRYA  895
             LVVNC+ FNPTPSLSAM++NHYK++ NI+S NLGGMGCSAG+I++DLA+ +L+   N YA
Sbjct  209   LVVNCSLFNPTPSLSAMVVNHYKLRGNIISYNLGGMGCSAGLISIDLAKQLLQVQRNSYA  268

Query  896   LVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQHIVRTHQGA  1075
             LVVS E ++  WY GN+RSML+ NC FR G +A+LL+NR  D   +KY+L H VRTH+GA
Sbjct  269   LVVSMENITLNWYLGNNRSMLLSNCLFRMGGAAILLTNRHSDRHRSKYQLIHTVRTHKGA  328

Query  1076  KDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQLYFFQTLIR  1255
              DR++  ++QEED     G+ +SKDL+ V GEALK NITTLGPLVLP++EQL F  TL+ 
Sbjct  329   DDRSYSCVFQEEDSNGTTGVALSKDLMAVAGEALKTNITTLGPLVLPMSEQLLFLLTLVG  388

Query  1256  RKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             +K+F  K KPYIPD+ +AFEHFCI+A  + +LDEL++NL+LS+ +ME SR TL+RFGNT
Sbjct  389   KKIFKMKVKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLQLSDWHMEPSRMTLYRFGNT  447



>ref|XP_010054134.1| PREDICTED: 3-ketoacyl-CoA synthase 1 [Eucalyptus grandis]
 gb|KCW78506.1| hypothetical protein EUGRSUZ_D02646 [Eucalyptus grandis]
Length=557

 Score =   427 bits (1097),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 224/445 (50%), Positives = 311/445 (70%), Gaps = 6/445 (1%)
 Frame = +2

Query  110   DAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVM  289
             D  + +  +++RR LPDF+QSVKLKYVKLGY Y  +    L   V LL +V  + +    
Sbjct  28    DKDSSSAVIKIRRSLPDFLQSVKLKYVKLGYGYSCDLAPVLK-FVLLLPLVLAIVIHLTG  86

Query  290   RGEKVWGKIWENSGGPDFGVVNMSLL----GLLGFTLSIYFMSKPMPIYLVDFACCKPSD  457
               +    ++W  S       ++ S+     GL    L +Y   +  P+YLVDFAC  P D
Sbjct  87    LDQAHLSEVWR-SPAAVLDSIDASMARACSGLFLLLLVLYVSKRTRPVYLVDFACYLPED  145

Query  458   DLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRG  637
             + K++ + F+ ++ +SG F+E  L++ +R+   SG+GDETY P+ I        +   R 
Sbjct  146   ERKMSVESFLQMSEESGAFEEDTLQFQRRISSRSGLGDETYFPRGITSKPPNLCMEEARL  205

Query  638   EASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLG  817
             EA  ++F A+D +L+KT ++  D+GILVVNC+ FNPTPSLSAMI+NHYK++ +I S NLG
Sbjct  206   EAEAVMFGAVDALLKKTGVKTEDVGILVVNCSLFNPTPSLSAMIVNHYKLRTDIKSYNLG  265

Query  818   GMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAV  997
             GMGCSAG+I++DLA+++L+ANPN YALVVSTE ++  WY GN +SML+ NC FR GC+AV
Sbjct  266   GMGCSAGLISIDLAQNLLKANPNTYALVVSTENITLNWYFGNDKSMLLCNCIFRMGCAAV  325

Query  998   LLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEAL  1177
             LLSNR RD   +KY+L H VRTH+GA DR +R +YQ+ED +   G+ ++K+L+ V GEAL
Sbjct  326   LLSNRGRDRGRSKYQLVHTVRTHRGADDRNYRCVYQKEDGQGTVGVSLAKELMTVAGEAL  385

Query  1178  KANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDE  1357
             K NITTLGPLVLP TEQ  FF TL+RRK+ GAK KPYIPD+ +AFEHFCI+A  + +LDE
Sbjct  386   KINITTLGPLVLPWTEQFKFFVTLVRRKVMGAKVKPYIPDFKLAFEHFCIHAGGRAVLDE  445

