BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13555_g2_i1 len=467 path=[1241:0-391 1633:392-466]

Length=467
                                                                      Score     E

gb|EYU20128.1|  hypothetical protein MIMGU_mgv1a010128mg              87.0    1e-17   
ref|XP_002275401.1|  PREDICTED: probable WRKY transcription facto...  84.7    9e-17   Vitis vinifera
emb|CBI25345.3|  unnamed protein product                              84.3    9e-17   
ref|XP_011085118.1|  PREDICTED: LOW QUALITY PROTEIN: probable WRK...  78.2    1e-14   
ref|XP_009793213.1|  PREDICTED: probable WRKY transcription facto...  76.6    5e-14   
gb|AAF61863.1|AF193770_1  DNA-binding protein 3                       76.6    6e-14   Nicotiana tabacum [American tobacco]
ref|XP_009362779.1|  PREDICTED: probable WRKY transcription facto...  76.3    7e-14   
ref|XP_007011368.1|  WRKY DNA-binding protein 70, putative isoform 2  76.3    8e-14   
ref|XP_007011367.1|  WRKY DNA-binding protein 70, putative isoform 1  76.3    9e-14   
ref|XP_010031073.1|  PREDICTED: probable WRKY transcription facto...  73.6    8e-13   
gb|KHG09099.1|  putative WRKY transcription factor 70 -like protein   72.8    1e-12   
ref|XP_006356477.1|  PREDICTED: probable WRKY transcription facto...  72.0    2e-12   
ref|XP_008388364.1|  PREDICTED: probable WRKY transcription facto...  72.4    2e-12   
ref|XP_009601871.1|  PREDICTED: probable WRKY transcription facto...  70.5    7e-12   
gb|AIR08538.1|  WRKY transcription factor                             70.5    7e-12   
ref|XP_010253044.1|  PREDICTED: probable WRKY transcription facto...  70.9    1e-11   
ref|XP_010031072.1|  PREDICTED: probable WRKY transcription facto...  70.1    1e-11   
ref|XP_004235231.1|  PREDICTED: probable WRKY transcription facto...  68.6    3e-11   
gb|AGQ04251.1|  WRKY transcription factor 57.1                        68.6    5e-11   
ref|XP_003544261.1|  PREDICTED: probable WRKY transcription facto...  68.9    5e-11   
gb|KHN39987.1|  Putative WRKY transcription factor 70                 68.9    5e-11   
gb|AIE43829.1|  WRKY transcription factor 102                         68.2    6e-11   
ref|XP_009363788.1|  PREDICTED: probable WRKY transcription facto...  68.6    8e-11   
gb|AGV75934.1|  WRKY transcription factor 14                          67.8    9e-11   
gb|AIE43833.1|  WRKY transcription factor 7                           67.8    9e-11   
ref|XP_011095148.1|  PREDICTED: probable WRKY transcription facto...  67.8    1e-10   
ref|XP_011076580.1|  PREDICTED: probable WRKY transcription facto...  67.0    2e-10   
emb|CDP13896.1|  unnamed protein product                              67.0    3e-10   
gb|AIE43831.1|  WRKY transcription factor 88                          65.9    3e-10   
gb|AGV75950.1|  WRKY transcription factor 46                          65.9    4e-10   
ref|XP_003615415.1|  WRKY transcription factor                        65.1    4e-10   
ref|XP_007219739.1|  hypothetical protein PRUPE_ppa026125mg           65.9    5e-10   
gb|AGQ04252.1|  WRKY transcription factor 57.2                        65.1    8e-10   
ref|XP_011014496.1|  PREDICTED: probable WRKY transcription facto...  65.1    1e-09   
emb|CBI18028.3|  unnamed protein product                              65.1    1e-09   
ref|XP_002272504.1|  PREDICTED: probable WRKY transcription facto...  65.1    1e-09   Vitis vinifera
ref|XP_006481203.1|  PREDICTED: probable WRKY transcription facto...  65.1    1e-09   
gb|KHG24505.1|  putative WRKY transcription factor 70 -like protein   64.3    1e-09   
ref|XP_008369379.1|  PREDICTED: LOW QUALITY PROTEIN: probable WRK...  64.3    1e-09   
ref|XP_006429596.1|  hypothetical protein CICLE_v10012055mg           65.1    1e-09   
ref|XP_010252044.1|  PREDICTED: probable WRKY transcription facto...  64.7    2e-09   
ref|XP_010067621.1|  PREDICTED: probable WRKY transcription facto...  64.3    2e-09   
gb|AHA15410.1|  WRKY70                                                63.9    2e-09   
gb|KDO64116.1|  hypothetical protein CISIN_1g020291mg                 63.5    4e-09   
ref|XP_011018999.1|  PREDICTED: probable WRKY transcription facto...  61.2    4e-09   
ref|XP_008234170.1|  PREDICTED: probable WRKY transcription facto...  63.2    4e-09   
emb|CAN66487.1|  hypothetical protein VITISV_015394                   64.3    5e-09   Vitis vinifera
gb|EYU42031.1|  hypothetical protein MIMGU_mgv1a008874mg              63.2    6e-09   
ref|XP_003544262.1|  PREDICTED: probable WRKY transcription facto...  62.0    1e-08   
gb|KHN39988.1|  Putative WRKY transcription factor 70                 61.6    1e-08   
ref|XP_002319879.2|  WRKY transcription factor 70 family protein      61.6    2e-08   Populus trichocarpa [western balsam poplar]
ref|XP_004307738.1|  PREDICTED: probable WRKY transcription facto...  61.6    2e-08   
ref|NP_001275414.1|  WRKY transcription factor 6                      61.2    2e-08   
gb|AIY62485.1|  WRKY114                                               61.2    2e-08   
ref|XP_010554725.1|  PREDICTED: probable WRKY transcription facto...  61.2    2e-08   
ref|NP_001237638.1|  transcription factor                             60.8    4e-08   
ref|XP_006596397.1|  PREDICTED: probable WRKY transcription facto...  59.3    6e-08   
gb|ADT82685.1|  WRKY1                                                 59.3    7e-08   
dbj|BAF95871.1|  hypothetical protein                                 59.7    7e-08   Vitis hybrid cultivar
ref|XP_010525416.1|  PREDICTED: probable WRKY transcription facto...  59.7    8e-08   
gb|ACY69975.1|  WRKY transcription factor                             59.7    8e-08   Vitis pseudoreticulata
ref|XP_006435943.1|  hypothetical protein CICLE_v10032192mg           59.7    8e-08   
dbj|BAA87069.2|  elicitor-induced DNA-binding protein homolog         58.9    9e-08   Matricaria chamomilla
ref|XP_009760864.1|  PREDICTED: probable WRKY transcription facto...  58.2    1e-07   
gb|AAF61864.1|AF193771_1  DNA-binding protein 4                       57.8    1e-07   Nicotiana tabacum [American tobacco]
ref|XP_010540486.1|  PREDICTED: probable WRKY transcription facto...  58.5    2e-07   
ref|XP_003526799.1|  PREDICTED: probable WRKY transcription facto...  58.5    2e-07   
gb|ACU19563.1|  unknown                                               58.5    2e-07   Glycine max [soybeans]
ref|XP_002520871.1|  WRKY transcription factor, putative              58.2    2e-07   Ricinus communis
gb|KDO67551.1|  hypothetical protein CISIN_1g021598mg                 58.2    2e-07   
ref|XP_010093537.1|  putative WRKY transcription factor 70            58.2    3e-07   
ref|XP_010098011.1|  putative WRKY transcription factor 70            58.2    3e-07   
ref|XP_003623638.1|  WRKY transcription factor                        57.4    4e-07   
ref|XP_004490521.1|  PREDICTED: probable WRKY transcription facto...  57.0    4e-07   
ref|XP_002309186.2|  hypothetical protein POPTR_0006s10950g           57.8    4e-07   Populus trichocarpa [western balsam poplar]
ref|XP_007136415.1|  hypothetical protein PHAVU_009G043100g           57.0    5e-07   
gb|AGQ04250.1|  WRKY transcription factor 56                          57.4    5e-07   
emb|CDX72140.1|  BnaC08g27340D                                        56.6    8e-07   
gb|ACQ76810.1|  WRKY transcription factor 70                          56.6    8e-07   Brassica napus [oilseed rape]
gb|ACI14407.1|  WRKY70-1 transcription factor                         54.7    3e-06   Brassica napus [oilseed rape]
gb|AIE43837.1|  WRKY transcription factor 106                         55.1    3e-06   
ref|XP_003623634.1|  WRKY transcription factor                        55.1    3e-06   
ref|NP_001288821.1|  probable WRKY transcription factor 70            54.7    3e-06   
ref|NP_001266272.1|  uncharacterized protein LOC101259967             54.3    4e-06   
ref|XP_009597703.1|  PREDICTED: probable WRKY transcription facto...  54.3    5e-06   
ref|XP_011001689.1|  PREDICTED: probable WRKY transcription facto...  54.3    6e-06   
ref|XP_009793854.1|  PREDICTED: probable WRKY transcription facto...  53.9    7e-06   
ref|XP_002878082.1|  WRKY DNA-binding protein 70                      53.9    7e-06   
emb|CDX75992.1|  BnaA04g02560D                                        53.9    7e-06   
ref|XP_009139102.1|  PREDICTED: probable WRKY transcription facto...  53.5    1e-05   
ref|XP_002528697.1|  WRKY transcription factor, putative              53.5    1e-05   Ricinus communis
ref|XP_007141318.1|  hypothetical protein PHAVU_008G185800g           53.1    1e-05   
ref|NP_001288847.1|  probable WRKY transcription factor 70            52.8    1e-05   
ref|XP_008788525.1|  PREDICTED: probable WRKY transcription facto...  53.1    2e-05   
ref|XP_010931380.1|  PREDICTED: probable WRKY transcription facto...  52.8    2e-05   
ref|XP_002323675.1|  hypothetical protein POPTR_0016s14490g           52.8    2e-05   Populus trichocarpa [western balsam poplar]
gb|AFK41801.1|  unknown                                               50.8    2e-05   
gb|KHN40637.1|  Putative WRKY transcription factor 70                 52.4    2e-05   
gb|ACU24049.1|  unknown                                               52.4    3e-05   Glycine max [soybeans]
ref|NP_001237619.1|  transcription factor                             52.0    3e-05   
ref|XP_010103666.1|  putative WRKY transcription factor 70            51.6    4e-05   
emb|CDY66845.1|  BnaCnng52600D                                        51.2    6e-05   
ref|XP_004502820.1|  PREDICTED: probable WRKY transcription facto...  51.2    6e-05   
emb|CDY32013.1|  BnaC06g15910D                                        50.8    8e-05   
ref|XP_007033512.1|  WRKY DNA-binding protein 70, putative isoform 1  50.8    9e-05   
ref|XP_010922757.1|  PREDICTED: probable WRKY transcription facto...  50.4    1e-04   
gb|KEH35529.1|  WRKY family transcription factor                      50.1    1e-04   
ref|XP_006402991.1|  hypothetical protein EUTSA_v10006146mg           50.1    1e-04   
emb|CDY23883.1|  BnaC04g01540D                                        49.7    2e-04   
ref|XP_009142707.1|  PREDICTED: probable WRKY transcription facto...  49.7    2e-04   
ref|XP_008442314.1|  PREDICTED: probable WRKY transcription facto...  49.7    2e-04   
ref|XP_010921156.1|  PREDICTED: probable WRKY transcription facto...  49.7    2e-04   
gb|EEC78982.1|  hypothetical protein OsI_19468                        49.7    2e-04   Oryza sativa Indica Group [Indian rice]
tpg|DAA05110.1|  TPA: WRKY transcription factor 45                    49.7    2e-04   
gb|AHB33851.1|  WRKY transcription factor 54                          49.7    2e-04   
emb|CDX79972.1|  BnaA05g01840D                                        49.7    2e-04   
ref|XP_007033513.1|  WRKY DNA-binding protein 70, putative isoform 2  48.9    2e-04   
ref|NP_001267577.1|  probable WRKY transcription factor 70-like       49.3    2e-04   
gb|KGN58681.1|  WRKY transcription factor                             49.3    2e-04   
ref|NP_001055192.1|  Os05g0322900                                     48.9    4e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010036006.1|  PREDICTED: probable WRKY transcription facto...  48.5    4e-04   
gb|KFK34897.1|  hypothetical protein AALP_AA5G207700                  48.5    4e-04   
gb|KCW47528.1|  hypothetical protein EUGRSUZ_K01289                   48.5    4e-04   
ref|XP_010504547.1|  PREDICTED: probable WRKY transcription facto...  48.5    5e-04   
ref|XP_010516246.1|  PREDICTED: probable WRKY transcription facto...  48.1    6e-04   
ref|XP_009586653.1|  PREDICTED: probable WRKY transcription facto...  47.8    8e-04   
ref|XP_010043454.1|  PREDICTED: probable WRKY transcription facto...  48.1    8e-04   
gb|AJB84598.1|  WRKY                                                  47.8    8e-04   
gb|KHN36906.1|  Putative WRKY transcription factor 70                 47.8    8e-04   
ref|XP_003534637.1|  PREDICTED: probable WRKY transcription facto...  47.8    8e-04   
gb|ACU23894.1|  unknown                                               47.8    8e-04   Glycine max [soybeans]
ref|XP_006594723.1|  PREDICTED: probable WRKY transcription facto...  47.8    9e-04   
gb|KHN29497.1|  Putative WRKY transcription factor 70                 47.8    9e-04   
ref|XP_008456968.1|  PREDICTED: LOW QUALITY PROTEIN: probable WRK...  47.8    0.001   
ref|XP_006291218.1|  hypothetical protein CARUB_v10017349mg           47.8    0.001   



>gb|EYU20128.1| hypothetical protein MIMGU_mgv1a010128mg [Erythranthe guttata]
Length=321

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 71/134 (53%), Gaps = 18/134 (13%)
 Frame = +3

Query  108  LSSLMAKPTMENPLHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQ  287
            + SLM+    E   H  RKR IS L +GKK A +LQTLL+N        +     EL  Q
Sbjct  1    MGSLMS----EGNFHAKRKRAISELVEGKKMAARLQTLLQNRVQEDDRSADVSAQELAVQ  56

Query  288  IMGSFSEAVSQLLQAADSA------VSGEN--------PAKARRGCYNRRKCSDTWINVS  425
            I+ SFS  +S +    +SA        G++          K RRGCY RRK  D+W+ VS
Sbjct  57   IVRSFSVTLSVVSSCTESAQIAAVDCGGDSRKKLKPGVVVKDRRGCYKRRKTKDSWVIVS  116

Query  426  NTKEDGGAWRKYGQ  467
            +T EDG AWRKYGQ
Sbjct  117  STMEDGCAWRKYGQ  130



>ref|XP_002275401.1| PREDICTED: probable WRKY transcription factor 70 [Vitis vinifera]
Length=313

 Score = 84.7 bits (208),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 70/119 (59%), Gaps = 18/119 (15%)
 Frame = +3

Query  147  LHTHRKRVISVLHKGKKSATQLQTLLRN-FSLGSQEESRRLFPELTEQIMGSFSEAVSQL  323
            L T RKRV+  L  G+  A QLQ LLR  FS    ++      +L  +I+ SF+EA+S L
Sbjct  9    LSTDRKRVVGELVHGRDLANQLQILLREPFS----DQGSVSAEDLVVKILRSFTEALSVL  64

Query  324  L---QAADSAVSGENPA--------KARRGCYNRRKCSDTWINVSNTKEDGGAWRKYGQ  467
                Q+ D+   GE+PA        K RRGCY RRK S+TW  VS+T EDG AWRKYGQ
Sbjct  65   RCYDQSGDAG--GESPAESGNYKVLKNRRGCYKRRKNSETWTAVSSTIEDGHAWRKYGQ  121



>emb|CBI25345.3| unnamed protein product [Vitis vinifera]
Length=288

 Score = 84.3 bits (207),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 70/119 (59%), Gaps = 18/119 (15%)
 Frame = +3

Query  147  LHTHRKRVISVLHKGKKSATQLQTLLRN-FSLGSQEESRRLFPELTEQIMGSFSEAVSQL  323
            L T RKRV+  L  G+  A QLQ LLR  FS    ++      +L  +I+ SF+EA+S L
Sbjct  9    LSTDRKRVVGELVHGRDLANQLQILLREPFS----DQGSVSAEDLVVKILRSFTEALSVL  64

Query  324  L---QAADSAVSGENPA--------KARRGCYNRRKCSDTWINVSNTKEDGGAWRKYGQ  467
                Q+ D+   GE+PA        K RRGCY RRK S+TW  VS+T EDG AWRKYGQ
Sbjct  65   RCYDQSGDAG--GESPAESGNYKVLKNRRGCYKRRKNSETWTAVSSTIEDGHAWRKYGQ  121



>ref|XP_011085118.1| PREDICTED: LOW QUALITY PROTEIN: probable WRKY transcription factor 
70 [Sesamum indicum]
Length=299

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 71/124 (57%), Gaps = 20/124 (16%)
 Frame = +3

Query  147  LHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEE-SRRLFP-ELTEQIMGSFSEAVSQ  320
            LH  RKRVI  L KGK++AT+L+TLLR   +  Q+  S  + P  L  QI+ SF++ +S 
Sbjct  7    LHAKRKRVIVELVKGKETATRLRTLLR---IPDQDHGSSSVTPGHLAFQILRSFNKTLSV  63

Query  321  L-----------LQAADSAVSGENPAK----ARRGCYNRRKCSDTWINVSNTKEDGGAWR  455
            L           +    SA SGE+  K    +RRGCY RR+  ++W  + +  EDG AWR
Sbjct  64   LTSSCAATSPAAVDCRGSACSGESKQKPGLKSRRGCYKRRRSCESWTKICSVVEDGYAWR  123

Query  456  KYGQ  467
            KYGQ
Sbjct  124  KYGQ  127



>ref|XP_009793213.1| PREDICTED: probable WRKY transcription factor 70 [Nicotiana sylvestris]
Length=300

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 71/141 (50%), Gaps = 31/141 (22%)
 Frame = +3

Query  120  MAKPTM-ENPLHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMG  296
            M KP + ENP    + RVI  L  GK+ ATQLQTLL+         S     EL  +I  
Sbjct  1    MKKPLVHENP---RKNRVIKELVDGKRFATQLQTLLQQPIADHGPVSA---DELLLKIWR  54

Query  297  SFSEAVSQL--------LQAADSAVSGENPAK----------------ARRGCYNRRKCS  404
            SFSEA+++L        ++  D A SG+  +K                 RRGCY RRK S
Sbjct  55   SFSEAITELNTWGLAFQIEEVDQADSGDRKSKDSTSELKKKKDKQGGKDRRGCYKRRKTS  114

Query  405  DTWINVSNTKEDGGAWRKYGQ  467
             +W+  S T EDG AWRKYGQ
Sbjct  115  GSWMKESATVEDGCAWRKYGQ  135



>gb|AAF61863.1|AF193770_1 DNA-binding protein 3 [Nicotiana tabacum]
Length=300

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 71/141 (50%), Gaps = 31/141 (22%)
 Frame = +3

