BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13534_g1_i1 len=1510 path=[1488:0-1300 2789:1301-1509]

Length=1510
                                                                      Score     E

ref|XP_009774626.1|  PREDICTED: probable serine/threonine-protein...    234   8e-65   
emb|CDO97634.1|  unnamed protein product                                231   8e-64   
ref|XP_009611194.1|  PREDICTED: probable serine/threonine-protein...    231   1e-63   
ref|XP_010314442.1|  PREDICTED: probable serine/threonine-protein...    224   2e-61   
ref|XP_006349306.1|  PREDICTED: probable serine/threonine-protein...    223   9e-61   
ref|XP_011092281.1|  PREDICTED: probable serine/threonine-protein...    216   3e-58   
ref|XP_011092279.1|  PREDICTED: probable serine/threonine-protein...    216   4e-58   
ref|XP_009355345.1|  PREDICTED: probable serine/threonine-protein...    214   1e-57   
ref|XP_010065274.1|  PREDICTED: probable serine/threonine-protein...    214   2e-57   
ref|XP_008365328.1|  PREDICTED: probable serine/threonine-protein...    213   3e-57   
gb|EYU33285.1|  hypothetical protein MIMGU_mgv1a002177mg                213   4e-57   
ref|XP_008378912.1|  PREDICTED: probable serine/threonine-protein...    213   5e-57   
ref|XP_007041171.1|  Serine/threonine-protein kinase cdk9               207   3e-55   
gb|ABE91953.2|  Protein kinase-like                                     194   4e-52   Medicago truncatula
ref|XP_008456985.1|  PREDICTED: probable serine/threonine-protein...    198   8e-52   
ref|XP_008456983.1|  PREDICTED: probable serine/threonine-protein...    197   2e-51   
ref|XP_010645923.1|  PREDICTED: probable serine/threonine-protein...    196   3e-51   
ref|XP_010645924.1|  PREDICTED: probable serine/threonine-protein...    194   7e-51   
emb|CBI31356.3|  unnamed protein product                                194   9e-51   
emb|CAN67625.1|  hypothetical protein VITISV_007388                     194   9e-51   Vitis vinifera
gb|KDO42442.1|  hypothetical protein CISIN_1g005582mg                   194   2e-50   
ref|XP_006431519.1|  hypothetical protein CICLE_v10000479mg             193   3e-50   
ref|XP_006470963.1|  PREDICTED: probable serine/threonine-protein...    193   3e-50   
gb|KDP42465.1|  hypothetical protein JCGZ_00262                         193   3e-50   
ref|XP_007225176.1|  hypothetical protein PRUPE_ppa002233mg             192   4e-50   
ref|XP_008218690.1|  PREDICTED: probable serine/threonine-protein...    191   1e-49   
ref|XP_008219089.1|  PREDICTED: probable serine/threonine-protein...    190   2e-49   
ref|XP_002526427.1|  Serine/threonine-protein kinase cdk9, putative     188   2e-49   Ricinus communis
ref|XP_010544117.1|  PREDICTED: probable serine/threonine-protein...    190   3e-49   
ref|XP_008219090.1|  PREDICTED: probable serine/threonine-protein...    189   4e-49   
gb|KHG17123.1|  hypothetical protein F383_22386                         189   8e-49   
ref|XP_002325944.2|  hypothetical protein POPTR_0019s10200g             188   1e-48   Populus trichocarpa [western balsam poplar]
ref|XP_007224433.1|  hypothetical protein PRUPE_ppa021439mg             188   1e-48   
ref|XP_010553694.1|  PREDICTED: probable serine/threonine-protein...    188   1e-48   
ref|XP_010545831.1|  PREDICTED: probable serine/threonine-protein...    186   5e-48   
ref|XP_004250837.1|  PREDICTED: probable serine/threonine-protein...    184   2e-47   
gb|KEH36411.1|  kinase superfamily protein, putative                    181   6e-47   
ref|XP_008352759.1|  PREDICTED: probable serine/threonine-protein...    181   6e-47   
ref|XP_006389488.1|  hypothetical protein POPTR_0022s00310g             182   8e-47   
ref|XP_011036368.1|  PREDICTED: probable serine/threonine-protein...    182   9e-47   
ref|XP_011015815.1|  PREDICTED: probable serine/threonine-protein...    182   1e-46   
ref|XP_009357190.1|  PREDICTED: probable serine/threonine-protein...    182   1e-46   
ref|XP_006363662.1|  PREDICTED: probable serine/threonine-protein...    182   1e-46   
ref|XP_010100096.1|  putative serine/threonine-protein kinase           182   1e-46   
ref|XP_009420482.1|  PREDICTED: probable serine/threonine-protein...    182   2e-46   
ref|XP_008352758.1|  PREDICTED: probable serine/threonine-protein...    181   2e-46   
ref|XP_010912690.1|  PREDICTED: probable serine/threonine-protein...    181   4e-46   
ref|XP_009148261.1|  PREDICTED: probable serine/threonine-protein...    180   5e-46   
ref|XP_010683176.1|  PREDICTED: probable serine/threonine-protein...    180   7e-46   
gb|KHN39684.1|  Putative serine/threonine-protein kinase                177   1e-45   
gb|AAG50753.1|AC079733_21  CRK1 protein, putative                       179   1e-45   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176083.2|  Protein kinase superfamily protein                    179   1e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004485427.1|  PREDICTED: probable serine/threonine-protein...    179   2e-45   
ref|XP_006592651.1|  PREDICTED: probable serine/threonine-protein...    179   2e-45   
ref|XP_009608659.1|  PREDICTED: probable serine/threonine-protein...    178   3e-45   
ref|XP_003539386.1|  PREDICTED: probable serine/threonine-protein...    178   3e-45   
ref|XP_006478251.1|  PREDICTED: probable serine/threonine-protein...    178   3e-45   
gb|KDO51718.1|  hypothetical protein CISIN_1g006004mg                   178   4e-45   
gb|KDP45636.1|  hypothetical protein JCGZ_17243                         177   4e-45   
ref|XP_009792319.1|  PREDICTED: probable serine/threonine-protein...    177   5e-45   
ref|XP_006376169.1|  hypothetical protein POPTR_0013s10440g             177   7e-45   
ref|XP_009385619.1|  PREDICTED: probable serine/threonine-protein...    175   9e-45   
ref|XP_010414812.1|  PREDICTED: probable serine/threonine-protein...    177   1e-44   
ref|XP_008806997.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    176   2e-44   
gb|EYU22739.1|  hypothetical protein MIMGU_mgv1a002645mg                176   2e-44   
emb|CDY50891.1|  BnaCnng19830D                                          177   3e-44   
ref|XP_004162865.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    175   3e-44   
emb|CDX93496.1|  BnaA06g05520D                                          175   3e-44   
ref|XP_009407059.1|  PREDICTED: probable serine/threonine-protein...    175   4e-44   
ref|XP_011006181.1|  PREDICTED: probable serine/threonine-protein...    174   5e-44   
ref|XP_010511348.1|  PREDICTED: probable serine/threonine-protein...    174   8e-44   
ref|XP_011006180.1|  PREDICTED: probable serine/threonine-protein...    174   1e-43   
ref|XP_008378721.1|  PREDICTED: probable serine/threonine-protein...    171   1e-43   
gb|KGN52685.1|  hypothetical protein Csa_5G650500                       173   1e-43   
ref|XP_008459631.1|  PREDICTED: probable serine/threonine-protein...    171   2e-43   
ref|XP_004141641.1|  PREDICTED: probable serine/threonine-protein...    172   3e-43   
ref|XP_008378719.1|  PREDICTED: probable serine/threonine-protein...    172   3e-43   
emb|CDY31800.1|  BnaC01g27560D                                          172   3e-43   
ref|XP_009102541.1|  PREDICTED: probable serine/threonine-protein...    172   3e-43   
ref|XP_003592893.1|  Zinc finger CCCH domain-containing protein         175   3e-43   
emb|CDY53144.1|  BnaAnng12030D                                          172   3e-43   
ref|XP_009378979.1|  PREDICTED: probable serine/threonine-protein...    171   4e-43   
ref|XP_008459626.1|  PREDICTED: probable serine/threonine-protein...    172   4e-43   
ref|XP_010480304.1|  PREDICTED: probable serine/threonine-protein...    172   4e-43   
ref|XP_008378720.1|  PREDICTED: probable serine/threonine-protein...    171   5e-43   
ref|XP_006306924.1|  hypothetical protein CARUB_v10008488mg             171   8e-43   
ref|XP_011095772.1|  PREDICTED: probable serine/threonine-protein...    171   8e-43   
ref|XP_002452282.1|  hypothetical protein SORBIDRAFT_04g022960          171   9e-43   Sorghum bicolor [broomcorn]
ref|XP_010475800.1|  PREDICTED: probable serine/threonine-protein...    171   1e-42   
ref|XP_006300312.1|  hypothetical protein CARUB_v10019892mg             170   2e-42   
emb|CDY25738.1|  BnaC03g69370D                                          170   2e-42   
ref|XP_004971749.1|  PREDICTED: probable serine/threonine-protein...    169   3e-42   
ref|XP_009107008.1|  PREDICTED: probable serine/threonine-protein...    169   6e-42   
ref|XP_002457168.1|  hypothetical protein SORBIDRAFT_03g002610          168   8e-42   Sorghum bicolor [broomcorn]
ref|XP_004244231.1|  PREDICTED: probable serine/threonine-protein...    168   9e-42   
ref|XP_006643878.1|  PREDICTED: probable serine/threonine-protein...    167   9e-42   
ref|XP_009144802.1|  PREDICTED: probable serine/threonine-protein...    168   1e-41   
ref|XP_009401105.1|  PREDICTED: probable serine/threonine-protein...    167   1e-41   
ref|XP_006417556.1|  hypothetical protein EUTSA_v10006949mg             167   2e-41   
emb|CDY02525.1|  BnaA08g01320D                                          167   2e-41   
ref|XP_006392368.1|  hypothetical protein EUTSA_v10023319mg             166   4e-41   
ref|XP_010062385.1|  PREDICTED: probable serine/threonine-protein...    165   7e-41   
ref|XP_002528049.1|  Cell division protein kinase, putative             165   8e-41   Ricinus communis
ref|NP_172431.1|  probable serine/threonine-protein kinase              164   2e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010260205.1|  PREDICTED: probable serine/threonine-protein...    164   2e-40   
tpg|DAA52935.1|  TPA: putative protein kinase superfamily protein       164   2e-40   
ref|XP_010471165.1|  PREDICTED: probable serine/threonine-protein...    163   4e-40   
ref|XP_009622009.1|  PREDICTED: probable serine/threonine-protein...    161   6e-40   
ref|XP_009622007.1|  PREDICTED: probable serine/threonine-protein...    161   6e-40   
ref|XP_010427987.1|  PREDICTED: probable serine/threonine-protein...    163   7e-40   
gb|AAC33218.1|  Similar to cdc2 protein kinases                         164   8e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010415864.1|  PREDICTED: probable serine/threonine-protein...    162   1e-39   
ref|XP_009127863.1|  PREDICTED: probable serine/threonine-protein...    161   1e-39   
ref|XP_002874601.1|  kinase family protein                              160   1e-39   
gb|KFK35750.1|  hypothetical protein AALP_AA4G031500                    161   2e-39   
ref|XP_009622006.1|  PREDICTED: probable serine/threonine-protein...    161   2e-39   
gb|KHG02812.1|  hypothetical protein F383_23996                         160   2e-39   
ref|XP_009105819.1|  PREDICTED: probable serine/threonine-protein...    160   2e-39   
ref|XP_010490179.1|  PREDICTED: probable serine/threonine-protein...    161   3e-39   
emb|CDY03697.1|  BnaA02g15400D                                          160   3e-39   
ref|XP_008655744.1|  PREDICTED: probable serine/threonine-protein...    160   4e-39   
gb|KFK40935.1|  hypothetical protein AALP_AA2G063200                    160   5e-39   
emb|CDY39924.1|  BnaA09g15060D                                          159   6e-39   
emb|CDY29169.1|  BnaC09g15660D                                          159   6e-39   
ref|XP_010260204.1|  PREDICTED: probable serine/threonine-protein...    160   7e-39   
gb|AAF43241.1|AC012654_25  Strong similarity to the putative prot...    156   8e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004301455.1|  PREDICTED: probable serine/threonine-protein...    159   8e-39   
ref|XP_010461202.1|  PREDICTED: probable serine/threonine-protein...    157   1e-38   
ref|XP_009762471.1|  PREDICTED: probable serine/threonine-protein...    157   1e-38   
ref|XP_010478807.1|  PREDICTED: probable serine/threonine-protein...    158   1e-38   
emb|CDY67268.1|  BnaCnng54190D                                          158   1e-38   
ref|XP_006390761.1|  hypothetical protein EUTSA_v10018253mg             158   2e-38   
ref|XP_006300829.1|  hypothetical protein CARUB_v10019921mg             158   2e-38   
ref|XP_009762469.1|  PREDICTED: probable serine/threonine-protein...    157   3e-38   
ref|XP_009762470.1|  PREDICTED: probable serine/threonine-protein...    157   3e-38   
ref|XP_006397114.1|  hypothetical protein EUTSA_v10028507mg             157   3e-38   
ref|XP_009118304.1|  PREDICTED: probable serine/threonine-protein...    157   3e-38   
ref|XP_009113343.1|  PREDICTED: probable serine/threonine-protein...    157   4e-38   
ref|XP_003610952.1|  hypothetical protein MTR_5g008860                  157   4e-38   
dbj|BAJ97184.1|  predicted protein                                      157   5e-38   
ref|XP_010458252.1|  PREDICTED: probable serine/threonine-protein...    157   5e-38   
ref|XP_010461203.1|  PREDICTED: probable serine/threonine-protein...    156   5e-38   
ref|NP_192739.2|  protein kinase family protein                         154   7e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009417044.1|  PREDICTED: probable serine/threonine-protein...    155   8e-38   
gb|KFK40934.1|  hypothetical protein AALP_AA2G063200                    156   8e-38   
ref|NP_177308.3|  protein kinase superfamily protein                    156   1e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010421919.1|  PREDICTED: probable serine/threonine-protein...    155   1e-37   
emb|CDY06363.1|  BnaA09g48400D                                          157   1e-37   
ref|XP_010437707.1|  PREDICTED: probable serine/threonine-protein...    155   2e-37   
emb|CDP00862.1|  unnamed protein product                                155   2e-37   
ref|XP_010542778.1|  PREDICTED: probable serine/threonine-protein...    155   2e-37   
emb|CDY36688.1|  BnaCnng07900D                                          154   3e-37   
emb|CDY22631.1|  BnaC08g42650D                                          156   3e-37   
emb|CDX72813.1|  BnaC06g32610D                                          154   3e-37   
emb|CAB39625.1|  putative protein kinase                                154   4e-37   Arabidopsis thaliana [mouse-ear cress]
emb|CDX68307.1|  BnaA07g23470D                                          154   4e-37   
ref|XP_006286675.1|  hypothetical protein CARUB_v10002640mg             153   6e-37   
ref|XP_010499920.1|  PREDICTED: probable serine/threonine-protein...    153   7e-37   
gb|KFK43257.1|  hypothetical protein AALP_AA1G100400                    155   7e-37   
ref|XP_006415063.1|  hypothetical protein EUTSA_v10007077mg             152   9e-37   
ref|NP_001146380.1|  uncharacterized protein LOC100279958               152   1e-36   Zea mays [maize]
gb|ABG21910.1|  transposon protein, putative, unclassified, expre...    150   1e-36   
ref|XP_010455394.1|  PREDICTED: probable serine/threonine-protein...    152   2e-36   
gb|KFK32036.1|  hypothetical protein AALP_AA6G191700                    152   2e-36   
ref|XP_007156995.1|  hypothetical protein PHAVU_002G034800g             152   2e-36   
ref|XP_006357474.1|  PREDICTED: probable serine/threonine-protein...    152   2e-36   
emb|CDY58380.1|  BnaC09g51600D                                          151   3e-36   
ref|XP_006356565.1|  PREDICTED: probable serine/threonine-protein...    151   4e-36   
ref|XP_009113591.1|  PREDICTED: probable serine/threonine-protein...    151   4e-36   
emb|CDX86879.1|  BnaA09g22690D                                          150   4e-36   
ref|XP_004511499.1|  PREDICTED: probable serine/threonine-protein...    150   8e-36   
gb|ABA96101.2|  transposon protein, putative, unclassified, expre...    150   1e-35   Oryza sativa Japonica Group [Japonica rice]
emb|CDX99520.1|  BnaC09g24720D                                          149   1e-35   
emb|CDY48795.1|  BnaA05g20750D                                          148   2e-35   
ref|XP_002441983.1|  hypothetical protein SORBIDRAFT_08g006390          148   3e-35   Sorghum bicolor [broomcorn]
ref|NP_174637.1|  protein kinase family protein                         148   4e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307022.1|  hypothetical protein CARUB_v10008607mg             147   5e-35   
ref|XP_004242255.1|  PREDICTED: probable serine/threonine-protein...    148   5e-35   
gb|KHG26788.1|  hypothetical protein F383_02840                         146   7e-35   
emb|CDY70545.1|  BnaAnng34090D                                          147   1e-34   
gb|EEC69001.1|  hypothetical protein OsI_37782                          149   2e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_009151479.1|  PREDICTED: probable serine/threonine-protein...    146   2e-34   
gb|EPS73453.1|  hypothetical protein M569_01299                         145   2e-34   
gb|EEE52923.1|  hypothetical protein OsJ_35543                          148   2e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011087653.1|  PREDICTED: probable serine/threonine-protein...    144   3e-34   
gb|EYU29815.1|  hypothetical protein MIMGU_mgv1a018704mg                145   4e-34   
ref|XP_010230587.1|  PREDICTED: probable serine/threonine-protein...    145   4e-34   
ref|XP_010235557.1|  PREDICTED: probable serine/threonine-protein...    146   4e-34   
ref|XP_010089557.1|  putative serine/threonine-protein kinase           145   7e-34   
ref|XP_008794127.1|  PREDICTED: probable serine/threonine-protein...    143   8e-34   
ref|XP_011087652.1|  PREDICTED: probable serine/threonine-protein...    144   1e-33   
ref|XP_011087651.1|  PREDICTED: probable serine/threonine-protein...    144   1e-33   
ref|XP_010694981.1|  PREDICTED: probable serine/threonine-protein...    144   3e-33   
emb|CDY20686.1|  BnaC08g13720D                                          143   3e-33   
ref|XP_006664429.1|  PREDICTED: probable serine/threonine-protein...    142   5e-33   
ref|XP_008794125.1|  PREDICTED: probable serine/threonine-protein...    143   5e-33   
ref|XP_008794126.1|  PREDICTED: probable serine/threonine-protein...    143   5e-33   
gb|EYU26381.1|  hypothetical protein MIMGU_mgv1a002080mg                142   6e-33   
gb|KDP27060.1|  hypothetical protein JCGZ_20995                         142   1e-32   
ref|XP_004151412.1|  PREDICTED: uncharacterized protein LOC101214435    136   2e-32   
ref|XP_009784583.1|  PREDICTED: probable serine/threonine-protein...    140   2e-32   
emb|CDY15287.1|  BnaC06g07730D                                          140   2e-32   
ref|XP_011004643.1|  PREDICTED: probable serine/threonine-protein...    140   2e-32   
ref|XP_007149459.1|  hypothetical protein PHAVU_005G071900g             140   3e-32   
gb|KHN36823.1|  Putative serine/threonine-protein kinase                139   4e-32   
ref|XP_010535099.1|  PREDICTED: probable serine/threonine-protein...    139   5e-32   
ref|XP_006590470.1|  PREDICTED: probable serine/threonine-protein...    139   5e-32   
ref|XP_010694982.1|  PREDICTED: probable serine/threonine-protein...    140   5e-32   
ref|XP_010925563.1|  PREDICTED: probable serine/threonine-protein...    140   5e-32   
ref|XP_007021485.1|  Kinase superfamily protein                         139   6e-32   
ref|XP_006392837.1|  hypothetical protein EUTSA_v10011275mg             139   6e-32   
ref|XP_006348252.1|  PREDICTED: probable serine/threonine-protein...    139   7e-32   
ref|XP_002533553.1|  Cell division protein kinase, putative             139   8e-32   Ricinus communis
emb|CDP05922.1|  unnamed protein product                                138   1e-31   
ref|XP_003596750.1|  Serine/threonine protein kinase cdk9               138   1e-31   
ref|XP_003527250.1|  PREDICTED: probable serine/threonine-protein...    138   1e-31   
ref|XP_003543242.1|  PREDICTED: probable serine/threonine-protein...    138   2e-31   
ref|XP_009804117.1|  PREDICTED: probable serine/threonine-protein...    136   2e-31   
ref|XP_011098308.1|  PREDICTED: probable serine/threonine-protein...    138   2e-31   
ref|XP_006451848.1|  hypothetical protein CICLE_v10007617mg             138   2e-31   
ref|XP_002316895.2|  hypothetical protein POPTR_0011s12010g             137   2e-31   Populus trichocarpa [western balsam poplar]
ref|XP_006464753.1|  PREDICTED: probable serine/threonine-protein...    138   2e-31   
ref|XP_008791720.1|  PREDICTED: probable serine/threonine-protein...    138   2e-31   
ref|XP_008791729.1|  PREDICTED: probable serine/threonine-protein...    138   2e-31   
ref|XP_008339473.1|  PREDICTED: probable serine/threonine-protein...    137   2e-31   
gb|KDO62492.1|  hypothetical protein CISIN_1g004999mg                   137   2e-31   
ref|XP_010060566.1|  PREDICTED: probable serine/threonine-protein...    137   3e-31   
ref|XP_010112974.1|  putative serine/threonine-protein kinase           138   3e-31   
ref|XP_009604687.1|  PREDICTED: probable serine/threonine-protein...    137   3e-31   
gb|KHN28061.1|  Putative serine/threonine-protein kinase                137   3e-31   
ref|XP_003540463.1|  PREDICTED: probable serine/threonine-protein...    137   3e-31   
emb|CDY50511.1|  BnaC06g10110D                                          137   3e-31   
ref|XP_003540111.1|  PREDICTED: probable serine/threonine-protein...    137   4e-31   
ref|XP_009356808.1|  PREDICTED: probable serine/threonine-protein...    137   4e-31   
ref|XP_002285008.1|  PREDICTED: probable serine/threonine-protein...    137   4e-31   Vitis vinifera
ref|XP_011029485.1|  PREDICTED: probable serine/threonine-protein...    137   4e-31   
ref|XP_009757170.1|  PREDICTED: probable serine/threonine-protein...    135   4e-31   
emb|CBI20299.3|  unnamed protein product                                137   4e-31   
ref|XP_009341042.1|  PREDICTED: probable serine/threonine-protein...    137   4e-31   
ref|XP_004243358.1|  PREDICTED: probable serine/threonine-protein...    137   4e-31   
ref|XP_008386179.1|  PREDICTED: probable serine/threonine-protein...    137   5e-31   
ref|XP_009757169.1|  PREDICTED: probable serine/threonine-protein...    136   6e-31   
ref|XP_006370257.1|  hypothetical protein POPTR_0001s41040g             136   6e-31   
ref|XP_009757166.1|  PREDICTED: probable serine/threonine-protein...    136   8e-31   
ref|XP_010479840.1|  PREDICTED: probable serine/threonine-protein...    136   8e-31   
gb|AFW71848.1|  putative protein kinase superfamily protein             136   8e-31   
ref|XP_008645824.1|  PREDICTED: probable serine/threonine-protein...    136   8e-31   
ref|XP_006836804.1|  hypothetical protein AMTR_s00099p00026630          136   8e-31   
ref|XP_008366989.1|  PREDICTED: probable serine/threonine-protein...    136   9e-31   
ref|XP_010462163.1|  PREDICTED: probable serine/threonine-protein...    135   2e-30   
ref|XP_010272444.1|  PREDICTED: probable serine/threonine-protein...    135   2e-30   
ref|NP_175713.1|  putative serine/threonine protein kinase              135   2e-30   Arabidopsis thaliana [mouse-ear cress]
gb|AAO42182.1|  putative cell division-related protein                  135   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006582174.1|  PREDICTED: probable serine/threonine-protein...    135   2e-30   
ref|XP_010252406.1|  PREDICTED: probable serine/threonine-protein...    133   2e-30   
ref|XP_006303920.1|  hypothetical protein CARUB_v10008475mg             134   3e-30   
ref|XP_010500934.1|  PREDICTED: probable serine/threonine-protein...    134   3e-30   
gb|KHG22910.1|  hypothetical protein F383_06618                         134   4e-30   
ref|XP_008456032.1|  PREDICTED: probable serine/threonine-protein...    134   4e-30   
ref|XP_010915426.1|  PREDICTED: probable serine/threonine-protein...    134   4e-30   
ref|XP_004487708.1|  PREDICTED: probable serine/threonine-protein...    134   4e-30   
ref|XP_006582172.1|  PREDICTED: probable serine/threonine-protein...    134   4e-30   
ref|XP_009802541.1|  PREDICTED: probable serine/threonine-protein...    134   5e-30   
ref|XP_004296506.1|  PREDICTED: probable serine/threonine-protein...    133   6e-30   
ref|XP_010915423.1|  PREDICTED: probable serine/threonine-protein...    134   6e-30   
ref|XP_010915425.1|  PREDICTED: probable serine/threonine-protein...    134   7e-30   
gb|KHN25621.1|  Putative serine/threonine-protein kinase                133   7e-30   
gb|AES73013.2|  cyclin-dependent kinase C                               132   7e-30   
ref|XP_003516727.1|  PREDICTED: probable serine/threonine-protein...    132   7e-30   
ref|XP_010915421.1|  PREDICTED: probable serine/threonine-protein...    133   8e-30   
ref|XP_010915422.1|  PREDICTED: probable serine/threonine-protein...    133   8e-30   
ref|XP_003602762.1|  hypothetical protein MTR_3g098760                  132   8e-30   
ref|XP_006592611.1|  PREDICTED: probable serine/threonine-protein...    132   1e-29   
ref|XP_010252405.1|  PREDICTED: probable serine/threonine-protein...    132   1e-29   
gb|KHG30226.1|  hypothetical protein F383_12098                         131   1e-29   
gb|EMT17795.1|  Putative serine/threonine-protein kinase                132   1e-29   
ref|XP_004146248.1|  PREDICTED: probable serine/threonine-protein...    132   1e-29   
ref|XP_009421283.1|  PREDICTED: probable serine/threonine-protein...    132   1e-29   
ref|XP_009337536.1|  PREDICTED: probable serine/threonine-protein...    131   2e-29   
ref|XP_011028376.1|  PREDICTED: probable serine/threonine-protein...    131   2e-29   
ref|XP_007214536.1|  hypothetical protein PRUPE_ppa002182mg             132   2e-29   
ref|XP_008392719.1|  PREDICTED: probable serine/threonine-protein...    130   2e-29   
ref|XP_006859032.1|  hypothetical protein AMTR_s00068p00177220          132   2e-29   
ref|XP_008226629.1|  PREDICTED: probable serine/threonine-protein...    132   2e-29   
ref|XP_010930474.1|  PREDICTED: probable serine/threonine-protein...    131   3e-29   
ref|XP_009757168.1|  PREDICTED: probable serine/threonine-protein...    131   3e-29   
ref|XP_006436913.1|  hypothetical protein CICLE_v10031084mg             130   3e-29   
ref|XP_002974808.1|  hypothetical protein SELMODRAFT_442565             131   3e-29   
ref|XP_006485128.1|  PREDICTED: probable serine/threonine-protein...    130   3e-29   
ref|XP_009624462.1|  PREDICTED: probable serine/threonine-protein...    130   4e-29   
gb|EEE54064.1|  hypothetical protein OsJ_00765                          130   4e-29   
gb|EEC70121.1|  hypothetical protein OsI_00791                          130   4e-29   
ref|XP_011028375.1|  PREDICTED: probable serine/threonine-protein...    130   5e-29   
ref|XP_001784887.1|  predicted protein                                  130   5e-29   
ref|XP_002274225.1|  PREDICTED: probable serine/threonine-protein...    130   5e-29   
dbj|BAC41787.1|  putative cyclin-dependent protein kinase               129   5e-29   
ref|NP_199899.1|  protein kinase family protein                         129   6e-29   
ref|XP_011002117.1|  PREDICTED: probable serine/threonine-protein...    129   6e-29   
ref|XP_002963724.1|  hypothetical protein SELMODRAFT_141733             129   7e-29   
ref|XP_006582173.1|  PREDICTED: probable serine/threonine-protein...    130   7e-29   
ref|XP_008786562.1|  PREDICTED: probable serine/threonine-protein...    130   8e-29   
gb|KHG15743.1|  hypothetical protein F383_22519                         129   9e-29   
ref|XP_010318321.1|  PREDICTED: probable serine/threonine-protein...    129   1e-28   
ref|XP_007159987.1|  hypothetical protein PHAVU_002G283400g             128   1e-28   
ref|XP_011100264.1|  PREDICTED: probable serine/threonine-protein...    129   1e-28   
ref|XP_006658942.1|  PREDICTED: probable serine/threonine-protein...    127   1e-28   
ref|XP_006366910.1|  PREDICTED: probable serine/threonine-protein...    128   1e-28   
ref|XP_007209085.1|  hypothetical protein PRUPE_ppa003653mg             128   1e-28   
ref|XP_008795313.1|  PREDICTED: probable serine/threonine-protein...    129   1e-28   
ref|XP_006844562.1|  hypothetical protein AMTR_s00016p00189320          128   1e-28   
ref|XP_008440049.1|  PREDICTED: probable serine/threonine-protein...    128   2e-28   
ref|XP_006650079.1|  PREDICTED: probable serine/threonine-protein...    126   2e-28   
ref|XP_004505575.1|  PREDICTED: probable serine/threonine-protein...    128   2e-28   
dbj|BAK06672.1|  predicted protein                                      129   2e-28   
gb|KHN03005.1|  Putative serine/threonine-protein kinase                127   2e-28   
ref|XP_007137880.1|  hypothetical protein PHAVU_009G163500g             127   2e-28   
ref|XP_002865826.1|  kinase family protein                              128   2e-28   
ref|XP_004161954.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    125   2e-28   
ref|XP_003573290.2|  PREDICTED: uncharacterized protein LOC100834933    130   2e-28   
ref|XP_006592612.1|  PREDICTED: probable serine/threonine-protein...    129   2e-28   
ref|XP_006385063.1|  hypothetical protein POPTR_0004s23550g             129   3e-28   
ref|XP_010093941.1|  putative serine/threonine-protein kinase           128   3e-28   
gb|EMT04194.1|  Putative serine/threonine-protein kinase                127   3e-28   
ref|XP_007147866.1|  hypothetical protein PHAVU_006G161400g             127   3e-28   
ref|XP_004954997.1|  PREDICTED: probable serine/threonine-protein...    128   3e-28   
gb|ABF95922.1|  Protein kinase domain containing protein, expressed     125   3e-28   
ref|XP_010655671.1|  PREDICTED: probable serine/threonine-protein...    118   3e-28   
ref|XP_003528653.1|  PREDICTED: probable serine/threonine-protein...    127   3e-28   
ref|XP_010921742.1|  PREDICTED: probable serine/threonine-protein...    127   4e-28   
gb|EEC82802.1|  hypothetical protein OsI_27571                          128   4e-28   
emb|CDP14791.1|  unnamed protein product                                128   4e-28   
ref|XP_004298098.1|  PREDICTED: probable serine/threonine-protein...    127   4e-28   
ref|XP_006402054.1|  hypothetical protein EUTSA_v10013077mg             127   4e-28   
ref|NP_001050108.1|  Os03g0349200                                       125   4e-28   
gb|KHN17474.1|  Putative serine/threonine-protein kinase                125   4e-28   
gb|KDO44513.1|  hypothetical protein CISIN_1g036122mg                   125   4e-28   
ref|XP_007154226.1|  hypothetical protein PHAVU_003G100900g             126   4e-28   
ref|XP_004503783.1|  PREDICTED: probable serine/threonine-protein...    127   5e-28   
ref|XP_008794856.1|  PREDICTED: probable serine/threonine-protein...    126   6e-28   
ref|XP_007147119.1|  hypothetical protein PHAVU_006G097500g             126   6e-28   
gb|EAZ05068.1|  hypothetical protein OsI_27258                          125   7e-28   
ref|XP_004164392.1|  PREDICTED: uncharacterized protein LOC101232128    122   8e-28   
ref|NP_001060831.1|  Os08g0112500                                       127   8e-28   
ref|XP_008364580.1|  PREDICTED: probable serine/threonine-protein...    126   8e-28   
gb|KDP22563.1|  hypothetical protein JCGZ_26394                         126   8e-28   
ref|XP_004959874.1|  PREDICTED: probable serine/threonine-protein...    125   9e-28   
ref|XP_002318759.2|  hypothetical protein POPTR_0012s10570g             126   9e-28   
dbj|BAC20085.1|  putative CRK1 protein(cdc2-related kinase 1)           126   1e-27   
ref|XP_003557843.1|  PREDICTED: probable serine/threonine-protein...    125   1e-27   
ref|XP_002322289.2|  hypothetical protein POPTR_0015s11450g             126   1e-27   
gb|ABK93496.1|  unknown                                                 126   1e-27   
ref|XP_003562490.1|  PREDICTED: probable serine/threonine-protein...    125   1e-27   
gb|KGN64435.1|  hypothetical protein Csa_1G051730                       125   1e-27   
ref|XP_011012673.1|  PREDICTED: probable serine/threonine-protein...    125   1e-27   
gb|EEE67776.1|  hypothetical protein OsJ_25501                          125   1e-27   
ref|XP_011015566.1|  PREDICTED: probable serine/threonine-protein...    125   1e-27   
ref|XP_004145145.1|  PREDICTED: probable serine/threonine-protein...    125   1e-27   
ref|XP_008239634.1|  PREDICTED: uncharacterized protein LOC103338230    127   1e-27   
gb|EYU43895.1|  hypothetical protein MIMGU_mgv1a003878mg                125   1e-27   
ref|NP_001168769.1|  uncharacterized LOC100382566                       125   1e-27   
ref|XP_002264491.2|  PREDICTED: probable serine/threonine-protein...    126   1e-27   
gb|KEH24542.1|  cyclin-dependent kinase                                 124   1e-27   
emb|CDX71637.1|  BnaC09g26780D                                          125   1e-27   
ref|XP_006659052.1|  PREDICTED: probable serine/threonine-protein...    126   1e-27   
gb|KHN31275.1|  Putative serine/threonine-protein kinase                124   1e-27   
emb|CBI17622.3|  unnamed protein product                                119   1e-27   
ref|XP_002511120.1|  DNA binding protein, putative                      127   2e-27   
gb|EAY89996.1|  hypothetical protein OsI_11562                          125   2e-27   
ref|XP_003524475.1|  PREDICTED: probable serine/threonine-protein...    125   2e-27   
ref|XP_007038087.1|  Kinase superfamily protein                         125   2e-27   
ref|XP_010482395.1|  PREDICTED: probable serine/threonine-protein...    125   2e-27   
ref|XP_006489159.1|  PREDICTED: probable serine/threonine-protein...    125   2e-27   
gb|EMT24715.1|  Putative serine/threonine-protein kinase                125   2e-27   
ref|XP_010442427.1|  PREDICTED: probable serine/threonine-protein...    125   2e-27   
ref|XP_002312751.2|  hypothetical protein POPTR_0008s20890g             125   2e-27   
ref|XP_008678323.1|  PREDICTED: probable serine/threonine-protein...    126   2e-27   
ref|XP_006419669.1|  hypothetical protein CICLE_v10004618mg             125   2e-27   
ref|XP_002461170.1|  hypothetical protein SORBIDRAFT_02g042260          124   2e-27   
ref|XP_010442568.1|  PREDICTED: probable serine/threonine-protein...    125   2e-27   
ref|XP_010555575.1|  PREDICTED: probable serine/threonine-protein...    125   2e-27   
ref|XP_010649299.1|  PREDICTED: probable serine/threonine-protein...    119   2e-27   
ref|XP_003554681.1|  PREDICTED: probable serine/threonine-protein...    125   2e-27   
ref|XP_006855464.1|  hypothetical protein AMTR_s00057p00183920          124   3e-27   
ref|XP_002276606.1|  PREDICTED: probable serine/threonine-protein...    124   3e-27   
ref|XP_003626368.1|  Cdc2-like protein kinase                           124   3e-27   
gb|KHN43230.1|  Putative serine/threonine-protein kinase                125   3e-27   
gb|AAL56635.1|AF120153_1  cyclin-dependent kinase CDC2C                 125   3e-27   
ref|XP_004300004.1|  PREDICTED: probable serine/threonine-protein...    125   3e-27   
emb|CBI26114.3|  unnamed protein product                                124   3e-27   
ref|XP_008648016.1|  PREDICTED: uncharacterized protein LOC100381...    125   3e-27   
dbj|BAJ91828.1|  predicted protein                                      124   4e-27   
gb|KHN23956.1|  Putative serine/threonine-protein kinase                123   4e-27   
gb|EEE61968.1|  hypothetical protein OsJ_16744                          122   4e-27   
dbj|BAJ86619.1|  predicted protein                                      124   4e-27   
dbj|BAJ97237.1|  predicted protein                                      124   4e-27   
ref|XP_003523166.1|  PREDICTED: probable serine/threonine-protein...    124   4e-27   
ref|XP_007148580.1|  hypothetical protein PHAVU_006G220500g             124   4e-27   
ref|XP_010910391.1|  PREDICTED: probable serine/threonine-protein...    125   4e-27   
ref|XP_006441627.1|  hypothetical protein CICLE_v100239741mg            117   5e-27   
ref|NP_001170286.1|  uncharacterized LOC100384249                       124   5e-27   
ref|XP_006594477.1|  PREDICTED: probable serine/threonine-protein...    123   5e-27   
gb|KDO53901.1|  hypothetical protein CISIN_1g005111mg                   125   5e-27   
ref|XP_007198826.1|  hypothetical protein PRUPE_ppa002174mg             124   5e-27   
ref|XP_008223102.1|  PREDICTED: probable serine/threonine-protein...    124   5e-27   
ref|XP_003542916.1|  PREDICTED: probable serine/threonine-protein...    123   5e-27   
ref|XP_004501733.1|  PREDICTED: probable serine/threonine-protein...    124   5e-27   
ref|XP_011047864.1|  PREDICTED: probable serine/threonine-protein...    124   5e-27   
ref|XP_003594001.1|  hypothetical protein MTR_2g020210                  123   6e-27   
ref|XP_003607463.1|  hypothetical protein MTR_4g078290                  124   6e-27   
emb|CDY05828.1|  BnaA10g05920D                                          124   6e-27   
gb|KEH30685.1|  cyclin-dependent kinase                                 124   6e-27   
ref|XP_010678314.1|  PREDICTED: probable serine/threonine-protein...    124   6e-27   
ref|XP_006447296.1|  hypothetical protein CICLE_v10014434mg             124   6e-27   
ref|XP_008342901.1|  PREDICTED: probable serine/threonine-protein...    124   7e-27   
ref|XP_004972482.1|  PREDICTED: probable serine/threonine-protein...    124   7e-27   
ref|XP_003546100.1|  PREDICTED: probable serine/threonine-protein...    123   8e-27   
ref|XP_003521735.1|  PREDICTED: probable serine/threonine-protein...    123   8e-27   
ref|XP_007148581.1|  hypothetical protein PHAVU_006G220500g             124   8e-27   
gb|KHN04043.1|  Putative serine/threonine-protein kinase                123   8e-27   
ref|XP_008670639.1|  PREDICTED: probable serine/threonine-protein...    123   8e-27   
ref|XP_011090850.1|  PREDICTED: probable serine/threonine-protein...    123   9e-27   
emb|CDO98674.1|  unnamed protein product                                123   1e-26   
ref|NP_198758.2|  cyclin-dependent kinase CDC2C                         123   1e-26   
ref|XP_007222466.1|  hypothetical protein PRUPE_ppa003511mg             122   1e-26   
ref|XP_003526935.1|  PREDICTED: probable serine/threonine-protein...    122   1e-26   
gb|EEC76758.1|  hypothetical protein OsI_14831                          121   1e-26   
ref|XP_006280224.1|  hypothetical protein CARUB_v10026141mg             122   1e-26   
ref|XP_008229000.1|  PREDICTED: probable serine/threonine-protein...    123   1e-26   
ref|XP_009405101.1|  PREDICTED: probable serine/threonine-protein...    123   1e-26   
ref|XP_002465275.1|  hypothetical protein SORBIDRAFT_01g035420          120   1e-26   
ref|XP_009611564.1|  PREDICTED: probable serine/threonine-protein...    122   1e-26   
gb|KDP40024.1|  hypothetical protein JCGZ_02022                         122   2e-26   
ref|XP_004134185.1|  PREDICTED: probable serine/threonine-protein...    122   2e-26   
ref|XP_004984389.1|  PREDICTED: probable serine/threonine-protein...    122   2e-26   
ref|XP_009140887.1|  PREDICTED: probable serine/threonine-protein...    122   2e-26   
ref|XP_009341988.1|  PREDICTED: probable serine/threonine-protein...    123   2e-26   
ref|XP_009336210.1|  PREDICTED: probable serine/threonine-protein...    123   2e-26   
ref|XP_003630554.1|  hypothetical protein MTR_8g099770                  122   2e-26   
ref|XP_009341987.1|  PREDICTED: probable serine/threonine-protein...    123   2e-26   
ref|XP_010533338.1|  PREDICTED: probable serine/threonine-protein...    115   2e-26   
ref|XP_009336211.1|  PREDICTED: probable serine/threonine-protein...    123   2e-26   
ref|XP_010105022.1|  putative serine/threonine-protein kinase           122   2e-26   
ref|XP_004159827.1|  PREDICTED: probable serine/threonine-protein...    122   2e-26   
ref|XP_009394765.1|  PREDICTED: probable serine/threonine-protein...    122   2e-26   
ref|XP_008438801.1|  PREDICTED: probable serine/threonine-protein...    122   2e-26   
emb|CDY31076.1|  BnaA08g26260D                                          122   2e-26   
ref|XP_009111211.1|  PREDICTED: probable serine/threonine-protein...    122   3e-26   
ref|XP_004229198.1|  PREDICTED: probable serine/threonine-protein...    122   3e-26   
ref|XP_003609580.1|  hypothetical protein MTR_4g118780                  121   3e-26   
ref|XP_004298538.1|  PREDICTED: uncharacterized protein LOC101314850    123   3e-26   
gb|KHG25473.1|  hypothetical protein F383_09936                         121   3e-26   
ref|XP_010243586.1|  PREDICTED: probable serine/threonine-protein...    121   3e-26   
gb|KHG25474.1|  hypothetical protein F383_09936                         121   3e-26   
ref|XP_010024564.1|  PREDICTED: probable serine/threonine-protein...    121   3e-26   
ref|XP_010689018.1|  PREDICTED: probable serine/threonine-protein...    122   3e-26   
ref|XP_004494661.1|  PREDICTED: probable serine/threonine-protein...    121   3e-26   
ref|XP_004486064.1|  PREDICTED: probable serine/threonine-protein...    121   3e-26   
gb|KHG25472.1|  hypothetical protein F383_09936                         122   4e-26   
ref|XP_003536103.1|  PREDICTED: probable serine/threonine-protein...    121   4e-26   
ref|XP_006382713.1|  hypothetical protein POPTR_0005s04700g             121   4e-26   
ref|XP_007035478.1|  Serine/threonine-protein kinase isoform 2          121   4e-26   
gb|KHN16166.1|  Putative serine/threonine-protein kinase                121   5e-26   
ref|XP_009385023.1|  PREDICTED: probable serine/threonine-protein...    121   5e-26   
ref|XP_009763727.1|  PREDICTED: probable serine/threonine-protein...    121   5e-26   
ref|XP_011071483.1|  PREDICTED: probable serine/threonine-protein...    121   5e-26   
ref|XP_011071482.1|  PREDICTED: probable serine/threonine-protein...    121   5e-26   
ref|XP_011090852.1|  PREDICTED: probable serine/threonine-protein...    121   5e-26   
ref|XP_009352210.1|  PREDICTED: probable serine/threonine-protein...    120   6e-26   
ref|XP_003550528.1|  PREDICTED: probable serine/threonine-protein...    120   6e-26   
gb|KHG12525.1|  hypothetical protein F383_07669                         120   6e-26   
ref|XP_008390743.1|  PREDICTED: probable serine/threonine-protein...    120   6e-26   
gb|EYU24917.1|  hypothetical protein MIMGU_mgv1a002276mg                121   7e-26   
emb|CDO98917.1|  unnamed protein product                                120   8e-26   
ref|XP_010035763.1|  PREDICTED: probable serine/threonine-protein...    121   8e-26   
gb|EYU43892.1|  hypothetical protein MIMGU_mgv1a003944mg                120   9e-26   
ref|XP_007159986.1|  hypothetical protein PHAVU_002G283400g             118   9e-26   
ref|XP_002284341.1|  PREDICTED: probable serine/threonine-protein...    120   9e-26   
ref|NP_001148044.1|  transposon protein                                 120   1e-25   
gb|EYU32922.1|  hypothetical protein MIMGU_mgv1a003828mg                120   1e-25   
emb|CAB89490.1|  CRK1 protein                                           120   1e-25   
ref|XP_010674933.1|  PREDICTED: probable serine/threonine-protein...    120   1e-25   
ref|XP_008791083.1|  PREDICTED: probable serine/threonine-protein...    118   1e-25   
ref|XP_006283311.1|  hypothetical protein CARUB_v10004349mg             120   1e-25   
ref|XP_009132688.1|  PREDICTED: probable serine/threonine-protein...    120   1e-25   
ref|XP_010024565.1|  PREDICTED: probable serine/threonine-protein...    120   1e-25   
emb|CBI30905.3|  unnamed protein product                                116   1e-25   
ref|XP_007030691.1|  Serine/threonine-protein kinase isoform 2          120   1e-25   
ref|XP_007035477.1|  Serine/threonine-protein kinase isoform 1          120   1e-25   
ref|XP_003532395.1|  PREDICTED: probable serine/threonine-protein...    119   1e-25   
ref|XP_007030690.1|  Serine/threonine-protein kinase isoform 1          119   1e-25   
ref|XP_011071480.1|  PREDICTED: probable serine/threonine-protein...    119   2e-25   
gb|EPS63681.1|  hypothetical protein M569_11103                         120   2e-25   
tpg|DAA45358.1|  TPA: putative protein kinase superfamily protein       119   2e-25   
ref|XP_008799326.1|  PREDICTED: probable serine/threonine-protein...    119   2e-25   
ref|XP_008799327.1|  PREDICTED: probable serine/threonine-protein...    119   2e-25   
ref|XP_011083509.1|  PREDICTED: probable serine/threonine-protein...    119   2e-25   
ref|XP_009403778.1|  PREDICTED: probable serine/threonine-protein...    119   2e-25   
ref|XP_002514714.1|  ATP binding protein, putative                      119   2e-25   
ref|XP_011032535.1|  PREDICTED: probable serine/threonine-protein...    119   2e-25   
ref|XP_007043608.1|  ATP binding protein, putative                      120   2e-25   