Query  1358  LKRNLRLSEQNMEASRATLHRFGNT  1432
             +++N++LS+++ME SR TLHRFGNT
Sbjct  446   IQKNMQLSDRHMEPSRMTLHRFGNT  470



>gb|AGK29991.1| 3-ketoacyl-CoA synthase 7 [Gossypium raimondii]
Length=510

 Score =   425 bits (1093),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 221/427 (52%), Positives = 307/427 (72%), Gaps = 6/427 (1%)
 Frame = +2

Query  152   LPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWENSG  331
             LPDF +SVKLKYVKLGY+Y+I + + L  T  ++ +   +   SV    K    +WE+  
Sbjct  18    LPDFKKSVKLKYVKLGYHYLITHGMYLFLTPLVVVIAAQLSTFSV----KDLFDLWEHLQ  73

Query  332   GPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKSGT  511
                  V+  S   LL F  ++YF+++P P+YLV+FAC KP +  K TK  F+D ++ +GT
Sbjct  74    YNLISVIICS--ALLVFLSTLYFLTRPRPVYLVNFACYKPEESRKCTKRMFVDQSQLTGT  131

Query  512   FDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEKTR  691
             F E+NL++ +R+LE SG+GD TY+P+++        ++  R EA  ++F AID++L KT 
Sbjct  132   FTEENLQFQRRILERSGLGDSTYLPEAVLNIPPNPSMHEARKEAEAVMFGAIDELLAKTS  191

Query  692   IRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARDIL  871
             ++ +DIGIL+VNC+ FNPTPSLSAM+INHYK++ NI S NLGGMGCSAG+I++DLA+ +L
Sbjct  192   VKPKDIGILIVNCSLFNPTPSLSAMVINHYKLRGNIQSYNLGGMGCSAGLISIDLAKHLL  251

Query  872   RANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRLQH  1051
             + +PN YALV+S E ++  WY GN RS L+ NC FR G +A+LLSN+  D R +KY+L H
Sbjct  252   QVHPNSYALVISMENITLNWYFGNDRSKLVSNCLFRMGGAAILLSNKWSDERRSKYQLVH  311

Query  1052  IVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTEQL  1231
              VRTH+G+ D+ F  + QEED     G+ +SKDL+ V G+ALK NITTLGPLVLP++EQL
Sbjct  312   TVRTHKGSDDKCFSCVTQEEDSIGKIGVTLSKDLMAVAGDALKTNITTLGPLVLPMSEQL  371

Query  1232  YFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASRAT  1411
              FF TL+ +KLF  K KPYIPD+ +AFEHFCI+A  + +LDEL++NL+LSE +ME SR T
Sbjct  372   LFFATLVGKKLFKMKVKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLQLSEWHMEPSRMT  431

Query  1412  LHRFGNT  1432
             L+RFGNT
Sbjct  432   LYRFGNT  438



>ref|XP_010530834.1| PREDICTED: 3-ketoacyl-CoA synthase 9 isoform X1 [Tarenaya hassleriana]
 ref|XP_010530836.1| PREDICTED: 3-ketoacyl-CoA synthase 9 isoform X2 [Tarenaya hassleriana]
Length=515

 Score =   425 bits (1093),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 225/449 (50%), Positives = 321/449 (71%), Gaps = 25/449 (6%)
 Frame = +2

Query  131   SVRVR-----RRLPDFVQSvklkyvklgyyyvINN-W-LCLAATVPLLTVVFGVEVGSVM  289
             SV++R     R+LP+F+QSV +KYVKLGY+Y+I + W LCL   VPL+ +V  +E   + 
Sbjct  10    SVQIRTQDGTRKLPNFLQSVNMKYVKLGYHYIITHMWKLCL---VPLMAIV-ALEASRLS  65

Query  290   RGE--KVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDL  463
               +   +W  +  N      GV+  S   +L F  ++Y M++P  ++LVD++C KP   +
Sbjct  66    PDDLRHLWIHLQYNL----VGVIVFS--AVLVFGSTVYIMTRPRSVFLVDYSCYKPPSHM  119

