BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13557_g1_i1 len=1374 path=[53:0-1165 26:1166-1373]

Length=1374
                                                                      Score     E

emb|CAN82498.1|  hypothetical protein VITISV_026906                     107   1e-22   Vitis vinifera
ref|XP_010658253.1|  PREDICTED: ethylene-responsive transcription...    107   1e-22   
emb|CBI25453.3|  unnamed protein product                                108   6e-22   
ref|XP_008369406.1|  PREDICTED: ethylene-responsive transcription...    105   1e-21   
ref|XP_007008915.1|  Integrase-type DNA-binding superfamily prote...    103   4e-21   
ref|XP_011076671.1|  PREDICTED: ethylene-responsive transcription...    103   5e-21   
ref|XP_003616666.1|  Ethylene-responsive transcription factor           102   6e-21   
ref|XP_007221036.1|  hypothetical protein PRUPE_ppa015230mg             103   6e-21   
ref|XP_008233783.1|  PREDICTED: ethylene-responsive transcription...    102   8e-21   
ref|XP_010105435.1|  Ethylene-responsive transcription factor ABI4      102   9e-21   
ref|XP_006435774.1|  hypothetical protein CICLE_v10033578mg             102   9e-21   
emb|CDP13992.1|  unnamed protein product                                102   1e-20   
gb|KDO68917.1|  hypothetical protein CISIN_1g038194mg                   102   1e-20   
ref|XP_009619856.1|  PREDICTED: ethylene-responsive transcription...    102   1e-20   
ref|XP_009776130.1|  PREDICTED: ethylene-responsive transcription...    101   1e-20   
gb|KDP44732.1|  hypothetical protein JCGZ_01232                         101   2e-20   
ref|XP_010034147.1|  PREDICTED: ethylene-responsive transcription...    101   2e-20   
ref|XP_002312168.2|  GLUCOSE INSENSITIVE 6 family protein               100   3e-20   Populus trichocarpa [western balsam poplar]
ref|XP_004308946.1|  PREDICTED: ethylene-responsive transcription...    100   3e-20   
ref|XP_008362743.1|  PREDICTED: ethylene-responsive transcription...    100   3e-20   
ref|XP_010689445.1|  PREDICTED: ethylene-responsive transcription...    100   4e-20   
gb|EYU20036.1|  hypothetical protein MIMGU_mgv1a024901mg                100   4e-20   
ref|XP_004491058.1|  PREDICTED: ethylene-responsive transcription...    100   5e-20   
ref|XP_010260885.1|  PREDICTED: ethylene-responsive transcription...  99.4    5e-20   
ref|XP_007141749.1|  hypothetical protein PHAVU_008G222400g           99.8    6e-20   
gb|KHN38522.1|  Ethylene-responsive transcription factor ABI4         97.4    6e-20   
ref|NP_001235932.1|  SGR                                              99.8    6e-20   
ref|XP_011000614.1|  PREDICTED: ethylene-responsive transcription...    100   7e-20   
ref|XP_002528318.1|  hypothetical protein RCOM_0839150                99.8    1e-19   Ricinus communis
ref|XP_004138561.1|  PREDICTED: uncharacterized protein LOC101216152  97.8    2e-19   
ref|XP_010937905.1|  PREDICTED: ethylene-responsive transcription...  97.4    2e-19   
gb|EPS59065.1|  abscisic acid insensitive 4-1                         97.1    3e-19   
ref|XP_008441640.1|  PREDICTED: ethylene-responsive transcription...  97.1    4e-19   
gb|ABO48359.1|  abscisic acid insensitive 4-1                         97.4    4e-19   Populus trichocarpa [western balsam poplar]
gb|AEK86261.1|  putative ABI4-like protein                            97.4    4e-19   
ref|XP_008794303.1|  PREDICTED: ethylene-responsive transcription...  94.0    5e-19   
gb|AAT44957.1|  putative AP2/EREBP transcription factor               97.1    6e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002315150.1|  GLUCOSE INSENSITIVE 6 family protein             98.2    6e-19   Populus trichocarpa [western balsam poplar]
ref|XP_010505746.1|  PREDICTED: ethylene-responsive transcription...  97.1    6e-19   
ref|NP_181551.1|  ethylene-responsive transcription factor ABI4       97.1    6e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010508893.1|  PREDICTED: ethylene-responsive transcription...  97.1    6e-19   
gb|ABK28529.1|  unknown                                               97.1    6e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010920980.1|  PREDICTED: ethylene-responsive transcription...  96.3    8e-19   
ref|XP_010517437.1|  PREDICTED: ethylene-responsive transcription...  96.7    8e-19   
gb|ABO48360.1|  abscisic acid insensitive 4-2                         96.3    9e-19   Populus trichocarpa [western balsam poplar]
ref|XP_009392069.1|  PREDICTED: ethylene-responsive transcription...  95.9    1e-18   
ref|XP_006296102.1|  hypothetical protein CARUB_v10025253mg           96.3    1e-18   
emb|CDY07614.1|  BnaA03g18970D                                        95.9    2e-18   
ref|XP_006411275.1|  hypothetical protein EUTSA_v10017614mg           95.5    2e-18   
emb|CDY52427.1|  BnaC03g72510D                                        95.5    2e-18   
ref|XP_009418042.1|  PREDICTED: ethylene-responsive transcription...  94.4    2e-18   
ref|XP_009133423.1|  PREDICTED: ethylene-responsive transcription...  95.5    2e-18   
ref|XP_009400145.1|  PREDICTED: ethylene-responsive transcription...  94.7    2e-18   
ref|XP_002881702.1|  predicted protein                                93.2    7e-18   
ref|XP_009143236.1|  PREDICTED: ethylene-responsive transcription...  93.2    9e-18   
ref|XP_010554674.1|  PREDICTED: ethylene-responsive transcription...  94.0    1e-17   
emb|CDY54991.1|  BnaCnng27900D                                        93.2    1e-17   
ref|XP_003568646.1|  PREDICTED: ethylene-responsive transcription...  90.9    2e-17   
ref|XP_011035901.1|  PREDICTED: ethylene-responsive transcription...  93.2    3e-17   
ref|XP_008649551.1|  PREDICTED: ethylene-responsive transcription...  87.8    4e-16   
ref|XP_004963859.1|  PREDICTED: ethylene-responsive transcription...  87.4    5e-16   
ref|XP_002440922.1|  hypothetical protein SORBIDRAFT_09g016550        87.4    5e-16   Sorghum bicolor [broomcorn]
ref|XP_009345774.1|  PREDICTED: ethylene-responsive transcription...  88.6    7e-16   
ref|NP_001174376.1|  Os05g0351200                                     84.0    1e-14   
gb|EAY97659.1|  hypothetical protein OsI_19581                        84.0    1e-14   Oryza sativa Indica Group [Indian rice]
gb|AAV44075.1|  hypothetical protein                                  84.0    1e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002980956.1|  hypothetical protein SELMODRAFT_420500           79.7    1e-13   
ref|XP_002989303.1|  hypothetical protein SELMODRAFT_427925           79.3    2e-13   
ref|XP_006843541.1|  hypothetical protein AMTR_s00007p00053050        81.3    2e-13   
emb|CDP18276.1|  unnamed protein product                              79.7    2e-13   
ref|XP_001773430.1|  predicted protein                                77.0    2e-13   
ref|XP_006850202.1|  hypothetical protein AMTR_s00022p00250320        78.2    9e-13   
ref|XP_002973089.1|  hypothetical protein SELMODRAFT_38502            74.3    9e-13   
emb|CDY33815.1|  BnaCnng07330D                                        75.1    9e-13   
ref|XP_004136746.1|  PREDICTED: dehydration-responsive element-bi...  76.6    1e-12   
ref|XP_004161497.1|  PREDICTED: dehydration-responsive element-bi...  76.6    1e-12   
ref|XP_009776426.1|  PREDICTED: uncharacterized protein LOC104226206  79.3    2e-12   
emb|CAT00689.1|  AP2 transcription factor                             75.5    3e-12   Antirrhinum majus [garden snapdragon]
ref|XP_006575245.1|  PREDICTED: dehydration-responsive element-bi...  75.5    3e-12   
ref|XP_010427643.1|  PREDICTED: dehydration-responsive element-bi...  76.3    4e-12   
ref|XP_003518110.1|  PREDICTED: dehydration-responsive element-bi...  76.6    4e-12   
ref|XP_010504692.1|  PREDICTED: dehydration-responsive element-bi...  76.3    4e-12   
gb|KHN48370.1|  Dehydration-responsive element-binding protein 2F     77.0    4e-12   
ref|XP_003535164.2|  PREDICTED: dehydration-responsive element-bi...  77.4    4e-12   
ref|XP_010516379.1|  PREDICTED: dehydration-responsive element-bi...  76.3    4e-12   
gb|KGN59345.1|  hypothetical protein Csa_3G812170                     77.0    4e-12   
ref|XP_007028832.1|  Integrase-type DNA-binding superfamily protein   76.3    4e-12   
ref|XP_008443124.1|  PREDICTED: dehydration-responsive element-bi...  76.6    5e-12   
gb|KFK35005.1|  hypothetical protein AALP_AA5G221900                  75.5    5e-12   
ref|XP_010524115.1|  PREDICTED: dehydration-responsive element-bi...  75.9    5e-12   
ref|XP_008776284.1|  PREDICTED: dehydration-responsive element-bi...  75.5    5e-12   
ref|XP_003625169.1|  Dehydration-responsive element-binding prote...  75.9    6e-12   
ref|XP_009340780.1|  PREDICTED: dehydration-responsive element-bi...  75.9    6e-12   
ref|XP_004493523.1|  PREDICTED: dehydration-responsive element-bi...  75.9    7e-12   
ref|XP_010265763.1|  PREDICTED: dehydration-responsive element-bi...  75.5    7e-12   
ref|XP_006291644.1|  hypothetical protein CARUB_v10017800mg           75.5    7e-12   
ref|XP_010257316.1|  PREDICTED: dehydration-responsive element-bi...  75.5    7e-12   
ref|XP_006402862.1|  hypothetical protein EUTSA_v10006489mg           75.5    7e-12   
ref|XP_008387280.1|  PREDICTED: dehydration-responsive element-bi...  75.5    7e-12   
ref|XP_008350282.1|  PREDICTED: dehydration-responsive element-bi...  75.5    7e-12   
ref|XP_009116465.1|  PREDICTED: dehydration-responsive element-bi...  75.1    8e-12   
ref|XP_002876426.1|  hypothetical protein ARALYDRAFT_486209           75.5    8e-12   
emb|CDX72012.1|  BnaC08g28620D                                        75.1    8e-12   
gb|KHN26337.1|  Dehydration-responsive element-binding protein 2F     75.5    8e-12   
ref|XP_003553420.1|  PREDICTED: dehydration-responsive element-bi...  75.5    8e-12   
ref|XP_010934576.1|  PREDICTED: dehydration-responsive element-bi...  73.6    8e-12   
ref|XP_007162244.1|  hypothetical protein PHAVU_001G136100g           75.1    8e-12   
ref|NP_191319.1|  dehydration-responsive element-binding protein 2F   75.1    8e-12   Arabidopsis thaliana [mouse-ear cress]
emb|CDY06088.1|  BnaA09g36920D                                        75.1    9e-12   
ref|XP_002526723.1|  hypothetical protein RCOM_0089590                75.5    9e-12   Ricinus communis
ref|XP_001781003.1|  predicted protein                                71.2    1e-11   
ref|XP_003520524.1|  PREDICTED: dehydration-responsive element-bi...  75.1    1e-11   
ref|XP_010940962.1|  PREDICTED: dehydration-responsive element-bi...  75.5    1e-11   
ref|XP_011033305.1|  PREDICTED: dehydration-responsive element-bi...  75.1    1e-11   
ref|XP_002323309.1|  Dehydration responsive element binding prote...  75.1    1e-11   Populus trichocarpa [western balsam poplar]
gb|ABR23508.1|  DREB2-like protein                                    76.3    1e-11   Chrysanthemum vestitum
ref|XP_002277662.2|  PREDICTED: dehydration-responsive element-bi...  75.1    1e-11   Vitis vinifera
ref|XP_004307569.1|  PREDICTED: dehydration-responsive element-bi...  75.1    1e-11   
ref|XP_008776283.1|  PREDICTED: dehydration-responsive element-bi...  75.5    1e-11   
ref|XP_004249756.1|  PREDICTED: dehydration-responsive element-bi...  75.1    1e-11   
gb|AES67310.2|  dehydration-responsive element-binding protein        73.6    1e-11   
ref|XP_009804771.1|  PREDICTED: dehydration-responsive element-bi...  74.7    1e-11   
ref|XP_002522019.1|  hypothetical protein RCOM_0610630                73.6    1e-11   Ricinus communis
ref|XP_009613454.1|  PREDICTED: dehydration-responsive element-bi...  74.7    1e-11   
ref|XP_008804145.1|  PREDICTED: dehydration-responsive element-bi...  74.3    1e-11   
ref|XP_001766084.1|  predicted protein                                70.9    1e-11   
emb|CDY20377.1|  BnaC02g24390D                                        73.6    2e-11   
ref|XP_008240865.1|  PREDICTED: dehydration-responsive element-bi...  74.7    2e-11   
ref|XP_008789182.1|  PREDICTED: ethylene-responsive transcription...  73.9    2e-11   
gb|AEI98833.1|  dehydration responsive element binding protein 1      75.1    2e-11   
ref|XP_008809802.1|  PREDICTED: dehydration-responsive element-bi...  74.7    2e-11   
ref|XP_009128106.1|  PREDICTED: dehydration-responsive element-bi...  73.2    2e-11   
ref|XP_007132590.1|  hypothetical protein PHAVU_011G107800g           73.2    2e-11   
ref|XP_002960299.1|  hypothetical protein SELMODRAFT_27203            72.4    2e-11   
gb|AFK47592.1|  unknown                                               73.6    2e-11   
ref|XP_006353419.1|  PREDICTED: dehydration-responsive element-bi...  75.1    2e-11   
ref|XP_002967414.1|  hypothetical protein SELMODRAFT_38483            70.9    2e-11   
ref|XP_009139025.1|  PREDICTED: dehydration-responsive element-bi...  73.9    2e-11   
ref|XP_006351409.1|  PREDICTED: dehydration-responsive element-bi...  74.3    2e-11   
ref|XP_007202407.1|  hypothetical protein PRUPE_ppa009616mg           74.3    2e-11   
emb|CDX88955.1|  BnaA04g02310D                                        73.9    2e-11   
ref|XP_007145629.1|  hypothetical protein PHAVU_007G255100g           74.3    2e-11   
ref|XP_010672841.1|  PREDICTED: dehydration-responsive element-bi...  74.3    2e-11   
ref|XP_010921035.1|  PREDICTED: dehydration-responsive element-bi...  73.9    2e-11   
ref|XP_008649742.1|  PREDICTED: dehydration-responsive element-bi...  73.2    2e-11   
gb|KCW65721.1|  hypothetical protein EUGRSUZ_G03094                   73.2    2e-11   
ref|XP_008233818.1|  PREDICTED: dehydration-responsive element-bi...  75.1    2e-11   
ref|XP_007218175.1|  hypothetical protein PRUPE_ppa007606mg           75.1    3e-11   
gb|ADV57357.1|  putative dehydration responsive element binding p...  72.8    3e-11   
gb|KHN29762.1|  Dehydration-responsive element-binding protein 2F     72.4    3e-11   
ref|NP_001240238.1|  uncharacterized protein LOC100783729             72.8    3e-11   
ref|XP_010091861.1|  Dehydration-responsive element-binding prote...  73.6    3e-11   
ref|XP_004513549.1|  PREDICTED: dehydration-responsive element-bi...  72.8    3e-11   
ref|XP_006421446.1|  hypothetical protein CICLE_v10005549mg           73.9    3e-11   
gb|KDP26013.1|  hypothetical protein JCGZ_21046                       73.6    3e-11   
ref|XP_006493905.1|  PREDICTED: dehydration-responsive element-bi...  73.6    3e-11   
gb|ABC49682.1|  dehydration responsive element binding protein        72.4    3e-11   Cicer arietinum [garbanzo]
ref|XP_009394631.1|  PREDICTED: dehydration-responsive element-bi...  72.8    3e-11   
gb|EYU18760.1|  hypothetical protein MIMGU_mgv1a011288mg              73.6    3e-11   
ref|XP_011075213.1|  PREDICTED: dehydration-responsive element-bi...  73.6    3e-11   
ref|XP_008804144.1|  PREDICTED: dehydration-responsive element-bi...  73.9    3e-11   
ref|XP_004302113.1|  PREDICTED: dehydration-responsive element-bi...  72.0    4e-11   
gb|AFK38091.1|  unknown                                               72.4    4e-11   
gb|AAP83131.1|  DREB                                                  72.4    4e-11   Glycine max [soybeans]
ref|XP_010067565.1|  PREDICTED: dehydration-responsive element-bi...  72.8    4e-11   
ref|XP_008799805.1|  PREDICTED: dehydration-responsive element-bi...  73.2    4e-11   
ref|XP_003597059.1|  Dehydration responsive factor                    73.2    4e-11   
ref|XP_009411347.1|  PREDICTED: dehydration-responsive element-bi...  73.6    4e-11   
gb|KEH15489.1|  dehydration-responsive element-binding protein        72.0    4e-11   
gb|KDP23749.1|  hypothetical protein JCGZ_23582                       72.4    4e-11   
ref|NP_001235466.1|  uncharacterized protein LOC100499747             72.0    4e-11   
ref|NP_001236509.1|  uncharacterized protein LOC100527471             72.0    4e-11   
ref|XP_006591847.1|  PREDICTED: uncharacterized protein LOC100527...  72.0    4e-11   
ref|XP_002308045.2|  Dehydration responsive element binding prote...  73.2    4e-11   Populus trichocarpa [western balsam poplar]
ref|XP_010057479.1|  PREDICTED: dehydration-responsive element-bi...  73.2    5e-11   
ref|XP_008664551.1|  PREDICTED: dehydration-responsive element-bi...  73.9    5e-11   
ref|XP_002444543.1|  hypothetical protein SORBIDRAFT_07g023575        74.3    5e-11   Sorghum bicolor [broomcorn]
emb|CDP10066.1|  unnamed protein product                              73.2    5e-11   
ref|NP_187713.1|  dehydration-responsive element-binding protein 2B   73.9    5e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001770012.1|  predicted protein                                69.7    5e-11   
ref|XP_006854296.1|  hypothetical protein AMTR_s00039p00088760        72.4    5e-11   
ref|XP_004487356.1|  PREDICTED: dehydration-responsive element-bi...  71.6    5e-11   
ref|XP_007149931.1|  hypothetical protein PHAVU_005G111200g           72.0    5e-11   
ref|XP_008660493.1|  PREDICTED: dehydration-responsive element-bi...  73.6    5e-11   
gb|AIB05898.1|  AP2-EREBP transcription factor                        73.6    6e-11   
ref|XP_004238613.1|  PREDICTED: dehydration-responsive element-bi...  72.4    6e-11   
ref|XP_004985522.1|  PREDICTED: dehydration-responsive element-bi...  73.6    6e-11   
ref|XP_010921034.1|  PREDICTED: dehydration-responsive element-bi...  73.2    6e-11   
ref|XP_011020328.1|  PREDICTED: dehydration-responsive element-bi...  72.8    6e-11   
ref|XP_008651496.1|  PREDICTED: dehydration-responsive element-bi...  73.2    6e-11   
gb|KFK26084.1|  hypothetical protein AALP_AA8G200700                  72.8    6e-11   
ref|XP_008230119.1|  PREDICTED: putative dehydration-responsive e...  71.2    7e-11   
gb|EAY88744.1|  hypothetical protein OsI_10219                        72.8    7e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_007216412.1|  hypothetical protein PRUPE_ppa022733mg           70.5    7e-11   
ref|XP_009764492.1|  PREDICTED: dehydration-responsive element-bi...  73.6    8e-11   
gb|EAZ25772.1|  hypothetical protein OsJ_09612                        72.8    8e-11   Oryza sativa Japonica Group [Japonica rice]
sp|Q10R18.1|DRE2E_ORYSJ  RecName: Full=Dehydration-responsive ele...  72.8    8e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010922641.1|  PREDICTED: dehydration-responsive element-bi...  72.4    8e-11   
gb|KHN36573.1|  Dehydration-responsive element-binding protein 2C     71.2    8e-11   
ref|XP_002887600.1|  hypothetical protein ARALYDRAFT_476698           71.2    8e-11   
ref|XP_008388158.1|  PREDICTED: dehydration-responsive element-bi...  72.0    8e-11   
gb|ABS11171.1|  putative DRE-binding protein DREB2                    72.0    8e-11   Avena sativa [cultivated oat]
gb|ABK59671.1|  At1g75490                                             71.2    8e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004239956.1|  PREDICTED: dehydration-responsive element-bi...  73.6    8e-11   
emb|CDY52095.1|  BnaC04g55440D                                        72.0    8e-11   
gb|ADZ15315.1|  DREB2                                                 73.6    8e-11   
ref|NP_177681.2|  dehydration-responsive element-binding protein 2D   71.2    9e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010428577.1|  PREDICTED: dehydration-responsive element-bi...  71.2    9e-11   
ref|XP_010416439.1|  PREDICTED: dehydration-responsive element-bi...  71.2    9e-11   
ref|XP_008678419.1|  PREDICTED: dehydration-responsive element-bi...  73.2    9e-11   
ref|XP_006342227.1|  PREDICTED: dehydration-responsive element-bi...  72.0    9e-11   
ref|XP_003638741.1|  Ethylene-responsive transcription factor         71.2    9e-11   
ref|XP_006302829.1|  hypothetical protein CARUB_v10020960mg           71.2    9e-11   
ref|XP_009336823.1|  PREDICTED: dehydration-responsive element-bi...  71.2    1e-10   
gb|AGE97365.1|  ethylene response factor 10                           72.4    1e-10   
emb|CBI25419.3|  unnamed protein product                              74.7    1e-10   
emb|CAB93939.1|  AP2-domain DNA-binding protein                       73.2    1e-10   Catharanthus roseus [chatas]
ref|XP_009612863.1|  PREDICTED: dehydration-responsive element-bi...  73.2    1e-10   
ref|XP_009106200.1|  PREDICTED: dehydration-responsive element-bi...  70.9    1e-10   
ref|XP_002273838.1|  PREDICTED: dehydration-responsive element-bi...  73.2    1e-10   Vitis vinifera
ref|XP_010471662.1|  PREDICTED: dehydration-responsive element-bi...  70.9    1e-10   
ref|XP_006355639.1|  PREDICTED: dehydration-responsive element-bi...  73.2    1e-10   
gb|EPS72578.1|  hypothetical protein M569_02179                       70.9    1e-10   
ref|XP_004237644.1|  PREDICTED: dehydration-responsive element-bi...  70.1    1e-10   
ref|XP_008799804.1|  PREDICTED: dehydration-responsive element-bi...  72.4    1e-10   
emb|CDY47519.1|  BnaAnng09170D                                        70.9    1e-10   
dbj|BAO00821.1|  transcription factor                                 72.4    1e-10   
gb|AHZ44784.1|  dehydration-responsive element-binding protein 2A     68.9    1e-10   
ref|XP_009135143.1|  PREDICTED: dehydration-responsive element-bi...  73.2    1e-10   
ref|XP_004293490.1|  PREDICTED: dehydration-responsive element-bi...  70.9    1e-10   
ref|XP_004499266.1|  PREDICTED: dehydration-responsive element-bi...  71.2    1e-10   
ref|XP_006828126.1|  hypothetical protein AMTR_s00023p00044590        72.8    1e-10   
ref|XP_002967543.1|  hypothetical protein SELMODRAFT_38500            68.2    1e-10   
gb|AAS82861.1|  DREB2 transcription factor                            72.0    1e-10   Helianthus annuus
gb|AIZ74387.1|  DREB1                                                 70.5    1e-10   
ref|XP_007208518.1|  hypothetical protein PRUPE_ppa026176mg           68.9    1e-10   
ref|XP_009131668.1|  PREDICTED: dehydration-responsive element-bi...  71.6    1e-10   
ref|XP_004147872.1|  PREDICTED: dehydration-responsive element-bi...  70.1    2e-10   
ref|NP_197346.1|  dehydration-responsive element-binding protein 2G   72.0    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008354169.1|  PREDICTED: dehydration-responsive element-bi...  72.8    2e-10   
gb|AFJ14632.1|  dehydration-responsive element-binding protein (D...  72.8    2e-10   
ref|XP_010549641.1|  PREDICTED: dehydration-responsive element-bi...  72.4    2e-10   
gb|AFS60111.1|  DREB2                                                 72.8    2e-10   