Query  120  MAKPTM-ENPLHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMG  296
            M KP + ENP    + RVI  L  GK+ ATQLQTLL+         S     EL  +I  
Sbjct  1    MKKPLVHENP---RKNRVIKELVDGKRFATQLQTLLQQPIADHGPVSA---DELLLKIWR  54

Query  297  SFSEAVSQL--------LQAADSAVSGENPAK----------------ARRGCYNRRKCS  404
            SFSEA+++L        ++  D A SG+  +K                 RRGCY RRK S
Sbjct  55   SFSEAITELNTWGLAFQIEEVDQADSGDRKSKDSTSELKKKKDKQGGKDRRGCYKRRKTS  114

Query  405  DTWINVSNTKEDGGAWRKYGQ  467
             +W+  S T EDG AWRKYGQ
Sbjct  115  GSWMRESATVEDGCAWRKYGQ  135



>ref|XP_009362779.1| PREDICTED: probable WRKY transcription factor 70 [Pyrus x bretschneideri]
 ref|XP_009362780.1| PREDICTED: probable WRKY transcription factor 70 [Pyrus x bretschneideri]
Length=302

 Score = 76.3 bits (186),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 68/143 (48%), Gaps = 42/143 (29%)
 Frame = +3

Query  147  LHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQLL  326
            + T+ KR+I  LH+G+K+A +LQ LL+N     Q   R L  EL  +IM  F+E++S L 
Sbjct  1    MGTNHKRLIEELHEGRKTAAELQILLQN-----QYGDRVLAEELLMKIMMVFAESLSALT  55

Query  327  QAAD------SAVSGE------------------------------NPAKARRGCYNRRK  398
             A+D      SA SGE                                 K RRGCY RRK
Sbjct  56   -ASDGHNDHQSAASGEVYQVKPEPSQVEHSHCCDRSSEDSGESRKTQAFKDRRGCYKRRK  114

Query  399  CSDTWINVSNTKEDGGAWRKYGQ  467
               +W   SN  EDG AWRKYGQ
Sbjct  115  TCQSWTVTSNKIEDGQAWRKYGQ  137



>ref|XP_007011368.1| WRKY DNA-binding protein 70, putative isoform 2 [Theobroma cacao]
 gb|EOY20178.1| WRKY DNA-binding protein 70, putative isoform 2 [Theobroma cacao]
Length=294

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 67/134 (50%), Gaps = 31/134 (23%)
 Frame = +3

Query  147  LHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQLL  326
            L + +KRVI  L  G++ ATQLQ L   F   S+E  +    EL ++I+ SF+E +S +L
Sbjct  12   LSSDKKRVIQELVHGQECATQLQIL---FHKPSEERGQLTAKELVQKILRSFNETIS-VL  67

Query  327  QAADSAVSGENPA---------------------------KARRGCYNRRKCSDTWINVS  425
             + DSA    N A                           K RRGCY R++ ++TW  +S
Sbjct  68   SSCDSAQVSRNQATNSNDDSPCCVDRRSEDSSESRKRPSSKDRRGCYKRKRAANTWTVIS  127

Query  426  NTKEDGGAWRKYGQ  467
               EDG AWRKYGQ
Sbjct  128  AAMEDGHAWRKYGQ  141



>ref|XP_007011367.1| WRKY DNA-binding protein 70, putative isoform 1 [Theobroma cacao]
 gb|EOY20177.1| WRKY DNA-binding protein 70, putative isoform 1 [Theobroma cacao]
Length=295

 Score = 76.3 bits (186),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 67/134 (50%), Gaps = 31/134 (23%)
 Frame = +3

Query  147  LHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQLL  326
            L + +KRVI  L  G++ ATQLQ L   F   S+E  +    EL ++I+ SF+E +S +L
Sbjct  12   LSSDKKRVIQELVHGQECATQLQIL---FHKPSEERGQLTAKELVQKILRSFNETIS-VL  67

Query  327  QAADSAVSGENPA---------------------------KARRGCYNRRKCSDTWINVS  425
             + DSA    N A                           K RRGCY R++ ++TW  +S
Sbjct  68   SSCDSAQVSRNQATNSNDDSPCCVDRRSEDSSESRKRPSSKDRRGCYKRKRAANTWTVIS  127

Query  426  NTKEDGGAWRKYGQ  467
               EDG AWRKYGQ
Sbjct  128  AAMEDGHAWRKYGQ  141



>ref|XP_010031073.1| PREDICTED: probable WRKY transcription factor 70 isoform X2 [Eucalyptus 
grandis]
 gb|KCW50333.1| hypothetical protein EUGRSUZ_J00106 [Eucalyptus grandis]
Length=314

 Score = 73.6 bits (179),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 65/121 (54%), Gaps = 19/121 (16%)
 Frame = +3

Query  162  KRVISVLHKGKKSATQLQTLLRNF-SLGSQEESRRL-FPELTEQIMGSFSEAVSQLLQAA  335
            KRV+  L +G+ +A QLQ LL+N  S    + SR L   EL E+I+ SF+E +S L    
Sbjct  21   KRVVEELLRGRCAAIQLQLLLQNPPSRDGSDGSRSLSAEELAEKILRSFAEGLSVLGSCC  80

Query  336  DSAVSGENPA-----------------KARRGCYNRRKCSDTWINVSNTKEDGGAWRKYG  464
            +SA +G +                   K R GC+ R K S TWI VS+T +D  AWRKYG
Sbjct  81   ESASAGHDHQVSPSSGESGDSKRRLNLKDRSGCHKRSKASQTWIKVSSTTQDNHAWRKYG  140

Query  465  Q  467
            Q
Sbjct  141  Q  141



>gb|KHG09099.1| putative WRKY transcription factor 70 -like protein [Gossypium 
arboreum]
Length=305

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 64/130 (49%), Gaps = 29/130 (22%)
 Frame = +3

Query  153  THRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQLLQA  332
            ++++RVI  L  G++ A QL+ LL N+    ++  R    EL  +I  SF  A+S LL A
Sbjct  14   SNKERVIEELVNGQECAKQLEILLHNWC---EKNGRLSAEELVHKIFASFDHALS-LLTA  69

Query  333  ADSAVSGENPA-------------------------KARRGCYNRRKCSDTWINVSNTKE  437
             +SA   +N A                         K +RGCY RR+    W  VS+T E
Sbjct  70   VESAEDSQNQATSYDDSPCCNGRSEDSTNSRKKLASKEKRGCYKRRRDEHAWTVVSSTVE  129

Query  438  DGGAWRKYGQ  467
            DG AWRKYGQ
Sbjct  130  DGHAWRKYGQ  139



>ref|XP_006356477.1| PREDICTED: probable WRKY transcription factor 70-like [Solanum 
tuberosum]
Length=277

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 64/130 (49%), Gaps = 30/130 (23%)
 Frame = +3

Query  138  ENPLHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVS  317
            ENP     KR+I  L +GK  A QLQ+LL+      Q     L  EL  +I GSF++A++
Sbjct  7    ENP----HKRLIKELVEGKIFAVQLQSLLK------QPNESVLADELIRKIWGSFTQAIT  56

Query  318  QL--------------LQAADSAVSGEN------PAKARRGCYNRRKCSDTWINVSNTKE  437
            +L              ++  D   SG          + RRGCY RRK S +W+  S T  
Sbjct  57   ELNSLGNSDNSLTQSQIEEVDQPNSGSGLKKKKKEKQDRRGCYKRRKTSGSWMRESETMN  116

Query  438  DGGAWRKYGQ  467
            DG AWRKYGQ
Sbjct  117  DGCAWRKYGQ  126



>ref|XP_008388364.1| PREDICTED: probable WRKY transcription factor 70 [Malus domestica]
Length=303

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 67/143 (47%), Gaps = 42/143 (29%)
 Frame = +3

Query  147  LHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQLL  326
            + T+ KR+I  LH+G K+A +LQ LL+N   G     R L  EL  +IM +F+E +S +L
Sbjct  1    MGTNHKRLIGELHEGXKTAXELQILLQN-PYGD----RVLAEELLMKIMTTFAETLS-VL  54

Query  327  QAAD------SAVSGE------------------------------NPAKARRGCYNRRK  398
             A+D      SA SGE                                 K RRGCY RRK
Sbjct  55   TASDGHEDHQSAASGEVHQVKPEPSQVEHSHCGDRSSEDSGESRKTQAFKDRRGCYKRRK  114

Query  399  CSDTWINVSNTKEDGGAWRKYGQ  467
               +W   S   EDG AWRKYGQ
Sbjct  115  TCQSWTVTSTKIEDGQAWRKYGQ  137



>ref|XP_009601871.1| PREDICTED: probable WRKY transcription factor 70 [Nicotiana tomentosiformis]
Length=285

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 68/139 (49%), Gaps = 32/139 (23%)
 Frame = +3

Query  135  MENPLHTHRK----RVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSF  302
            ME PL  H+     RV+  L +GK+ ATQLQTL   F     +       EL  +I  SF
Sbjct  1    MEKPL-VHQNPRKIRVMKELVEGKRFATQLQTL---FQQPIADHGSVSADELLLKIWRSF  56

Query  303  SEAVSQL--------LQAADSAVSGENPAK----------------ARRGCYNRRKCSDT  410
            SEA+++L        ++  D A S +  +K                 RRGCY RRK S +
Sbjct  57   SEAITELNTWGLAFQIEEVDQADSEDRKSKDSTSELKKKKDKQGGKDRRGCYKRRKTSAS  116

Query  411  WINVSNTKEDGGAWRKYGQ  467
            W+  S T EDG AWRKYGQ
Sbjct  117  WMRESATVEDGCAWRKYGQ  135



>gb|AIR08538.1| WRKY transcription factor [Solanum habrochaites]
Length=270

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 61/129 (47%), Gaps = 29/129 (22%)
 Frame = +3

Query  138  ENPLHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVS  317
            ENP      R+I  L +GK    QLQTLL+      Q     L  EL  +I GSF++A++
Sbjct  7    ENP----HNRLIKELIEGKSFTVQLQTLLK------QPNESVLAEELIRKIWGSFTQAIT  56

Query  318  QL--------------LQAADSAVSGENPAKA-----RRGCYNRRKCSDTWINVSNTKED  440
             L              ++  D   SG    K      RRGCY RRK S +W+  S T  D
Sbjct  57   VLNSLGNSDNSLTQGQIEEVDQPNSGSEMKKKKEKQDRRGCYKRRKTSGSWMRESETMND  116

Query  441  GGAWRKYGQ  467
            G AWRKYGQ
Sbjct  117  GCAWRKYGQ  125



>ref|XP_010253044.1| PREDICTED: probable WRKY transcription factor 70 [Nelumbo nucifera]
Length=329

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 76/143 (53%), Gaps = 34/143 (24%)
 Frame = +3

Query  132  TMENP----LHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGS  299
            T+E+P        RKR+I+ L +G++  TQLQT+L N  LG ++ S     +L  +I+ S
Sbjct  4    TVESPWPGNFSIDRKRLINSLVRGRELTTQLQTILCN-RLGHEDGSLST-EDLLPRILRS  61

Query  300  FSEAVSQLLQAADSAVSGENPA--------------------------KARRGCYNRRKC  401
            F+EA+S  L++ADS    +NP+                          K RRG Y RRK 
Sbjct  62   FTEAIS-ALKSADSGEVCQNPSSTNVSSPSCDGPRTEDSGESRKSPAVKDRRGDYKRRKV  120

Query  402  SDTWINVSNTK-EDGGAWRKYGQ  467
            S+TW  ++ T  +DG AWRKYGQ
Sbjct  121  SETWTKITPTPIDDGRAWRKYGQ  143



>ref|XP_010031072.1| PREDICTED: probable WRKY transcription factor 70 isoform X1 [Eucalyptus 
grandis]
 gb|KCW50332.1| hypothetical protein EUGRSUZ_J00106 [Eucalyptus grandis]
Length=319

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 66/126 (52%), Gaps = 24/126 (19%)
 Frame = +3

Query  162  KRVISVLHKGKKSATQLQTLLRNF-SLGSQEESRRL-FPELTEQIMGSFSEAVSQLLQAA  335
            KRV+  L +G+ +A QLQ LL+N  S    + SR L   EL E+I+ SF+E +S L    
Sbjct  21   KRVVEELLRGRCAAIQLQLLLQNPPSRDGSDGSRSLSAEELAEKILRSFAEGLSVLGSCC  80

Query  336  DSAVSGENPA-----------------KARRGCYNRR-----KCSDTWINVSNTKEDGGA  449
            +SA +G +                   K R GC+ RR     K S TWI VS+T +D  A
Sbjct  81   ESASAGHDHQVSPSSGESGDSKRRLNLKDRSGCHKRRCDQESKASQTWIKVSSTTQDNHA  140

Query  450  WRKYGQ  467
            WRKYGQ
Sbjct  141  WRKYGQ  146



>ref|XP_004235231.1| PREDICTED: probable WRKY transcription factor 70 [Solanum lycopersicum]
Length=273

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 61/130 (47%), Gaps = 30/130 (23%)
 Frame = +3

Query  138  ENPLHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVS  317
            ENP      R+I  L +GK    QLQTLL+      Q     L  EL  +I GSF++A++
Sbjct  7    ENP----HNRLIKELVEGKSFTVQLQTLLK------QPNESVLAEELIRKIWGSFTQAIT  56

Query  318  QL--------------LQAADSAVSGEN------PAKARRGCYNRRKCSDTWINVSNTKE  437
             L              ++  D   SG          + RRGCY RRK S +W+  S T  
Sbjct  57   VLNSLGNSDNSLTQGQIEEVDQPNSGSELKKKKKEKQDRRGCYKRRKTSGSWMRESATMN  116

Query  438  DGGAWRKYGQ  467
            DG AWRKYGQ
Sbjct  117  DGCAWRKYGQ  126



>gb|AGQ04251.1| WRKY transcription factor 57.1 [Jatropha curcas]
Length=289

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 67/136 (49%), Gaps = 31/136 (23%)
 Frame = +3

Query  138  ENPLHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVS  317
            EN   T+R++V   L  G++ ATQLQ LL+    G       L  EL  +I+ SF+EA+S
Sbjct  7    ENVPSTNREKVGEELLHGQEFATQLQFLLKG-PCGD----LLLADELVVKILRSFNEALS  61

Query  318  QL-------------------------LQAADSAVSGENPA-KARRGCYNRRKCSDTWIN  419
             L                          ++ DS  S + P  K RRGCY R+K S +WI 
Sbjct  62   LLSSCEFLENSQNLITTSQVDSVCCDDRRSEDSGESRKRPTNKDRRGCYKRKKTSQSWIT  121

Query  420  VSNTKEDGGAWRKYGQ  467
            VS   EDG AWRKYGQ
Sbjct  122  VSAAMEDGHAWRKYGQ  137



>ref|XP_003544261.1| PREDICTED: probable WRKY transcription factor 70-like [Glycine 
max]
Length=329

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 67/121 (55%), Gaps = 21/121 (17%)
 Frame = +3

Query  159  RKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVS-------  317
            ++ ++  L KG++SATQL+ LL     GS  E      ELT  ++ SF++A+S       
Sbjct  20   KRMIMKELVKGQESATQLKVLLEK-PFGS--EGSLSCQELTANVLRSFTQAISIINSSSA  76

Query  318  ------QLLQAADS----AVSGENPA-KARRGCYNRRKCSDTWINVSNTKEDGGAWRKYG  464
                   LL +  +    AVSGEN + K RRG YNRRK + TW  +S T +D  AWRKYG
Sbjct  77   DEVAHRSLLNSGQNGSPVAVSGENRSQKGRRGRYNRRKNALTWTILSCTTDDNHAWRKYG  136

Query  465  Q  467
            Q
Sbjct  137  Q  137



>gb|KHN39987.1| Putative WRKY transcription factor 70 [Glycine soja]
Length=329

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 67/121 (55%), Gaps = 21/121 (17%)
 Frame = +3

Query  159  RKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVS-------  317
            ++ ++  L KG++SATQL+ LL     GS  E      ELT  ++ SF++A+S       
Sbjct  20   KRMIMKELVKGQESATQLKVLLEK-PFGS--EGSLSCQELTANVLRSFTQAISIINSSSA  76

Query  318  ------QLLQAADS----AVSGENPA-KARRGCYNRRKCSDTWINVSNTKEDGGAWRKYG  464
                   LL +  +    AVSGEN + K RRG YNRRK + TW  +S T +D  AWRKYG
Sbjct  77   DEVAHRSLLNSGQNGSPVAVSGENRSQKGRRGRYNRRKNALTWTILSCTTDDNHAWRKYG  136

Query  465  Q  467
            Q
Sbjct  137  Q  137



>gb|AIE43829.1| WRKY transcription factor 102 [Gossypium hirsutum]
Length=302

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 66/134 (49%), Gaps = 31/134 (23%)
 Frame = +3

Query  147  LHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPE--LTEQIMGSFSEAVSQ  320
            L  ++KRVI  L  G++ ATQLQ L  N S    EE  RL  E  L + I+ SF+  +S 
Sbjct  11   LSNNKKRVIQQLVHGQECATQLQILFHNPS----EEGGRLSAEEILVQNILTSFNHTLSA  66

Query  321  LLQAADSAVS-------GENP------------------AKARRGCYNRRKCSDTWINVS  425
            L     S VS        ++P                  +K +RGCY R++ ++ W  VS
Sbjct  67   LSCIDSSEVSQNQTTCNDDSPWCEDRRSEGCSESSKRPGSKDKRGCYKRKRDAEAWTVVS  126

Query  426  NTKEDGGAWRKYGQ  467
             T EDG AWRKYGQ
Sbjct  127  ATMEDGQAWRKYGQ  140



>ref|XP_009363788.1| PREDICTED: probable WRKY transcription factor 70 [Pyrus x bretschneideri]
Length=344

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 70/145 (48%), Gaps = 46/145 (32%)
 Frame = +3

Query  147  LHTHRKRVISVLHKGKKSATQLQTLLRN--FSLGSQEESRRLFPELTEQIMGSFSEAVSQ  320
            + T+ KR+I  L +G+K+A +LQ+LL       GS EE       L  +IM +F+E++S 
Sbjct  34   MGTNHKRLIEELLEGRKTAVELQSLLHKPFGDSGSAEE-------LLMKIMKTFTESLS-  85

Query  321  LLQAAD--------------------------------SAVSGENPA----KARRGCYNR  392
            +L A+D                                S  SGE+P     K RRGCY R
Sbjct  86   VLTASDGHEDHQSAASGEVYQVKPEPSHVEHSHCGDRSSEGSGESPKTQAFKDRRGCYKR  145

Query  393  RKCSDTWINVSNTKEDGGAWRKYGQ  467
            RK S +W  +S   EDG AWRKYGQ
Sbjct  146  RKTSQSWKVISTKIEDGQAWRKYGQ  170



>gb|AGV75934.1| WRKY transcription factor 14 [Gossypium hirsutum]
Length=303

 Score = 67.8 bits (164),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 65/134 (49%), Gaps = 31/134 (23%)
 Frame = +3