>ref|XP_009774626.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Nicotiana sylvestris]
Length=724

 Score =   234 bits (597),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 168/370 (45%), Positives = 215/370 (58%), Gaps = 70/370 (19%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +ATIFKP++ Y+R +A TFKD   S+L+LLDSLL+ EPE 
Sbjct  361   KIFKLCGSPSEEYWKKSKLPHATIFKPQQPYKRCLANTFKDFPASALALLDSLLAFEPEY  420

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEG--  1156
             RG+A+ AL++EFFTT PLPCDPS+LPKYPP KE+DA+MR+E  RRQ G G K    E   
Sbjct  421   RGSATLALQSEFFTTKPLPCDPSSLPKYPPSKEFDAKMREEEARRQRGGGTKGSGVESNR  480

Query  1155  -------ATPAPGDLAKLQDAIKKWQGQ---------LKLKKCGG---------------  1069
                    A PAP   A+L  +I+KW+ Q            ++ GG               
Sbjct  481   KGAKQSKAVPAPDANAELPASIQKWKQQSNPTSISEKYSREEDGGSGFPIDPSRGSLYNS  540

Query  1068  -MSEVDNSRR--------LG-------GSELSRHVSFKARG-----GGVGQLPMFCSSAA  952
              +S+V +S          LG       G + SR     ARG     G   QL  F +S A
Sbjct  541   HLSQVSDSANSINTDTNGLGPLMSSQRGFDSSRFGELCARGSFRPHGAAAQLSRFSNSVA  600

Query  951   PHPAAIGLDLCREDISVNSHW--HRLAMKCNRVIDNES-------DHHYQNDEQKPRKDT  799
              H ++      R D+S +S W    +  K N++ D++S       D   + D+    K++
Sbjct  601   AHGSS------RFDMSRDSQWPEEHMTGKYNQLNDSDSSYSLLGKDSPNKKDKHSTGKES  654

Query  798   MMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQT  619
               GY+P+   IHYSGPL+P GGNIDEMLKEHEKQIQ AVRKARLDK +K KK + D GQT
Sbjct  655   TAGYIPKKNRIHYSGPLMPLGGNIDEMLKEHEKQIQQAVRKARLDK-NKIKKEHNDNGQT  713

Query  618   ESLLQYVGNA  589
             ESLL Y  N 
Sbjct  714   ESLLHYTSNG  723



>emb|CDO97634.1| unnamed protein product [Coffea canephora]
Length=725

 Score =   231 bits (590),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 168/364 (46%), Positives = 208/364 (57%), Gaps = 65/364 (18%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +ATIFKP+  Y+R + ETFKD  PS+L+LLDSLL+ EPER
Sbjct  359   KIFKLCGSPSEEYWKKSKLPHATIFKPQHPYKRSVGETFKDFPPSALTLLDSLLAFEPER  418

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEG--  1156
             RG+A+SALE+EFFTT PLPC PS+LPKYPP KE+DA++RDE  RRQ  +G K +  E   
Sbjct  419   RGSATSALESEFFTTKPLPCAPSSLPKYPPSKEFDAKIRDEEARRQKAAGSKGRGIESYR  478

Query  1155  -------ATPAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGS-----------  1030
                    A PAP   A+L  +++KWQ Q   K    +SE  N    GGS           
Sbjct  479   KGSKESKAVPAPDANAELLTSMQKWQAQSNPKS---ISEKYNHEEDGGSGFPIEPSRPSL  535

Query  1029  --------------------ELSRHVSFKARG------------GGVGQLPMFCSSAAPH  946
                                 E   +++    G            G   +L  F +S A H
Sbjct  536   NKGHLLQNGASRSSLNMDVNEAGSNINCSRYGAESRMQIPNKSQGTAAKLSRFSNSVAAH  595

Query  945   PAAIGLDLCREDISVNSHW--HRL---AMKCNRVIDNESDHHYQNDEQKPRKDTMMGYVP  781
              ++  LDL  E  S +  W   RL      C+ +    S H+   DEQ  RK+   GY  
Sbjct  596   GSS-HLDLSGEG-STHPQWMEERLNDSGSTCHLLGGTSSSHN--KDEQAYRKEFNGGYAL  651

Query  780   QTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQTESLLQY  601
             +   IHYSGPL+P GGNI+EMLKEHEKQIQNAVRKAR+DK +K  K   D GQTE LLQY
Sbjct  652   KKSRIHYSGPLLPPGGNIEEMLKEHEKQIQNAVRKARIDK-NKNTKTYADNGQTELLLQY  710

Query  600   VGNA  589
             VGN 
Sbjct  711   VGNG  714



>ref|XP_009611194.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Nicotiana tomentosiformis]
Length=722

 Score =   231 bits (588),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 165/368 (45%), Positives = 208/368 (57%), Gaps = 68/368 (18%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +ATIFKP++ Y+R +A TFKD   S+L+LLDSLL+ EPE 
Sbjct  361   KIFKLCGSPSEEYWKKSKLPHATIFKPQQPYKRCLANTFKDFPVSALALLDSLLAFEPEY  420

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEG--  1156
             RG+A+ AL++EFFTT PLPCDPS+LPKYPP KE+DA+MR+E  RRQ G G K    E   
Sbjct  421   RGSATLALQSEFFTTKPLPCDPSSLPKYPPSKEFDAKMREEEARRQRGGGIKGSGVESNR  480

Query  1155  -------ATPAPGDLAKLQDAIKKWQ----------------------------GQLKLK  1081
                    A PAP   A+L  +I+KW+                            G L   
Sbjct  481   KGAKQSKAVPAPDANAELPASIQKWKQLSNPTSISEKYSREEDGGSGFPIDPSRGSLYNG  540

Query  1080  KCGGMSEVDNS-----RRLG-------GSELSRHVSFKARG-----GGVGQLPMFCSSAA  952
                 +S+  NS       LG       G + SR     ARG     G   QL  F +S A
Sbjct  541   HSSQVSDSGNSINTNINGLGPLMSSQRGFDSSRFGELSARGSFRPHGAAAQLSRFSNSVA  600

Query  951   PHPAAIGLDLCREDISVNSHW--HRLAMKCNRVIDNE-----SDHHYQNDEQKPRKDTMM  793
              H ++      R D+S +S W    +  K N++ D+       D   + D+    K++  
Sbjct  601   AHGSS------RFDMSRDSQWPEEHMTGKYNQLNDSSYSLLGKDSSSKKDKHSTGKESTA  654

Query  792   GYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQTES  613
             GY+P+   IHYSGPL+P GGNIDEMLKEHEKQIQ AVRKARLDK +K KK +   GQTES
Sbjct  655   GYIPKKNRIHYSGPLMPPGGNIDEMLKEHEKQIQQAVRKARLDK-NKMKKEHNGNGQTES  713

Query  612   LLQYVGNA  589
             LL Y  N 
Sbjct  714   LLHYTSNG  721



>ref|XP_010314442.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Solanum lycopersicum]
Length=732

 Score =   224 bits (572),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 162/374 (43%), Positives = 209/374 (56%), Gaps = 71/374 (19%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +ATIFKP++ Y+R +A  FKD  PS+L LLDSLL+ EPE 
Sbjct  362   KIFKLCGSPSEEYWKKSKLPHATIFKPQQPYKRCLASIFKDFPPSALVLLDSLLAFEPEY  421

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEG--  1156
             RG+A+ AL+NEFFTT PLPCDPS+LPKYPP KE+DA+MRDE  RRQ G   +     G  
Sbjct  422   RGSATLALQNEFFTTKPLPCDPSSLPKYPPSKEFDAKMRDEEARRQRGEAREGTKGSGIE  481

Query  1155  ----------ATPAPGDLAKLQDAIKKWQGQLKLKKC-----------------------  1075
                       A PAP   A+L  +I+K + QL                            
Sbjct  482   SCRKAAKQSKAVPAPDANAELPASIQKRKQQLNPTSVSEKYNHEEDGGLVFPFDPSRRSL  541

Query  1074  --GGMSEVDNS------------------RRLGGS---ELSRHVSFKARGGGVGQLPMFC  964
               G +S+V +S                  R    S   ELS   SF+  G     L  F 
Sbjct  542   YNGHLSQVSDSGNSIDTNTNGLGPLMSSQRAFDSSIFGELSAQNSFRPHGAA-AHLSRFS  600

Query  963   SSAAPHPAAIGLDLCREDISVNSHW--HRLAMKCNRVIDNES-------DHHYQNDEQKP  811
             +S A H ++   D+ RE +S +S W         N++ D++S       D   + D+   
Sbjct  601   NSVAAHGSS-RYDMSRE-VSTHSQWPEEHTTGTYNQLNDSDSSYSLLGKDSSNKKDKHST  658

Query  810   RKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNID  631
              K++ +GY+P+   IHYSGPL+P GGNIDEMLKEHEKQIQ AVRKAR+D+ +K +K + D
Sbjct  659   GKESAVGYIPKKNRIHYSGPLMPPGGNIDEMLKEHEKQIQQAVRKARIDR-NKIRKEHTD  717

Query  630   YGQTESLLQYVGNA  589
              GQTESLL Y  N 
Sbjct  718   NGQTESLLHYTTNG  731



>ref|XP_006349306.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Solanum tuberosum]
Length=729

 Score =   223 bits (568),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 162/371 (44%), Positives = 206/371 (56%), Gaps = 68/371 (18%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +ATIFKP++ Y+  +A  FKD  PS+L LLDSLL+ EPE 
Sbjct  362   KIFKLCGSPSEEYWKKSKLPHATIFKPQQPYKHCLANIFKDFPPSALVLLDSLLAFEPEY  421

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEG--  1156
             RG+A+ AL+NEFFTT PLPCDPS+LPKYPP KE+DA+MRDE  RRQ G G K    E   
Sbjct  422   RGSATLALQNEFFTTKPLPCDPSSLPKYPPSKEFDAKMRDEEARRQRGEGTKGSGIESCR  481

Query  1155  -------ATPAPGDLAKLQDAIKKWQGQLKLKKC-------------------------G  1072
                    A PAP   A+L  +I+K + QL                              G
Sbjct  482   KAAKQSKAVPAPDANAELPASIQKRKQQLNPTSVSEKYNHEQDGGPVFPFDPSRGSLNNG  541

Query  1071  GMSEVD--------NSRRLG-------------GSELSRHVSFKARGGGVGQLPMFCSSA  955
              +S+V         N+  LG               ELS   SF+  G     L  F +S 
Sbjct  542   HLSQVSDSGNSINTNTNGLGPLMSSQQAFDSSIFGELSAQKSFRPHGAA-AHLSRFSNSV  600

Query  954   APHPAAIGLDLCREDISVNSHW--HRLAMKCNRVIDNES-------DHHYQNDEQKPRKD  802
             A H ++   D+ R  +S  S W         N++ D++S       D   + D+    K+
Sbjct  601   AAHGSS-RYDMSRA-VSTQSQWPEEHTTGTYNQLNDSDSSYSLLGKDSSNKKDKHTTGKE  658

Query  801   TMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQ  622
             + +GY+P+   IHYSGPL+P GGNIDEMLKEHEKQIQ AVRKAR+D+ +K +K   D GQ
Sbjct  659   SAVGYIPKKNRIHYSGPLMPPGGNIDEMLKEHEKQIQQAVRKARIDR-NKIRKNLTDNGQ  717

Query  621   TESLLQYVGNA  589
             TESLL Y  N 
Sbjct  718   TESLLHYTTNG  728



>ref|XP_011092281.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
isoform X2 [Sesamum indicum]
Length=718

 Score =   216 bits (550),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 161/370 (44%), Positives = 202/370 (55%), Gaps = 73/370 (20%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +ATIFKP+  Y R I ETFKD  PS+LSLL+SLL+ E E 
Sbjct  358   KIFKLCGSPSEEYWKTSKLPHATIFKPQHPYRRCITETFKDFPPSALSLLESLLAFEAEL  417

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNG---------SGY  1177
             RGT +SAL +EFFTT PLPCDPS+LPKYPP KE+DA+MRDE  RRQ           S  
Sbjct  418   RGTTTSALHSEFFTTKPLPCDPSSLPKYPPSKEFDAKMRDEEARRQKAAGGKGGGAESSR  477

Query  1176  KCKDSEGATPAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVD-------------------  1054
             K      A PAP   A+LQ +I+KW+ Q   K    M                       
Sbjct  478   KGSKESRAVPAPDANAELQASIQKWKEQSNPKSNSEMYNRGENGGSGFPMGPSRGSLQTG  537

Query  1053  ---------------------NSRR----LGGSELSRHVSFKARGGGVGQLPMFCSSAAP  949
                                  NSRR     G  EL    SFK + G   +L  F +  A 
Sbjct  538   HSMLMGSSGSSSQAADEGLHINSRRALDSTGCRELKIQRSFKPQ-GTTSRLSRFSNLVA-  595

Query  948   HPAAIGLDLCREDISVNSHW--HRLAMKCNRVIDNESDHH--------YQNDEQKPRKDT  799
                +  LD  R+      HW  H    +  ++ + ES +H        ++++ Q PRK+ 
Sbjct  596   -DGSSQLDFSRD------HWPDHCSNTRYEQINEGESSNHLLGRPDSPHKSNGQAPRKEN  648

Query  798   MMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQT  619
               GY  +   +HYSGPL+P GG+++EMLKEHEKQIQ AVRKAR+DK +K +KG  D GQT
Sbjct  649   NTGYGFKKTRMHYSGPLLPPGGSVEEMLKEHEKQIQIAVRKARIDK-NKTRKGYTDNGQT  707

Query  618   ESLLQYVGNA  589
             +SLL YV N 
Sbjct  708   DSLLGYVNNG  717



>ref|XP_011092279.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
isoform X1 [Sesamum indicum]
 ref|XP_011092280.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
isoform X1 [Sesamum indicum]
Length=750

 Score =   216 bits (550),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 161/370 (44%), Positives = 202/370 (55%), Gaps = 73/370 (20%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +ATIFKP+  Y R I ETFKD  PS+LSLL+SLL+ E E 
Sbjct  390   KIFKLCGSPSEEYWKTSKLPHATIFKPQHPYRRCITETFKDFPPSALSLLESLLAFEAEL  449

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNG---------SGY  1177
             RGT +SAL +EFFTT PLPCDPS+LPKYPP KE+DA+MRDE  RRQ           S  
Sbjct  450   RGTTTSALHSEFFTTKPLPCDPSSLPKYPPSKEFDAKMRDEEARRQKAAGGKGGGAESSR  509

Query  1176  KCKDSEGATPAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVD-------------------  1054
             K      A PAP   A+LQ +I+KW+ Q   K    M                       
Sbjct  510   KGSKESRAVPAPDANAELQASIQKWKEQSNPKSNSEMYNRGENGGSGFPMGPSRGSLQTG  569

Query  1053  ---------------------NSRR----LGGSELSRHVSFKARGGGVGQLPMFCSSAAP  949
                                  NSRR     G  EL    SFK + G   +L  F +  A 
Sbjct  570   HSMLMGSSGSSSQAADEGLHINSRRALDSTGCRELKIQRSFKPQ-GTTSRLSRFSNLVA-  627

Query  948   HPAAIGLDLCREDISVNSHW--HRLAMKCNRVIDNESDHH--------YQNDEQKPRKDT  799
                +  LD  R+      HW  H    +  ++ + ES +H        ++++ Q PRK+ 
Sbjct  628   -DGSSQLDFSRD------HWPDHCSNTRYEQINEGESSNHLLGRPDSPHKSNGQAPRKEN  680

Query  798   MMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQT  619
               GY  +   +HYSGPL+P GG+++EMLKEHEKQIQ AVRKAR+DK +K +KG  D GQT
Sbjct  681   NTGYGFKKTRMHYSGPLLPPGGSVEEMLKEHEKQIQIAVRKARIDK-NKTRKGYTDNGQT  739

Query  618   ESLLQYVGNA  589
             +SLL YV N 
Sbjct  740   DSLLGYVNNG  749



>ref|XP_009355345.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Pyrus x bretschneideri]
Length=725

 Score =   214 bits (545),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 160/355 (45%), Positives = 205/355 (58%), Gaps = 61/355 (17%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +ATIFKP   Y+R +AET+KD   S+L+LL+ LL++EPE 
Sbjct  383   KIFKLCGSPSEEYWKRSKLPHATIFKPTHPYKRCVAETYKDFPRSALALLEVLLAVEPEG  442

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGTASSAL++EFFT+ PLPCDPS+LPKYPP KE+DA++RDE  RR+  +  K   S+ + 
Sbjct  443   RGTASSALQSEFFTSLPLPCDPSSLPKYPPSKEFDAKLRDEEARRRKAASGKGGSSKESK  502

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSEL------------------  1024
               P   A   +AI++ QGQ   K    +SE  N    GGS                    
Sbjct  503   AVPASDA---NAIQR-QGQTNPK---SISEKYNPEEDGGSGFPIEPPKGAASNAFSHSGQ  555

Query  1023  --------------SRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSHW-  889
                           S++ S+  R  G  Q   + +SA+    +   D   E  S N HW 
Sbjct  556   SVRPSAFESLQSSHSKNGSYMYR--GAAQSSRYSNSASVRSGS-RFDGIAE--SANPHWP  610

Query  888   -HRLAMKCNRVIDNES------DHH--------YQNDEQKPRKDTMMGYVPQTGHIHYSG  754
               R   + N + + ES       HH        ++ DEQ   K+   GY  +   IHYSG
Sbjct  611   EERKNARYNHLDNGESSVKHDWSHHLLERPKSSHKKDEQPSGKEYATGYGNKKNRIHYSG  670

Query  753   PLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQTESLLQYVGNA  589
             PL+  GGN++EMLKEHEKQIQ+AVRKARLDKT KAKK N D GQTESLLQ+V N 
Sbjct  671   PLMHPGGNLEEMLKEHEKQIQHAVRKARLDKT-KAKKANSDNGQTESLLQHVRNG  724



>ref|XP_010065274.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Eucalyptus grandis]
 gb|KCW62682.1| hypothetical protein EUGRSUZ_G00243 [Eucalyptus grandis]
Length=718

 Score =   214 bits (544),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 152/369 (41%), Positives = 202/369 (55%), Gaps = 73/369 (20%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +ATIFKP++ Y+R + ETFKD   S+L LLD LL++EPE 
Sbjct  355   KIFKLCGSPSEEYWKKSKLPHATIFKPQQPYKRCLLETFKDFPSSALGLLDVLLAVEPEC  414

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEG--  1156
             RGTASSAL+NEFFT+ PLP DPS+LPKYP  KE+DAR+RDE  R+   +  K +  E   
Sbjct  415   RGTASSALQNEFFTSNPLPSDPSSLPKYPSSKEFDARLRDEEARKHKATAGKARGLESIR  474

Query  1155  -------ATPAPGDLAKLQDAIKKWQGQLKLKKCG-----------------------GM  1066
                      P     A L+ +I+K Q Q   +  G                       G 
Sbjct  475   KGSKESKVVPTSNANADLKASIQKRQEQSNPRSTGEKPGGTTQNNFILSGQSAQPSLNGS  534

Query  1065  SEVDNSRRL--------------GGSELSRHVSFKARGGGVGQLPMFCSSAAPHPAAIGL  928
             +++ N+  +              GG+EL R  SF  R     QL  F +S      A+G 
Sbjct  535   TQIGNANEVEALIVPDRELDSPRGGAELRRQRSFMQR--RASQLSRFSNS-----VAVGG  587

Query  927   DL---CREDISVNSHWHR--LAMKCNR------VIDNESDHH--------YQNDEQKPRK  805
             D    C  +   N+ W       +C+       V  ++  HH        ++   +  R+
Sbjct  588   DSHLDCSREKGANTQWRDEGFVARCSHPDGGELVGKHDWSHHLLHRPISLFKKGGEHSRR  647

Query  804   DTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYG  625
             D++  Y P+ G IHYSGPL+P+G N+DEMLKEHE+QIQNAVRKARLDK  K K+   D+G
Sbjct  648   DSIASYSPKKGRIHYSGPLLPSGDNLDEMLKEHERQIQNAVRKARLDKV-KTKREYADHG  706

Query  624   QTESLLQYV  598
             QTESLL + 
Sbjct  707   QTESLLYWA  715



>ref|XP_008365328.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Malus domestica]
Length=725

 Score =   213 bits (542),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 160/355 (45%), Positives = 204/355 (57%), Gaps = 61/355 (17%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +ATIFKP   Y+R +AET+KD   S+L+LL+ LL++EPE 
Sbjct  383   KIFKLCGSPSEEYWKRSKLPHATIFKPTHPYKRCVAETYKDFPRSALALLEVLLAVEPEG  442

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGTASSAL++E FT+ PLPCDPS+LPKYPP KE+DA++RDE  RR+  +  K   S+ + 
Sbjct  443   RGTASSALQSELFTSLPLPCDPSSLPKYPPSKEFDAKLRDEEARRRKAASGKGGSSKDSK  502

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSEL------------------  1024
               P   A   +AI++ QGQ   K    +SE  N    GGS                    
Sbjct  503   AVPASDA---NAIQR-QGQTNPK---SISEKYNPEEDGGSGFPIEPPKGAASNAFSHSGQ  555

Query  1023  --------------SRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSHW-  889
                           S++ S+  R  G  Q   F +SA+    +   D   E  S N HW 
Sbjct  556   SVHPSAFESLQSGHSKNGSYMYR--GAAQSSRFSNSASVRSGS-RFDGIAE--SANPHWP  610

Query  888   -HRLAMKCNRVIDNES------DHH--------YQNDEQKPRKDTMMGYVPQTGHIHYSG  754
               R   + N + + ES       HH        ++ DEQ   K+   GY  +   IHYSG
Sbjct  611   EERKNARYNHLDNGESSVKHDWSHHLLERPKSSHKKDEQPSGKEYATGYGNKKNRIHYSG  670

Query  753   PLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQTESLLQYVGNA  589
             PL+  GGN++EMLKEHEKQIQ+AVRKARLDKT KAKK N D GQTESLLQ+V N 
Sbjct  671   PLMHPGGNLEEMLKEHEKQIQHAVRKARLDKT-KAKKANSDNGQTESLLQHVRNG  724



>gb|EYU33285.1| hypothetical protein MIMGU_mgv1a002177mg [Erythranthe guttata]
Length=705

 Score =   213 bits (541),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 157/352 (45%), Positives = 205/352 (58%), Gaps = 52/352 (15%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSP++E+WK SKL +ATIFKP++ Y R +AETFK+   S+LSLLDSLL+ EPE 
Sbjct  358   KIFKLCGSPAEEYWKRSKLPHATIFKPQQPYRRCVAETFKEFPSSTLSLLDSLLAFEPEC  417

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQ---NGSG-------  1180
             RGT +SAL +EFFTT PLPCDPS+LPKYPP KE+DA++RDE  RRQ   NG G       
Sbjct  418   RGTTTSALHSEFFTTKPLPCDPSSLPKYPPSKEFDAKVRDEEARRQRAANGKGGGAESSR  477

Query  1179  YKCKDSEGATPAPGDLAKLQDAIKKWQGQ-------------------LKLKKCGGMSEV  1057
                KDS+ A PAP   A+LQ +I+K +G                      ++    +  V
Sbjct  478   KGSKDSK-AVPAPDANAELQVSIQKRKGLANPKSNTEVYNPKGDGESGFLMEASRTLDAV  536

Query  1056  DNSRRL---------GGSELSRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDIS  904
             D  R L         G  EL    SFK +     +L  F +S A   ++  LD  R D S
Sbjct  537   DEGRHLSSYRGLDSSGYRELKTQRSFKPQTTS-ARLSKFSNSVASRGSS-QLDFSR-DSS  593

Query  903   VNSHW---HRL-----AMKCNRVIDNESDHHYQNDEQKPRKDTMMGYVPQTGHIHYSGPL  748
             ++SHW   +R      A   N ++   +  H  N+ + P K+T   Y  +   +HYSGPL
Sbjct  594   IHSHWPNNNRYEQMNDAESSNHLLGRPNSPHKNNNGEAPLKETDAVYALKKTRMHYSGPL  653

Query  747   IPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQTESLLQYVGN  592
             +P GG+++EMLKEHEKQIQ AVRKAR  + +  +K   D GQT+ LL YV N
Sbjct  654   LPHGGSVEEMLKEHEKQIQIAVRKAR--EKNNTRKAQNDNGQTDLLLGYVSN  703



>ref|XP_008378912.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Malus domestica]
Length=725

 Score =   213 bits (541),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 161/355 (45%), Positives = 204/355 (57%), Gaps = 61/355 (17%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSP +E+WK SKL +ATIFKP   Y+R +AET+KD   SSL+LL+ LL++EPE 
Sbjct  383   KIFKLCGSPCEEYWKRSKLPHATIFKPTHPYKRCVAETYKDFPRSSLALLEVLLAVEPEG  442

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGTASSAL++EFFT+ PLPCDPS+LPKYPP KE+DA++RDE  RR+  +  K   S+ + 
Sbjct  443   RGTASSALQSEFFTSLPLPCDPSSLPKYPPSKEFDAKLRDEEARRRKAASGKGGSSKDSK  502

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSEL------------------  1024
               P   A   +AI++ QGQ   K    +SE  N    GGS                    
Sbjct  503   AVPASDA---NAIQR-QGQTNPK---SISEKYNPEEDGGSGFPIEPPKGAASNAFSHSGQ  555

Query  1023  --------------SRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSHW-  889
                           S++ S+  R  G  Q   F +SA+    +   D   E  S N HW 
Sbjct  556   SVHPSAFESLQSGHSKNGSYMYR--GAAQSSRFSNSASVRSGS-RFDGIAE--SANPHWP  610

Query  888   -HRLAMKCNRVIDNES------DHH--------YQNDEQKPRKDTMMGYVPQTGHIHYSG  754
               R   + N + + ES       HH        ++ DEQ   K+   GY  +   IHYSG
Sbjct  611   EERKNARYNHLDNGESSVKHDWSHHLLERPKSSHKKDEQPSGKEYATGYGNKKNRIHYSG  670

Query  753   PLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQTESLLQYVGNA  589
             PL+  GGN++EMLKEHEKQIQ+AVRKARLDKT KAKK N D GQTESLLQ+V N 
Sbjct  671   PLMHPGGNLEEMLKEHEKQIQHAVRKARLDKT-KAKKANSDNGQTESLLQHVRNG  724



>ref|XP_007041171.1| Serine/threonine-protein kinase cdk9 [Theobroma cacao]
 gb|EOX97002.1| Serine/threonine-protein kinase cdk9 [Theobroma cacao]
Length=748

 Score =   207 bits (528),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 162/382 (42%), Positives = 211/382 (55%), Gaps = 80/382 (21%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +ATIFKP+  Y+R + ETFKD   S+L+LL+ LL++EPE 
Sbjct  369   KIFKLCGSPSEEYWKRSKLPHATIFKPQLPYKRCVPETFKDFPSSALALLEVLLAIEPEC  428

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKD-----  1165
             RGTASSAL++EFFTT PLPCDPS+LPKYPP KE+DA++R+E  RR+  +G K  +     
Sbjct  429   RGTASSALQSEFFTTNPLPCDPSSLPKYPPSKEFDAKLREEESRRRRPAGGKVHEHNPVR  488

Query  1164  ----SEGATPAPGDLAKLQDAIKKWQGQLKLKKCG-------------------GMSEV-  1057
                    A PAP   A+LQ +I+K QGQ   K                      G + V 
Sbjct  489   KVSRESTAVPAPDANAELQASIQKRQGQFNTKSISEVHHPEEDRGAGFRIEPPKGTARVV  548

Query  1056  -------------DNSRRLGGSEL-SRHVSFKARGG----------------GVGQLPMF  967
                           +SR +   E+ S   S +A G                 G  +L  F
Sbjct  549   YSHSGQSMHPNNFGSSRNMKAHEIESMKASARAFGSPRKPEELRTQTTYVHRGAVELSRF  608

Query  966   CSSAAPHPAAIGLDLCREDISVNSHW--HRLAMKCNRVIDN-------ESDHH-------  835
              +S A   ++    + +E  S+N HW   R   + N  +DN       E  HH       
Sbjct  609   SNSVAVRGSS-RFAMTKE-TSINPHWPEERFTARYNH-MDNAEPSEKHEWSHHLLDRPKT  665

Query  834   -YQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKT  658
              ++ DEQ   K+T +GYVP+   IH+SGPL+P+GGN++EMLKEHEK+IQ AVRKARLDKT
Sbjct  666   SHEKDEQPSSKETTVGYVPKKNRIHHSGPLLPSGGNLEEMLKEHEKRIQQAVRKARLDKT  725

Query  657   SKAKKGNIDYGQTESLLQYVGN  592
              K K    D GQTE LL    N
Sbjct  726   -KTKNDFDDNGQTELLLYRTRN  746



>gb|ABE91953.2| Protein kinase-like [Medicago truncatula]
Length=480

 Score =   194 bits (494),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 153/385 (40%), Positives = 204/385 (53%), Gaps = 90/385 (23%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +ATIFKP++ Y+R ++ETFK+   S+LSLL+ LL++EP+ 
Sbjct  97    KIFKLCGSPSEEYWKKSKLPHATIFKPQQPYKRVVSETFKNFPSSALSLLEVLLAIEPKD  156

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYD----ARMRDEMLR------------  1198
             RGTASSAL+NEFFT+ PLPCDPS LPKYPP KE+D     R R+E+ +            
Sbjct  157   RGTASSALQNEFFTSKPLPCDPSTLPKYPPSKEFDPNFEKRKREEIAKRCAASVVGRRAA  216

Query  1197  -----RQNGSGYKCKDSEGATPAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGG  1033
                  RQ   G+  K+S+   PAP    ++Q +I+K QGQ    KC  +SE  N    GG
Sbjct  217   NKGHVRQESVGWNFKESK-VVPAPDANVEIQSSIEKRQGQCN-SKC--ISEKYNPEEEGG  272

Query  1032  SEL---------------------------SRHVSFKARG--------------------  994
                                           SR ++ K                       
Sbjct  273   YGFPLEPAKLRSRNIFSHSGQSMHPSAYGSSRDMNLKEEAALPGPDRVFTSRKIELRKQN  332

Query  993   ----GGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSHW--HRLAMKCNRVIDNESD---  841
                 G   QL  F +S A    +  LD+   D S+NS W   +  M+ + + D ES+   
Sbjct  333   SYWHGSTAQLSRFSNSVAIRGDS-QLDMS-GDCSLNSQWLEDQFDMRYSHLDDGESNQLL  390

Query  840   ----HHYQNDEQKPRKDTMMGYVPQTGHI-HYSGPLIPAGGNIDEMLKEHEKQIQNAVRK  676
                 H  + D    RKD  MG  P+ GHI +YSGPL+P   N++E+LKEHE+QIQ AVRK
Sbjct  391   DGTKHSRKKDFHLFRKDRAMGCAPKNGHILNYSGPLLPREDNLEEILKEHERQIQQAVRK  450

Query  675   ARLDKTSKAKKGNIDYGQTESLLQY  601
             ARL K +  KK + + GQTESL  +
Sbjct  451   ARLVKEN--KKADSENGQTESLFHF  473



>ref|XP_008456985.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
isoform X2 [Cucumis melo]
Length=731

 Score =   198 bits (503),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 160/375 (43%), Positives = 212/375 (57%), Gaps = 77/375 (21%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +ATIFKP+  Y+R +AETFKD   S+L+LLD LL++EP+ 
Sbjct  367   KIFKLCGSPSEEYWKKSKLPHATIFKPQHPYKRCVAETFKDFPFSALALLDVLLAVEPDG  426

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEM---------LRRQNGSGY  1177
             RGTASSAL +EFFTT PLP DPS LPKYPPCKE+D ++RDE          + R++ + Y
Sbjct  427   RGTASSALRSEFFTTKPLPSDPSDLPKYPPCKEFDVKLRDEEARRRRAPISVAREHEAAY  486

Query  1176  KCKDSEGATPAPGDLAKLQDAIKKWQGQ----------------------------LKLK  1081
             K      A PAP   A+L  +I+K Q Q                            ++++
Sbjct  487   KFPRESKAIPAPHANAELHASIQKKQVQQNPTSVSEKYNHEEDGGSGFCIEPRKEAMQMQ  546

Query  1080  KCGGMS-------EVDNSR--RLG--GSELSRHVSFKARGGGVGQLPMFCSSAAPHPAAI  934
               G  S       + DN R   +G  G+EL +  SF     G GQL  + +S A    + 
Sbjct  547   PTGLGSSQNMNGNQGDNQRGSSVGAKGAELRKQRSFMQH--GAGQLSRYSNSVAVRGGS-  603

Query  933   GLDLCREDISVNSHWHRLAMKCNRVIDNE------SDHH-------------YQNDEQKP  811
               D C  + S NSHW     +C  V  N       S+ H             Y+ D+Q  
Sbjct  604   RFD-CGGESSANSHWPE---ECFNVSYNHFNGGESSEKHEWSRHLLGRPKSSYKMDDQSS  659

Query  810   RKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNID  631
              K++ M Y P+   IHYSGPL+P GGN++EMLKEHEKQIQ+AVRKAR+DK +K KK + D
Sbjct  660   GKES-MSYAPKK-RIHYSGPLMPPGGNLEEMLKEHEKQIQHAVRKARIDK-AKTKKTHDD  716

Query  630   YGQTESLLQYVGNAS  586
              GQ E+LL ++ N +
Sbjct  717   KGQMEALLYHMRNGN  731



>ref|XP_008456983.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
isoform X1 [Cucumis melo]
 ref|XP_008456984.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
isoform X1 [Cucumis melo]
Length=736

 Score =   197 bits (500),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 160/379 (42%), Positives = 213/379 (56%), Gaps = 80/379 (21%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +ATIFKP+  Y+R +AETFKD   S+L+LLD LL++EP+ 
Sbjct  367   KIFKLCGSPSEEYWKKSKLPHATIFKPQHPYKRCVAETFKDFPFSALALLDVLLAVEPDG  426

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEM---------LRRQNGSGY  1177
             RGTASSAL +EFFTT PLP DPS LPKYPPCKE+D ++RDE          + R++ + Y
Sbjct  427   RGTASSALRSEFFTTKPLPSDPSDLPKYPPCKEFDVKLRDEEARRRRAPISVAREHEAAY  486

Query  1176  KCKDSEGATPAPGDLAKLQDAIKKWQGQ----------------------------LKLK  1081
             K      A PAP   A+L  +I+K Q Q                            ++++
Sbjct  487   KFPRESKAIPAPHANAELHASIQKKQVQQNPTSVSEKYNHEEDGGSGFCIEPRKEAMQMQ  546

Query  1080  KCGGMS-------EVDNSR--RLG--GSELSRHVSFKARGGGVGQLPMFCSSAAPHPAAI  934
               G  S       + DN R   +G  G+EL +  SF     G GQL  + +S A    + 
Sbjct  547   PTGLGSSQNMNGNQGDNQRGSSVGAKGAELRKQRSFMQH--GAGQLSRYSNSVAVRGGS-  603

Query  933   GLDLCREDISVNSHWHRLAMKCNRVIDNE------SDHH-------------YQNDEQKP  811
               D C  + S NSHW     +C  V  N       S+ H             Y+ D+Q  
Sbjct  604   RFD-CGGESSANSHWPE---ECFNVSYNHFNGGESSEKHEWSRHLLGRPKSSYKMDDQSS  659

Query  810   RKDTM----MGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKK  643
              K++M    + Y P+   IHYSGPL+P GGN++EMLKEHEKQIQ+AVRKAR+DK +K KK
Sbjct  660   GKESMVNCPVSYAPKK-RIHYSGPLMPPGGNLEEMLKEHEKQIQHAVRKARIDK-AKTKK  717

Query  642   GNIDYGQTESLLQYVGNAS  586
              + D GQ E+LL ++ N +
Sbjct  718   THDDKGQMEALLYHMRNGN  736



>ref|XP_010645923.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
isoform X1 [Vitis vinifera]
Length=667

 Score =   196 bits (497),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 125/303 (41%), Positives = 179/303 (59%), Gaps = 22/303 (7%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ SKL +A+ FKP+  Y+RR+AETF++   S+L+L+D LLS+EP+ 
Sbjct  368   KIFKLCGSPSEEYWQKSKLAHASSFKPQHPYKRRLAETFRNFPSSALALVDVLLSVEPDA  427

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGA-  1153
             RGTA+SAL++EFFTT PLPCDPS+LPKY P KEYDA++R+E  RRQ     K + +E   
Sbjct  428   RGTAASALKSEFFTTKPLPCDPSSLPKYVPSKEYDAKLRNEEARRQRAEAVKGRGAESVR  487

Query  1152  --------TPAPGDLAKLQDAIKKWQGQLKL--------KKCGGMSEVDNSRRLGGSELS  1021
                      P P    + Q ++++ Q   K         +  G    ++  R    + LS
Sbjct  488   RGSRQSKDVPTPEFKPQAQASLQQGQTNTKCISEKYKPGEDSGSNFRMEPHRGTVPNGLS  547

Query  1020  RHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESD  841
              H +       VG         A        D  R  + + +H   +      V    S+
Sbjct  548   -HSTLMINQNAVGSSEKKVEDEAQLGYGNTFDSSRNKVELRTHGSHMPHGAAGV----SN  602

Query  840   HHYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDK  661
               ++ DE+   K+++ GYVP+   +HYSGPL+P+GGNI+EMLK+HE+QIQ AVRKAR+DK
Sbjct  603   SSHRKDERISGKESVTGYVPKKNRMHYSGPLMPSGGNIEEMLKDHERQIQEAVRKARIDK  662

Query  660   TSK  652
             T +
Sbjct  663   TQQ  665



>ref|XP_010645924.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
isoform X2 [Vitis vinifera]
Length=666

 Score =   194 bits (494),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 127/305 (42%), Positives = 178/305 (58%), Gaps = 27/305 (9%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ SKL +A+ FKP+  Y+RR+AETF++   S+L+L+D LLS+EP+ 
Sbjct  368   KIFKLCGSPSEEYWQKSKLAHASSFKPQHPYKRRLAETFRNFPSSALALVDVLLSVEPDA  427

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGA-  1153
             RGTA+SAL++EFFTT PLPCDPS+LPKY P KEYDA++R+E  RRQ     K + +E   
Sbjct  428   RGTAASALKSEFFTTKPLPCDPSSLPKYVPSKEYDAKLRNEEARRQRAEAVKGRGAESVR  487

Query  1152  --------TPAPGDLAKLQDAIKKWQGQLKLK----------KCGGMSEVDNSRRLGGSE  1027
                      P P    + Q ++   QGQ   K            G    ++  R    + 
Sbjct  488   RGSRQSKDVPTPEFKPQAQASL---QGQTNTKCISEKYKPGEDSGSNFRMEPHRGTVPNG  544