ref|XP_008466672.1|  PREDICTED: dehydration-responsive element-bi...  70.1    2e-10   
ref|XP_010087025.1|  Dehydration-responsive element-binding prote...  72.4    2e-10   
ref|XP_010257031.1|  PREDICTED: dehydration-responsive element-bi...  72.4    2e-10   
ref|XP_010534622.1|  PREDICTED: dehydration-responsive element-bi...  72.4    2e-10   
ref|XP_010492849.1|  PREDICTED: dehydration-responsive element-bi...  71.6    2e-10   
ref|XP_010692920.1|  PREDICTED: dehydration-responsive element-bi...  72.4    2e-10   
ref|XP_009345422.1|  PREDICTED: dehydration-responsive element-bi...  72.4    2e-10   
ref|NP_001280947.1|  dehydration-responsive element-binding prote...  72.8    2e-10   
ref|XP_010243654.1|  PREDICTED: dehydration-responsive element-bi...  70.1    2e-10   
gb|AAY35055.1|  dehydration responsive element binding protein        71.2    2e-10   Populus alba x Populus alba var. pyramidalis
ref|XP_008389032.1|  PREDICTED: dehydration-responsive element-bi...  70.5    2e-10   
ref|XP_007226392.1|  hypothetical protein PRUPE_ppa023248mg           70.9    2e-10   
ref|XP_010420608.1|  PREDICTED: dehydration-responsive element-bi...  71.6    2e-10   
ref|XP_009351419.1|  PREDICTED: dehydration-responsive element-bi...  68.9    2e-10   
emb|CDY64211.1|  BnaC06g43980D                                        70.1    2e-10   
ref|XP_008660491.1|  PREDICTED: dehydration-responsive element-bi...  71.6    2e-10   
gb|KGN62640.1|  hypothetical protein Csa_2G363010                     70.1    2e-10   
ref|XP_009369224.1|  PREDICTED: dehydration-responsive element-bi...  72.4    2e-10   
gb|AFP89590.1|  putative dehydration responsive element-binding p...  70.1    2e-10   
ref|XP_009416308.1|  PREDICTED: dehydration-responsive element-bi...  71.2    2e-10   
ref|XP_003589344.1|  Ethylene-responsive transcription factor ERF071  70.9    2e-10   
ref|XP_004152768.1|  PREDICTED: dehydration-responsive element-bi...  69.3    2e-10   
ref|XP_003527879.1|  PREDICTED: dehydration-responsive element-bi...  70.5    2e-10   
ref|XP_010454086.1|  PREDICTED: dehydration-responsive element-bi...  71.2    2e-10   
ref|XP_009386995.1|  PREDICTED: dehydration-responsive element-bi...  70.9    2e-10   
ref|XP_010517453.1|  PREDICTED: dehydration-responsive element-bi...  72.0    2e-10   
ref|NP_001234689.1|  dehydration responsive element binding protein   71.2    2e-10   
ref|XP_010692919.1|  PREDICTED: dehydration-responsive element-bi...  72.0    2e-10   
ref|XP_006289041.1|  hypothetical protein CARUB_v10002425mg           71.2    2e-10   
ref|XP_008792180.1|  PREDICTED: dehydration-responsive element-bi...  70.9    2e-10   
gb|KFK41984.1|  hypothetical protein AALP_AA2G197300                  70.1    2e-10   
gb|ACB30552.1|  DREB protein                                          72.4    2e-10   Taxus cuspidata [ichii]
ref|XP_011084760.1|  PREDICTED: ethylene-responsive transcription...  69.7    2e-10   
ref|XP_003523563.1|  PREDICTED: dehydration-responsive element-bi...  70.5    2e-10   
ref|XP_009391184.1|  PREDICTED: dehydration-responsive element-bi...  69.7    2e-10   
ref|XP_010922640.1|  PREDICTED: dehydration-responsive element-bi...  71.6    2e-10   
gb|AHJ08574.1|  DREB2-like protein                                    72.0    2e-10   
ref|XP_010931300.1|  PREDICTED: dehydration-responsive element-bi...  70.9    2e-10   
ref|XP_006390299.1|  hypothetical protein EUTSA_v10019142mg           69.7    2e-10   
ref|XP_009126252.1|  PREDICTED: dehydration-responsive element-bi...  70.9    3e-10   
emb|CDX73896.1|  BnaA03g31510D                                        72.0    3e-10   
ref|XP_002873895.1|  hypothetical protein ARALYDRAFT_909855           71.2    3e-10   
gb|AGG39692.1|  ERF transcription factor ERF1                         71.6    3e-10   
ref|XP_004292958.1|  PREDICTED: dehydration-responsive element-bi...  70.5    3e-10   
gb|KDP44697.1|  hypothetical protein JCGZ_01197                       72.0    3e-10   
ref|XP_002520794.1|  Dehydration-responsive element-binding prote...  72.0    3e-10   
ref|XP_009104705.1|  PREDICTED: dehydration-responsive element-bi...  69.7    3e-10   
ref|XP_008444762.1|  PREDICTED: dehydration-responsive element-bi...  69.7    3e-10   
gb|AHI45171.1|  DREB group protein                                    72.0    3e-10   
gb|EPS73069.1|  ethylene response factor 3                            70.9    3e-10   
ref|XP_010674522.1|  PREDICTED: dehydration-responsive element-bi...  70.1    3e-10   
gb|KHN22865.1|  Dehydration-responsive element-binding protein 2A     69.7    3e-10   
gb|ABJ88942.1|  dehydration responsive element binding protein        70.9    3e-10   
emb|CAN66064.1|  hypothetical protein VITISV_032355                   69.3    3e-10   
ref|XP_009386363.1|  PREDICTED: dehydration-responsive element-bi...  69.7    3e-10   
ref|XP_009402399.1|  PREDICTED: dehydration-responsive element-bi...  70.5    3e-10   
ref|XP_003539883.1|  PREDICTED: dehydration-responsive element-bi...  69.7    3e-10   
ref|XP_009406908.1|  PREDICTED: dehydration-responsive element-bi...  71.2    3e-10   
ref|XP_009406909.1|  PREDICTED: dehydration-responsive element-bi...  71.2    3e-10   
ref|XP_003571275.1|  PREDICTED: dehydration-responsive element-bi...  69.7    3e-10   
emb|CDY58117.1|  BnaA02g35180D                                        70.5    3e-10   
emb|CAG30547.1|  putative DREB2A protein                              70.1    3e-10   
ref|XP_008347385.1|  PREDICTED: dehydration-responsive element-bi...  70.1    3e-10   
ref|XP_002312185.2|  dehydration responsive element binding prote...  70.5    3e-10   
emb|CDY67039.1|  BnaAnng23490D                                        70.5    3e-10   
emb|CAH10193.1|  dehydration-responsive element binding protein 2...  70.1    3e-10   
gb|ABO48361.1|  DRE-binding protein 2                                 70.5    3e-10   
gb|AFU07643.1|  ethylene-responsive element binding factor 6          71.6    3e-10   
ref|XP_010327720.1|  PREDICTED: dehydration-responsive element-bi...  68.9    3e-10   
gb|AEK48231.1|  dehydration-responsive element-binding protein        68.6    3e-10   
ref|XP_003545264.1|  PREDICTED: ethylene-responsive transcription...  70.5    3e-10   
ref|XP_009120973.1|  PREDICTED: dehydration-responsive element-bi...  70.9    3e-10   
gb|AAS59530.1|  putative DRE-binding protein DREB2                    70.1    3e-10   
gb|AGL08025.1|  dehydration-responsive element-binding protein        68.6    4e-10   
gb|AFJ14633.1|  dehydration-responsive element-binding protein (D...  72.4    4e-10   
ref|XP_003569085.1|  PREDICTED: dehydration-responsive element-bi...  70.5    4e-10   
emb|CDY02629.1|  BnaC02g08060D                                        70.5    4e-10   
ref|XP_008388157.1|  PREDICTED: dehydration-responsive element-bi...  70.5    4e-10   
ref|XP_008377237.1|  PREDICTED: dehydration-responsive element-bi...  70.1    4e-10   
ref|XP_010534621.1|  PREDICTED: dehydration-responsive element-bi...  71.6    4e-10   
ref|XP_008218369.1|  PREDICTED: dehydration-responsive element-bi...  69.3    4e-10   
ref|XP_009788693.1|  PREDICTED: dehydration-responsive element-bi...  71.2    4e-10   
gb|AEK48229.1|  dehydration-responsive element-binding protein        68.6    4e-10   
gb|AAR11157.1|  dehydration-responsive element binding protein 2      70.1    4e-10   
gb|AEO78515.1|  dehydration-responsive element-binding protein        68.6    4e-10   
ref|XP_009594350.1|  PREDICTED: dehydration-responsive element-bi...  71.2    4e-10   
ref|XP_007160709.1|  hypothetical protein PHAVU_001G010400g           70.1    4e-10   
gb|ABA08425.1|  dehydration-responsive element-binding protein        68.9    4e-10   
gb|AGL08026.1|  dehydration-responsive element-binding protein        68.6    4e-10   
gb|AEK48227.1|  dehydration-responsive element-binding protein        68.6    4e-10   
ref|XP_009384928.1|  PREDICTED: dehydration-responsive element-bi...  70.1    4e-10   
ref|XP_009336842.1|  PREDICTED: dehydration-responsive element-bi...  70.1    4e-10   
ref|XP_003616701.1|  Ethylene-responsive element binding protein      71.6    4e-10   
ref|XP_002267549.1|  PREDICTED: dehydration-responsive element-bi...  68.9    4e-10   
gb|AEO78516.1|  dehydration-responsive element-binding protein        68.2    4e-10   
ref|XP_006407478.1|  hypothetical protein EUTSA_v10021161mg           70.5    5e-10   
gb|AEO78514.1|  dehydration-responsive element-binding protein        68.2    5e-10   
gb|AEZ68005.1|  dehydration-responsive element-binding protein        68.6    5e-10   
gb|AGL08027.1|  dehydration-responsive element-binding protein        68.2    5e-10   
gb|AIY22669.1|  Dreb-like protein                                     69.7    5e-10   
dbj|BAF47192.1|  embryonic element binding Factor 6                   71.2    5e-10   
ref|XP_004307690.1|  PREDICTED: dehydration-responsive element-bi...  71.2    5e-10   
gb|AIY22668.1|  Dreb-like protein                                     69.7    5e-10   
ref|XP_008221333.1|  PREDICTED: dehydration-responsive element-bi...  70.9    5e-10   
emb|CDP07457.1|  unnamed protein product                              69.7    5e-10   
gb|AIY22665.1|  Dreb-like protein                                     69.7    5e-10   
emb|CDX70820.1|  BnaC03g09040D                                        70.1    5e-10   
gb|AGL08024.1|  dehydration-responsive element-binding protein        68.2    5e-10   
gb|AEZ68001.1|  dehydration-responsive element-binding protein        68.2    5e-10   
gb|KEH36215.1|  dehydration-responsive element-binding protein        69.3    5e-10   
emb|CDY70626.1|  BnaCnng69090D                                        68.9    5e-10   
gb|AFO12475.1|  DRE-binding protein 2                                 69.7    5e-10   
gb|AIY22663.1|  Dreb-like protein                                     69.7    5e-10   
ref|XP_011004133.1|  PREDICTED: dehydration-responsive element-bi...  70.1    5e-10   
gb|ADD92167.1|  DREB2A                                                70.9    5e-10   
emb|CDP13966.1|  unnamed protein product                              70.9    5e-10   
gb|ADE35085.1|  DREB2A                                                70.9    5e-10   
ref|XP_006660398.1|  PREDICTED: dehydration-responsive element-bi...  69.3    5e-10   
gb|AEZ68003.1|  dehydration-responsive element-binding protein        68.2    5e-10   
ref|XP_004961770.1|  PREDICTED: dehydration-responsive element-bi...  69.3    5e-10   
ref|XP_010043317.1|  PREDICTED: dehydration-responsive element-bi...  69.3    5e-10   
emb|CDY00987.1|  BnaC05g42130D                                        70.5    5e-10   
gb|AFO12473.1|  DRE-binding protein 2                                 69.7    5e-10   
gb|AGI78251.1|  dehydration responsive element binding protein 2      71.2    5e-10   
gb|AEZ68002.1|  dehydration-responsive element-binding protein        68.2    5e-10   
ref|XP_009146782.1|  PREDICTED: dehydration-responsive element-bi...  70.5    6e-10   
gb|AIY22667.1|  Dreb-like protein                                     69.3    6e-10   
ref|XP_004509207.1|  PREDICTED: ethylene-responsive transcription...  68.6    6e-10   
ref|NP_001291246.1|  dehydration-responsive element-binding prote...  69.7    6e-10   
ref|XP_008789576.1|  PREDICTED: dehydration-responsive element-bi...  68.6    6e-10   
emb|CDY25420.1|  BnaC09g39350D                                        70.5    6e-10   
ref|XP_010505763.1|  PREDICTED: dehydration-responsive element-bi...  70.5    6e-10   
gb|AIY22664.1|  Dreb-like protein                                     69.3    6e-10   
emb|CDY08557.1|  BnaA05g27930D                                        70.1    6e-10   
gb|ADL27988.1|  DRE-binding transcription factor 2A                   68.2    6e-10   
ref|XP_010508876.1|  PREDICTED: dehydration-responsive element-bi...  70.5    6e-10   
ref|XP_004138558.1|  PREDICTED: dehydration-responsive element-bi...  70.9    6e-10   
gb|EMS47871.1|  Dehydration-responsive element-binding protein 2A     72.0    6e-10   
gb|AAX13289.1|  DREB transcription factor 6                           69.3    6e-10   
gb|ACN27284.1|  unknown                                               69.3    6e-10   
gb|ABA08426.1|  dehydration-responsive element-binding protein        69.3    6e-10   
gb|AEI98920.1|  AP2/EREBP transcription factor                        69.7    6e-10   
ref|XP_010533259.1|  PREDICTED: dehydration-responsive element-bi...  68.6    7e-10   
ref|XP_009767687.1|  PREDICTED: dehydration-responsive element-bi...  68.9    7e-10   
ref|XP_008792179.1|  PREDICTED: dehydration-responsive element-bi...  70.1    7e-10   
ref|XP_009345024.1|  PREDICTED: dehydration-responsive element-bi...  69.7    7e-10   
gb|AFI71293.1|  dehydration responsive element binding protein 2 ...  69.3    7e-10   
gb|AAL01124.1|AF303376_1  AP2-containing protein                      69.3    7e-10   
ref|XP_008676276.1|  PREDICTED: dehydration-responsive element-bi...  67.4    7e-10   
ref|XP_009598034.1|  PREDICTED: dehydration-responsive element-bi...  68.9    7e-10   
gb|EMT23900.1|  Dehydration-responsive element-binding protein 2A     71.6    7e-10   
emb|CBX87024.1|  DREB2 protein                                        69.3    8e-10   
ref|XP_011076647.1|  PREDICTED: dehydration-responsive element-bi...  70.5    8e-10   
emb|CDX93190.1|  BnaC04g47060D                                        68.6    8e-10   
ref|XP_009402398.1|  PREDICTED: dehydration-responsive element-bi...  70.1    8e-10   
gb|AAY44604.1|  dehydration responsive element binding protein W73    69.3    8e-10   
ref|XP_009384927.1|  PREDICTED: dehydration-responsive element-bi...  69.7    8e-10   
ref|XP_008456436.1|  PREDICTED: putative dehydration-responsive e...  67.8    8e-10   
emb|CAN60823.1|  hypothetical protein VITISV_037056                   67.8    9e-10   
emb|CAN75315.1|  hypothetical protein VITISV_024158                   71.6    9e-10   
ref|XP_008441483.1|  PREDICTED: dehydration-responsive element-bi...  70.5    9e-10   
ref|XP_008441482.1|  PREDICTED: dehydration-responsive element-bi...  70.5    9e-10   
ref|XP_007136043.1|  hypothetical protein PHAVU_009G013200g           68.9    9e-10   
ref|XP_002510462.1|  Dehydration-responsive element-binding prote...  68.6    9e-10   
gb|ABY19375.1|  DRE-binding protein DREB2                             68.9    9e-10   
ref|XP_009767453.1|  PREDICTED: dehydration-responsive element-bi...  68.2    9e-10   
gb|ADA59487.1|  DREB2b                                                68.9    1e-09   
emb|CAG30548.1|  putative DREB2A protein                              68.6    1e-09   
gb|ABQ59087.1|  DREB2A                                                68.9    1e-09   
ref|XP_008362249.1|  PREDICTED: putative dehydration-responsive e...  67.8    1e-09   
gb|ADA59486.1|  DREB2a                                                68.9    1e-09   
gb|AAS58438.1|  DREB2A                                                69.7    1e-09   
emb|CBI19777.3|  unnamed protein product                              67.8    1e-09   
gb|KCW67902.1|  hypothetical protein EUGRSUZ_F01607                   68.2    1e-09   
gb|AAU93685.1|  DREB2A                                                67.4    1e-09   
ref|NP_001062535.1|  Os08g0565200                                     68.2    1e-09   
gb|KDP38573.1|  hypothetical protein JCGZ_04498                       68.2    1e-09   
ref|XP_010064559.1|  PREDICTED: dehydration-responsive element-bi...  68.2    1e-09   
ref|XP_010271525.1|  PREDICTED: dehydration-responsive element-bi...  67.8    1e-09   
dbj|BAJ53172.1|  JHL18I08.6                                           68.2    1e-09   
emb|CAG30549.1|  putative FaDREB2A                                    68.2    1e-09   
ref|XP_008366770.1|  PREDICTED: dehydration-responsive element-bi...  68.6    1e-09   
ref|XP_011083628.1|  PREDICTED: dehydration-responsive element-bi...  67.8    1e-09   
gb|ACR22835.1|  dehydration responsive factor 1                       67.4    1e-09   
ref|XP_006411292.1|  hypothetical protein EUTSA_v10016913mg           69.3    1e-09   
ref|XP_009630729.1|  PREDICTED: ethylene-responsive transcription...  69.3    1e-09   
gb|ADJ67432.1|  ethylene response factor 3                            69.3    1e-09   
gb|AFO12481.1|  DRE-binding protein 2                                 68.2    1e-09   
ref|XP_009122438.1|  PREDICTED: dehydration-responsive element-bi...  68.6    1e-09   
gb|EAZ08049.1|  hypothetical protein OsI_30314                        67.8    1e-09   
gb|AIZ97485.1|  CBF-like protein CBF7                                 68.6    1e-09   
gb|AIY22662.1|  Dreb-like protein                                     68.6    1e-09   
ref|XP_002280893.3|  PREDICTED: dehydration-responsive element-bi...  67.8    2e-09   
ref|XP_002306897.2|  hypothetical protein POPTR_0005s25470g           67.8    2e-09   
gb|AFO12477.1|  DRE-binding protein 2                                 68.2    2e-09   
ref|NP_001105876.1|  LOC732788                                        68.9    2e-09   
ref|XP_011048848.1|  PREDICTED: dehydration-responsive element-bi...  67.8    2e-09   
gb|EYU39769.1|  hypothetical protein MIMGU_mgv1a018752mg              65.9    2e-09   
ref|XP_006435084.1|  hypothetical protein CICLE_v10002280mg           67.8    2e-09   
gb|KDO84711.1|  hypothetical protein CISIN_1g036655mg                 67.8    2e-09   
gb|AIY22666.1|  Dreb-like protein                                     68.2    2e-09   
ref|XP_010102188.1|  Dehydration-responsive element-binding prote...  67.0    2e-09   
ref|XP_006473580.1|  PREDICTED: dehydration-responsive element-bi...  67.8    2e-09   
ref|XP_002881716.1|  hypothetical protein ARALYDRAFT_903325           69.3    2e-09   
emb|CDY36289.1|  BnaA01g31290D                                        68.6    2e-09   
ref|XP_010105262.1|  GTPase obg                                       70.1    2e-09   
gb|AAL91280.1|  At2g22200/T26C19.14                                   67.8    2e-09   
ref|XP_002882709.1|  DRE-binding protein 2B                           68.9    2e-09   
gb|ACR22839.1|  dehydration responsive factor 1                       67.0    2e-09   
gb|ACR22838.1|  dehydration responsive factor 1                       67.0    2e-09   
gb|ACR22837.1|  dehydration responsive factor 1                       67.4    2e-09   
ref|XP_010936099.1|  PREDICTED: dehydration-responsive element-bi...  67.0    2e-09   
gb|ACR22841.1|  dehydration responsive factor 1                       67.0    2e-09   
gb|EPS61812.1|  hypothetical protein M569_12986                       67.0    2e-09   
gb|ACO72991.1|  DRE-binding protein 1c                                68.6    2e-09   
gb|AFO12469.1|  DRE-binding protein 2                                 67.8    2e-09   
ref|XP_006435820.1|  hypothetical protein CICLE_v10032029mg           68.9    2e-09   
gb|ACR22840.1|  dehydration responsive factor 1                       67.0    2e-09   
ref|XP_003549447.2|  PREDICTED: ethylene-responsive transcription...  68.2    2e-09   
ref|XP_006345609.1|  PREDICTED: ethylene-responsive transcription...  67.0    2e-09   
gb|ADX06857.1|  AP2/ERF domain-containing transcription factor        68.2    2e-09   
gb|EYU38883.1|  hypothetical protein MIMGU_mgv1a014821mg              66.6    2e-09   
ref|XP_007030307.1|  Integrase-type DNA-binding superfamily prote...  67.0    2e-09   
gb|ADM73511.1|  dehydration responsive element-binding protein 2      67.4    2e-09   
gb|KHN12670.1|  Dehydration-responsive element-binding protein 2D     68.2    2e-09   
ref|XP_008796422.1|  PREDICTED: dehydration-responsive element-bi...  67.0    2e-09   
gb|AFO12478.1|  DRE-binding protein 2                                 67.8    2e-09   
gb|AFO12476.1|  DRE-binding protein 2                                 67.8    2e-09   
ref|XP_009356066.1|  PREDICTED: putative dehydration-responsive e...  67.0    2e-09   
gb|AFI71292.1|  dehydration responsive element binding protein 2 ...  68.6    2e-09   
ref|XP_002976278.1|  hypothetical protein SELMODRAFT_26594            66.6    2e-09   
ref|XP_002302006.1|  hypothetical protein POPTR_0002s03090g           67.4    2e-09   
gb|AFO12472.1|  DRE-binding protein 2                                 67.8    2e-09   
emb|CBH19568.1|  AP2 domain containing protein                        67.0    2e-09   
gb|AFO12480.1|  DRE-binding protein 2                                 67.8    2e-09   
ref|XP_009399704.1|  PREDICTED: ethylene-responsive transcription...  66.6    2e-09   
ref|XP_002315132.1|  dehydration responsive element binding prote...  68.2    2e-09   
gb|ACO58508.1|  dehydration responsive factor 1                       67.0    2e-09   
ref|XP_009621512.1|  PREDICTED: dehydration-responsive element-bi...  67.0    2e-09   
gb|ABV03750.1|  DRE-binding protein                                   67.8    2e-09   
gb|AEY70512.1|  dehydration responsive element binding protein        67.0    2e-09   
gb|AAD25951.1|AF085279_24  hypothetical protein                       67.8    2e-09   
gb|ACO58507.1|  dehydration responsive factor 1                       67.0    3e-09   
ref|XP_011015329.1|  PREDICTED: dehydration-responsive element-bi...  67.8    3e-09   
gb|AFO12474.1|  DRE-binding protein 2                                 67.4    3e-09   
gb|AFO12471.1|  DRE-binding protein 2                                 67.4    3e-09   
gb|EYU32882.1|  hypothetical protein MIMGU_mgv1a018624mg              67.0    3e-09   
gb|AFO12470.1|  DRE-binding protein 2                                 67.4    3e-09   
ref|XP_002968658.1|  hypothetical protein SELMODRAFT_38494            64.7    3e-09   
gb|AFH75401.1|  dehydration-responsive element-binding transcript...  67.4    3e-09   
ref|XP_002987168.1|  hypothetical protein SELMODRAFT_26604            66.2    3e-09   
ref|XP_010911409.1|  PREDICTED: ethylene-responsive transcription...  66.6    3e-09   
ref|XP_010254126.1|  PREDICTED: dehydration-responsive element-bi...  68.2    3e-09   
gb|AFO12479.1|  DRE-binding protein 2                                 67.4    3e-09   
ref|XP_004491005.1|  PREDICTED: dehydration-responsive element-bi...  68.9    3e-09   
gb|AFO12483.1|  DRE-binding protein 2                                 67.4    3e-09   
ref|XP_009141887.1|  PREDICTED: dehydration-responsive element-bi...  67.8    3e-09   