Query  147  LHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPE--LTEQIMGSFSEAVSQ  320
            L   +KRVI  L  G++ ATQLQ L  N S    EE  RL  E  L + I+ SF+  +S 
Sbjct  11   LSNSKKRVIQQLVHGQECATQLQILFHNPS----EEGGRLSAEEVLVQNILTSFNHTLSA  66

Query  321  LLQAADSAVS-------GENP------------------AKARRGCYNRRKCSDTWINVS  425
            L     S VS        ++P                  +K +RGCY R++ ++ W  VS
Sbjct  67   LSCIDSSEVSQNQTTCNDDSPWCEDRRSEGCSESSKRPGSKDKRGCYKRKRDAEAWTVVS  126

Query  426  NTKEDGGAWRKYGQ  467
             T EDG AWRKYGQ
Sbjct  127  ATMEDGQAWRKYGQ  140



>gb|AIE43833.1| WRKY transcription factor 7 [Gossypium hirsutum]
Length=305

 Score = 67.8 bits (164),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 64/130 (49%), Gaps = 29/130 (22%)
 Frame = +3

Query  153  THRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQLLQA  332
            ++++RVI  L  G++ A QLQ LL N+    ++  R    EL  +I  SF  A+S LL +
Sbjct  14   SNKERVIKELVNGQECAKQLQILLHNWC---EKNGRLSAEELLHKIFASFDHALS-LLTS  69

Query  333  ADSAVSGEN-------------------------PAKARRGCYNRRKCSDTWINVSNTKE  437
             +SA   +N                         P+K +RGCY RR+       VS+T E
Sbjct  70   VESAEDSQNQATSYDDSPCCNGRSEDSTNSRKKLPSKEKRGCYKRRRDEHARTVVSSTVE  129

Query  438  DGGAWRKYGQ  467
            DG AWRKYGQ
Sbjct  130  DGHAWRKYGQ  139



>ref|XP_011095148.1| PREDICTED: probable WRKY transcription factor 70 [Sesamum indicum]
Length=327

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 62/110 (56%), Gaps = 8/110 (7%)
 Frame = +3

Query  162  KRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFS-----EAVSQL-  323
            ++VI  L +G++ A QL+ +LR+        ++ L  ++ E    S S      AVSQL 
Sbjct  6    EKVIGELSRGREVADQLRLMLRHTPPLDPTPAQGLVAKILETFTHSLSMLSPTAAVSQLP  65

Query  324  -LQAADSAVSGENPAKARRGCYNRRKCSDTWI-NVSNTKEDGGAWRKYGQ  467
             L++ DS  +   P K RRGCY RR+ S+TW    ++  EDG AWRKYGQ
Sbjct  66   PLKSEDSGETPPPPTKDRRGCYKRRRSSETWTKKTASLFEDGHAWRKYGQ  115



>ref|XP_011076580.1| PREDICTED: probable WRKY transcription factor 70 [Sesamum indicum]
Length=316

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 64/122 (52%), Gaps = 23/122 (19%)
 Frame = +3

Query  162  KRVISV-LHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQLLQAAD  338
            KR++ V L KG+ +AT+L+ LL++        S     +L  +I  SFSE++S L    D
Sbjct  15   KRLMVVELLKGRDTATRLRALLQDPRSHQDPVSAE---QLAVEIFRSFSESLSVLSSRVD  71

Query  339  SAVSGENPA-------------------KARRGCYNRRKCSDTWINVSNTKEDGGAWRKY  461
               S + PA                   K RRGCY RR+ SD+ + VS+T EDG AWRKY
Sbjct  72   VVGSAQIPAVDSGGSSSCSGESKKKPGVKDRRGCYKRRRTSDSRVTVSSTMEDGCAWRKY  131

Query  462  GQ  467
            GQ
Sbjct  132  GQ  133



>emb|CDP13896.1| unnamed protein product [Coffea canephora]
Length=333

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 65/137 (47%), Gaps = 28/137 (20%)
 Frame = +3

Query  141  NP--LHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAV  314
            NP  L T ++ VI  L KGK+SATQL  LL+               EL  QI  SFSE++
Sbjct  5    NPQQLRTIQETVIGKLLKGKESATQLVALLKKPRSSGDRGGSVSAEELALQISRSFSESI  64

Query  315  SQL----------LQAADSAV-----------SGENP-----AKARRGCYNRRKCSDTWI  416
            S            + AAD  V           + +N       K RRGCY RR  + + I
Sbjct  65   SAFGSLEGNGICQIVAADGVVRVSSVDRGSSKTSDNGRKRLGVKDRRGCYRRRNVAQSSI  124

Query  417  NVSNTKEDGGAWRKYGQ  467
             VS+T EDG AWRKYGQ
Sbjct  125  IVSSTVEDGHAWRKYGQ  141



>gb|AIE43831.1| WRKY transcription factor 88 [Gossypium hirsutum]
Length=275

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 67/131 (51%), Gaps = 29/131 (22%)
 Frame = +3

Query  147  LHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQLL  326
            L +++KRVI  L +G++ AT+LQ ++   +  SQ+       EL ++I+ SF++ +S L 
Sbjct  13   LSSNKKRVIQQLAEGQQCATELQVIVLQNNKPSQQTE-----ELVQKILWSFNQTISMLA  67

Query  327  QAA--DSAVSGENP----------------------AKARRGCYNRRKCSDTWINVSNTK  434
            +A   D  +S                          AK +RGCY R++ + T   VS+  
Sbjct  68   EAGHHDEVISQNQATCNDDCKSQDSSESSKRSLSAFAKDKRGCYKRKRFAQTSTVVSDKI  127

Query  435  EDGGAWRKYGQ  467
            EDG AWRKYGQ
Sbjct  128  EDGHAWRKYGQ  138



>gb|AGV75950.1| WRKY transcription factor 46 [Gossypium hirsutum]
Length=275

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 67/131 (51%), Gaps = 29/131 (22%)
 Frame = +3

Query  147  LHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQLL  326
            L +++KRVI  L +G++ AT+LQ ++   +  SQ+       EL ++I+ SF++ +S L 
Sbjct  13   LSSNKKRVIQQLAEGQQCATELQVIVLQNNKPSQQAE-----ELVQKILWSFNQTISMLA  67

Query  327  QAA--DSAVSGENP----------------------AKARRGCYNRRKCSDTWINVSNTK  434
            +A   D  +S                          AK +RGCY R++ + T   VS+  
Sbjct  68   EAGHHDEVISQNQATCNDDCKSQDSSESSKRSLSAFAKDKRGCYKRKRFAQTSTVVSDKI  127

Query  435  EDGGAWRKYGQ  467
            EDG AWRKYGQ
Sbjct  128  EDGHAWRKYGQ  138



>ref|XP_003615415.1| WRKY transcription factor [Medicago truncatula]
 gb|AES98373.1| WRKY family transcription factor [Medicago truncatula]
Length=236

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 67/125 (54%), Gaps = 23/125 (18%)
 Frame = +3

Query  135  MEN--PLHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSE  308
            M+N  P    +K +I  L KG+++AT+L+ LL+N       E+      L   ++ SF+E
Sbjct  1    MDNNIPESVRKKVIIKELVKGQEAATKLKFLLQN-------ENPYGADHLAAYVLRSFTE  53

Query  309  AVS-----------QLLQAADSAVSGENPAKARRGCYNRRK-CSDTWINVSNTKEDGGAW  452
            A+S            L+++ADS    E+  K RRGCY RRK  ++ W  VS T  D  +W
Sbjct  54   ALSIISQPSCDDFLNLIKSADSI--NESRKKGRRGCYKRRKSAAEIWTIVSQTIVDNHSW  111

Query  453  RKYGQ  467
            RKYGQ
Sbjct  112  RKYGQ  116



>ref|XP_007219739.1| hypothetical protein PRUPE_ppa026125mg [Prunus persica]
 gb|EMJ20938.1| hypothetical protein PRUPE_ppa026125mg [Prunus persica]
Length=323

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 66/144 (46%), Gaps = 40/144 (28%)
 Frame = +3

Query  147  LHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQL-  323
            + ++ KR+I  L +GKK+AT+LQ LL    LG    +     EL  +IM SF+E++S L 
Sbjct  1    MGSNHKRLIKELVEGKKTATELQMLLHK-PLGDHGSASA--EELVVKIMTSFTESLSVLA  57

Query  324  --------------------------------LQAADSAVSGEN----PAKARRGCYNRR  395
                                                 S  SGE+     +K RRGCY RR
Sbjct  58   AEKKNPGDGHEDHQSGAFGEVYQIKPEPSHSHCDDRSSGDSGESRKVQGSKDRRGCYKRR  117

Query  396  KCSDTWINVSNTKEDGGAWRKYGQ  467
            K S +W  VS   EDG AWRKYGQ
Sbjct  118  KTSQSWTTVSPAIEDGRAWRKYGQ  141



>gb|AGQ04252.1| WRKY transcription factor 57.2 [Jatropha curcas]
 gb|KDP21637.1| hypothetical protein JCGZ_03308 [Jatropha curcas]
Length=290

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 67/137 (49%), Gaps = 32/137 (23%)
 Frame = +3

Query  138  ENPLHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVS  317
            EN   T+R++V   L  G++ ATQLQ LL+    G       L  EL  +I+ SF+EA+S
Sbjct  7    ENVPSTNREKVGEELLHGQEFATQLQFLLKG-PCGD----LLLADELVVKILRSFNEALS  61

Query  318  QL-------------------------LQAADSAVSGENPA-KARRGCYNR-RKCSDTWI  416
             L                          ++ DS  S + P  K RRGCY R RK S +WI
Sbjct  62   LLSSCEFLENSQNLITTSQVDSVCCDDRRSEDSGESRKRPTNKDRRGCYKRNRKTSQSWI  121

Query  417  NVSNTKEDGGAWRKYGQ  467
             VS   EDG AWRKYGQ
Sbjct  122  TVSAAMEDGHAWRKYGQ  138



>ref|XP_011014496.1| PREDICTED: probable WRKY transcription factor 70 [Populus euphratica]
Length=322

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 67/139 (48%), Gaps = 38/139 (27%)
 Frame = +3

Query  147  LHTHRKRVISVLHKGKKSATQLQTLLR----NFSLGSQEESRRLFP-ELTEQIMGSFSEA  311
            L + R++VI  L +G + ATQLQ  L+    NF      + R   P EL  +I+ SFSE 
Sbjct  9    LSSSREKVIKELVRGHEFATQLQIRLQKPCGNF------DGRFSSPGELVGKILRSFSET  62

Query  312  VSQLL--------------------------QAADSAVSGENPA-KARRGCYNRRKCSDT  410
            +S +                           ++ DS  S + PA K RRGCYNR+K S +
Sbjct  63   LSVITSSESAGGEICQNLASSLGDSACYDDRRSKDSGESKKRPATKDRRGCYNRKKISQS  122

Query  411  WINVSNTKEDGGAWRKYGQ  467
            W  V  T ED  AWRKYGQ
Sbjct  123  WTTVCPTIEDSHAWRKYGQ  141



>emb|CBI18028.3| unnamed protein product [Vitis vinifera]
Length=331

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 66/126 (52%), Gaps = 26/126 (21%)
 Frame = +3

Query  159  RKRVISVLHKGKKSATQLQTLLRNFSLGSQEES-RRLFPELTEQIMGSFS--------EA  311
            RKR I  L +G+    QL+++L     G Q+ES + L  +++     + S        EA
Sbjct  59   RKRAIDELLRGRSFTKQLRSVLLG---GDQQESAQDLLVKISRSFTDTLSILNSGESDEA  115

Query  312  VSQL-------------LQAADSAVSGENPAKARRGCYNRRKCSDTWINVS-NTKEDGGA  449
            VSQ+              ++ +S  SG++  K RRGCY RRK S +WI ++ N  +DG A
Sbjct  116  VSQIPASGQLYSPGWHGRRSEESCESGKSSTKDRRGCYKRRKNSQSWIRITPNFHDDGYA  175

Query  450  WRKYGQ  467
            WRKYGQ
Sbjct  176  WRKYGQ  181



>ref|XP_002272504.1| PREDICTED: probable WRKY transcription factor 70 [Vitis vinifera]
Length=322

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 63/126 (50%), Gaps = 26/126 (21%)
 Frame = +3

Query  159  RKRVISVLHKGKKSATQLQTLLRNFSLGSQEES---------RRLFPELTEQIMGSFSEA  311
            RKR I  L +G+    QL+++L     G Q+ES         R     L+    G   EA
Sbjct  24   RKRAIDELLRGRSFTKQLRSVLLG---GDQQESAQDLLVKISRSFTDTLSILNSGESDEA  80

Query  312  VSQL-------------LQAADSAVSGENPAKARRGCYNRRKCSDTWINVS-NTKEDGGA  449
            VSQ+              ++ +S  SG++  K RRGCY RRK S +WI ++ N  +DG A
Sbjct  81   VSQIPASGQLYSPGWHGRRSEESCESGKSSTKDRRGCYKRRKNSQSWIRITPNFHDDGYA  140

Query  450  WRKYGQ  467
            WRKYGQ
Sbjct  141  WRKYGQ  146



>ref|XP_006481203.1| PREDICTED: probable WRKY transcription factor 70-like [Citrus 
sinensis]
Length=328

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 66/132 (50%), Gaps = 30/132 (23%)
 Frame = +3

Query  159  RKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLF--PELTEQIMGSFSEAVSQL---  323
            R+R I  L KG++ A QL+ L+   S  S E S+ +    +L   I+ SF+ ++S L   
Sbjct  21   RRRAIEELIKGQEMALQLRNLIHK-STKSGEGSKAMIINQDLVANILSSFTNSLSILKNG  79

Query  324  ----------------------LQAADSAVSGEN-PAKARRGCYNRRKCSDTWINVSNT-  431
                                  L+  DS  S ++   K RRGCY RRKC+++W   S+T 
Sbjct  80   DSDEASQVQEHTQLSSPCWEAYLKTEDSGESSKSSTVKDRRGCYKRRKCAESWTEHSSTL  139

Query  432  KEDGGAWRKYGQ  467
             +DG AWRKYGQ
Sbjct  140  TDDGHAWRKYGQ  151



>gb|KHG24505.1| putative WRKY transcription factor 70 -like protein [Gossypium 
arboreum]
Length=275

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 69/133 (52%), Gaps = 33/133 (25%)
 Frame = +3

Query  147  LHTHRKRVISVLHKGKKSATQLQTL-LRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQL  323
            L +++KRVI  L +G++ AT+LQ + L N     Q E      EL ++I+ SF++ +S L
Sbjct  13   LSSNKKRVIQKLVEGQQCATELQVIVLHNNKPPQQAE------ELVQKILWSFNQTLSML  66

Query  324  LQAA--DSAVSGENPA-----------------------KARRGCYNRRKCSDTWINVSN  428
             +A   D  +S +N A                       K +RGCY R++ + T I VS+
Sbjct  67   AEAGHHDEVIS-QNQATCNDDCKSQDSSESSKRSLSAFVKDKRGCYKRKRFAQTKIVVSD  125

Query  429  TKEDGGAWRKYGQ  467
              EDG AWRKYGQ
Sbjct  126  KIEDGHAWRKYGQ  138



>ref|XP_008369379.1| PREDICTED: LOW QUALITY PROTEIN: probable WRKY transcription factor 
70 [Malus domestica]
Length=302

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 68/142 (48%), Gaps = 40/142 (28%)
 Frame = +3

Query  147  LHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQLL  326
            + T+ KR+I  L +G+K+A +LQ+LL     G +E +     EL  +IM +F+E++S L 
Sbjct  1    MGTNHKRLIEELLEGRKTAVELQSLLHK-PFGDRESAE----ELLMKIMTTFTESLSVLT  55

Query  327  ---------QAADSAV----------------------SGENPA----KARRGCYNRRKC  401
                      AA   V                      SGE+P     K RRG Y RRK 
Sbjct  56   ASNGHEDHQSAASGEVYQVKPEPSHVEHSHCGDRSSEGSGESPKTQAFKDRRGSYKRRKT  115

Query  402  SDTWINVSNTKEDGGAWRKYGQ  467
            S +W  +S   EDG AWRKYGQ
Sbjct  116  SQSWKVISTKIEDGQAWRKYGQ  137



>ref|XP_006429596.1| hypothetical protein CICLE_v10012055mg [Citrus clementina]
 gb|ESR42836.1| hypothetical protein CICLE_v10012055mg [Citrus clementina]
Length=356

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 66/132 (50%), Gaps = 30/132 (23%)
 Frame = +3

Query  159  RKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLF--PELTEQIMGSFSEAVSQL---  323
            R+R I  L KG++ A QL+ L+   S  S E S+ +    +L   I+ SF+ ++S L   
Sbjct  49   RRRAIEELIKGQEMALQLRNLIHK-STKSGEGSKAMIINQDLVANILSSFTNSLSILKNG  107

Query  324  ----------------------LQAADSAVSGEN-PAKARRGCYNRRKCSDTWINVSNT-  431
                                  L+  DS  S ++   K RRGCY RRKC+++W   S+T 
Sbjct  108  DSDEASQVQEHTQLSSPCWEAYLKTEDSGESSKSSTVKDRRGCYKRRKCAESWTEHSSTL  167

Query  432  KEDGGAWRKYGQ  467
             +DG AWRKYGQ
Sbjct  168  TDDGHAWRKYGQ  179



>ref|XP_010252044.1| PREDICTED: probable WRKY transcription factor 70 [Nelumbo nucifera]
Length=326

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 63/131 (48%), Gaps = 30/131 (23%)
 Frame = +3

Query  156  HRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQLLQAA  335
            +R++ I+ L +G++  TQLQ +LRN   G    S     +L  +I+ SF+EA++ L    
Sbjct  15   NRRKAINELVRGREFTTQLQIILRNPLGGHGSVSAE---DLLPKILTSFTEAIAALNTTV  71

Query  336  DSAVSGENPA--------------------------KARRGCYNRRKCSDTWINVSNTK-  434
            +S    +NPA                          K RRG Y RRK   TW  +S T  
Sbjct  72   ESGEVSQNPASTHVSSPSCGDRATEDSGESKKSTVLKDRRGSYKRRKLLQTWTKLSATPI  131

Query  435  EDGGAWRKYGQ  467
            +DG AWRKYGQ
Sbjct  132  DDGRAWRKYGQ  142



>ref|XP_010067621.1| PREDICTED: probable WRKY transcription factor 70 [Eucalyptus 
grandis]
 gb|KCW65790.1| hypothetical protein EUGRSUZ_G03145 [Eucalyptus grandis]
Length=321

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 71/142 (50%), Gaps = 36/142 (25%)
 Frame = +3

Query  135  MENPLHTH---RKRVISVLHKGKKSATQLQTLLRNFS--LGSQEESRRLFPELTEQIMGS  299
            +E  L T+   ++R I  L  G++SA +L+TLLR  S   GSQ        EL  +I+ S
Sbjct  6    LERSLSTNSSSKRRAIEELVDGRESAMRLKTLLRKPSGNNGSQPAD-----ELVVKILRS  60

Query  300  FSEAVSQLLQAADSAV----------------------SGENPA----KARRGCYNRRKC  401
            F+E++S L    +S V                      SGE+      K  RGCY RRK 
Sbjct  61   FTESISALSSCEESEVREVMSPQIGGFGAGCDDQGSEHSGESRKRPGLKDGRGCYKRRKE  120