Query  1026  LSRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNE  847
             LS H +       VG         A        D  R  + + +H   +      V    
Sbjct  545   LS-HSTLMINQNAVGSSEKKVEDEAQLGYGNTFDSSRNKVELRTHGSHMPHGAAGV----  599

Query  846   SDHHYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARL  667
             S+  ++ DE+   K+++ GYVP+   +HYSGPL+P+GGNI+EMLK+HE+QIQ AVRKAR+
Sbjct  600   SNSSHRKDERISGKESVTGYVPKKNRMHYSGPLMPSGGNIEEMLKDHERQIQEAVRKARI  659

Query  666   DKTSK  652
             DKT +
Sbjct  660   DKTQQ  664



>emb|CBI31356.3| unnamed protein product [Vitis vinifera]
Length=615

 Score =   194 bits (492),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 128/300 (43%), Positives = 178/300 (59%), Gaps = 19/300 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ SKL +A+ FKP+  Y+RR+AETF++   S+L+L+D LLS+EP+ 
Sbjct  319   KIFKLCGSPSEEYWQKSKLAHASSFKPQHPYKRRLAETFRNFPSSALALVDVLLSVEPDA  378

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGA-  1153
             RGTA+SAL++EFFTT PLPCDPS+LPKY P KEYDA++R+E  RRQ     K + +E   
Sbjct  379   RGTAASALKSEFFTTKPLPCDPSSLPKYVPSKEYDAKLRNEEARRQRAEAVKGRGAESVR  438

Query  1152  ----------TPA--PGDLAKLQDAIKKWQGQLKL-KKCGGMSEVDNSRRLGGSELSRHV  1012
                       TP   P   A LQ   K    + K  +  G    ++  R    + LS H 
Sbjct  439   RGSRQSKDVPTPEFKPQAQASLQTNTKCISEKYKPGEDSGSNFRMEPHRGTVPNGLS-HS  497

Query  1011  SFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHY  832
             +       VG         A        D  R  + + +H   +      V    S+  +
Sbjct  498   TLMINQNAVGSSEKKVEDEAQLGYGNTFDSSRNKVELRTHGSHMPHGAAGV----SNSSH  553

Query  831   QNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSK  652
             + DE+   K+++ GYVP+   +HYSGPL+P+GGNI+EMLK+HE+QIQ AVRKAR+DKT +
Sbjct  554   RKDERISGKESVTGYVPKKNRMHYSGPLMPSGGNIEEMLKDHERQIQEAVRKARIDKTQQ  613



>emb|CAN67625.1| hypothetical protein VITISV_007388 [Vitis vinifera]
Length=656

 Score =   194 bits (493),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 127/305 (42%), Positives = 178/305 (58%), Gaps = 27/305 (9%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ SKL +A+ FKP+  Y+RR+AETF++   S+L+L+D LLS+EP+ 
Sbjct  358   KIFKLCGSPSEEYWQKSKLAHASSFKPQHPYKRRLAETFRNFPSSALALVDVLLSVEPDA  417

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGA-  1153
             RGTA+SAL++EFFTT PLPCDPS+LPKY P KEYDA++R+E  RRQ     K + +E   
Sbjct  418   RGTAASALKSEFFTTKPLPCDPSSLPKYVPSKEYDAKLRNEEARRQRAEAVKGRGAESVR  477

Query  1152  --------TPAPGDLAKLQDAIKKWQGQLKLK----------KCGGMSEVDNSRRLGGSE  1027
                      P P    + Q ++   QGQ   K            G    ++  R    + 
Sbjct  478   RGSRQSKDVPTPEFKPQAQASL---QGQTNTKCISEKYKPGEDSGSNFRMEPHRGTVPNG  534

Query  1026  LSRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNE  847
             LS H +       VG         A        D  R  + + +H   +      V    
Sbjct  535   LS-HSTLMINQNAVGSSEKKVEDEAQLGYGNTFDSSRNKVELRTHGSHMPHGAAGV----  589

Query  846   SDHHYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARL  667
             S+  ++ DE+   K+++ GYVP+   +HYSGPL+P+GGNI+EMLK+HE+QIQ AVRKAR+
Sbjct  590   SNSSHRKDERISGKESVTGYVPKKNRMHYSGPLMPSGGNIEEMLKDHERQIQEAVRKARI  649

Query  666   DKTSK  652
             DKT +
Sbjct  650   DKTQQ  654



>gb|KDO42442.1| hypothetical protein CISIN_1g005582mg [Citrus sinensis]
Length=690

 Score =   194 bits (492),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 152/341 (45%), Positives = 196/341 (57%), Gaps = 43/341 (13%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +ATIFKP++ Y+R +AETFKD+  S+LSLLD LLS EPE 
Sbjct  350   KIFKLCGSPSEEYWKRSKLPHATIFKPQQPYKRCVAETFKDIPSSALSLLDILLSTEPEV  409

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNG-------SGYKC  1171
             RGTASSAL+NEFFTT PLPCDPS+LPKYPP KE+D ++RD+  RR  G       S  K 
Sbjct  410   RGTASSALQNEFFTTKPLPCDPSSLPKYPPSKEFDVKLRDDDRRRGGGGKGRGLESIRKA  469

Query  1170  KDSEGATPAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGS----ELSRHVSFK  1003
                  A PAP   A+LQ +I+K Q Q   K     SE  NS    GS    E  + +   
Sbjct  470   GKESKAVPAPDANAELQTSIQKRQNQSNPK---ATSEQFNSDEDSGSGFPIEPPKGIGRN  526

Query  1002  ARG--------GGVGQLPMFC---SSAAPHPAAIGLDLCREDISVNSHWHRL--AMKCNR  862
             A G        G    + M     S +  HP A GL      ++V     +L  + + N 
Sbjct  527   AGGQTMKPTTVGASLNMTMDSDRNSRSYMHPGAAGLSRFANSVAVRGGHSQLDCSNRVNS  586

Query  861   VIDNESDHHY-QNDEQKP-------------RKDTMMGYVPQTGHIHYSGPLIPAGGNID  724
                ++S H + QN   +P             ++     +  +   +HYSGP++P GGN++
Sbjct  587   QWSDDSGHEWSQNLLDRPMSSYNKKGEKPSGKESKTQDFASKKTRMHYSGPILPPGGNLE  646

Query  723   EMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQTESLLQY  601
             EMLKEHE+QIQ AVR+AR DKT   K G  + GQT+SLL Y
Sbjct  647   EMLKEHERQIQQAVRRARGDKTKAQKNG--ESGQTQSLLHY  685



>ref|XP_006431519.1| hypothetical protein CICLE_v10000479mg [Citrus clementina]
 gb|ESR44759.1| hypothetical protein CICLE_v10000479mg [Citrus clementina]
Length=690

 Score =   193 bits (490),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 152/341 (45%), Positives = 196/341 (57%), Gaps = 43/341 (13%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +ATIFKP++ Y+R +AETFKD+  S+LSLLD LLS EPE 
Sbjct  350   KIFKLCGSPSEEYWKRSKLPHATIFKPQQPYKRCVAETFKDIPSSALSLLDILLSTEPEV  409

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNG-------SGYKC  1171
             RGTASSAL+NEFFTT PLPCDPS+LPKYPP KE+D ++RD+  RR  G       S  K 
Sbjct  410   RGTASSALQNEFFTTKPLPCDPSSLPKYPPSKEFDVKLRDDDRRRGGGGKGRGLESIRKT  469

Query  1170  KDSEGATPAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGS----ELSRHVSFK  1003
                  A PAP   A+LQ +I+K Q Q   K     SE  NS    GS    E  + +   
Sbjct  470   GKESKAVPAPDANAELQTSIQKRQNQSNPK---ATSEQFNSDEDSGSGFPIEPPKGIGRN  526

Query  1002  ARG--------GGVGQLPMFC---SSAAPHPAAIGLDLCREDISVNSHWHRL--AMKCNR  862
             A G        G    + M     S +  HP A GL      ++V     +L  + + N 
Sbjct  527   AGGQTMKPTTVGASLNMTMDSDRNSRSYMHPGAAGLSRFANSVAVRGGHSQLDCSNRVNS  586

Query  861   VIDNESDHHY-QNDEQKP-------------RKDTMMGYVPQTGHIHYSGPLIPAGGNID  724
                ++S H + QN   +P             ++     +  +   +HYSGP++P GGN++
Sbjct  587   QWSDDSGHEWSQNLLDRPMSSYNKKGEKPSGKESKTQDFASKKTRMHYSGPILPPGGNLE  646

Query  723   EMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQTESLLQY  601
             EMLKEHE+QIQ AVR+AR DKT   K G  + GQT+SLL Y
Sbjct  647   EMLKEHERQIQQAVRRARGDKTKAQKNG--ESGQTQSLLHY  685



>ref|XP_006470963.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Citrus sinensis]
Length=690

 Score =   193 bits (490),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 151/342 (44%), Positives = 192/342 (56%), Gaps = 45/342 (13%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +ATIFKP++ Y+R +AETFKD+  S+LSLLD LLS EPE 
Sbjct  350   KIFKLCGSPSEEYWKRSKLPHATIFKPQQPYKRCVAETFKDIPSSALSLLDILLSTEPEV  409

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNG-------SGYKC  1171
             RGTASSAL+NEFFTT PLPCDPS+LPKYPP KE+D ++RD+  RR  G       S  K 
Sbjct  410   RGTASSALQNEFFTTKPLPCDPSSLPKYPPSKEFDVKLRDDDRRRGGGGKGRGLESIRKA  469

Query  1170  KDSEGATPAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGG  991
                  A PAP   A+LQ +I+K Q Q   K     SE  NS    GS        K  G 
Sbjct  470   GKESKAVPAPDANAELQTSIQKRQNQSNPK---ATSEQFNSDEDSGSGFPIEPP-KGIGR  525

Query  990   GVGQLPMFCSSAAP----------------HPAAIGLDLCREDISVNSHWHRL--AMKCN  865
              VG   M  ++                   HP A GL      ++V     +L  + + N
Sbjct  526   NVGGQTMKPTTVGASLNMTMDSDRNSRSYMHPGAAGLSRFANSVAVRGGHSQLDCSNRVN  585

Query  864   RVIDNESDHHY-QNDEQKP-------------RKDTMMGYVPQTGHIHYSGPLIPAGGNI  727
                 ++S H + QN   +P             ++     Y  +   +HYSGP++P GGN+
Sbjct  586   SQWSDDSGHEWSQNLLDRPMSSYNKKGEKPSGKESKTQDYASKKTRMHYSGPILPPGGNL  645

Query  726   DEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQTESLLQY  601
             +EMLKEHE+QIQ AVR+AR DKT   K G  + G T+SLL Y
Sbjct  646   EEMLKEHERQIQQAVRRARGDKTKAQKNG--ESGHTQSLLHY  685



>gb|KDP42465.1| hypothetical protein JCGZ_00262 [Jatropha curcas]
Length=706

 Score =   193 bits (490),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 156/372 (42%), Positives = 195/372 (52%), Gaps = 73/372 (20%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS E+WK SKL +ATIFKP++ Y+R ++ETFK+   S+L+LLD LL++EPE 
Sbjct  340   KIFKLCGSPSVEYWKRSKLPHATIFKPQQPYKRCVSETFKEFPSSALALLDVLLAVEPED  399

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDE---------MLRRQNGSGY  1177
             RGTASSAL +EFFTT PLPCDPS+LPKYPP KE+D ++RD+            R + S  
Sbjct  400   RGTASSALSSEFFTTKPLPCDPSSLPKYPPTKEFDVKLRDQDSKRRKGGGGKGRGHESTS  459

Query  1176  KCKDSEGATPAPGDLAKLQDAIKKWQGQLKLKKCG-------------------------  1072
             K      A PAP   A+L  +I+K QGQ   K                            
Sbjct  460   KSSRGSKAVPAPDANAELPASIQKRQGQSNAKSVSEQYKPNDGIEPSEGTAKNASPYSGQ  519

Query  1071  -----------GMSEVDNS-RRLGG--------SELSRHVSFKARGGGVGQLPMFCSSAA  952
                        G++  DN   R  G         EL    SF  RG    QL  F +S A
Sbjct  520   SAHPMNFAASRGINVNDNEVLRAPGPFASPKKPGELRTQRSFVNRGA--AQLSRFSNSVA  577

Query  951   PHPAAIGLDLCREDISVNSHW-----HRLAMKCNRVIDNESDHH------YQNDEQKPRK  805
                 +  LD      +V  HW     H    + N + D  S HH      + N E +P  
Sbjct  578   VRGRS-QLD-NGSATTVTRHWPEDSSHHFHPRYNHLDD--STHHLLNRPKFSNKEVQPAG  633

Query  804   -DTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDY  628
              +T   +  + G +HYSGPL+ AG NI+EMLKEHEKQIQ AVRKAR DK  K  K N + 
Sbjct  634   LETAAAFYQKKGRMHYSGPLMNAGSNIEEMLKEHEKQIQEAVRKARSDKI-KTNKANNEN  692

Query  627   GQTESLLQYVGN  592
             GQTESLL +  N
Sbjct  693   GQTESLLYHGKN  704



>ref|XP_007225176.1| hypothetical protein PRUPE_ppa002233mg [Prunus persica]
 gb|EMJ26375.1| hypothetical protein PRUPE_ppa002233mg [Prunus persica]
Length=698

 Score =   192 bits (489),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 154/359 (43%), Positives = 203/359 (57%), Gaps = 61/359 (17%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +ATIFKP   Y+R +AETFKD  PS+L+LL+ LL++EPE 
Sbjct  348   KIFKLCGSPSEEYWKRSKLPHATIFKPTHPYKRCVAETFKDFPPSALALLEVLLAVEPES  407

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSE--G  1156
             RGTASSAL +EFFT+ PLP DPS LPKYPP KE+DA++RDE  RR+   G K   S+   
Sbjct  408   RGTASSALHSEFFTSLPLPSDPSTLPKYPPSKEFDAKLRDEEARRRRAPGSKGGSSKESK  467

Query  1155  ATPAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLG--------------------  1036
             A PAP       +AI++ QGQ   K        D     G                    
Sbjct  468   AVPAPD-----ANAIQR-QGQPNPKSISEKYNPDEDSGSGFPIEPPKGATSNGYSYSGQS  521

Query  1035  ------GSELSRHVSFKARGG--------GVGQLPMFCSSAAPHPAAIGLDLCREDISVN  898
                   GS  +   S ++R G        G  Q   F +SA+    +    +   + S N
Sbjct  522   MHPNAFGSSRNMSQSGQSRNGGEKSYMYRGAAQSSRFSNSASVRSDSRYDGVV--EASAN  579

Query  897   SHW--HRLAMKCNRVIDNES------DHHY--------QNDEQKPRKDTMMGYVPQTGHI  766
              HW   R+  + + + + +S       H++        + DEQ   K++  GY  +   I
Sbjct  580   PHWPEERINARYSHLDNGDSSAKHDWSHNFLDRPKSSHKKDEQPSGKESATGYATKKNRI  639

Query  765   HYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQTESLLQYVGNA  589
             HYSGPL+P GGN++EMLKEHE+QIQ+AVRKARLDK +KAKK N + GQTESLL ++ N 
Sbjct  640   HYSGPLMPPGGNLEEMLKEHERQIQHAVRKARLDK-NKAKKANSENGQTESLLHHIRNG  697



>ref|XP_008218690.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Prunus mume]
Length=698

 Score =   191 bits (485),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 152/359 (42%), Positives = 199/359 (55%), Gaps = 61/359 (17%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +ATIFKP   Y+R +AETFKD   S+L+LL+ LL++EPE 
Sbjct  348   KIFKLCGSPSEEYWKRSKLPHATIFKPTHPYKRCVAETFKDFPLSALALLEVLLAVEPES  407

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSE--G  1156
             RGTASSAL +EFFT+ PLP DPS LPKYPP KE+DA++RDE  RR+   G K   S+   
Sbjct  408   RGTASSALHSEFFTSLPLPSDPSTLPKYPPSKEFDAKLRDEEARRRRAPGSKGGSSKESK  467

Query  1155  ATPAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLG--------------------  1036
             A PAP       +AI++ QGQ   K        D     G                    
Sbjct  468   AVPAPD-----ANAIQR-QGQPNPKSISEKYNPDEDSGSGFPIEPPKGATSNGYSHSGQS  521

Query  1035  ------GSELSRHVSFKARGG--------GVGQLPMFCSSAAPHPAAIGLDLCREDISVN  898
                   GS  +   S ++R G        G  Q   F +SA+    +    +   + S N
Sbjct  522   MHPSAFGSSRNMSQSGQSRNGAEKSYMYRGAAQSSRFSNSASVRSDSQYDGVV--EASAN  579

Query  897   SHW--HRLAMKCNRVIDNESD--------------HHYQNDEQKPRKDTMMGYVPQTGHI  766
              HW   R+  + + + + +S                 ++ DEQ   K++  GY  +   I
Sbjct  580   PHWPEERINARYSHLDNGDSSAKHDWSHNLLDRPKSSHKKDEQPSGKESATGYATKKNRI  639

Query  765   HYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQTESLLQYVGNA  589
             HYSGPL+P GGN++EMLKEHE+QIQ+AVRKARLDK +K KK N + GQTESLL +V N 
Sbjct  640   HYSGPLMPPGGNLEEMLKEHERQIQHAVRKARLDK-NKPKKANSENGQTESLLHHVRNG  697



>ref|XP_008219089.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
isoform X1 [Prunus mume]
Length=647

 Score =   190 bits (483),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 136/297 (46%), Positives = 184/297 (62%), Gaps = 36/297 (12%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS++FWK +KL +AT FKP++ Y+RRIA+TFK+L  SSL+L+D LLS+EPE+
Sbjct  368   KIFKLCGSPSEDFWKKTKLPHATSFKPQQPYKRRIADTFKELPSSSLALIDRLLSIEPEK  427

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEG--  1156
             RG+A+SAL +EFFTT PLPC+PS LPKYPP KE+DA++RDE  RR+    +K + +E   
Sbjct  428   RGSAASALSSEFFTTQPLPCNPSNLPKYPPSKEFDAKLRDEEKRRKV-DAFKGRGTESVR  486

Query  1155  -------ATPAPGDLAKLQDAIKKWQGQLKLKKCGG--MSEVDNSRRLGGSELSRHVSFK  1003
                    A P P   A+   +++  QGQ  LK  G   M + D+      S  +   S  
Sbjct  487   RSSRDTKAVPTPEFNAQGDASLQ--QGQRNLKTTGHKYMPQRDSV-----SGFAMEPSGG  539

Query  1002  ARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVN------SHWHRLAMKCNRVIDNESD  841
             AR  G       CSS   HP+A+   L +   ++N         H+     +  I +   
Sbjct  540   ARQNGYSH----CSSMI-HPSAVESSLNKTVSTLNKSELRTQKSHKPQAGADFFISSN--  592

Query  840   HHYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKAR  670
                + DE+   +D+ MGYVP+   IHYSGPL+P GGNI++MLKEHE+QIQ AVRKAR
Sbjct  593   ---KKDERVHSRDSRMGYVPKN-RIHYSGPLVPPGGNIEDMLKEHERQIQQAVRKAR  645



>ref|XP_002526427.1| Serine/threonine-protein kinase cdk9, putative [Ricinus communis]
 gb|EEF35922.1| Serine/threonine-protein kinase cdk9, putative [Ricinus communis]
Length=506

 Score =   188 bits (477),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 153/371 (41%), Positives = 201/371 (54%), Gaps = 79/371 (21%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +ATIFKP++ Y+R +AETFKD   S+L LLD LL++EPE 
Sbjct  132   KIFKLCGSPSEEYWKRSKLPHATIFKPQQPYKRNVAETFKDFPSSALGLLDVLLAVEPED  191

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDE---------MLRRQNGSGY  1177
             RGT +SAL +EFFTT PLPCDPS+LPKYPP KE+D ++R++            R + S  
Sbjct  192   RGTVNSALGSEFFTTKPLPCDPSSLPKYPPTKEFDVKLREDDARRRRGHGGKGRGHESAR  251

Query  1176  KCKDSEGATPAPGDLAKLQDAIKKWQG---------QLKLKKCGG---------------  1069
             K      A PAP   A+L  +I+K QG         Q   ++ GG               
Sbjct  252   KNSRVSKAVPAPDANAELLASIQKRQGQSNPKSISEQFNPEEVGGSGFPTVPPEGTTRNV  311

Query  1068  --------------------MSEVDNSRRLGGS--------ELSRHVSFKARGGGVGQLP  973
                                  +E +  R  G +        EL+   SF     G  QL 
Sbjct  312   YSHSGKSMHPTNHGSSRGMTANETEALRTSGQAFSSPKKTEELTTQRSFTQ--WGAAQLS  369

Query  972   MFCSSAAPHPAAIGLDLCREDISVNSHW--HRLAMKCNRVIDNESDHH------YQNDEQ  817
              F +S A   ++   D   E  + NSHW   R   + N + D  S HH      + + E 
Sbjct  370   RFSNSVAVRGSS-NSDSGSE-TTANSHWPEDRFNPQHNHLDD--SSHHLLDRPKFSDKEC  425

Query  816   KPRK-DTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKG  640
             +P   ++ MG+  + G IHYSGPL+ AGGNI+EML+EHEKQIQ AVRKAR ++T+KA KG
Sbjct  426   RPAGLESTMGFFQKKGRIHYSGPLMSAGGNIEEMLREHEKQIQEAVRKARANQTNKAHKG  485

Query  639   NIDYGQTESLL  607
              I+   TESLL
Sbjct  486   -IEL--TESLL  493



>ref|XP_010544117.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Tarenaya hassleriana]
 ref|XP_010544118.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Tarenaya hassleriana]
Length=706

 Score =   190 bits (483),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 148/351 (42%), Positives = 188/351 (54%), Gaps = 65/351 (19%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK S+L +ATIFKP++ Y+R +AETFKDL  S+L+LL+ LL++EP+ 
Sbjct  365   KIFKLCGSPSEEYWKRSRLPHATIFKPQQPYKRCVAETFKDLPSSALALLEVLLAVEPDA  424

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKD-----  1165
             RGTASSAL++EFFTT P P DP +LP Y P KEYDA+ RDE  RR+ G+  K ++     
Sbjct  425   RGTASSALQSEFFTTKPFPSDPLSLPTYKPRKEYDAKFRDEEARRKKGANSKGQNETKRA  484

Query  1164  --SEGATPAPGDLAKLQDAIKKWQGQLKLKKC------------GGMSEVDNSRRLGGS-  1030
                  A PAP   A+L  +I+K QGQ                  G   E  N    G S 
Sbjct  485   SRESKAVPAPDANAELLTSIQKRQGQGNATSVSENFNREEDSGAGFRIEPQNGTAFGYSV  544

Query  1029  -----------------ELSRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISV  901
                              EL    SF  R  G  QL  F +S A    +    +   D  V
Sbjct  545   NMNANGDGLLGCSSHSKELRTQRSFVQR--GAAQLSRFSNSVAARDGSRFGSI--RDTIV  600

Query  900   NSHWHRLAMKCNRVIDNESDHHY-------------QNDEQKPRKDTMMGYVPQTGHIHY  760
             N  + R     N   D +S                   DEQ+P      GY  + G +HY
Sbjct  601   NPAYGRY----NHGGDGQSSEKLDWSQCLPGKSKAPMKDEQQP---CGTGYGGKNGRMHY  653

Query  759   SGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQTESLL  607
             SGPLIPAGGN+DEMLKEHE+QIQ AVR+AR+DKT K  +     GQ++ LL
Sbjct  654   SGPLIPAGGNLDEMLKEHERQIQLAVRRARVDKTKKDDRN----GQSQMLL  700



>ref|XP_008219090.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
isoform X2 [Prunus mume]
Length=646

 Score =   189 bits (481),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 136/297 (46%), Positives = 183/297 (62%), Gaps = 37/297 (12%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS++FWK +KL +AT FKP++ Y+RRIA+TFK+L  SSL+L+D LLS+EPE+
Sbjct  368   KIFKLCGSPSEDFWKKTKLPHATSFKPQQPYKRRIADTFKELPSSSLALIDRLLSIEPEK  427

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEG--  1156
             RG+A+SAL +EFFTT PLPC+PS LPKYPP KE+DA++RDE  RR+    +K + +E   
Sbjct  428   RGSAASALSSEFFTTQPLPCNPSNLPKYPPSKEFDAKLRDEEKRRKV-DAFKGRGTESVR  486

Query  1155  -------ATPAPGDLAKLQDAIKKWQGQLKLKKCGG--MSEVDNSRRLGGSELSRHVSFK  1003
                    A P P   A+   ++   QGQ  LK  G   M + D+      S  +   S  
Sbjct  487   RSSRDTKAVPTPEFNAQGDASL---QGQRNLKTTGHKYMPQRDSV-----SGFAMEPSGG  538

Query  1002  ARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVN------SHWHRLAMKCNRVIDNESD  841
             AR  G       CSS   HP+A+   L +   ++N         H+     +  I +   
Sbjct  539   ARQNGYSH----CSSMI-HPSAVESSLNKTVSTLNKSELRTQKSHKPQAGADFFISSN--  591

Query  840   HHYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKAR  670
                + DE+   +D+ MGYVP+   IHYSGPL+P GGNI++MLKEHE+QIQ AVRKAR
Sbjct  592   ---KKDERVHSRDSRMGYVPKN-RIHYSGPLVPPGGNIEDMLKEHERQIQQAVRKAR  644



>gb|KHG17123.1| hypothetical protein F383_22386 [Gossypium arboreum]
Length=739

 Score =   189 bits (480),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 148/374 (40%), Positives = 194/374 (52%), Gaps = 75/374 (20%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++WK SKL +ATIFKP+  Y+  + +TFKD   S+L LL+ LL++EPE 
Sbjct  368   KIFKLCGSPSEDYWKRSKLPHATIFKPQHPYKSCVLKTFKDFPASALVLLEVLLAIEPEC  427

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSG--------YK  1174
             RGTA SAL++EFFTT PLPCDPS+LPKYPP KE+D ++R+E  RRQ   G         K
Sbjct  428   RGTAPSALQSEFFTTFPLPCDPSSLPKYPPSKEFDTKLREEESRRQRAGGKVHAVDPVRK  487

Query  1173  CKDSEGATPAPGDLAKLQDAIKKWQGQLKLKKC----------GGMSEVDNSRRL-----  1039
                   A PAP   A+LQ +I+K +GQ   K            G    ++ S+R      
Sbjct  488   FSREPIAVPAPDFNAELQASIQKRRGQFDAKSISEVCYPEEDRGAGVPIEPSKRTERVVY  547

Query  1038  ----------GGSELSRH-------VSFKARGGGVGQLP--MFCSSAAPHPAAIGLDLCR  916
                       G  E SR+       +   AR  G  + P  +   +   H  A+ L    
Sbjct  548   NSHSGRSMHPGKFESSRNKKTEIESMKTSARAFGFPRKPEELKTQTTFVHRGAVELSRFS  607

Query  915   EDISVNSHWHRLAMKCNRVID--------NESDHHYQNDEQKPRKD--------------  802
               I+V     R  M     I+        N   +H  N E   + D              
Sbjct  608   NSIAVRGS-SRFDMTKENNINPQWPEEHFNSGYNHLDNAESSEKHDLSHGLLDRPKASNV  666

Query  801   ---------TMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKA  649
                      + +GYV     IHYSGPL+P GGN++E+LKEHE++IQNAVR+ARL+KT KA
Sbjct  667   KDGQPSSKESAVGYVSMNNRIHYSGPLMPRGGNLEELLKEHERRIQNAVRRARLNKT-KA  725

Query  648   KKGNIDYGQTESLL  607
             K    D GQTESLL
Sbjct  726   KINFDDNGQTESLL  739



>ref|XP_002325944.2| hypothetical protein POPTR_0019s10200g [Populus trichocarpa]
 gb|EEF00326.2| hypothetical protein POPTR_0019s10200g [Populus trichocarpa]
Length=644

 Score =   188 bits (477),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 129/295 (44%), Positives = 175/295 (59%), Gaps = 13/295 (4%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+ +W   K  +AT FKP++ Y RRIAETFK+ +PS+L+L+D LLS+EP+ 
Sbjct  352   KIFKLCGSPSEAYWTKKKFPHATSFKPQQPYIRRIAETFKNFTPSALTLVDKLLSMEPQD  411

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+A+SAL +EFF   PLP DPS+LPKYPP KE DA+MRD+  RRQ     K +  E   
Sbjct  412   RGSATSALRSEFFRIEPLPSDPSSLPKYPPSKELDAKMRDQEARRQKAEAVKGRGPESVR  471

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
                GD  K   +    QGQ K   C       N +  GGS         ++  G+     
Sbjct  472   RGSGDTKKDPTSEFTAQGQPK-TICSSYKY--NIQEDGGSSFRIEPPRVSKKNGLEH---  525

Query  969   FCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHH--YQNDEQKPRKDTM  796
               S++  H +A+GL L +  +    +   L  K +RV  +        +  E+ P  D+ 
Sbjct  526   --SASVIHHSAVGLSLNK-SVDCTENNPELRSKKSRVSQSGEISSSSLKKKERAPSIDSS  582

Query  795   MGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNID  631
              G+VP+   IHYSGPL+P GGN++E+LKEHE+QIQ AVRKARL+K+    K N+D
Sbjct  583   AGFVPRKTRIHYSGPLMPPGGNMEEILKEHERQIQQAVRKARLEKS--GTKDNLD  635



>ref|XP_007224433.1| hypothetical protein PRUPE_ppa021439mg [Prunus persica]
 gb|EMJ25632.1| hypothetical protein PRUPE_ppa021439mg [Prunus persica]
Length=647

 Score =   188 bits (477),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 134/294 (46%), Positives = 184/294 (63%), Gaps = 31/294 (11%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS++FWK +KL +AT FKP++ Y+RRIA+TFK+L  SSL+L+D LLS+EPE+
Sbjct  369   KIFKLCGSPSEDFWKKTKLPHATSFKPQQPYKRRIADTFKELPSSSLALIDRLLSIEPEK  428

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEG--  1156
             RG+A+SAL +EFFTT PLPC+PS LPKYPP KE+DA++RDE  RR+    +K + +E   
Sbjct  429   RGSAASALSSEFFTTQPLPCNPSNLPKYPPSKEFDAKLRDEEKRRKV-DAFKGRGTESVR  487

Query  1155  -------ATPAPGDLAKLQDAIKKWQGQLKLKKCGG--MSEVDNSRRLGGSELSRHVSFK  1003
                    A P P   A+   ++   QGQ  LK  G   M + D+      S  +   S  
Sbjct  488   RSSRDTKAVPTPEFNAQGDASL---QGQRNLKTTGHKYMPQRDSV-----SGFAMEPSGG  539

Query  1002  ARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQND  823
             AR  G       CSS   HP+ +   L +   ++N     L+ + +      +D    ++
Sbjct  540   ARQNGYSH----CSSMI-HPSTVESSLNKTVSTLNK--SELSTQKSHKPQAGADFFISSN  592

Query  822   EQKPR---KDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKAR  670
             ++  R   +D+ MGYVP+   IHYSGPL+P GGNI++MLKEHE+QIQ AVRKAR
Sbjct  593   KKDERVYIRDSRMGYVPKN-RIHYSGPLVPPGGNIEDMLKEHERQIQQAVRKAR  645



>ref|XP_010553694.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Tarenaya hassleriana]
Length=714

 Score =   188 bits (478),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 144/348 (41%), Positives = 187/348 (54%), Gaps = 53/348 (15%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslep-E  1333
             KIFKLCGSPS+E+WK SKL +ATIFKP++ Y++ +AETFKDL PSS   L  +L      
Sbjct  365   KIFKLCGSPSEEYWKRSKLPHATIFKPQQRYQKCVAETFKDLLPSSALALLEVLLAVEPN  424

Query  1332  RRGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKD----  1165
              RGTASSAL++EFFT  P P DPS+LP+Y P KEYDA+ RDE  RR+ G+  K ++    
Sbjct  425   ARGTASSALQSEFFTMKPFPSDPSSLPRYQPRKEYDAKFRDEEARRKKGASGKGQNESKR  484

Query  1164  ----SEGATPAPGDLAKLQDAIKKWQGQLKLKKC------------GGMSEVDNSRRLGG  1033
                    A PAP   A+L  +I+K Q Q  +               G   +  N   LG 
Sbjct  485   AASRESKAVPAPDANAELLASIQKRQVQNNVTSVSENFNCEEDAGAGFRIQHPNGTALGS  544

Query  1032  S------------------ELSRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDI  907
             S                  EL    SF  R  G  QL  F +  A           R D 
Sbjct  545   SVNMNGNGDGFLGSSSHSKELRMQRSFVQR--GAAQLSRFSNPVATRGDGSRFGSVR-DS  601

Query  906   SVNSHWHRLAMKCNRVIDNESDHHYQNDEQKPR---KD-----TMMGYVPQTGHIHYSGP  751
             +VN ++ R     +    +E+    Q    KP+   KD     T  G+  + G +HYSGP
Sbjct  602   TVNPNYGRHQQHVDGDQSSENGDWSQRLLDKPKAPVKDEYSCGTNQGFDGKNGRMHYSGP  661

Query  750   LIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQTESLL  607
             LIPAGGN+DEMLKEHE+QI+ AVR+AR+DKT   KK + + GQ++SLL
Sbjct  662   LIPAGGNLDEMLKEHERQIRLAVRRARVDKT---KKRDDENGQSQSLL  706



>ref|XP_010545831.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Tarenaya hassleriana]
 ref|XP_010545832.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Tarenaya hassleriana]
Length=679

 Score =   186 bits (473),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 129/318 (41%), Positives = 181/318 (57%), Gaps = 35/318 (11%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ SKL +ATIFKP++ Y R +AETF++    +L LL++LL + P+ 
Sbjct  340   KIFKLCGSPSEDYWRKSKLPHATIFKPQQPYRRVVAETFREFPEPALDLLETLLLVNPDE  399

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSG--------YK  1174
             RGTA+SAL++EFFT  PLPCDPS+LPKYPPCKE DARMRDE  RRQ  +G         +
Sbjct  400   RGTAASALQSEFFTIKPLPCDPSSLPKYPPCKELDARMRDEEARRQGVAGNNNHIRQERR  459

Query  1173  CKDSEGATPAPGDLAKLQDAIKKWQGQLKLK-----------KCGGMSEVDNSRRLGGSE  1027
                   A PAP   A+L  +++K QGQ   +           +      +D  R L  SE
Sbjct  460   VSKESRAVPAPEANAELAASMQKRQGQSTSRSRSEKFNPHPEEVASGFPIDPPRPLQTSE  519

Query  1026  L---SRHVSFKARGGGVGQLPMFCSSAA-----PHPAAI---GLDLCREDISVNSHWH--  886
                 S+ +  K R    G L    +SA       H A+    GL   R   S        
Sbjct  520   SKADSQGIPHK-RASHSGPLARRSASATRNYDDSHKASAAMPGLAAARTSGSQQETVRGM  578

Query  885   -RLAMKCNRVIDNESDHHYQNDEQKPRKD-TMMGYVPQTGHIHYSGPLIPAGGNIDEMLK  712
              RL+      ++  ++ + +ND +  ++D  +MGY  +   IHYSGPL+   GN+D+MLK
Sbjct  579   ARLSGSFKGAVEISAESNQRNDGRSNKQDPILMGYGSKGYKIHYSGPLVVPSGNMDQMLK  638

Query  711   EHEKQIQNAVRKARLDKT  658
             EH++ +Q AVR+AR+DK 
Sbjct  639   EHDRHVQEAVRRARIDKA  656



>ref|XP_004250837.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Solanum lycopersicum]
Length=640

 Score =   184 bits (468),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 132/310 (43%), Positives = 181/310 (58%), Gaps = 38/310 (12%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +AT FKP+  Y+R + +TFKD  PS+L+L+D LLS+EPER
Sbjct  352   KIFKLCGSPSEEYWKKSKLPHATSFKPQHPYKRCVTDTFKDFPPSALALVDILLSIEPER  411

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYK-CKDSEGA  1153
             RGTASSAL +EFF+T PLPCDPS+LPKYPP KEYDA+MR+E  RR+     K C D    
Sbjct  412   RGTASSALNSEFFSTKPLPCDPSSLPKYPPSKEYDAKMREEEARRRKAESVKGCGDE---  468

Query  1152  TPAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSF---KARGGGVG  982
                      L  + ++ +G+  ++   G          G S LS  V +   +  G G  
Sbjct  469   --------SLSKSSRQSKGESTIESIAGQ---------GQSNLSISVKYNPLEESGTGFP  511

Query  981   QLP--------MFCSSAAPHPAAIGLD-LCREDISVNSH---WHRLAMKCNRVIDNESDH  838
               P           S++  HP + G     +ED   + H   + R     +R + + S  
Sbjct  512   IEPPRVKNRNGFIHSTSVIHPNSAGYSRQVKEDSCTSQHGGEFLRQGSHTSRTVGDFSSV  571

Query  837   HYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKT  658
             H + D+     D+ + YVP+   +  SGPL+P GG++++MLKEHE+QIQ AVRKARL+K 
Sbjct  572   HSKRDDGSSYGDSTV-YVPKKSRLLCSGPLVPPGGSMEDMLKEHERQIQEAVRKARLEK-  629

Query  657   SKAKKGNIDY  628
              + KK   DY
Sbjct  630   GRTKKNCYDY  639



>gb|KEH36411.1| kinase superfamily protein, putative [Medicago truncatula]
Length=530

 Score =   181 bits (460),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 153/409 (37%), Positives = 204/409 (50%), Gaps = 112/409 (27%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +ATIFKP++ Y+R ++ETFK+   S+LSLL+ LL++EP+ 
Sbjct  121   KIFKLCGSPSEEYWKKSKLPHATIFKPQQPYKRVVSETFKNFPSSALSLLEVLLAIEPKD  180

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYD-----------------------AR  1219
             RGTASSAL+NEFFT+ PLPCDPS LPKYPP KE+D                       A 
Sbjct  181   RGTASSALQNEFFTSKPLPCDPSTLPKYPPSKEFDPNFEKRKREGIPSLILVIIIDSHAI  240

Query  1218  MRDEMLR------------------------RQNGSGYKCKDSEGATPAPGDLAKLQDAI  1111
             +   ML                         RQ   G+  K+S+   PAP    ++Q +I
Sbjct  241   LSYLMLALSAEIAKRCAASVVGRRAANKGHVRQESVGWNFKESK-VVPAPDANVEIQSSI  299

Query  1110  KKWQGQLKLKKC----------GGM------------------------SEVDNSRRLGG  1033
             +K QGQ    KC          GG                         S   +SR +  
Sbjct  300   EKRQGQCN-SKCISEKYNPEEEGGYGFPLEPAKLRSRNIFSHSGQSMHPSAYGSSRDMNL  358

Query  1032  SE-----------LSRHVSFKARG----GGVGQLPMFCSSAAPHPAAIGLDLCREDISVN  898
              E            SR +  + +     G   QL  F +S A    +  LD+   D S+N
Sbjct  359   KEEAALPGPDRVFTSRKIELRKQNSYWHGSTAQLSRFSNSVAIRGDS-QLDMS-GDCSLN  416

Query  897   SHW--HRLAMKCNRVIDNESD-------HHYQNDEQKPRKDTMMGYVPQTGHI-HYSGPL  748
             S W   +  M+ + + D ES+       H  + D    RKD  MG  P+ GHI +YSGPL
Sbjct  417   SQWLEDQFDMRYSHLDDGESNQLLDGTKHSRKKDFHLFRKDRAMGCAPKNGHILNYSGPL  476

Query  747   IPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQTESLLQY  601
             +P   N++E+LKEHE+QIQ AVRKARL K +  KK + + GQTESL  +
Sbjct  477   LPREDNLEEILKEHERQIQQAVRKARLVKEN--KKADSENGQTESLFHF  523



>ref|XP_008352759.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
isoform X2 [Malus domestica]
Length=491

 Score =   181 bits (458),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 131/290 (45%), Positives = 176/290 (61%), Gaps = 32/290 (11%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+EFWK +KL  AT FKP++ Y+RRIA+TFKD  PS+L L++ LL++EPE 
Sbjct  222   KIFKLCGSPSEEFWKKTKLPLATSFKPQQPYKRRIADTFKDFPPSALGLIEKLLAIEPET  281

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYK--CKDSEG  1156
             RG+A+SAL +EFF+T PLPCDP+ LPKYPP KE+DA++RDE  RR+    +K   +D++G
Sbjct  282   RGSAASALTSEFFSTHPLPCDPADLPKYPPSKEFDAKLRDEEKRRK-ADAFKGGSRDTKG  340

Query  1155  ATP---APGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGV  985
              +P     GD++         QGQ  LK  G        +R   S  +      AR  G 
Sbjct  341   PSPEFNVQGDVS--------LQGQRNLKTTG---HKYTPQRDSVSGFAMEPPGGARPNGY  389

Query  984   GQLPMFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNR-----VIDNESDHHYQNDE  820
                   CSS   HP+A+G  L +       +  R  +K  R        + S    + DE
Sbjct  390   S----LCSSMV-HPSAVGSSLNK----TAGYTSRPELKSQRSHMPQAAADLSSSSSKKDE  440

Query  819   QKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKAR  670
                 K++   YVP+   IHYSGPL+P GGN+++MLKEHE+QIQ+AVRKAR
Sbjct  441   TVASKESRRCYVPKN-RIHYSGPLVPPGGNLEDMLKEHERQIQHAVRKAR  489



>ref|XP_006389488.1| hypothetical protein POPTR_0022s00310g, partial [Populus trichocarpa]
 gb|ERP48402.1| hypothetical protein POPTR_0022s00310g, partial [Populus trichocarpa]
Length=656

 Score =   182 bits (463),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 148/358 (41%), Positives = 186/358 (52%), Gaps = 87/358 (24%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPSDE+WK SKL +ATIFKP+  Y+R + ETFKD   S+L+LLD LL++EPE 
Sbjct  311   KIFKLCGSPSDEYWKRSKLPHATIFKPQHPYKRCVTETFKDFPSSALALLDVLLAVEPEA  370

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEG--  1156
             RGTA SAL++EFFTT PLPCDPS LPK+PP KE+D + RDE  RR+  +G K +  E   
Sbjct  371   RGTALSALDSEFFTTKPLPCDPSTLPKHPPTKEFDVKFRDEDARRRRAAGGKGRGYESTR  430

Query  1155  -------ATPAPGDLAKLQDAIKKWQG---QLKLKKCGGMSEVDNSR-------------  1045
                      PA    A+LQ +I+K QG   Q+ + +     E   SR             
Sbjct  431   RGSKESKVMPAADANAELQASIQKRQGQSKQISISEIYNHEEDGVSRSPVGPAKGTARNI  490

Query  1044  -----------RLGGS-----------------------ELSRHVSFKARGGGVGQLPMF  967
                         LG S                       EL    SF  RG    QL  F
Sbjct  491   YSHSGQSVHPMNLGSSHNMNINETFRAPGQDFISSRQAAELRAQRSFIERGAV--QLYGF  548