>emb|CAN82498.1| hypothetical protein VITISV_026906 [Vitis vinifera]
Length=290

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 97/125 (78%), Gaps = 7/125 (6%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDNSKFKYRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAAI+LYGS+AQ
Sbjct  55   PDNSKFKYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAIILYGSRAQ  114

Query  472  LNLQPsgnsddgsssssqsskratsysTQNLRPIlpkppgfglvpppSAA---AATAYIP  642
            LNLQP       S+SSS     ++S  TQ LRP+LP+P GFGL     +A    A  Y+P
Sbjct  115  LNLQP----SVSSASSSSRGSSSSSSGTQTLRPLLPRPSGFGLTFSSPSATPHTAGGYVP  170

Query  643  YGFQY  657
            YGF +
Sbjct  171  YGFSH  175



>ref|XP_010658253.1| PREDICTED: ethylene-responsive transcription factor ABI4 [Vitis 
vinifera]
Length=306

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 97/125 (78%), Gaps = 7/125 (6%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDNSKFKYRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAAI+LYGS+AQ
Sbjct  54   PDNSKFKYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAIILYGSRAQ  113

Query  472  LNLQPsgnsddgsssssqsskratsysTQNLRPIlpkppgfglvpppSAA---AATAYIP  642
            LNLQP       S+SSS     ++S  TQ LRP+LP+P GFGL     +A    A  Y+P
Sbjct  114  LNLQP----SVSSASSSSRGSSSSSSGTQTLRPLLPRPSGFGLTFSSPSATPHTAGGYVP  169

Query  643  YGFQY  657
            YGF +
Sbjct  170  YGFSH  174



>emb|CBI25453.3| unnamed protein product [Vitis vinifera]
Length=659

 Score =   108 bits (270),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 97/125 (78%), Gaps = 7/125 (6%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDNSKFKYRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAAI+LYGS+AQ
Sbjct  54   PDNSKFKYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAIILYGSRAQ  113

Query  472  LNLQPsgnsddgsssssqsskratsysTQNLRPIlpkppgfglvpppSAA---AATAYIP  642
            LNLQP       S+SSS     ++S  TQ LRP+LP+P GFGL     +A    A  Y+P
Sbjct  114  LNLQP----SVSSASSSSRGSSSSSSGTQTLRPLLPRPSGFGLTFSSPSATPHTAGGYVP  169

Query  643  YGFQY  657
            YGF +
Sbjct  170  YGFSH  174



>ref|XP_008369406.1| PREDICTED: ethylene-responsive transcription factor ABI4 [Malus 
domestica]
Length=355

 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 104/127 (82%), Gaps = 6/127 (5%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N+KF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTF+TAEDAARAYDRAAI+LYGS+AQ
Sbjct  56   PENNKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFSTAEDAARAYDRAAIILYGSRAQ  115

Query  472  LNLQPsgnsddgsssssqsskratsysTQNLRPIlpkppgfglvpppSAAA------ATA  633
            LNLQPSG+S   S+  S SS  ++S STQ LRP+LP+P GFGL  P  ++A      A+ 
Sbjct  116  LNLQPSGSSSQNSTRGSSSSSSSSSSSTQTLRPLLPRPSGFGLTLPHLSSAHPVPLMASG  175

Query  634  YIPYGFQ  654
            ++PYG +
Sbjct  176  FVPYGVE  182



>ref|XP_007008915.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma 
cacao]
 gb|EOY17725.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma 
cacao]
Length=328

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+KF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAAI+LYGSKAQ
Sbjct  68   PDNNKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAIILYGSKAQ  127

Query  472  LNLQPsgnsddgsssssqsskratsysTQNLRPI  573
            LNLQPS +S   SS+SS     ++S STQ LRP+
Sbjct  128  LNLQPSVSSSSSSSASSSRGGSSSSSSTQTLRPL  161



>ref|XP_011076671.1| PREDICTED: ethylene-responsive transcription factor ABI4 [Sesamum 
indicum]
Length=340

 Score =   103 bits (256),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDNSKF+YRGVRQRSWGKWVAEIREP+KRTRRWLGTF+TAEDAARAYDRAAI+LYGS+AQ
Sbjct  62   PDNSKFRYRGVRQRSWGKWVAEIREPRKRTRRWLGTFSTAEDAARAYDRAAIILYGSRAQ  121

Query  472  LNLQP  486
            LNLQP
Sbjct  122  LNLQP  126



>ref|XP_003616666.1| Ethylene-responsive transcription factor [Medicago truncatula]
 gb|AES99624.1| AP2 domain class transcription factor [Medicago truncatula]
Length=333

 Score =   102 bits (255),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+KF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTF+TAEDAA+AYDRAAI+LYGS+AQ
Sbjct  59   PDNNKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFSTAEDAAKAYDRAAIILYGSRAQ  118

Query  472  LNLQP  486
            LNLQP
Sbjct  119  LNLQP  123



>ref|XP_007221036.1| hypothetical protein PRUPE_ppa015230mg, partial [Prunus persica]
 gb|EMJ22235.1| hypothetical protein PRUPE_ppa015230mg, partial [Prunus persica]
Length=352

 Score =   103 bits (256),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 100/125 (80%), Gaps = 6/125 (5%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+KF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAAI+LYGS+AQ
Sbjct  59   PDNNKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAIILYGSRAQ  118

Query  472  LNLQPsgnsddgsssssqsskratsysTQNLRPIlpkppgfglvpppSAAA------ATA  633
            LNLQPSG +   S+  S SS  + + S Q LRP+LP+P GFGL  P  ++A      A+ 
Sbjct  119  LNLQPSGANSQSSTRGSSSSSSSCNSSAQTLRPLLPRPSGFGLTLPFPSSAHPVPLMASG  178

Query  634  YIPYG  648
            ++PYG
Sbjct  179  FVPYG  183



>ref|XP_008233783.1| PREDICTED: ethylene-responsive transcription factor ABI4 [Prunus 
mume]
Length=347

 Score =   102 bits (255),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 101/125 (81%), Gaps = 6/125 (5%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+KF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAAI+LYGS+AQ
Sbjct  53   PDNNKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAIILYGSRAQ  112

Query  472  LNLQPsgnsddgsssssqsskratsysTQNLRPIlpkppgfglvpppSAAA------ATA  633
            LNLQPSG +   S+  S SS  + + S+Q LRP+LP+P GFGL  P  ++A      A+ 
Sbjct  113  LNLQPSGTNSQSSTRGSSSSSSSCNSSSQTLRPLLPRPSGFGLTLPFPSSAHPVPLMASG  172

Query  634  YIPYG  648
            ++PYG
Sbjct  173  FVPYG  177



>ref|XP_010105435.1| Ethylene-responsive transcription factor ABI4 [Morus notabilis]
 gb|AHJ25984.1| dehydration responsive element binding transcription factor [Morus 
notabilis]
 gb|EXC04710.1| Ethylene-responsive transcription factor ABI4 [Morus notabilis]
Length=358

 Score =   102 bits (255),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDNSKF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAAI+LYGS+AQ
Sbjct  46   PDNSKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAIILYGSRAQ  105

Query  472  LNLQPsgnsddgsssssqsskratsysTQNLRPI  573
            LNLQPSG S   SSS   SS  ++S S Q LRP+
Sbjct  106  LNLQPSGGSSSQSSSRGTSSSSSSSSSAQTLRPL  139



>ref|XP_006435774.1| hypothetical protein CICLE_v10033578mg [Citrus clementina]
 ref|XP_006486528.1| PREDICTED: ethylene-responsive transcription factor ABI4-like 
[Citrus sinensis]
 gb|ESR49014.1| hypothetical protein CICLE_v10033578mg [Citrus clementina]
Length=349

 Score =   102 bits (254),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDNSKF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAAI+LYGS+AQ
Sbjct  58   PDNSKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAIILYGSRAQ  117

Query  472  LNLQP  486
            LNLQP
Sbjct  118  LNLQP  122



>emb|CDP13992.1| unnamed protein product [Coffea canephora]
Length=356

 Score =   102 bits (254),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+KF+YRGVRQRSWGKWVAEIREP+KRTRRWLGTFATAEDAARAYDRAAI+LYGS+AQ
Sbjct  69   PDNNKFRYRGVRQRSWGKWVAEIREPRKRTRRWLGTFATAEDAARAYDRAAIILYGSRAQ  128

Query  472  LNLQP  486
            LNLQP
Sbjct  129  LNLQP  133



>gb|KDO68917.1| hypothetical protein CISIN_1g038194mg [Citrus sinensis]
Length=349

 Score =   102 bits (254),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDNSKF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAAI+LYGS+AQ
Sbjct  58   PDNSKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAIILYGSRAQ  117

Query  472  LNLQP  486
            LNLQP
Sbjct  118  LNLQP  122



>ref|XP_009619856.1| PREDICTED: ethylene-responsive transcription factor ABI4 [Nicotiana 
tomentosiformis]
Length=330

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+KF+YRGVRQRSWGKWVAEIREP+KRTRRWLGTFATAEDAARAYDRAAI+LYGS+AQ
Sbjct  54   PDNNKFRYRGVRQRSWGKWVAEIREPRKRTRRWLGTFATAEDAARAYDRAAIILYGSRAQ  113

Query  472  LNLQP  486
            LNLQP
Sbjct  114  LNLQP  118



>ref|XP_009776130.1| PREDICTED: ethylene-responsive transcription factor ABI4 [Nicotiana 
sylvestris]
Length=324

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+KF+YRGVRQRSWGKWVAEIREP+KRTRRWLGTFATAEDAARAYDRAAI+LYGS+AQ
Sbjct  54   PDNNKFRYRGVRQRSWGKWVAEIREPRKRTRRWLGTFATAEDAARAYDRAAIILYGSRAQ  113

Query  472  LNLQP  486
            LNLQP
Sbjct  114  LNLQP  118



>gb|KDP44732.1| hypothetical protein JCGZ_01232 [Jatropha curcas]
Length=343

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDNSKF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFA+AEDAARAYDRAAI+LYGS+AQ
Sbjct  55   PDNSKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFASAEDAARAYDRAAIILYGSRAQ  114

Query  472  LNLQP  486
            LNLQP
Sbjct  115  LNLQP  119



>ref|XP_010034147.1| PREDICTED: ethylene-responsive transcription factor ABI4 [Eucalyptus 
grandis]
Length=322

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+KF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAA++LYGS+AQ
Sbjct  55   PDNNKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAALILYGSRAQ  114

Query  472  LNLQPsgnsddgsssssqsskratsysTQNLRPI  573
            LNLQPS +S   SS  S SS  ++S STQNLRP+
Sbjct  115  LNLQPSCSSSTTSSRGSSSSSTSSSSSTQNLRPL  148



>ref|XP_002312168.2| GLUCOSE INSENSITIVE 6 family protein [Populus trichocarpa]
 gb|EEE89535.2| GLUCOSE INSENSITIVE 6 family protein [Populus trichocarpa]
Length=326

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN KF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAAI+LYGS+AQ
Sbjct  62   PDNGKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAIILYGSRAQ  121

Query  472  LNLQP  486
            LNLQP
Sbjct  122  LNLQP  126



>ref|XP_004308946.1| PREDICTED: ethylene-responsive transcription factor ABI4-like 
[Fragaria vesca subsp. vesca]
Length=329

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+KF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAAI+LYGS+AQ
Sbjct  52   PDNNKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAIILYGSRAQ  111

Query  472  LNLQP  486
            LNLQP
Sbjct  112  LNLQP  116



>ref|XP_008362743.1| PREDICTED: ethylene-responsive transcription factor ABI4-like 
[Malus domestica]
Length=363

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+KF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAAI+LYGS+AQ
Sbjct  58   PDNNKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAIILYGSRAQ  117

Query  472  LNLQP  486
            LNLQP
Sbjct  118  LNLQP  122



>ref|XP_010689445.1| PREDICTED: ethylene-responsive transcription factor ABI4, partial 
[Beta vulgaris subsp. vulgaris]
Length=306

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+KF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAAI+LYGS+AQ
Sbjct  19   PDNNKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAIILYGSRAQ  78

Query  472  LNLQP  486
            LNLQP
Sbjct  79   LNLQP  83



>gb|EYU20036.1| hypothetical protein MIMGU_mgv1a024901mg [Erythranthe guttata]
Length=366

 Score =   100 bits (250),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN KF+YRGVRQRSWGKWVAEIREP+KRTRRWLGTFATAEDAARAYDRAAI+LYG+KAQ
Sbjct  69   PDNGKFRYRGVRQRSWGKWVAEIREPRKRTRRWLGTFATAEDAARAYDRAAIILYGNKAQ  128

Query  472  LNLQP  486
            LNLQP
Sbjct  129  LNLQP  133



>ref|XP_004491058.1| PREDICTED: ethylene-responsive transcription factor ABI4-like 
[Cicer arietinum]
Length=334

 Score =   100 bits (248),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+KF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTF+TAEDAARAYDRAA++LYGS+AQ
Sbjct  64   PDNNKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFSTAEDAARAYDRAALILYGSRAQ  123

Query  472  LNLQP  486
            LNLQP
Sbjct  124  LNLQP  128



>ref|XP_010260885.1| PREDICTED: ethylene-responsive transcription factor ABI4 [Nelumbo 
nucifera]
Length=290

 Score = 99.4 bits (246),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+KF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAA+VLYGS+AQ
Sbjct  53   PDNNKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAALVLYGSRAQ  112

Query  472  LNLQP  486
            LNLQP
Sbjct  113  LNLQP  117



>ref|XP_007141749.1| hypothetical protein PHAVU_008G222400g [Phaseolus vulgaris]
 gb|ESW13743.1| hypothetical protein PHAVU_008G222400g [Phaseolus vulgaris]
Length=329