Query  464   KVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEA  643
             +V   +F+D +R    FD+ +L++ +++LE SG+G+ETY+P+++ C      +   R EA
Sbjct  120   QVKFQKFMDHSRLIEDFDDSSLQFQRKILERSGLGEETYLPEALHCIPPKPTMAAAREEA  179

Query  644   SQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGM  823
              Q++F A+D + E T+I+ RDIGILVVNC+ FNPTPSLSAMIIN YK++ NI S NLGGM
Sbjct  180   EQVMFGALDSLFENTKIKPRDIGILVVNCSLFNPTPSLSAMIINKYKLRGNIKSYNLGGM  239

Query  824   GCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLL  1003
             GCSAG+I++DLA+D+L+ + N YA+VVSTE ++  WY GN +SMLIPNC FR G +A+LL
Sbjct  240   GCSAGVISIDLAKDLLQVHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGAAMLL  299

Query  1004  SNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKA  1183
             SN+  D R +KY+L H +RTH+GA D+AF+ +YQE+D     G+ +SKDL+ + GEALK 
Sbjct  300   SNKSGDRRRSKYKLVHTIRTHKGADDKAFKCVYQEQDDNGKTGVSLSKDLMAIAGEALKT  359

Query  1184  NITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAA------SKM  1345
             NITTLGPLVLP++EQL FF TL+ ++LF AK KPYIPD+ +AFEHFCI+A        + 
Sbjct  360   NITTLGPLVLPISEQLLFFMTLVAKRLFNAKIKPYIPDFKLAFEHFCIHAGGRAGIDERA  419

Query  1346  LLDELKRNLRLSEQNMEASRATLHRFGNT  1432
             ++DEL++NL+LS  ++EASR TLHRFGNT
Sbjct  420   VIDELEKNLQLSPTHVEASRMTLHRFGNT  448



>ref|XP_009779614.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like [Nicotiana sylvestris]
Length=518

 Score =   425 bits (1093),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 223/431 (52%), Positives = 317/431 (74%), Gaps = 12/431 (3%)
 Frame = +2

Query  149   RLPDFVQSvklkyvklgyyyvINN--WLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWE  322
             +LP+F+ SVKLKYVKLGY+Y+I++  +LCL   VP+L  V  V + ++   E V  ++W 
Sbjct  22    KLPNFLLSVKLKYVKLGYHYLISHVMYLCL---VPILGAV-SVHLSTLTVEEVV--QLWY  75

Query  323   NSGGPDFGVVNMSLL-GLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIAR  499
                   F +V + L   L+ F  ++YFM++P  +YLVDF+C KP  D    K+ F++ ++
Sbjct  76    QL---KFNLVTVLLCSALMVFLATLYFMTRPRKVYLVDFSCYKPKPDFMCPKELFMERSK  132

Query  500   KSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVL  679
             ++G F ++NL + K++LE SG+G +TY P+++        +   R EA  ++F AID++L
Sbjct  133   EAGIFIDENLAFQKKILERSGLGQKTYFPEALLKVPPNPCMAEARKEAEMVMFGAIDELL  192

Query  680   EKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLA  859
             EKT ++A+DIGILVVNC+ FNPTPSLSAMI+NHYK++ NI+S NLGGMGCSAG+I++DLA
Sbjct  193   EKTGVKAKDIGILVVNCSLFNPTPSLSAMIVNHYKLRGNIMSYNLGGMGCSAGLISIDLA  252

Query  860   RDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKY  1039
             + +L+ +PN YALVVS E ++  WY GN+RSML+ NC FR G +A+LLSN+  D R +KY
Sbjct  253   KQMLQVHPNSYALVVSMENITLNWYFGNNRSMLVSNCIFRMGGAAILLSNKSSDRRRSKY  312

Query  1040  RLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPL  1219
             +L H VRTH+GA D+++  ++QEED  +  G+ +SKDL+ V GEALK NITTLGP+VLP+
Sbjct  313   QLIHTVRTHKGADDKSYSCVFQEEDDNKKIGVALSKDLMAVAGEALKTNITTLGPIVLPM  372

Query  1220  TEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEA  1399
             +EQL FF TL+ RK+F  K KPYIPD+ +AFEHFCI+A  + +LDEL++NL LS+ +ME 
Sbjct  373   SEQLLFFITLVARKVFKMKIKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLELSQWHMEP  432