Query  966   CSSAAPHPAAIGLDLCRED--------ISVNSHWHRLAMKCNRVIDNESDH------HYQ  829
              +S A           R D         ++NSHW   +        ++S H      ++ 
Sbjct  549   SNSVA----------VRGDSQFHGSSSTNLNSHWPEGSFNARYNSLDDSSHGLPGRPNFS  598

Query  828   NDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTS  655
             N  +KP  D+  GY  +  H+HYSGPL+P GGNI+EMLKEHEKQIQ AVRKARLDK +
Sbjct  599   N--KKPGLDSTTGYSTKKSHVHYSGPLVPRGGNIEEMLKEHEKQIQRAVRKARLDKNT  654



>ref|XP_011036368.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Populus euphratica]
Length=646

 Score =   182 bits (463),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 128/301 (43%), Positives = 174/301 (58%), Gaps = 25/301 (8%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+ +W   K  +AT FKP++ Y RRIAETFK+  PS+L+L+D LLS+EP+ 
Sbjct  354   KIFKLCGSPSEAYWTKKKFPHATSFKPQQPYIRRIAETFKNFPPSALTLVDKLLSMEPQD  413

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+A+SAL +EFF   PLP DPS+LPKYPP KE DA+MRD+  RRQ     K +  E   
Sbjct  414   RGSATSALRSEFFRIEPLPSDPSSLPKYPPSKELDAKMRDQEARRQKAEAVKGRGPESVR  473

Query  1149  PAPGDLAKLQDAIKKWQGQLKL----KKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVG  982
                GD  K   +    QGQ K      K     +  +S R     +S+  S K       
Sbjct  474   RGSGDTKKAPTSEFTAQGQPKTICSSYKYNIPEDGSSSFRFEPPRVSKKNSLKH------  527

Query  981   QLPMFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNR----VIDNESDHHYQNDEQK  814
                   S++  H +A+GL L +   SV+   +   ++ N+         S    +  E+ 
Sbjct  528   ------SASVIHHSAVGLSLNK---SVDCTENNPELRSNKSRMSQSGEISSSSLKKKERA  578

Query  813   PRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNI  634
             P  D+  G+VP+   IHYSGPL+P  GN++E+LKEHE+QIQ AVRKARL+K+    K N+
Sbjct  579   PSIDSSAGFVPRKNRIHYSGPLMPPEGNMEEILKEHERQIQQAVRKARLEKS--GTKDNL  636

Query  633   D  631
             D
Sbjct  637   D  637



>ref|XP_011015815.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Populus euphratica]
 ref|XP_011015816.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Populus euphratica]
Length=645

 Score =   182 bits (463),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 128/301 (43%), Positives = 174/301 (58%), Gaps = 25/301 (8%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+ +W   K  +AT FKP++ Y RRIAETFK+  PS+L+L+D LLS+EP+ 
Sbjct  353   KIFKLCGSPSEAYWTKKKFPHATSFKPQQPYIRRIAETFKNFPPSALTLVDKLLSMEPQD  412

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+A+SAL +EFF   PLP DPS+LPKYPP KE DA+MRD+  RRQ     K +  E   
Sbjct  413   RGSATSALRSEFFRIEPLPSDPSSLPKYPPSKELDAKMRDQEARRQKAEAVKGRGPESVR  472

Query  1149  PAPGDLAKLQDAIKKWQGQLKL----KKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVG  982
                GD  K   +    QGQ K      K     +  +S R     +S+  S K       
Sbjct  473   RGSGDTKKAPTSEFTAQGQPKTICSSYKYNIPEDGSSSFRFEPPRVSKKNSLKH------  526

Query  981   QLPMFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNR----VIDNESDHHYQNDEQK  814
                   S++  H +A+GL L +   SV+   +   ++ N+         S    +  E+ 
Sbjct  527   ------SASVIHHSAVGLSLNK---SVDCTENNPELRSNKSRMSQSGEISSSSLKKKERA  577

Query  813   PRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNI  634
             P  D+  G+VP+   IHYSGPL+P  GN++E+LKEHE+QIQ AVRKARL+K+    K N+
Sbjct  578   PSIDSSAGFVPRKNRIHYSGPLMPPEGNMEEILKEHERQIQQAVRKARLEKS--GTKDNL  635

Query  633   D  631
             D
Sbjct  636   D  636



>ref|XP_009357190.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Pyrus x bretschneideri]
Length=633

 Score =   182 bits (462),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 130/290 (45%), Positives = 175/290 (60%), Gaps = 32/290 (11%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+EFWK +KL  AT FKP++ Y+RRIA+TFKD  PS+L L++ LL++EPE 
Sbjct  364   KIFKLCGSPSEEFWKKTKLPLATSFKPQQPYKRRIADTFKDFPPSALGLIEKLLAIEPET  423

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYK--CKDSEG  1156
             RG+A+S L +EFF+T PLPCDP+ LPKYPP KE+DA+ RDE   R+ G+ +K   +D++G
Sbjct  424   RGSAASVLNSEFFSTHPLPCDPADLPKYPPSKEFDAKHRDEEKGRKAGA-FKGGSRDTKG  482

Query  1155  ATP---APGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGV  985
              +P     GD++         QGQ  LK  G        +R   S  +      AR  G 
Sbjct  483   PSPEFNVQGDVS--------LQGQRNLKTTG---HKYTPQRDSVSGFAMEPPGGARPNGY  531

Query  984   GQLPMFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNR-----VIDNESDHHYQNDE  820
                   CSS   HP+A+G    +       H  R  +K  R        + S +  + DE
Sbjct  532   S----LCSSMV-HPSAVGSSFNK----TAGHTSRPELKSQRSHMPQAAADLSSYSSKKDE  582

Query  819   QKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKAR  670
                 K++   YVP+   IHYSGPL+P GGN+++MLKEHE+QIQ+AVRKAR
Sbjct  583   TVASKESRRCYVPKN-RIHYSGPLVPPGGNLEDMLKEHERQIQHAVRKAR  631



>ref|XP_006363662.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Solanum tuberosum]
Length=644

 Score =   182 bits (462),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 129/299 (43%), Positives = 177/299 (59%), Gaps = 16/299 (5%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +AT FKP+  Y+R + +TFKD  PS+L+L+D LLS+EPER
Sbjct  356   KIFKLCGSPSEEYWKKSKLPHATSFKPQHPYKRCVTDTFKDFPPSALALVDILLSIEPER  415

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYK-CKDSEGA  1153
             RGTA SAL +EFF+T PLPCDPS+LPKYPP KEYDA++R+E  RR+     K C D   +
Sbjct  416   RGTAYSALNSEFFSTKPLPCDPSSLPKYPPSKEYDAKIREEEARRRKAESVKGCGDESLS  475

Query  1152  TPAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLP  973
               +     +        QGQ  +      + ++ S   G   L      K R G +    
Sbjct  476   KSSRQSKGESTTESISGQGQSNISISVKYNPLEES---GSGFLIEPPRVKNRNGFIH---  529

Query  972   MFCSSAAPHPAAIGLDL-CREDISVNSH---WHRLAMKCNRVIDNESDHHYQNDEQKPRK  805
                S++  HP A G     +ED   + H   + R     +R + + S  H + D+     
Sbjct  530   ---STSVIHPNAAGYSRKVKEDSCTSQHGGEFLRQGSHTSRAVGDFSSVHSKRDDGSSYG  586

Query  804   DTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDY  628
             D+ + YVP+   +  SGPL+P GG++++MLKEHE+QIQ AVRKARL+K  + KK   DY
Sbjct  587   DSTV-YVPKKSRLLCSGPLVPPGGSMEDMLKEHERQIQEAVRKARLEK-GRTKKNCYDY  643



>ref|XP_010100096.1| putative serine/threonine-protein kinase [Morus notabilis]
 gb|EXB81479.1| putative serine/threonine-protein kinase [Morus notabilis]
Length=649

 Score =   182 bits (461),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 133/298 (45%), Positives = 174/298 (58%), Gaps = 27/298 (9%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS++FW+ ++L +AT FKP++ Y+R + ETFKD  PS+L+L+D LL++EPE 
Sbjct  353   KIFKLCGSPSEDFWQRTRLPHATSFKPQQPYKRCVPETFKDFPPSALALVDRLLTIEPES  412

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGA-  1153
             RG+A S LE++FFT+ PLPCDPS LPKYPP KE+DA++R+E  RR      + +  E   
Sbjct  413   RGSAVSTLESDFFTSEPLPCDPSCLPKYPPSKEFDAKLRNEEARRCKADTVRGRGPESVR  472

Query  1152  --------TPAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKAR  997
                     TP P      QD I   Q Q K K     S   + +  GGS         AR
Sbjct  473   RGSRDNKQTPTPE--FDNQDDIP-LQKQSKAKTS---SHKYSPQEDGGSGFRMEPPRGAR  526

Query  996   GGGVGQLPMFCSSAAPHPAAIGLDLCRE---DISVNS---HWHRLAMKCNRVIDNESDHH  835
               G        S++  HP+A+ +   R    D + N       R  M      ++     
Sbjct  527   QNGYAH-----STSMVHPSAVVVGPSRHKAADFTRNKPEFRTQRSHMPQPPPAESSFSST  581

Query  834   YQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDK  661
              +ND   P K++ MGYVPQ   IHYSGPL+P GGNI++MLKEHEKQIQ AVRKARLDK
Sbjct  582   KKND-IVPAKESGMGYVPQKNRIHYSGPLVPPGGNIEDMLKEHEKQIQQAVRKARLDK  638



>ref|XP_009420482.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Musa acuminata subsp. malaccensis]
Length=729

 Score =   182 bits (462),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 134/346 (39%), Positives = 184/346 (53%), Gaps = 49/346 (14%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+EFW+ SKL +AT FKP++ Y RR+ ETFKD  P +L+LLD LLS++P  
Sbjct  378   KIFKLCGSPSEEFWRTSKLPHATSFKPQQPYLRRVRETFKDFPPPALALLDHLLSVDPAN  437

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGTA+SALE+EFFTT P  CDPS+LPK+PP KEYDA++R+E  RRQ  +  K    E   
Sbjct  438   RGTATSALESEFFTTKPFACDPSSLPKFPPSKEYDAKLRNEEARRQRAAAMKGHGVENGN  497

Query  1149  ----PAPGDLAKLQDAIKKWQGQLKL--KKCGGMSEVDNSRRLGGSELSRHVSFKARG--  994
                 P P     ++   +K  G  ++   K     EV +  ++  S  +    F   G  
Sbjct  498   RKEMPVPD--GNMEPQTRKIHGSHRIGSDKYKSREEVSSGLQMDLSRGTAENGFLHSGPL  555

Query  993   --------GGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMK-----------  871
                      G+   P   +   PH     L +    +   S+  RL  +           
Sbjct  556   MHSGRLSTTGLPIGPEMKTHVLPHGRTADLPITSGPVVARSNTARLDRRQSAKHMHMPGN  615

Query  870   ------CNRVIDNES----DHH--------YQNDEQKPRKDTMMGYVPQTGHIHYSGPLI  745
                    +R I + S     HH        ++ D++   K++ +G+ P+   IHYSGPL+
Sbjct  616   QASSKYFHRDIADSSKQEWTHHLLDGPSASHRKDDRTGDKESTIGHGPKKNRIHYSGPLM  675

Query  744   PAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQTESLL  607
             P GGNI+EMLKEHE+QIQ  VR+AR D+T     G  D  Q E+LL
Sbjct  676   PPGGNIEEMLKEHEQQIQQVVRRARHDRTKPRNHG--DRAQLEALL  719



>ref|XP_008352758.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
isoform X1 [Malus domestica]
Length=633

 Score =   181 bits (460),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 131/290 (45%), Positives = 176/290 (61%), Gaps = 32/290 (11%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+EFWK +KL  AT FKP++ Y+RRIA+TFKD  PS+L L++ LL++EPE 
Sbjct  364   KIFKLCGSPSEEFWKKTKLPLATSFKPQQPYKRRIADTFKDFPPSALGLIEKLLAIEPET  423

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYK--CKDSEG  1156
             RG+A+SAL +EFF+T PLPCDP+ LPKYPP KE+DA++RDE  RR+    +K   +D++G
Sbjct  424   RGSAASALTSEFFSTHPLPCDPADLPKYPPSKEFDAKLRDEEKRRK-ADAFKGGSRDTKG  482

Query  1155  ATP---APGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGV  985
              +P     GD++         QGQ  LK  G        +R   S  +      AR  G 
Sbjct  483   PSPEFNVQGDVS--------LQGQRNLKTTG---HKYTPQRDSVSGFAMEPPGGARPNGY  531

Query  984   GQLPMFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNR-----VIDNESDHHYQNDE  820
                   CSS   HP+A+G  L +       +  R  +K  R        + S    + DE
Sbjct  532   S----LCSSMV-HPSAVGSSLNK----TAGYTSRPELKSQRSHMPQAAADLSSSSSKKDE  582

Query  819   QKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKAR  670
                 K++   YVP+   IHYSGPL+P GGN+++MLKEHE+QIQ+AVRKAR
Sbjct  583   TVASKESRRCYVPKN-RIHYSGPLVPPGGNLEDMLKEHERQIQHAVRKAR  631



>ref|XP_010912690.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Elaeis guineensis]
Length=694

 Score =   181 bits (459),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 136/323 (42%), Positives = 179/323 (55%), Gaps = 35/323 (11%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPSDE+WK SKL +ATIF+P+  Y R  AETFKD  PS+L+LLDSLL++EPE+
Sbjct  370   KIFKLCGSPSDEYWKRSKLPHATIFRPQNQYRRCFAETFKDFPPSALALLDSLLAIEPEK  429

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGTA+SAL++EFF + PL CDPS+LPKYPP KEYDA++RDE  RRQ  +    + SE   
Sbjct  430   RGTAASALDSEFFRSMPLACDPSSLPKYPPSKEYDAKLRDEEARRQKAAVKNSRGSESVR  489

Query  1149  PAPGDLAKLQDAIKKWQGQLKLK-KCGGMSEVDNSRRLGGSELSRH--------------  1015
             P  G+    Q  +++ + Q +   KC             G  +  H              
Sbjct  490   PGRGESRGKQVPLEQQKQQAQTNPKCTSEKYCPLEDGAEGFPIDPHSGAENGFPQSGQPG  549

Query  1014  VSFKARGGGVGQLPMFCSSA-APHPAAI----------GLDLCREDISV------NSHWH  886
             V    R   V +    CSS   P+   +          G D      SV      NS + 
Sbjct  550   VYGNLRPKNVNKDVRSCSSMRVPNGPQLRTQRSYRPQSGADFSNFPASVAAKGSSNSRYD  609

Query  885   RLAM---KCNRVIDNESDHHYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEML  715
             RL +      +++D  S  + ++     +  T +GY  +   IHYSGPL+P GGNI++ML
Sbjct  610   RLDVTEPSEKQMLDRPSSTYKKDYGVGGKDSTAIGYGSKNKRIHYSGPLVPPGGNIEDML  669

Query  714   KEHEKQIQNAVRKARLDKTSKAK  646
             KEHE+QIQ AVRKARLDK    K
Sbjct  670   KEHERQIQQAVRKARLDKVKTKK  692



>ref|XP_009148261.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Brassica rapa]
Length=663

 Score =   180 bits (457),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 135/336 (40%), Positives = 182/336 (54%), Gaps = 52/336 (15%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL  AT+FKP+  Y+R +AETFK L  S+L+L++ LL++EP+ 
Sbjct  341   KIFKLCGSPSEEYWKRSKLSQATVFKPQNPYKRCVAETFKSLPSSALALVEVLLAVEPDA  400

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSE---  1159
             RGT + AL++EFFTT P   DPS+LPKY P KE D ++R+E  RR+ G+  K  +S+   
Sbjct  401   RGTTALALQSEFFTTKPYASDPSSLPKYKPKKEIDVKLREEEARRKKGTSSKQNESKQVS  460

Query  1158  ---GATPAPGDLAKLQDAIKKWQGQLK---------------------LKKCGGMS----  1063
                 A PAP   A+L  +++K QGQ                       LK   G +    
Sbjct  461   RESKAVPAPDANAELLASLQKRQGQSNQTSMSEKFNPNEDAAGFLIEPLKSGTGQNGYAR  520

Query  1062  ---EVDNSRRLGGSELSRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSH  892
                   +SR     EL    SF  RG    QL  F +S A   A+            N  
Sbjct  521   NGVSSGSSRSTPRKELRGQRSFVQRGA--AQLTKFSNSVAARDAS-------HFAIANPR  571

Query  891   WHRLAMKCNRVIDNESDHHYQNDEQKPR-----KDTMMGYVPQTGHIHYSGPLIPAGGNI  727
             W    +  N     +     Q    KP+     K++++GY  +T  ++YSGPL+ AGGN+
Sbjct  572   WLEDRLNNNNDGRQDDGDWSQRLLVKPKDCTKDKESILGYGEKTEKMNYSGPLVSAGGNL  631

Query  726   DEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQT  619
             DEMLKEHE+QIQ AVRKAR+DK    K    D+GQT
Sbjct  632   DEMLKEHERQIQVAVRKARVDK----KSNRDDHGQT  663



>ref|XP_010683176.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Beta vulgaris subsp. vulgaris]
Length=691

 Score =   180 bits (457),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 123/301 (41%), Positives = 174/301 (58%), Gaps = 32/301 (11%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+ +WK +KL +AT FKP + Y+RR+ E F+D    +L+L+D+LLS+EPE+
Sbjct  382   KIFKLCGSPSESYWKKTKLPHATSFKPSQPYKRRLMEAFRDFPSPALALVDALLSIEPEK  441

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGTAS+AL++EFFTT PLPCDPS+LPK+PP KE+D ++RDE  RR+     K +  E   
Sbjct  442   RGTASTALKSEFFTTHPLPCDPSSLPKFPPTKEFDIKLRDEEARRRKAEAVKGRGPESVR  501

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
               P +     +      G + L+   G      ++R GGS L+     +    G      
Sbjct  502   RGPRESKPTPEY--DADGDVSLQGQKGARNY-KAQRNGGSALTTEADRRNTPNGK-----  553

Query  969   FCSSAAPHPAAIGLDLCREDISVN------------------SHWHRLAMKCNRVIDNES  844
              CS+   HP+A+G    ++    N                  S  HRL M       + S
Sbjct  554   -CSTMV-HPSAVGSTWNKKSKDENDAHEAPGRTISSSKNGPDSRSHRLGMASGDA--DLS  609

Query  843   DHHYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLD  664
             +   +++E    KD   GY+P+   +HYSGPL+P GGN+++MLKEHEKQIQ AVRK+R +
Sbjct  610   NLSNRSNEWASGKDN--GYMPKKNRMHYSGPLVPTGGNLEDMLKEHEKQIQQAVRKSRTE  667

Query  663   K  661
             K
Sbjct  668   K  668



>gb|KHN39684.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=490

 Score =   177 bits (449),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 142/329 (43%), Positives = 187/329 (57%), Gaps = 36/329 (11%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +AT+FKP++ Y+R +++TFKD+  S+LSLL+ LL++EPE 
Sbjct  173   KIFKLCGSPSEEYWKKSKLPHATVFKPQQPYKRVVSQTFKDIPSSALSLLEVLLAVEPED  232

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLR---------RQNGSGY  1177
             RGTAS AL++EFFT  P PCDPS LPKYPP KE+DA++R+E  R              G 
Sbjct  233   RGTASLALQHEFFTAMPRPCDPSTLPKYPPIKEFDAKLREEEARRRRAANKGYEHESVGR  292

Query  1176  KCKDSEGATPAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKAR  997
               ++S+ A P P   A+ Q  +++ QGQ    KC    E  N +  G      H   K+R
Sbjct  293   NFRESK-AVPIPDANAEFQATMRR-QGQCN-SKC--TIEKYNPQEDGDYGF-HHEPEKSR  346

Query  996   GGGVGQLPMFCSSAAPHPAAIGLDLCRE---DISVNSHW--HRLAMKCNRVIDNESDHHY  832
                V    +  S    HP A+  D   +   D SVNS W   +  M+ +   D ES+   
Sbjct  347   ALNV----LSHSGQLMHPIAVRGDSLLDMSGDFSVNSQWPEDQFGMRYSHQADGESNKLL  402

Query  831   -------QNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKA  673
                    + D     KD   GY  +   +H+SGPL+    N +EMLKEHE+QIQ AVRK 
Sbjct  403   DGLKSSQKKDFHPVDKDCTKGYANKNARMHHSGPLLAPEDNREEMLKEHERQIQQAVRKV  462

Query  672   RL--DKTSKAKKGNIDYGQTESLLQYVGN  592
             RL  DKT  A  GN   G TESL Q+V N
Sbjct  463   RLGKDKTKNADSGN---GLTESLFQHVRN  488



>gb|AAG50753.1|AC079733_21 CRK1 protein, putative [Arabidopsis thaliana]
Length=686

 Score =   179 bits (455),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 134/331 (40%), Positives = 185/331 (56%), Gaps = 56/331 (17%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ S+L++ATIFKP+  Y+R +A+TFKDL  S+L+LL+ LL++EP+ 
Sbjct  352   KIFKLCGSPSEEYWRRSRLRHATIFKPQHPYKRCVADTFKDLPSSALALLEVLLAVEPDA  411

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSE---  1159
             RGTASSAL++EFFTT P P +PS+LP+Y P KE+DA++R+E  RR+ GS  K  + +   
Sbjct  412   RGTASSALQSEFFTTKPFPSEPSSLPRYQPRKEFDAKLREEEARRRKGSSSKQNEQKRLA  471

Query  1158  ---GATPAPGDLAKLQDAIKKWQGQLKL----KKCGGMSEVDNSRRL-------------  1039
                 A PAP   A+L  +I+K  G+       +K     +  N  R+             
Sbjct  472   RESKAVPAPSANAELLASIQKRLGETNRTSISEKFNPEGDSGNGFRIEPLKGNTAQNPYP  531

Query  1038  ----------GGSELSRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSHW  889
                       G S+L    S+  RG   GQL  F +S AP          R+ I VN  W
Sbjct  532   IYTNGDNHPNGSSQLRTQRSYVQRGS--GQLSRFSNSMAPTRDGSQFGSMRDAI-VNQRW  588

Query  888   -----------HRLAMKCNRVIDNESDHHYQNDEQKPRKDTMMGYVPQT-GHIHYSGPLI  745
                         RL  K N +         ++D     K+++MGY  +  G I YSGPLI
Sbjct  589   LEDGSENFNLSQRLLEKPNGI--------RKDDPSSSSKESIMGYDGEKRGRIQYSGPLI  640

Query  744   PAGGNIDEMLKEHEKQIQNAVRKARLDKTSK  652
             P  GN+DEMLKEHE+QI  AVR+A+ DK  +
Sbjct  641   PGEGNLDEMLKEHERQILLAVRRAQADKAKR  671



>ref|NP_176083.2| Protein kinase superfamily protein [Arabidopsis thaliana]
 gb|AEE33454.1| Protein kinase superfamily protein [Arabidopsis thaliana]
Length=692

 Score =   179 bits (455),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 134/331 (40%), Positives = 185/331 (56%), Gaps = 56/331 (17%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ S+L++ATIFKP+  Y+R +A+TFKDL  S+L+LL+ LL++EP+ 
Sbjct  358   KIFKLCGSPSEEYWRRSRLRHATIFKPQHPYKRCVADTFKDLPSSALALLEVLLAVEPDA  417

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSE---  1159
             RGTASSAL++EFFTT P P +PS+LP+Y P KE+DA++R+E  RR+ GS  K  + +   
Sbjct  418   RGTASSALQSEFFTTKPFPSEPSSLPRYQPRKEFDAKLREEEARRRKGSSSKQNEQKRLA  477

Query  1158  ---GATPAPGDLAKLQDAIKKWQGQLKL----KKCGGMSEVDNSRRL-------------  1039
                 A PAP   A+L  +I+K  G+       +K     +  N  R+             
Sbjct  478   RESKAVPAPSANAELLASIQKRLGETNRTSISEKFNPEGDSGNGFRIEPLKGNTAQNPYP  537

Query  1038  ----------GGSELSRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSHW  889
                       G S+L    S+  RG   GQL  F +S AP          R+ I VN  W
Sbjct  538   IYTNGDNHPNGSSQLRTQRSYVQRGS--GQLSRFSNSMAPTRDGSQFGSMRDAI-VNQRW  594

Query  888   -----------HRLAMKCNRVIDNESDHHYQNDEQKPRKDTMMGYVPQT-GHIHYSGPLI  745
                         RL  K N +         ++D     K+++MGY  +  G I YSGPLI
Sbjct  595   LEDGSENFNLSQRLLEKPNGI--------RKDDPSSSSKESIMGYDGEKRGRIQYSGPLI  646

Query  744   PAGGNIDEMLKEHEKQIQNAVRKARLDKTSK  652
             P  GN+DEMLKEHE+QI  AVR+A+ DK  +
Sbjct  647   PGEGNLDEMLKEHERQILLAVRRAQADKAKR  677



>ref|XP_004485427.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Cicer arietinum]
Length=702

 Score =   179 bits (454),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 139/357 (39%), Positives = 188/357 (53%), Gaps = 85/357 (24%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++WK SKL +ATIFKP++ Y+R ++ETFKD   S+LSLL+ LL++EP+ 
Sbjct  353   KIFKLCGSPSEDYWKKSKLPHATIFKPQQPYKRVVSETFKDFPSSALSLLEVLLAIEPKD  412

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRR---------QNGSGY  1177
             RGTASS L+NEFFT+ PLPCDP+ LPKYPP KE D + R+E  RR         Q   G 
Sbjct  413   RGTASSTLQNEFFTSNPLPCDPTTLPKYPPSKELDVKFREEDARRRRTANKGHGQESVGR  472

Query  1176  KCKDSEGATPAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRH-VSFKA  1000
               K+S+   PAP      Q +I+K QGQ    KC  +SE  N    GG       V  KA
Sbjct  473   NFKESK-VVPAPEANVNFQASIEKRQGQCN-SKC--VSEKYNPEEEGGYGFPLGPVKSKA  528

Query  999   RGGGVGQLPMFCSSA-APHPAAIG----LDLCREDISV----------------NSHWHR  883
             +        +F  S  + HP+A G    ++L  ED+ +                NS+WH 
Sbjct  529   QN-------IFSHSGQSMHPSAYGSSCNMNLRGEDVLIGPDRVFTSRNSELRKQNSYWHG  581

Query  882   LAMKCNRVIDN---------------------ESDH------HYQNDEQKPR--------  808
                K +R  ++                     + DH      H  N E            
Sbjct  582   STAKLSRFSNSVAVRGDSRFDMSGDCSLNSQWQEDHFDMRYSHLANGESSQLLDGTKHSR  641

Query  807   --------KDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDK  661
                     KD  MGY  +  H+++SGPL+P+  +++E+LKEHE+QIQ AVRKARL+K
Sbjct  642   KEEFHLLGKDRSMGYASKNSHLNFSGPLLPSDDDLEEILKEHERQIQQAVRKARLNK  698



>ref|XP_006592651.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X2 [Glycine max]
Length=661

 Score =   179 bits (453),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 145/373 (39%), Positives = 194/373 (52%), Gaps = 74/373 (20%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SK  +AT+FKP++ Y+  I++TFKD+  S+LSLL+ LLS+EP+ 
Sbjct  295   KIFKLCGSPSEEYWKKSKPPHATVFKPQQPYKCVISQTFKDIPSSALSLLEVLLSVEPKD  354

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNG--SGYKCKDSEG  1156
             RGTAS AL++EFFT  PLPCDPS LPKYPP KE+DA++R+E  RRQ     GY+  +S G
Sbjct  355   RGTASLALQHEFFTAMPLPCDPSTLPKYPPSKEFDAKLREEETRRQRAVNKGYE-HESVG  413

Query  1155  -------ATPAPGDLAKLQDAIKKWQGQLKLK----------------------------  1081
                    A P P   A+ Q  + + QGQ   K                            
Sbjct  414   RNFRESKAVPIPDANAEFQATVGR-QGQCNSKCITKKYNPEEDGDYGFHREPAKSRALDV  472

Query  1080  ---------------------KCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPMFC  964
                                  K   ++  D+  R   SEL +  S+    G   +L  F 
Sbjct  473   LSHSGQSVHPSVYGSSRNMNLKEEDLTSPDHGFRSRKSELRKQKSYWQ--GSTAKLSRFS  530

Query  963   SSAAPHPAAIGLDLCREDISVNSHW--HRLAMKCNRVIDNESDH-------HYQNDEQKP  811
             +S A     + LD+   D S NS W   +  M+C+   D +S           +ND    
Sbjct  531   NSVAVQGDPL-LDMS-GDSSANSQWPEDQFGMRCSHQADGDSKQLLDGLKSSQKNDFHPI  588

Query  810   RKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNID  631
              KD   GY  +   +H+SGPL+    N++EMLKEHE+QIQ AVRKARL K  K KK + +
Sbjct  589   GKDRAKGYANKNARMHHSGPLLAPEDNLEEMLKEHERQIQQAVRKARLGK-DKTKKADSE  647

Query  630   YGQTESLLQYVGN  592
              G TESL  +V N
Sbjct  648   SGLTESLFHHVRN  660



>ref|XP_009608659.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Nicotiana tomentosiformis]
 ref|XP_009608660.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Nicotiana tomentosiformis]
Length=648

 Score =   178 bits (452),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 133/310 (43%), Positives = 181/310 (58%), Gaps = 38/310 (12%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +AT FKP+  Y+R + +T+KD  PS+L+L+D LLS+EPE+
Sbjct  360   KIFKLCGSPSEEYWKKSKLPHATSFKPQHPYKRCVTDTYKDFPPSALALVDVLLSIEPEK  419

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYK-CKDSEGA  1153
             RGTA SAL +EFF T PLPCDPS+LPKYPP KEYDA++R+E  RR+     K C D    
Sbjct  420   RGTAYSALNSEFFNTKPLPCDPSSLPKYPPSKEYDAKIREEEARRRKAESMKGCGD----  475

Query  1152  TPAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSF---KARGGGVG  982
                        D++ K   Q K     G S  +++   G S +S+ V +   +  G G  
Sbjct  476   -----------DSLGKSSRQSK-----GESTTESNAGQGQSNISKSVKYNPLEESGTGFP  519

Query  981   QLP--------MFCSSAAPHP-AAIGLDLCREDISVNSH---WHRLAMKCNRVIDNESDH  838
               P           S++  HP AA      +ED  V+ H     R     +R + + S  
Sbjct  520   IEPPRVKNRNGFTHSTSVVHPTAAAYAHKVKEDSCVSQHGGELRRQGSHKSRAVGDFSSV  579

Query  837   HYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKT  658
             H + D+     D+ + YVP+   I  SGPL+P GG++++MLKEHE+QIQ AVRKARL+K 
Sbjct  580   HSKRDDGSSYGDSTV-YVPKKSRILCSGPLVPPGGSMEDMLKEHERQIQEAVRKARLEK-  637

Query  657   SKAKKGNIDY  628
              + KK   DY
Sbjct  638   GRTKKNCYDY  647



>ref|XP_003539386.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X1 [Glycine max]
Length=709

 Score =   178 bits (452),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 145/373 (39%), Positives = 194/373 (52%), Gaps = 74/373 (20%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SK  +AT+FKP++ Y+  I++TFKD+  S+LSLL+ LLS+EP+ 
Sbjct  343   KIFKLCGSPSEEYWKKSKPPHATVFKPQQPYKCVISQTFKDIPSSALSLLEVLLSVEPKD  402

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNG--SGYKCKDSEG  1156
             RGTAS AL++EFFT  PLPCDPS LPKYPP KE+DA++R+E  RRQ     GY+  +S G
Sbjct  403   RGTASLALQHEFFTAMPLPCDPSTLPKYPPSKEFDAKLREEETRRQRAVNKGYE-HESVG  461

Query  1155  -------ATPAPGDLAKLQDAIKKWQGQLKLK----------------------------  1081
                    A P P   A+ Q  + + QGQ   K                            
Sbjct  462   RNFRESKAVPIPDANAEFQATVGR-QGQCNSKCITKKYNPEEDGDYGFHREPAKSRALDV  520

Query  1080  ---------------------KCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPMFC  964
                                  K   ++  D+  R   SEL +  S+    G   +L  F 
Sbjct  521   LSHSGQSVHPSVYGSSRNMNLKEEDLTSPDHGFRSRKSELRKQKSYWQ--GSTAKLSRFS  578

Query  963   SSAAPHPAAIGLDLCREDISVNSHW--HRLAMKCNRVIDNESDH-------HYQNDEQKP  811
             +S A     + LD+   D S NS W   +  M+C+   D +S           +ND    
Sbjct  579   NSVAVQGDPL-LDMS-GDSSANSQWPEDQFGMRCSHQADGDSKQLLDGLKSSQKNDFHPI  636

Query  810   RKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNID  631
              KD   GY  +   +H+SGPL+    N++EMLKEHE+QIQ AVRKARL K  K KK + +
Sbjct  637   GKDRAKGYANKNARMHHSGPLLAPEDNLEEMLKEHERQIQQAVRKARLGK-DKTKKADSE  695

Query  630   YGQTESLLQYVGN  592
              G TESL  +V N
Sbjct  696   SGLTESLFHHVRN  708



>ref|XP_006478251.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Citrus sinensis]
Length=665

 Score =   178 bits (452),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 123/307 (40%), Positives = 179/307 (58%), Gaps = 18/307 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ SK  +AT FKP++ Y+R++ ETF+++  S+L+L+D LL++EPE 
Sbjct  371   KIFKLCGSPSEDYWRKSKSAHATSFKPQQPYKRKVLETFRNIPQSALALVDKLLTIEPEN  430

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+A+SAL +EFF T PLPCDPS LPKYPP KE DA++RD+  R+Q     + +  E   
Sbjct  431   RGSAASALRSEFFKTEPLPCDPSNLPKYPPSKELDAKLRDQEARKQKAEAVRGRGPESVR  490

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
                 D   ++       GQ K            S +    E S    F+     VG+  +
Sbjct  491   RGSRDFTAVRTPEFIPSGQSKPTSI--------SHKFHNQEDSCS-GFRIEPPTVGRQNV  541

Query  969   FC-SSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKPR---KD  802
                SS A HP+A      +  +S  ++   L  + + +    +D    N+    R   +D
Sbjct  542   NSHSSTAVHPSA---SWNKSTVSTRNN-SELRTQRSHLPQTAADFSNNNNRMNDRVFIRD  597

Query  801   TMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQ  622
             + MGYVP+   IHYSGPL+P GGN++++LKEHE+QIQ+AVRKARL+K+     G I  GQ
Sbjct  598   SNMGYVPKKNRIHYSGPLMPPGGNMEDILKEHERQIQHAVRKARLEKSGTNNNG-IVVGQ  656

Query  621   TESLLQY  601
                  +Y
Sbjct  657   PNHYGRY  663



>gb|KDO51718.1| hypothetical protein CISIN_1g006004mg [Citrus sinensis]
Length=665

 Score =   178 bits (451),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 119/296 (40%), Positives = 175/296 (59%), Gaps = 17/296 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ SK  +AT FKP++ Y+R++ ETF++   S+L+L+D LL++EPE 
Sbjct  371   KIFKLCGSPSEDYWRKSKSAHATSFKPQQPYKRKVLETFRNFPQSALALVDKLLTIEPEN  430

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+A+SAL +EFF T PLPCDPS LPKYPP KE DA++RD+  R+Q     + +  E   
Sbjct  431   RGSAASALRSEFFKTEPLPCDPSNLPKYPPSKELDAKLRDQEARKQEAEAVRGRGPESVR  490

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
                 D + ++       GQ K            S +    E S    F+     VG+  +
Sbjct  491   RGSRDFSAVRTPEFIPSGQSKPTSI--------SHKFHNQEDSCS-GFRIEPPTVGRQNV  541

Query  969   FC-SSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKPR---KD  802
                SS A HP+A      +  +S  ++   L  + + +    +D    N+    R   +D
Sbjct  542   NSHSSTAVHPSA---SWNKSTVSTRNN-SELRTQRSHLPQTAADFSNNNNRMNDRVFIRD  597

Query  801   TMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNI  634
             + MGYVP+   IHYSGPL+P GGN++++LKEHE+QIQ+AVRKARL+K+     G +
Sbjct  598   SNMGYVPKKNRIHYSGPLMPPGGNMEDILKEHERQIQHAVRKARLEKSGTNNNGLV  653



>gb|KDP45636.1| hypothetical protein JCGZ_17243 [Jatropha curcas]
Length=642

 Score =   177 bits (450),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 124/294 (42%), Positives = 169/294 (57%), Gaps = 18/294 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W    L +AT FKP+ +Y+RR+AETFK+   S+LSL+D LLS+EPE 
Sbjct  365   KIFKLCGSPSEDYWHKKGLSHATSFKPQHSYKRRVAETFKNFPSSALSLIDKLLSMEPEA  424

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+A+SAL ++FF + P PCDPS+LPKYPP KE DA++R+E  RR    G       GA 
Sbjct  425   RGSATSALNSQFFNSEPFPCDPSSLPKYPPSKELDAKIREEEARRMRAEGKAS--VHGAE  482

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
             P       +Q  I   QGQ K        ++       GS        K     + Q   
Sbjct  483   PVRIVSRDIQGFIP--QGQTKTNSTSYKYDIQED---AGSGFRIEPPNKPINIALSQ---  534

Query  969   FCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKPR--KDTM  796
               S++  HP+ +G  L  +++  + H      +  +    +S     N   K    +D M
Sbjct  535   --SNSTIHPSQVGSSLVNKNLGSSRH-RNTEFRTQKSYRPQSTVDISNSSLKKDFIRDPM  591

Query  795   MGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNI  634
             +G VP+   IHYSGPL+P GGNI++MLKEHE+QIQ AVRKARL+K+    KGN 
Sbjct  592   VG-VPRKNRIHYSGPLMPPGGNIEDMLKEHERQIQQAVRKARLEKS--GTKGNF  642



>ref|XP_009792319.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Nicotiana sylvestris]
 ref|XP_009792320.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Nicotiana sylvestris]
Length=647

 Score =   177 bits (450),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 133/312 (43%), Positives = 180/312 (58%), Gaps = 42/312 (13%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS E+WK SKL +AT FKP+  Y+R + +T+KD  PS+L+L+D LLS+EPE+
Sbjct  359   KIFKLCGSPSQEYWKKSKLPHATSFKPQHPYKRCVTDTYKDFPPSALALVDVLLSIEPEK  418

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYK-CKDSEGA  1153
             RGTA SAL +EFF T PLPCDPS+LPKYPP KEYDA++R+E  RR+     K C D    
Sbjct  419   RGTAYSALNSEFFNTKPLPCDPSSLPKYPPSKEYDAKIREEEARRRKAESVKGCGD----  474

Query  1152  TPAPGDLAKLQDAIKK--WQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSF---KARGGG  988
                        D++ K  WQ +       G S  +++   G S +S+ V +   +  G G
Sbjct  475   -----------DSLGKSTWQSK-------GESTTESNAGQGQSNISKSVKYNPLEESGTG  516

Query  987   VGQLP--------MFCSSAAPHP-AAIGLDLCREDISVNSH---WHRLAMKCNRVIDNES  844
                 P           S++  HP AA      +ED  V+ H     R     +R +   S
Sbjct  517   FPIEPPRVKNRNGFTHSTSVVHPTAAAYAHKVKEDSCVSRHGGELRRQGSHKSRAVGEFS  576

Query  843   DHHYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLD  664
               H + D+     D+ + YVP+   I  SGPL+P GG++++MLKEHE+QIQ AVRKARL+
Sbjct  577   SVHSKRDDGSSYGDSTV-YVPKKSRILCSGPLVPPGGSMEDMLKEHERQIQEAVRKARLE  635

Query  663   KTSKAKKGNIDY  628
             K  + KK   DY
Sbjct  636   K-GRTKKNCYDY  646



>ref|XP_006376169.1| hypothetical protein POPTR_0013s10440g, partial [Populus trichocarpa]
 gb|ERP53966.1| hypothetical protein POPTR_0013s10440g, partial [Populus trichocarpa]
Length=653

 Score =   177 bits (449),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 127/317 (40%), Positives = 182/317 (57%), Gaps = 33/317 (10%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+ +W+ +K  +AT FKP+++Y R I ETFK   PS+L+L+D LLS+EP+ 
Sbjct  355   KIFKLCGSPSEIYWQKTKFPHATSFKPQQSYIRCITETFKHFPPSALTLVDKLLSMEPQD  414

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGA-  1153
             RG+A+SAL +EFF   PLP DPS+LPKY PCKE DA++RDE  RRQ     K +  E   
Sbjct  415   RGSATSALRSEFFRIEPLPADPSSLPKYSPCKELDAKLRDEEARRQRAEAVKGRGPESVR  474

Query  1152  --------TPAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKAR  997
                      P P   A+ Q        +  +++  G        R+    +S+   F+  
Sbjct  475   RGSIDTKKAPTPEFTAQAQPKTASSSYKYYIQEDAG-----TGFRIEPPRVSKQNGFEH-  528

Query  996   GGGVGQLPMFCSSAAPHPAAI-GLDLCREDISVNSHWHRLAMKCNRVIDNESDHHY--QN  826
                        S++  HP+A+ GL L +   S  ++    A K +     E       +N
Sbjct  529   -----------STSMIHPSAVAGLSLNKSAGSSRNNPELRAQKSHESQSGEMSSSSLKKN  577

Query  825   DEQKPRKDTMMG-YVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKA  649
             ++  P +D+ MG YVP+   IHYSGPL+P GGN++E+LKEH++QIQ AVRKARL+K+   
Sbjct  578   EKAPPSRDSSMGGYVPRKTRIHYSGPLMPPGGNMEEILKEHDRQIQQAVRKARLEKS--G  635

Query  648   KKGNID-YGQTESLLQY  601
              + N+D YGQ  +  +Y
Sbjct  636   TRDNLDGYGQLHNNRRY  652



>ref|XP_009385619.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Musa acuminata subsp. malaccensis]
Length=493

 Score =   175 bits (443),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 133/330 (40%), Positives = 170/330 (52%), Gaps = 57/330 (17%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSP DE+WK  KL NATIFKP+  Y+R +AETFKD   S+L+LLDSLLS+EP  
Sbjct  177   KIFKLCGSPHDEYWKKLKLPNATIFKPQHQYKRCVAETFKDFPSSALTLLDSLLSIEPAH  236

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGTA+SALE+EFF T P  C PS LPKYPP KEYDA+++ + +RR+     K + S  A 
Sbjct  237   RGTAASALESEFFKTKPFACKPSNLPKYPPSKEYDAKIQGQEIRRKRAEATKDR-SGSAR  295

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKC------------------------------GGMSE  1060
             P   +   + DA  + Q Q   K                                 G   
Sbjct  296   PGTRETKAMLDANVEQQAQTNPKSISEKYNNAQDEIGPGFLIDTPVGTTHTGFYHSGTRN  355