Query  402  SDTWINVSNTKEDGGAWRKYGQ  467
            S+T   +S TK+DG AWRKYGQ
Sbjct  121  SETRTTISPTKDDGHAWRKYGQ  142



>gb|AHA15410.1| WRKY70 [Capsicum annuum]
Length=299

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 64/133 (48%), Gaps = 31/133 (23%)
 Frame = +3

Query  159  RKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQL-----  323
            RKR+I  L +GK  A QLQ+LL+  ++   + S  L  EL  +I  SF++A+++L     
Sbjct  10   RKRLIKELVEGKSFAKQLQSLLQQPNIEHYDGS-VLADELVLKIWRSFTQAITELNTLVD  68

Query  324  --------------LQAADSAVSGE-----------NPAKARRGCYNRRKCSDTWINVSN  428
                           +  D A +G+              K RRGCY RR  S +W+  S 
Sbjct  69   SNSILVQTQMEVEKTEEVDQADTGDRSNSELKKKGKQGGKDRRGCYKRRNNSGSWMRESE  128

Query  429  TKEDGGAWRKYGQ  467
            T  DG AWRKYGQ
Sbjct  129  TMNDGCAWRKYGQ  141



>gb|KDO64116.1| hypothetical protein CISIN_1g020291mg [Citrus sinensis]
Length=328

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 65/131 (50%), Gaps = 28/131 (21%)
 Frame = +3

Query  159  RKRVISVLHKGKKSATQLQTLLRNFSL-GSQEESRRLFPELTEQIMGSFSEAVSQL----  323
            R+R I  L KG++ A QL+ L+   +  G   ++  +  +L   I+ SF+ ++S L    
Sbjct  21   RRRAIEELIKGQEMALQLRNLIHTSTKKGEGSKAMIINQDLVANILSSFTNSLSILKNGD  80

Query  324  ---------------------LQAADSAVSGEN-PAKARRGCYNRRKCSDTWINVSNT-K  434
                                 L+  DS  S ++   K RRGCY RRKC+++W   S+T  
Sbjct  81   SDEASQVQEHTQLSSPCWEAYLKTEDSGESSKSSTVKDRRGCYKRRKCAESWTEHSSTLT  140

Query  435  EDGGAWRKYGQ  467
            +DG AWRKYGQ
Sbjct  141  DDGHAWRKYGQ  151



>ref|XP_011018999.1| PREDICTED: probable WRKY transcription factor 70 [Populus euphratica]
Length=153

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 65/138 (47%), Gaps = 34/138 (25%)
 Frame = +3

Query  147  LHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQLL  326
            L +HRK+VI  L +G++ A QL+ ++R     + ++       L  +IM SF+  +S L 
Sbjct  9    LPSHRKKVIDELLRGQEIAKQLKLVMRK---STGDDGSMSAENLVREIMNSFNSTLSILN  65

Query  327  QAA--------------------------DSAVSGENPA----KARRGCYNRRKCSDTWI  416
                                         DS  S ++ A    K RRGCY RRK S +W 
Sbjct  66   GGGYDDDVSQTTAPTKVCSPLWDGRKSPEDSGESSKSTAAVKVKDRRGCYKRRKSSHSWT  125

Query  417  NVSNT-KEDGGAWRKYGQ  467
            N ++T  +DG AWRKYGQ
Sbjct  126  NETSTLTDDGHAWRKYGQ  143



>ref|XP_008234170.1| PREDICTED: probable WRKY transcription factor 70 [Prunus mume]
Length=323

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 65/144 (45%), Gaps = 40/144 (28%)
 Frame = +3

Query  147  LHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQL-  323
            + ++ KR+I  L +GKK+A +LQ LL     G    +     EL  +IM SF+E++S L 
Sbjct  1    MGSNHKRLIKELVEGKKTAAELQMLLHK-PFGDHGSASA--EELVVKIMTSFTESLSVLA  57

Query  324  --------------------------------LQAADSAVSGEN----PAKARRGCYNRR  395
                                                 S  SGE+     +K RRGCY RR
Sbjct  58   AEKKNPGDGHEDHQSGAFGEVYQIKPEPSHSHCDDRSSGDSGESRKVQGSKDRRGCYKRR  117

Query  396  KCSDTWINVSNTKEDGGAWRKYGQ  467
            K S +W  +S+  EDG AWRKYGQ
Sbjct  118  KTSQSWTTISSAIEDGRAWRKYGQ  141



>emb|CAN66487.1| hypothetical protein VITISV_015394 [Vitis vinifera]
Length=719

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 68/138 (49%), Gaps = 32/138 (23%)
 Frame = +3

Query  132  TMENPLHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFS--  305
            T    +   RKR I  L +G+    QL+++L     G Q+ES +   +L  +I  SF+  
Sbjct  412  TWSEKISGDRKRAIDELLRGRSFTKQLRSVLLG---GXQQESXQ---DLLXKIXRSFTDT  465

Query  306  ----------EAVSQL-------------LQAADSAVSGENPAKARRGCYNRRKCSDTWI  416
                      E VSQ+              ++ +S  SG++  K RRGCY RRK S +WI
Sbjct  466  LSILNSGESDEXVSQIPASGQLYSPGWHGRRSEESCESGKSSTKDRRGCYKRRKNSQSWI  525

Query  417  NVS-NTKEDGGAWRKYGQ  467
             ++ N  +DG AWRKYGQ
Sbjct  526  RITPNFHDDGYAWRKYGQ  543



>gb|EYU42031.1| hypothetical protein MIMGU_mgv1a008874mg [Erythranthe guttata]
Length=360

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 66/125 (53%), Gaps = 24/125 (19%)
 Frame = +3

Query  165  RVISVLHKGKKSATQLQTLLR---NFSLGSQEE-SRRLFPE--LTEQIMGSFSEAVSQL-  323
            RVI  L +G+  A QL+ +LR   +  +G  ++ S  + P   L  +I+ SF+ ++S L 
Sbjct  18   RVIGELTRGRDVADQLRQMLRESRHHGVGVDDDASSSVLPAQGLVGKILDSFTHSLSILS  77

Query  324  ---------------LQAADSAVSGENPA-KARRGCYNRRKCSDTWINVSNTK-EDGGAW  452
                           L++ DS  S + P  K RRGCY RR+ S+TW   + +  EDG AW
Sbjct  78   SDEASQVPVGFSSPSLKSEDSGDSCKTPLPKDRRGCYKRRRSSETWTKETGSLFEDGHAW  137

Query  453  RKYGQ  467
            RKYGQ
Sbjct  138  RKYGQ  142



>ref|XP_003544262.1| PREDICTED: probable WRKY transcription factor 70-like [Glycine 
max]
Length=303

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 64/120 (53%), Gaps = 21/120 (18%)
 Frame = +3

Query  162  KRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVS--------  317
            + ++  L KG++SATQL+ LL     GS  E      ELT  ++ SF++A+S        
Sbjct  19   RMIMKELVKGQESATQLKVLLEK-PFGS--EGSLSCQELTANVLRSFTQAISIINSSSAD  75

Query  318  -----QLLQAADS----AVSGENPA-KARRGCYNRRKCSDTWINVSNTKEDGGAWRKYGQ  467
                  LL +  +    AVSGEN + K  RG YNRRK + +W  +S T +D   WRKYGQ
Sbjct  76   EVAHRSLLNSGQNGSPVAVSGENRSQKGGRGRYNRRKSAVSWSILSCTTDDNHVWRKYGQ  135



>gb|KHN39988.1| Putative WRKY transcription factor 70 [Glycine soja]
Length=284

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 63/118 (53%), Gaps = 21/118 (18%)
 Frame = +3

Query  168  VISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVS----------  317
            ++  L KG++SATQL+ LL     GS  E      ELT  ++ SF++A+S          
Sbjct  2    IMKELVKGQESATQLKVLLEK-PFGS--EGSLSCQELTANVLRSFTQAISIINSSSADEV  58

Query  318  ---QLLQAADS----AVSGENPA-KARRGCYNRRKCSDTWINVSNTKEDGGAWRKYGQ  467
                LL +  +    AVSGEN + K  RG YNRRK + +W  +S T +D   WRKYGQ
Sbjct  59   AHRSLLNSGQNGSPVAVSGENRSQKGGRGRYNRRKSAVSWSILSCTTDDNHVWRKYGQ  116



>ref|XP_002319879.2| WRKY transcription factor 70 family protein [Populus trichocarpa]
 gb|EEE95802.2| WRKY transcription factor 70 family protein [Populus trichocarpa]
Length=324

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 64/139 (46%), Gaps = 29/139 (21%)
 Frame = +3

Query  135  MENPLHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAV  314
            +   L + R+RVI  L +G + A QLQ  L+    G+ +       EL  +I+ SFSE +
Sbjct  5    LSEKLSSSRERVIKELVQGHEFAAQLQIRLQK-PCGNFDGRFSSAGELVGKILRSFSETL  63

Query  315  SQLL--------------------------QAADSAVSGENPA--KARRGCYNRRKCSDT  410
            S +                           ++ DS  S + PA  K RRGCY R+K S +
Sbjct  64   SVITSSESAGGEICQNLASSLGDSACYDDRRSEDSGESKKRPATTKDRRGCYKRKKISQS  123

Query  411  WINVSNTKEDGGAWRKYGQ  467
            W  V  T ED  AWRKYGQ
Sbjct  124  WTTVCPTIEDSHAWRKYGQ  142



>ref|XP_004307738.1| PREDICTED: probable WRKY transcription factor 70-like [Fragaria 
vesca subsp. vesca]
Length=340

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 74/157 (47%), Gaps = 43/157 (27%)
 Frame = +3

Query  120  MAKPTMENPLHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGS  299
            MA   +E     H++ +++ L  G+  A +LQ+LL N   GS   S R   EL  +I+ S
Sbjct  1    MATTWLEALPAQHKRLIMNELVHGRNRARELQSLLNNRGHGST--SSRSEEELVMEIVKS  58

Query  300  FSEAVSQL-------------------------LQAADSAV------------SGENP--  362
            FSE++S L                         ++A  S V            SGE+   
Sbjct  59   FSESLSVLSESSAKFGGDDQQYSGTTGCGGGETVKAEQSHVEHSHCGDRSFEDSGESKKR  118

Query  363  --AKARRGCYNRRKCSDTWINVSNTKEDGGAWRKYGQ  467
               K RRGCY RRK S++W  VS+T EDG AWRKYGQ
Sbjct  119  PGVKDRRGCYKRRKNSESWATVSSTVEDGQAWRKYGQ  155



>ref|NP_001275414.1| WRKY transcription factor 6 [Solanum tuberosum]
 gb|ABU49725.1| WRKY transcription factor 6 [Solanum tuberosum]
Length=293

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 62/118 (53%), Gaps = 13/118 (11%)
 Frame = +3

Query  153  THRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQL---  323
            T   R I  L +G++   +L+ +++   +G  E +  +  EL  +IM SFSE +S +   
Sbjct  6    TDLNRAIEGLIRGREFTRRLKEIIKKPLVGGGEVANIMAEELVAKIMESFSETLSVINNS  65

Query  324  ---------LQAADSAVSGENPAKARRGCYNRRKCSDTWI-NVSNTKEDGGAWRKYGQ  467
                     +++ +   SG   +  RRGCY RRK S++ I   S+  +DG AWRKYGQ
Sbjct  66   DVIITTPVEVKSPEDYSSGSCKSSDRRGCYKRRKTSESNIKESSDLVDDGHAWRKYGQ  123



>gb|AIY62485.1| WRKY114 [Gossypium aridum]
Length=305

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 62/134 (46%), Gaps = 37/134 (28%)
 Frame = +3

Query  159  RKRVISVLHKGKKSATQLQTLLR------------NFSLGSQEESRRLFPELTEQIMGSF  302
            +K+V+  L +G+  A QLQ LLR               L S +E      +L ++I+ SF
Sbjct  16   KKKVVKQLVEGQDYANQLQILLRNNNNNPSQQQQTEHHLSSTKE------QLVDKILSSF  69

Query  303  SEAVS-------------------QLLQAADSAVSGENPAKARRGCYNRRKCSDTWINVS  425
            ++ +S                   QL+++ D + S     K +RGCY R++    W  VS
Sbjct  70   NQTLSELTSVNVASSHNQTGSNDDQLVKSEDCSESRRPRPKGKRGCYKRKRAEQAWTVVS  129

Query  426  NTKEDGGAWRKYGQ  467
             T +DG  WRKYGQ
Sbjct  130  ATTQDGHGWRKYGQ  143



>ref|XP_010554725.1| PREDICTED: probable WRKY transcription factor 54 [Tarenaya hassleriana]
Length=319

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/149 (32%), Positives = 65/149 (44%), Gaps = 46/149 (31%)
 Frame = +3

Query  159  RKRVISVLHKGKKSATQLQTLLRN-FSLGSQEESRRLF----------PELTEQIMGSFS  305
            + +V+  L +G + ATQLQ LL   F       + R+            EL  +I+GSF 
Sbjct  7    KGKVVEQLVQGYEFATQLQLLLSEPFGDHDPHGTTRILSGSGSSPGHVDELVAKILGSFD  66

Query  306  EAVSQL-----------LQAADSAVSGENPA------------------------KARRG  380
            E +S L           +  + +A SGE+PA                        K +RG
Sbjct  67   ETISVLGSFEPVSAAVPVDGSRNASSGESPALEAAVYDGRCEDSGHGRKRLLGVNKGKRG  126

Query  381  CYNRRKCSDTWINVSNTKEDGGAWRKYGQ  467
            CY R++ S +W   SNT ED  AWRKYGQ
Sbjct  127  CYKRKRKSQSWTLESNTLEDTHAWRKYGQ  155



>ref|NP_001237638.1| transcription factor [Glycine max]
 gb|ABY84662.1| transcription factor [Glycine max]
Length=317

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 67/144 (47%), Gaps = 48/144 (33%)
 Frame = +3

Query  153  THRKRVISVLHKGKKSATQLQTLLR-----NFSLGSQEESRRLFPELTEQIMGSFSEAVS  317
            T RKRVI  L +G+  ATQL+ LL+     + S+ ++E        L   ++ SF+E +S
Sbjct  12   TKRKRVIRELVQGRDYATQLKFLLQKPIGPDGSVSAKE--------LVANVLRSFTETLS  63

Query  318  QLLQAADSAVSGEN----------------------------------PAKARRGCYNRR  395
             +L +++ A+SG++                                   +K RRG Y RR
Sbjct  64   -VLTSSEVAISGDHHRDEVAQNLVISGEDASQVESIDPRSEGSTESKKGSKDRRGSYKRR  122

Query  396  KCSDTWINVSNTKEDGGAWRKYGQ  467
            K   TW  V+ T +D  AWRKYGQ
Sbjct  123  KTEQTWTIVAQTTDDNHAWRKYGQ  146



>ref|XP_006596397.1| PREDICTED: probable WRKY transcription factor 70-like [Glycine 
max]
Length=240

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 69/136 (51%), Gaps = 28/136 (21%)
 Frame = +3

Query  138  ENPLHTHRKRVI-SVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAV  314
            E  + T +KRVI   L KG+++ATQL+ LL      S  E+   F E+ + ++ SFSEA+
Sbjct  10   EISVSTQKKRVIIEELLKGQEAATQLKVLLLEKPFWS--EAFLSFQEVMDNVLRSFSEAL  67

Query  315  SQL-----LQAADSAV---------SGENPA-----------KARRGCYNRRKCSDTWIN  419
            S L      + A SA          SG+N +           K  RG YNRRK + +W  
Sbjct  68   SILNSSSSSEPAGSAAEVAHRSLLNSGQNGSPVAASGEKRFQKDGRGRYNRRKSAVSWTI  127

Query  420  VSNTKEDGGAWRKYGQ  467
            +S T +D   WRKYGQ
Sbjct  128  LSCTIDDNHVWRKYGQ  143



>gb|ADT82685.1| WRKY1 [Catharanthus roseus]
Length=259

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 62/125 (50%), Gaps = 19/125 (15%)
 Frame = +3

Query  150  HTHRKRVISVLHKGKKSATQLQTLLR---NFS----LGSQEESRRLFPELTEQIMGSFSE  308
            H  +K +  +L KGK+SAT+LQTLL    N S    + + E S ++F   TE +     +
Sbjct  8    HDRKKLLEEILLKGKESATKLQTLLHQKPNNSPYDVVSAAELSVQIFRSFTETLAVLGPD  67

Query  309  AVSQLLQAADSAVSGENP------------AKARRGCYNRRKCSDTWINVSNTKEDGGAW  452
             + Q++ A   A S  +              K R+G Y RR  S+T    S+T ED  AW
Sbjct  68   DIRQIVAADGMARSSSSEITDGFIRKKSAGVKYRKGSYKRRNVSETETKYSSTMEDEYAW  127

Query  453  RKYGQ  467
            RKYGQ
Sbjct  128  RKYGQ  132



>dbj|BAF95871.1| hypothetical protein [Vitis hybrid cultivar]
Length=291

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 63/122 (52%), Gaps = 32/122 (26%)
 Frame = +3

Query  180  LHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFS------------EAVSQL  323
            L +G+    QL+++L     G Q+ES +    L  +I+ SF+            EAVSQ+
Sbjct  1    LRRGRSFTKQLRSVLVG---GDQQESAQ---NLLAKILRSFTDTLSILNSGQSDEAVSQI  54

Query  324  -------------LQAADSAVSGENPAKARRGCYNRRKCSDTWINVS-NTKEDGGAWRKY  461
                          ++ +S  SG++  K RRGCY RRK S +WI ++ N  +DG AWRKY
Sbjct  55   PTSGQPYSPGWHGRRSEESCESGKSSTKDRRGCYKRRKSSQSWIRITPNFHDDGYAWRKY  114

Query  462  GQ  467
            GQ
Sbjct  115  GQ  116



>ref|XP_010525416.1| PREDICTED: probable WRKY transcription factor 70 [Tarenaya hassleriana]
Length=338

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 71/150 (47%), Gaps = 47/150 (31%)
 Frame = +3

Query  159  RKRVISVLHKGKKSATQLQTLL--RNFSLGSQEESRR--LFP--------ELTEQIMGSF  302
            +++V+  L +G + ATQLQ LL  ++F L S  +  R   FP        +L  +I+GSF
Sbjct  7    KRKVVEQLVEGYEFATQLQLLLSKKSFDLRSPHDQTRPGSFPGLGPGPADDLMLKILGSF  66

Query  303  SEAVSQL-----------LQAADSAVSGENPA------------------------KARR  377
             + +S L           ++ + +A SG++ A                        K +R
Sbjct  67   DKTISVLGSFEPLSVLPAVEGSRNASSGDSMAAITVVSDARCEDSGESRKRPSVVDKGKR  126

Query  378  GCYNRRKCSDTWINVSNTKEDGGAWRKYGQ  467
            GCY R++ S +W   SNT ED  AWRKYGQ
Sbjct  127  GCYKRKRKSQSWTVESNTLEDSHAWRKYGQ  156



>gb|ACY69975.1| WRKY transcription factor [Vitis pseudoreticulata]
Length=322

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 66/129 (51%), Gaps = 32/129 (25%)
 Frame = +3