 Score = 99.8 bits (247),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+KF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAA++LYGS+AQ
Sbjct  51   PDNNKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAALILYGSRAQ  110

Query  472  LNLQP  486
            LNL+P
Sbjct  111  LNLEP  115



>gb|KHN38522.1| Ethylene-responsive transcription factor ABI4 [Glycine soja]
Length=194

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+KF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAAI+LYGS+AQ
Sbjct  56   PDNNKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAIILYGSRAQ  115

Query  472  LNLQP  486
            LNLQP
Sbjct  116  LNLQP  120



>ref|NP_001235932.1| SGR [Glycine max]
 gb|ABS30430.1| SGR [Glycine max]
Length=338

 Score = 99.8 bits (247),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+KF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAAI+LYGS+AQ
Sbjct  56   PDNNKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAIILYGSRAQ  115

Query  472  LNLQP  486
            LNLQP
Sbjct  116  LNLQP  120



>ref|XP_011000614.1| PREDICTED: ethylene-responsive transcription factor ABI4-like 
[Populus euphratica]
Length=381

 Score =   100 bits (249),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN KF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAAI+LYGS+AQ
Sbjct  115  PDNGKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAIILYGSRAQ  174

Query  472  LNLQP  486
            LNLQP
Sbjct  175  LNLQP  179



>ref|XP_002528318.1| hypothetical protein RCOM_0839150 [Ricinus communis]
 gb|EEF34076.1| hypothetical protein RCOM_0839150 [Ricinus communis]
Length=366

 Score = 99.8 bits (247),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+KF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAAI+LYGS+AQ
Sbjct  70   PDNNKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAIILYGSRAQ  129

Query  472  LNLQP  486
            LNLQP
Sbjct  130  LNLQP  134



>ref|XP_004138561.1| PREDICTED: uncharacterized protein LOC101216152 [Cucumis sativus]
 ref|XP_004160749.1| PREDICTED: uncharacterized LOC101216152 [Cucumis sativus]
 gb|KGN45797.1| hypothetical protein Csa_6G011730 [Cucumis sativus]
Length=305

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+KF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTF+TAEDAARAYDRAAI+LYGS+AQ
Sbjct  61   PDNNKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFSTAEDAARAYDRAAIILYGSRAQ  120

Query  472  LNLQ  483
            LNLQ
Sbjct  121  LNLQ  124



>ref|XP_010937905.1| PREDICTED: ethylene-responsive transcription factor ABI4-like 
[Elaeis guineensis]
Length=286

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN KF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTF+TAEDAARAYDRAA+VLYG +AQ
Sbjct  58   PDNGKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFSTAEDAARAYDRAALVLYGPRAQ  117

Query  472  LNLQP  486
            LNLQP
Sbjct  118  LNLQP  122



>gb|EPS59065.1| abscisic acid insensitive 4-1 [Genlisea aurea]
Length=280

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+KF+YRGVRQRSWGKWVAEIREP+KR+RRWLGTFATAEDAARAYDRAA+VLYG KAQ
Sbjct  41   PDNAKFRYRGVRQRSWGKWVAEIREPRKRSRRWLGTFATAEDAARAYDRAAVVLYGHKAQ  100

Query  472  LNLQ  483
            LNLQ
Sbjct  101  LNLQ  104



>ref|XP_008441640.1| PREDICTED: ethylene-responsive transcription factor ABI4 [Cucumis 
melo]
Length=308

 Score = 97.1 bits (240),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+KF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTF+TAEDAARAYDRAAI+LYGS+AQ
Sbjct  65   PDNNKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFSTAEDAARAYDRAAIILYGSRAQ  124

Query  472  LNLQ  483
            LNLQ
Sbjct  125  LNLQ  128



>gb|ABO48359.1| abscisic acid insensitive 4-1 [Populus trichocarpa]
Length=334

 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN KF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAA +LYGS+A 
Sbjct  63   PDNGKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAFILYGSRAH  122

Query  472  LNLQP  486
            LNLQP
Sbjct  123  LNLQP  127



>gb|AEK86261.1| putative ABI4-like protein [Pinus taeda]
Length=337

 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN KF+YRGVRQRSWGKWVAEIR+P KRTRRWLGTFATAE AA+AYD AAI+LYGSKA 
Sbjct  40   PDNIKFQYRGVRQRSWGKWVAEIRQPGKRTRRWLGTFATAEQAAQAYDNAAILLYGSKAH  99

Query  472  LNLQP  486
            LNLQP
Sbjct  100  LNLQP  104



>ref|XP_008794303.1| PREDICTED: ethylene-responsive transcription factor ABI4-like, 
partial [Phoenix dactylifera]
Length=164

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN KF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTF+TAEDAARAYDRAA++LYG +AQ
Sbjct  58   PDNGKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFSTAEDAARAYDRAALILYGHRAQ  117

Query  472  LNLQP  486
            LNLQP
Sbjct  118  LNLQP  122



>gb|AAT44957.1| putative AP2/EREBP transcription factor [Arabidopsis thaliana]
Length=327

 Score = 97.1 bits (240),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDNSKF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAA+ LYGS+AQ
Sbjct  48   PDNSKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAVYLYGSRAQ  107

Query  472  LNLQP  486
            LNL P
Sbjct  108  LNLTP  112



>ref|XP_002315150.1| GLUCOSE INSENSITIVE 6 family protein [Populus trichocarpa]
 gb|EEF01321.1| GLUCOSE INSENSITIVE 6 family protein [Populus trichocarpa]
Length=412

 Score = 98.2 bits (243),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN KF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAA +LYGS+A 
Sbjct  141  PDNGKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAFILYGSRAH  200

Query  472  LNLQP  486
            LNLQP
Sbjct  201  LNLQP  205



>ref|XP_010505746.1| PREDICTED: ethylene-responsive transcription factor ABI4-like 
[Camelina sativa]
Length=340

 Score = 97.1 bits (240),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDNSKF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAA+ LYGS+AQ
Sbjct  52   PDNSKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAVYLYGSRAQ  111

Query  472  LNLQP  486
            LNL P
Sbjct  112  LNLTP  116



>ref|NP_181551.1| ethylene-responsive transcription factor ABI4 [Arabidopsis thaliana]
 sp|A0MES8.2|ABI4_ARATH RecName: Full=Ethylene-responsive transcription factor ABI4; 
Short=ERF ABI4; AltName: Full=Protein ABSCISIC ACID INSENSITIVE 
4; AltName: Full=Protein GLUCOSE INSENSITIVE 6; AltName: 
Full=Protein IMPAIRED SUCROSE INDUCTION 3; AltName: Full=Protein 
SALOBRENO 5; AltName: Full=Protein SUCROSE UNCOUPLED 6; 
AltName: Full=Protein SUGAR INSENSITIVE 5 [Arabidopsis thaliana]
 gb|AAD25937.1|AF085279_10 ABI4 [Arabidopsis thaliana]
 gb|AAC39489.1| AP2 domain family transcription factor homolog [Arabidopsis thaliana]
 gb|ABE65896.1| abscisic acid-insensitive 4 [Arabidopsis thaliana]
 gb|AEC09798.1| ethylene-responsive transcription factor ABI4 [Arabidopsis thaliana]
Length=328

 Score = 97.1 bits (240),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDNSKF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAA+ LYGS+AQ
Sbjct  48   PDNSKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAVYLYGSRAQ  107

Query  472  LNLQP  486
            LNL P
Sbjct  108  LNLTP  112



>ref|XP_010508893.1| PREDICTED: ethylene-responsive transcription factor ABI4 [Camelina 
sativa]
Length=337

 Score = 97.1 bits (240),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDNSKF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAA+ LYGS+AQ
Sbjct  51   PDNSKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAVYLYGSRAQ  110

Query  472  LNLQP  486
            LNL P
Sbjct  111  LNLTP  115



>gb|ABK28529.1| unknown [Arabidopsis thaliana]
Length=329

 Score = 97.1 bits (240),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDNSKF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAA+ LYGS+AQ
Sbjct  48   PDNSKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAVYLYGSRAQ  107

Query  472  LNLQP  486
            LNL P
Sbjct  108  LNLTP  112



>ref|XP_010920980.1| PREDICTED: ethylene-responsive transcription factor ABI4-like 
[Elaeis guineensis]
Length=304

 Score = 96.3 bits (238),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN KF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTF TAEDAARAYDRAA++LYG +AQ
Sbjct  66   PDNGKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFCTAEDAARAYDRAALILYGPRAQ  125

Query  472  LNLQP  486
            LNLQP
Sbjct  126  LNLQP  130



>ref|XP_010517437.1| PREDICTED: ethylene-responsive transcription factor ABI4-like 
[Camelina sativa]
Length=339

 Score = 96.7 bits (239),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDNSKF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAA+ LYGS+AQ
Sbjct  52   PDNSKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAVYLYGSRAQ  111

Query  472  LNLQP  486
            LNL P
Sbjct  112  LNLTP  116



>gb|ABO48360.1| abscisic acid insensitive 4-2 [Populus trichocarpa]
Length=326

 Score = 96.3 bits (238),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN KF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAAI+LYGS+AQ
Sbjct  62   PDNGKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAIILYGSRAQ  121

Query  472  LNL  480
            LNL
Sbjct  122  LNL  124



>ref|XP_009392069.1| PREDICTED: ethylene-responsive transcription factor ABI4-like 
[Musa acuminata subsp. malaccensis]
Length=316

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N KF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTF+TAEDAA+AYDRAA+VLYG +AQ
Sbjct  86   PENRKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFSTAEDAAKAYDRAALVLYGPRAQ  145

Query  472  LNLQ  483
            LNLQ
Sbjct  146  LNLQ  149



>ref|XP_006296102.1| hypothetical protein CARUB_v10025253mg [Capsella rubella]
 gb|EOA29000.1| hypothetical protein CARUB_v10025253mg [Capsella rubella]
Length=332

 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDNSKF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAA+ LYGS+AQ
Sbjct  51   PDNSKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAVYLYGSRAQ  110

Query  472  LNLQP  486
            LNL P
Sbjct  111  LNLTP  115



>emb|CDY07614.1| BnaA03g18970D [Brassica napus]
Length=336

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDNSKF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAA+ LYGS+AQ
Sbjct  50   PDNSKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAVFLYGSRAQ  109

Query  472  LNL  480
            LNL
Sbjct  110  LNL  112



>ref|XP_006411275.1| hypothetical protein EUTSA_v10017614mg [Eutrema salsugineum]
 gb|ESQ52728.1| hypothetical protein EUTSA_v10017614mg [Eutrema salsugineum]
Length=324

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDNSKF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAA+ LYGS+AQ
Sbjct  52   PDNSKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAVFLYGSRAQ  111

Query  472  LNL  480
            LNL
Sbjct  112  LNL  114



>emb|CDY52427.1| BnaC03g72510D [Brassica napus]
Length=323

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDNSKF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAA+ LYGS+AQ
Sbjct  47   PDNSKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAVFLYGSRAQ  106

Query  472  LNL  480
            LNL
Sbjct  107  LNL  109



>ref|XP_009418042.1| PREDICTED: ethylene-responsive transcription factor ABI4-like 
[Musa acuminata subsp. malaccensis]
Length=257

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N +F+YRGVRQRSWGKWVAEIREP+KRTRRWLGTF+TAEDAA+AYDRAA+VLYG +AQ
Sbjct  42   PENGRFRYRGVRQRSWGKWVAEIREPRKRTRRWLGTFSTAEDAAKAYDRAALVLYGPRAQ  101

Query  472  LNLQ  483
            LNLQ
Sbjct  102  LNLQ  105



>ref|XP_009133423.1| PREDICTED: ethylene-responsive transcription factor ABI4 [Brassica 
rapa]
Length=329

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDNSKF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAA+ LYGS+AQ
Sbjct  50   PDNSKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAVFLYGSRAQ  109

Query  472  LNL  480
            LNL
Sbjct  110  LNL  112



>ref|XP_009400145.1| PREDICTED: ethylene-responsive transcription factor ABI4-like 
[Musa acuminata subsp. malaccensis]
Length=292

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N KF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTF+TAEDAA+AYDRAA++LYG +AQ
Sbjct  64   PENGKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFSTAEDAAKAYDRAALILYGPRAQ  123

Query  472  LNLQ  483
            LNLQ
Sbjct  124  LNLQ  127



>ref|XP_002881702.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57961.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=292

 Score = 93.2 bits (230),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDNSKF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAA+ LYGS+AQ
Sbjct  49   PDNSKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAVYLYGSRAQ  108

Query  472  LNL  480
            LNL
Sbjct  109  LNL  111



>ref|XP_009143236.1| PREDICTED: ethylene-responsive transcription factor ABI4-like 
[Brassica rapa]
Length=317

 Score = 93.2 bits (230),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NSKF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAA+ LYGS+AQ
Sbjct  50   PENSKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAVFLYGSRAQ  109

Query  472  LNL  480
            LNL
Sbjct  110  LNL  112



>ref|XP_010554674.1| PREDICTED: ethylene-responsive transcription factor ABI4 [Tarenaya 
hassleriana]
Length=357

 Score = 94.0 bits (232),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+KF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTF+TAEDAARAYDRAA+ LYGS+AQ
Sbjct  53   PDNAKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFSTAEDAARAYDRAALFLYGSRAQ  112

Query  472  LNL  480
            LNL
Sbjct  113  LNL  115



>emb|CDY54991.1| BnaCnng27900D [Brassica napus]
Length=337

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NSKF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTFATAEDAARAYDRAA+ LYGS+AQ
Sbjct  52   PENSKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAVFLYGSRAQ  111

Query  472  LNL  480
            LNL
Sbjct  112  LNL  114



>ref|XP_003568646.1| PREDICTED: ethylene-responsive transcription factor ABI4-like 
[Brachypodium distachyon]
Length=229

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NSKF+YRGVRQRSWGKWVAEIREP+KR+R+WLGTF+TAE+AARAYDRAA+ LYG +AQ
Sbjct  25   PENSKFRYRGVRQRSWGKWVAEIREPRKRSRKWLGTFSTAEEAARAYDRAALQLYGPRAQ  84

Query  472  LNL  480
            LNL
Sbjct  85   LNL  87



>ref|XP_011035901.1| PREDICTED: ethylene-responsive transcription factor ABI4-like 
[Populus euphratica]
Length=413

 Score = 93.2 bits (230),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN KF+YRGVRQRSWGKWVAE REP+KRTR+WL TFATAEDAARAYDRAA +LYGS+A 
Sbjct  142  PDNGKFRYRGVRQRSWGKWVAETREPRKRTRKWLRTFATAEDAARAYDRAAFILYGSRAH  201

Query  472  LNLQP  486
            LNLQP
Sbjct  202  LNLQP  206



>ref|XP_008649551.1| PREDICTED: ethylene-responsive transcription factor ABI4 [Zea 
mays]
 gb|AAM95247.1| AP2 domain transcription factor [Zea mays]
 gb|AFW77748.1| putative AP2/EREBP transcription factor superfamily protein [Zea 
mays]
 gb|AIB05042.1| AP2-EREBP transcription factor, partial [Zea mays]
Length=248

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N KF+YRGVRQRSWGKWVAEIREP+KR+R+WLGTFATAEDAARAYDRAA++LYG +A 
Sbjct  35   PENGKFRYRGVRQRSWGKWVAEIREPRKRSRKWLGTFATAEDAARAYDRAALLLYGPRAH  94

Query  472  LNL  480
            LNL
Sbjct  95   LNL  97



>ref|XP_004963859.1| PREDICTED: ethylene-responsive transcription factor ABI4-like 
[Setaria italica]
Length=255

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N KF+YRGVRQRSWGKWVAEIREP+KR+R+WLGTFATAEDAARAYDRAA++LYG +A 
Sbjct  33   PENGKFRYRGVRQRSWGKWVAEIREPRKRSRKWLGTFATAEDAARAYDRAALLLYGPRAH  92

Query  472  LNL  480
            LNL
Sbjct  93   LNL  95



>ref|XP_002440922.1| hypothetical protein SORBIDRAFT_09g016550 [Sorghum bicolor]
 gb|EES19352.1| hypothetical protein SORBIDRAFT_09g016550 [Sorghum bicolor]
Length=249

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N KF+YRGVRQRSWGKWVAEIREP+KR+R+WLGTFATAEDAARAYDRAA++LYG +A 
Sbjct  36   PENGKFRYRGVRQRSWGKWVAEIREPRKRSRKWLGTFATAEDAARAYDRAALLLYGPRAH  95

Query  472  LNL  480
            LNL
Sbjct  96   LNL  98



>ref|XP_009345774.1| PREDICTED: ethylene-responsive transcription factor ABI4-like 
[Pyrus x bretschneideri]
Length=363

 Score = 88.6 bits (218),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 101/145 (70%), Gaps = 26/145 (18%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSW--------------------GKWVAEIREPKKRTRRWLGTFata  411
            PDN+KF+YRGVRQRSW                    GKWVAEIREP+KRTR+WLGTFATA
Sbjct  41   PDNNKFRYRGVRQRSWGKWVAEIREPRKRTRKWLPAGKWVAEIREPRKRTRKWLGTFATA  100

Query  412  edaaraydraaIVLYGSKAQLNLQPsgnsddgsssssqsskratsysTQNLRPIlpkppg  591
            EDAA AY RAAI+LYGS+AQLNLQPSG+S   S+  S SS  +++ STQ LRP+LP+P G
Sbjct  101  EDAAHAYARAAIILYGSRAQLNLQPSGSSSQNSTRGSSSSASSSTSSTQTLRPLLPRPSG  160

Query  592  fglvpppSAAAA------TAYIPYG  648
            FGL  P S++A       + ++PYG
Sbjct  161  FGLTLPYSSSAHPVPLMDSGFVPYG  185



>ref|NP_001174376.1| Os05g0351200 [Oryza sativa Japonica Group]
 sp|C7J2Z1.1|ABI4_ORYSJ RecName: Full=Ethylene-responsive transcription factor ABI4; 
AltName: Full=ERF ABI4; AltName: Full=Protein ABI4 homolog; 
Short=OsABI4 [Oryza sativa Japonica Group]
 dbj|BAH93104.1| Os05g0351200 [Oryza sativa Japonica Group]
Length=269

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N KF+YRGVRQRSWGKWVAEIREP+KR+R+WLGTFATAEDAARAYDRAA++LYG +A 
Sbjct  43   PENGKFRYRGVRQRSWGKWVAEIREPRKRSRKWLGTFATAEDAARAYDRAALLLYGPRAH  102

Query  472  LN  477
            LN
Sbjct  103  LN  104



>gb|EAY97659.1| hypothetical protein OsI_19581 [Oryza sativa Indica Group]
Length=269

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N KF+YRGVRQRSWGKWVAEIREP+KR+R+WLGTFATAEDAARAYDRAA++LYG +A 
Sbjct  43   PENGKFRYRGVRQRSWGKWVAEIREPRKRSRKWLGTFATAEDAARAYDRAALLLYGPRAH  102

Query  472  LN  477
            LN
Sbjct  103  LN  104



>gb|AAV44075.1| hypothetical protein [Oryza sativa Japonica Group]
Length=292

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N KF+YRGVRQRSWGKWVAEIREP+KR+R+WLGTFATAEDAARAYDRAA++LYG +A 
Sbjct  66   PENGKFRYRGVRQRSWGKWVAEIREPRKRSRKWLGTFATAEDAARAYDRAALLLYGPRAH  125

Query  472  LN  477
            LN
Sbjct  126  LN  127



>ref|XP_002980956.1| hypothetical protein SELMODRAFT_420500 [Selaginella moellendorffii]
 gb|EFJ18141.1| hypothetical protein SELMODRAFT_420500 [Selaginella moellendorffii]
Length=210

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N  + YRGVRQRSWG+WVAEIREP++RTR WLGTFATA+DAA+AYD AA  LYGS+AQ
Sbjct  60   PENGLYTYRGVRQRSWGRWVAEIREPRRRTRVWLGTFATAQDAAQAYDMAAWRLYGSRAQ  119

Query  472  LNLQ  483
            LNL+
Sbjct  120  LNLR  123



>ref|XP_002989303.1| hypothetical protein SELMODRAFT_427925 [Selaginella moellendorffii]
 gb|EFJ09577.1| hypothetical protein SELMODRAFT_427925 [Selaginella moellendorffii]
Length=203

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N  + YRGVRQRSWG+WVAEIREP++RTR WLGTFATA+DAA+AYD AA  LYGS+AQ
Sbjct  53   PENGLYTYRGVRQRSWGRWVAEIREPRRRTRVWLGTFATAQDAAQAYDMAAWRLYGSRAQ  112

Query  472  LNLQ  483
            LNL+
Sbjct  113  LNLR  116



>ref|XP_006843541.1| hypothetical protein AMTR_s00007p00053050 [Amborella trichopoda]
 gb|ERN05216.1| hypothetical protein AMTR_s00007p00053050 [Amborella trichopoda]
Length=329