Query  1059  VD------------NSRRLGGSELSRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCR  916
             V+            + R   G +L  H S+  + G       F  S AP   A      R
Sbjct  356   VNQEELSIPGRSYSSVRVSNGPQLQTHRSYMHQSGAAN----FSGSVAPRSTA-NSRYNR  410

Query  915   EDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAG  736
              D++  S  H L        D  +  H + D +   KD+ + Y  +   IHYSGPL+P G
Sbjct  411   HDVTEPSDKHTL--------DGPASVH-KKDGRIVTKDSTVDYGTRNKRIHYSGPLMPPG  461

Query  735   GNIDEMLKEHEKQIQNAVRKARLDKTSKAK  646
             GNI++MLKEHE+QIQ AVRKAR+DK    K
Sbjct  462   GNIEDMLKEHERQIQEAVRKARVDKVKTKK  491



>ref|XP_010414812.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Camelina sativa]
Length=695

 Score =   177 bits (448),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 128/323 (40%), Positives = 182/323 (56%), Gaps = 40/323 (12%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ S+L++ATIFKP+  Y+R +A+TFKDL PS+L+ L+ LL++EP+ 
Sbjct  361   KIFKLCGSPSEEYWRRSRLRHATIFKPQHPYKRCVADTFKDLPPSALAFLEVLLAVEPDA  420

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKD-----  1165
             RGTASSAL++EFFTT P P +PS+LP+YPP KE+DA++R+E  RR+ G+  K  +     
Sbjct  421   RGTASSALQSEFFTTKPFPSEPSSLPRYPPRKEFDAKLREEETRRRKGASSKQNEPKRLS  480

Query  1164  -SEGATPAPGDLAKLQDAIKKWQGQLKL----KKCGGMSEVDNSRRL-------------  1039
                 A PAP   A+L  +I+K  G+       +K     +  N  R+             
Sbjct  481   RESRAVPAPSANAELLTSIQKRLGETNQTSVSEKFNPEGDSGNGFRIEPLKGNTAQNPYP  540

Query  1038  ----------GGSELSRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSHW  889
                       G S+L    S+  RG    QL  F +S AP          R+ I VN  W
Sbjct  541   VYTNGDVHSNGSSQLRTQRSYVQRGA--AQLSRFSNSMAPTRDGSQFGSMRDAI-VNQRW  597

Query  888   HRLA---MKCNRVIDNESDHHYQNDEQKPRKDTMMGYVPQT-GHIHYSGPLIPAGGNIDE  721
                       ++ +  + +   ++D     K+ +M Y  +  G I YSGPLIP  GN+DE
Sbjct  598   LEDGSENFNLSQRLLEKPNGFRKDDPSSSSKEPIMSYDGEKRGRIQYSGPLIPGEGNLDE  657

Query  720   MLKEHEKQIQNAVRKARLDKTSK  652
             MLKEHE+QI  AVR+A+ DK  +
Sbjct  658   MLKEHERQILLAVRRAQADKAKR  680



>ref|XP_008806997.1| PREDICTED: LOW QUALITY PROTEIN: probable serine/threonine-protein 
kinase At1g54610 [Phoenix dactylifera]
Length=749

 Score =   176 bits (446),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 139/369 (38%), Positives = 185/369 (50%), Gaps = 74/369 (20%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+EFW+  KL +AT FK  + Y R + E F++  PS++ LLD LL++EP  
Sbjct  377   KIFKLCGSPSEEFWRKLKLPHATSFKLTQPYRRCVGEAFRNFPPSAVVLLDRLLAVEPAD  436

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGA-  1153
             RG+A+SAL++EFFTT PL CDPS+LPKYPPCKEYDA++R+E  RRQ  +  K  + E   
Sbjct  437   RGSAASALKSEFFTTKPLACDPSSLPKYPPCKEYDAKLRNEEARRQKAAAIKGHELESGR  496

Query  1152  ---TPAPGDLAKLQ---------DAIKKW--------------------QGQLKLKKCGG  1069
                 P P    +LQ             K+                     G L L   G 
Sbjct  497   RKTMPMPDVNTELQKRRIRANPESGSNKYNPQEDGGSGFPIHPSRGTVENGFLHLSHSGV  556

Query  1068  MSEV-------DNSRRLGGSELSR-----------HVSFKARGGGVGQLPMFCSSAAPHP  943
                        DN++   G  L+              S+   GG    L  F    A   
Sbjct  557   SRSTWNNKGYGDNAQTFSGHSLTNLGQSNGPDAPMQRSYMPHGGA-ADLSSFSGLVAARS  615

Query  942   AAIGLDLCREDISVNSHW--HRLAMKCNR---------------VIDNESDHHYQNDEQK  814
             +   LD  RE  + +++W  HR ++K N+               ++D  S  H   D   
Sbjct  616   STTKLDNHRE-WAKDANWPEHRPSLKYNQLDVADASEKQEWMKHLLDRPSSSH--KDGSA  672

Query  813   PRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNI  634
               K++  GY  +   IHYSGPL+P GGNI+EMLKEHE+QIQ AVR+ARLDK      G  
Sbjct  673   VSKESTAGYGTKKNRIHYSGPLMPPGGNIEEMLKEHERQIQQAVRRARLDKVKSQNYGV-  731

Query  633   DYGQTESLL  607
               GQ+E+LL
Sbjct  732   -RGQSEALL  739



>gb|EYU22739.1| hypothetical protein MIMGU_mgv1a002645mg [Erythranthe guttata]
Length=650

 Score =   176 bits (445),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 124/304 (41%), Positives = 189/304 (62%), Gaps = 25/304 (8%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSP++E+W  +KL +AT FK ++ Y+RR+++TFKD+  S+L+L++ LLS++P++
Sbjct  361   KIFKLCGSPTEEYWMKTKLPHATSFKSQRVYKRRVSDTFKDIPSSALALVEVLLSIDPKQ  420

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGTASSAL +EFFT+ PLPCDPS+LPKYPP KE DA++R+E  +R+     K +++E   
Sbjct  421   RGTASSALRSEFFTSKPLPCDPSSLPKYPPSKELDAKIREEEAKRRKEESVKGREAEYEK  480

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
                 + +  Q A+ + QGQ         +  ++S      E  R    K + G       
Sbjct  481   ----NNSNKQKAVPEGQGQSNKSTSYKYNPQEDSGAGFPIEPPRA---KLKNG------Y  527

Query  969   FCSSAAPHPAAIGLDLCR--EDISVNSHWHRLAMKCNR--------VIDNESDHHYQNDE  820
               S++  HP A+G    +  +D SV+S   +  ++  R        +I + SD+  + + 
Sbjct  528   THSNSVIHPNAVGYSWSKNMKDDSVHSVQSQHGVQLTRQGSQGRRPIIADSSDYRTKANV  587

Query  819   QKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKG  640
             +    D+ +GYVP+   I +SGPL+P GGN+++MLKEHE+QIQ AVRKARLDK  + KK 
Sbjct  588   RSSNNDS-IGYVPKRNRILFSGPLMPPGGNMEDMLKEHERQIQEAVRKARLDK-DRTKKN  645

Query  639   NIDY  628
             + DY
Sbjct  646   SYDY  649



>emb|CDY50891.1| BnaCnng19830D [Brassica napus]
Length=957

 Score =   177 bits (450),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 134/343 (39%), Positives = 182/343 (53%), Gaps = 58/343 (17%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++WK SKL +AT+FKP+  Y+R +AETFK    S+L+L++ LL++EP+ 
Sbjct  343   KIFKLCGSPSEDYWKRSKLSHATVFKPQNPYKRCVAETFKSFPSSALALVEVLLAVEPDA  402

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSE---  1159
             RGT + AL++EFFTT P   DP +LPKY   KE D ++R+E  RR+ G+  K  +S+   
Sbjct  403   RGTTAHALQSEFFTTKPYASDPLSLPKYQSKKETDVKLREEEARRKKGTSSKQNESKQVS  462

Query  1158  ---GATPAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGS--------------  1030
                 A PAP   A+L  +I+K QGQ    K   MSE  N+                    
Sbjct  463   RESKAVPAPDANAELLTSIQKRQGQ---SKQTSMSEKFNTNEDAAGFLIEPLKSGTGHNG  519

Query  1029  -----------------ELSRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISV  901
                              EL    SF  RG    QL  F +S A   A+            
Sbjct  520   YARNGVSSGSSRSPPRKELRGQRSFVQRGA--AQLTKFSNSVAARDAS-------HFAIA  570

Query  900   NSHWHRLAMKCNRVIDNESDHHYQNDEQKPR-----KDTMMGYVPQTGHIHYSGPLIPAG  736
             N  W    +  N     +     Q    KP+     K+++ GY  +T  ++YSGPL+ AG
Sbjct  571   NPRWLEDRLNNNNNGRQDDGDWSQRLLVKPKDCTKDKESIRGYGEKTEKMNYSGPLVSAG  630

Query  735   GNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQTESLL  607
             GN+DEMLKEHE+QIQ AVRKAR+DK SK      D+GQT++ L
Sbjct  631   GNLDEMLKEHERQIQVAVRKARVDKKSKRD----DHGQTQAFL  669



>ref|XP_004162865.1| PREDICTED: LOW QUALITY PROTEIN: probable serine/threonine-protein 
kinase At1g54610-like [Cucumis sativus]
Length=632

 Score =   175 bits (443),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 118/290 (41%), Positives = 164/290 (57%), Gaps = 20/290 (7%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+EFW+ +KL +AT FKP+  Y+  ++ETFK   PS+L+L++ LL++EPE 
Sbjct  357   KIFKLCGSPSEEFWRRTKLPHATSFKPQHRYKSCLSETFKSFPPSALALVNKLLAIEPEH  416

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+A+ AL +EFF T PLPCDPS+LPKYPP KE+DA++R+E  R++     K +  E   
Sbjct  417   RGSATLALRSEFFRTEPLPCDPSSLPKYPPSKEFDAKLRNEEERKKKAEAVKGRHPESVR  476

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
                 D   +       QG  K        + D        E SR V  +           
Sbjct  477   RGSRDTKAVPTPEFNTQGDTKKTSTKFNPQEDG-------EPSRVVQNRYNH--------  521

Query  969   FCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKC--NRVIDNESDHHYQNDEQKPRKDTM  796
               S++  HP   G    +   ++ +H      K   +R + + S    + ++    KD+ 
Sbjct  522   --STSMVHPTVAG-SWGKPTGALRNHAELKTQKSQMHRSVGDLSASSLKKEDSMSNKDSG  578

Query  795   MGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAK  646
             MGYV +   IHYSGPL+P GGNI++MLKEHE+QIQ A RKARLDK    K
Sbjct  579   MGYVQKKNRIHYSGPLVPTGGNIEDMLKEHERQIQQAFRKARLDKAKTTK  628



>emb|CDX93496.1| BnaA06g05520D [Brassica napus]
Length=675

 Score =   175 bits (444),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 134/345 (39%), Positives = 186/345 (54%), Gaps = 54/345 (16%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +AT+FKP+  Y+R +AETFK L  S+L+L++ LL++EP+ 
Sbjct  344   KIFKLCGSPSEEYWKRSKLSHATVFKPQNPYKRCVAETFKSLPSSALALVEVLLAVEPDA  403

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDS----  1162
             RGT + AL++EFFTT P   DPS+LPKY P KE D ++R+E  RR+ G+  K  +S    
Sbjct  404   RGTTAHALQSEFFTTKPYASDPSSLPKYKPKKETDVKIREEAARRKKGTSSKQNESNQVS  463

Query  1161  --EGATPAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRR-------------LGGSE  1027
                 A PAP   A+L  +I+K QGQ        MSE  N                +G + 
Sbjct  464   RESKAVPAPDANAELLASIQKRQGQ---SNQTSMSEKFNPNEDAAGFLIEPLKSGIGQNG  520

Query  1026  LSRHVSF----------KARG------GGVGQLPMFCSSAAPHPAAIGLDLCREDISVNS  895
              +R+             + RG      GG  +L  F +S A   A+            N 
Sbjct  521   YARNGVSSGSSRSPPRKELRGQRSFVQGGAAKLTKFSNSVAARDAS-------HFAIANP  573

Query  894   HWHRLAMKCNRVIDNESDHHYQNDEQKPR-----KDTMMGYVPQTGHIHYSGPLIPAGGN  730
              W    +  N     +     Q    KP+     K++++     T  ++YSGPL+ AGGN
Sbjct  574   RWLEDRLNNNNDGRQDDGDWSQRLLVKPKDSKKDKESILVRRTTTEKMNYSGPLVSAGGN  633

Query  729   IDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQTESLLQYVG  595
             +DEMLKEHE+QIQ AVRKAR+DK S  +    D+GQT++ L   G
Sbjct  634   LDEMLKEHERQIQVAVRKARVDKKSNRE----DHGQTQAFLAANG  674



>ref|XP_009407059.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Musa acuminata subsp. malaccensis]
Length=693

 Score =   175 bits (443),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 132/331 (40%), Positives = 184/331 (56%), Gaps = 52/331 (16%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKL GSPSDE+WK SKL +ATIFKP+  Y+R  A+TFKD  PS+L+LLD+LL++EPE 
Sbjct  370   KIFKLLGSPSDEYWKKSKLPHATIFKPQHQYKRCFADTFKDFPPSALTLLDTLLAIEPEN  429

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGTA+SALE+EFF T PL CDPS+LPKYPP KEYD ++RDE +RRQ     K   SE A 
Sbjct  430   RGTAASALESEFFRTKPLACDPSSLPKYPPSKEYDVKLRDEEIRRQRAEATKGW-SETAR  488

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLG----------------------  1036
             P   +   +  A+     +L+ ++    +  D  RR G                      
Sbjct  489   PGRKETKGM--AMPDANMELQKQQAQAYNAQDAERRSGFPIDSAVGTAQNGFYQLGVHPG  546

Query  1035  --GSELSRHVS-----------FKARGGGVGQLP-----MFCSSAAPHPAAIGLDLCRED  910
               G+ L++ V+             AR     QL      +  S A   P ++        
Sbjct  547   GYGTTLTKKVNQEEMRVPGPSKSSARVSNDSQLQKQRSYIHLSGADGIPGSVA-----AR  601

Query  909   ISVNSHWHRLAMKCN---RVIDNESDHHYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPA  739
              + NS ++RL +  +    ++D  +  H ++D    ++ T++ Y  +   I YSGPL+P 
Sbjct  602   TTANSRYNRLDVTESSDKHILDRAASTHKKDDRTVSKESTIV-YGTRNKKIQYSGPLMPP  660

Query  738   GGNIDEMLKEHEKQIQNAVRKARLDKTSKAK  646
             GGN+++MLKEHE+QIQ AVRKAR+DK    K
Sbjct  661   GGNVEDMLKEHERQIQQAVRKARIDKVKTKK  691



>ref|XP_011006181.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Populus euphratica]
Length=654

 Score =   174 bits (442),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 126/314 (40%), Positives = 180/314 (57%), Gaps = 23/314 (7%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+ +W+ +K  +AT FKP+++Y R I ETFK   PS+L+L+D LLS+EP+ 
Sbjct  355   KIFKLCGSPSEIYWQKTKFPHATSFKPQQSYIRCITETFKHFPPSALTLVDKLLSMEPQD  414

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+A+SA+ +EFF   PLP DPS+LPKY PCKE DA++RDE  RRQ     K +  E   
Sbjct  415   RGSATSAIRSEFFRIEPLPSDPSSLPKYSPCKELDAKLRDEEARRQRAEAVKGRGPESVR  474

Query  1149  PAPGDLAKLQDAIKKWQGQLKLK----KCGGMSEVDNSRRLGGSELSRHVSFKARGGGVG  982
                 D  K        Q Q K      K   + +     R+    +S+   F+       
Sbjct  475   RGSIDTKKAPTPEFTAQAQPKTASSSYKYYILEDAGTGFRIEPPRVSKQNGFEH------  528

Query  981   QLPMFCSSAAPHPAAI-GLDLCREDISVNSHWHRLAMKCNRVIDNESDHHY--QNDEQKP  811
                   S++  HP+A+ G+   +   S  ++    A K +     E       +N++  P
Sbjct  529   ------STSMIHPSAVAGMSSNKSAGSSRNNPELRAQKSHESQSGEMSSSSLKKNEKAPP  582

Query  810   RKDTMMG-YVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNI  634
              +D+ MG YVP+   IHYSGPL+P GGN++E+LKEH++QIQ AVRKARL+K+    + N+
Sbjct  583   SRDSSMGGYVPRKTRIHYSGPLMPPGGNMEEILKEHDRQIQQAVRKARLEKS--GTRDNL  640

Query  633   D-YGQTESLLQYVG  595
             D YGQ  +  +Y G
Sbjct  641   DGYGQLHNNRRYKG  654



>ref|XP_010511348.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Camelina sativa]
Length=693

 Score =   174 bits (441),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 126/323 (39%), Positives = 185/323 (57%), Gaps = 40/323 (12%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ S+L++ATIFKP+  Y+R +A+TFKDL PS+L+LL+ LL++EP+ 
Sbjct  359   KIFKLCGSPSEEYWRRSRLRHATIFKPQHPYKRCVADTFKDLPPSALALLEVLLAVEPDA  418

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKD-----  1165
             RGTASSAL++EFFTT P P +PS+LP+YPP KE+DA++R+E  RR+ G+  K  +     
Sbjct  419   RGTASSALQSEFFTTKPFPSEPSSLPRYPPRKEFDAKLREEEARRRKGASSKQNEPKRLS  478

Query  1164  -SEGATPAPGDLAKLQDAIKKWQGQ-------------------LKLKKCGGMSEVD---  1054
                 A PAP   A+L  +I+K  G+                    +++   G +  +   
Sbjct  479   RESRAVPAPSANAELLTSIQKRLGETNQTSVSEKFIPEGDSGNGFRIEPLKGNTAQNPYP  538

Query  1053  -----NSRRLGGSELSRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSHW  889
                  ++   G S+L    S+  RG    QL  F +S AP          R+ I VN  W
Sbjct  539   VYTNGDTHSNGSSQLRTQRSYVQRGA--AQLSRFSNSMAPTRDGSQFGSMRDAI-VNQRW  595

Query  888   HRLA---MKCNRVIDNESDHHYQNDEQKPRKDTMMGYVPQT-GHIHYSGPLIPAGGNIDE  721
                       ++ +  + +   ++D     K+ +M Y  +  G + YSGPLIP  GN+DE
Sbjct  596   LEDGSENFNLSQRLLEKPNGFRKDDPSSSSKEPIMSYDGEKRGRMQYSGPLIPGEGNLDE  655

Query  720   MLKEHEKQIQNAVRKARLDKTSK  652
             MLKEHE+QI  AVR+A+ DK  +
Sbjct  656   MLKEHERQILLAVRRAQADKAKR  678



>ref|XP_011006180.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Populus euphratica]
Length=700

 Score =   174 bits (441),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 126/314 (40%), Positives = 180/314 (57%), Gaps = 23/314 (7%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+ +W+ +K  +AT FKP+++Y R I ETFK   PS+L+L+D LLS+EP+ 
Sbjct  401   KIFKLCGSPSEIYWQKTKFPHATSFKPQQSYIRCITETFKHFPPSALTLVDKLLSMEPQD  460

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+A+SA+ +EFF   PLP DPS+LPKY PCKE DA++RDE  RRQ     K +  E   
Sbjct  461   RGSATSAIRSEFFRIEPLPSDPSSLPKYSPCKELDAKLRDEEARRQRAEAVKGRGPESVR  520

Query  1149  PAPGDLAKLQDAIKKWQGQLKLK----KCGGMSEVDNSRRLGGSELSRHVSFKARGGGVG  982
                 D  K        Q Q K      K   + +     R+    +S+   F+       
Sbjct  521   RGSIDTKKAPTPEFTAQAQPKTASSSYKYYILEDAGTGFRIEPPRVSKQNGFEH------  574

Query  981   QLPMFCSSAAPHPAAI-GLDLCREDISVNSHWHRLAMKCNRVIDNESDHHY--QNDEQKP  811
                   S++  HP+A+ G+   +   S  ++    A K +     E       +N++  P
Sbjct  575   ------STSMIHPSAVAGMSSNKSAGSSRNNPELRAQKSHESQSGEMSSSSLKKNEKAPP  628

Query  810   RKDTMMG-YVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNI  634
              +D+ MG YVP+   IHYSGPL+P GGN++E+LKEH++QIQ AVRKARL+K+    + N+
Sbjct  629   SRDSSMGGYVPRKTRIHYSGPLMPPGGNMEEILKEHDRQIQQAVRKARLEKS--GTRDNL  686

Query  633   D-YGQTESLLQYVG  595
             D YGQ  +  +Y G
Sbjct  687   DGYGQLHNNRRYKG  700



>ref|XP_008378721.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
isoform X3 [Malus domestica]
Length=496

 Score =   171 bits (434),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 127/297 (43%), Positives = 176/297 (59%), Gaps = 41/297 (14%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+EFWK +KL  AT FKP++ Y+RRIA+TFKD+ PS+L L++ LL++EPE 
Sbjct  222   KIFKLCGSPSEEFWKKTKLPLATSFKPQQPYKRRIADTFKDVPPSALELIEKLLAIEPET  281

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQ----NGSGYK----  1174
             RG+A+SAL +EFF+T PLPCDPS LPKY P KE+DA++RDE  RR+     G G +    
Sbjct  282   RGSAASALSSEFFSTHPLPCDPSDLPKYRPSKEFDAKLRDEEKRRKADAFKGRGPESVRR  341

Query  1173  -CKDSEGATP---APGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSF  1006
               +D++  +P    PG+           QGQ + +K  G   +     + G  +  H   
Sbjct  342   GSRDTKAPSPEFNXPGE-----------QGQ-RNRKTTGHKYMSQRETVSGFAMEPHGG-  388

Query  1005  KARGGGVGQLPMFCSSAAPHPAAIGLDLCREDIS-----VNSHWHRLAMKCNRVIDNESD  841
              AR  G       CS+   HP+A+G  L +   S     + S    +      ++ + S 
Sbjct  389   -ARSNGYSH----CSTMV-HPSAVGSSLNKTAGSTSRPELRSQRSHMPQAAADLLSSSS-  441

Query  840   HHYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKAR  670
                +  E    K++  GYVP+   IH SGPL+P GGN+++MLKEHE+QIQ AVRKAR
Sbjct  442   ---KKKETVAGKESRTGYVPKN-RIHCSGPLVPPGGNLEDMLKEHERQIQQAVRKAR  494



>gb|KGN52685.1| hypothetical protein Csa_5G650500 [Cucumis sativus]
Length=640

 Score =   173 bits (439),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 118/296 (40%), Positives = 167/296 (56%), Gaps = 24/296 (8%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+EFW+ +KL +AT FKP+  Y+  ++ETFK   PS+L+L++ LL++EPE 
Sbjct  357   KIFKLCGSPSEEFWRRTKLPHATSFKPQHRYKSCLSETFKSFPPSALALVNKLLAIEPEH  416

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+A+ AL +EFF T PLPCDPS+LPKYPP KE+DA++R+E  R++     K +  E   
Sbjct  417   RGSATLALRSEFFRTEPLPCDPSSLPKYPPSKEFDAKLRNEEERKKKAEAVKGRHPESVR  476

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVS--FKARGGG----  988
                 D   +       QG + +K                  +S+  S  F  +  G    
Sbjct  477   RGSRDTKAVPTPEFNTQGDIPIKAL---------------PISKKTSTKFNPQEDGEPSR  521

Query  987   VGQLPMFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKC--NRVIDNESDHHYQNDEQK  814
             V Q     S++  HP   G    +   ++ +H      K   +R + + S    + ++  
Sbjct  522   VVQNRYNHSTSMVHPTVAG-SWGKPTGALRNHAELKTQKSQMHRSVGDLSASSLKKEDSV  580

Query  813   PRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAK  646
               KD+ MGYV +   IHYSGPL+P GG I++MLKEHE+QIQ A RKARLDK    K
Sbjct  581   SNKDSGMGYVQKKNRIHYSGPLVPTGGTIEDMLKEHERQIQQAFRKARLDKAKTTK  636



>ref|XP_008459631.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
isoform X2 [Cucumis melo]
Length=507

 Score =   171 bits (434),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 122/305 (40%), Positives = 170/305 (56%), Gaps = 42/305 (14%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+EFW+ +KL +AT FKP+  Y+  ++ETFK   PS+L+L++ LL++EPE 
Sbjct  222   KIFKLCGSPSEEFWRRTKLPHATSFKPQSRYKSCLSETFKSFPPSALALVNKLLAIEPEH  281

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEG--  1156
             RG+A+ AL +EFF T PLPCDPS+LPKYPP KE+DA++R+E  R++     K +  E   
Sbjct  282   RGSATLALRSEFFRTEPLPCDPSSLPKYPPSKEFDAKLRNEEERKKKAEAVKGRHPESVR  341

Query  1155  -------ATPAP-----GDLA-KLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRH  1015
                    A P P     GD+  K+    KK   +   ++ G  S V  +R         H
Sbjct  342   RGSRDTKAVPTPEFNTQGDITIKVHPISKKTSAKYNPQEDGEPSRVVQNR-------YNH  394

Query  1014  VSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKC--NRVIDNESD  841
                              S++  HP+  G    +   +  +H    A K   +R + + S 
Sbjct  395   -----------------STSMVHPSIAG-SWGKPTGASRNHAELKAQKSQMHRSVGDLSA  436

Query  840   HHYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDK  661
                + ++    KD  MGYV +   IHYSGPL+P GG I++MLKEHE+QIQ A RKARLDK
Sbjct  437   SSLKKEDLVSNKDPGMGYVQKKNRIHYSGPLVPTGGTIEDMLKEHERQIQQAFRKARLDK  496

Query  660   TSKAK  646
                 K
Sbjct  497   AKTTK  501



>ref|XP_004141641.1| PREDICTED: probable serine/threonine-protein kinase At1g54610-like 
[Cucumis sativus]
Length=652

 Score =   172 bits (437),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 117/290 (40%), Positives = 163/290 (56%), Gaps = 20/290 (7%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+EFW+ +KL +AT FKP+  Y+  ++ETFK   PS+L+L++ LL++EPE 
Sbjct  357   KIFKLCGSPSEEFWRRTKLPHATSFKPQHRYKSCLSETFKSFPPSALALVNKLLAIEPEH  416

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+A+ AL +EFF T PLPCDPS+LPKYPP KE+DA++R+E  R++     K +  E   
Sbjct  417   RGSATLALRSEFFRTEPLPCDPSSLPKYPPSKEFDAKLRNEEERKKKAEAVKGRHPESVR  476

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
                 D   +       QG  K        + D        E SR V  +           
Sbjct  477   RGSRDTKAVPTPEFNTQGDTKKTSTKFNPQEDG-------EPSRVVQNRYNH--------  521

Query  969   FCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKC--NRVIDNESDHHYQNDEQKPRKDTM  796
               S++  HP   G    +   ++ +H      K   +R + + S    + ++    KD+ 
Sbjct  522   --STSMVHPTVAG-SWGKPTGALRNHAELKTQKSQMHRSVGDLSASSLKKEDSVSNKDSG  578

Query  795   MGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAK  646
             MGYV +   IHYSGPL+P GG I++MLKEHE+QIQ A RKARLDK    K
Sbjct  579   MGYVQKKNRIHYSGPLVPTGGTIEDMLKEHERQIQQAFRKARLDKAKTTK  628



>ref|XP_008378719.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
isoform X1 [Malus domestica]
Length=625

 Score =   172 bits (436),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 126/297 (42%), Positives = 175/297 (59%), Gaps = 41/297 (14%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+EFWK +KL  AT FKP++ Y+RRIA+TFKD+ PS+L L++ LL++EPE 
Sbjct  351   KIFKLCGSPSEEFWKKTKLPLATSFKPQQPYKRRIADTFKDVPPSALELIEKLLAIEPET  410

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQ----NGSGYK----  1174
             RG+A+SAL +EFF+T PLPCDPS LPKY P KE+DA++RDE  RR+     G G +    
Sbjct  411   RGSAASALSSEFFSTHPLPCDPSDLPKYRPSKEFDAKLRDEEKRRKADAFKGRGPESVRR  470

Query  1173  -CKDSEGATP---APGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSF  1006
               +D++  +P    PG+           QGQ + +K  G   +     + G  +  H   
Sbjct  471   GSRDTKAPSPEFNXPGE-----------QGQ-RNRKTTGHKYMSQRETVSGFAMEPH---  515

Query  1005  KARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVN-----SHWHRLAMKCNRVIDNESD  841
                GG        CS+   HP+A+G  L +   S +     S    +      ++ + S 
Sbjct  516   ---GGARSNGYSHCSTMV-HPSAVGSSLNKTAGSTSRPELRSQRSHMPQAAADLLSSSS-  570

Query  840   HHYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKAR  670
                +  E    K++  GYVP+   IH SGPL+P GGN+++MLKEHE+QIQ AVRKAR
Sbjct  571   ---KKKETVAGKESRTGYVPKN-RIHCSGPLVPPGGNLEDMLKEHERQIQQAVRKAR  623



>emb|CDY31800.1| BnaC01g27560D [Brassica napus]
Length=679

 Score =   172 bits (437),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 125/317 (39%), Positives = 175/317 (55%), Gaps = 35/317 (11%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ S+L++ATIFKP+  Y+R +AET+KDL PSS   L  +L      
Sbjct  352   KIFKLCGSPSEEYWRRSRLRHATIFKPQHQYKRCLAETYKDLIPSSALALLDVLLAVEPE  411

Query  1329  -RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSE--  1159
              RGT SSAL++EFFTT P P +PS+LP+Y P KE+D ++R+E  RR+ G+  K  + +  
Sbjct  412   ARGTTSSALQSEFFTTKPFPSEPSSLPRYQPRKEFDIKLREEEARRRKGASSKQNEQKRF  471

Query  1158  ----GATPAPGDLAKLQDAIKKWQGQ-------------------LKLKKCGGMSEVDNS  1048
                  A PAPG  A+L  +I+K  G+                    +++     +  DN 
Sbjct  472   SRESRAVPAPGANAELLASIQKRLGETNQTSVSETFNPEGDSGSGFRIEPHNPYTNGDNH  531

Query  1047  RRLGGSELSRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSHW-HRLAMK  871
                G S L    S+  RGG   QL  F +S AP+           D  VN  W    +  
Sbjct  532   SN-GSSHLRTQRSYVQRGG--AQLSRFSNSVAPNRDGSSQFGSMRDALVNQRWLEDGSGN  588

Query  870   CN---RVIDNESDHHYQNDEQKPRKDTMMGYVPQT-GHIHYSGPLIPAGGNIDEMLKEHE  703
             CN   R+++N +    ++D     K  +MGY  +    IHYSGPLI   GN+DEMLK+HE
Sbjct  589   CNLSQRLLENPNGLR-KDDPSSSSKGPLMGYDGEKRERIHYSGPLISGEGNLDEMLKDHE  647

Query  702   KQIQNAVRKARLDKTSK  652
             +QI  AVR+A+ DK  +
Sbjct  648   RQILLAVRRAQADKAKR  664



>ref|XP_009102541.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Brassica rapa]
Length=674

 Score =   172 bits (436),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 125/314 (40%), Positives = 176/314 (56%), Gaps = 32/314 (10%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ S+L++ATIFKP+  Y+R +AET+KDL PSS   L  +L      
Sbjct  350   KIFKLCGSPSEEYWRRSRLRHATIFKPQHQYKRCLAETYKDLIPSSALALLDVLLAVEPE  409

Query  1329  -RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSE--  1159
              RGT SSAL++EFFTT P P +PS+LP+Y P KE+D ++R+E  RR+ G+  K  + +  
Sbjct  410   ARGTTSSALQSEFFTTKPFPSEPSSLPRYQPRKEFDIKLREEEARRRKGASSKQNEQKRF  469

Query  1158  -GATPAPGDLAKLQDAIKKWQGQ-------------------LKLKKCGGMSEVDNSRRL  1039
               A PAPG  A+L  +I+K  G+                    +++     ++ DN    
Sbjct  470   LRAVPAPGANAELLASIQKRLGETNQTSVSETFNPEGDSGSGFRIEPHNPNTKGDNHSN-  528

Query  1038  GGSELSRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSHW-HRLAMKCN-  865
             G S L    S+  RGG   QL  F +S AP+           D  VN  W    +  CN 
Sbjct  529   GSSHLRTQRSYVQRGG--AQLSRFSNSVAPNRDGSSQFGSMRDALVNQRWLEDGSGNCNL  586

Query  864   --RVIDNESDHHYQNDEQKPRKDTMMGYVPQT-GHIHYSGPLIPAGGNIDEMLKEHEKQI  694
               R+++ + +   ++D     K  +MGY  +    IHYSGPLI   GN+DEMLKEHE+QI
Sbjct  587   SQRLLE-KPNGLRKDDPSSSSKGPLMGYDGEKRERIHYSGPLISGEGNLDEMLKEHERQI  645

Query  693   QNAVRKARLDKTSK  652
               AVR+A+ DK  +
Sbjct  646   LLAVRRAQADKAKR  659



>ref|XP_003592893.1| Zinc finger CCCH domain-containing protein [Medicago truncatula]
Length=1146

 Score =   175 bits (444),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 147/409 (36%), Positives = 198/409 (48%), Gaps = 112/409 (27%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +ATIFKP++ Y+R ++ETFK+   S+LSLL+ LL++EP+ 
Sbjct  737   KIFKLCGSPSEEYWKKSKLPHATIFKPQQPYKRVVSETFKNFPSSALSLLEVLLAIEPKD  796

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYD-------------------------  1225
             RGTASSAL+NEFFT+ PLPCDPS LPKYPP KE+D                         
Sbjct  797   RGTASSALQNEFFTSKPLPCDPSTLPKYPPSKEFDPNFEKRKREGIPSLILVIIIDSHAI  856

Query  1224  ----------------------ARMRDEMLRRQNGSGYKCKDSEGATPAPGDLAKLQDAI  1111
                                    R  ++   RQ   G+  K+S+   PAP    ++Q +I
Sbjct  857   LSYLMLALSAEIAKRCAASVVGRRAANKGHVRQESVGWNFKESK-VVPAPDANVEIQSSI  915

Query  1110  KKWQGQLKLKKCGGMSEVDNSRRLGG-------SELSRHVSFKARG--------GGVGQL  976
             +K QGQ    KC  +SE  N    GG       ++L     F   G        G    +
Sbjct  916   EKRQGQCN-SKC--ISEKYNPEEEGGYGFPLEPAKLRSRNIFSHSGQSMHPSAYGSSRDM  972

Query  975   PMFCSSAAPHPAAIGLDLCREDISVNSHWH------------------------------  886
              +   +A P P  +      E    NS+WH                              
Sbjct  973   NLKEEAALPGPDRVFTSRKIELRKQNSYWHGSTAQLSRFSNSVAIRGDSQLDMSGDCSLN  1032

Query  885   ------RLAMKCNRVIDNESD-------HHYQNDEQKPRKDTMMGYVPQTGHI-HYSGPL  748
                   +  M+ + + D ES+       H  + D    RKD  MG  P+ GHI +YSGPL
Sbjct  1033  SQWLEDQFDMRYSHLDDGESNQLLDGTKHSRKKDFHLFRKDRAMGCAPKNGHILNYSGPL  1092

Query  747   IPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQTESLLQY  601
             +P   N++E+LKEHE+QIQ AVRKARL K +  KK + + GQTESL  +
Sbjct  1093  LPREDNLEEILKEHERQIQQAVRKARLVKEN--KKADSENGQTESLFHF  1139



>emb|CDY53144.1| BnaAnng12030D [Brassica napus]
Length=671

 Score =   172 bits (436),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 125/314 (40%), Positives = 175/314 (56%), Gaps = 32/314 (10%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ S+L++ATIFKP+  Y+R +AET+KDL PSS   L  +L      
Sbjct  347   KIFKLCGSPSEEYWRRSRLRHATIFKPQHQYKRCLAETYKDLIPSSALALLDVLLAVEPE  406

Query  1329  -RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSE--  1159
              RGT SSAL++EFFTT P P +PS+LP+Y P KE+D ++R+E  RR+ G+  K  + +  
Sbjct  407   ARGTTSSALQSEFFTTKPFPSEPSSLPRYQPRKEFDIKLREEEARRRKGASSKQNEQKRF  466

Query  1158  -GATPAPGDLAKLQDAIKKWQGQ-------------------LKLKKCGGMSEVDNSRRL  1039
               A PAPG  A+L  +I+K  G+                    +++     +  DN    
Sbjct  467   SRAVPAPGANAELLASIQKRLGETNQTSVSETFNPEGDSGSGFRIEPHNPNTNGDNHSN-  525

Query  1038  GGSELSRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSHW-HRLAMKCN-  865
             G S L    S+  RGG   QL  F +S AP+           D  VN  W    +  CN 
Sbjct  526   GSSHLRTQRSYVQRGG--AQLSRFSNSVAPNRDGSSQFGSMRDALVNQRWLEDGSGNCNL  583

Query  864   --RVIDNESDHHYQNDEQKPRKDTMMGYVPQT-GHIHYSGPLIPAGGNIDEMLKEHEKQI  694
               R+++ + +   ++D     K  +MGY  +    IHYSGPLI   GN+DEMLKEHE+QI
Sbjct  584   SQRLLE-KPNGLRKDDPSSSSKGPLMGYDGEKRERIHYSGPLISGEGNLDEMLKEHERQI  642

Query  693   QNAVRKARLDKTSK  652
               AVR+A+ DK  +
Sbjct  643   LLAVRRAQADKAKR  656



>ref|XP_009378979.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Pyrus x bretschneideri]
Length=528

 Score =   171 bits (432),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 126/288 (44%), Positives = 171/288 (59%), Gaps = 24/288 (8%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS++FWK +KL  AT FKP++ Y+RRIA+TFKD+ PS+L L++ LL++EPE 
Sbjct  255   KIFKLCGSPSEDFWKKTKLPLATSFKPQQPYKRRIADTFKDVPPSALELIEKLLAIEPET  314

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+A+SAL +EFF+T PLPCDPS LPKY P KE+DA++RDE  RR+     K +  E   
Sbjct  315   RGSAASALSSEFFSTHPLPCDPSDLPKYRPSKEFDAKLRDEEKRRK-ADAIKGRGPESVR  373

Query  1149  PAPGDL-AKLQDAIKKWQGQLKLKKCGG--MSEVDNSRRLGGSELSRHVSFKARGGGVGQ  979
                 D  A   +   + +GQ   K  G   MS+ D    + G  +  H      GG    
Sbjct  374   RGSRDTKAPSPEFNAQGEGQRNRKTTGHKYMSQRDT---VSGFAMEPH------GGARSN  424

Query  978   LPMFCSSAAPHPAAIGLDLCREDISVN-----SHWHRLAMKCNRVIDNESDHHYQNDEQK  814
                 CS+   HP+A+G  L +   S N     S    +      ++ + S    +  E  
Sbjct  425   GYSHCSTMV-HPSAVGSSLNKTAGSTNRPELRSQRSHMPQAAADLLSSSS----KKKETL  479

Query  813   PRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKAR  670
               K++  GYVP+   IH SGPL+P GGN+++MLKEHE+QIQ AVRKAR
Sbjct  480   AGKESRTGYVPKN-RIHCSGPLVPPGGNLEDMLKEHERQIQQAVRKAR  526



>ref|XP_008459626.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
isoform X1 [Cucumis melo]
 ref|XP_008459627.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
isoform X1 [Cucumis melo]
 ref|XP_008459629.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
isoform X1 [Cucumis melo]
 ref|XP_008459630.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
isoform X1 [Cucumis melo]
Length=642

 Score =   172 bits (435),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 122/305 (40%), Positives = 170/305 (56%), Gaps = 42/305 (14%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+EFW+ +KL +AT FKP+  Y+  ++ETFK   PS+L+L++ LL++EPE 
Sbjct  357   KIFKLCGSPSEEFWRRTKLPHATSFKPQSRYKSCLSETFKSFPPSALALVNKLLAIEPEH  416

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEG--  1156
             RG+A+ AL +EFF T PLPCDPS+LPKYPP KE+DA++R+E  R++     K +  E   
Sbjct  417   RGSATLALRSEFFRTEPLPCDPSSLPKYPPSKEFDAKLRNEEERKKKAEAVKGRHPESVR  476

Query  1155  -------ATPAP-----GDLA-KLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRH  1015
                    A P P     GD+  K+    KK   +   ++ G  S V  +R         H
Sbjct  477   RGSRDTKAVPTPEFNTQGDITIKVHPISKKTSAKYNPQEDGEPSRVVQNRY-------NH  529

Query  1014  VSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKC--NRVIDNESD  841
                              S++  HP+  G    +   +  +H    A K   +R + + S 
Sbjct  530   -----------------STSMVHPSIAG-SWGKPTGASRNHAELKAQKSQMHRSVGDLSA  571

Query  840   HHYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDK  661
                + ++    KD  MGYV +   IHYSGPL+P GG I++MLKEHE+QIQ A RKARLDK
Sbjct  572   SSLKKEDLVSNKDPGMGYVQKKNRIHYSGPLVPTGGTIEDMLKEHERQIQQAFRKARLDK  631

Query  660   TSKAK  646
                 K
Sbjct  632   AKTTK  636



>ref|XP_010480304.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Camelina sativa]
Length=694

 Score =   172 bits (436),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 130/324 (40%), Positives = 184/324 (57%), Gaps = 42/324 (13%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ S+L++ATIFKP+  Y+R +A+TFKDL PS+L+LL+ LL++EP+ 
Sbjct  360   KIFKLCGSPSEEYWRRSRLRHATIFKPQHPYKRCVADTFKDLPPSALALLEVLLAVEPDA  419

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYK-------C  1171
             RGTASSAL++EFFTT P P +PS+LP+Y P KE+DA++R+E  RR+ G+  K        
Sbjct  420   RGTASSALQSEFFTTKPFPSEPSSLPRYRPRKEFDAKLREEEARRRKGASSKQNEPKRLS  479

Query  1170  KDSEGATPAPGDLAKLQDAIKKWQGQLKL----KKCGGMSEVDNSRRL------------  1039
             K+S  A PAP   A+L  +I+K  G+       +K     +  N  R+            
Sbjct  480   KESR-AVPAPSANAELLTSIQKRLGETNQTSVSEKFNPEGDSGNGFRMEPLKGNTAQNPY  538

Query  1038  -----------GGSELSRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSH  892
                        G S+L    S+  RG    QL  F +S AP          R+ I VN  
Sbjct  539   PVYTNGDVHSNGSSQLRTQRSYVQRGA--AQLSRFSNSMAPTRDGSQFGSMRDAI-VNQR  595

Query  891   WHRLA---MKCNRVIDNESDHHYQNDEQKPRKDTMMGYVPQT-GHIHYSGPLIPAGGNID  724
             W          ++ +  + +   ++D     K+ +M Y  +  G I YSGPLIP  GN+D
Sbjct  596   WLEDGSENFNLSQRLLEKPNGFRKDDPSSSSKEPIMSYDGEKRGRIQYSGPLIPGEGNLD  655