Query  159  RKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFS-----------  305
            RKR I  L +G+    QL+++L     G Q+ES +   +L  +I+ SF+           
Sbjct  24   RKRAIDELLRGRSFTKQLRSVLVG---GDQQESAQ---DLLAKILRSFNDTLSILNSGES  77

Query  306  -EAVSQL-------------LQAADSAVSGENPAKARRGCYNRRKCSDTWINVS-NTKED  440
             E VSQ+              ++ +S  SG++  K RRGCY RRK S + I ++ N  +D
Sbjct  78   NEVVSQIPASGQLYSPGWHGRRSEESCESGKSSTKDRRGCYKRRKNSQSLIRITPNFHDD  137

Query  441  GGAWRKYGQ  467
            G AWRKYGQ
Sbjct  138  GYAWRKYGQ  146



>ref|XP_006435943.1| hypothetical protein CICLE_v10032192mg [Citrus clementina]
 ref|XP_006486150.1| PREDICTED: probable WRKY transcription factor 70-like [Citrus 
sinensis]
 gb|ESR49183.1| hypothetical protein CICLE_v10032192mg [Citrus clementina]
Length=309

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 66/141 (47%), Gaps = 40/141 (28%)
 Frame = +3

Query  153  THRKRVISVLHKGKKSATQLQTLLRN-FSLGSQEESRRLFPELTEQIMGSFSEAVSQL--  323
            T R+++   L KGKK A QLQ LL+  F    +E+      +L  +I+ SF++ +S L  
Sbjct  9    TSREKMAKELVKGKKFAHQLQVLLQKPF----EEDGLVSAEDLVVKILRSFTQTLSVLGT  64

Query  324  -----------------------------LQAADSAVSGENPAK----ARRGCYNRRKCS  404
                                          ++ DS  S + PA     ++RGCY R+K S
Sbjct  65   TVTTSCDDDHEKYQQQQANSCNVNSDDYRRRSEDSGESKKRPAAKDSVSKRGCYKRKKNS  124

Query  405  DTWINVSNTKEDGGAWRKYGQ  467
             TW  VS+T  DG AWRKYGQ
Sbjct  125  QTWTVVSSTSNDGHAWRKYGQ  145



>dbj|BAA87069.2| elicitor-induced DNA-binding protein homolog [Matricaria chamomilla]
Length=280

 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 58/118 (49%), Gaps = 26/118 (22%)
 Frame = +3

Query  171  ISVLHKGKKSATQLQTLL--RNFSLGSQEESRRLFPELTEQIMGSFSEAVSQL-------  323
            I  L KG+ S  +LQ LL  + ++ G       L  +L  +I+GSFS  +S L       
Sbjct  13   IGELIKGRDSTKKLQNLLPRKIYNDGV------LANDLVVKILGSFSNTLSTLSSLGPGE  66

Query  324  ----------LQAADSAVSGENPAKARRGCYNRRKCSDTWINVSNTKEDGGAWRKYGQ  467
                       +A DS    + P K RRGCY RRK  D+ I + +T ED  AWRKYGQ
Sbjct  67   LSPVISPCCNDRALDSDEIEKKP-KDRRGCYKRRKTEDSRIKIVDTIEDEFAWRKYGQ  123



>ref|XP_009760864.1| PREDICTED: probable WRKY transcription factor 70 [Nicotiana sylvestris]
Length=227

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 69/124 (56%), Gaps = 14/124 (11%)
 Frame = +3

Query  138  ENPLHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEA--  311
            EN   +  ++V   L++G++   +L+ +++     + + S  L  EL  +IM SFSE   
Sbjct  4    ENYTQSRLEKVTEKLNRGRELTRRLREMIKKPEARAGDGSVILTEELVGKIMSSFSETLS  63

Query  312  ---------VSQLLQAA-DSAVSGENPA-KARRGCYNRRKCSDTWINVSNT-KEDGGAWR  455
                     VSQ+L++  DS+ S +  + K RRG Y RRK  +T IN ++T  +DG AWR
Sbjct  64   ILRSNECSEVSQILKSTEDSSGSCKTSSLKDRRGHYKRRKTLETTINETSTLVDDGHAWR  123

Query  456  KYGQ  467
            KYGQ
Sbjct  124  KYGQ  127



>gb|AAF61864.1|AF193771_1 DNA-binding protein 4 [Nicotiana tabacum]
Length=227

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 69/124 (56%), Gaps = 14/124 (11%)
 Frame = +3

Query  138  ENPLHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEA--  311
            EN   +  ++V   L++G++   +L+ +++     + + S  L  EL  +IM SFSE   
Sbjct  4    ENYTQSRLEKVAEKLNRGRELTRRLREMIKKPEARAGDGSVILTEELVGKIMSSFSETLS  63

Query  312  ---------VSQLLQAA-DSAVSGENPA-KARRGCYNRRKCSDTWINVSNT-KEDGGAWR  455
                     VSQ+L++  DS+ S +  + K RRG Y RRK  +T IN ++T  +DG AWR
Sbjct  64   ILRSNECSEVSQILKSTEDSSGSCKTSSLKDRRGHYKRRKTLETTINETSTLVDDGHAWR  123

Query  456  KYGQ  467
            KYGQ
Sbjct  124  KYGQ  127



>ref|XP_010540486.1| PREDICTED: probable WRKY transcription factor 54 [Tarenaya hassleriana]
Length=294

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/142 (31%), Positives = 66/142 (46%), Gaps = 39/142 (27%)
 Frame = +3

Query  159  RKRVISVLHKGKKSATQLQTLL-RNFSLGSQEESRRL-----FPELTEQIMGSFSEAVSQ  320
            ++ V   L +G + A+QLQ LL +N   G  + +R +       EL  +I+GSF + +S 
Sbjct  7    KQEVAKQLVEGYRFASQLQILLSKNPDHGPNDLNRIVSGSGPVDELMAKILGSFDKTISV  66

Query  321  L-----------LQAADSAVSGENPA----------------------KARRGCYNRRKC  401
            L           +  + +  SG++PA                      K +RGCY R++ 
Sbjct  67   LGSFEPVSVAVPVDGSRNTSSGDSPAAAVSDGRCENSGDCRKRTLGVNKGKRGCYKRQRK  126

Query  402  SDTWINVSNTKEDGGAWRKYGQ  467
            S +W   SNT ED  AWRKYGQ
Sbjct  127  SQSWTVESNTSEDAHAWRKYGQ  148



>ref|XP_003526799.1| PREDICTED: probable WRKY transcription factor 70-like [Glycine 
max]
 gb|KHN25801.1| Putative WRKY transcription factor 70 [Glycine soja]
Length=319

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/144 (30%), Positives = 63/144 (44%), Gaps = 49/144 (34%)
 Frame = +3

Query  159  RKRVISVLHKGKKSATQLQTLLR-----NFSLGSQEESRRLFPELTEQIMGSFSEAVSQL  323
            RKRVI  L +G+  ATQL+ LL+     + S+ ++E        L   ++ SF+E +S L
Sbjct  14   RKRVIRELVQGRDYATQLKFLLQKPIGPDGSVSAKE--------LVANVLRSFAETLSVL  65

Query  324  LQAADSAVSGEN------------------------------------PAKARRGCYNRR  395
              +++ + SG +                                     +K RRG Y RR
Sbjct  66   TSSSEDSTSGHDHDDEVIAQNLVISGEDASQVASINDPSSEDSTESRKGSKDRRGSYKRR  125

Query  396  KCSDTWINVSNTKEDGGAWRKYGQ  467
            K   TW  V+ T +D  AWRKYGQ
Sbjct  126  KTEQTWTIVAQTTDDNHAWRKYGQ  149



>gb|ACU19563.1| unknown [Glycine max]
Length=319

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/144 (30%), Positives = 63/144 (44%), Gaps = 49/144 (34%)
 Frame = +3

Query  159  RKRVISVLHKGKKSATQLQTLLR-----NFSLGSQEESRRLFPELTEQIMGSFSEAVSQL  323
            RKRVI  L +G+  ATQL+ LL+     + S+ ++E        L   ++ SF+E +S L
Sbjct  14   RKRVIRELVQGRDYATQLKFLLQKPIGPDGSVSAKE--------LVANVLRSFAETLSVL  65

Query  324  LQAADSAVSGEN------------------------------------PAKARRGCYNRR  395
              +++ + SG +                                     +K RRG Y RR
Sbjct  66   TSSSEDSTSGHDHDDGVIAQNLVISGEDASQVASINDPSSEDSTESRKGSKDRRGSYKRR  125

Query  396  KCSDTWINVSNTKEDGGAWRKYGQ  467
            K   TW  V+ T +D  AWRKYGQ
Sbjct  126  KTEQTWTIVAQTTDDNHAWRKYGQ  149



>ref|XP_002520871.1| WRKY transcription factor, putative [Ricinus communis]
 gb|EEF41580.1| WRKY transcription factor, putative [Ricinus communis]
Length=314

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 69/146 (47%), Gaps = 33/146 (23%)
 Frame = +3

Query  117  LMAKPTMENPLHTHRKRVISVLHKGKKSATQLQTLLR-----NFSLGSQEESRRLFPELT  281
            +M   +  + L  +++RV   L +G++ ATQLQ LL+     N  L ++        EL 
Sbjct  1    MMGSSSSPDKLSANKERVAKELVQGQEFATQLQILLKKPYGENCFLTTEAHQY----ELL  56

Query  282  EQIMGSFSEAVS-----------QLLQA--ADSAV--------SGEN---PAKARRGCYN  389
             +I+ SF++A+S           Q L A  ADS          SGE+   P   RRGCY 
Sbjct  57   LKILASFTQALSLVTTCDSVEVCQNLAASPADSVCCDDRRSENSGESRRKPTANRRGCYR  116

Query  390  RRKCSDTWINVSNTKEDGGAWRKYGQ  467
            R+  S +W  VS    D   WRKYGQ
Sbjct  117  RKNTSLSWTTVSAAIGDAHTWRKYGQ  142



>gb|KDO67551.1| hypothetical protein CISIN_1g021598mg [Citrus sinensis]
Length=310

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 66/142 (46%), Gaps = 41/142 (29%)
 Frame = +3

Query  153  THRKRVISVLHKGKKSATQLQTLLRN-FSLGSQEESRRLFPELTEQIMGSFSEAVSQL--  323
            T R+++   L KGKK A QLQ LL+  F    +E+      +L  +I+ SF++ +S L  
Sbjct  9    TSREKMAKELVKGKKFAHQLQFLLQKPF----EEDGLVSAEDLVVKILRSFTQTLSVLGT  64

Query  324  ------------------------------LQAADSAVSGENPAK----ARRGCYNRRKC  401
                                           ++ DS  S + PA     ++RGCY R+K 
Sbjct  65   TVTTSSCDDDHEKYQQQQANSCNVNSDDYRRRSEDSGESKKRPAAKDSVSKRGCYKRKKN  124

Query  402  SDTWINVSNTKEDGGAWRKYGQ  467
            S TW  VS+T  DG AWRKYGQ
Sbjct  125  SQTWTVVSSTSNDGHAWRKYGQ  146



>ref|XP_010093537.1| putative WRKY transcription factor 70 [Morus notabilis]
 gb|EXB54244.1| putative WRKY transcription factor 70 [Morus notabilis]
Length=332

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 71/151 (47%), Gaps = 36/151 (24%)
 Frame = +3

Query  117  LMAKPTMENPLHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMG  296
            + + P  EN L + R+++I  L +G++ A +LQTLL    +G          +L  +IM 
Sbjct  1    MASSPLPENVL-SGRQKLIDELVQGREIANRLQTLLSQ-PVGDDGSLVNSAEDLVSRIME  58

Query  297  SFS------------EAVSQLLQAA---------------DSAVSGEN------PAKARR  377
            SF+            EAV   +QAA                S  SGE+        K RR
Sbjct  59   SFTNTLFMLNKNGTVEAVLSQIQAAAATSSRVDSPRLDGRKSEDSGESCRSVSTTLKDRR  118

Query  378  GCYNRRKCSDTWINVSNTK-EDGGAWRKYGQ  467
            GCY RRK + TW   ++T  +DG AWRKYGQ
Sbjct  119  GCYKRRKAAHTWQRETSTSIDDGHAWRKYGQ  149



>ref|XP_010098011.1| putative WRKY transcription factor 70 [Morus notabilis]
 gb|EXB74394.1| putative WRKY transcription factor 70 [Morus notabilis]
Length=332

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 71/151 (47%), Gaps = 36/151 (24%)
 Frame = +3

Query  117  LMAKPTMENPLHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMG  296
            + + P  EN L + R+++I  L +G++ A +LQTLL    +G          +L  +IM 
Sbjct  1    MASSPLPENVL-SGRQKLIDELVQGREIANRLQTLLSQ-PVGDDGSLVNSAEDLVSRIME  58

Query  297  SFS------------EAVSQLLQAA---------------DSAVSGEN------PAKARR  377
            SF+            EAV   +QAA                S  SGE+        K RR
Sbjct  59   SFTNTLFMLNKNGTVEAVLSQIQAAAATSSRVDSPCLDGRKSEDSGESCRSVSTTLKDRR  118

Query  378  GCYNRRKCSDTWINVSNTK-EDGGAWRKYGQ  467
            GCY RRK + TW   ++T  +DG AWRKYGQ
Sbjct  119  GCYKRRKAAHTWQRETSTSIDDGHAWRKYGQ  149



>ref|XP_003623638.1| WRKY transcription factor [Medicago truncatula]
 gb|AES79856.1| WRKY transcription factor [Medicago truncatula]
Length=283

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 63/129 (49%), Gaps = 19/129 (15%)
 Frame = +3

Query  138  ENPLHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFP---ELTEQIMGSFSE  308
            EN  H  R +V+  L +G++ A +L+ +L         +   + P   +L ++++ +F+ 
Sbjct  4    ENLAHGGRGKVVDELLRGRELANKLRNILNESGDIYNNDGSTIPPFAEDLLKEVLTTFTN  63

Query  309  AV-------------SQLLQAADSAVSG--ENPAKARRGCYNRRKCSDTWINVSNT-KED  440
            ++              QL ++ DS  S    +  K RRGCY RRK S TW   S   +ED
Sbjct  64   SLLFLNNNPTSEGSDMQLTKSEDSLESNCKSSIVKERRGCYKRRKISQTWEKESEQPEED  123

Query  441  GGAWRKYGQ  467
            G  WRKYGQ
Sbjct  124  GHQWRKYGQ  132



>ref|XP_004490521.1| PREDICTED: probable WRKY transcription factor 70-like [Cicer 
arietinum]
Length=263

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 60/116 (52%), Gaps = 12/116 (10%)
 Frame = +3

Query  141  NPLHTHRKRVI-SVLHKGKKSATQLQTLLRN-FSLGSQEESRRLFPELTEQIMGSFSEAV  314
            N L + +KRVI   L +GK++AT+L+ LL N  S G+    +     L   ++ SF++A+
Sbjct  5    NILQSVKKRVIIKELVEGKEAATKLKYLLENENSFGNLSSDK-----LAANVLSSFTKAL  59

Query  315  SQLLQAADS-----AVSGENPAKARRGCYNRRKCSDTWINVSNTKEDGGAWRKYGQ  467
            S + Q          V   N  K    CY RRK ++T   VS T  D  +WRKYGQ
Sbjct  60   SIITQHGGENGSPVVVVAGNDRKGGIRCYKRRKSAETLTMVSGTTTDIHSWRKYGQ  115



>ref|XP_002309186.2| hypothetical protein POPTR_0006s10950g [Populus trichocarpa]
 gb|EEE92709.2| hypothetical protein POPTR_0006s10950g [Populus trichocarpa]
Length=333

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 65/136 (48%), Gaps = 34/136 (25%)
 Frame = +3

Query  153  THRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQL---  323
            +HRK+VI  L +G++ A +L+ ++   S  + ++       L  +IM SF+  +S L   
Sbjct  11   SHRKKVIDELLRGQEIAKKLKFVM---SKSTGDDGSMSAENLVREIMNSFNSTLSILNGG  67

Query  324  -----------------------LQAADSAVSGENPA----KARRGCYNRRKCSDTWINV  422
                                     + DS  S ++ A    K RRGCY RR+ S +W N 
Sbjct  68   GYDDDVSQTPATTKVCSPLWDGRKSSEDSGESSKSTATVKVKDRRGCYKRRRSSHSWTNE  127

Query  423  SNT-KEDGGAWRKYGQ  467
            ++T  +DG AWRKYGQ
Sbjct  128  TSTLTDDGHAWRKYGQ  143



>ref|XP_007136415.1| hypothetical protein PHAVU_009G043100g [Phaseolus vulgaris]
 gb|ESW08409.1| hypothetical protein PHAVU_009G043100g [Phaseolus vulgaris]
Length=282

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 64/136 (47%), Gaps = 38/136 (28%)
 Frame = +3

Query  162  KRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQLLQAADS  341
            KRVI+ L  G   ATQL+ LL+N  +G   +      EL   +  SF+E +S LL ++++
Sbjct  3    KRVITELVLGLDYATQLKFLLQN-PVGP--DGSVAAKELVTNVQRSFAETLS-LLTSSEA  58

Query  342  A-----------VSGENPAKA-----------------------RRGCYNRRKCSDTWIN  419
            A           +SGE+ ++A                       RRG Y RRK   TW  
Sbjct  59   ASGEDEVAQNLVISGEDASQAASIDIRSEDSTESRKRSLPLSKDRRGSYKRRKTEQTWSI  118

Query  420  VSNTKEDGGAWRKYGQ  467
            VS T +D  AWRKYGQ
Sbjct  119  VSQTTDDNHAWRKYGQ  134



>gb|AGQ04250.1| WRKY transcription factor 56 [Jatropha curcas]
 gb|KDP21860.1| hypothetical protein JCGZ_00647 [Jatropha curcas]
Length=327

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 61/136 (45%), Gaps = 30/136 (22%)
 Frame = +3

Query  147  LHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQLL  326
            L T RK +I  L  G++ A QL+  L++ S+     S     +L  +I+ SF+ ++S   
Sbjct  9    LPTDRKSLIDELVSGREFANQLKLALKDQSINGDAGSVPA-EDLVMRIVNSFTNSLSIFS  67

Query  327  QAADSAVSGENPA----------------------------KARRGCYNRRKCSDTWI-N  419
            +  DS    + PA                            K RRGCY RRK S +W  +
Sbjct  68   RVIDSDEVSQFPASTSFGSPLWDGCRKSEESDESTKSTSRMKERRGCYKRRKTSHSWTRD  127

Query  420  VSNTKEDGGAWRKYGQ  467
              N  +DG AWRKYGQ
Sbjct  128  TPNLVDDGHAWRKYGQ  143



>emb|CDX72140.1| BnaC08g27340D [Brassica napus]
Length=276

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 56/125 (45%), Gaps = 34/125 (27%)
 Frame = +3

Query  180  LHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQL--------LQAA  335
            L +G++ AT+LQ LL    LG          +L  +I+GSF+ ++S L          + 
Sbjct  18   LVQGREVATELQQLLFQHGLGLDSAD-----DLVAKILGSFNNSISALDSLEPVSSSSSL  72