 Score = 81.3 bits (199),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+KF+YRGVRQRSWGKWVAEIREP+KRTR+WLGTF+TAE+AARAYDRAA  LYG++AQ
Sbjct  79   PDNNKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFSTAEEAARAYDRAAAALYGARAQ  138

Query  472  LNLQ  483
            LNL+
Sbjct  139  LNLE  142



>emb|CDP18276.1| unnamed protein product [Coffea canephora]
Length=234

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS+  YRGVRQR+WGKWVAEIREPKK +R WLGTF TA +AA AYD+AA V+YG  AQ
Sbjct  74   PENSRHNYRGVRQRTWGKWVAEIREPKKGSRLWLGTFGTAIEAALAYDKAARVMYGPSAQ  133

Query  472  LNL  480
            LNL
Sbjct  134  LNL  136



>ref|XP_001773430.1| predicted protein [Physcomitrella patens]
 gb|EDQ61803.1| predicted protein [Physcomitrella patens]
Length=117

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N+  ++RGVRQR+WGKWVAEIREPKKR R WLG+F+TA +AA AYD AA  LYGS A+
Sbjct  40   PENAACEFRGVRQRTWGKWVAEIREPKKRARLWLGSFSTAREAALAYDIAARKLYGSMAE  99

Query  472  LNLQP  486
            LNL P
Sbjct  100  LNLPP  104



>ref|XP_006850202.1| hypothetical protein AMTR_s00022p00250320 [Amborella trichopoda]
 gb|ERN11783.1| hypothetical protein AMTR_s00022p00250320 [Amborella trichopoda]
Length=280

 Score = 78.2 bits (191),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P NS  +YRGVRQR+WGKWVAEIREPKKRTR WLG+F+TAE+AA AYD AA  LYG +A 
Sbjct  23   PQNSSCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFSTAEEAALAYDEAARRLYGPEAH  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>ref|XP_002973089.1| hypothetical protein SELMODRAFT_38502, partial [Selaginella moellendorffii]
 ref|XP_002976779.1| hypothetical protein SELMODRAFT_105485, partial [Selaginella 
moellendorffii]
 gb|EFJ22448.1| hypothetical protein SELMODRAFT_105485, partial [Selaginella 
moellendorffii]
 gb|EFJ25463.1| hypothetical protein SELMODRAFT_38502, partial [Selaginella moellendorffii]
Length=75

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N+   YRGVRQR+WGKWVAEIREPKKR+R WLG+FATA++AARAYD AA  LYG +A 
Sbjct  12   PENASCTYRGVRQRTWGKWVAEIREPKKRSRLWLGSFATADEAARAYDEAAKRLYGPEAH  71

Query  472  LNL  480
            LNL
Sbjct  72   LNL  74



>emb|CDY33815.1| BnaCnng07330D [Brassica napus]
Length=115

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+FAT+E+AA AYD AA+ LYG  A 
Sbjct  15   PQNALCRYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATSEEAAMAYDEAALKLYGHDAY  74

Query  472  LNL  480
            LNL
Sbjct  75   LNL  77



>ref|XP_004136746.1| PREDICTED: dehydration-responsive element-binding protein 2F-like 
[Cucumis sativus]
Length=174

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+F+TAE+AA AYD+AA  LYG  A 
Sbjct  31   PQNASCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFSTAEEAAMAYDQAATKLYGPHAY  90

Query  472  LNL  480
            LNL
Sbjct  91   LNL  93



>ref|XP_004161497.1| PREDICTED: dehydration-responsive element-binding protein 2F-like 
[Cucumis sativus]
Length=175

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+F+TAE+AA AYD+AA  LYG  A 
Sbjct  31   PQNASCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFSTAEEAAMAYDQAATKLYGPHAY  90

Query  472  LNL  480
            LNL
Sbjct  91   LNL  93



>ref|XP_009776426.1| PREDICTED: uncharacterized protein LOC104226206 [Nicotiana sylvestris]
Length=485

 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN   KYRGVRQR+WGKWVAEIREP + +R WLGTF+TA DAA AYD  AI +YGS+A+
Sbjct  72   PDNQNCKYRGVRQRTWGKWVAEIREPNRGSRIWLGTFSTALDAALAYDEVAISMYGSRAR  131

Query  472  LNL  480
            LNL
Sbjct  132  LNL  134



>emb|CAT00689.1| AP2 transcription factor [Antirrhinum majus]
Length=196

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG++A 
Sbjct  23   PQNATCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAAMAYDEAARRLYGAEAY  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>ref|XP_006575245.1| PREDICTED: dehydration-responsive element-binding protein 2F-like 
isoform X2 [Glycine max]
Length=203

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P NS  +YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  23   PQNSSCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAALAYDEAARRLYGPDAY  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>ref|XP_010427643.1| PREDICTED: dehydration-responsive element-binding protein 2F 
[Camelina sativa]
Length=278

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKR R WLG+FATAE+AA AYD AA+ LYG +A 
Sbjct  21   PQNALCQYRGVRQRTWGKWVAEIREPKKRARLWLGSFATAEEAAMAYDEAALKLYGHEAY  80

Query  472  LNL  480
            LNL
Sbjct  81   LNL  83



>ref|XP_003518110.1| PREDICTED: dehydration-responsive element-binding protein 2F-like 
isoform X1 [Glycine max]
 gb|KHN05961.1| Dehydration-responsive element-binding protein 2F [Glycine soja]
Length=309

 Score = 76.6 bits (187),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P NS  +YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  23   PQNSSCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAALAYDEAARRLYGPDAY  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>ref|XP_010504692.1| PREDICTED: dehydration-responsive element-binding protein 2F-like 
[Camelina sativa]
Length=278

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKR R WLG+FATAE+AA AYD AA+ LYG +A 
Sbjct  21   PQNALCQYRGVRQRTWGKWVAEIREPKKRARLWLGSFATAEEAAMAYDEAALKLYGHEAY  80

Query  472  LNL  480
            LNL
Sbjct  81   LNL  83



>gb|KHN48370.1| Dehydration-responsive element-binding protein 2F [Glycine soja]
Length=319

 Score = 77.0 bits (188),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P NS  +YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  23   PQNSSCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAALAYDEAARRLYGPDAY  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>ref|XP_003535164.2| PREDICTED: dehydration-responsive element-binding protein 2F-like 
[Glycine max]
Length=360

 Score = 77.4 bits (189),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P NS  +YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  64   PQNSSCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAALAYDEAARRLYGPDAY  123

Query  472  LNL  480
            LNL
Sbjct  124  LNL  126



>ref|XP_010516379.1| PREDICTED: dehydration-responsive element-binding protein 2F-like 
[Camelina sativa]
Length=278

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKR R WLG+FATAE+AA AYD AA+ LYG +A 
Sbjct  21   PQNALCQYRGVRQRTWGKWVAEIREPKKRARLWLGSFATAEEAAMAYDEAALKLYGHEAY  80

Query  472  LNL  480
            LNL
Sbjct  81   LNL  83



>gb|KGN59345.1| hypothetical protein Csa_3G812170 [Cucumis sativus]
Length=333

 Score = 77.0 bits (188),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+F+TAE+AA AYD+AA  LYG  A 
Sbjct  31   PQNASCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFSTAEEAAMAYDQAATKLYGPHAY  90

Query  472  LNL  480
            LNL
Sbjct  91   LNL  93



>ref|XP_007028832.1| Integrase-type DNA-binding superfamily protein [Theobroma cacao]
 gb|EOY09334.1| Integrase-type DNA-binding superfamily protein [Theobroma cacao]
Length=283

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG +A 
Sbjct  23   PQNASCQYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAAMAYDEAARRLYGPEAY  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>ref|XP_008443124.1| PREDICTED: dehydration-responsive element-binding protein 2F 
[Cucumis melo]
Length=330

 Score = 76.6 bits (187),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+F+TAE+AA AYD+AA  LYG  A 
Sbjct  31   PQNASCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFSTAEEAAMAYDQAATKLYGPHAY  90

Query  472  LNL  480
            LNL
Sbjct  91   LNL  93



>gb|KFK35005.1| hypothetical protein AALP_AA5G221900 [Arabis alpina]
Length=253

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKR R WLG+FATAE+AA AYD AA+ LYG  A 
Sbjct  21   PQNALCQYRGVRQRTWGKWVAEIREPKKRARLWLGSFATAEEAAMAYDEAALKLYGHDAY  80

Query  472  LNL  480
            LNL
Sbjct  81   LNL  83



>ref|XP_010524115.1| PREDICTED: dehydration-responsive element-binding protein 2F 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010524123.1| PREDICTED: dehydration-responsive element-binding protein 2F 
isoform X2 [Tarenaya hassleriana]
Length=291

 Score = 75.9 bits (185),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+F+T+E+AA AYD AA+ LYG  A 
Sbjct  24   PQNALCRYRGVRQRTWGKWVAEIREPKKRTRLWLGSFSTSEEAAMAYDAAALKLYGPDAY  83

Query  472  LNL  480
            LNL
Sbjct  84   LNL  86



>ref|XP_008776284.1| PREDICTED: dehydration-responsive element-binding protein 2B-like 
isoform X2 [Phoenix dactylifera]
Length=270

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN   KYRGVRQR+WGKWVAEIREP + +R WLGTF TA +AA AYD AA  +YGS A+
Sbjct  7    PDNPHCKYRGVRQRTWGKWVAEIREPSRGSRLWLGTFPTAVEAALAYDEAARAMYGSYAR  66

Query  472  LNL  480
            LNL
Sbjct  67   LNL  69



>ref|XP_003625169.1| Dehydration-responsive element-binding protein 2F [Medicago truncatula]
 gb|AES81387.1| dehydration-responsive element-binding protein [Medicago truncatula]
Length=288

 Score = 75.9 bits (185),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  23   PQNASCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAAMAYDEAARRLYGPDAY  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>ref|XP_009340780.1| PREDICTED: dehydration-responsive element-binding protein 2F-like 
[Pyrus x bretschneideri]
Length=285

 Score = 75.9 bits (185),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG +A 
Sbjct  23   PQNASCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAAMAYDDAARRLYGPEAF  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>ref|XP_004493523.1| PREDICTED: dehydration-responsive element-binding protein 2F-like 
[Cicer arietinum]
Length=289

 Score = 75.9 bits (185),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  24   PQNASCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAAMAYDEAARRLYGPDAY  83

Query  472  LNL  480
            LNL
Sbjct  84   LNL  86



>ref|XP_010265763.1| PREDICTED: dehydration-responsive element-binding protein 2F-like 
[Nelumbo nucifera]
Length=286

 Score = 75.5 bits (184),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG +A 
Sbjct  23   PQNASCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAAMAYDEAARRLYGPEAY  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>ref|XP_006291644.1| hypothetical protein CARUB_v10017800mg [Capsella rubella]
 gb|EOA24542.1| hypothetical protein CARUB_v10017800mg [Capsella rubella]
Length=278

 Score = 75.5 bits (184),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKR R WLG+FATAE+AA AYD AA+ LYG  A 
Sbjct  21   PQNALCQYRGVRQRTWGKWVAEIREPKKRARLWLGSFATAEEAAMAYDEAALKLYGHDAY  80

Query  472  LNL  480
            LNL
Sbjct  81   LNL  83



>ref|XP_010257316.1| PREDICTED: dehydration-responsive element-binding protein 2F-like 
[Nelumbo nucifera]
Length=284

 Score = 75.5 bits (184),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+F+TAE+AA AYD AA  LYG +A 
Sbjct  23   PQNASCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFSTAEEAAMAYDEAARRLYGPEAY  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>ref|XP_006402862.1| hypothetical protein EUTSA_v10006489mg [Eutrema salsugineum]
 gb|ESQ44315.1| hypothetical protein EUTSA_v10006489mg [Eutrema salsugineum]
Length=280

 Score = 75.5 bits (184),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKR R WLG+FATAE+AA AYD AA+ LYG  A 
Sbjct  21   PQNALCRYRGVRQRTWGKWVAEIREPKKRARLWLGSFATAEEAAMAYDEAALKLYGHDAY  80

Query  472  LNL  480
            LNL
Sbjct  81   LNL  83



>ref|XP_008387280.1| PREDICTED: dehydration-responsive element-binding protein 2F 
[Malus domestica]
Length=285

 Score = 75.5 bits (184),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG +A 
Sbjct  23   PQNASCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAAMAYDDAARRLYGPEAF  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>ref|XP_008350282.1| PREDICTED: dehydration-responsive element-binding protein 2F-like 
[Malus domestica]
 gb|AER13453.1| dehydration-responsive element binding protein [Malus prunifolia]
Length=285

 Score = 75.5 bits (184),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG +A 
Sbjct  23   PQNASCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAAMAYDDAARRLYGPEAF  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>ref|XP_009116465.1| PREDICTED: dehydration-responsive element-binding protein 2F 
[Brassica rapa]
Length=270

 Score = 75.1 bits (183),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKR R WLG+FATAE+AA AYD AA+ LYG +A 
Sbjct  21   PQNALCRYRGVRQRTWGKWVAEIREPKKRARLWLGSFATAEEAAMAYDEAALKLYGPEAY  80

Query  472  LNL  480
            LNL
Sbjct  81   LNL  83



>ref|XP_002876426.1| hypothetical protein ARALYDRAFT_486209 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52685.1| hypothetical protein ARALYDRAFT_486209 [Arabidopsis lyrata subsp. 
lyrata]
Length=277

 Score = 75.5 bits (184),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKR R WLG+FATAE+AA AYD AA+ LYG  A 
Sbjct  21   PQNALCQYRGVRQRTWGKWVAEIREPKKRARLWLGSFATAEEAAMAYDEAALKLYGHDAY  80

Query  472  LNL  480
            LNL
Sbjct  81   LNL  83



>emb|CDX72012.1| BnaC08g28620D [Brassica napus]
Length=273

 Score = 75.1 bits (183),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKR R WLG+FATAE+AA AYD AA+ LYG +A 
Sbjct  21   PQNALCRYRGVRQRTWGKWVAEIREPKKRARLWLGSFATAEEAAMAYDEAALKLYGPEAY  80

Query  472  LNL  480
            LNL
Sbjct  81   LNL  83



>gb|KHN26337.1| Dehydration-responsive element-binding protein 2F [Glycine soja]
Length=282

 Score = 75.5 bits (184),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  23   PQNASCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAAMAYDEAARRLYGPDAY  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>ref|XP_003553420.1| PREDICTED: dehydration-responsive element-binding protein 2F-like 
[Glycine max]
Length=282

 Score = 75.5 bits (184),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  23   PQNASCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAAMAYDEAARRLYGPDAY  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>ref|XP_010934576.1| PREDICTED: dehydration-responsive element-binding protein 2F, 
partial [Elaeis guineensis]
Length=159

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+F+TA++AA AYD AA  LYG  A 
Sbjct  23   PQNASCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFSTAQEAAMAYDEAARRLYGPDAY  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>ref|XP_007162244.1| hypothetical protein PHAVU_001G136100g [Phaseolus vulgaris]
 gb|ESW34238.1| hypothetical protein PHAVU_001G136100g [Phaseolus vulgaris]
Length=280

 Score = 75.1 bits (183),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  23   PQNASCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAAIAYDEAARRLYGPDAY  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>ref|NP_191319.1| dehydration-responsive element-binding protein 2F [Arabidopsis 
thaliana]
 sp|Q9SVX5.1|DRE2F_ARATH RecName: Full=Dehydration-responsive element-binding protein 
2F; Short=Protein DREB2F [Arabidopsis thaliana]
 emb|CAB41195.1| putative protein [Arabidopsis thaliana]
 gb|AAM64799.1| AP2 transcription factor-like protein [Arabidopsis thaliana]
 dbj|BAE99254.1| AP2 transcription factor - like protein [Arabidopsis thaliana]
 gb|ABI49492.1| At3g57600 [Arabidopsis thaliana]
 gb|AEE79677.1| dehydration-responsive element-binding protein 2F [Arabidopsis 
thaliana]
Length=277

 Score = 75.1 bits (183),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKR R WLG+FATAE+AA AYD AA+ LYG  A 
Sbjct  21   PQNALCQYRGVRQRTWGKWVAEIREPKKRARLWLGSFATAEEAAMAYDEAALKLYGHDAY  80

Query  472  LNL  480
            LNL
Sbjct  81   LNL  83



>emb|CDY06088.1| BnaA09g36920D [Brassica napus]
Length=270

 Score = 75.1 bits (183),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKR R WLG+FATAE+AA AYD AA+ LYG +A 
Sbjct  21   PQNALCRYRGVRQRTWGKWVAEIREPKKRARLWLGSFATAEEAAMAYDEAALKLYGPEAY  80

Query  472  LNL  480
            LNL
Sbjct  81   LNL  83



>ref|XP_002526723.1| hypothetical protein RCOM_0089590 [Ricinus communis]
 gb|EEF35637.1| hypothetical protein RCOM_0089590 [Ricinus communis]
Length=300

 Score = 75.5 bits (184),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  23   PQNAMCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAAMAYDEAARRLYGPDAY  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>ref|XP_001781003.1| predicted protein [Physcomitrella patens]
 gb|EDQ54187.1| predicted protein [Physcomitrella patens]
Length=76

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS  ++RGVRQR+WGKWVAEIREPKKR R WLG+F TA++AA AYD AA   YG  A+
Sbjct  7    PENSACEFRGVRQRTWGKWVAEIREPKKRVRLWLGSFPTAKEAALAYDIAARKFYGPLAE  66

Query  472  LNL  480
            LNL
Sbjct  67   LNL  69



>ref|XP_003520524.1| PREDICTED: dehydration-responsive element-binding protein 2F-like 
[Glycine max]
 gb|KHN07388.1| Dehydration-responsive element-binding protein 2F [Glycine soja]
Length=284

 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  23   PQNASCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAAMAYDEAARRLYGPDAY  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>ref|XP_010940962.1| PREDICTED: dehydration-responsive element-binding protein 2E-like 
[Elaeis guineensis]
Length=301

 Score = 75.5 bits (184),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  24   PQNASCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAAMAYDEAARRLYGPDAY  83

Query  472  LNL  480
            LNL
Sbjct  84   LNL  86



>ref|XP_011033305.1| PREDICTED: dehydration-responsive element-binding protein 2F-like 
[Populus euphratica]
Length=286

 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  23   PQNAMCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAAMAYDEAARRLYGPDAY  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>ref|XP_002323309.1| Dehydration responsive element binding protein 2F [Populus trichocarpa]
 gb|EEF05070.1| Dehydration responsive element binding protein 2F [Populus trichocarpa]
Length=286

 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  23   PQNAMCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAAMAYDEAARRLYGPDAY  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>gb|ABR23508.1| DREB2-like protein [Chrysanthemum vestitum]
Length=366

 Score = 76.3 bits (186),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS+ K+RGVRQR+WGKWVAEIREP + +R WLGTF +A +AA AYD AA V+YGS A+
Sbjct  76   PENSRCKFRGVRQRTWGKWVAEIREPNRGSRLWLGTFGSAVEAALAYDEAARVMYGSCAR  135

Query  472  LNL  480
            LNL
Sbjct  136  LNL  138



>ref|XP_002277662.2| PREDICTED: dehydration-responsive element-binding protein 2F 
[Vitis vinifera]
 emb|CAN80643.1| hypothetical protein VITISV_016914 [Vitis vinifera]
Length=287

 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  23   PQNATCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAAMAYDEAARRLYGPDAY  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>ref|XP_004307569.1| PREDICTED: dehydration-responsive element-binding protein 2F-like 
[Fragaria vesca subsp. vesca]
Length=286

 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  23   PQNASCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAAMAYDEAARRLYGPDAF  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>ref|XP_008776283.1| PREDICTED: dehydration-responsive element-binding protein 2B-like 
isoform X1 [Phoenix dactylifera]
Length=326

 Score = 75.5 bits (184),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN   KYRGVRQR+WGKWVAEIREP + +R WLGTF TA +AA AYD AA  +YGS A+
Sbjct  63   PDNPHCKYRGVRQRTWGKWVAEIREPSRGSRLWLGTFPTAVEAALAYDEAARAMYGSYAR  122

Query  472  LNL  480
            LNL
Sbjct  123  LNL  125



>ref|XP_004249756.1| PREDICTED: dehydration-responsive element-binding protein 2F 
[Solanum lycopersicum]
Length=317

 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG +A 
Sbjct  23   PQNALCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAAMAYDEAARRLYGPEAY  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>gb|AES67310.2| dehydration-responsive element-binding protein [Medicago truncatula]
Length=188

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS+  YRGVRQR+WGKWV+EIREP + +R WLGTF TA  AA AYD AA  +YGS+A+
Sbjct  58   PENSRCNYRGVRQRTWGKWVSEIREPNRGSRLWLGTFTTAIGAALAYDEAARAMYGSRAR  117

Query  472  LNL  480
            LN 
Sbjct  118  LNF  120



>ref|XP_009804771.1| PREDICTED: dehydration-responsive element-binding protein 2F 
[Nicotiana sylvestris]
Length=287