Query  723   EMLKEHEKQIQNAVRKARLDKTSK  652
             EMLKEHE+QI  AVR+A+ DK  +
Sbjct  656   EMLKEHERQILLAVRRAQADKAKR  679



>ref|XP_008378720.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
isoform X2 [Malus domestica]
Length=624

 Score =   171 bits (434),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 123/286 (43%), Positives = 170/286 (59%), Gaps = 20/286 (7%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+EFWK +KL  AT FKP++ Y+RRIA+TFKD+ PS+L L++ LL++EPE 
Sbjct  351   KIFKLCGSPSEEFWKKTKLPLATSFKPQQPYKRRIADTFKDVPPSALELIEKLLAIEPET  410

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+A+SAL +EFF+T PLPCDPS LPKY P KE+DA++RDE  RR+    +K +  E   
Sbjct  411   RGSAASALSSEFFSTHPLPCDPSDLPKYRPSKEFDAKLRDEEKRRK-ADAFKGRGPESVR  469

Query  1149  PAPGDL-AKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLP  973
                 D  A   +     +GQ + +K  G   +     + G  +  H      GG      
Sbjct  470   RGSRDTKAPSPEFNXPGEGQ-RNRKTTGHKYMSQRETVSGFAMEPH------GGARSNGY  522

Query  972   MFCSSAAPHPAAIGLDLCREDISVN-----SHWHRLAMKCNRVIDNESDHHYQNDEQKPR  808
               CS+   HP+A+G  L +   S +     S    +      ++ + S    +  E    
Sbjct  523   SHCSTMV-HPSAVGSSLNKTAGSTSRPELRSQRSHMPQAAADLLSSSS----KKKETVAG  577

Query  807   KDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKAR  670
             K++  GYVP+   IH SGPL+P GGN+++MLKEHE+QIQ AVRKAR
Sbjct  578   KESRTGYVPKN-RIHCSGPLVPPGGNLEDMLKEHERQIQQAVRKAR  622



>ref|XP_006306924.1| hypothetical protein CARUB_v10008488mg [Capsella rubella]
 gb|EOA39822.1| hypothetical protein CARUB_v10008488mg [Capsella rubella]
Length=684

 Score =   171 bits (433),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 139/341 (41%), Positives = 182/341 (53%), Gaps = 56/341 (16%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSP +E+W+ SKL +ATIFKP++ Y+R +AE+FK L  S+L+L++ LL++EP+ 
Sbjct  363   KIFKLCGSPCEEYWRKSKLPHATIFKPQQPYKRCVAESFKSLPSSALALVEVLLAVEPDT  422

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRR------QNGSGYKCK  1168
             RGT +SAL++EFFTT P   DPS+LPKY P KE D + R+E  R+      QN S    +
Sbjct  423   RGTTASALQSEFFTTMPFASDPSSLPKYQPRKEIDVKAREEAKRKKGTSTKQNESKQVSR  482

Query  1167  DSEGATPAPGDLAKLQDAIKKWQGQ---------LKLKKCG---------GMSEVDN---  1051
             +S  A PAP   A+L  +I+K QGQ         ++  K G         G+S V+    
Sbjct  483   ESR-AVPAPDANAELLTSIQKHQGQQNKDAASFRIEPLKSGTPQVGYNRYGVSSVNRNGE  541

Query  1050  -----SRRLGGSELSRHVSFKARGGGVGQLPMFCSSAAP----HPAAIGLDLCREDISVN  898
                  S R    EL    SF  RG    QL  F +S A     H A        +    +
Sbjct  542   NVMRGSSRSPRKELRTQRSFVQRGAA--QLSRFSNSVAARDGSHFAIANPRWLEDSYRND  599

Query  897   SHWHRLAMKCNRVIDNESDHHYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEM  718
               W +  M    V    S  H    E KP       Y  +T  +HYSGPL+ AGGN+DEM
Sbjct  600   GDWSQRLM----VKPKGSTKH---KESKPV------YGEKTERMHYSGPLVSAGGNLDEM  646

Query  717   LKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQTESLLQYVG  595
             LKEHE+QIQ AVRKAR DK    K    D  Q ++ L   G
Sbjct  647   LKEHERQIQLAVRKARADK----KMNRDDNKQAQAFLAATG  683



>ref|XP_011095772.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Sesamum indicum]
 ref|XP_011095778.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Sesamum indicum]
 ref|XP_011095785.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Sesamum indicum]
Length=647

 Score =   171 bits (433),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 118/308 (38%), Positives = 178/308 (58%), Gaps = 51/308 (17%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSP+DE+W+ +KL +A+ FK ++TY+RR+A+TFK+   S+L+L++ LLS++PE 
Sbjct  363   KIFKLCGSPTDEYWRKTKLPHASSFKSQRTYKRRLADTFKEFPSSALALVEVLLSIDPEE  422

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGTASSAL++EFFT+ PLPC+PS +P YPP KE DA++R+E  +++     K   ++  +
Sbjct  423   RGTASSALKSEFFTSNPLPCEPSNIPSYPPSKELDAKIREEEAKKRKAESVKGHGADTRS  482

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
                   ++ Q A+ + QGQ                    S+ + +      G G G  PM
Sbjct  483   -----HSRQQKAVAEGQGQ-------------------SSKFTSYKYNPQEGSGTG-FPM  517

Query  969   -----------FCSSAAPHPAAIGL---------DLCREDISVNSHWHR--LAMKCNRV-  859
                          S++  HP AIG           L     S+ S  HR  L  + ++V 
Sbjct  518   EPPRGNLNNGYSHSNSMIHPNAIGYAYKKIEDDPGLSVPARSLVSFQHRGGLTRQSSQVR  577

Query  858   --IDNESDHHYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNA  685
               + + SD+  ++  +    D++ GY P+   I +SGPL+P GGN+D+MLKEHE+QIQ A
Sbjct  578   QSVADISDYQLKDVGRTSNNDSV-GYAPKRNRILFSGPLVPPGGNMDDMLKEHERQIQEA  636

Query  684   VRKARLDK  661
             VRKAR+ K
Sbjct  637   VRKARMSK  644



>ref|XP_002452282.1| hypothetical protein SORBIDRAFT_04g022960 [Sorghum bicolor]
 gb|EES05258.1| hypothetical protein SORBIDRAFT_04g022960 [Sorghum bicolor]
Length=695

 Score =   171 bits (433),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 126/323 (39%), Positives = 178/323 (55%), Gaps = 45/323 (14%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W  +KL + T+FKP++ Y R+IAETFKD  P++L LLD+LL++EP  
Sbjct  370   KIFKLCGSPSEDYWAKAKLPDVTLFKPQRPYRRKIAETFKDFPPTALELLDTLLAIEPSD  429

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCK------  1168
             RGT +SAL++EFF T PL CDP++LPKYPPCKEYDA++R +   RQN +G   K      
Sbjct  430   RGTVASALDSEFFRTKPLACDPASLPKYPPCKEYDAKLRGQEASRQNAAGIGGKGSVSVK  489

Query  1167  ----DSEGATPAPGDLA---------------------KLQDAIKKWQGQLKLKKCGGMS  1063
                 D +GA PA  D+A                      L+D++  ++ +       G +
Sbjct  490   PGRDDVKGAAPAQ-DVAIADYQRRQARANQKSTSHHYSSLEDSVPGFRIEPPAVAVRGPA  548

Query  1062  EVDNSRRLGGSELSRH----VSFKARGGGVGQLPMFCSSAAPHPAAIGLDL---CREDIS  904
              +      G +  +R     VS  +            +S   +  + G DL        +
Sbjct  549   TLQTGGGFGSTWYNRSDQRAVSRASSSVRASSSSSHLTSQRSYAQSRGTDLHPSSSAATN  608

Query  903   VNSHWHRL--AMKCNRVIDNESDHHYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGN  730
              NS ++RL  A   N V    S HH    +    +D   G+  +   IHYSGPL+P GGN
Sbjct  609   ANSRYNRLDVAEPANAVGRPGSSHH----KDLGMRDASAGFGARNKRIHYSGPLMPPGGN  664

Query  729   IDEMLKEHEKQIQNAVRKARLDK  661
             +++MLKEHEKQIQ AVRKAR++K
Sbjct  665   MEDMLKEHEKQIQQAVRKARVEK  687



>ref|XP_010475800.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Camelina sativa]
Length=696

 Score =   171 bits (432),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 125/317 (39%), Positives = 177/317 (56%), Gaps = 45/317 (14%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +ATIFKP++ Y+R +AE+FK L  S+L+L++ LL++EP  
Sbjct  383   KIFKLCGSPSEEYWKKSKLPHATIFKPQQPYKRCVAESFKSLPSSALALVEVLLAVEPNA  442

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGT  SAL++EFFTT P   DPS+LPKY P KE D + R+E  +R+ G+  K  +S+  +
Sbjct  443   RGTTDSALQSEFFTTKPFASDPSSLPKYQPRKETDVKAREEEAKRKKGTSSKQNESKQVS  502

Query  1149  ---PAPGDLAKLQDAIKKWQ--------GQLKLKKC-GGMSEVDNSRRLGGSELSRHVSF  1006
                 AP   A+L  +I+K +         + +++    G  +VDN+R  G S ++R+   
Sbjct  503   KGASAPDANAELLTSIQKREKFNPDEDAARYRIEPLKSGTPQVDNTR-YGVSSVNRYGEN  561

Query  1005  KARGG-----------------GVGQLPMFCSSAAPHPAAIGLDLCREDISVNSHWHRLA  877
               RG                  G  QL  F +S A    +            N  W   +
Sbjct  562   VLRGSSRSPRKELRTQRSFVQRGASQLSRFSNSVAARDGS-------HFAIANPRWLEDS  614

Query  876   MKCNRVIDNESDHHYQNDEQKPR-----KDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLK  712
                NR  D +    +     KP+     K+ + GY  +T  +HYSGPL+ AGGN++EMLK
Sbjct  615   YNNNRQNDGDWSQRFL---VKPKGYTKHKENIPGYGEKTERMHYSGPLVSAGGNLNEMLK  671

Query  711   EHEKQIQNAVRKARLDK  661
             EHE+QIQ AVRKAR  K
Sbjct  672   EHERQIQVAVRKARAGK  688



>ref|XP_006300312.1| hypothetical protein CARUB_v10019892mg [Capsella rubella]
 gb|EOA33210.1| hypothetical protein CARUB_v10019892mg [Capsella rubella]
Length=692

 Score =   170 bits (430),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 128/324 (40%), Positives = 181/324 (56%), Gaps = 42/324 (13%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ S+L++ATIFKP+  Y+R +A+TFKDL PS+L+LL+ LL++EP+ 
Sbjct  358   KIFKLCGSPSEEYWRRSRLRHATIFKPQHPYKRCVADTFKDLPPSALALLEVLLAVEPDA  417

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKD-----  1165
             RGTASSAL++EFFTT P P +PS+LP+YPP KE+D ++R+E  RR+ G+  K  +     
Sbjct  418   RGTASSALQSEFFTTKPFPSEPSSLPRYPPRKEFDVKLREEEARRRKGASSKQNEPKRFS  477

Query  1164  -SEGATPAPGDLAKLQDAIKKWQGQ-------------------LKLKKCGG--------  1069
                 A PAP   A+L  +I+K  G+                    + +   G        
Sbjct  478   RESKAVPAPSANAELLTSIQKRLGETNQTSVSEKFIPEGDSGNGFRFEPLKGSTAQNPYP  537

Query  1068  -MSEVDNSRRLGGSELSRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSH  892
               S  DN    G S+L    S+  RG    QL  F +S A           R D  VN  
Sbjct  538   IYSNGDNHPN-GSSQLRTQRSYVQRGA--AQLSRFSNSMAHTRDGSQFGSMR-DAMVNQR  593

Query  891   WHRLA---MKCNRVIDNESDHHYQNDEQKPRKDTMMGYVPQT-GHIHYSGPLIPAGGNID  724
             W          ++ +  + +   ++D     K+++ GY  +  G I YSGPLIP  GN+D
Sbjct  594   WLEDGSENFNLSQRLLEKPNGFTKDDPSSSSKESITGYDGEKRGRIQYSGPLIPGEGNLD  653

Query  723   EMLKEHEKQIQNAVRKARLDKTSK  652
             EMLKEHE+QI  AVR+A+ DK  +
Sbjct  654   EMLKEHERQILLAVRRAQADKAKR  677



>emb|CDY25738.1| BnaC03g69370D [Brassica napus]
Length=659

 Score =   170 bits (430),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 120/320 (38%), Positives = 169/320 (53%), Gaps = 50/320 (16%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W  S+L +ATIFKP + Y+R + ETFK+    +L+LL++LLS+ P+ 
Sbjct  326   KIFKLCGSPSEEYWVKSRLPHATIFKPTQPYKRVVDETFKEFPQPALALLETLLSINPDD  385

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSE---  1159
             RGTA+SAL +EFFTT PLPCDPS+LPKYPP KE DARMRDE  RRQ G   + +  E   
Sbjct  386   RGTATSALHSEFFTTRPLPCDPSSLPKYPPSKELDARMRDEESRRQGGGNREQRHQERRG  445

Query  1158  ----GATPAPGDLAKLQDAIKKWQGQLKLKK------------CGGMSEVD---------  1054
                  A PAP   A+L  +++K Q Q    +                  +D         
Sbjct  446   TKESRAIPAPEANAELVTSMQKRQSQSSTNRSRSEKFNPHPEEVASGFPIDPPRPSSQAF  505

Query  1053  --NSRRLGGSELSRHVSFKARGGGVGQLPMFCSSAA-------PHPAAIGLDLCREDISV  901
               N    G   L  H     R    G L    +SA        P   ++  + CR    +
Sbjct  506   EPNRESQGNIVLPPH----KRASHSGPLTRRSASAKGRRTYQDPQKVSLQQETCRGMTRL  561

Query  900   NSHWHRLAMKCNRVIDNESDHHYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDE  721
                +  ++ + N+          +N     +   ++GY  +   IHYSGPL+   GN+D+
Sbjct  562   PGSFKEVSEEANQ---------EENGRSNKKDPILLGYGSKGHKIHYSGPLVVPSGNMDQ  612

Query  720   MLKEHEKQIQNAVRKARLDK  661
             +LK+H++ IQ AVR+AR+DK
Sbjct  613   VLKDHDRHIQEAVRRARIDK  632



>ref|XP_004971749.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Setaria italica]
Length=614

 Score =   169 bits (428),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 121/334 (36%), Positives = 176/334 (53%), Gaps = 51/334 (15%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ SKL +ATIFKP+  Y RR++ETFK+    +L+L+D LLS++P  
Sbjct  246   KIFKLCGSPSEDYWRKSKLPHATIFKPQHPYARRVSETFKEFPAPALALVDVLLSVDPAD  305

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYK--------  1174
             RGTA SAL++EFFTT P  C+PS+LP+YPP KE+DA+ R+E  RRQ  +G K        
Sbjct  306   RGTAFSALQSEFFTTKPYACNPSSLPRYPPSKEFDAKRREEEARRQGVAGGKQHKHDPER  365

Query  1173  -CKDSEGATPAPGDLAKLQDAIKKWQGQLKLKKCGGM-----------------------  1066
               ++S  A PAP   A+L  +++K Q Q   +    M                       
Sbjct  366   RTRESR-AVPAPDANAELVSSLQKRQAQANTRSRSEMFNPCKEDSASGFRIEPPRPTPVT  424

Query  1065  -SEVDNSR----RLGGSELSRHVSFKARGGGVGQLPMFCSSAAPHPAAIGL--DLCREDI  907
              S  D+ R    R+  S    + +  ++GGGV    +     A HP  +     L  +D 
Sbjct  425   ESSEDSQRAYPTRIFHSGPLVNQNHPSKGGGVKNGELQVPGVANHPVVVSTRSSLRTDDS  484

Query  906   SVNSHWHRLAMKCNRVIDNESDHHYQN-----------DEQKPRKDTMMGYVPQTGHIHY  760
             S        A    R +    + H+ N           D++  R D  +GY  +   IH+
Sbjct  485   SRTMAAQAEAFAHGRRLSESINEHFSNSGKYDQVFPKKDDRSSRVDGAIGYGSKGNKIHH  544

Query  759   SGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKT  658
             SGPL    GN+DEMLKE+++QIQ   R+ R++K+
Sbjct  545   SGPLTCPSGNVDEMLKENDRQIQEVFRRTRVEKS  578



>ref|XP_009107008.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Brassica rapa]
Length=673

 Score =   169 bits (427),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 119/320 (37%), Positives = 169/320 (53%), Gaps = 50/320 (16%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W  S+L +ATIFKP + Y+R + ETFK+    +L+LL++LLS+ P+ 
Sbjct  340   KIFKLCGSPSEEYWVKSRLPHATIFKPTQPYKRVVDETFKEFPQPALALLETLLSVNPDD  399

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSE---  1159
             RGTA+SAL +EFF+T PLPCDPS+LPKYPP KE DARMRDE  RRQ G   + +  E   
Sbjct  400   RGTATSALHSEFFSTRPLPCDPSSLPKYPPSKELDARMRDEESRRQGGGNREQRHQERRG  459

Query  1158  ----GATPAPGDLAKLQDAIKKWQGQLKLKK------------CGGMSEVD---------  1054
                  A PAP   A+L  +++K Q Q    +                  +D         
Sbjct  460   TKESRAIPAPEANAELVTSMQKRQSQSSTNRSRSEKFNPHPEEVASGFPIDQPRPSSQAF  519

Query  1053  --NSRRLGGSELSRHVSFKARGGGVGQLPMFCSSAA-------PHPAAIGLDLCREDISV  901
               N    G   L  H     R    G L    +SA        P   ++  + CR    +
Sbjct  520   EPNRESQGNIVLPPH----KRASHSGPLTRRSASAKGRRTYQDPQKVSLQQETCRGMTRL  575

Query  900   NSHWHRLAMKCNRVIDNESDHHYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDE  721
                +  ++ + N+          +N     +   ++GY  +   IHYSGPL+   GN+D+
Sbjct  576   PGSFKEVSEEANQ---------EENGRSNKKDPILLGYGSKGHKIHYSGPLVVPSGNMDQ  626

Query  720   MLKEHEKQIQNAVRKARLDK  661
             +LK+H++ IQ AVR+AR+DK
Sbjct  627   VLKDHDRHIQEAVRRARIDK  646



>ref|XP_002457168.1| hypothetical protein SORBIDRAFT_03g002610 [Sorghum bicolor]
 gb|EES02288.1| hypothetical protein SORBIDRAFT_03g002610 [Sorghum bicolor]
Length=692

 Score =   168 bits (426),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 128/341 (38%), Positives = 183/341 (54%), Gaps = 56/341 (16%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ SKL +ATIFKP+  Y RR+ ETFK+    +L+L+D LLS++P  
Sbjct  324   KIFKLCGSPSEDYWRKSKLPHATIFKPQHPYARRVPETFKEFPAPALALVDILLSVDPAD  383

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYK--------  1174
             RGTASSAL++EFFTT P  C+PS+LP+YPP KE+DA+ R+E  RRQ  +G K        
Sbjct  384   RGTASSALQSEFFTTKPYACNPSSLPRYPPSKEFDAKRREEEARRQGVTGGKQHKHDPER  443

Query  1173  -CKDSEGATPAPGDLAKLQDAIKKWQGQLKLKKCGGM-----------------------  1066
               ++S  A PAP   A+L  +++K Q Q   +    M                       
Sbjct  444   RTRESR-AVPAPDANAELVSSLQKRQAQTNTRSRSEMFNPCKEDSASGFRIEPPRPTPVT  502

Query  1065  -SEVDNSRRL------GGSELSRHVSFKARGGGVGQLPMFCSSAAPHPAAI----GL---  928
              S  D  R         G  +++    KA GG  G+L +     A HP  +    GL   
Sbjct  503   ESSEDPQRAYPTRIFHSGPLVNQSQPSKAGGGKNGELQV--PGVANHPVLVSTRSGLRTD  560

Query  927   DLCREDIS---VNSHWHRLAMKCNRVIDNESDHHY---QNDEQKPRKDTMMGYVPQTGHI  766
             D  R  ++     +H  RL+   N    N   +     + DE+  R D  +GY  +   I
Sbjct  561   DSSRTMVAQAEAFAHGRRLSESINEHFSNSGKYDQVFPKKDERNSRADGAIGYGSKGNKI  620

Query  765   HYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKK  643
             H+SGPL    GN+DEMLKE+++QIQ   R+ R++K S+A++
Sbjct  621   HHSGPLTCPSGNVDEMLKENDRQIQEVFRRTRVEK-SRARR  660



>ref|XP_004244231.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Solanum lycopersicum]
Length=705

 Score =   168 bits (426),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 132/357 (37%), Positives = 191/357 (54%), Gaps = 66/357 (18%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ S+L +ATIFKP++ Y R +AETFK+    +L+L+++LLS++P  
Sbjct  337   KIFKLCGSPSEEYWRKSRLPHATIFKPQQPYRRCVAETFKEFPAPALALIETLLSIDPAD  396

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYK--------  1174
             RG++ SAL+ EFFTT PLPCDPS+LPKYPP KE+DA++RDE  RRQ  +G K        
Sbjct  397   RGSSCSALKCEFFTTKPLPCDPSSLPKYPPSKEFDAKVRDEEARRQAAAGGKGHRYDPER  456

Query  1173  --CKDSEGATPAPGDLAKLQDAIKKWQGQLKLKKCGGM-----SEVDN---------SRR  1042
                ++S  A PAP   A+L  +++K QGQ   K    M      EV +         S+ 
Sbjct  457   RGTRESR-AVPAPEANAELVSSMQKRQGQSNPKSRSEMFNSHPEEVASGFPIDPPRPSQV  515

Query  1041  LGGSELSRHVSFKARGGGVGQLPMFCS--------------SAAPHPAAIGLDLCR----  916
             +  +    HV    RG   G L    +              S A   A  GL   R    
Sbjct  516   VEEASNDPHVQLHKRGSHSGPLSHRAAWAKAGKNMDDAPKLSVADMSAMSGLVAARRSMF  575

Query  915   -EDISVNSHWHRLAM-------------KCNRVIDNESDHH------YQNDEQKPRKD--  802
              ED    S  H+  +               +  +  E  +H      +QN++ +   +  
Sbjct  576   SEDRPDKSGSHKQEVPKLIARFPGSYKEASHSTMKQEQKNHALASSHHQNEDGRTSNNDP  635

Query  801   TMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNID  631
              ++GY  +   IHYSGPL+   G +D++LK+H++ IQ AVR+ARLDK +KAKK  ++
Sbjct  636   VLLGYGSKGNKIHYSGPLLVPSGKMDQVLKDHDRHIQEAVRRARLDK-AKAKKIQVE  691



>ref|XP_006643878.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Oryza brachyantha]
Length=519

 Score =   167 bits (422),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 122/319 (38%), Positives = 175/319 (55%), Gaps = 35/319 (11%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ SKL +ATIFKP+  Y RR++ETFKD    +++L+D LLS++P  
Sbjct  169   KIFKLCGSPSEDYWRKSKLPHATIFKPQHPYPRRVSETFKDFPLPAVALVDVLLSIDPAD  228

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYK--------  1174
             RGTASSAL++EFF T P  C+PS+LP+YPP KE+DA+ R+E  RRQ  +G K        
Sbjct  229   RGTASSALQSEFFATKPYACNPSSLPRYPPSKEFDAKRREEEARRQGIAGGKQHKYDPQK  288

Query  1173  -CKDSEGATPAPGDLAKLQDAIKKWQGQLKLKKCGGMSE-----------VDNSRRLGGS  1030
               ++S  A PAP   A+L  +++K Q Q+  K    M             +D  R     
Sbjct  289   RARESR-AVPAPDANAELVSSLQKRQNQVNTKSRSEMFNPSKEDSASGFPIDPPRPTHAV  347

Query  1029  ELSR--HVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVNS-----HWHRLAMK  871
             E S+  H  +  R    G L    +   P  A    +  R    V       H  RL+  
Sbjct  348   ESSQDSHRVYSTRTFHSGPL---VNQNNPSKAGQSENDNRHGTVVTQAEAFPHERRLSES  404

Query  870   CNRVIDNESDH---HYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEK  700
              N    +   +     Q DE+  R D  +GY  +   IH+SGPL    GN+D+MLKE+++
Sbjct  405   INERFSSSGKYDQVFQQKDERSSRVDGAIGYGSKGNKIHHSGPLNCPSGNVDQMLKENDR  464

Query  699   QIQNAVRKARLDKTSKAKK  643
             QIQ   R+ R++K S+A++
Sbjct  465   QIQEVFRRTRVEK-SRARR  482



>ref|XP_009144802.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Brassica rapa]
 emb|CDY25881.1| BnaA05g14720D [Brassica napus]
Length=682

 Score =   168 bits (425),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 122/327 (37%), Positives = 177/327 (54%), Gaps = 45/327 (14%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W  S+L +ATIFKP + Y+R + ETFK+    +L+LL++LLS+ P+ 
Sbjct  330   KIFKLCGSPSEDYWVKSRLPHATIFKPTQPYKRIVDETFKEFPQPALALLETLLSVNPDD  389

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEG--  1156
             RGTA+SAL++EFF+T PLPCDPS+LPKYPP KE DARMRDE  RRQ G     ++  G  
Sbjct  390   RGTANSALQSEFFSTRPLPCDPSSLPKYPPSKELDARMRDEESRRQAGGNKGHQERRGTK  449

Query  1155  ---ATPAPGDLAKLQDAIKKWQGQLK----------------------------------  1087
                A PAP   A+L  +++K Q Q                                    
Sbjct  450   ESRAIPAPDANAELVASMQKRQSQANNNRSRSEKFNPHPEEVASGFPIDPPRSSSQAFEP  509

Query  1086  LKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVG-QLP---MFCSSAAPHPAAIGLDLC  919
              ++  G   V + R      L+R  S  A+GG    Q P   +   +AA + A  G    
Sbjct  510   NRESQGNIMVPHKRASHSGPLTRR-SASAKGGRRNYQDPSQKVLSIAAADYSAIPGFAAT  568

Query  918   REDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKPRKDT-MMGYVPQTGHIHYSGPLIP  742
             R   S       +        +   + + + + +  +KD+ ++GY  +   IHYSGPL+ 
Sbjct  569   RTSASQQETCRGMTRLPGSFKETSEEANQEENGRSNKKDSVLLGYGSKGHKIHYSGPLVV  628

Query  741   AGGNIDEMLKEHEKQIQNAVRKARLDK  661
               GN+D++LK+H++ IQ AVR+AR+DK
Sbjct  629   PSGNMDQVLKDHDRHIQEAVRRARIDK  655



>ref|XP_009401105.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Musa acuminata subsp. malaccensis]
Length=694

 Score =   167 bits (424),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 138/328 (42%), Positives = 175/328 (53%), Gaps = 53/328 (16%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+  KL +AT+FKP+  Y R  AE FKD  PS+LSLLDSLL++EPE+
Sbjct  372   KIFKLCGSPSEEYWEREKLPHATVFKPQHQYRRCFAEIFKDFPPSALSLLDSLLAIEPEK  431

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQ----NGSGYKC---  1171
             RGTA SALE++FF T P  CDPS LPKYPP KEYDA+++DE  RR+    NG G +    
Sbjct  432   RGTAVSALESKFFLTKPFACDPSNLPKYPPSKEYDAKLQDEARRRRAEVTNGRGCESVRP  491

Query  1170  -KDSEGATPAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARG  994
              +    A PAP     LQ    K Q Q   K    +S   N +   G E +    F   G
Sbjct  492   GRREFKAMPAPDANIDLQ----KLQVQANPKS---ISHKYNPQDETGPEATARNGFSHSG  544

Query  993   ---GGVG-------------QLPMFCSSAA---------------PHPAAIGLDLCREDI  907
                 G+G             Q+P    S+                P P           +
Sbjct  545   VHPNGLGPSWTRKRNQEQLRQMPSRTYSSVRVSNGPQLKTQMSYRPQPGVADFSDISGSL  604

Query  906   ----SVNSHWHRLAMKCNR-VIDNESDHHYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIP  742
                 + NS  +RLA    R  +D  S H  + D+    KD   GY  +   IHYSGPL+P
Sbjct  605   AARNTANSTHNRLAEPAARHALDRPSTH--KKDDSLGGKDPTTGYGTRIRRIHYSGPLMP  662

Query  741   AGGNIDEMLKEHEKQIQNAVRKARLDKT  658
              GGNI++MLKEHE+QIQ AVRK+R+DK 
Sbjct  663   PGGNIEDMLKEHERQIQQAVRKSRIDKV  690



>ref|XP_006417556.1| hypothetical protein EUTSA_v10006949mg [Eutrema salsugineum]
 gb|ESQ35909.1| hypothetical protein EUTSA_v10006949mg [Eutrema salsugineum]
Length=710

 Score =   167 bits (424),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 136/347 (39%), Positives = 184/347 (53%), Gaps = 60/347 (17%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +ATIFKP+  Y+R +AETFK L  S+L+L++ LLS+EP+ 
Sbjct  373   KIFKLCGSPSEEYWKRSKLPHATIFKPQHPYKRCVAETFKSLPSSALALVEVLLSVEPDA  432

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSE---  1159
             RGT + AL++EFFTT P   DPS+LPKY P KE D ++R+E  RR+ G+  K  +S+   
Sbjct  433   RGTTAHALQSEFFTTKPFASDPSSLPKYQPRKEIDVKLREEEARRKKGTSGKQNESKQVS  492

Query  1158  GATPAPGDLAKLQDAIKKWQGQ--------------------LKLKKCG---------GM  1066
              A PAP   A+   +I+K QGQ                    ++  K G         G+
Sbjct  493   KAVPAPDANAESLASIQKRQGQNNQTSMSEKFNPNEDAAGFRVEALKSGTAQNGYTRYGV  552

Query  1065  SEVD---------NSRRLGGSELSRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCRE  913
             S V+         +SR     EL    SF  RG    QL  F +S A    +        
Sbjct  553   SSVNRNGENVMIGSSRSPPRKELRTQRSFVQRGA--AQLSKFSNSVAARDGS-------H  603

Query  912   DISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKPR-----KDTMMGYVPQTGHIHYSGPL  748
                 N  W       N    N+ D   Q    KPR     ++++ G+  +T  ++YSGPL
Sbjct  604   FAIANPRWLEDRYNNNNGRQNDGDWS-QRLMVKPRDSTKDRESIPGHGEKTERMNYSGPL  662

Query  747   IPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQTESLL  607
               AGG++D+MLKEHE+QIQ AVRKAR+DK    K    D  QT   +
Sbjct  663   ASAGGSLDDMLKEHERQIQVAVRKARVDK----KTTRQDNAQTRGFI  705



>emb|CDY02525.1| BnaA08g01320D [Brassica napus]
Length=660

 Score =   167 bits (423),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 118/321 (37%), Positives = 169/321 (53%), Gaps = 51/321 (16%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W  S+L +ATIFKP + Y+R + ETFK+    +L+LL++LLS+ P+ 
Sbjct  326   KIFKLCGSPSEEYWVKSRLPHATIFKPTQPYKRVVDETFKEFPQPALALLETLLSVNPDD  385

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEG--  1156
             RGTA+SAL +EFF+T PLPCDPS+LPKYPP KE DARMRDE  RRQ G   + +  +   
Sbjct  386   RGTATSALHSEFFSTRPLPCDPSSLPKYPPSKELDARMRDEESRRQGGGNREAQRHQERR  445

Query  1155  ------ATPAPGDLAKLQDAIKKWQGQLKLKK------------CGGMSEVD--------  1054
                   A PAP   A+L  +++K Q Q    +                  +D        
Sbjct  446   GTKESRAIPAPEANAELVTSMQKRQSQSSTNRSRSEKFNPHPEEVASGFPIDPPRPSSQA  505

Query  1053  ---NSRRLGGSELSRHVSFKARGGGVGQLPMFCSSAA-------PHPAAIGLDLCREDIS  904
                N    G   L  H     R    G L    +SA        P   ++  + CR    
Sbjct  506   FEPNRESQGNIVLPPH----KRASHSGPLTRRSASAKGRRTYQDPQKVSLQQETCRGMTR  561

Query  903   VNSHWHRLAMKCNRVIDNESDHHYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNID  724
             +   +  ++ + N+          +N     +   ++GY  +   IHYSGPL+   GN+D
Sbjct  562   LPGSFKEVSEEANQ---------EENGRSNKKDPILLGYGSKGHKIHYSGPLVVPSGNMD  612

Query  723   EMLKEHEKQIQNAVRKARLDK  661
             ++LK+H++ IQ AVR+AR+DK
Sbjct  613   QVLKDHDRHIQEAVRRARIDK  633



>ref|XP_006392368.1| hypothetical protein EUTSA_v10023319mg [Eutrema salsugineum]
 gb|ESQ29654.1| hypothetical protein EUTSA_v10023319mg [Eutrema salsugineum]
Length=685

 Score =   166 bits (420),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 123/318 (39%), Positives = 173/318 (54%), Gaps = 36/318 (11%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslep-E  1333
             KIFKLCGSPS+E+W+ S+L++ATIFKP+  Y+R +A++FKDL P +   L  +L     E
Sbjct  363   KIFKLCGSPSEEYWRRSRLRHATIFKPQHQYKRCLADSFKDLLPPTALALLDVLLAVEPE  422

Query  1332  RRGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKD----  1165
              RGT SSAL++EFFTT P P +PS+LP+Y P KE+D ++R+E  RR+ G+  K  +    
Sbjct  423   ARGTTSSALQSEFFTTKPFPSEPSSLPRYQPRKEFDVKLREEEARRRKGTSSKQNEPKRF  482

Query  1164  --SEGATPAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRR-----------------  1042
                  A P P   A+L  +I+K  G+        +SE  N  R                 
Sbjct  483   SRESKAVPTPSANAELLASIQKRLGETNQT---SVSEKFNPERDSGSGFRIEPLKGDNHP  539

Query  1041  LGGSELSRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSHW-HRLAMKCN  865
              G S+L    S+  RG    QL  F +S AP          R D  VN  W    +  CN
Sbjct  540   NGSSQLRTQRSYVQRGA--AQLSRFSNSVAPSRDGSQFGSVR-DALVNQRWLEDGSGNCN  596

Query  864   ---RVIDNESDHHYQNDEQKPRKDTMMGYVPQT-GHIHYSGPLIPAGGNIDEMLKEHEKQ  697
                R+++ + +   ++D     K+++M Y  +    IHYSGPLI   GN+DEMLKEHE+Q
Sbjct  597   LSQRLLE-KPNGLRKDDHSSSSKESIMRYDGEKRDRIHYSGPLIQGEGNLDEMLKEHERQ  655

Query  696   IQNAVRKARLDKTSKAKK  643
             I  AVR+A+ DK  +  K
Sbjct  656   ILLAVRRAQADKAKRDDK  673



>ref|XP_010062385.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Eucalyptus grandis]
 gb|KCW69527.1| hypothetical protein EUGRSUZ_F02965 [Eucalyptus grandis]
Length=649

 Score =   165 bits (418),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 121/309 (39%), Positives = 170/309 (55%), Gaps = 30/309 (10%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+N++   AT F+ ++ ++RR+AE FKD   S+L+L++ LL++EP+ 
Sbjct  358   KIFKLCGSPSEDYWQNTRFPQATSFRTQQHHKRRVAEKFKDFPSSALALIEKLLAMEPKE  417

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+A+SAL++EFF T P PCD S+LPKYPP KE+DA++R+   RRQ     K +  E   
Sbjct  418   RGSAASALKSEFFMTKPFPCDTSSLPKYPPSKEFDAKLRNAEARRQKAEAVKGRGPESVR  477

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLP-  973
                 D  KL        G++ L+  G  + +  S +    E S        G G    P 
Sbjct  478   RGSRD-DKLPTPEFDGNGEVCLQ--GQSNHISISHKFNPQEDS--------GSGFPIEPP  526

Query  972   --------MFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKC---NRVIDNESDHHYQN  826
                       CSS   HP+     L  +  S  +       K    +   D  +    +N
Sbjct  527   RVNRPNDYSHCSSMI-HPSITESSLTSKGSSRKNQADLKPQKSVIPHATADLSNASLKKN  585

Query  825   DEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAK  646
             DE  P K+ + GYVP+   IHYSGPL+P G NID+MLKEHE+QIQ AVR ARL +    K
Sbjct  586   DEGAP-KELVQGYVPKKNRIHYSGPLMPPGANIDDMLKEHERQIQQAVRNARLGRNRTNK  644

Query  645   KGNIDYGQT  619
                  YGQ+
Sbjct  645   -----YGQS  648



>ref|XP_002528049.1| Cell division protein kinase, putative [Ricinus communis]
 gb|EEF34367.1| Cell division protein kinase, putative [Ricinus communis]
Length=676

 Score =   165 bits (418),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 131/300 (44%), Positives = 178/300 (59%), Gaps = 22/300 (7%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ +KL +AT FKP+ +Y+R +AETFK++ PS+LSL+D LLS+EPE 
Sbjct  363   KIFKLCGSPSEDYWQKTKLPHATSFKPQLSYKRCVAETFKNIPPSALSLVDKLLSMEPEA  422

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+A+SAL +EFF   P PCDPS LPKYPP KE DA++R+E  RR+     K + +E   
Sbjct  423   RGSATSALSSEFFNREPFPCDPSCLPKYPPSKELDAKVREEEARRKREEAGKVRGAESVR  482

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
                 DL K +      QGQ K        ++      GGS         A+   + Q   
Sbjct  483   RGSRDL-KAESPEFIPQGQTKTTSTSYKYDIQED---GGSGFRIEPPRGAKHPVISQ---  535

Query  969   FCSSAAPHPAAIGLDLCREDISVNSHWH-------RLAMKCNRVIDNESDHHYQNDEQKP  811
              CSS   HP A+   + +   +V S  H         + K    ID  S    + DE+  
Sbjct  536   -CSSMI-HPCAVQSSINK---NVGSSRHNNMESRTEKSHKPQAAID-VSISSIKKDERVH  589

Query  810   RKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNID  631
              KD  +GYV +   I+YSGPL+P GGNI+E+LKEHE+QIQ+AVRKARL+K+    K N+D
Sbjct  590   AKDNNLGYVRRKNRINYSGPLLPPGGNIEEILKEHERQIQHAVRKARLEKS--GTKSNLD  647



>ref|NP_172431.1| probable serine/threonine-protein kinase [Arabidopsis thaliana]
 sp|F4I114.1|Y1960_ARATH RecName: Full=Probable serine/threonine-protein kinase At1g09600 
[Arabidopsis thaliana]
 gb|AEE28467.1| probable serine/threonine-protein kinase [Arabidopsis thaliana]
Length=714

 Score =   164 bits (416),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 139/358 (39%), Positives = 186/358 (52%), Gaps = 72/358 (20%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +ATIFKP++ Y+R +AETFK L  S+L+L++ LL++EP+ 
Sbjct  375   KIFKLCGSPSEEYWKISKLPHATIFKPQQPYKRCVAETFKSLPSSALALVEVLLAVEPDA  434

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSE---  1159
             RGT +SALE+EFFTT+PL  DPS+LPKY P KE D + ++E  +R+  +  K  DS+   
Sbjct  435   RGTTASALESEFFTTSPLASDPSSLPKYQPRKEIDVKAQEEEAKRKKDTSSKQNDSKQVS  494

Query  1158  ---GATPAPGDLAKLQDAIKKWQGQ--------------------LKLKKCG--------  1072
                 A PAP   A+   +I+K QGQ                    ++  K G        
Sbjct  495   RESKAVPAPDSNAESLTSIQKRQGQHNQVSNSDKFNPGEDAASFRIEPLKSGTAKDGHTR  554

Query  1071  -GMSEVD--------NSRRLGGSELSRHVSFKARGGGVGQLPMFCSSAAPHPA---AIGL  928
              G+S V+         S R    EL    SF  R  G  QL  F +S A       AI  
Sbjct  555   YGVSSVNRNGENVMMGSSRSPRKELRTQRSFVQR--GTAQLSRFSNSVAARDGSHFAIAN  612

Query  927   DLCRED-------ISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKPRKDTMMGYVPQTGH  769
                 ED             W +  +  ++      +    N E+K R             
Sbjct  613   PRWFEDSYNNNNGRQNGGAWSQRLVVKHKEFTKHKESITVNGEKKER-------------  659

Query  768   IHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQTESLLQYVG  595
             +H SGPL+ AGGN+DEMLKEHE+QIQ AVRKAR+DK  K  +G  D  QT++ L   G
Sbjct  660   MHCSGPLVSAGGNLDEMLKEHERQIQLAVRKARVDK--KTNRG--DNRQTQAFLAANG  713



>ref|XP_010260205.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Nelumbo nucifera]
Length=713

 Score =   164 bits (416),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 136/371 (37%), Positives = 192/371 (52%), Gaps = 71/371 (19%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ +KL +ATIFKP++ YER +A TFKD  P++L L+++LLS++P  
Sbjct  343   KIFKLCGSPSEDYWRKAKLPHATIFKPQQPYERCVAGTFKDFPPAALGLMETLLSIDPAD  402

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSE---  1159
             RGTA+SAL++EFF T PL CDPS+LPKYPP KE+DA++RDE  RRQ  +  K + S+   
Sbjct  403   RGTAASALKSEFFITKPLACDPSSLPKYPPSKEFDAKVRDEEARRQGAAWGKGQRSDLER  462

Query  1158  ------GATPAPGDLAKLQDAIKKWQGQLKLKKCGGMSE-----------VDNSRRLGGS  1030
                    A PAP   A+L  +++K QGQ   K    M             +D  R+   +
Sbjct  463   KVPRESRAVPAPDANAELILSMQKRQGQSNSKSRSEMFNHHQEEVASGFPIDPPRQSQAT  522

Query  1029  ELSR------------------HVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDIS  904
             E  R                  H S  A+ G +   P   S+ +   A   L   R  +S
Sbjct  523   EEVRKDAQGHFHKRASHSGPLVHRSAWAKVGRLDDAPK-VSNGSDLSALSSLVAARNLLS  581

Query  903   -------------VNSHWHRL------AMKCNRVIDNESDHHYQ--------NDEQKPRK  805
                          + S   RL      A + NR  D +  HH Q         DE+   K
Sbjct  582   DDRREKSGPSQSEMTSLLSRLPGSFNEASESNRKQDRK--HHAQVLVGSHQKEDERTSNK  639

Query  804   DTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAK---KGNI  634
             + ++GY  +   IHYSGPL+    N+D+MLK+H++Q+Q  VR+ +LDK    K    GN 
Sbjct  640   EKILGYGSKGHKIHYSGPLLLPSDNVDQMLKDHDRQLQEVVRRKKLDKAKLRKLQAAGNP  699

Query  633   DYGQTESLLQY  601
              +G   S   Y
Sbjct  700   IFGNPMSTSGY  710