Query  336  DSAVSGE---------------------NPAKARRGCYNRRKCSDTWINVSNTKEDGGAW  452
             +AV G                       P K +RGCY R+K S+TW   S   ED  +W
Sbjct  73   VTAVEGSQNASCDNDGKLEDSGDSRKRLGPVKGKRGCYKRKKRSETWTVESTVLEDAFSW  132

Query  453  RKYGQ  467
            RKYGQ
Sbjct  133  RKYGQ  137



>gb|ACQ76810.1| WRKY transcription factor 70 [Brassica napus]
Length=276

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 56/125 (45%), Gaps = 34/125 (27%)
 Frame = +3

Query  180  LHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQL--------LQAA  335
            L +G++ AT+LQ LL    LG          +L  +I+GSF+ ++S L          + 
Sbjct  18   LVQGREVATELQQLLFQHGLGLDSAD-----DLVAKILGSFNNSISALDSLEPVSSSSSL  72

Query  336  DSAVSGEN---------------------PAKARRGCYNRRKCSDTWINVSNTKEDGGAW  452
             +AV G                       P K +RGCY R+K S+TW   S   ED  +W
Sbjct  73   VTAVEGSQNASCDNDGKLEDSGDSRKRLGPVKGKRGCYKRKKRSETWTVESTVLEDAFSW  132

Query  453  RKYGQ  467
            RKYGQ
Sbjct  133  RKYGQ  137



>gb|ACI14407.1| WRKY70-1 transcription factor [Brassica napus]
Length=275

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 56/125 (45%), Gaps = 34/125 (27%)
 Frame = +3

Query  180  LHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQL--------LQAA  335
            L +G++ AT+LQ LL    LG          +L  +I+GSF+ ++S L          + 
Sbjct  18   LVQGREVATKLQHLLFQHGLGLNSAD-----DLMAKILGSFNNSISALDSLEPISSSSSL  72

Query  336  DSAVSGE---------------------NPAKARRGCYNRRKCSDTWINVSNTKEDGGAW  452
             +AV G                       P K +RGCY R+K S+TW   S   +D  +W
Sbjct  73   VTAVEGSQNASCDNDGKLEDSGDSRKRLGPVKGKRGCYKRKKRSETWTVESTVLDDAFSW  132

Query  453  RKYGQ  467
            RKYGQ
Sbjct  133  RKYGQ  137



>gb|AIE43837.1| WRKY transcription factor 106 [Gossypium hirsutum]
Length=305

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 60/125 (48%), Gaps = 25/125 (20%)
 Frame = +3

Query  168  VISVLHKGKKSATQLQTLLRN--FSLGSQEESRRLF----PELTEQIMGSFSEAVS----  317
            VI  L +G+  A QLQ LL N  ++   Q+++         +L ++I+ SF++ ++    
Sbjct  19   VIKQLVEGQDYANQLQILLNNNNYNPSQQQQTEHHLSSTKDQLVDKILSSFNQTLAELTS  78

Query  318  ---------------QLLQAADSAVSGENPAKARRGCYNRRKCSDTWINVSNTKEDGGAW  452
                           QL+++ D + S     K +RGCY R++       VS+T +DG  W
Sbjct  79   VNVSSSHNQTGSNDDQLVKSEDCSESRRPRPKGKRGCYKRKRAEQARTVVSDTTQDGHGW  138

Query  453  RKYGQ  467
            RKYG 
Sbjct  139  RKYGH  143



>ref|XP_003623634.1| WRKY transcription factor [Medicago truncatula]
 gb|AES79852.1| WRKY transcription factor [Medicago truncatula]
Length=294

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 60/122 (49%), Gaps = 19/122 (16%)
 Frame = +3

Query  159  RKRVISVLHKGKKSATQLQTLL-RNFSLGSQEESRRLFPE-LTEQIMGSFSEAV------  314
            R +VI  L +G++ A QL+ +L  +        S   F E L ++++ +F+ ++      
Sbjct  12   RGKVIDELRRGRELANQLKNILNESGDFDDINGSTTPFAEDLLKEVLTTFTNSLLFLNNN  71

Query  315  -------SQLLQAADSAVSG---ENPAKARRGCYNRRKCSDTWINVSNT-KEDGGAWRKY  461
                    QL ++ DS  S     +  K RRGCY RRK S TW   S+   EDG  WRKY
Sbjct  72   PTSEGSDMQLTKSEDSLESNCKSTSIVKERRGCYKRRKVSQTWEKESDRPVEDGHQWRKY  131

Query  462  GQ  467
            GQ
Sbjct  132  GQ  133



>ref|NP_001288821.1| probable WRKY transcription factor 70 [Brassica rapa]
 gb|AHB33862.1| WRKY transcription factor 67 [Brassica rapa]
 emb|CDY27218.1| BnaA09g35840D [Brassica napus]
Length=276

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 56/125 (45%), Gaps = 34/125 (27%)
 Frame = +3

Query  180  LHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQL--------LQAA  335
            L +G++ AT+LQ LL    LG          +L  +I+GSF+ ++S L          + 
Sbjct  18   LVQGREVATKLQHLLFQHGLGLNSAD-----DLMAKILGSFNNSISALDSLEPISSSSSL  72

Query  336  DSAVSGE---------------------NPAKARRGCYNRRKCSDTWINVSNTKEDGGAW  452
             +AV G                       P K +RGCY R+K S+TW   S   +D  +W
Sbjct  73   VTAVEGSQNASCDNDGKLEDSGDSRKRLGPVKGKRGCYKRKKRSETWTVESTVLDDAFSW  132

Query  453  RKYGQ  467
            RKYGQ
Sbjct  133  RKYGQ  137



>ref|NP_001266272.1| uncharacterized protein LOC101259967 [Solanum lycopersicum]
 gb|ADZ15316.1| WRKY3 [Solanum lycopersicum]
Length=291

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 59/115 (51%), Gaps = 18/115 (16%)
 Frame = +3

Query  165  RVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQLLQAADSA  344
            R I  L +G++   +L+ +++   +   E    +  +L  +I+ SFSE +S ++  +D  
Sbjct  10   RAIEGLIRGREFTRRLKQIIK---ISGGEVENIMAEDLVAKILDSFSETLS-VINNSDVV  65

Query  345  V-------------SGENPAKARRGCYNRRKCSDTWI-NVSNTKEDGGAWRKYGQ  467
            V             SG   +  RRGCY RRK S++ I   S+  +DG AWRKYGQ
Sbjct  66   VATAVEVKSPEDYSSGSCKSSDRRGCYKRRKTSESDIKESSDLVDDGHAWRKYGQ  120



>ref|XP_009597703.1| PREDICTED: probable WRKY transcription factor 70 [Nicotiana tomentosiformis]
Length=321

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 65/139 (47%), Gaps = 43/139 (31%)
 Frame = +3

Query  135  MENPL----HTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSF  302
            ME+PL        KR I  L +G++   QL+ +++      +  +  +  +L  +IM SF
Sbjct  1    MESPLPEKSSADLKRAIDGLIRGQEFTRQLKEIIK------KPLATIMAEDLVGKIMNSF  54

Query  303  SEAVSQLLQAADSAVSGENPA------------------KARRGCYNRRKCSDTWINVSN  428
            SE +S +    +S  S E+ A                  K RRGCY RRK S+T     N
Sbjct  55   SETLSVI----NSGESNEDTAEVKSPEDSSGSCKSTTSLKDRRGCYKRRKTSET-----N  105

Query  429  TKE------DGGAWRKYGQ  467
            TKE      DG AWRKYGQ
Sbjct  106  TKESSDLVDDGHAWRKYGQ  124



>ref|XP_011001689.1| PREDICTED: probable WRKY transcription factor 70 [Populus euphratica]
Length=319

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 64/132 (48%), Gaps = 33/132 (25%)
 Frame = +3

Query  159  RKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPE-LTEQIM------------GS  299
            RK+ I  L +G++ A QL+ L+ N S+G  E    LF E L ++IM            G 
Sbjct  13   RKKAIDELVRGQEIAAQLK-LVMNKSVGVDES---LFAEDLVKKIMNSFNSSLYLLNGGE  68

Query  300  FSEAVSQLLQAA-----------DSAVSGENPA----KARRGCYNRRKCSDT-WINVSNT  431
            F E  SQ+ Q             DS  SG+  A    K RRGCY RRK S +   + +  
Sbjct  69   FDEVASQIPQVGSPCWDGRKSSKDSGESGKGTAGLKVKDRRGCYKRRKSSHSRTDDSTTL  128

Query  432  KEDGGAWRKYGQ  467
             +DG AWRKYGQ
Sbjct  129  TDDGHAWRKYGQ  140



>ref|XP_009793854.1| PREDICTED: probable WRKY transcription factor 70 [Nicotiana sylvestris]
Length=323

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 47/140 (34%), Positives = 65/140 (46%), Gaps = 44/140 (31%)
 Frame = +3

Query  135  MENPL----HTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSF  302
            ME+PL        KR I  L +G++   QL+ +++      +  +  +  +L  +IM SF
Sbjct  1    MESPLPEKSSADLKRAIDGLIRGQEFTRQLKEIIK------KPLATIMAEDLVGKIMNSF  54

Query  303  SEAVSQLLQAADSAVSGENPA-------------------KARRGCYNRRKCSDTWINVS  425
            SE +S +    +S  S E+ A                   K RRGCY RRK S+T     
Sbjct  55   SETLSVI----NSGESDEDTAEVKSPEDSSGSCKSTTTSFKDRRGCYKRRKTSET-----  105

Query  426  NTKE------DGGAWRKYGQ  467
            NTKE      DG AWRKYGQ
Sbjct  106  NTKESSDLVDDGHAWRKYGQ  125



>ref|XP_002878082.1| WRKY DNA-binding protein 70 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54341.1| WRKY DNA-binding protein 70 [Arabidopsis lyrata subsp. lyrata]
Length=298

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 62/132 (47%), Gaps = 38/132 (29%)
 Frame = +3

Query  165  RVISVLHKGKKSATQLQTLLR--NFSLGSQEESRRLFPELTEQIMGSFSEAVSQL-----  323
            +V++ L +G +  TQLQ L+      LG  E+       L  +I+GSF+ ++S L     
Sbjct  10   KVMNQLVEGHELTTQLQQLVSQPGSGLGPAED-------LVAKILGSFNNSISILDTFEP  62

Query  324  -------LQAADSAV------------SGEN-----PAKARRGCYNRRKCSDTWINVSNT  431
                   L A + +             SG++     P K +RGCY R+K S+TW   S  
Sbjct  63   ISSSFSSLAAVEGSQNASCDNDGKFEDSGDSRKRLGPVKGKRGCYKRKKRSETWTKESTI  122

Query  432  KEDGGAWRKYGQ  467
             ED  +WRKYGQ
Sbjct  123  LEDAFSWRKYGQ  134



>emb|CDX75992.1| BnaA04g02560D [Brassica napus]
Length=285

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 57/128 (45%), Gaps = 32/128 (25%)
 Frame = +3

Query  165  RVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQL-------  323
            +V+  L +G + AT+LQ LL     G     R    +L  +I  SFS+ +S L       
Sbjct  13   KVMDQLVQGHELATKLQQLLSQHGSG-----RGAAGDLVAKISASFSDTISDLDSFEPIP  67

Query  324  ------LQAADSAVSGEN--------------PAKARRGCYNRRKCSDTWINVSNTKEDG  443
                  ++ + +A    +              P K +RGCY R+K +DTW   S   ED 
Sbjct  68   SSLFTAVEGSQNASCNNDGKLEDSVDSRKRFGPVKGKRGCYKRKKRADTWTVESTLLEDA  127

Query  444  GAWRKYGQ  467
             +WRKYG+
Sbjct  128  FSWRKYGK  135



>ref|XP_009139102.1| PREDICTED: probable WRKY transcription factor 70 [Brassica rapa]
Length=285

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 57/128 (45%), Gaps = 32/128 (25%)
 Frame = +3

Query  165  RVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQL-------  323
            +V+  L +G + AT+LQ LL     G     R    +L  +I  SFS+ +S L       
Sbjct  13   KVMDQLVQGHELATKLQQLLSQHGSG-----RGAAGDLVAKISASFSDTISALDSFEPIP  67

Query  324  ------LQAADSAVSGEN--------------PAKARRGCYNRRKCSDTWINVSNTKEDG  443
                  ++ + +A    +              P K +RGCY R+K +DTW   S   ED 
Sbjct  68   SSLFTAVEGSQNASCNNDGKLEDSVDSRKRLGPVKGKRGCYKRKKRADTWTVESTLLEDA  127

Query  444  GAWRKYGQ  467
             +WRKYG+
Sbjct  128  FSWRKYGK  135



>ref|XP_002528697.1| WRKY transcription factor, putative [Ricinus communis]
 gb|EEF33686.1| WRKY transcription factor, putative [Ricinus communis]
Length=330

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 64/132 (48%), Gaps = 35/132 (27%)
 Frame = +3

Query  159  RKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFP--ELTEQIMGSFSEAVSQLLQA  332
            ++R I  L +G++ A QL+ +L      S+++     P  +L  +I+ SF+ ++S +L  
Sbjct  13   QRRAIGELIRGRELARQLKIVL-----NSRDDMEEHVPVDDLVMKILNSFTNSLS-ILNR  66

Query  333  ADSAV---------------------SGEN-----PAKARRGCYNRRKCSDTWI-NVSNT  431
             DS +                     SGE+       K RRGCY RRK S+  I   S+ 
Sbjct  67   FDSDIEFPPSTHVGSPCWDSGRKSEDSGESIRSTSTNKDRRGCYKRRKISNALIRETSDL  126

Query  432  KEDGGAWRKYGQ  467
             +DG AWRKYGQ
Sbjct  127  IDDGHAWRKYGQ  138



>ref|XP_007141318.1| hypothetical protein PHAVU_008G185800g [Phaseolus vulgaris]
 gb|ESW13312.1| hypothetical protein PHAVU_008G185800g [Phaseolus vulgaris]
Length=256

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 63/140 (45%), Gaps = 45/140 (32%)
 Frame = +3

Query  159  RKRVISVLHKGKKSATQLQTLLRN-----FSLGSQEESRRLFPELTEQIMGSFSEAVSQL  323
            ++ ++  L KG+++ATQL+ LL N      SL S          L  +++ SF++A+S +
Sbjct  17   KRAIMEELVKGQEAATQLRVLLHNPFETDLSLSSHH--------LIAKVLTSFTQALSVI  68

Query  324  ------------LQAADSAVSGEN--------------------PAKARRGCYNRRKCSD  407
                        L   +  +SGEN                      K  RG Y+RRK + 
Sbjct  69   NSSPLLPGSADGLGYQNLLLSGENGWSVPRSSNCPTSGDCSEKRSQKGGRGRYSRRKSAL  128

Query  408  TWINVSNTKEDGGAWRKYGQ  467
            TW  +S T +D  AWRKYGQ
Sbjct  129  TWTKLSCTTDDNHAWRKYGQ  148



>ref|NP_001288847.1| probable WRKY transcription factor 70 [Brassica rapa]
 gb|AHB33865.1| WRKY transcription factor 70 [Brassica rapa]
 emb|CDX67645.1| BnaA07g16850D [Brassica napus]
Length=283

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/135 (30%), Positives = 60/135 (44%), Gaps = 37/135 (27%)
 Frame = +3

Query  153  THRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFP--ELTEQIMGSFSEAVSQLL  326
            T + +++  L +G +  T++Q LL        +    L P  +L E+I+GS ++ +S L 
Sbjct  9    TIKLKIMDQLLQGHEMTTKVQQLLS-------QHGSDLGPAKDLVEKILGSINDTISSLD  61

Query  327  Q-------AADSAVSGEN---------------------PAKARRGCYNRRKCSDTWINV  422
                    A  +AV G                       P K +RGCY R+K S+TW   
Sbjct  62   SFEPISPSALVTAVEGSQNASCDNDGKLEDSGDSHKKLGPVKGKRGCYKRKKKSETWTVE  121

Query  423  SNTKEDGGAWRKYGQ  467
            S   ED  +WRKYGQ
Sbjct  122  STLLEDTFSWRKYGQ  136



>ref|XP_008788525.1| PREDICTED: probable WRKY transcription factor 70 [Phoenix dactylifera]
Length=334

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 61/137 (45%), Gaps = 22/137 (16%)
 Frame = +3

Query  120  MAKPTMENPLHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRR-LFPELTEQIMG  296
            MA    EN    HR+    VL+KGK++A +++ LL+  S  S++  +  +   L E+I+ 
Sbjct  18   MASLEQENSPLIHRRTATQVLNKGKEAANKIKCLLQE-SFPSEDHGKNSMIGFLNEEILD  76

Query  297  SFSEAVSQLL-------------------QAADSAVSGENPAKARRGCYNRRKCSDTWIN  419
            SFSEA+  L                    Q +D +         RR  Y RR        
Sbjct  77   SFSEALIILTSEGAPETPLDQASTPCSDEQGSDHSSKKRKVQSGRRNGYRRRAHPYASTR  136

Query  420  V-SNTKEDGGAWRKYGQ  467
            V S T +DG  WRKYGQ
Sbjct  137  VLSKTMDDGRTWRKYGQ  153



>ref|XP_010931380.1| PREDICTED: probable WRKY transcription factor 67 [Elaeis guineensis]
Length=312

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 61/125 (49%), Gaps = 24/125 (19%)
 Frame = +3

Query  159  RKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPEL-TEQIMGSFSEA--------  311
            RK++   L KG++SAT+L+ LL+  S  S++ ++    EL  E+I+GSFS A        
Sbjct  13   RKKLTGELMKGQESATKLKILLQE-SFSSEDHAKNSMVELFIEEILGSFSRAFTILNSGK  71

Query  312  -----VSQLLQAADSAVSGENPAKAR------RGCYNRRK--CSDTWINVSNTKEDGGAW  452
                 V Q           +N +K R      R  Y RR    S T I +S T EDG  W
Sbjct  72   APEAPVDQATTPCSEEQESQNSSKKRKIQSSPRTGYRRRANLYSSTRI-LSETMEDGRTW  130

Query  453  RKYGQ  467
            RKYGQ
Sbjct  131  RKYGQ  135



>ref|XP_002323675.1| hypothetical protein POPTR_0016s14490g [Populus trichocarpa]
 gb|EEF05436.1| hypothetical protein POPTR_0016s14490g [Populus trichocarpa]
Length=321

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 64/133 (48%), Gaps = 33/133 (25%)
 Frame = +3

Query  156  HRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPE-LTEQIM------------G  296
            +RK+ I  L +G++ A QL+ L+ N S+G  E    +F E L ++IM            G
Sbjct  12   NRKKAIDELVRGQEIAAQLK-LVMNKSIGVDES---VFAEDLVKKIMNSFNSSLYILNGG  67

Query  297  SFSEAVSQLLQAA-----------DSAVSGENPA----KARRGCYNRRKCSDT-WINVSN  428
             F E  SQ+ Q             DS  SG   A    K RRGCY RRK S +   + + 
Sbjct  68   EFDEVASQIPQVGSPCWDGRKSSKDSGESGRGTAELKVKDRRGCYKRRKSSHSRTDDSTT  127