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  23   PQNALCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAAMAYDEAARRLYGPDAY  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>ref|XP_002522019.1| hypothetical protein RCOM_0610630 [Ricinus communis]
 gb|EEF40423.1| hypothetical protein RCOM_0610630 [Ricinus communis]
Length=215

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N+   YRGVRQR+WGKWVAEIREP +  R WLGTF T+ +AA+AYD+AAI LYGS A 
Sbjct  26   PENALCTYRGVRQRTWGKWVAEIREPNRGNRIWLGTFNTSHEAAKAYDQAAIKLYGSSAT  85

Query  472  LNL  480
            LNL
Sbjct  86   LNL  88



>ref|XP_009613454.1| PREDICTED: dehydration-responsive element-binding protein 2F 
[Nicotiana tomentosiformis]
Length=286

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  23   PQNALCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAAMAYDEAARRLYGPDAY  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>ref|XP_008804145.1| PREDICTED: dehydration-responsive element-binding protein 2B-like 
isoform X2 [Phoenix dactylifera]
Length=266

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+  KYRGVRQR+WGKWVAEIREP + +R WLGTF TA +AA AYD AA  +YG  A+
Sbjct  7    PDNAHCKYRGVRQRTWGKWVAEIREPNRGSRLWLGTFPTALEAALAYDEAAKAMYGPYAR  66

Query  472  LNL  480
            LNL
Sbjct  67   LNL  69



>ref|XP_001766084.1| predicted protein [Physcomitrella patens]
 gb|EDQ69143.1| predicted protein [Physcomitrella patens]
Length=81

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N+   YRGVRQR+WGKWVAEIREP + +R WLGT+ TAE AA AYD AA VLYGS A 
Sbjct  19   PENAMCNYRGVRQRTWGKWVAEIREPNRGSRLWLGTYPTAEIAALAYDSAARVLYGSNAL  78

Query  472  LNL  480
            LNL
Sbjct  79   LNL  81



>emb|CDY20377.1| BnaC02g24390D [Brassica napus]
Length=198

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+   Y+GVRQR+WGKWVAEIREP +  R WLGTF TA +AA AYD AA  LYGS+A 
Sbjct  26   PDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTAREAALAYDSAARKLYGSEAH  85

Query  472  LNL  480
            LNL
Sbjct  86   LNL  88



>ref|XP_008240865.1| PREDICTED: dehydration-responsive element-binding protein 2F 
[Prunus mume]
Length=285

 Score = 74.7 bits (182),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  23   PQNASCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAAMAYDDAARRLYGPDAF  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>ref|XP_008789182.1| PREDICTED: ethylene-responsive transcription factor ABI4-like 
[Phoenix dactylifera]
Length=251

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +1

Query  328  QRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQLNLQP  486
            +RSWGKWVAEIREP+KRTR+WLGTF+TAEDAARAYDRAA+VLYG +AQLNLQP
Sbjct  31   ERSWGKWVAEIREPRKRTRKWLGTFSTAEDAARAYDRAALVLYGPRAQLNLQP  83



>gb|AEI98833.1| dehydration responsive element binding protein 1 [Solanum tuberosum]
Length=319

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS+ KYRGVRQR WGKWVAEIREPK+ +R WLGTF TA +AA AYD AA  +YG  A+
Sbjct  76   PENSRCKYRGVRQRIWGKWVAEIREPKRGSRLWLGTFGTAIEAALAYDEAARAMYGPCAR  135

Query  472  LNL  480
            LNL
Sbjct  136  LNL  138



>ref|XP_008809802.1| PREDICTED: dehydration-responsive element-binding protein 2F 
[Phoenix dactylifera]
Length=303

 Score = 74.7 bits (182),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+   YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  24   PQNASCDYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAAMAYDEAARRLYGPDAY  83

Query  472  LNL  480
            LNL
Sbjct  84   LNL  86



>ref|XP_009128106.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Brassica rapa]
 emb|CDY39036.1| BnaA02g17250D [Brassica napus]
Length=198

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+   Y+GVRQR+WGKWVAEIREP +  R WLGTF TA +AA AYD AA  LYGS+A 
Sbjct  26   PDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTAREAALAYDSAARKLYGSEAH  85

Query  472  LNL  480
            LNL
Sbjct  86   LNL  88



>ref|XP_007132590.1| hypothetical protein PHAVU_011G107800g [Phaseolus vulgaris]
 ref|XP_007132591.1| hypothetical protein PHAVU_011G107800g [Phaseolus vulgaris]
 gb|ESW04584.1| hypothetical protein PHAVU_011G107800g [Phaseolus vulgaris]
 gb|ESW04585.1| hypothetical protein PHAVU_011G107800g [Phaseolus vulgaris]
Length=199

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS+  YRGVRQR+WGKWVAEIREP + +R WLGTF TA  AA AYD AA  +YGS A+
Sbjct  58   PENSRCNYRGVRQRTWGKWVAEIREPNRGSRLWLGTFPTAISAALAYDEAARAMYGSGAR  117

Query  472  LNL  480
            LN 
Sbjct  118  LNF  120



>ref|XP_002960299.1| hypothetical protein SELMODRAFT_27203, partial [Selaginella moellendorffii]
 gb|EFJ37838.1| hypothetical protein SELMODRAFT_27203, partial [Selaginella moellendorffii]
Length=144

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N    YRGVRQR+WGKWVAEIREP + +R WLGT+ATAE+AA AYD AA VLYGS A+
Sbjct  26   PENPLCHYRGVRQRTWGKWVAEIREPNRGSRLWLGTYATAEEAAMAYDDAARVLYGSCAR  85

Query  472  LNL  480
            LNL
Sbjct  86   LNL  88



>gb|AFK47592.1| unknown [Lotus japonicus]
Length=203

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS+  YRGVRQR+WGKWVAEIREP +  R WLGTFATA  AA AYD AA  +YGS A+
Sbjct  60   PENSRCNYRGVRQRTWGKWVAEIREPNRGKRLWLGTFATAIGAALAYDEAARAMYGSSAR  119

Query  472  LNL  480
            LN 
Sbjct  120  LNF  122



>ref|XP_006353419.1| PREDICTED: dehydration-responsive element-binding protein 2A-like 
[Solanum tuberosum]
Length=320

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS+ KYRGVRQR WGKWVAEIREPK+ +R WLGTF TA +AA AYD AA  +YG  A+
Sbjct  76   PENSRCKYRGVRQRIWGKWVAEIREPKRGSRLWLGTFGTAIEAALAYDEAARAMYGPCAR  135

Query  472  LNL  480
            LNL
Sbjct  136  LNL  138



>ref|XP_002967414.1| hypothetical protein SELMODRAFT_38483, partial [Selaginella moellendorffii]
 gb|EFJ32013.1| hypothetical protein SELMODRAFT_38483, partial [Selaginella moellendorffii]
Length=83

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N    YRGVRQR+WGKWVAEIREP + +R WLGT+ATAE+AA AYD AA VLYGS A+
Sbjct  19   PENPLCHYRGVRQRTWGKWVAEIREPNRGSRLWLGTYATAEEAAMAYDDAARVLYGSCAR  78

Query  472  LNL  480
            LNL
Sbjct  79   LNL  81



>ref|XP_009139025.1| PREDICTED: dehydration-responsive element-binding protein 2F-like 
[Brassica rapa]
Length=259

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKR R WLG+FATAE+AA AYD+AA+ L+G  A 
Sbjct  21   PQNALCRYRGVRQRTWGKWVAEIREPKKRARLWLGSFATAEEAAMAYDKAALKLFGHDAY  80

Query  472  LNL  480
            LNL
Sbjct  81   LNL  83



>ref|XP_006351409.1| PREDICTED: dehydration-responsive element-binding protein 2F-like 
[Solanum tuberosum]
Length=292

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  23   PQNALCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAAMAYDEAARRLYGPDAY  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>ref|XP_007202407.1| hypothetical protein PRUPE_ppa009616mg [Prunus persica]
 gb|EMJ03606.1| hypothetical protein PRUPE_ppa009616mg [Prunus persica]
Length=285

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  23   PQNASCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAAMAYDDAARRLYGPDAF  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>emb|CDX88955.1| BnaA04g02310D [Brassica napus]
Length=260

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKR R WLG+FATAE+AA AYD+AA+ L+G  A 
Sbjct  21   PQNALCRYRGVRQRTWGKWVAEIREPKKRARLWLGSFATAEEAAMAYDKAALKLFGHDAY  80

Query  472  LNL  480
            LNL
Sbjct  81   LNL  83



>ref|XP_007145629.1| hypothetical protein PHAVU_007G255100g [Phaseolus vulgaris]
 gb|ESW17623.1| hypothetical protein PHAVU_007G255100g [Phaseolus vulgaris]
Length=292

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKR+R WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  23   PQNASCEYRGVRQRTWGKWVAEIREPKKRSRLWLGSFATAEEAALAYDEAARRLYGPDAY  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>ref|XP_010672841.1| PREDICTED: dehydration-responsive element-binding protein 2F 
[Beta vulgaris subsp. vulgaris]
Length=289

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+   YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG +A 
Sbjct  26   PQNATCTYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAALAYDEAARRLYGPEAY  85

Query  472  LNL  480
            LNL
Sbjct  86   LNL  88



>ref|XP_010921035.1| PREDICTED: dehydration-responsive element-binding protein 2B-like 
isoform X2 [Elaeis guineensis]
Length=259

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN + KYRGVRQR+WGKWVAEIREP + +R WLGTF TA +AA AYD AA  +YG  A+
Sbjct  7    PDNPQCKYRGVRQRTWGKWVAEIREPNRGSRLWLGTFPTALEAALAYDEAARAMYGPYAR  66

Query  472  LNL  480
            LNL
Sbjct  67   LNL  69



>ref|XP_008649742.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Zea mays]
 gb|AFW78347.1| putative AP2/EREBP transcription factor superfamily protein [Zea 
mays]
 gb|AIB04736.1| AP2-EREBP transcription factor, partial [Zea mays]
Length=205

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN++  YRGVRQR WGKWVAEIREP +  R WLGTF    DAA AYDRAA+ ++G+ A 
Sbjct  55   PDNTRHNYRGVRQRRWGKWVAEIREPNRGKRHWLGTFDNPVDAAVAYDRAAVSIHGAHAH  114

Query  472  LNL  480
            LN 
Sbjct  115  LNF  117



>gb|KCW65721.1| hypothetical protein EUGRSUZ_G03094 [Eucalyptus grandis]
Length=235

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N+ F YRGVRQR+WGKWVAEIREP + +R WLGTF TA +AA+AYD AA  +YG  A+
Sbjct  46   PENTTFNYRGVRQRTWGKWVAEIREPNRGSRLWLGTFPTAIEAAKAYDEAATAMYGPCAR  105

Query  472  LNL  480
            LN 
Sbjct  106  LNF  108



>ref|XP_008233818.1| PREDICTED: dehydration-responsive element-binding protein 2C 
[Prunus mume]
Length=388

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDNS+  YRGVRQR+WGKWVAEIREP + +R WLGTF TA DAA AYD AA  +YG  A+
Sbjct  74   PDNSRCNYRGVRQRTWGKWVAEIREPNRGSRLWLGTFPTALDAALAYDEAAKAMYGPAAR  133

Query  472  LNL  480
            LNL
Sbjct  134  LNL  136



>ref|XP_007218175.1| hypothetical protein PRUPE_ppa007606mg [Prunus persica]
 gb|EMJ19374.1| hypothetical protein PRUPE_ppa007606mg [Prunus persica]
Length=362

 Score = 75.1 bits (183),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDNS+  YRGVRQR+WGKWVAEIREP + +R WLGTF TA DAA AYD AA  +YG  A+
Sbjct  74   PDNSRCNYRGVRQRTWGKWVAEIREPNRGSRLWLGTFPTALDAALAYDEAAKAMYGPAAR  133

Query  472  LNL  480
            LNL
Sbjct  134  LNL  136



>gb|ADV57357.1| putative dehydration responsive element binding protein [Eremosparton 
songoricum]
Length=207

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS+  YRGVRQR+WGKWVAEIREP +  R WLGTF+ A  AA AYD AA  +YGS A+
Sbjct  65   PENSRCNYRGVRQRTWGKWVAEIREPNRGNRLWLGTFSNAVGAALAYDEAARAMYGSCAR  124

Query  472  LNL  480
            LN 
Sbjct  125  LNF  127



>gb|KHN29762.1| Dehydration-responsive element-binding protein 2F [Glycine soja]
Length=172

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQ++WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  21   PQNACCEYRGVRQQTWGKWVAEIREPKKRTRLWLGSFATAEEAAMAYDEAARRLYGPDAY  80

Query  472  LNL  480
            LNL
Sbjct  81   LNL  83



>ref|NP_001240238.1| uncharacterized protein LOC100783729 [Glycine max]
 ref|XP_006580986.1| PREDICTED: uncharacterized protein LOC100783729 isoform X1 [Glycine 
max]
 gb|ACU19685.1| unknown [Glycine max]
 gb|KHN41188.1| Dehydration-responsive element-binding protein 2A [Glycine soja]
Length=214

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS+  YRGVRQR+WGKWVAEIREP + +R WLGTF TA  AA AYD AA  +YGS A+
Sbjct  60   PENSRCNYRGVRQRTWGKWVAEIREPNRGSRLWLGTFPTAISAALAYDEAARAMYGSCAR  119

Query  472  LNL  480
            LN 
Sbjct  120  LNF  122



>ref|XP_010091861.1| Dehydration-responsive element-binding protein 2F [Morus notabilis]
 gb|AHJ25967.1| dehydration responsive element binding transcription factor [Morus 
notabilis]
 gb|EXB46302.1| Dehydration-responsive element-binding protein 2F [Morus notabilis]
Length=285

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  23   PLNASCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAAMAYDEAARRLYGPDAY  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>ref|XP_004513549.1| PREDICTED: dehydration-responsive element-binding protein 2A-like 
[Cicer arietinum]
Length=202

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS+  YRGVRQR+WGKWVAEIREP + +R WLGTF  A  AA AYD AA  +YGS A+
Sbjct  58   PENSRCNYRGVRQRTWGKWVAEIREPNRGSRLWLGTFPNAVGAALAYDEAARAMYGSCAR  117

Query  472  LNL  480
            LN 
Sbjct  118  LNF  120



>ref|XP_006421446.1| hypothetical protein CICLE_v10005549mg [Citrus clementina]
 gb|ESR34686.1| hypothetical protein CICLE_v10005549mg [Citrus clementina]
Length=293

 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  23   PLNASCQYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAAMAYDEAARRLYGPDAY  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>gb|KDP26013.1| hypothetical protein JCGZ_21046 [Jatropha curcas]
Length=288

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKR+R WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  23   PQNAMCEYRGVRQRTWGKWVAEIREPKKRSRLWLGSFATAEEAAMAYDEAARRLYGPDAY  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>ref|XP_006493905.1| PREDICTED: dehydration-responsive element-binding protein 2F-like 
[Citrus sinensis]
 gb|KDO45392.1| hypothetical protein CISIN_1g042353mg [Citrus sinensis]
Length=293

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  23   PLNASCQYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAAMAYDEAARRLYGPDAY  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>gb|ABC49682.1| dehydration responsive element binding protein [Cicer arietinum]
Length=202

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS+  YRGVRQR+WGKWVAEIREP + +R WLGTF  A  AA AYD AA  +YGS A+
Sbjct  58   PENSRCNYRGVRQRTWGKWVAEIREPNRGSRLWLGTFPNAVGAALAYDEAARAMYGSCAR  117

Query  472  LNL  480
            LN 
Sbjct  118  LNF  120



>ref|XP_009394631.1| PREDICTED: dehydration-responsive element-binding protein 2E-like 
[Musa acuminata subsp. malaccensis]
Length=236

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREP+KRTR WLG+F TAE+AA AYD AA  LYG  A 
Sbjct  24   PQNASCQYRGVRQRTWGKWVAEIREPRKRTRLWLGSFPTAEEAALAYDEAARRLYGPDAY  83

Query  472  LNL  480
            LNL
Sbjct  84   LNL  86



>gb|EYU18760.1| hypothetical protein MIMGU_mgv1a011288mg [Erythranthe guttata]
Length=287

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKR R WLG+FATAE+AA AYD AA  LYG +A 
Sbjct  23   PQNATCEYRGVRQRTWGKWVAEIREPKKRARLWLGSFATAEEAAMAYDEAARRLYGPEAY  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>ref|XP_011075213.1| PREDICTED: dehydration-responsive element-binding protein 2F 
[Sesamum indicum]
Length=288

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREP KRTR WLG+FATAE+AA AYD AA  LYG +A 
Sbjct  23   PQNAMCEYRGVRQRTWGKWVAEIREPNKRTRLWLGSFATAEEAAMAYDEAARRLYGPEAY  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>ref|XP_008804144.1| PREDICTED: dehydration-responsive element-binding protein 2B-like 
isoform X1 [Phoenix dactylifera]
Length=322

 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+  KYRGVRQR+WGKWVAEIREP + +R WLGTF TA +AA AYD AA  +YG  A+
Sbjct  63   PDNAHCKYRGVRQRTWGKWVAEIREPNRGSRLWLGTFPTALEAALAYDEAAKAMYGPYAR  122

Query  472  LNL  480
            LNL
Sbjct  123  LNL  125



>ref|XP_004302113.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Fragaria vesca subsp. vesca]
Length=180

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N+   +RGVRQR+WGKWVAEIREPK+  R WLGTF T+ +AA AYD AA  LYGS A+
Sbjct  15   PENATCTFRGVRQRTWGKWVAEIREPKRGARLWLGTFNTSTEAALAYDDAARKLYGSSAK  74

Query  472  LNL  480
            LNL
Sbjct  75   LNL  77



>gb|AFK38091.1| unknown [Medicago truncatula]
Length=197

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS+  YRGVRQR+WGKWVAEIREP +  R WLGTF+ A  AA AYD AA  +YGS A+
Sbjct  58   PENSRCNYRGVRQRTWGKWVAEIREPNRGNRLWLGTFSNAVGAALAYDEAARAMYGSCAR  117

Query  472  LNL  480
            LN 
Sbjct  118  LNF  120



>gb|AAP83131.1| DREB [Glycine max]
Length=198

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS+  YRGVRQR+WGKWVAEIREP +  R WLGTF TA  AA AYD AA  +YGS A+
Sbjct  58   PENSRCNYRGVRQRTWGKWVAEIREPNRGNRLWLGTFPTAIGAALAYDEAAQAMYGSCAR  117

Query  472  LNL  480
            LN 
Sbjct  118  LNF  120



>ref|XP_010067565.1| PREDICTED: dehydration-responsive element-binding protein 2B-like 
[Eucalyptus grandis]
 gb|KCW65720.1| hypothetical protein EUGRSUZ_G03094 [Eucalyptus grandis]
Length=253

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N+ F YRGVRQR+WGKWVAEIREP + +R WLGTF TA +AA+AYD AA  +YG  A+
Sbjct  64   PENTTFNYRGVRQRTWGKWVAEIREPNRGSRLWLGTFPTAIEAAKAYDEAATAMYGPCAR  123

Query  472  LNL  480
            LN 
Sbjct  124  LNF  126



>ref|XP_008799805.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
isoform X2 [Phoenix dactylifera]
 ref|XP_008799806.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
isoform X2 [Phoenix dactylifera]
Length=263

 Score = 73.2 bits (178),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS   YRGVRQR+WGKWVAEIREP + +R WLGTF TA DAA AYD AA  +YG  A+
Sbjct  7    PENSHCNYRGVRQRTWGKWVAEIREPNRGSRLWLGTFNTALDAAMAYDEAARAMYGPCAR  66

Query  472  LNL  480
            LNL
Sbjct  67   LNL  69



>ref|XP_003597059.1| Dehydration responsive factor [Medicago truncatula]
Length=260

 Score = 73.2 bits (178),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS+  YRGVRQR+WGKWV+EIREP + +R WLGTF TA  AA AYD AA  +YGS+A+
Sbjct  100  PENSRCNYRGVRQRTWGKWVSEIREPNRGSRLWLGTFTTAIGAALAYDEAARAMYGSRAR  159

Query  472  LNL  480
            LN 
Sbjct  160  LNF  162



>ref|XP_009411347.1| PREDICTED: dehydration-responsive element-binding protein 2F-like 
[Musa acuminata subsp. malaccensis]
Length=299

 Score = 73.6 bits (179),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  23   PQNASCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAALAYDEAARRLYGPDAY  82

Query  472  LNL  480
            +NL
Sbjct  83   VNL  85



>gb|KEH15489.1| dehydration-responsive element-binding protein [Medicago truncatula]
Length=197

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS+  YRGVRQR+WGKWVAEIREP +  R WLGTF+ A  AA AYD AA  +YGS A+
Sbjct  58   PENSRCNYRGVRQRTWGKWVAEIREPNRGNRLWLGTFSNAVGAALAYDEAARAMYGSCAR  117