>tpg|DAA52935.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=694

 Score =   164 bits (415),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 123/336 (37%), Positives = 178/336 (53%), Gaps = 54/336 (16%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ SKL +ATIFKP+  Y RR+ ETFK+    +L+L+D LLS++P  
Sbjct  325   KIFKLCGSPSEDYWRKSKLPHATIFKPQHPYARRVPETFKEFPVPALALVDVLLSVDPAD  384

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYK--------  1174
             RGTASSAL++EFFTT P  C+PS+LP+YPP KE+DA+ R+E  RRQ  +G K        
Sbjct  385   RGTASSALQSEFFTTKPYACNPSSLPRYPPSKEFDAKRREEEARRQGVTGGKQHKHDPER  444

Query  1173  -CKDSEGATPAPGDLAKLQDAIKKWQGQLKLKKCGGM-----------------------  1066
               ++S  A PAP   A+L  +++K Q Q   +    M                       
Sbjct  445   RTRESR-AVPAPEANAELVSSLQKRQAQANTRSRSEMFNPCKEDSASGFRIEPPRPTPVT  503

Query  1065  -SEVDNSRRL------GGSELSRHVSFKARGG--------GVGQLPMFCSS-AAPHPAAI  934
              S  D  R         G  +++    KA GG        GV   P+  S+ + P     
Sbjct  504   ESSEDPQRAYPTRIFHSGPLVNQSQPSKAGGGKNGEPQVPGVANHPVVLSTRSGPRADDS  563

Query  933   GLDLCREDISVNSHWHRLAMKCNRVIDNESDHHY---QNDEQKPRKDTMMGYVPQTGHIH  763
             G  +  +     +H  RL+   N    N   +     + D++  R D  +GY  +   IH
Sbjct  564   GRTMVAQ-AEAFAHGRRLSESINEHFSNSGKYDQVFPKKDDRNIRADGAIGYGSKGSKIH  622

Query  762   YSGPLI-PAGGNIDEMLKEHEKQIQNAVRKARLDKT  658
             +SGPL  P+G N+DEMLKE+++QIQ   R+ R++K+
Sbjct  623   HSGPLTCPSGSNVDEMLKENDRQIQEVFRRTRVEKS  658



>ref|XP_010471165.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Camelina sativa]
Length=658

 Score =   163 bits (412),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 115/289 (40%), Positives = 160/289 (55%), Gaps = 12/289 (4%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ + L  AT FKP   Y+  +AETFK    S+L L++ LL++EPE+
Sbjct  362   KIFKLCGSPSEDYWRRATLPLATSFKPSHPYKAVLAETFKHFPASALMLINKLLAIEPEK  421

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+A+S L +EFFTT PLP +PS LP+YPP KE DA++R+E  RR      K +  E  T
Sbjct  422   RGSAASTLRSEFFTTEPLPANPSNLPRYPPSKELDAKLRNEEARRLRAEDSKRRGGETVT  481

Query  1149  PA-PGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLP  973
                P DL   Q       GQ K+       + D     GG+        +    G+ Q  
Sbjct  482   RGRPKDLKTAQTPEFMAAGQSKVTCISHKFKTDEE---GGTGFRIEPPRR----GIQQNG  534

Query  972   MFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKPRKDTMM  793
                +S+  HP   G +  R           L  + ++  D  S   Y+ D  +   D   
Sbjct  535   KAHASSMVHPTVAGKEWNRGGSMKRQTNAELKSRISQTGD-LSGESYRRDSNR---DYST  590

Query  792   GYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAK  646
             G  P+   IHYSGPL+P GGN++++LKEHEKQIQ AVRKAR++K++  K
Sbjct  591   GNAPRKNRIHYSGPLMPPGGNLEDLLKEHEKQIQQAVRKARVEKSASRK  639



>ref|XP_009622009.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
isoform X3 [Nicotiana tomentosiformis]
Length=513

 Score =   161 bits (408),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 123/306 (40%), Positives = 169/306 (55%), Gaps = 38/306 (12%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ SKL +AT FKP+  Y+R IA+TFKD  PS+L+L+D LLS+EPE+
Sbjct  219   KIFKLCGSPSEEYWRKSKLPHATSFKPQNPYKRCIADTFKDFPPSALALVDVLLSIEPEK  278

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGTASSAL +EFF T PLPCDP  LPKYPP KEYDA++RD   RR+     K    E   
Sbjct  279   RGTASSALNSEFFKTKPLPCDPYTLPKYPPSKEYDAKVRDHEARRRKAKTIKGHGGESTK  338

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLP-  973
              +P      + + +K   +    K G  S+         S   ++   +  G G    P 
Sbjct  339   KSP------RQSKEKLTTEFNAHKQGQPSK---------SISVKYNPLEDNGTGFSIEPP  383

Query  972   -------MFCSSAAPHPAAIGL---DLCREDISVNSHWHRLAMKCNRVIDNESDH-----  838
                    +  S++  HP   G    +  +ED S  +     A +    +  +  H     
Sbjct  384   ILRYRNRLAHSNSVIHPNTAGYTWSNKVKEDSSAITERAYAASQHGVELLRQGSHKPRAA  443

Query  837   ------HYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRK  676
                     + D++    D+ + YVP+      SGPL+PAGG++++MLKEHE+QIQ AVRK
Sbjct  444   GEFSSIRSRRDDRSSFGDSTV-YVPKRSRRILSGPLVPAGGSMEDMLKEHERQIQEAVRK  502

Query  675   ARLDKT  658
             AR DKT
Sbjct  503   ARQDKT  508



>ref|XP_009622007.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
isoform X2 [Nicotiana tomentosiformis]
Length=523

 Score =   161 bits (408),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 123/306 (40%), Positives = 169/306 (55%), Gaps = 38/306 (12%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ SKL +AT FKP+  Y+R IA+TFKD  PS+L+L+D LLS+EPE+
Sbjct  229   KIFKLCGSPSEEYWRKSKLPHATSFKPQNPYKRCIADTFKDFPPSALALVDVLLSIEPEK  288

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGTASSAL +EFF T PLPCDP  LPKYPP KEYDA++RD   RR+     K    E   
Sbjct  289   RGTASSALNSEFFKTKPLPCDPYTLPKYPPSKEYDAKVRDHEARRRKAKTIKGHGGESTK  348

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLP-  973
              +P      + + +K   +    K G  S+         S   ++   +  G G    P 
Sbjct  349   KSP------RQSKEKLTTEFNAHKQGQPSK---------SISVKYNPLEDNGTGFSIEPP  393

Query  972   -------MFCSSAAPHPAAIGL---DLCREDISVNSHWHRLAMKCNRVIDNESDH-----  838
                    +  S++  HP   G    +  +ED S  +     A +    +  +  H     
Sbjct  394   ILRYRNRLAHSNSVIHPNTAGYTWSNKVKEDSSAITERAYAASQHGVELLRQGSHKPRAA  453

Query  837   ------HYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRK  676
                     + D++    D+ + YVP+      SGPL+PAGG++++MLKEHE+QIQ AVRK
Sbjct  454   GEFSSIRSRRDDRSSFGDSTV-YVPKRSRRILSGPLVPAGGSMEDMLKEHERQIQEAVRK  512

Query  675   ARLDKT  658
             AR DKT
Sbjct  513   ARQDKT  518



>ref|XP_010427987.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Camelina sativa]
Length=725

 Score =   163 bits (412),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 114/289 (39%), Positives = 160/289 (55%), Gaps = 12/289 (4%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ + L  AT FKP   Y+  +AETFK    S+L L++ LL++EPE+
Sbjct  429   KIFKLCGSPSEDYWRRATLPLATSFKPSHPYKAVLAETFKHFPTSALMLINKLLAIEPEK  488

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+A+S L +EFFTT PLP +PS LP+YPP KE DA++R+E  RR      K +  E  T
Sbjct  489   RGSAASTLRSEFFTTEPLPANPSNLPRYPPSKELDAKLRNEEARRLRAEDSKRRGGETVT  548

Query  1149  PA-PGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLP  973
                P DL   Q       GQ K+       + D     GG+        +    G+ Q  
Sbjct  549   RGRPKDLKTAQTPEFMAAGQSKVTCISHKFKTDEE---GGTGFR----IEPPRRGIQQNG  601

Query  972   MFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKPRKDTMM  793
                +S+  HP   G +  R           L  + ++  D   D  Y+ D  +   D   
Sbjct  602   KAHASSMVHPTMAGKEWNRGGSMKRQTNAELKSRISQTGDLSGDS-YRRDSNR---DYST  657

Query  792   GYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAK  646
             G  P+   IHYSGPL+P GGN++++LKEHE+QIQ AVRKAR++K++  K
Sbjct  658   GNAPRKNRIHYSGPLMPPGGNLEDLLKEHERQIQQAVRKARVEKSASRK  706



>gb|AAC33218.1| Similar to cdc2 protein kinases [Arabidopsis thaliana]
Length=967

 Score =   164 bits (416),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 139/361 (39%), Positives = 188/361 (52%), Gaps = 72/361 (20%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +ATIFKP++ Y+R +AETFK L  S+L+L++ LL++EP+ 
Sbjct  375   KIFKLCGSPSEEYWKISKLPHATIFKPQQPYKRCVAETFKSLPSSALALVEVLLAVEPDA  434

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEG--  1156
             RGT +SALE+EFFTT+PL  DPS+LPKY P KE D + ++E  +R+  +  K  DS+   
Sbjct  435   RGTTASALESEFFTTSPLASDPSSLPKYQPRKEIDVKAQEEEAKRKKDTSSKQNDSKQVS  494

Query  1155  ----ATPAPGDLAKLQDAIKKWQGQ--------------------LKLKKCG--------  1072
                 A PAP   A+   +I+K QGQ                    ++  K G        
Sbjct  495   RESKAVPAPDSNAESLTSIQKRQGQHNQVSNSDKFNPGEDAASFRIEPLKSGTAKDGHTR  554

Query  1071  -GMSEVD--------NSRRLGGSELSRHVSFKARGGGVGQLPMFCSSAAPHPA---AIGL  928
              G+S V+         S R    EL    SF  R  G  QL  F +S A       AI  
Sbjct  555   YGVSSVNRNGENVMMGSSRSPRKELRTQRSFVQR--GTAQLSRFSNSVAARDGSHFAIAN  612

Query  927   DLCRED-------ISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKPRKDTMMGYVPQTGH  769
                 ED             W +  +  ++      +    N E+K R             
Sbjct  613   PRWFEDSYNNNNGRQNGGAWSQRLVVKHKEFTKHKESITVNGEKKER-------------  659

Query  768   IHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQTESLLQYVGNA  589
             +H SGPL+ AGGN+DEMLKEHE+QIQ AVRKAR+DK  K  +G  D  QT++ L   G +
Sbjct  660   MHCSGPLVSAGGNLDEMLKEHERQIQLAVRKARVDK--KTNRG--DNRQTQAFLAANGRS  715

Query  588   S  586
             +
Sbjct  716   T  716



>ref|XP_010415864.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Camelina sativa]
Length=658

 Score =   162 bits (409),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 114/289 (39%), Positives = 159/289 (55%), Gaps = 12/289 (4%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ + L  AT FKP   Y+  + ETFK    S+L L++ LL++EPE+
Sbjct  362   KIFKLCGSPSEDYWRRATLPLATSFKPSHPYKAVLVETFKHFPASALMLINKLLAIEPEK  421

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+A+S L +EFFTT PLP +PS LP+YPP KE DA++R+E  RR      K +  E  T
Sbjct  422   RGSAASTLRSEFFTTEPLPANPSNLPRYPPSKELDAKLRNEEARRLRAEDSKRRGGETVT  481

Query  1149  PA-PGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLP  973
                P DL   Q       GQ K+       + D     GG+        +    G+ Q  
Sbjct  482   RGRPKDLKTAQTPEFMAAGQSKVTCISHKFKTDEE---GGTGFRIEPPRR----GIQQNG  534

Query  972   MFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKPRKDTMM  793
                +S+  HP   G +  R           L  + ++  D  S   Y+ D  +   D   
Sbjct  535   KAHASSMVHPTVAGKEWNRGGSMKRQTNAELKSRISQTGD-LSGESYRRDSNR---DYST  590

Query  792   GYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAK  646
             G  P+   IHYSGPL+P GGN++++LKEHEKQIQ AVRKAR++K++  K
Sbjct  591   GNAPRKNRIHYSGPLMPPGGNLEDLLKEHEKQIQQAVRKARVEKSASRK  639



>ref|XP_009127863.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Brassica rapa]
Length=646

 Score =   161 bits (408),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 112/297 (38%), Positives = 161/297 (54%), Gaps = 27/297 (9%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++WK + L  ATIFKP   Y+  +AETF     S+++L++ LL++EPE+
Sbjct  355   KIFKLCGSPSEDYWKRATLPLATIFKPSHPYKPVLAETFSHFPASAMTLINKLLAIEPEK  414

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+A S+L +EFFT  PLP +PS+LP+YPP KE DA++R+E  R+      K +  E  T
Sbjct  415   RGSAVSSLRSEFFTMEPLPANPSSLPRYPPSKELDAKLRNEEARKLRAEDNKRRGGETVT  474

Query  1149  PA-PGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLP  973
                P DL   Q      +GQ K+       + D     GG+        +    G+ Q  
Sbjct  475   RGRPKDLKTSQTPEFMDRGQSKVTCISHKFKTDEE---GGTGFRIEPPRR----GIQQNG  527

Query  972   MFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQ--------NDEQ  817
                + +  HP+             N+ W+R      R  + E              +  +
Sbjct  528   YAHAFSMVHPSV-----------ANTEWNRGGGSIKRQTNAELKSRISQTGNLSGDSSRR  576

Query  816   KPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAK  646
               ++D   G  P+   IHYSGPL+P GGN++EMLKEHEKQIQ AVRKAR++K++  K
Sbjct  577   ASKRDYSTGNAPRKNRIHYSGPLMPPGGNLEEMLKEHEKQIQQAVRKARVEKSTSNK  633



>ref|XP_002874601.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50860.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=473

 Score =   160 bits (404),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 116/290 (40%), Positives = 164/290 (57%), Gaps = 13/290 (4%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPSD++WK +KL  AT FKP++ Y+R + ETFK+L  S+L+L+D LL LEPE+
Sbjct  188   KIFKLCGSPSDDYWKKTKLPLATSFKPQQPYKRVLLETFKNLPSSALALVDKLLCLEPEK  247

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGTASS L ++FFT  PLPCD S+LPKYPP KE DA++RDE  RR+     K +  E   
Sbjct  248   RGTASSTLSSKFFTMEPLPCDVSSLPKYPPSKELDAKVRDEEARRKKAETVKGRGPESVR  307

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
                 D        K      +    G   +   ++R    E SR       G G  +   
Sbjct  308   RGSRDF-------KSTAITPEFVASGHSKDTITTKRFNPQEDSRTGLRGETGRGDREKGF  360

Query  969   FCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKP--RKDTM  796
               +++  HP +I     + + S N   + + +K  R  +      Y +   K     +T 
Sbjct  361   SHTNSMIHP-SIAATWSKNESSRN---NVVELKATRSSNVPMTGRYLSPSHKEDVAVETT  416

Query  795   MGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAK  646
               YV +   +H SGPL+P GGNI+++LK+HE+QIQ AVRK+RL+K++  K
Sbjct  417   TTYVRKKNRMHCSGPLMPPGGNIEDILKDHERQIQEAVRKSRLEKSATRK  466



>gb|KFK35750.1| hypothetical protein AALP_AA4G031500 [Arabis alpina]
Length=702

 Score =   161 bits (408),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 116/325 (36%), Positives = 169/325 (52%), Gaps = 42/325 (13%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W  S+L +ATIFKP + Y+R + ETFK+    +L+LL++LLS+ P+ 
Sbjct  351   KIFKLCGSPSEDYWVKSRLPHATIFKPTQPYKRVVDETFKEFPQPALALLETLLSVNPDD  410

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSE---  1159
             RGTA+SAL++EFF+T PLPC+PS+LPKYPP KE DARMRDE  RRQ G     +  E   
Sbjct  411   RGTATSALQSEFFSTRPLPCNPSSLPKYPPSKELDARMRDEESRRQVGGNKDQRHQERRG  470

Query  1158  ----GATPAPGDLAKLQDAIKKWQGQLK--------------------------------  1087
                  A PAP   A+L  +++K Q Q                                  
Sbjct  471   TKESRAVPAPDANAELVTSMQKRQSQSTNRSRSEKFNPHPEEVASGFPIDPPRPSSQAFE  530

Query  1086  -LKKCGGMSEVDNSRRLGGSELSRH-VSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCRE  913
               ++  G   + + R      LSR   S K R        +  S    + A  G    R 
Sbjct  531   PNRESQGNIIIPHKRASHSGPLSRRSASAKGRRNYQDSQKVASSITTDYSAIPGFTATRT  590

Query  912   DISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKPRKDTM-MGYVPQTGHIHYSGPLIPAG  736
              +     +  +        +   + + + + +  +KD + +GY  +   IHYSGPL+   
Sbjct  591   SVPQQETYRGMTRLPGSFKETSEETNQEENGRTNKKDPILLGYGSKGHKIHYSGPLVVPS  650

Query  735   GNIDEMLKEHEKQIQNAVRKARLDK  661
             GN+D++LK+H+  IQ AVR+AR+DK
Sbjct  651   GNMDQVLKDHDLHIQEAVRRARIDK  675



>ref|XP_009622006.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Nicotiana tomentosiformis]
Length=665

 Score =   161 bits (408),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 123/306 (40%), Positives = 169/306 (55%), Gaps = 38/306 (12%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ SKL +AT FKP+  Y+R IA+TFKD  PS+L+L+D LLS+EPE+
Sbjct  371   KIFKLCGSPSEEYWRKSKLPHATSFKPQNPYKRCIADTFKDFPPSALALVDVLLSIEPEK  430

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGTASSAL +EFF T PLPCDP  LPKYPP KEYDA++RD   RR+     K    E   
Sbjct  431   RGTASSALNSEFFKTKPLPCDPYTLPKYPPSKEYDAKVRDHEARRRKAKTIKGHGGESTK  490

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLP-  973
              +P      + + +K   +    K G  S+         S   ++   +  G G    P 
Sbjct  491   KSP------RQSKEKLTTEFNAHKQGQPSK---------SISVKYNPLEDNGTGFSIEPP  535

Query  972   -------MFCSSAAPHPAAIGL---DLCREDISVNSHWHRLAMKCNRVIDNESDH-----  838
                    +  S++  HP   G    +  +ED S  +     A +    +  +  H     
Sbjct  536   ILRYRNRLAHSNSVIHPNTAGYTWSNKVKEDSSAITERAYAASQHGVELLRQGSHKPRAA  595

Query  837   ------HYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRK  676
                     + D++    D+ + YVP+      SGPL+PAGG++++MLKEHE+QIQ AVRK
Sbjct  596   GEFSSIRSRRDDRSSFGDSTV-YVPKRSRRILSGPLVPAGGSMEDMLKEHERQIQEAVRK  654

Query  675   ARLDKT  658
             AR DKT
Sbjct  655   ARQDKT  660



>gb|KHG02812.1| hypothetical protein F383_23996 [Gossypium arboreum]
Length=584

 Score =   160 bits (406),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 115/304 (38%), Positives = 162/304 (53%), Gaps = 59/304 (19%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ +KL +AT FKP++ Y+R IA+TF++L  S+LSL+D LL++EPE 
Sbjct  319   KIFKLCGSPSEEYWQKTKLPHATSFKPQQPYKRLIADTFRNLPQSALSLIDKLLAIEPEV  378

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             R +A+SAL +EFFTT P PC PS LPKYPP KE DA+ R+E  RR+     K + +E  +
Sbjct  379   RRSATSALRSEFFTTEPFPCTPSELPKYPPSKEQDAKQRNEEARRKRAEAMKGRGAESVS  438

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
                 DL +                                  +R   F A+    GQ   
Sbjct  439   RGSRDLKE----------------------------------ARSPEFIAK----GQSKP  460

Query  969   FCSSAAPHPAAIGLDLCREDI-------------SVNSHWHRLA--------MKCNRVID  853
               +    HP+A  LD C+ ++             S    W++           K N +  
Sbjct  461   GATHKYDHPSASVLDPCKVNLQNGISSSSSMIHPSAVDSWNKTGGTRNISELRKQNTMKP  520

Query  852   NESDHHYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKA  673
               ++  Y   ++   KD  + Y  +   IH SGPL+P GGNID++LKEHE+QIQ AVRKA
Sbjct  521   QVANTCYTKYDRASNKDQALVYTAKKNRIHCSGPLMPPGGNIDDILKEHERQIQQAVRKA  580

Query  672   RLDK  661
             R++K
Sbjct  581   RIEK  584



>ref|XP_009105819.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Brassica rapa]
 emb|CDX96330.1| BnaA07g29410D [Brassica napus]
Length=636

 Score =   160 bits (406),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 113/290 (39%), Positives = 158/290 (54%), Gaps = 12/290 (4%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+   L  AT FKP   Y+  + ETF     S+L+L++ LL++EPE+
Sbjct  351   KIFKLCGSPSEDYWRRETLPLATSFKPSHPYKAVLGETFGHFPASALALINKLLAIEPEK  410

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+A+SAL +EFFTT PLP +PS+LP+YPP KE DA++R+E  R+      K +  E  T
Sbjct  411   RGSAASALRSEFFTTEPLPANPSSLPRYPPSKELDAKLRNEEARKVRAEDKKRRGGETVT  470

Query  1149  PA-PGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLP  973
                P DL   Q       GQ K+       + D     GG+        K    G+ Q  
Sbjct  471   RGRPKDLKTAQTPEFMVAGQSKVTCISHKFKTDEE---GGTGFRIEPPRK----GIQQNG  523

Query  972   MFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKPRKDTMM  793
                +S   HP+    +  R           L  +  +  D   D   ++      +D   
Sbjct  524   YAHASTVVHPSVADTEWNRGGSIKRETNAELKSRVTQTGDLPGDSCRRSSS----RDYST  579

Query  792   GYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKK  643
             G  P+   IHYSGPL+P GGN+DEMLKEHEKQIQ AVRKAR++K+ + ++
Sbjct  580   GNAPRKNRIHYSGPLMPPGGNLDEMLKEHEKQIQQAVRKARVEKSGQQQR  629



>ref|XP_010490179.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Camelina sativa]
Length=704

 Score =   161 bits (407),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 129/346 (37%), Positives = 186/346 (54%), Gaps = 63/346 (18%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +ATIFKP++ Y+R +AE+FK L  S+L+L++ LL++EP  
Sbjct  380   KIFKLCGSPSEEYWKKSKLPHATIFKPQQPYKRCVAESFKSLPSSALALVEVLLAVEPGA  439

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGT  SAL++E FTT P   +PS+LPKY P KE D + RDE  +R+ G+  K  +S+  +
Sbjct  440   RGTTDSALQSECFTTKPFASEPSSLPKYQPRKEIDVKTRDEEAKRKKGTSSKQNESKQVS  499

Query  1149  ---PAPGDLAKLQDAIKKWQ--------GQLKLKKC-GGMSEVDNSRRLGGSELSRHVSF  1006
                 AP   A+L  +I+K +         + +++    G  +V N+ R G S ++R+   
Sbjct  500   KGASAPDANAELLTSIQKREKFNPDEDAARYRIEPLKSGTPQVGNT-RYGVSSVNRYGEN  558

Query  1005  KARGG-----------------GVGQLPMFCSSAAPHPAAIGLDLCREDISVNSHWHRLA  877
               RG                  G  QL  F +S A                  SH+   A
Sbjct  559   VMRGSSRSPTKELRTQRSFVQRGASQLTRFSNSVAARDG--------------SHF---A  601

Query  876   MKCNRVIDNESDHHYQNDEQ-------KPR-----KDTMMGYVPQTGHIHYSGPLIPAGG  733
             +   R +++  ++  QND         KP+     K+ + GY  +T  +H SGPL+ AGG
Sbjct  602   IANPRWLEDSYNNSRQNDGDWSQRFLVKPKGYTKHKENIPGYGEKTERMHCSGPLVSAGG  661

Query  732   NIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQTESLLQYVG  595
             N++EMLKEHE+QIQ AVRKAR  K    K    D G  ++ L   G
Sbjct  662   NLNEMLKEHERQIQVAVRKARAGK----KMNRDDNGLVQAFLAATG  703



>emb|CDY03697.1| BnaA02g15400D [Brassica napus]
Length=649

 Score =   160 bits (405),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 111/297 (37%), Positives = 161/297 (54%), Gaps = 27/297 (9%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ + L  ATIFKP   Y+  +AETF     S+++L++ LL++EPE+
Sbjct  356   KIFKLCGSPSEDYWRRATLPLATIFKPSLPYKPVLAETFSHFPASAMTLINKLLAIEPEK  415

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+A S+L +EFFT  PLP +PS+LP+YPP KE DA++R+E  R+      K +  E  T
Sbjct  416   RGSAVSSLRSEFFTMEPLPANPSSLPRYPPSKELDAKLRNEEARKLRAEDNKRRGGETVT  475

Query  1149  PA-PGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLP  973
                P DL   Q      +GQ K+       + D     GG+        +    G+ Q  
Sbjct  476   RGRPKDLKTSQTPEFMDRGQSKVTCISHKFKTDEE---GGTGFRIEPPRR----GIQQNG  528

Query  972   MFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQ--------NDEQ  817
                + +  HP+             N+ W+R      R  + E              +  +
Sbjct  529   YAHAFSMVHPSV-----------ANTEWNRGGGSIKRQTNAELKSRISQTGNLSGDSSRR  577

Query  816   KPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAK  646
               ++D   G  P+   IHYSGPL+P GGN++EMLKEHEKQIQ AVRKAR++K++  K
Sbjct  578   ASKRDYSTGNAPRKNRIHYSGPLMPPGGNLEEMLKEHEKQIQQAVRKARVEKSTSNK  634



>ref|XP_008655744.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Zea mays]
 gb|AFW80340.1| putative protein kinase superfamily protein [Zea mays]
Length=694

 Score =   160 bits (405),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 123/341 (36%), Positives = 180/341 (53%), Gaps = 54/341 (16%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ SKL +ATIFKP+  Y RR+AETFK+    +L+L+D LLS++P  
Sbjct  324   KIFKLCGSPSEDYWRKSKLPHATIFKPQHPYARRVAETFKEFPAPTLALVDVLLSVDPAD  383

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYK--------  1174
             RGTAS AL++EFFTT P  C+PS+LP+YPP KE+DA+ R+E  RRQ  +G K        
Sbjct  384   RGTASYALQSEFFTTKPYACNPSSLPRYPPSKEFDAKRREEEARRQGVTGGKQHKHDPER  443

Query  1173  -CKDSEGATPAPGDLAKLQDAIKKWQGQLKLKKCGGM-----------SEVDNSRRLGGS  1030
               ++S  A PAP   A+L  +++K + Q   +    M             ++  R   G+
Sbjct  444   RTRESR-AVPAPDANAELVSSLQKRRAQANTRSRSEMFNPCKEDSASGFRIEPPRPTPGT  502

Query  1029  ELSR-----------------HVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLC-REDIS  904
             E S                  + S  ++ GG     +     A HP  +      R D S
Sbjct  503   ESSEDPQHAYPTRIFHSGPLVNQSQPSKAGGGKNDELQVPGVANHPVVVSSRTGPRADDS  562

Query  903   ---------VNSHWHRLAMKCNRVIDNESDHHY----QNDEQKPRKDTMMGYVPQTGHIH  763
                        SH  RL+   N  + N   +      ++D    R D  +GY  +   IH
Sbjct  563   SWTMVAQAGAFSHGRRLSESINEHLSNSGKYDQVFPKKDDRNTIRADGAIGYGSKGNKIH  622

Query  762   YSGPLI-PAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKK  643
             +SGPL  P+G  +DEMLKE+++QIQ   R+ R++K S+A++
Sbjct  623   HSGPLTCPSGSVVDEMLKENDRQIQEVFRRTRVEK-SRARR  662



>gb|KFK40935.1| hypothetical protein AALP_AA2G063200 [Arabis alpina]
Length=686

 Score =   160 bits (404),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 131/324 (40%), Positives = 189/324 (58%), Gaps = 42/324 (13%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ S+L++ATIFKP+  Y+R IA+TFKDL PS+L+LL+ LL++EP+ 
Sbjct  352   KIFKLCGSPSEEYWRRSRLRHATIFKPQHQYKRCIADTFKDLPPSALALLEVLLAVEPDG  411

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKD-----  1165
             RGTASSAL++EFFTT P P +P++LP+Y P KE+DAR+R+E  RR+ G+  K  +     
Sbjct  412   RGTASSALQSEFFTTKPFPSEPASLPRYQPRKEFDARLREEEARRRKGASSKQNEPKRLP  471

Query  1164  -SEGATPAPGDLAKLQDAIKKWQGQ-------------------LKLKKCGGMSEVD---  1054
                 A PAP   A+L  +I+K  G+                    +++   G++  +   
Sbjct  472   RESKAVPAPSANAELLASIQKRLGETNQTSVSEKFNPEGDSGSGFRMEPRKGITSQNPNP  531

Query  1053  -----NSRRLGGSELSRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSHW  889
                  ++   G S+L    S+  RG    QL  F +S AP          R  I VN  W
Sbjct  532   NYTNGDNHPNGSSQLRTQRSYVQRGA--AQLSRFSNSFAPARDGSQFGSVRHAI-VNQRW  588

Query  888   -HRLAMKCN---RVIDNESDHHYQNDEQKPRKDTMMGY-VPQTGHIHYSGPLIPAGGNID  724
                 +  CN   R+++ + +   + D     K+++MGY   +   IHYSGPLIP  GN+D
Sbjct  589   LEDGSTNCNLSQRLLE-KPNGLRKEDHSSSSKESIMGYDGDKKERIHYSGPLIPGEGNLD  647

Query  723   EMLKEHEKQIQNAVRKARLDKTSK  652
             EMLKEHE+QI  AVR+A+ DK  +
Sbjct  648   EMLKEHERQILLAVRRAQADKARR  671



>emb|CDY39924.1| BnaA09g15060D [Brassica napus]
Length=663

 Score =   159 bits (403),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 124/332 (37%), Positives = 184/332 (55%), Gaps = 38/332 (11%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslep-E  1333
             KIFKLCGSPS+E+W+ S+L++A IFKP+  Y+R +A+T KDL P S   L  +L     E
Sbjct  335   KIFKLCGSPSEEYWRRSRLRHAAIFKPQHQYKRCLADTCKDLIPPSALALLEVLLAVEPE  394

Query  1332  RRGTASSALENEFFTTTPLPCDPSALPKY-PPCKEYDARMRDEMLRRQNGSGYKCKDSE-  1159
              RGT SSAL++EFFTT P P +PS+LP+Y  P KE+D ++R+E  RR+ G+  K  +++ 
Sbjct  395   SRGTTSSALQSEFFTTRPFPSEPSSLPRYHQPRKEFDIKLREEEARRRKGASNKQNEAKR  454

Query  1158  -----GATPAPGDLAKLQDAIKKWQGQ-------------------LKLKKCGGMSEVDN  1051
                   A PAP   A+L  +I+K  G+                    +++   G++   N
Sbjct  455   FSRESKAVPAPSANAELLASIQKRLGETNQTSVSEKFNPEGDSGFGFRIEPLEGITTAPN  514

Query  1050  SRRLGGSELSRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMK  871
                 G S+L    S+  RGG   QL  F +S AP+         R+ +         +  
Sbjct  515   LN--GSSQLRTQRSYVQRGGA--QLSRFSNSVAPNRDGSQFGSVRDALVNQRCLEDGSGN  570

Query  870   CN---RVIDNESDHHYQNDEQKPRKDTMMGYVP-QTGHIHYSGPLIPAGGNIDEMLKEHE  703
             CN   R+++  +    ++D     K++++GY   +   IHYSGPLIP  GN+DEMLKEHE
Sbjct  571   CNLSQRLLEKPNGLKKEDDSSSSSKESILGYGGGKRERIHYSGPLIPGEGNLDEMLKEHE  630

Query  702   KQIQNAVRKARLDKTSKAKKGNIDYGQTESLL  607
             +QI  AVR+A+ D   KAK+ +   G+  SL+
Sbjct  631   RQILLAVRRAQSD---KAKRDDNIQGRRASLM  659



>emb|CDY29169.1| BnaC09g15660D [Brassica napus]
Length=663

 Score =   159 bits (403),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 124/332 (37%), Positives = 184/332 (55%), Gaps = 38/332 (11%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslep-E  1333
             KIFKLCGSPS+E+W+ S+L++A IFKP+  Y+R +A+T KDL P S   L  +L     E
Sbjct  335   KIFKLCGSPSEEYWRRSRLRHAAIFKPQHQYKRCLADTCKDLIPPSALALLEVLLAVEPE  394

Query  1332  RRGTASSALENEFFTTTPLPCDPSALPKY-PPCKEYDARMRDEMLRRQNGSGYKCKDSE-  1159
              RGT SSAL++EFFTT P P +PS+LP+Y  P KE+D ++R+E  RR+ G+  K  +++ 
Sbjct  395   SRGTTSSALQSEFFTTRPFPSEPSSLPRYHQPRKEFDIKLREEEARRRKGASNKQNEAKR  454

Query  1158  -----GATPAPGDLAKLQDAIKKWQGQ-------------------LKLKKCGGMSEVDN  1051
                   A PAP   A+L  +I+K  G+                    +++   G++   N
Sbjct  455   FSRESKAVPAPSANAELLASIQKRLGETNQTSVSEKFNPEGDSGFGFRIEPLEGITTAPN  514

Query  1050  SRRLGGSELSRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMK  871
                 G S+L    S+  RGG   QL  F +S AP+         R+ +         +  
Sbjct  515   LN--GSSQLRTQRSYVQRGGA--QLSRFSNSVAPNRDGSQFGSVRDALVNQRCLEDGSGN  570

Query  870   CN---RVIDNESDHHYQNDEQKPRKDTMMGYVP-QTGHIHYSGPLIPAGGNIDEMLKEHE  703
             CN   R+++  +    ++D     K++++GY   +   IHYSGPLIP  GN+DEMLKEHE
Sbjct  571   CNLSQRLLEKPNGLKKEDDSSSSSKESILGYGGGKRERIHYSGPLIPGEGNLDEMLKEHE  630

Query  702   KQIQNAVRKARLDKTSKAKKGNIDYGQTESLL  607
             +QI  AVR+A+ D   KAK+ +   G+  SL+
Sbjct  631   RQILLAVRRAQSD---KAKRDDNIQGRRASLM  659



>ref|XP_010260204.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Nelumbo nucifera]
Length=714

 Score =   160 bits (404),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 136/372 (37%), Positives = 192/372 (52%), Gaps = 72/372 (19%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ +KL +ATIFKP++ YER +A TFKD  P++L L+++LLS++P  
Sbjct  343   KIFKLCGSPSEDYWRKAKLPHATIFKPQQPYERCVAGTFKDFPPAALGLMETLLSIDPAD  402

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSE---  1159
             RGTA+SAL++EFF T PL CDPS+LPKYPP KE+DA++RDE  RRQ  +  K + S+   
Sbjct  403   RGTAASALKSEFFITKPLACDPSSLPKYPPSKEFDAKVRDEEARRQGAAWGKGQRSDLER  462

Query  1158  ------GATPAPGDLAKLQDAIKKWQGQLKLKKCGGMSE-----------VDNSRRLGGS  1030
                    A PAP   A+L  +++K QGQ   K    M             +D  R+   +
Sbjct  463   KVPRESRAVPAPDANAELILSMQKRQGQSNSKSRSEMFNHHQEEVASGFPIDPPRQSQAT  522

Query  1029  ELSR------------------HVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDIS  904
             E  R                  H S  A+ G +   P   S+ +   A   L   R  +S
Sbjct  523   EEVRKDAQGHFHKRASHSGPLVHRSAWAKVGRLDDAPK-VSNGSDLSALSSLVAARNLLS  581

Query  903   -------------VNSHWHRL------AMKCNRVIDNESDHHYQ--------NDEQKPRK  805
                          + S   RL      A + NR  D +  HH Q         DE+   K
Sbjct  582   DDRREKSGPSQSEMTSLLSRLPGSFNEASESNRKQDRK--HHAQVLVGSHQKEDERTSNK  639

Query  804   DTMM-GYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAK---KGN  637
             + ++ GY  +   IHYSGPL+    N+D+MLK+H++Q+Q  VR+ +LDK    K    GN
Sbjct  640   EKILQGYGSKGHKIHYSGPLLLPSDNVDQMLKDHDRQLQEVVRRKKLDKAKLRKLQAAGN  699

Query  636   IDYGQTESLLQY  601
               +G   S   Y
Sbjct  700   PIFGNPMSTSGY  711



>gb|AAF43241.1|AC012654_25 Strong similarity to the putative protein kinase F26A9.10 gi|6682614 
from A. thaliana on BAC gb|AC016163 ; It contains an 
eukaryotic protein kinase domain PF|00069. This gene is cut 
off, partial [Arabidopsis thaliana]
Length=389

 Score =   156 bits (394),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 111/289 (38%), Positives = 159/289 (55%), Gaps = 12/289 (4%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ + L  AT FKP   Y+  +AETF     S+L L++ LL++EPE+
Sbjct  93    KIFKLCGSPSEDYWRRATLPLATSFKPSHPYKPVLAETFNHFPSSALMLINKLLAIEPEK  152

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+A+S L +EFFTT PLP +PS LP+YPP KE DA++R+E  R+    G K +  E  T
Sbjct  153   RGSAASTLRSEFFTTEPLPANPSNLPRYPPSKELDAKLRNEEARKLRAEGNKRRGGETVT  212

Query  1149  PA-PGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLP  973
                P DL   Q       GQ K+       + D     GG+        +    G+ Q  
Sbjct  213   RGRPKDLKTAQTPEFMAAGQSKVTCISHKFKTDEE---GGTGFRIEPPRR----GIQQNG  265

Query  972   MFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKPRKDTMM  793
                +S+  HP     +              +  + ++  D  S   Y+ D   P +D   
Sbjct  266   KAHASSMVHPTVADTEWNGGGSIKRQTNAEMKSRTSQTGD-LSGESYRRD---PNRDYST  321

Query  792   GYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAK  646
             G  P+   I+YSGPL+P GGN++++LKEHEKQIQ AVRKAR++K++  K
Sbjct  322   GNAPRKNRINYSGPLMPPGGNLEDLLKEHEKQIQQAVRKARVEKSASRK  370



>ref|XP_004301455.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Fragaria vesca subsp. vesca]
Length=629

 Score =   159 bits (402),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 118/292 (40%), Positives = 165/292 (57%), Gaps = 33/292 (11%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS++FWKN+KL +AT FKP++ Y+RR+A+TFKD   ++L+L+D LLS+E E 
Sbjct  357   KIFKLCGSPSEDFWKNTKLPHATSFKPQQPYKRRLADTFKDFPSTALALVDKLLSIEEEN  416

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGA-  1153
             RG+A SAL + FFTT P+ C PSALP+YPP KE+DA++RDE  +RQ     K +  E   
Sbjct  417   RGSAGSALRSAFFTTPPVACHPSALPQYPPSKEFDAKLRDEE-KRQREVPVKGRGPESVR  475

Query  1152  -TPAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLG----------GSELSRHVSF  1006
                  G +A   D              G +S+  N + +G           S  +     
Sbjct  476   RVSRDGKVAPTPDY------------NGRISQGKNPKSMGHKYMPHQQDSASGFAMEAHR  523

Query  1005  KARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQN  826
             + R  G  Q    CSS     + +G  L +   S  +     A   ++   + +   ++N
Sbjct  524   RDRQKGYSQ----CSSVIHPSSGVGSSLNKTTASARNKPELRAQTSHK--PHTATDLFKN  577

Query  825   DEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKAR  670
             D     K+  MGYV ++  IH SGPL+P GGNI++MLKEHE+ IQ AVRKAR
Sbjct  578   DRLF-IKEAGMGYVTKS-RIHCSGPLVPPGGNIEDMLKEHERHIQQAVRKAR  627



>ref|XP_010461202.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
isoform X1 [Camelina sativa]
Length=447

 Score =   157 bits (396),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 116/295 (39%), Positives = 165/295 (56%), Gaps = 37/295 (13%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+EFW+ +K   AT +KP++ Y R + ETFK+L  SSL+LLD LLS+EPE+
Sbjct  185   KIFKLCGSPSEEFWETTKFPQATSYKPQQPYTRVLLETFKNLPSSSLALLDKLLSVEPEK  244

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             R +ASS L +EFFTT PLPC  S+LPKYPP KE DA++RDE  +R+     K +  E   
Sbjct  245   RCSASSTLLSEFFTTEPLPCHISSLPKYPPSKELDAKVRDEESKRKKAEAVKWRGHESVR  304

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
                 D     D I      + +       E    +R  G+    H S ++    VG++  
Sbjct  305   RGSRDSKVTPDFIASGHSNVSINTPAFKKE----KRFTGTNSVIHPSSRS---NVGEVKT  357

Query  969   FCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKPRKDTMMG  790
               S+  P             +++  +    + K N V+ N          ++P K     
Sbjct  358   SRSNNVP-------------VTMEDYLASYSQKEN-VVSN----------KQPTKT----  389

Query  789   YVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYG  625
             Y+ +   +HYSGPL+P GGNI++M+K+HE++IQ AVRK+RL+KT  A K N D+ 
Sbjct  390   YMRKKNRMHYSGPLMPPGGNIEDMMKDHERRIQEAVRKSRLEKT--ATKKNKDFS  442



>ref|XP_009762471.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
isoform X3 [Nicotiana sylvestris]
Length=512

 Score =   157 bits (398),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 125/297 (42%), Positives = 168/297 (57%), Gaps = 21/297 (7%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ SKL +AT FKP+  Y+R IA+TFKDL PS+L+L+D LLS+EPE+
Sbjct  219   KIFKLCGSPSEEYWRKSKLPHATSFKPQNPYKRCIADTFKDLPPSALALVDVLLSIEPEK  278

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGTASSAL +EFF T PLPCDP +LPKYPP KEYDA++RD   RR+     K    E   
Sbjct  279   RGTASSALNSEFFKTKPLPCDPYSLPKYPPSKEYDAKVRDHEARRRKAKTVKGHGGELTK  338

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
              +P    +         GQ + +K   +          G  +   V  + R G      +
Sbjct  339   KSPRQSKEEPTTKLNAHGQGQPRKSISVKYNPLEDSGTGFPIEPPV-LRYRNG------L  391

Query  969   FCSSAAPHPAAIGLDLC---REDIS-------VNSHWHRLAMKCN---RVIDNESDHHYQ  829
               S++  HP   G       +ED S        + H   L  + +   RV    S    +
Sbjct  392   THSNSVIHPNIAGYTWSNKGKEDSSGIERAYAASQHGVELLRQGSHKPRVAGEFSSIRTR  451