Query  1400  SRATLHRFGNT  1432
             SR TL+RFGNT
Sbjct  433   SRMTLYRFGNT  443



>ref|XP_009374066.1| PREDICTED: 3-ketoacyl-CoA synthase 11 [Pyrus x bretschneideri]
Length=518

 Score =   425 bits (1093),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 222/429 (52%), Positives = 306/429 (71%), Gaps = 6/429 (1%)
 Frame = +2

Query  146   RRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWEN  325
             R LPDF +S+KLKYVKLGY+ +I + + L  +   L VV   ++ +     K    +WE+
Sbjct  24    RNLPDFKKSIKLKYVKLGYHILITHGMYLFLSP--LVVVIAAQISTF--SLKDLYDLWEH  79

Query  326   SGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARKS  505
                    V+  S   LL F  ++YF+++P P+YLV+F+C KP +  K TK  F++ ++ +
Sbjct  80    LQYNLISVIICS--TLLVFLSTVYFVTRPRPVYLVNFSCYKPEESRKCTKKIFMEQSQMT  137

Query  506   GTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLEK  685
             GTF E NL++ +R+LE SG+GD TY+P+++        +   R EA  ++F AID++L K
Sbjct  138   GTFTEDNLQFQRRILERSGLGDSTYLPEAVLNIPPNPSMKEARKEAEAVMFGAIDELLAK  197

Query  686   TRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLARD  865
             T ++ +DIGIL+VNC+ FNPTPSLSAM+INHY+++ NIVS NLGGMGCSAG+I++DLA++
Sbjct  198   TAVKPKDIGILIVNCSLFNPTPSLSAMVINHYQLRGNIVSYNLGGMGCSAGLISIDLAKN  257

Query  866   ILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYRL  1045
             +L+ +PN YALV+S E ++  WY GN RS L+ NC FR G +AVLLSN+  D R +KYRL
Sbjct  258   LLQVHPNSYALVISMENITLNWYFGNDRSKLVSNCLFRMGGAAVLLSNKSSDKRRSKYRL  317

Query  1046  QHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLTE  1225
              H VRTH+GA D+ F  + QEED     G+ +SKDL+ V G+ALK NITTLGPLVLP++E
Sbjct  318   VHTVRTHKGADDKCFSCVTQEEDDNGKIGVTLSKDLMAVAGDALKTNITTLGPLVLPMSE  377

Query  1226  QLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEASR  1405
             QL FF TLI RKLF  K KPYIPD+ +AFEHFCI+A  + +LDEL++NL LS+ +ME SR
Sbjct  378   QLLFFATLIGRKLFKMKIKPYIPDFRLAFEHFCIHAGGRAVLDELEKNLHLSDWHMEPSR  437

Query  1406  ATLHRFGNT  1432
              TL+RFGNT
Sbjct  438   MTLYRFGNT  446



>ref|XP_009606335.1| PREDICTED: 3-ketoacyl-CoA synthase 1 [Nicotiana tomentosiformis]
Length=532

 Score =   426 bits (1094),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 219/440 (50%), Positives = 310/440 (70%), Gaps = 15/440 (3%)
 Frame = +2

Query  134   VRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMR--GEKV-  304
             +++RR+LPDF+QSVKLKYVKLGY      + C  AT+ LL  +  V   ++++  G K+ 
Sbjct  27    IKIRRKLPDFLQSVKLKYVKLGY-----GYSCNPATLLLLVTILPVVTLTLIQLTGLKLD  81

Query  305   -WGKIWENSGGPDFGVVNMSLLG---LLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVT  472
              +  IW +   P   V   + L    +L F L IY++ KP P+YLVDFAC KP D+ K++
Sbjct  82    RFSDIWTS---PTLLVDTSTGLAGSIVLFFFLGIYYVKKPRPVYLVDFACYKPEDERKMS  138

Query  473   KDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQL  652
              D F+ +  ++G F ++ + + KR+ E SG+GDETY P+ I        +   R EA  +
Sbjct  139   VDSFLKMTEENGAFTDETIVFQKRISERSGLGDETYFPRGITSNPPNLCMKEARAEAETV  198