Query  472  LNL  480
            LN 
Sbjct  118  LNF  120



>gb|KDP23749.1| hypothetical protein JCGZ_23582 [Jatropha curcas]
Length=224

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N+   YRGVRQR+WGKWVAEIREP +  R WLGTF T+++AARAYD+AA+ LYGS A 
Sbjct  26   PENALCTYRGVRQRTWGKWVAEIREPNRGNRIWLGTFNTSDEAARAYDQAALKLYGSSAT  85

Query  472  LNL  480
            LNL
Sbjct  86   LNL  88



>ref|NP_001235466.1| uncharacterized protein LOC100499747 [Glycine max]
 gb|ACU13469.1| unknown [Glycine max]
Length=198

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS+  YRGVRQR+WGKWVAEIREP +  R WLGTF TA  AA AYD AA  +YGS A+
Sbjct  58   PENSRCNYRGVRQRTWGKWVAEIREPNRGNRLWLGTFPTAIGAALAYDEAARAMYGSCAR  117

Query  472  LNL  480
            LN 
Sbjct  118  LNF  120



>ref|NP_001236509.1| uncharacterized protein LOC100527471 [Glycine max]
 gb|ACU16563.1| unknown [Glycine max]
Length=186

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS+  YRGVRQR+WGKWVAEIREP +  R WLGTF TA  AA AYD AA  +YGS A+
Sbjct  58   PENSRCNYRGVRQRTWGKWVAEIREPNRGNRLWLGTFPTAIGAALAYDEAARAMYGSCAR  117

Query  472  LNL  480
            LN 
Sbjct  118  LNF  120



>ref|XP_006591847.1| PREDICTED: uncharacterized protein LOC100527471 isoform X1 [Glycine 
max]
 gb|KHN25756.1| Dehydration-responsive element-binding protein 2A [Glycine soja]
Length=197

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS+  YRGVRQR+WGKWVAEIREP +  R WLGTF TA  AA AYD AA  +YGS A+
Sbjct  58   PENSRCNYRGVRQRTWGKWVAEIREPNRGNRLWLGTFPTAIGAALAYDEAARAMYGSCAR  117

Query  472  LNL  480
            LN 
Sbjct  118  LNF  120



>ref|XP_002308045.2| Dehydration responsive element binding protein 2F [Populus trichocarpa]
 gb|EEE91568.2| Dehydration responsive element binding protein 2F [Populus trichocarpa]
Length=286

 Score = 73.2 bits (178),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+   YRGVRQR+WGKWVAEIREPKKR R WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  23   PQNAMCDYRGVRQRTWGKWVAEIREPKKRARLWLGSFATAEEAAMAYDEAARRLYGPNAY  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>ref|XP_010057479.1| PREDICTED: dehydration-responsive element-binding protein 2F 
[Eucalyptus grandis]
 gb|KCW90227.1| hypothetical protein EUGRSUZ_A02390 [Eucalyptus grandis]
Length=290

 Score = 73.2 bits (178),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+   YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  23   PLNASCSYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAAMAYDEAARKLYGPDAY  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>ref|XP_008664551.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Zea mays]
 tpg|DAA48537.1| TPA: putative AP2/EREBP transcription factor superfamily protein 
[Zea mays]
Length=359

 Score = 73.9 bits (180),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN +  +RGVRQR+WGKWVAEIREP +  R WLGTF +A +AARAYD AA  LYG  A+
Sbjct  78   PDNQQCPFRGVRQRTWGKWVAEIREPNRGARLWLGTFGSALEAARAYDAAARTLYGDCAR  137

Query  472  LNLQ  483
            LNLQ
Sbjct  138  LNLQ  141



>ref|XP_002444543.1| hypothetical protein SORBIDRAFT_07g023575 [Sorghum bicolor]
 gb|EES14038.1| hypothetical protein SORBIDRAFT_07g023575 [Sorghum bicolor]
Length=388

 Score = 74.3 bits (181),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN +  YRGVRQR+WGKWVAEIREP +  R WLGTF +A +AARAYD AA  LYG  A+
Sbjct  82   PDNQQCPYRGVRQRTWGKWVAEIREPNRGARLWLGTFGSALEAARAYDNAARQLYGDCAR  141

Query  472  LNLQ  483
            LNLQ
Sbjct  142  LNLQ  145



>emb|CDP10066.1| unnamed protein product [Coffea canephora]
Length=286

 Score = 73.2 bits (178),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  23   PQNAMCEYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAAMAYDEAARRLYGPDAY  82

Query  472  LNL  480
            +NL
Sbjct  83   VNL  85



>ref|NP_187713.1| dehydration-responsive element-binding protein 2B [Arabidopsis 
thaliana]
 sp|O82133.1|DRE2B_ARATH RecName: Full=Dehydration-responsive element-binding protein 
2B; Short=Protein DREB2B [Arabidopsis thaliana]
 gb|AAF01519.1|AC009991_15 DREB2B transcription factor [Arabidopsis thaliana]
 dbj|BAA33795.1| DREB2B [Arabidopsis thaliana]
 dbj|BAA36706.1| DREB2B [Arabidopsis thaliana]
 dbj|BAC42033.1| putative DREB2B transcription factor [Arabidopsis thaliana]
 gb|AAP37710.1| At3g11020 [Arabidopsis thaliana]
 gb|AEE74994.1| dehydration-responsive element-binding protein 2B [Arabidopsis 
thaliana]
 gb|AGI05189.1| DRE/CRT-binding protein 2B [Arabidopsis thaliana]
Length=330

 Score = 73.9 bits (180),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDNS   +RGVRQR WGKWVAEIREPK  TR WLGTF TAE AA AYD AA  +YGS A+
Sbjct  71   PDNSHCSFRGVRQRIWGKWVAEIREPKIGTRLWLGTFPTAEKAASAYDEAATAMYGSLAR  130

Query  472  LNL  480
            LN 
Sbjct  131  LNF  133



>ref|XP_001770012.1| predicted protein [Physcomitrella patens]
 gb|EDQ65188.1| predicted protein [Physcomitrella patens]
Length=94

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N++  YRGVRQR+WGKWVAEIREP + +R WLGT+ TAE+AA AYD AA VLYG  A 
Sbjct  31   PENAQCSYRGVRQRTWGKWVAEIREPNRGSRLWLGTYGTAEEAALAYDEAARVLYGLNAL  90

Query  472  LNL  480
            LNL
Sbjct  91   LNL  93



>ref|XP_006854296.1| hypothetical protein AMTR_s00039p00088760 [Amborella trichopoda]
 gb|ERN15763.1| hypothetical protein AMTR_s00039p00088760 [Amborella trichopoda]
Length=247

 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N+   YRGVRQR+WGKWVAEIREP K  R WLGTFAT+E+AA AYD A+  LYG+ A+
Sbjct  20   PENALCAYRGVRQRTWGKWVAEIREPNKGDRLWLGTFATSEEAALAYDTASRKLYGTSAR  79

Query  472  LNL  480
            LNL
Sbjct  80   LNL  82



>ref|XP_004487356.1| PREDICTED: dehydration-responsive element-binding protein 2A-like 
isoform X1 [Cicer arietinum]
 ref|XP_004487357.1| PREDICTED: dehydration-responsive element-binding protein 2A-like 
isoform X2 [Cicer arietinum]
 ref|XP_004487358.1| PREDICTED: dehydration-responsive element-binding protein 2A-like 
isoform X3 [Cicer arietinum]
 ref|XP_004487359.1| PREDICTED: dehydration-responsive element-binding protein 2A-like 
isoform X4 [Cicer arietinum]
Length=191

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS+  YRGVRQR+WGKWVAEIREP +  R WLGTF TA  AA AYD AA  +YGS A+
Sbjct  60   PENSRCNYRGVRQRTWGKWVAEIREPNRGKRLWLGTFLTAIGAALAYDEAARAMYGSCAR  119

Query  472  LNL  480
            LN 
Sbjct  120  LNF  122



>ref|XP_007149931.1| hypothetical protein PHAVU_005G111200g [Phaseolus vulgaris]
 gb|ESW21925.1| hypothetical protein PHAVU_005G111200g [Phaseolus vulgaris]
Length=204

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS+  YRGVRQR+WGKWVAEIREP +  R WLGTF TA  AA AYD AA  +YGS A+
Sbjct  60   PENSRCNYRGVRQRTWGKWVAEIREPNRGNRLWLGTFPTAIGAALAYDEAARAMYGSCAR  119

Query  472  LNL  480
            LN 
Sbjct  120  LNF  122



>ref|XP_008660493.1| PREDICTED: dehydration-responsive element-binding protein 2E 
[Zea mays]
 gb|AFW89512.1| putative AP2/EREBP transcription factor superfamily protein [Zea 
mays]
Length=322

 Score = 73.6 bits (179),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREP KRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  21   PQNAACEYRGVRQRTWGKWVAEIREPNKRTRLWLGSFATAEEAALAYDEAARRLYGPDAF  80

Query  472  LNL  480
            LNL
Sbjct  81   LNL  83



>gb|AIB05898.1| AP2-EREBP transcription factor, partial [Zea mays]
Length=322

 Score = 73.6 bits (179),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREP KRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  21   PQNAACEYRGVRQRTWGKWVAEIREPNKRTRLWLGSFATAEEAALAYDEAARRLYGPDAF  80

Query  472  LNL  480
            LNL
Sbjct  81   LNL  83



>ref|XP_004238613.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Solanum lycopersicum]
Length=248

 Score = 72.4 bits (176),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N+   Y+GVRQR+WGKWVAEIREP +  R WLGTF  + DAA  YD AA+ LYG++A+
Sbjct  24   PENANCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDNSYDAAVVYDAAALKLYGAEAK  83

Query  472  LNL  480
            LNL
Sbjct  84   LNL  86



>ref|XP_004985522.1| PREDICTED: dehydration-responsive element-binding protein 2E-like 
[Setaria italica]
Length=321

 Score = 73.6 bits (179),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREP KRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  23   PQNAACEYRGVRQRTWGKWVAEIREPNKRTRLWLGSFATAEEAALAYDEAARRLYGPDAF  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>ref|XP_010921034.1| PREDICTED: dehydration-responsive element-binding protein 2B-like 
isoform X1 [Elaeis guineensis]
Length=313

 Score = 73.2 bits (178),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN + KYRGVRQR+WGKWVAEIREP + +R WLGTF TA +AA AYD AA  +YG  A+
Sbjct  61   PDNPQCKYRGVRQRTWGKWVAEIREPNRGSRLWLGTFPTALEAALAYDEAARAMYGPYAR  120

Query  472  LNL  480
            LNL
Sbjct  121  LNL  123



>ref|XP_011020328.1| PREDICTED: dehydration-responsive element-binding protein 2F 
[Populus euphratica]
Length=285

 Score = 72.8 bits (177),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+   YRGVRQR+WGKWVAEIREPKKR R WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  23   PQNAMCDYRGVRQRTWGKWVAEIREPKKRARLWLGSFATAEEAAMAYDEAARRLYGPSAY  82

Query  472  LNL  480
            LNL
Sbjct  83   LNL  85



>ref|XP_008651496.1| PREDICTED: dehydration-responsive element-binding protein 2E-like 
[Zea mays]
 tpg|DAA43644.1| TPA: putative AP2/EREBP transcription factor superfamily protein 
[Zea mays]
 gb|AIB05365.1| AP2-EREBP transcription factor, partial [Zea mays]
Length=321

 Score = 73.2 bits (178),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREP KRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  21   PQNAACEYRGVRQRTWGKWVAEIREPNKRTRLWLGSFATAEEAALAYDEAARRLYGPDAF  80

Query  472  LNL  480
            LNL
Sbjct  81   LNL  83



>gb|KFK26084.1| hypothetical protein AALP_AA8G200700 [Arabis alpina]
Length=295

 Score = 72.8 bits (177),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N+   YRGVRQR+WGKWVAEIREP + TR WLGTF T+ +AA AYD AA  LYG +A+
Sbjct  27   PENATCTYRGVRQRTWGKWVAEIREPNRGTRLWLGTFNTSVEAAMAYDEAAKKLYGHEAK  86

Query  472  LNL  480
            LNL
Sbjct  87   LNL  89



>ref|XP_008230119.1| PREDICTED: putative dehydration-responsive element-binding protein 
2H [Prunus mume]
Length=196

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS+  YRGVRQR+WGKWVAEIR P + +R WLGTF TA +AA AYD AA  +YGS A+
Sbjct  60   PENSRCNYRGVRQRTWGKWVAEIRAPNRGSRLWLGTFPTAIEAALAYDEAARAMYGSAAR  119

Query  472  LNL  480
            LN 
Sbjct  120  LNF  122



>gb|EAY88744.1| hypothetical protein OsI_10219 [Oryza sativa Indica Group]
Length=315

 Score = 72.8 bits (177),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREP KRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  21   PQNAACEYRGVRQRTWGKWVAEIREPNKRTRLWLGSFATAEEAALAYDEAARRLYGPDAF  80

Query  472  LNL  480
            LNL
Sbjct  81   LNL  83



>ref|XP_007216412.1| hypothetical protein PRUPE_ppa022733mg, partial [Prunus persica]
 gb|EMJ17611.1| hypothetical protein PRUPE_ppa022733mg, partial [Prunus persica]
Length=150

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS+  YRGVRQR+WGKWVAEIR P + +R WLGTF TA +AA AYD AA  +YGS A+
Sbjct  60   PENSRCNYRGVRQRTWGKWVAEIRTPNRGSRLWLGTFPTAIEAALAYDEAARAMYGSAAR  119

Query  472  LNL  480
            LN 
Sbjct  120  LNF  122



>ref|XP_009764492.1| PREDICTED: dehydration-responsive element-binding protein 2A-like 
[Nicotiana sylvestris]
Length=368

 Score = 73.6 bits (179),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS+  YRGVRQR+WGKWVAEIREP + +R WLGTF TA +AA AYD AA  +YG  A+
Sbjct  87   PENSRCNYRGVRQRTWGKWVAEIREPNRGSRLWLGTFGTAIEAALAYDEAAKAMYGPSAR  146

Query  472  LNL  480
            LNL
Sbjct  147  LNL  149



>gb|EAZ25772.1| hypothetical protein OsJ_09612 [Oryza sativa Japonica Group]
Length=318

 Score = 72.8 bits (177),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREP KRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  21   PQNAACEYRGVRQRTWGKWVAEIREPNKRTRLWLGSFATAEEAALAYDEAARRLYGPDAF  80

Query  472  LNL  480
            LNL
Sbjct  81   LNL  83



>sp|Q10R18.1|DRE2E_ORYSJ RecName: Full=Dehydration-responsive element-binding protein 
2E; Short=OsDREB2E [Oryza sativa Japonica Group]
 gb|ABF94251.1| AP2 domain containing protein [Oryza sativa Japonica Group]
Length=318

 Score = 72.8 bits (177),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREP KRTR WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  21   PQNAACEYRGVRQRTWGKWVAEIREPNKRTRLWLGSFATAEEAALAYDEAARRLYGPDAF  80

Query  472  LNL  480
            LNL
Sbjct  81   LNL  83



>ref|XP_010922641.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
isoform X2 [Elaeis guineensis]
Length=272

 Score = 72.4 bits (176),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS   YRGVRQR+WGKWVAEIREP + +R WLGTF TA DAA AYD AA  +YG  A+
Sbjct  7    PENSHCNYRGVRQRTWGKWVAEIREPNRGSRLWLGTFNTALDAAMAYDEAARAMYGPCAR  66

Query  472  LNL  480
            LNL
Sbjct  67   LNL  69



>gb|KHN36573.1| Dehydration-responsive element-binding protein 2C [Glycine soja]
Length=198

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS+  YRGVRQR+WGKWVAEIREP    R WLGTF TA  AA A D AA  +YGS A+
Sbjct  58   PENSRCNYRGVRQRTWGKWVAEIREPNGGNRLWLGTFPTAIGAALACDEAARAMYGSCAR  117

Query  472  LNL  480
            LN 
Sbjct  118  LNF  120



>ref|XP_002887600.1| hypothetical protein ARALYDRAFT_476698 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63859.1| hypothetical protein ARALYDRAFT_476698 [Arabidopsis lyrata subsp. 
lyrata]
Length=196

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+   Y+GVRQR+WGKWVAEIREP +  R WLGTF T+ +AA AYD AA  LYG +A 
Sbjct  26   PDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSREAALAYDSAARKLYGPEAH  85

Query  472  LNL  480
            LNL
Sbjct  86   LNL  88



>ref|XP_008388158.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Malus domestica]
Length=251

 Score = 72.0 bits (175),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N+   Y+GVRQR+WGKWVAEIREP +  R WLGTFAT+ +AA AYD AA  LYGSKA+
Sbjct  35   PENAMCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFATSFEAALAYDAAARKLYGSKAK  94

Query  472  LNL  480
            LNL
Sbjct  95   LNL  97



>gb|ABS11171.1| putative DRE-binding protein DREB2 [Avena sativa]
Length=272

 Score = 72.0 bits (175),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS  KYRGVRQR+WGKWVAEIREP +  R WLG+F  A +AA AYD AA  +YG+KA+
Sbjct  64   PENSNCKYRGVRQRTWGKWVAEIREPNRGNRLWLGSFPNAVEAAHAYDEAARAMYGAKAR  123

Query  472  LNL  480
            +N 
Sbjct  124  VNF  126



>gb|ABK59671.1| At1g75490 [Arabidopsis thaliana]
Length=197

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+   Y+GVRQR+WGKWVAEIREP +  R WLGTF T+ +AA AYD AA  LYG +A 
Sbjct  26   PDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSREAALAYDSAARKLYGPEAH  85

Query  472  LNL  480
            LNL
Sbjct  86   LNL  88



>ref|XP_004239956.1| PREDICTED: dehydration-responsive element-binding protein 2A-like 
[Solanum lycopersicum]
 ref|XP_010321452.1| PREDICTED: dehydration-responsive element-binding protein 2A-like 
[Solanum lycopersicum]
Length=408

 Score = 73.6 bits (179),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN + KYRGVRQR+WGKWVAEIREP +  R WLGTF TA +AA AYD AA  +YG  A+
Sbjct  76   PDNGRCKYRGVRQRTWGKWVAEIREPHRGRRLWLGTFDTAIEAALAYDEAARAMYGPCAR  135

Query  472  LNL  480
            LNL
Sbjct  136  LNL  138



>emb|CDY52095.1| BnaC04g55440D [Brassica napus]
Length=266

 Score = 72.0 bits (175),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+  +YRGVRQR+WGKWVAEIREPKKR R WLG+FATAE+AA AYD+AA+ L+  +A 
Sbjct  21   PQNALCRYRGVRQRTWGKWVAEIREPKKRARLWLGSFATAEEAAMAYDKAALKLFDHEAY  80

Query  472  LNL  480
            LNL
Sbjct  81   LNL  83



>gb|ADZ15315.1| DREB2 [Solanum lycopersicum]
Length=408

 Score = 73.6 bits (179),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN + KYRGVRQR+WGKWVAEIREP +  R WLGTF TA +AA AYD AA  +YG  A+
Sbjct  76   PDNGRCKYRGVRQRTWGKWVAEIREPHRGRRLWLGTFDTAIEAALAYDEAARAMYGPCAR  135

Query  472  LNL  480
            LNL
Sbjct  136  LNL  138



>ref|NP_177681.2| dehydration-responsive element-binding protein 2D [Arabidopsis 
thaliana]
 sp|Q9LQZ2.1|DRE2D_ARATH RecName: Full=Dehydration-responsive element-binding protein 
2D; Short=Protein DREB2D [Arabidopsis thaliana]
 gb|AAF87124.1|AC006434_20 F10A5.29 [Arabidopsis thaliana]
 dbj|BAD43665.1| transcription factor DREB2A like protein [Arabidopsis thaliana]
 gb|AEE35725.1| dehydration-responsive element-binding protein 2D [Arabidopsis 
thaliana]
Length=206

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+   Y+GVRQR+WGKWVAEIREP +  R WLGTF T+ +AA AYD AA  LYG +A 
Sbjct  35   PDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSREAALAYDSAARKLYGPEAH  94

Query  472  LNL  480
            LNL
Sbjct  95   LNL  97



>ref|XP_010428577.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Camelina sativa]
Length=205

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+   Y+GVRQR+WGKWVAEIREP +  R WLGTF T+ +AA AYD AA  LYG +A 
Sbjct  35   PDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSREAALAYDSAARKLYGPEAH  94

Query  472  LNL  480
            LNL
Sbjct  95   LNL  97



>ref|XP_010416439.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Camelina sativa]
Length=206

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+   Y+GVRQR+WGKWVAEIREP +  R WLGTF T+ +AA AYD AA  LYG +A 
Sbjct  35   PDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSREAALAYDSAARKLYGPEAH  94

Query  472  LNL  480
            LNL
Sbjct  95   LNL  97



>ref|XP_008678419.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Zea mays]
 gb|AFW61647.1| putative AP2/EREBP transcription factor superfamily protein [Zea 
mays]
 gb|AIB05166.1| AP2-EREBP transcription factor, partial [Zea mays]
Length=352