Query  429  TKEDGGAWRKYGQ  467
              +DG AWRKYGQ
Sbjct  128  LTDDGHAWRKYGQ  140



>gb|AFK41801.1| unknown [Medicago truncatula]
Length=155

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 56/120 (47%), Gaps = 31/120 (26%)
 Frame = +3

Query  186  KGKKSATQLQTLLRN--FSLGSQEESRRLFPELTEQIMGSFSEAVSQL------------  323
            +GK+ ATQL+ LL+N   S GS         EL   ++ SFSE +S +            
Sbjct  23   QGKEYATQLKLLLKNPVCSDGSPS-----VKELVTNVLRSFSETISVMNSTEDCSLDVND  77

Query  324  ---------LQAADSAVSGEN---PAKARRGCYNRRKCSDTWINVSNTKEDGGAWRKYGQ  467
                     L++ D++ S +      K RRG Y RRK  +T   VS T  D  +WRKYGQ
Sbjct  78   SGSLVEADDLKSEDTSESKKRLSPTTKDRRGSYKRRKTDETRTIVSKTIGDTHSWRKYGQ  137



>gb|KHN40637.1| Putative WRKY transcription factor 70 [Glycine soja]
Length=299

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 63/137 (46%), Gaps = 30/137 (22%)
 Frame = +3

Query  135  MENPLHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQ----IMGSF  302
            M N   + R++ I  L +G+  A QL++++     GS E+     P   EQ    ++ SF
Sbjct  1    MANLGCSSRRKAIEELLRGRDCAKQLRSVIN----GSCEDGSSTTPSFAEQLVKEVLMSF  56

Query  303  SEAVS----------------QLLQAADSAVSGENPAKA-----RRGCYNRRKCSDTWIN  419
            + ++S                Q+ ++  S  S E+  K+     RRGCY RR+   TW  
Sbjct  57   TNSLSFLKNNPTSESHDVSNVQVCESPKSEDSQESNCKSSTIKERRGCYKRRRTEQTWEK  116

Query  420  VSNT-KEDGGAWRKYGQ  467
             S    +DG  WRKYGQ
Sbjct  117  ESEAPIDDGHQWRKYGQ  133



>gb|ACU24049.1| unknown [Glycine max]
Length=299

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 60/129 (47%), Gaps = 30/129 (23%)
 Frame = +3

Query  159  RKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQ----IMGSFSEAVS---  317
            R++ I  L +G+  A QL++++     GS E+     P   EQ    ++ SF+ ++S   
Sbjct  9    RRKAIEELLRGRDCAKQLRSVIN----GSCEDGSSTTPSFAEQLVKEVLMSFTNSLSFLK  64

Query  318  -------------QLLQAADSAVSGENPAKA-----RRGCYNRRKCSDTWINVSNT-KED  440
                         Q+ ++  S  S E+  K+     RRGCY RR+   TW   S    +D
Sbjct  65   NNPTSESHDVSNVQVCESPKSEDSQESNCKSSIIKERRGCYKRRRTEQTWEKESEAPIDD  124

Query  441  GGAWRKYGQ  467
            G  WRKYGQ
Sbjct  125  GHQWRKYGQ  133



>ref|NP_001237619.1| transcription factor [Glycine max]
 gb|ABY84661.1| transcription factor [Glycine max]
Length=299

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 60/129 (47%), Gaps = 30/129 (23%)
 Frame = +3

Query  159  RKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQ----IMGSFSEAVS---  317
            R++ I  L +G+  A QL++++     GS E+     P   EQ    ++ SF+ ++S   
Sbjct  9    RRKAIEELLRGRDCAKQLRSVIN----GSCEDGSSTTPSFAEQLVKEVLMSFTNSLSFLK  64

Query  318  -------------QLLQAADSAVSGENPAKA-----RRGCYNRRKCSDTWINVSNT-KED  440
                         Q+ ++  S  S E+  K+     RRGCY RR+   TW   S    +D
Sbjct  65   NNPTSESHDVSNVQVCESPKSEDSQESNCKSSIIKERRGCYKRRRTEQTWEKESEAPIDD  124

Query  441  GGAWRKYGQ  467
            G  WRKYGQ
Sbjct  125  GHQWRKYGQ  133



>ref|XP_010103666.1| putative WRKY transcription factor 70 [Morus notabilis]
 gb|EXB96549.1| putative WRKY transcription factor 70 [Morus notabilis]
Length=360

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +3

Query  366  KARRGCYNRRKCSDTWINVSNTKEDGGAWRKYGQ  467
            K RRGCY RRK S +W  ++   EDG AWRKYGQ
Sbjct  109  KDRRGCYKRRKSSQSWTKITANLEDGQAWRKYGQ  142



>emb|CDY66845.1| BnaCnng52600D [Brassica napus]
Length=287

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 55/128 (43%), Gaps = 32/128 (25%)
 Frame = +3

Query  165  RVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQLL------  326
            +V+  L +G + AT+LQ LL     G     R    +L  +I  SFS+ +S L       
Sbjct  13   KVMDQLVQGHELATKLQKLLSQHGSG-----RGPAEDLVAKISASFSDTISALDSFEPIP  67

Query  327  ----------QAADSAVSGE-----------NPAKARRGCYNRRKCSDTWINVSNTKEDG  443
                      Q A     G+            P K +RGCY R+K +D+W   S   ED 
Sbjct  68   SYLFTAVEGSQNASCTNDGKLEDSVDSRKRLGPVKGKRGCYKRKKRADSWTVESTLLEDA  127

Query  444  GAWRKYGQ  467
             +WRKYG+
Sbjct  128  FSWRKYGK  135



>ref|XP_004502820.1| PREDICTED: probable WRKY transcription factor 70-like [Cicer 
arietinum]
Length=314

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 61/130 (47%), Gaps = 32/130 (25%)
 Frame = +3

Query  159  RKRVISVLHKGKKSATQLQTLLRN--FSLGSQEESRRLFPELTEQIMGSFSE-------A  311
            RK ++  L +GK+ ATQL+ LL+N   S GS         EL   ++ SFS        +
Sbjct  9    RKLLVKELLQGKEYATQLKFLLKNPIASHGSPS-----VKELMTNVLRSFSHTXXXXXLS  63

Query  312  VSQLLQAADSAV--SGEN----------------PAKARRGCYNRRKCSDTWINVSNTKE  437
            V    Q + SAV  SGE+                  K RRG Y RRK  +T   VS T +
Sbjct  64   VINSSQPSSSAVNYSGEDFRSEDSSESRKRLLPTTTKDRRGSYKRRKSEETRNIVSQTTD  123

Query  438  DGGAWRKYGQ  467
            D  +WRKYGQ
Sbjct  124  DIHSWRKYGQ  133



>emb|CDY32013.1| BnaC06g15910D [Brassica napus]
Length=283

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 46/93 (49%), Gaps = 28/93 (30%)
 Frame = +3

Query  273  ELTEQIMGSFSEAVSQL-----------LQAADSAV------------SGEN-----PAK  368
            +L E+I+GS S+ +S L           + AA+ +             SG++     P K
Sbjct  44   DLVEKILGSISDTISALDSFEPISPSYLVTAAEGSQNASCDNDGKLEDSGDSQKRLGPVK  103

Query  369  ARRGCYNRRKCSDTWINVSNTKEDGGAWRKYGQ  467
             +RGCY R+K S+TW   S   ED  +WRKYGQ
Sbjct  104  GKRGCYKRKKKSETWTVESTVLEDTFSWRKYGQ  136



>ref|XP_007033512.1| WRKY DNA-binding protein 70, putative isoform 1 [Theobroma cacao]
 gb|EOY04438.1| WRKY DNA-binding protein 70, putative isoform 1 [Theobroma cacao]
Length=285

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 60/133 (45%), Gaps = 38/133 (29%)
 Frame = +3

Query  159  RKRVISVLHKGKKSATQLQTLL-RNFS----LGSQEESRRLFPELTEQIMGSFSEAVSQL  323
            R++ I  L +G+    QL+ LL ++F     LGS++        L  +I+ SF+  +S L
Sbjct  5    RRKAIEELARGRDLTNQLRDLLTKSFGDDGLLGSED--------LVTKILNSFANTLSIL  56

Query  324  LQAA-DSAVSGENP-----------------------AKARRGCYNRRKCSDTWINVSNT  431
              ++ D     +NP                        K RRGCY RRK   +W   S T
Sbjct  57   RSSSGDYDEVSQNPRNSNMSWDGRKSEESGESIKSSTQKDRRGCYKRRKSEHSWTRDSPT  116

Query  432  -KEDGGAWRKYGQ  467
              +DG AWRKYGQ
Sbjct  117  LIDDGHAWRKYGQ  129



>ref|XP_010922757.1| PREDICTED: probable WRKY transcription factor 70 [Elaeis guineensis]
Length=323

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 52/122 (43%), Gaps = 20/122 (16%)
 Frame = +3

Query  162  KRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQL------  323
            K    VL KGK+SA +LQ+LL+  S         +     E+I+GSF  A++ L      
Sbjct  24   KTATRVLIKGKESAIKLQSLLQESSPSEDHGKNSMIGFFIEEILGSFDGALATLDSVGAP  83

Query  324  -------------LQAADSAVSGENPAKARRGCYNRRKCSDTWINVSN-TKEDGGAWRKY  461
                          Q  D +      A  RR  Y RR    +   VS+ T +DG  WRKY
Sbjct  84   ETHLDQASTPCSDEQGRDDSSKKRKVASVRRNGYRRRAHPYSCRRVSSKTMDDGYTWRKY  143

Query  462  GQ  467
            GQ
Sbjct  144  GQ  145



>gb|KEH35529.1| WRKY family transcription factor [Medicago truncatula]
Length=310

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 55/118 (47%), Gaps = 27/118 (23%)
 Frame = +3

Query  186  KGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQL--------------  323
            +GK+ ATQL+ LL+N        S +   EL   ++ SFSE +S +              
Sbjct  23   QGKEYATQLKLLLKNPVCSDGSPSVK---ELVTNVLRSFSETISVMNSTEDCSLDVNDSG  79

Query  324  -------LQAADSAVSGEN---PAKARRGCYNRRKCSDTWINVSNTKEDGGAWRKYGQ  467
                   L++ D++ S +      K RRG Y RRK  +T   VS T  D  +WRKYGQ
Sbjct  80   SLVEADDLKSEDTSESKKRLSPTTKDRRGSYKRRKTDETRTIVSKTIGDTHSWRKYGQ  137



>ref|XP_006402991.1| hypothetical protein EUTSA_v10006146mg [Eutrema salsugineum]
 gb|ESQ44444.1| hypothetical protein EUTSA_v10006146mg [Eutrema salsugineum]
Length=280

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 36/66 (55%), Gaps = 2/66 (3%)
 Frame = +3

Query  276  LTEQIMGSFSEAVSQLLQAADSAVSGE--NPAKARRGCYNRRKCSDTWINVSNTKEDGGA  449
            L   + GS + +    ++  DS  S +   P K +RGCY R+K S+TW   S   ED  +
Sbjct  69   LVTAVEGSQNASCDNDVKLEDSGDSRKRLGPVKGKRGCYKRKKRSETWTVESTNLEDAYS  128

Query  450  WRKYGQ  467
            WRKYGQ
Sbjct  129  WRKYGQ  134



>emb|CDY23883.1| BnaC04g01540D [Brassica napus]
Length=339

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 59/141 (42%), Gaps = 39/141 (28%)
 Frame = +3

Query  159  RKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLF-------PELTEQIMGSFSEAVS  317
            +++V+  L +G + ATQLQ LL +          R+         EL  +I+ SF + +S
Sbjct  12   KRKVVDQLVQGYEFATQLQLLLSHQHSSQYISQTRIVSGDLDPVDELIAKILSSFHKTIS  71

Query  318  QLLQAADS---AVSGE---------------------------NPAKARRGCYNRRKCSD  407
             +L + DS   AV G                               K +RGCY R+K   
Sbjct  72   -VLDSCDSVPMAVEGSPNASRGDDLAAPVSCNGGDSGDSRKRLGVGKGKRGCYTRKKRWH  130

Query  408  TW-INVSNTKEDGGAWRKYGQ  467
            TW +  S   ED  AWRKYGQ
Sbjct  131  TWTVEASRIDEDKYAWRKYGQ  151



>ref|XP_009142707.1| PREDICTED: probable WRKY transcription factor 54 [Brassica rapa]
Length=339

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 61/141 (43%), Gaps = 39/141 (28%)
 Frame = +3

Query  159  RKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLF-------PELTEQIMGSFSEAVS  317
            +++V+  L +G + ATQLQ LL +          R+         EL  +I+ SF + +S
Sbjct  12   KRKVVDQLVQGYEFATQLQLLLSHQHSSQYISQTRIVSGDLDPVDELIAKILSSFHKTIS  71

Query  318  QLLQAADS----------AVSGENPA--------------------KARRGCYNRRKCSD  407
             +L + DS          A  G++ A                    K +RGCY R+K   
Sbjct  72   -VLDSCDSVPMAVKGSPNASRGDDLAAPVSCNGGDSGDSRKRLGVGKGKRGCYTRKKRWH  130

Query  408  TW-INVSNTKEDGGAWRKYGQ  467
            TW +  S   ED  AWRKYGQ
Sbjct  131  TWTVEASRIDEDKYAWRKYGQ  151



>ref|XP_008442314.1| PREDICTED: probable WRKY transcription factor 70 [Cucumis melo]
Length=295

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 54/128 (42%), Gaps = 32/128 (25%)
 Frame = +3

Query  159  RKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQLLQAAD  338
            R++    L +G++ A QL+  L+  S  + ++       L  +I+ SFS+ +S L    D
Sbjct  13   RRKAADELLRGRELAQQLRAYLQRSSTPASQD-------LLTRILSSFSKTLSILNHRCD  65

Query  339  S------------------------AVSGENPAKARRGCYNRRKCSDTWI-NVSNTKEDG  443
            S                        +     P   RRGCY RRK   +W     +  +DG
Sbjct  66   SDDINGSIVDSPEDHGSRKSEESGDSCKSSTPNNDRRGCYKRRKSCQSWARETCSLVDDG  125

Query  444  GAWRKYGQ  467
             AWRKYGQ
Sbjct  126  HAWRKYGQ  133



>ref|XP_010921156.1| PREDICTED: probable WRKY transcription factor 70 [Elaeis guineensis]
Length=291

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 66/129 (51%), Gaps = 22/129 (17%)
 Frame = +3

Query  120  MAKPTMENPLHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGS  299
            M  P+  NPL    +  I  L KG+++A +L+ LL+  +LG+         E  +++  S
Sbjct  1    MTSPSQGNPL---TQAAIGQLIKGQEAAARLEVLLQETTLGNSA------IEAFKEVWDS  51

Query  300  FSEAVSQL-----LQAA-DSAVSG------ENPAKARRGCYNRR-KCSDTWINVSNTKED  440
            FS ++S L     L+   D A++G       +P + +RG   RR + +   + +S T +D
Sbjct  52   FSRSISLLDSGKPLETGQDPAITGVSKKRKTSPGEVKRGASRRRSQPTSLRMVLSKTLDD  111

Query  441  GGAWRKYGQ  467
            G  WRKYGQ
Sbjct  112  GYTWRKYGQ  120



>gb|EEC78982.1| hypothetical protein OsI_19468 [Oryza sativa Indica Group]
 gb|ACX37125.1| WRKY-type transcription factor 45-2 [Oryza sativa Indica Group]
 gb|ACX37126.1| WRKY-type transcription factor 45-2 [Oryza sativa Indica Group]
 gb|ACX37127.1| WRKY-type transcription factor 45-2 [Oryza sativa Indica Group]
Length=322

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 55/123 (45%), Gaps = 31/123 (25%)
 Frame = +3

Query  165  RVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQLLQAADSA  344
            +V+  + KGK+ A QLQ LLR+    S E  R       +QI+ +FS A+  L +AA SA
Sbjct  15   QVMEDMEKGKELAAQLQGLLRD----SPEAGR-----FVDQILHTFSRAMRALDKAAVSA  65

Query  345  VSGEN---------------------PAKARRG-CYNRRKCSDTWINVSNTKEDGGAWRK  458
              GE                      PA  R+  C  R + S     V    +DG AWRK
Sbjct  66   AGGEGSEVQSEVTCGGGASAGGKRKAPAANRKANCRRRTQQSSGNTVVVKNLDDGQAWRK  125

Query  459  YGQ  467
            YGQ
Sbjct  126  YGQ  128



>tpg|DAA05110.1| TPA_exp: WRKY transcription factor 45 [Oryza sativa (indica cultivar-group)]
 gb|ABC02809.1| WRKY transcription factor 45 [Oryza sativa]
Length=318

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 55/123 (45%), Gaps = 31/123 (25%)
 Frame = +3

Query  165  RVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQLLQAADSA  344
            +V+  + KGK+ A QLQ LLR+    S E  R       +QI+ +FS A+  L +AA SA
Sbjct  11   QVMEDMEKGKELAAQLQGLLRD----SPEAGR-----FVDQILHTFSRAMRALDKAAVSA  61

Query  345  VSGEN---------------------PAKARRG-CYNRRKCSDTWINVSNTKEDGGAWRK  458
              GE                      PA  R+  C  R + S     V    +DG AWRK
Sbjct  62   AGGEGSEVQSEVTCGGGASAGGKRKAPAANRKANCRRRTQQSSGNTVVVKNLDDGQAWRK  121

Query  459  YGQ  467
            YGQ
Sbjct  122  YGQ  124



>gb|AHB33851.1| WRKY transcription factor 54 [Brassica rapa]
Length=297

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 61/141 (43%), Gaps = 39/141 (28%)
 Frame = +3

Query  159  RKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLF-------PELTEQIMGSFSEAVS  317
            +++V+  L +G + ATQLQ LL +          R+         EL  +I+ SF + +S
Sbjct  12   KRKVVDQLVQGYEFATQLQLLLSHQHSSQYISQTRIVSGDLDPVDELIAKILSSFHKTIS  71

Query  318  QLLQAADS----------AVSGENPA--------------------KARRGCYNRRKCSD  407
             +L + DS          A  G++ A                    K +RGCY R+K   
Sbjct  72   -VLDSCDSVPMAVKGSPNASRGDDLAAPVSCNGGDSGDSRKRLGVGKGKRGCYTRKKRWH  130

Query  408  TW-INVSNTKEDGGAWRKYGQ  467
            TW +  S   ED  AWRKYGQ
Sbjct  131  TWTVEASRIDEDKYAWRKYGQ  151



>emb|CDX79972.1| BnaA05g01840D [Brassica napus]
Length=337

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 61/146 (42%), Gaps = 49/146 (34%)
 Frame = +3

Query  159  RKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRL------------FPELTEQIMGSF  302
            +++V+  L +G + ATQLQ LL +     Q  S  +              EL  +I+ SF
Sbjct  12   KRKVVDQLVQGYEFATQLQLLLSH-----QHSSHYIDQTGVVSGDPDPVDELIAKILSSF  66