Query  653   IFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCS  832
             +F A+D++  KT+++  +IGIL+VNC+ FNPTPSLS+MI+NHYK+K +I S NLGGMGCS
Sbjct  199   MFGALDQLFAKTKVKPEEIGILIVNCSLFNPTPSLSSMIVNHYKLKTDIKSYNLGGMGCS  258

Query  833   AGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNR  1012
             AG+I++DLA+ +L+ANPN YA+VVS E ++  WY GN RSML+ NC FR G +A+LLSN+
Sbjct  259   AGLISIDLAKHLLKANPNTYAVVVSMENITLNWYFGNDRSMLLCNCIFRMGGAAMLLSNK  318

Query  1013  RRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANIT  1192
              +D   +KY L H VRTH+GA D ++  +YQ ED + + G+ ++++L+ V G+ALK NIT
Sbjct  319   SKDRTRSKYELVHTVRTHKGADDNSYNCVYQREDDKGVIGVSLARELMAVAGDALKTNIT  378

Query  1193  TLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNL  1372
             TLGPLVLPL+EQ  FF TL++RK+  AK KPYIPD+ +AFEHFCI+A  + +LDE++ NL
Sbjct  379   TLGPLVLPLSEQFRFFVTLVKRKMLKAKVKPYIPDFKLAFEHFCIHAGGRAVLDEIQNNL  438

Query  1373  RLSEQNMEASRATLHRFGNT  1432
              LS+ +ME SR TLHRFGNT
Sbjct  439   NLSDWHMEPSRMTLHRFGNT  458



>gb|EMT15934.1| 3-ketoacyl-CoA synthase 11 [Aegilops tauschii]
Length=518

 Score =   425 bits (1093),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 219/430 (51%), Positives = 313/430 (73%), Gaps = 8/430 (2%)
 Frame = +2

Query  146   RRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVEVGSVMRGEKVWGKIWEN  325
             RRLPDF+QSV+LKYVKLGY+++I++   L  + PL+ +V  V++ +V  G+     +WE 
Sbjct  20    RRLPDFLQSVRLKYVKLGYHHLISHGTYLLLS-PLMALV-AVQLSTVSPGD--LADLWEQ  75

Query  326   SGGPDFGVVNMSLLG-LLGFTLSIYFMSKPMPIYLVDFACCKPSDDLKVTKDQFIDIARK  502
                  F +V++ +   LL F  ++YF+++P P+YLVDFAC KP  + + T+  F+  +  
Sbjct  76    L---RFNLVSVLVCSTLLVFLSTVYFLTRPRPVYLVDFACYKPEPERRCTRQTFMRCSEA  132

Query  503   SGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIRGEASQLIFEAIDKVLE  682
             +G+F + NL++ +++LE SG+G++TY+P ++        ++  R EAS ++F AID++LE
Sbjct  133   TGSFTDANLDFQRKILERSGLGEDTYLPPAVLRVPPNPCMDEARKEASTVMFGAIDQLLE  192

Query  683   KTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNLGGMGCSAGIIALDLAR  862
             KT +R +DIGILVVNC+ FNPTPSLSAM++NHY+++ N+VS NLGGMGCSAG++++DLA+
Sbjct  193   KTGVRPKDIGILVVNCSLFNPTPSLSAMVVNHYRLRGNVVSYNLGGMGCSAGLLSIDLAK  252

Query  863   DILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSAVLLSNRRRDYRHAKYR  1042
             D+L+ +PN YALV+S E ++  WY GN RSML+ NC FR G +A+LLSNRR D R +KY 
Sbjct  253   DLLQVHPNSYALVISMENITLNWYFGNDRSMLVSNCLFRMGGAAILLSNRRADRRRSKYE  312

Query  1043  LQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEALKANITTLGPLVLPLT  1222
             L H VRTH+GA DR F  + Q+ED     G+ +SKDL+     ALK NITTLGPLVLPL+
Sbjct  313   LVHTVRTHKGADDRCFGCVTQQEDSAGKVGVSLSKDLMAWAVAALKTNITTLGPLVLPLS  372