 Score = 73.2 bits (178),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN +  +RGVRQR+WGKWVAEIREP +  R WLGTF +A +AARAYD AA  LYG  A+
Sbjct  71   PDNQQCPFRGVRQRTWGKWVAEIREPNRGARLWLGTFGSALEAARAYDAAARALYGDCAR  130

Query  472  LNLQ  483
            LNLQ
Sbjct  131  LNLQ  134



>ref|XP_006342227.1| PREDICTED: dehydration-responsive element-binding protein 2A-like 
[Solanum tuberosum]
Length=262

 Score = 72.0 bits (175),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N+   Y+GVRQR+WGKWVAEIREP +  R WLGTF  + DAA  YD AA+ LYG++A+
Sbjct  24   PENASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDNSYDAAVVYDAAALKLYGAEAK  83

Query  472  LNL  480
            LNL
Sbjct  84   LNL  86



>ref|XP_003638741.1| Ethylene-responsive transcription factor [Medicago truncatula]
Length=226

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  301  SKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQLNL  480
            +K KYRGVRQR+WGKWVAEIR+PK+ TR WLGTF TAE+AARAYD+AAI  +G++A++N 
Sbjct  121  NKKKYRGVRQRAWGKWVAEIRDPKRATRVWLGTFQTAENAARAYDQAAIKFHGARAKINF  180



>ref|XP_006302829.1| hypothetical protein CARUB_v10020960mg [Capsella rubella]
 gb|EOA35727.1| hypothetical protein CARUB_v10020960mg [Capsella rubella]
Length=205

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+   Y+GVRQR+WGKWVAEIREP +  R WLGTF T+ +AA AYD AA  LYG +A 
Sbjct  35   PDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSREAALAYDSAARKLYGPEAH  94

Query  472  LNL  480
            LNL
Sbjct  95   LNL  97



>ref|XP_009336823.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Pyrus x bretschneideri]
Length=225

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N+   Y+GVRQR+WGKWVAEIREP +  R WLGTFAT+ +AA AYD AA  LYGSKA+
Sbjct  39   PENAMCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFATSYEAALAYDAAARKLYGSKAK  98

Query  472  LNL  480
            LNL
Sbjct  99   LNL  101



>gb|AGE97365.1| ethylene response factor 10 [Tamarix hispida]
Length=309

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N +  YRGVRQR+WGKWVAEIREP +  R WLGTF+ A DAA AYD AA  +YG KA+
Sbjct  80   PENQRCNYRGVRQRTWGKWVAEIREPNRGKRLWLGTFSNAIDAALAYDEAARSMYGLKAR  139

Query  472  LNL  480
            LNL
Sbjct  140  LNL  142



>emb|CBI25419.3| unnamed protein product [Vitis vinifera]
Length=1635

 Score = 74.7 bits (182),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 43/63 (68%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS   YRGVRQR+WGKWVAEIREP + +R WLGTF TA +AA AYD AA  +YGS A+
Sbjct  58   PENSICGYRGVRQRTWGKWVAEIREPNRGSRLWLGTFPTAIEAALAYDEAARAMYGSSAR  117

Query  472  LNL  480
            LNL
Sbjct  118  LNL  120



>emb|CAB93939.1| AP2-domain DNA-binding protein [Catharanthus roseus]
Length=376

 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS  KYRGVRQR+WGKWVAEIREP + +R WLGTF  A +AA AYD AA  +YG  A+
Sbjct  74   PENSHCKYRGVRQRTWGKWVAEIREPNRGSRLWLGTFRNAIEAALAYDEAARAMYGPCAR  133

Query  472  LNL  480
            LNL
Sbjct  134  LNL  136



>ref|XP_009612863.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Nicotiana tomentosiformis]
Length=369

 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS+  YRGVRQR+WGKWVAEIREP + +R WLGTF TA +AA AYD AA  +YG  A+
Sbjct  87   PENSRCNYRGVRQRTWGKWVAEIREPNRGSRLWLGTFGTAIEAALAYDEAARAMYGPSAR  146

Query  472  LNL  480
            LNL
Sbjct  147  LNL  149



>ref|XP_009106200.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Brassica rapa]
Length=206

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+   Y+GVRQR+WGKWVAEIREP +  R WLGTF T+ +AA AYD AA  LYG +A 
Sbjct  35   PDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSREAALAYDSAARKLYGPEAH  94

Query  472  LNL  480
            LNL
Sbjct  95   LNL  97



>ref|XP_002273838.1| PREDICTED: dehydration-responsive element-binding protein 2C 
[Vitis vinifera]
Length=355

 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS   YRGVRQR+WGKWVAEIREP + +R WLGTF TA +AA AYD AA  +YGS A+
Sbjct  58   PENSICGYRGVRQRTWGKWVAEIREPNRGSRLWLGTFPTAIEAALAYDEAARAMYGSSAR  117

Query  472  LNL  480
            LNL
Sbjct  118  LNL  120



>ref|XP_010471662.1| PREDICTED: dehydration-responsive element-binding protein 2D 
[Camelina sativa]
Length=205

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+   Y+GVRQR+WGKWVAEIREP +  R WLGTF T+ +AA AYD AA  LYG +A 
Sbjct  35   PDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSREAALAYDSAARKLYGPEAH  94

Query  472  LNL  480
            LNL
Sbjct  95   LNL  97



>ref|XP_006355639.1| PREDICTED: dehydration-responsive element-binding protein 2A-like 
[Solanum tuberosum]
Length=409

 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN + KYRGVRQR+WGKWVAEIREP +  R WLGTF TA +AA AYD AA  +YG  A+
Sbjct  76   PDNGRCKYRGVRQRTWGKWVAEIREPHRGRRLWLGTFDTAIEAALAYDEAARAMYGPCAR  135

Query  472  LNL  480
            LNL
Sbjct  136  LNL  138



>gb|EPS72578.1| hypothetical protein M569_02179, partial [Genlisea aurea]
Length=209

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P N+   YRGVRQR+WGKWVAEIREP KR+R WLG+FATAE+AA AYD AA  LYG  A 
Sbjct  21   PQNASCGYRGVRQRTWGKWVAEIREPHKRSRLWLGSFATAEEAAVAYDEAARRLYGEDAY  80

Query  472  LNL  480
            LNL
Sbjct  81   LNL  83



>ref|XP_004237644.1| PREDICTED: dehydration-responsive element-binding protein 2G-like 
[Solanum lycopersicum]
Length=161

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N+   YRGVRQR+WGKWVAEIREP    R WLGTF T+ +AARAYD AA  LYGS A+
Sbjct  31   PENASCTYRGVRQRTWGKWVAEIREPNGGARIWLGTFNTSVEAARAYDDAARRLYGSDAK  90

Query  472  LNL  480
            LNL
Sbjct  91   LNL  93



>ref|XP_008799804.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
isoform X1 [Phoenix dactylifera]
Length=319

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS   YRGVRQR+WGKWVAEIREP + +R WLGTF TA DAA AYD AA  +YG  A+
Sbjct  63   PENSHCNYRGVRQRTWGKWVAEIREPNRGSRLWLGTFNTALDAAMAYDEAARAMYGPCAR  122

Query  472  LNL  480
            LNL
Sbjct  123  LNL  125



>emb|CDY47519.1| BnaAnng09170D [Brassica napus]
Length=206

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+   Y+GVRQR+WGKWVAEIREP +  R WLGTF T+ +AA AYD AA  LYG +A 
Sbjct  35   PDNASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSREAALAYDSAARKLYGPEAH  94

Query  472  LNL  480
            LNL
Sbjct  95   LNL  97



>dbj|BAO00821.1| transcription factor [Lactuca sativa var. capitata]
Length=322

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS+  +RGVRQR+WGKWVAEIREP + +R WLGTF +A +AA AYD AA V+YG  A+
Sbjct  72   PENSRCNFRGVRQRTWGKWVAEIREPNRGSRLWLGTFGSAVEAALAYDEAARVMYGPCAR  131

Query  472  LNL  480
            LNL
Sbjct  132  LNL  134



>gb|AHZ44784.1| dehydration-responsive element-binding protein 2A, partial [Brassica 
oleracea var. viridis]
Length=103

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS+  +RGVRQR WGKWVAEIREP + +R WLGTF TAE+AA AYD AA V+YG  A+
Sbjct  15   PENSQCSFRGVRQRIWGKWVAEIREPNRGSRLWLGTFPTAEEAALAYDEAARVMYGPLAR  74

Query  472  LNL  480
            LN 
Sbjct  75   LNF  77



>ref|XP_009135143.1| PREDICTED: dehydration-responsive element-binding protein 2B-like 
[Brassica rapa]
Length=384

 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N+K  +RGVRQR WGKWVAEIREP + +R WLGTF TAE+AA AYD AA V+YGS A+
Sbjct  65   PENTKCSFRGVRQRVWGKWVAEIREPNRVSRLWLGTFPTAEEAACAYDEAAKVMYGSSAR  124

Query  472  LNL  480
            LN 
Sbjct  125  LNF  127



>ref|XP_004293490.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Fragaria vesca subsp. vesca]
Length=198

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS+  YRGVRQR+WGKWVAEIR P + +R WLGTF TA +AA AYD+AA  +YGS A+
Sbjct  60   PENSRCNYRGVRQRTWGKWVAEIRSPNRGSRLWLGTFPTAIEAALAYDKAARAMYGSAAR  119

Query  472  LNL  480
            LN 
Sbjct  120  LNF  122



>ref|XP_004499266.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Cicer arietinum]
Length=249

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N+   Y+GVRQR+WGKWVAEIREP +  R WLGTF T+ +AA AYD AA  LYGS A+
Sbjct  33   PENASCTYKGVRQRTWGKWVAEIREPNRGARLWLGTFETSHEAALAYDAAARKLYGSDAK  92

Query  472  LNL  480
            LNL
Sbjct  93   LNL  95



>ref|XP_006828126.1| hypothetical protein AMTR_s00023p00044590 [Amborella trichopoda]
 gb|ERM95542.1| hypothetical protein AMTR_s00023p00044590 [Amborella trichopoda]
Length=382

 Score = 72.8 bits (177),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS+  YRGVRQR+WGKWVAEIREP +  R WLGTF TA  AA AYD AA  +YGS A+
Sbjct  61   PENSRCNYRGVRQRTWGKWVAEIREPNRGNRLWLGTFPTALAAALAYDEAARAMYGSCAR  120

Query  472  LNL  480
            LNL
Sbjct  121  LNL  123



>ref|XP_002967543.1| hypothetical protein SELMODRAFT_38500, partial [Selaginella moellendorffii]
 ref|XP_002981801.1| hypothetical protein SELMODRAFT_38498, partial [Selaginella moellendorffii]
 gb|EFJ17283.1| hypothetical protein SELMODRAFT_38498, partial [Selaginella moellendorffii]
 gb|EFJ30890.1| hypothetical protein SELMODRAFT_38500, partial [Selaginella moellendorffii]
Length=75

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P NS+ +YRGVRQR+WGKWVAEIREP +  R WLGTF TAEDAA AYDRAA + YG  AQ
Sbjct  12   PQNSQCQYRGVRQRTWGKWVAEIREPNRGARIWLGTFTTAEDAAAAYDRAAKIHYGPSAQ  71

Query  472  LNL  480
            LN 
Sbjct  72   LNF  74



>gb|AAS82861.1| DREB2 transcription factor [Helianthus annuus]
Length=314

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS+  +RGVRQR+WGKWVAEIREP +  R WLGTF +A +AA AYD AA  +YG+ A+
Sbjct  84   PENSRTNFRGVRQRTWGKWVAEIREPNRGRRLWLGTFGSAVEAALAYDEAARAMYGTSAR  143

Query  472  LNL  480
            LNL
Sbjct  144  LNL  146



>gb|AIZ74387.1| DREB1 [Sophora moorcroftiana]
Length=199

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS+  YRGVRQR+WGKWVAEIREP + +R WLGTF TA  AA AYD AA  +YG+ A+
Sbjct  58   PENSRCNYRGVRQRTWGKWVAEIREPNRGSRLWLGTFPTAIGAALAYDEAARAMYGTCAR  117

Query  472  LNL  480
            LN 
Sbjct  118  LNF  120



>ref|XP_007208518.1| hypothetical protein PRUPE_ppa026176mg, partial [Prunus persica]
 gb|EMJ09717.1| hypothetical protein PRUPE_ppa026176mg, partial [Prunus persica]
Length=110

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N+   +RGVRQR+WGKWVAEIREP +  R WLGTF T+ +AA AYD AA  LYGS A+
Sbjct  30   PENALCSFRGVRQRTWGKWVAEIREPNRGARLWLGTFNTSTEAALAYDEAARKLYGSSAK  89

Query  472  LNL  480
            LNL
Sbjct  90   LNL  92



>ref|XP_009131668.1| PREDICTED: dehydration-responsive element-binding protein 2G-like 
[Brassica rapa]
Length=291

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 1/66 (2%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N+   +RGVRQR+WGKWVAEIREP + TR WLGTF T+  AA AYD AA+ LYG +A+
Sbjct  26   PENATCTFRGVRQRTWGKWVAEIREPNRGTRLWLGTFNTSVQAAMAYDEAAMKLYGPEAR  85

Query  472  LN-LQP  486
            LN LQP
Sbjct  86   LNLLQP  91



>ref|XP_004147872.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Cucumis sativus]
 ref|XP_004167757.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Cucumis sativus]
 gb|KGN60003.1| hypothetical protein Csa_3G865380 [Cucumis sativus]
Length=184

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+   ++GVRQR+WGKWVAEIREP +  R WLGTF TA +AA AYD AA  LYGS+A+
Sbjct  27   PDNAACTFKGVRQRTWGKWVAEIREPNRGARLWLGTFDTAHEAALAYDAAARKLYGSEAK  86

Query  472  LNL  480
            LNL
Sbjct  87   LNL  89



>ref|NP_197346.1| dehydration-responsive element-binding protein 2G [Arabidopsis 
thaliana]
 sp|P61827.1|DRE2G_ARATH RecName: Full=Dehydration-responsive element-binding protein 
2G; Short=Protein DREB2G [Arabidopsis thaliana]
 gb|AAT44920.1| putative AP2/EREBP transcription factor [Arabidopsis thaliana]
 gb|ABG48430.1| At5g18450 [Arabidopsis thaliana]
 gb|AED92565.1| dehydration-responsive element-binding protein 2G [Arabidopsis 
thaliana]
Length=307

 Score = 72.0 bits (175),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N+   +RGVRQR+WGKWVAEIREP + TR WLGTF T+ +AA AYD AA  LYG +A+
Sbjct  27   PENATCTFRGVRQRTWGKWVAEIREPNRGTRLWLGTFNTSVEAAMAYDEAAKKLYGHEAK  86

Query  472  LNL  480
            LNL
Sbjct  87   LNL  89



>ref|XP_008354169.1| PREDICTED: dehydration-responsive element-binding protein 2A-like 
[Malus domestica]
Length=398

 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N++  YRGVRQR+WGKWVAEIREP + +R WLGTF TA DAA AYD AA  +YG+ A+
Sbjct  74   PENARCNYRGVRQRTWGKWVAEIREPDRGSRLWLGTFPTALDAALAYDEAAKAMYGTGAR  133

Query  472  LNL  480
            LNL
Sbjct  134  LNL  136



>gb|AFJ14632.1| dehydration-responsive element-binding protein (DREB2), partial 
[Malus domestica]
Length=398

 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N++  YRGVRQR+WGKWVAEIREP + +R WLGTF TA DAA AYD AA  +YG+ A+
Sbjct  74   PENARCNYRGVRQRTWGKWVAEIREPDRGSRLWLGTFPTALDAALAYDEAAKAMYGTGAR  133

Query  472  LNL  480
            LNL
Sbjct  134  LNL  136



>ref|XP_010549641.1| PREDICTED: dehydration-responsive element-binding protein 2G 
[Tarenaya hassleriana]
Length=370

 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+  +YRGVRQR+WGKWVAEIREP + +R WLGTF T+ +AA AYD+AA  LYG  A+
Sbjct  58   PDNATCRYRGVRQRTWGKWVAEIREPNRGSRLWLGTFDTSFEAAMAYDKAAKKLYGQAAK  117

Query  472  LNL  480
            LNL
Sbjct  118  LNL  120



>gb|AFS60111.1| DREB2 [Malus sieversii]
Length=398

 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N++  YRGVRQR+WGKWVAEIREP + +R WLGTF TA DAA AYD AA  +YG+ A+
Sbjct  74   PENARCNYRGVRQRTWGKWVAEIREPDRGSRLWLGTFPTALDAALAYDEAAKAMYGTGAR  133

Query  472  LNL  480
            LNL
Sbjct  134  LNL  136



>ref|XP_008466672.1| PREDICTED: dehydration-responsive element-binding protein 2D-like 
[Cucumis melo]
Length=184

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            PDN+   ++GVRQR+WGKWVAEIREP +  R WLGTF TA +AA AYD AA  LYGS+A+
Sbjct  27   PDNASCTFKGVRQRTWGKWVAEIREPNRGARLWLGTFDTAHEAALAYDAAARKLYGSEAK  86

Query  472  LNL  480
            LNL
Sbjct  87   LNL  89



>ref|XP_010087025.1| Dehydration-responsive element-binding protein 2C [Morus notabilis]
 gb|AHJ25962.1| dehydration responsive element binding transcription factor [Morus 
notabilis]
 gb|EXB25843.1| Dehydration-responsive element-binding protein 2C [Morus notabilis]
Length=366

 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS+  YRGVRQR+WGKWVAEIREP + +R WLGTF TA +AA +YD AA  +YG  A+
Sbjct  77   PENSRCNYRGVRQRTWGKWVAEIREPNRGSRLWLGTFPTALEAAISYDEAARAMYGPCAR  136

Query  472  LNL  480
            LNL
Sbjct  137  LNL  139



>ref|XP_010257031.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
[Nelumbo nucifera]
Length=362

 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS+  YRGVRQR+WGKWVAEIREP + +R WLGTFATA +AARAYD AA  +YG  A+
Sbjct  65   PENSRCNYRGVRQRTWGKWVAEIREPNRGSRLWLGTFATALEAARAYDEAARAMYGPCAR  124

Query  472  LNL  480
            LNL
Sbjct  125  LNL  127



>ref|XP_010534622.1| PREDICTED: dehydration-responsive element-binding protein 2C 
isoform X2 [Tarenaya hassleriana]
 ref|XP_010534623.1| PREDICTED: dehydration-responsive element-binding protein 2C 
isoform X2 [Tarenaya hassleriana]
 ref|XP_010534624.1| PREDICTED: dehydration-responsive element-binding protein 2C 
isoform X2 [Tarenaya hassleriana]
 ref|XP_010534625.1| PREDICTED: dehydration-responsive element-binding protein 2C 
isoform X2 [Tarenaya hassleriana]
 ref|XP_010534626.1| PREDICTED: dehydration-responsive element-binding protein 2C 
isoform X2 [Tarenaya hassleriana]
Length=358

 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N    YRGVRQR+WGKWVAEIREP K TR WLGTF  A +AA AYD AA  +YG  A+
Sbjct  7    PENFDCDYRGVRQRTWGKWVAEIREPNKGTRLWLGTFPNAYEAALAYDNAARAMYGQSAR  66

Query  472  LNL  480
            LNL
Sbjct  67   LNL  69



>ref|XP_010492849.1| PREDICTED: dehydration-responsive element-binding protein 2G 
[Camelina sativa]
Length=305

 Score = 71.6 bits (174),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N+   +RGVRQR+WGKWVAEIREP + TR WLGTF T+ +AA AYD AA  LYG +A+
Sbjct  27   PENATCNFRGVRQRTWGKWVAEIREPNRGTRLWLGTFNTSVEAAMAYDEAAKKLYGHEAK  86

Query  472  LNL  480
            LNL
Sbjct  87   LNL  89



>ref|XP_010692920.1| PREDICTED: dehydration-responsive element-binding protein 2C-like 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=355

 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+NS  KYRGVRQR+WGKWVAEIREP +  R WLGTF TA +AA AYD AA  +YG  A+
Sbjct  63   PENSLCKYRGVRQRTWGKWVAEIREPNRGKRLWLGTFPTALEAALAYDEAARTMYGPSAR  122

Query  472  LNL  480
            LNL
Sbjct  123  LNL  125



>ref|XP_009345422.1| PREDICTED: dehydration-responsive element-binding protein 2A-like 
[Pyrus x bretschneideri]
Length=398

 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  292  PDNSKFKYRGVRQRSWGKWVAEIREPKKRTRRWLGTFataedaaraydraaIVLYGSKAQ  471
            P+N++  YRGVRQR+WGKWVAEIREP + +R WLGTF TA DAA AYD AA  +YG+ A+
Sbjct  74   PENARCNYRGVRQRTWGKWVAEIREPDRGSRLWLGTFPTAIDAALAYDEAAKAMYGAGAR  133

Query  472  LNL  480
            LNL
Sbjct  134  LNL  136



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3711262295195