Query  303  SEAVSQLLQAADS---AVSGENPA---------------------------KARRGCYNR  392
             + +S +L + DS   AV G   A                           K +RGCY R
Sbjct  67   HKTIS-VLDSCDSVPMAVEGSQNASRGDDLAAPVSCNGGDSGDSRKRLGVGKGKRGCYTR  125

Query  393  RKCSDTW-INVSNTKEDGGAWRKYGQ  467
            +K   TW +  S   ED  AWRKYGQ
Sbjct  126  KKRWHTWTVEASRIDEDKYAWRKYGQ  151



>ref|XP_007033513.1| WRKY DNA-binding protein 70, putative isoform 2, partial [Theobroma 
cacao]
 gb|EOY04439.1| WRKY DNA-binding protein 70, putative isoform 2, partial [Theobroma 
cacao]
Length=204

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 61/133 (46%), Gaps = 38/133 (29%)
 Frame = +3

Query  159  RKRVISVLHKGKKSATQLQTLL-RNFS----LGSQEESRRLFPELTEQIMGSFSEAVSQL  323
            R++ I  L +G+    QL+ LL ++F     LGS++        L  +I+ SF+  +S L
Sbjct  5    RRKAIEELARGRDLTNQLRDLLTKSFGDDGLLGSED--------LVTKILNSFANTLSIL  56

Query  324  LQAA--------------------DSAVSGEN----PAKARRGCYNRRKCSDTWINVSNT  431
              ++                     S  SGE+      K RRGCY RRK   +W   S T
Sbjct  57   RSSSGDYDEVSQNPRNSNMSWDGRKSEESGESIKSSTQKDRRGCYKRRKSEHSWTRDSPT  116

Query  432  -KEDGGAWRKYGQ  467
              +DG AWRKYGQ
Sbjct  117  LIDDGHAWRKYGQ  129



>ref|NP_001267577.1| probable WRKY transcription factor 70-like [Cucumis sativus]
 gb|ADU52513.1| WRKY protein [Cucumis sativus]
Length=280

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 55/128 (43%), Gaps = 32/128 (25%)
 Frame = +3

Query  159  RKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQLLQAAD  338
            R++    L +G++ A QL+  L+  S  + ++       L  +I+ SFS+ +S L    D
Sbjct  13   RRKAADELLRGRELAQQLRAYLQISSTPASQD-------LLTRILSSFSKTLSILNHRCD  65

Query  339  S------------------------AVSGENPAKARRGCYNRRKCSDTWINVS-NTKEDG  443
            S                        +     P   RRGCY RRK   +W   S +  +DG
Sbjct  66   SDDINGSIVDSPEDHGSRKSEESGDSCKSSTPNNDRRGCYKRRKSCQSWARESCDLVDDG  125

Query  444  GAWRKYGQ  467
             AWRKYGQ
Sbjct  126  HAWRKYGQ  133



>gb|KGN58681.1| WRKY transcription factor [Cucumis sativus]
Length=329

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 55/128 (43%), Gaps = 32/128 (25%)
 Frame = +3

Query  159  RKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQLLQAAD  338
            R++    L +G++ A QL+  L+  S  + ++       L  +I+ SFS+ +S L    D
Sbjct  62   RRKAADELLRGRELAQQLRAYLQISSTPASQD-------LLTRILSSFSKTLSILNHRCD  114

Query  339  S------------------------AVSGENPAKARRGCYNRRKCSDTWINVS-NTKEDG  443
            S                        +     P   RRGCY RRK   +W   S +  +DG
Sbjct  115  SDDINGSIVDSPEDHGSRKSEESGDSCKSSTPNNDRRGCYKRRKSCQSWARESCDLVDDG  174

Query  444  GAWRKYGQ  467
             AWRKYGQ
Sbjct  175  HAWRKYGQ  182



>ref|NP_001055192.1| Os05g0322900 [Oryza sativa Japonica Group]
 gb|AAV44133.1| putative WRKY transcription factor [Oryza sativa Japonica Group]
 gb|AAV44172.1| putative WRKY transcription factor [Oryza sativa Japonica Group]
 gb|AAW63720.1| WRKY45 [Oryza sativa Japonica Group]
 dbj|BAF17106.1| Os05g0322900 [Oryza sativa Japonica Group]
 dbj|BAG96342.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89885.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ACX37128.1| WRKY-type transcription factor 45-1 [Oryza sativa Japonica Group]
 gb|ACX37129.1| WRKY-type transcription factor 45-1 [Oryza sativa Japonica Group]
 gb|ACX37130.1| WRKY-type transcription factor 45-1 [Oryza sativa Japonica Group]
Length=326

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 57/124 (46%), Gaps = 33/124 (27%)
 Frame = +3

Query  165  RVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQLLQAADSA  344
            +V+  + KGK+ A QLQ LLR+    S E  R       +QI+ +FS A+  L +AA SA
Sbjct  15   QVMEDMEKGKELAAQLQGLLRD----SPEAGR-----FVDQILHTFSRAMRALDKAAVSA  65

Query  345  VSGEN---------------------PAKARRGCYNRR--KCSDTWINVSNTKEDGGAWR  455
              GE                      PA  R+    RR  + S   + V N  +DG AWR
Sbjct  66   AGGEGSEVQSEVTCGGGASAGGKRKAPAADRKANCRRRTQQSSGNSVVVKNL-DDGQAWR  124

Query  456  KYGQ  467
            KYGQ
Sbjct  125  KYGQ  128



>ref|XP_010036006.1| PREDICTED: probable WRKY transcription factor 70 [Eucalyptus 
grandis]
Length=275

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 64/132 (48%), Gaps = 28/132 (21%)
 Frame = +3

Query  135  MENPLHTHRK-RVISVLHKGKKSATQLQ-TLLRNFSLGSQEESRRLFPELTEQIMGSFSE  308
            ME     HRK + +  L +G+  A +LQ ++ R  S  S E+         ++++ SF++
Sbjct  1    MEASSFGHRKVKAMKELVRGQDLAKRLQKSISRGGSPSSAEDD-------AQELVASFTK  53

Query  309  AVSQLLQAADSAVS----GENPAKAR--------------RGCYNRRKCSDTWINVSNT-  431
            A+S L  +     S    G+N   AR              RG Y RR+ SDTW  +S T 
Sbjct  54   ALSVLSHSESDDGSQVSDGQNDPAARSDGSSEESSKRKDGRGRYKRRRPSDTWSKISPTL  113

Query  432  KEDGGAWRKYGQ  467
             +DG AWRKYGQ
Sbjct  114  VDDGHAWRKYGQ  125



>gb|KFK34897.1| hypothetical protein AALP_AA5G207700 [Arabis alpina]
Length=291

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 59/129 (46%), Gaps = 35/129 (27%)
 Frame = +3

Query  165  RVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQL-------  323
            + I  L +G++ AT+LQ  +     GS      L  +L  +I+ SF+  +S L       
Sbjct  12   KAIDQLVQGQEFATKLQQFISQ--TGSD-----LAEDLVVKILESFNNVISTLESLEPVS  64

Query  324  ----LQAADSAV------------SGEN-----PAKARRGCYNRRKCSDTWINVSNTKED  440
                L A + +             SG++     P K +RGCY R+K  +TW   S+  ED
Sbjct  65   SSSSLAAVEGSQNASCDNDGKFEDSGDSRKRLGPVKGKRGCYKRKKKPETWTVESSILED  124

Query  441  GGAWRKYGQ  467
              +WRKYGQ
Sbjct  125  AFSWRKYGQ  133



>gb|KCW47528.1| hypothetical protein EUGRSUZ_K01289, partial [Eucalyptus grandis]
Length=251

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 66/132 (50%), Gaps = 28/132 (21%)
 Frame = +3

Query  135  MENPLHTHRK-RVISVLHKGKKSATQLQ-TLLRNFSLGSQEESRRLFPELTEQIMGSFSE  308
            ME     HRK + +  L +G+  A +LQ ++ R  S  S E+         ++++ SF++
Sbjct  1    MEASSFGHRKVKAMKELVRGQDLAKRLQKSISRGGSPSSAEDD-------AQELVASFTK  53

Query  309  AVSQLLQAAD---SAVS-GENPAKAR--------------RGCYNRRKCSDTWINVSNT-  431
            A+S L  +     S VS G+N   AR              RG Y RR+ SDTW  +S T 
Sbjct  54   ALSVLSHSESDDGSQVSDGQNDPAARSDGSSEESSKRKDGRGRYKRRRPSDTWSKISPTL  113

Query  432  KEDGGAWRKYGQ  467
             +DG AWRKYGQ
Sbjct  114  VDDGHAWRKYGQ  125



>ref|XP_010504547.1| PREDICTED: probable WRKY transcription factor 70 [Camelina sativa]
Length=299

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +3

Query  360  PAKARRGCYNRRKCSDTWINVSNTKEDGGAWRKYGQ  467
            P K +RGCY R+K S+TW   S   ED  +WRKYGQ
Sbjct  100  PVKGKRGCYKRKKRSETWTKQSPILEDTYSWRKYGQ  135



>ref|XP_010516246.1| PREDICTED: probable WRKY transcription factor 70 isoform X1 [Camelina 
sativa]
 ref|XP_010516247.1| PREDICTED: probable WRKY transcription factor 70 isoform X2 [Camelina 
sativa]
Length=301

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +3

Query  360  PAKARRGCYNRRKCSDTWINVSNTKEDGGAWRKYGQ  467
            P K +RGCY R+K S+TW   S   ED  +WRKYGQ
Sbjct  100  PVKGKRGCYKRKKRSETWTKQSPILEDTYSWRKYGQ  135



>ref|XP_009586653.1| PREDICTED: probable WRKY transcription factor 70 [Nicotiana tomentosiformis]
Length=224

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 65/124 (52%), Gaps = 17/124 (14%)
 Frame = +3

Query  138  ENPLHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEA--  311
            EN   +  ++V   L++G++   +L+ +++       +    L  +L  +IM SF E   
Sbjct  4    ENYTQSDLEKVTEKLNRGRELTRRLREMIKK---PEADAGDVLTEDLVGKIMSSFCETLS  60

Query  312  ---------VSQLLQAA-DSAVSGENPA-KARRGCYNRRKCSDTWINVSNT-KEDGGAWR  455
                     VSQ++++  DS+ S +  + K RRG Y RRK  +T I  ++T  +DG AWR
Sbjct  61   ILRSNECSEVSQIVKSTEDSSGSCKTSSLKDRRGRYKRRKTLETTIKETSTLVDDGHAWR  120

Query  456  KYGQ  467
            KYGQ
Sbjct  121  KYGQ  124



>ref|XP_010043454.1| PREDICTED: probable WRKY transcription factor 70 [Eucalyptus 
grandis]
Length=341

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 1/35 (3%)
 Frame = +3

Query  366  KARRGCYNRRKCSDTWINVS-NTKEDGGAWRKYGQ  467
            + RRGCY RRK SDT I +  N  +DG  WRKYGQ
Sbjct  117  RDRRGCYKRRKTSDTQIRMDHNLIDDGHQWRKYGQ  151



>gb|AJB84598.1| WRKY [Glycine max]
Length=300

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 63/134 (47%), Gaps = 26/134 (19%)
 Frame = +3

Query  135  MENPLHTHRKRVISVLHKGKKSATQLQTLLR-NFSLGSQEESRRLFPELTEQIMGSFSEA  311
            MEN   + R++ I  L +G+ SA QL++++   +  GS   +     +L ++++ SF+ +
Sbjct  1    MENLGGSSRRKAIEELLRGRDSAQQLKSVINGTYDDGS---ATPFAQQLVKEVLMSFTNS  57

Query  312  VSQL-------------LQAADSAVSGEN--------PAKARRGCYNRRKCSDTWINVSN  428
            +  L             +Q  DS  S ++          K  RGCY RR+   TW   S 
Sbjct  58   LLFLHNNPTSESHHVFNVQVWDSPKSEDSQESNCKSSTIKEPRGCYKRRRTEQTWEKESE  117

Query  429  T-KEDGGAWRKYGQ  467
               +DG  WRKYGQ
Sbjct  118  APIDDGHHWRKYGQ  131



>gb|KHN36906.1| Putative WRKY transcription factor 70 [Glycine soja]
Length=270

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 60/142 (42%), Gaps = 31/142 (22%)
 Frame = +3

Query  135  MENPLHTHRKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRR------LFPELTEQIMG  296
            MEN     R+ +   L KG ++A QL  +L + S  + E+         L  +L  +++ 
Sbjct  1    MENQPSNGRRAMEEELIKGCETANQLLEVLVHKSNTTHEDVELEGSVQPLVEDLVRKVLC  60

Query  297  SFSEA-----------VSQLL-------------QAADSAVSGENPAKARRGCYNRRKCS  404
            SF+             VS+               Q  D A      A+ RRGCY R+  +
Sbjct  61   SFTNTLLLLNTNNINDVSKYTIKDAPSSVKCPETQGTDEACKSFFHAEKRRGCYKRKSSA  120

Query  405  DTW-INVSNTKEDGGAWRKYGQ  467
             TW  N S   EDG AWRKYGQ
Sbjct  121  PTWETNSSILLEDGYAWRKYGQ  142



>ref|XP_003534637.1| PREDICTED: probable WRKY transcription factor 70-like [Glycine 
max]
Length=300

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 63/134 (47%), Gaps = 26/134 (19%)
 Frame = +3

Query  135  MENPLHTHRKRVISVLHKGKKSATQLQTLLR-NFSLGSQEESRRLFPELTEQIMGSFSEA  311
            MEN   + R++ I  L +G+ SA QL++++   +  GS   +     +L ++++ SF+ +
Sbjct  1    MENLGGSSRRKAIEELLRGRDSAQQLKSVINGTYDDGS---ATPFAQQLVKEVLMSFTNS  57

Query  312  VSQL-------------LQAADSAVSGEN--------PAKARRGCYNRRKCSDTWINVSN  428
            +  L             +Q  DS  S ++          K  RGCY RR+   TW   S 
Sbjct  58   LLFLHNNPTSESHHVFNVQVWDSPKSEDSQESNCKSSTIKEPRGCYKRRRTEQTWEKESE  117

Query  429  T-KEDGGAWRKYGQ  467
               +DG  WRKYGQ
Sbjct  118  APIDDGHHWRKYGQ  131



>gb|ACU23894.1| unknown [Glycine max]
Length=300

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 63/134 (47%), Gaps = 26/134 (19%)
 Frame = +3

Query  135  MENPLHTHRKRVISVLHKGKKSATQLQTLLR-NFSLGSQEESRRLFPELTEQIMGSFSEA  311
            MEN   + R++ I  L +G+ SA QL++++   +  GS   +     +L ++++ SF+ +
Sbjct  1    MENLGGSSRRKAIEELLRGRDSAQQLKSVINGTYDDGS---ATPFAQQLVKEVLMSFTNS  57

Query  312  VSQL-------------LQAADSAVSGEN--------PAKARRGCYNRRKCSDTWINVSN  428
            +  L             +Q  DS  S ++          K  RGCY RR+   TW   S 
Sbjct  58   LLFLHNNPTSESHHVFNVQVWDSPKSEDSQESNCKSSTIKEPRGCYKRRRTEQTWEKESE  117

Query  429  T-KEDGGAWRKYGQ  467
               +DG  WRKYGQ
Sbjct  118  APIDDGHHWRKYGQ  131



>ref|XP_006594723.1| PREDICTED: probable WRKY transcription factor 70-like [Glycine 
max]
Length=259

 Score = 47.8 bits (112),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
 Frame = +3

Query  327  QAADSAVSGENPAKARRGCYNRRKCSDTW-INVSNTKEDGGAWRKYGQ  467
            Q  D A      A+ RRGCY R+  + TW  N S   EDG AWRKYGQ
Sbjct  84   QGTDEACKSFFHAEKRRGCYKRKSSAPTWETNSSILLEDGYAWRKYGQ  131



>gb|KHN29497.1| Putative WRKY transcription factor 70 [Glycine soja]
Length=300

 Score = 47.8 bits (112),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 63/134 (47%), Gaps = 26/134 (19%)
 Frame = +3

Query  135  MENPLHTHRKRVISVLHKGKKSATQLQTLLR-NFSLGSQEESRRLFPELTEQIMGSFSEA  311
            MEN   + R++ I  L +G+ SA QL++++   +  GS   +     +L ++++ SF+ +
Sbjct  1    MENLGGSSRRKAIEELLRGRDSAQQLKSVINGTYDDGS---ATPFAQQLVKEVLMSFTNS  57

Query  312  VSQL-------------LQAADSAVSGEN--------PAKARRGCYNRRKCSDTWINVSN  428
            +  L             +Q  DS  S ++          K  RGCY RR+   TW   S 
Sbjct  58   LLFLHNNPTSESHHVFNVQVWDSPKSEDSQESNCKSSTIKEPRGCYKRRRTEQTWEKESE  117

Query  429  T-KEDGGAWRKYGQ  467
               +DG  WRKYGQ
Sbjct  118  APIDDGHHWRKYGQ  131



>ref|XP_008456968.1| PREDICTED: LOW QUALITY PROTEIN: probable WRKY transcription factor 
70 [Cucumis melo]
Length=281

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 63/140 (45%), Gaps = 37/140 (26%)
 Frame = +3

Query  135  MENPLHTH--------RKRVISVLHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQI  290
            ME P  +H        R+++ + L  G+ SA  LQTLL+  S  + E+ +R    L  +I
Sbjct  1    MEAPEFSHGRILPAELRRKITAKLLPGQDSAAHLQTLLQ--SAAATEQDKRA---LATKI  55

Query  291  MGSFSEAVSQLLQAADSAVS---------------------GENPAKARRGCYNRRKCSD  407
            + S +EA+S L  AA   +S                       NP++A +    RR  + 
Sbjct  56   LTSITEAISILESAAGEELSCPDNSLCSDLDSDDSRRSTGVKNNPSRANK---RRRSMNT  112

Query  408  TWINVSNTKEDGGAWRKYGQ  467
             ++  S T ED   WRKYGQ
Sbjct  113  RFVRTSRTTEDEYGWRKYGQ  132



>ref|XP_006291218.1| hypothetical protein CARUB_v10017349mg, partial [Capsella rubella]
 gb|EOA24116.1| hypothetical protein CARUB_v10017349mg, partial [Capsella rubella]
Length=412

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 58/125 (46%), Gaps = 34/125 (27%)
 Frame = +3

Query  180  LHKGKKSATQLQTLLRNFSLGSQEESRRLFPELTEQIMGSFSEAVSQL------------  323
            L +G + AT+LQ LL     G       L  +L  +I+ +F++A+S L            
Sbjct  138  LVEGHEFATKLQQLLSQPGSG-----HGLAEDLAAKIVVTFNKAISVLDSFEPISSSSSS  192

Query  324  LQAADSAV------------SGEN-----PAKARRGCYNRRKCSDTWINVSNTKEDGGAW  452
            L A + +             SG++     P K +RGCY R+K ++TW   S   +D  +W
Sbjct  193  LAAVEGSQNASCDNDGKFEDSGDSRKRLGPVKGKRGCYKRKKRAETWTMHSTVLDDEFSW  252

Query  453  RKYGQ  467
            RKYGQ
Sbjct  253  RKYGQ  257



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 514802592608