Query  1223  EQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLDELKRNLRLSEQNMEAS  1402
             EQL F  TL+ +K F  K KPYIPD+ +AFEHFCI+A  + +L+EL++NL L+E +ME S
Sbjct  373   EQLLFMATLVAKKAFKVKIKPYIPDFKLAFEHFCIHAGGRAVLNELEKNLGLTEWHMEPS  432

Query  1403  RATLHRFGNT  1432
             R TL+RFGNT
Sbjct  433   RMTLYRFGNT  442



>ref|XP_009348198.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Pyrus x bretschneideri]
Length=516

 Score =   425 bits (1093),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 224/446 (50%), Positives = 309/446 (69%), Gaps = 6/446 (1%)
 Frame = +2

Query  95    EPSGPDAGALTFSVRVRRRLPDFVQSvklkyvklgyyyvINNWLCLAATVPLLTVVFGVE  274
             +P  P     + S    R LPDF  SVKLKYVKLGY+ +I + + L  +   L VV   +
Sbjct  5     KPDTPLIPPSSSSPSSSRNLPDFKNSVKLKYVKLGYHILITHGMYLFLSP--LVVVIAAQ  62

Query  275   VGSVMRGEKVWGKIWENSGGPDFGVVNMSLLGLLGFTLSIYFMSKPMPIYLVDFACCKPS  454
             + +     K    +WE+       V+  S   LL F  ++YF+++P P+YLV+F+C KP 
Sbjct  63    ISTF--SLKDLYDLWEHLQYNLISVIICS--TLLVFLSTVYFVTRPRPVYLVNFSCYKPE  118

Query  455   DDLKVTKDQFIDIARKSGTFDEKNLEYLKRMLESSGIGDETYIPKSIGCPEKIKKLNNIR  634
             +  K TK  F++ ++ +GTF E NL++ +R+LE SG+GD TY+P+++        +   R
Sbjct  119   ESRKCTKKIFMEQSQMTGTFTEDNLQFQRRILERSGLGDSTYLPEAVLNIPPNPSMKEAR  178

Query  635   GEASQLIFEAIDKVLEKTRIRARDIGILVVNCNTFNPTPSLSAMIINHYKMKRNIVSTNL  814
              EA  ++F AID++  KT ++ +DIGIL+VNC+ FNPTPSLSAM+INHY+++ NIVS NL
Sbjct  179   KEAEAVMFGAIDELFAKTAVKPKDIGILIVNCSLFNPTPSLSAMVINHYQLRGNIVSYNL  238

Query  815   GGMGCSAGIIALDLARDILRANPNRYALVVSTEIVSATWYSGNHRSMLIPNCFFRTGCSA  994
             GGMGCSAG+I++DLA+++L+ +PN YALV+S E ++  WY GN RS L+ NC FR G +A
Sbjct  239   GGMGCSAGLISIDLAKNLLQVHPNSYALVISMENITLNWYFGNDRSKLVSNCLFRMGGAA  298

Query  995   VLLSNRRRDYRHAKYRLQHIVRTHQGAKDRAFRSIYQEEDVERIKGLKISKDLVEVGGEA  1174
             +LLSN+  D R +KYRL H VRTH+GA D+ F  + QEED     G+ +SKDL+ V G+A
Sbjct  299   ILLSNKSSDKRRSKYRLVHTVRTHKGADDKCFSCVTQEEDDNGKIGVTLSKDLMAVAGDA  358

Query  1175  LKANITTLGPLVLPLTEQLYFFQTLIRRKLFGAKTKPYIPDYTIAFEHFCINAASKMLLD  1354
             LK NITTLGPLVLP++EQL FF TL+ RKLF  K KPYIPD+ +AFEHFCI+A  + +LD
Sbjct  359   LKTNITTLGPLVLPMSEQLLFFATLVGRKLFKMKIKPYIPDFRLAFEHFCIHAGGRAVLD  418

Query  1355  ELKRNLRLSEQNMEASRATLHRFGNT  1432
             EL++NL LS+ +ME SR TLHRFGNT
Sbjct  419   ELEKNLHLSDWHMEPSRMTLHRFGNT  444



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3863858971050