Query  828   NDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKT  658
              D++    D+ + YVP+      SG L+PAGG++++MLKEHE+QIQ AVRKAR DKT
Sbjct  452   RDDRSSFGDSTV-YVPKRSRRILSGLLVPAGGSMEDMLKEHERQIQEAVRKARQDKT  507



>ref|XP_010478807.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Camelina sativa]
Length=616

 Score =   158 bits (400),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 118/289 (41%), Positives = 164/289 (57%), Gaps = 35/289 (12%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+EFW+ +K   AT +KP++ Y R + ETFK+L PSSL+LLD LLS+EPE+
Sbjct  354   KIFKLCGSPSEEFWETTKFPQATSYKPQQPYTRVLLETFKNLPPSSLALLDKLLSVEPEK  413

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             R +ASS L +EFFTT PLPC  S+LPKYPP KE DA++RDE  +R+     K +  E   
Sbjct  414   RWSASSTLLSEFFTTEPLPCHISSLPKYPPSKELDAKVRDEESKRKKAEAVKWRGHESVR  473

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
                 D     D I      + +       E    +R  G+    H S ++    VG++  
Sbjct  474   RGSRDSKVTPDFIASGHSNVSINTPAFKKE----KRFSGTNSVIHPSSRS---NVGEVKA  526

Query  969   FCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKPRKDTMMG  790
               S+  P        +  ED   +S     + K N V            +Q+P K     
Sbjct  527   SRSNNVP--------VTMEDYLASS-----SQKENVV-----------SKQQPTKT----  558

Query  789   YVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKK  643
             Y+ +   +HYSGPL+P GGNI++M+K+HE++IQ AVRK+RL+KT+  KK
Sbjct  559   YMRKKNRMHYSGPLMPPGGNIEDMMKDHERRIQEAVRKSRLEKTATKKK  607



>emb|CDY67268.1| BnaCnng54190D [Brassica napus]
Length=650

 Score =   158 bits (400),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 111/297 (37%), Positives = 157/297 (53%), Gaps = 27/297 (9%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ + L  ATIFKP   Y+  +AETF     S+++L++ LL +EPE+
Sbjct  359   KIFKLCGSPSEDYWRRATLPLATIFKPSHPYKPVLAETFSHFPASAMTLINKLLEIEPEK  418

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+A S+L +EFF T PLP  PS+LP+YPP KE DA++R+E  R+      K +  E  T
Sbjct  419   RGSAVSSLRSEFFNTEPLPAIPSSLPRYPPSKELDAKLRNEEERKLRAEDNKRRGGETVT  478

Query  1149  PA-PGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLP  973
                P DL   Q      +GQ K+       + D     GG+        +    G+ Q  
Sbjct  479   RGRPKDLKSTQTPELMARGQSKVTCISHKFKTDEE---GGTGFRIEPPRR----GIQQNG  531

Query  972   MFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQND--------EQ  817
                +S+  HP+             NS W+       R  + E                 +
Sbjct  532   YVHASSMVHPSV-----------ANSEWNIGGGSIKRKTNAELKSRISQTGNVSGDSCRR  580

Query  816   KPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAK  646
               ++D   G  P+   IHYSGPL+P GGN++EMLKEHEKQIQ AVRKAR++ ++  K
Sbjct  581   ASKRDYSTGNAPRKNRIHYSGPLMPPGGNLEEMLKEHEKQIQQAVRKARVENSASNK  637



>ref|XP_006390761.1| hypothetical protein EUTSA_v10018253mg [Eutrema salsugineum]
 gb|ESQ28047.1| hypothetical protein EUTSA_v10018253mg [Eutrema salsugineum]
Length=648

 Score =   158 bits (400),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 113/291 (39%), Positives = 160/291 (55%), Gaps = 12/291 (4%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ + L  AT FKP   Y+  +AETF     S+L+L++ LL++EPE+
Sbjct  358   KIFKLCGSPSEDYWRRATLPLATSFKPSHPYKPVLAETFNHFPASALTLINKLLAIEPEK  417

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+A+SAL +EFFTT PLP +P+ LP+YPP KE DA++R+E  R+      K +  E  T
Sbjct  418   RGSAASALRSEFFTTEPLPANPANLPRYPPSKELDAKLRNEEARKLRAEDNKRRGGETVT  477

Query  1149  PA-PGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLP  973
                P D    Q       GQ K+       + D     GG+        +    G+ Q  
Sbjct  478   RGRPKDHKTAQTPEFMAAGQSKVTCISHKFKTDEE---GGTGFRIEPPRR----GIQQNG  530

Query  972   MFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKPRKDTMM  793
                +S+  HP   G +  R           L  + ++     S   Y+ D   P +D   
Sbjct  531   HAHASSMVHPIVAGKEWNRGGSMKRQTNAELKSRISQT-GELSGSSYRRD---PNRDYST  586

Query  792   GYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKG  640
             G  P+   IHYSGPL+P GGN++++LKEHEKQIQ AVRKAR++K+   K G
Sbjct  587   GNAPRKNRIHYSGPLMPPGGNLEDLLKEHEKQIQQAVRKARVEKSGSRKTG  637



>ref|XP_006300829.1| hypothetical protein CARUB_v10019921mg [Capsella rubella]
 gb|EOA33727.1| hypothetical protein CARUB_v10019921mg [Capsella rubella]
Length=658

 Score =   158 bits (400),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 113/289 (39%), Positives = 159/289 (55%), Gaps = 12/289 (4%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ + L  AT FKP   Y+  +AETF     S+L+L++ LL++EPE+
Sbjct  363   KIFKLCGSPSEDYWRRATLPLATSFKPSHPYKAVLAETFSHFPASALTLINKLLAIEPEK  422

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+A+S L +EFFTT PLP +PS LP+YPP KE DA++R+E  R+      K +  E  T
Sbjct  423   RGSAASTLRSEFFTTEPLPANPSNLPRYPPSKELDAKLRNEEARKLRAEDSKRRGGETVT  482

Query  1149  PA-PGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLP  973
                P DL   Q       GQ K+       + D     GG+        +    G+ Q  
Sbjct  483   RRRPKDLKTAQTPEFMAAGQSKVTCISHKFKTDEE---GGTGFRIEPPRR----GIQQNG  535

Query  972   MFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKPRKDTMM  793
                +S+  HP     +  R           L  K ++  D   D  Y+ D  +   D   
Sbjct  536   KAHASSMVHPTVADTEWNRGGSIKRQTNAELKSKISQTGDLSGDS-YRRDSNR---DYST  591

Query  792   GYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAK  646
             G  P+   IHYSGPL+P GGN++++LKEHEKQIQ AVRKAR++K++  K
Sbjct  592   GNAPRKNRIHYSGPLMPPGGNLEDLLKEHEKQIQQAVRKARVEKSASRK  640



>ref|XP_009762469.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Nicotiana sylvestris]
Length=664

 Score =   157 bits (398),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 125/297 (42%), Positives = 168/297 (57%), Gaps = 21/297 (7%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ SKL +AT FKP+  Y+R IA+TFKDL PS+L+L+D LLS+EPE+
Sbjct  371   KIFKLCGSPSEEYWRKSKLPHATSFKPQNPYKRCIADTFKDLPPSALALVDVLLSIEPEK  430

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGTASSAL +EFF T PLPCDP +LPKYPP KEYDA++RD   RR+     K    E   
Sbjct  431   RGTASSALNSEFFKTKPLPCDPYSLPKYPPSKEYDAKVRDHEARRRKAKTVKGHGGELTK  490

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
              +P    +         GQ + +K   +          G  +   V  + R G      +
Sbjct  491   KSPRQSKEEPTTKLNAHGQGQPRKSISVKYNPLEDSGTGFPIEPPV-LRYRNG------L  543

Query  969   FCSSAAPHPAAIGLDLC---REDIS-------VNSHWHRLAMKCN---RVIDNESDHHYQ  829
               S++  HP   G       +ED S        + H   L  + +   RV    S    +
Sbjct  544   THSNSVIHPNIAGYTWSNKGKEDSSGIERAYAASQHGVELLRQGSHKPRVAGEFSSIRTR  603

Query  828   NDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKT  658
              D++    D+ + YVP+      SG L+PAGG++++MLKEHE+QIQ AVRKAR DKT
Sbjct  604   RDDRSSFGDSTV-YVPKRSRRILSGLLVPAGGSMEDMLKEHERQIQEAVRKARQDKT  659



>ref|XP_009762470.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Nicotiana sylvestris]
Length=662

 Score =   157 bits (398),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 124/297 (42%), Positives = 168/297 (57%), Gaps = 23/297 (8%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ SKL +AT FKP+  Y+R IA+TFKDL PS+L+L+D LLS+EPE+
Sbjct  371   KIFKLCGSPSEEYWRKSKLPHATSFKPQNPYKRCIADTFKDLPPSALALVDVLLSIEPEK  430

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGTASSAL +EFF T PLPCDP +LPKYPP KEYDA++RD   RR+     K    E   
Sbjct  431   RGTASSALNSEFFKTKPLPCDPYSLPKYPPSKEYDAKVRDHEARRRKAKTVKGHGGELTK  490

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
              +P    +         GQ +       + +++S   G          + R G      +
Sbjct  491   KSPRQSKEEPTTKLNAHGQPRKSISVKYNPLEDS---GTGFPIEPPVLRYRNG------L  541

Query  969   FCSSAAPHPAAIGLDLC---REDIS-------VNSHWHRLAMKCN---RVIDNESDHHYQ  829
               S++  HP   G       +ED S        + H   L  + +   RV    S    +
Sbjct  542   THSNSVIHPNIAGYTWSNKGKEDSSGIERAYAASQHGVELLRQGSHKPRVAGEFSSIRTR  601

Query  828   NDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKT  658
              D++    D+ + YVP+      SG L+PAGG++++MLKEHE+QIQ AVRKAR DKT
Sbjct  602   RDDRSSFGDSTV-YVPKRSRRILSGLLVPAGGSMEDMLKEHERQIQEAVRKARQDKT  657



>ref|XP_006397114.1| hypothetical protein EUTSA_v10028507mg [Eutrema salsugineum]
 gb|ESQ38567.1| hypothetical protein EUTSA_v10028507mg [Eutrema salsugineum]
Length=641

 Score =   157 bits (397),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 115/290 (40%), Positives = 161/290 (56%), Gaps = 19/290 (7%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPSD++WK  KL  AT FKP++ Y+R + ETFK L  S+L+L+D LLSLEPE+
Sbjct  363   KIFKLCGSPSDDYWKKKKLPLATSFKPQQPYKRVLLETFKSLPSSALALVDKLLSLEPEK  422

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+ SS L ++FFTT PLPCD S+LPKYPP KE DA++RDE  RR+     K +  E   
Sbjct  423   RGSTSSTLNSKFFTTEPLPCDVSSLPKYPPSKELDAKVRDEEARRKRAETVKGRGPESVR  482

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
                 D        +            G S+V N +    + L        R  G      
Sbjct  483   RGSRDFKSTVTTPEFI--------ASGQSKVINPQEDSRTGLRGETGRCDRDKGFSH---  531

Query  969   FCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQK--PRKDTM  796
               +++  HP +I     + + S N   + + +K  R  +      Y +   K     +  
Sbjct  532   --TNSMIHP-SITATWSKNESSRN---NVVELKATRSSNVPMTGRYLSPSHKDDAAVEPT  585

Query  795   MGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAK  646
               Y+ +   +HYSGPL+P GGNI+++LKEHE+QIQ AVRK+RL+K++  K
Sbjct  586   ATYIRKKNRMHYSGPLMPPGGNIEDILKEHERQIQEAVRKSRLEKSATKK  635



>ref|XP_009118304.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Brassica rapa]
Length=694

 Score =   157 bits (398),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 132/339 (39%), Positives = 189/339 (56%), Gaps = 58/339 (17%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK +KL +ATIFKP+  Y+R +AETFK L  S+L+L+++LL++EP+ 
Sbjct  374   KIFKLCGSPSEEYWKRAKLPDATIFKPQHPYKRCVAETFKSLPSSALALVEALLAVEPDA  433

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGT + AL++EFFTT P   +PS+LPKY P KE D ++R+E  RR+ G+  K  +S+  +
Sbjct  434   RGTTALALQSEFFTTEPFASEPSSLPKYQPRKESDVKLREEEARRKKGTSSKQNESKQVS  493

Query  1149  PAPGDLAKLQDAIKKWQGQ---------LKLK-----KCG---------GMSEVDNSRR-  1042
                    +L  +I+K QGQ         L +      K G         G+S V+ S   
Sbjct  494   KESKANGELLPSIQKPQGQSSQTGLSEKLNINEDAALKSGTTENGYTRYGLSSVNRSGEN  553

Query  1041  --LGGS-----ELSRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISV-NSHWH  886
               +G S     EL    SF  RG    QL  F +S A   A+          SV N  W 
Sbjct  554   VMMGSSRSPRKELRTQRSFVQRGAP--QLSKFSNSVAARDAS--------HFSVANPGWL  603

Query  885   RLAMKCNRVIDNESDHHY-QNDEQKPR-----KDTMMGYVPQTGHIHYSGPLIPAGGNID  724
                   +   +N+ D  + Q    KP+     K+++ G+  +   ++YSGPL+  GGN+D
Sbjct  604   E-----DSYSNNKGDGDWSQRLLVKPKYSTKDKESIRGHGEKIERMNYSGPLVSNGGNLD  658

Query  723   EMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQTESLL  607
             +MLKEHE+ IQ AVRKAR  KT++      D GQT++ L
Sbjct  659   DMLKEHERLIQLAVRKARDKKTNRD-----DNGQTQACL  692



>ref|XP_009113343.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Brassica rapa]
Length=664

 Score =   157 bits (397),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 124/332 (37%), Positives = 183/332 (55%), Gaps = 38/332 (11%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslep-E  1333
             KIFKLCGSPS+E+W+ S+L++A IFKP+  Y+R +A+T KDL P S   L  +L     E
Sbjct  336   KIFKLCGSPSEEYWRRSRLRHAAIFKPQHQYKRCLADTCKDLIPPSALALLEVLLAVEPE  395

Query  1332  RRGTASSALENEFFTTTPLPCDPSALPKY-PPCKEYDARMRDEMLRRQNGSGYKCKDSE-  1159
              RGT SSAL++EFFTT P P +PS+LP+Y  P KE+D ++R+E  RR+ G+  K  +++ 
Sbjct  396   SRGTTSSALQSEFFTTRPFPSEPSSLPRYHQPRKEFDIKLREEEARRRKGASNKQNEAKR  455

Query  1158  -----GATPAPGDLAKLQDAIKKWQGQ-------------------LKLKKCGGMSEVDN  1051
                   A PAP   A+L  +I+K  G+                    +++   G++   N
Sbjct  456   FSRESKAVPAPSANAELLASIQKRLGETNQTSVSEKFNPEGDSGFGFRIEPLEGITTAPN  515

Query  1050  SRRLGGSELSRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMK  871
                 G S+L    S+  RGG   QL  F +S AP+         R+ +         +  
Sbjct  516   LN--GSSQLRTQRSYVQRGGA--QLSRFSNSVAPNRDGSQFGSVRDALVNQRCLEDGSGN  571

Query  870   CN---RVIDNESDHHYQNDEQKPRKDTMMGYVP-QTGHIHYSGPLIPAGGNIDEMLKEHE  703
             CN   R+++  +    ++D     K+++ GY   +   IHYSGPLIP  GN+DEMLKEHE
Sbjct  572   CNLSQRLLEKPNGLKKEDDSSSSSKESIPGYGGGKRERIHYSGPLIPGEGNLDEMLKEHE  631

Query  702   KQIQNAVRKARLDKTSKAKKGNIDYGQTESLL  607
             +QI  AVR+A+ D   KAK+ +   G+  SL+
Sbjct  632   RQILLAVRRAQSD---KAKRDDNIQGRRASLM  660



>ref|XP_003610952.1| hypothetical protein MTR_5g008860 [Medicago truncatula]
 gb|AES93910.1| cyclin-dependent kinase [Medicago truncatula]
Length=627

 Score =   157 bits (396),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 110/284 (39%), Positives = 165/284 (58%), Gaps = 16/284 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ +KL  AT FKP+ +Y R++A+ FK    ++L+L+D LLS+EP++
Sbjct  352   KIFKLCGSPSEDYWQRTKLPYATSFKPQNSYRRQVADAFKHFPSTALALVDKLLSMEPQK  411

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+A+SALE+EFFTT PLPCDP +LPK+PP KE+D + RD+   R+N    K      A+
Sbjct  412   RGSATSALESEFFTTDPLPCDPLSLPKFPPSKEFDVKRRDKEATRKNTEAVKGHGPVTAS  471

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
                 +   L+      QG + L    G S    S     S+     + K       + PM
Sbjct  472   RGARNTKALETPEYNAQGDISLP---GKSNTRMSPLKYESQEDDESNNKCEP---SRSPM  525

Query  969   FCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKPR----KD  802
                +   H +AI L   R D   +S  +   ++  R   N++   + +  +K +    +D
Sbjct  526   H--NGYTH-SAISLHSKRSD---SSRKNIPELRAQRSHLNQAAIDFSDSIKKEQGMSGRD  579

Query  801   TMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKAR  670
             T MGY+P+   IH SGPL+PAGGNID+ML+EHE+ +Q+  R  +
Sbjct  580   TGMGYIPKKNRIHCSGPLMPAGGNIDDMLREHERLMQDVFRSVK  623



>dbj|BAJ97184.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=699

 Score =   157 bits (397),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 122/333 (37%), Positives = 174/333 (52%), Gaps = 50/333 (15%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W  +KL + T+FKP++ Y RR  ETF+D  P++L LLD+LL++EP  
Sbjct  371   KIFKLCGSPSEEYWVKAKLPDVTLFKPQRPYRRRTNETFRDFPPTALDLLDTLLAIEPSH  430

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQN-GSGYKCKDSEGA  1153
             RGTA+SAL+++FF T PL CDPS+LPKYPP KEYDA++R E   RQN  +    K S+  
Sbjct  431   RGTAASALDSQFFRTKPLACDPSSLPKYPPSKEYDAKLRGEEAMRQNVATTIAGKGSQSV  490

Query  1152  -------TPAPGDLA----------------------KLQDAIKKWQGQLKLKKCGGMSE  1060
                     P PG  A                       L+D++  ++ + +    G  S 
Sbjct  491   KPGRNEPKPVPGHGAIGADHQRSQARNNPRSSSHHYNTLEDSMSGFRMEPR-AAAGPPST  549

Query  1059  VDNSRRLGGS------ELSRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDL---CREDI  907
             + N  + G +      +  R V        V       +S   +  + G DL        
Sbjct  550   IQNVGQFGSTWYRKDDQRDRAVQRTTSSVRVSNHAPHLTSQRSYATSRGTDLHPSSSATR  609

Query  906   SVNSHWHRL-----AMKCNRVIDNESDHHYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIP  742
             + NS ++RL     A   +R +    D   ++         + GY  +   ++YSGPL+P
Sbjct  610   NTNSKYNRLDVAEPANALDRPVPANKDTTMRDA-----PSAVAGYEGRNQRMNYSGPLVP  664

Query  741   AGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKK  643
              GGN+D+MLKEHE+QIQ AVRKAR DK    +K
Sbjct  665   PGGNMDDMLKEHERQIQVAVRKARADKERTNRK  697



>ref|XP_010458252.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Camelina sativa]
 ref|XP_010458253.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Camelina sativa]
 ref|XP_010458254.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Camelina sativa]
 ref|XP_010458255.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Camelina sativa]
Length=694

 Score =   157 bits (397),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 127/320 (40%), Positives = 177/320 (55%), Gaps = 52/320 (16%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +ATIFKP++ Y+R +AE+FK L  S+L+L++ LL++EP  
Sbjct  382   KIFKLCGSPSEEYWKKSKLPHATIFKPQQPYKRCVAESFKSLPSSALALVEVLLAVEPNA  441

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGT  SAL++EFFTT P   +PS+LPKY P KE D + RDE  +R+ G+  K  +S+  +
Sbjct  442   RGTTDSALQSEFFTTKPFASEPSSLPKYQPRKEIDVKARDEEAKRKKGTSSKQNESKQVS  501

Query  1149  ---PAPGDLAKLQDAIKKWQ--------GQLKLKKC-GGMSEVDNSRRLGGSELSRHVSF  1006
                 AP   A+L  +I+K +         + +++    G  +V N+R  G S ++R+   
Sbjct  502   KGASAPDANAELLTSIQKREKFNPGEDAARYRIEPLKSGTPQVGNTR-YGVSSVNRYGDN  560

Query  1005  KARGG-----------------GVGQLPMFCSSAAPHPA---AIGLDLCREDISVNSHWH  886
               RG                  G  QL  F +S A       AI      ED S NS   
Sbjct  561   VMRGSSRSPRKELRTQRSFVQRGASQLTRFSNSVAARDGSHFAIANPRWLED-SYNSR--  617

Query  885   RLAMKCNRVIDNESDHHYQNDEQKPR-----KDTMMGYVPQTGHIHYSGPLIPAGGNIDE  721
                        N+ D   Q    KP+     K+ + G+  +T  +H SGPL+ AGGN++E
Sbjct  618   ----------QNDGDWS-QRFLVKPKGYTKHKEYIPGHGEKTERMHCSGPLVSAGGNLNE  666

Query  720   MLKEHEKQIQNAVRKARLDK  661
             MLKEHE+QIQ AVRKAR  K
Sbjct  667   MLKEHERQIQVAVRKARAGK  686



>ref|XP_010461203.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
isoform X2 [Camelina sativa]
Length=613

 Score =   156 bits (395),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 116/294 (39%), Positives = 165/294 (56%), Gaps = 37/294 (13%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+EFW+ +K   AT +KP++ Y R + ETFK+L  SSL+LLD LLS+EPE+
Sbjct  351   KIFKLCGSPSEEFWETTKFPQATSYKPQQPYTRVLLETFKNLPSSSLALLDKLLSVEPEK  410

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             R +ASS L +EFFTT PLPC  S+LPKYPP KE DA++RDE  +R+     K +  E   
Sbjct  411   RCSASSTLLSEFFTTEPLPCHISSLPKYPPSKELDAKVRDEESKRKKAEAVKWRGHESVR  470

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
                 D     D I      + +       E    +R  G+    H S ++    VG++  
Sbjct  471   RGSRDSKVTPDFIASGHSNVSINTPAFKKE----KRFTGTNSVIHPSSRS---NVGEVKT  523

Query  969   FCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKPRKDTMMG  790
               S+  P             +++  +    + K N V+ N          ++P K     
Sbjct  524   SRSNNVP-------------VTMEDYLASYSQKEN-VVSN----------KQPTKT----  555

Query  789   YVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDY  628
             Y+ +   +HYSGPL+P GGNI++M+K+HE++IQ AVRK+RL+KT  A K N D+
Sbjct  556   YMRKKNRMHYSGPLMPPGGNIEDMMKDHERRIQEAVRKSRLEKT--ATKKNKDF  607



>ref|NP_192739.2| protein kinase family protein [Arabidopsis thaliana]
 dbj|BAC42724.1| putative protein kinase [Arabidopsis thaliana]
 gb|AEE82829.1| protein kinase family protein [Arabidopsis thaliana]
Length=469

 Score =   154 bits (390),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 113/294 (38%), Positives = 161/294 (55%), Gaps = 25/294 (9%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFK CGSPSD++W+ +KL  AT FKP++ Y+R + ETFK+L PS+L+L+D LLSLEP +
Sbjct  188   KIFKFCGSPSDDYWQKTKLPLATSFKPQQPYKRVLLETFKNLPPSALALVDKLLSLEPAK  247

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGTASS L ++FFT  PLPC+ S+LPKYPP KE DA++RDE  RR+     K +  E   
Sbjct  248   RGTASSTLSSKFFTMEPLPCNVSSLPKYPPSKELDAKVRDEEARRKKSETVKGRGPESVR  307

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
                 D        K      +    G   +   ++R    E SR        G   Q   
Sbjct  308   RGSRDF-------KSTATTPEFVASGQSKDTITTKRFNPQEDSR----TGLRGDRDQKGF  356

Query  969   FCSSAAPHPAAIGL----DLCREDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKP--R  808
               +++  HP+        + CR ++        + +K  R  +      Y +   K    
Sbjct  357   SHTNSMIHPSITATWSKNESCRNNV--------VELKATRSSNVPMTGRYLSPSHKEDVA  408

Query  807   KDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAK  646
               T   YV +   +H SGPL+P GGNI+++LK+HE+QIQ AVRK+RL+K++  K
Sbjct  409   VQTTTTYVRKKNRMHCSGPLMPPGGNIEDILKDHERQIQEAVRKSRLEKSATRK  462



>ref|XP_009417044.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Musa acuminata subsp. malaccensis]
Length=504

 Score =   155 bits (391),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 126/340 (37%), Positives = 170/340 (50%), Gaps = 66/340 (19%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPSDE+WK SKL +ATIFKP+  Y R +AETF+D    +L+LLDSLL++EP  
Sbjct  177   KIFKLCGSPSDEYWKKSKLPHATIFKPQHQYRRCVAETFEDFPSVALTLLDSLLAVEPAN  236

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDA--------RMRDEMLRRQNGSGYK  1174
             RGTA+SAL + FF T P  C+PS+LPKYPP KEYDA        R R E  ++++ S   
Sbjct  237   RGTAASALSSAFFKTKPFACNPSSLPKYPPSKEYDAKLRDEEIRRQRAEATKKRSESARP  296

Query  1173  CKDSEGATPAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARG  994
              +      P P   A ++   +K Q   K       ++ D S    G  +   V     G
Sbjct  297   GRREIKTKPMPD--ANVKQQKRKPQANPKTSSEKYNAQYDESG--SGFSIDPPVGTAQNG  352

Query  993   --------GGVG------------QLP---------------------MFCSSAAPHPAA  937
                     GG G            Q+P                     M  S AA  P +
Sbjct  353   FYHPGMHAGGFGSSLTKEENQEEPQVPGRSYSSMGVANGPRLQAQRSYMPLSGAAFFPGS  412

Query  936   IGLDLCREDISVNSHWHRLAM---KCNRVIDNESDHHYQNDEQKPRKDTMMGYVPQTGHI  766
             +         + +S ++RL +       ++D  +  H ++D     +    GY P+   I
Sbjct  413   VA-----ARSTASSRYNRLDVAEPSDKHILDRPASTHKKDD-----RTASKGYGPRNKKI  462

Query  765   HYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAK  646
             HYSG L+P GGN+++MLKEHE+QIQ  VRKARLDK    K
Sbjct  463   HYSGLLMPTGGNVEDMLKEHERQIQQVVRKARLDKVKTKK  502



>gb|KFK40934.1| hypothetical protein AALP_AA2G063200 [Arabis alpina]
Length=685

 Score =   156 bits (395),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 133/323 (41%), Positives = 186/323 (58%), Gaps = 41/323 (13%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ S+L++ATIFKP+  Y+R IA+TFKDL PS+L+LL+ LL++EP+ 
Sbjct  352   KIFKLCGSPSEEYWRRSRLRHATIFKPQHQYKRCIADTFKDLPPSALALLEVLLAVEPDG  411

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKD-----  1165
             RGTASSAL++EFFTT P P +P++LP+Y P KE+DAR+R+E  RR+ G+  K  +     
Sbjct  412   RGTASSALQSEFFTTKPFPSEPASLPRYQPRKEFDARLREEEARRRKGASSKQNEPKRLP  471

Query  1164  -SEGATPAPGDLAKLQDAIKKW----QGQLKLK---------------KCGGMSEVDNSR  1045
                 A PAP   A+L  +I++     Q  +  K               + G  S+  N  
Sbjct  472   RESKAVPAPSANAELLASIQRLGETNQTSVSEKFNPEGDSGSGFRMEPRKGITSQNPNPN  531

Query  1044  RL-------GGSELSRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSHW-  889
                      G S+L    S+  RG    QL  F +S AP          R  I VN  W 
Sbjct  532   YTNGDNHPNGSSQLRTQRSYVQRGA--AQLSRFSNSFAPARDGSQFGSVRHAI-VNQRWL  588

Query  888   HRLAMKCN---RVIDNESDHHYQNDEQKPRKDTMMGY-VPQTGHIHYSGPLIPAGGNIDE  721
                +  CN   R+++ + +   + D     K+++MGY   +   IHYSGPLIP  GN+DE
Sbjct  589   EDGSTNCNLSQRLLE-KPNGLRKEDHSSSSKESIMGYDGDKKERIHYSGPLIPGEGNLDE  647

Query  720   MLKEHEKQIQNAVRKARLDKTSK  652
             MLKEHE+QI  AVR+A+ DK  +
Sbjct  648   MLKEHERQILLAVRRAQADKARR  670



>ref|NP_177308.3| protein kinase superfamily protein [Arabidopsis thaliana]
 gb|AAG51826.1|AC016163_15 putative protein kinase; 36307-33767 [Arabidopsis thaliana]
 gb|AEE35210.1| protein kinase superfamily protein [Arabidopsis thaliana]
Length=655

 Score =   156 bits (394),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 110/296 (37%), Positives = 163/296 (55%), Gaps = 26/296 (9%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ + L  AT FKP   Y+  +AETF     S+L L++ LL++EPE+
Sbjct  359   KIFKLCGSPSEDYWRRATLPLATSFKPSHPYKPVLAETFNHFPSSALMLINKLLAIEPEK  418

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+A+S L +EFFTT PLP +PS LP+YPP KE DA++R+E  R+    G K +  E  T
Sbjct  419   RGSAASTLRSEFFTTEPLPANPSNLPRYPPSKELDAKLRNEEARKLRAEGNKRRGGETVT  478

Query  1149  PA-PGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLP  973
                P DL   Q       GQ K+       + D     GG+        +    G+ Q  
Sbjct  479   RGRPKDLKTAQTPEFMAAGQSKVTCISHKFKTDEE---GGTGFRIEPPRR----GIQQNG  531

Query  972   MFCSSAAPHPAAIGLDLCREDISVNSHWH---RLAMKCNRVIDNES----DHHYQNDEQK  814
                +S+  HP              ++ W+    +  + N  + + +    D   ++  + 
Sbjct  532   KAHASSMVHPTV-----------ADTEWNGGGSIKRQTNAEMKSRTSQTGDLSGESYRRD  580

Query  813   PRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAK  646
             P +D   G  P+   I+YSGPL+P GGN++++LKEHEKQIQ AVRKAR++K++  K
Sbjct  581   PNRDYSTGNAPRKNRINYSGPLMPPGGNLEDLLKEHEKQIQQAVRKARVEKSASRK  636



>ref|XP_010421919.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Camelina sativa]
Length=656

 Score =   155 bits (393),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 117/293 (40%), Positives = 163/293 (56%), Gaps = 13/293 (4%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSP +++W+ +KL  AT FKP++ Y+R + ETFK+L PS+L+L+D LLSLEPE 
Sbjct  370   KIFKLCGSPCNDYWQKTKLPLATSFKPQQPYKRVLLETFKNLPPSALALVDKLLSLEPEM  429

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGTASS L ++FFTT PLPCD S+LPKYPP KE DA++RDE  RR+     K +  E   
Sbjct  430   RGTASSTLSSKFFTTEPLPCDVSSLPKYPPSKELDAKVRDEEARRKKAETVKGRGPESVR  489

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
                 D        K      +    G   +   +RR    E SR       G G      
Sbjct  490   RGSRDF-------KSTATTPEFVASGQAKDTITNRRYNPQEDSRTGLRGEMGRGDRDKGF  542

Query  969   FCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKP--RKDTM  796
               +++  HP  I     + D   +S  + + +K  R  +      Y +   K     +  
Sbjct  543   SHTNSMIHPN-IAATWSKND---SSRHNVVELKATRSSNVPMAGRYLSPSHKEDVSLEPT  598

Query  795   MGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGN  637
               YV +   +H SGPL+P GGNI+++LK+HE+QIQ AVRK+RL+K++  K  N
Sbjct  599   TTYVRKKNRMHCSGPLMPPGGNIEDILKDHERQIQEAVRKSRLEKSATKKNNN  651



>emb|CDY06363.1| BnaA09g48400D [Brassica napus]
Length=835

 Score =   157 bits (397),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 133/339 (39%), Positives = 189/339 (56%), Gaps = 58/339 (17%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK +KL +ATIFKP+  Y+R +AETFK L  S+L+L+++LL++EP+ 
Sbjct  515   KIFKLCGSPSEEYWKRAKLPDATIFKPQHPYKRCVAETFKSLPSSALALVEALLAVEPDA  574

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGT + AL++EFFTT P   +PS+LPKY P KE D ++R+E  RR+ G+  K  +S+  +
Sbjct  575   RGTTALALQSEFFTTEPFASEPSSLPKYQPRKESDVKLREEEARRKKGTSSKQNESKQVS  634

Query  1149  PAPGDLAKLQDAIKKWQGQL-------KLK-------KCG---------GMSEVDNSRR-  1042
                    +L  +I+K QGQ        KL        K G         G+S V+ S   
Sbjct  635   RESKANGELLPSIQKPQGQSSQTGLSEKLNTNEDAALKSGTTENGYTRYGLSSVNRSGEN  694

Query  1041  --LGGS-----ELSRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISV-NSHWH  886
               +G S     EL    SF  RG    QL  F +S A   A+          SV N  W 
Sbjct  695   VMMGSSRSPRKELRTQRSFVQRGAP--QLSKFSNSVAARDAS--------HFSVANPGWL  744

Query  885   RLAMKCNRVIDNESDHHY-QNDEQKPR-----KDTMMGYVPQTGHIHYSGPLIPAGGNID  724
                   +   +N+ D  + Q    KP+     K+++ G+  +   ++YSGPL+  GGN+D
Sbjct  745   E-----DSYSNNKGDGDWSQRLLVKPKYSTKDKESIRGHGEKIERMNYSGPLVSNGGNLD  799

Query  723   EMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQTESLL  607
             +MLKEHE+ IQ AVRKAR  KT++      D GQT++ L
Sbjct  800   DMLKEHERLIQLAVRKARDKKTNRD-----DNGQTQACL  833



>ref|XP_010437707.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Camelina sativa]
Length=661

 Score =   155 bits (392),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 116/293 (40%), Positives = 162/293 (55%), Gaps = 13/293 (4%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSP +++W+ +K   AT FKP++ Y+R + ETFK+L PS+L+L+D LLSLEPE 
Sbjct  374   KIFKLCGSPCNDYWQKTKFPLATSFKPQQPYKRVLLETFKNLPPSALALVDKLLSLEPEM  433

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGT SS L ++FFTT PLPCD S+LPKYPP KE DA++RDE  RR+     K +  E   
Sbjct  434   RGTTSSTLSSKFFTTEPLPCDVSSLPKYPPSKELDAKVRDEEARRKKAETVKGRGPESVR  493

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
                 D        K      +    G   +   +RR    E SR       G G      
Sbjct  494   RGSRDF-------KSTATTPEFVASGQAKDTITNRRFNPQEDSRTGLRGEMGRGDRDKGF  546

Query  969   FCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKP--RKDTM  796
               +++  HP +I     + D   +S  + L +K  R  +      Y +   K     +  
Sbjct  547   SHTNSMIHP-SIAATWSKND---SSRHNVLELKATRSSNVPMAGRYLSPSHKEDVSLEPT  602

Query  795   MGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGN  637
               YV +   +H SGPL+P GGNI+++LK+HE+QIQ AVRK+RL+K++  K  N
Sbjct  603   TTYVRKKNRMHCSGPLMPPGGNIEDILKDHERQIQEAVRKSRLEKSATKKNNN  655



>emb|CDP00862.1| unnamed protein product [Coffea canephora]
Length=678

 Score =   155 bits (393),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 119/304 (39%), Positives = 170/304 (56%), Gaps = 31/304 (10%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ SKL +AT FKP+  Y R +A+TFKD  P +L+L+++LLS+EPE+
Sbjct  363   KIFKLCGSPSEEYWRKSKLPHATSFKPQHPYRRCVADTFKDFPPPALALVETLLSIEPEK  422

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGTA  AL +EFFT  PLPCDPS+LPKYPP KE+DA++RDE  RR+     K      A 
Sbjct  423   RGTAKYALNSEFFTKKPLPCDPSSLPKYPPSKEFDAKLRDEEERRRKAESIKGHGDVYAR  482

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
                 +   +       QGQ    KC  +S   N+    G+          + G       
Sbjct  483   KVSREPTAVNTRDFNTQGQGHSNKC--ISVRLNTMEDSGAGFPIEPPRGIKNG------F  534

Query  969   FCSSAAPHPAAIG----LDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQ------NDE  820
               S++  HP AIG         E  +++  +     + +R I  +     Q      +++
Sbjct  535   SHSTSMIHPNAIGAFKSTKQGNEGGTISGTYSH--SQHDRSIKKQGSQKSQVVPGLTSND  592

Query  819   QKPRKDTMMGYV-------PQTG----HIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKA  673
                R+ T++ ++       P +G     IH SGPL+P GGN+++MLKEHE+QI+ AVRKA
Sbjct  593   ILLRQATLVRFMSFQLTIFPNSGSQRTRIHCSGPLVPPGGNMEDMLKEHERQIREAVRKA  652

Query  672   RLDK  661
             RL+K
Sbjct  653   RLEK  656



>ref|XP_010542778.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Tarenaya hassleriana]
Length=657

 Score =   155 bits (391),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 116/288 (40%), Positives = 160/288 (56%), Gaps = 17/288 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+ +W+ +KL  AT FKP+  Y+R + ETFK+   S+L+L+D LL++EPE 
Sbjct  366   KIFKLCGSPSEGYWQKTKLPLATSFKPQHPYKRALLETFKNFPSSALALIDKLLAMEPET  425

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+ASS L +EFFT  PLPCD S+LP+YPP KE DA++R+E  RR+     K +  E  +
Sbjct  426   RGSASSVLSSEFFTMEPLPCDISSLPRYPPSKELDAKVREEA-RRKRADAAKGRGHESVS  484

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
                 D+  +        GQ K+   G  +      R G              G  G    
Sbjct  485   RGSRDVKNVATPEFIPSGQSKVTINGQRNNPQGINRTG---------LSVDPGRSGAQKG  535

Query  969   FC-SSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVI---DNESDHHYQNDEQKPRKD  802
             F  SS+  HP  +     +   S NS     A + + V     N S    +ND      +
Sbjct  536   FSHSSSMVHPV-VAASWNKNGSSRNSTVELKATRSSNVPVEGSNFSGSLRKNDTAC--GE  592

Query  801   TMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKT  658
             + M YV +   IH SGPL+P GGNI+++LKEHE+QIQ AVRK+RL+K+
Sbjct  593   STMTYVRKKNRIHCSGPLMPPGGNIEDILKEHERQIQQAVRKSRLEKS  640



>emb|CDY36688.1| BnaCnng07900D [Brassica napus]
Length=617

 Score =   154 bits (389),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 113/286 (40%), Positives = 150/286 (52%), Gaps = 20/286 (7%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++WK + L  AT FKP   Y+  +AETF     S+L+L+  LL++EPER
Sbjct  347   KIFKLCGSPSEDYWKRATLPLATSFKPSHPYKPLLAETFNHFPASALTLIKRLLAIEPER  406

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+A+S L +EFFTT PLP DPS LP+Y P KE DA +R+E  R+      K +  E  T
Sbjct  407   RGSAASTLRSEFFTTEPLPADPSNLPRYQPSKELDAMLRNEEARKLRAEDKKRRRGETVT  466

Query  1149  PA-PGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLP  973
                P D+  +Q       GQ K+         D     GG+          R GG  Q  
Sbjct  467   RGQPKDVKTVQTPELMAAGQSKVTCISHKFRTDEE---GGTGFRIE---PPRRGGSQQNG  520

Query  972   MFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQ--NDEQKPRKDT  799
                +S+  HP+             ++ W+R      +   +      Q  N      +D 
Sbjct  521   YVQASSVVHPSV-----------ADTEWNRGGSIKRQTNADMKSRIVQTGNLSGGSNRDY  569

Query  798   MMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDK  661
               G  P    I YSGPL+P GGN++EMLKEHEKQIQ AVRKAR++K
Sbjct  570   STGNAPMKNRIIYSGPLMPPGGNLEEMLKEHEKQIQQAVRKARVEK  615



>emb|CDY22631.1| BnaC08g42650D [Brassica napus]
Length=833

 Score =   156 bits (394),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 131/328 (40%), Positives = 183/328 (56%), Gaps = 53/328 (16%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++WK SKL +ATIFKP+  Y+R +AETFK L  S+L+L++ LL++EP+ 
Sbjct  513   KIFKLCGSPSEDYWKRSKLPDATIFKPQHPYKRCVAETFKSLPSSALALVEVLLAVEPDV  572

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGT + AL++EFFTT P   +PS+LPKY P KE D ++R+E  RR+ G+  K  +S+  +
Sbjct  573   RGTTAIALQSEFFTTEPFASEPSSLPKYQPRKESDVKLREEEARRKKGTSSKQNESKQVS  632

Query  1149  PAPGDLAKLQDAIKKWQGQL-------KLK-------KCG---------GMSEVDNSRR-  1042
                    +L  +I+K QGQ        KL        K G         G+S V+ S   
Sbjct  633   RESKANGELLPSIQKPQGQSSQTGLSEKLNTNEDAALKSGTTENGYTRYGLSSVNRSGEN  692

Query  1041  --LGGS-----ELSRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISV-NSHWH  886
               +G S     EL    SF  RG    QL  F +S A   A+          SV N  W 
Sbjct  693   VMMGSSRSPRKELRTQRSFVQRGAP--QLSKFSNSVAARDAS--------HFSVANPRW-  741

Query  885   RLAMKCNRVIDNESDHHY-QNDEQKPR-----KDTMMGYVPQTGHIHYSGPLIPAGGNID  724
              L    N   +N+ D  + Q    KP+     K+++ G+  +   ++YSGPL+  GGN+D
Sbjct  742   -LEDSYN---NNKGDGDWSQRLLVKPKYSTKDKESIRGHGEKIERMNYSGPLVSNGGNLD  797

Query  723   EMLKEHEKQIQNAVRKARLDKTSKAKKG  640
             +MLKEHE+ IQ AVRKAR  KT++   G
Sbjct  798   DMLKEHERLIQLAVRKARDKKTNRDDNG  825



>emb|CDX72813.1| BnaC06g32610D [Brassica napus]
Length=636

 Score =   154 bits (389),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 112/297 (38%), Positives = 159/297 (54%), Gaps = 26/297 (9%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+   L  AT FKP   Y+  + ETF     S+L+L+  LL++EPE+
Sbjct  351   KIFKLCGSPSEDYWRRETLPLATSFKPSHPYKAVLGETFSHFPASALTLIHKLLAIEPEK  410

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+A+SAL +EFFTT PLP +PS+LP+YPP KE DA++R+E  R+      K +  E  T
Sbjct  411   RGSAASALRSEFFTTEPLPANPSSLPRYPPSKELDAKLRNEEARKVKAEDKKRRGGETVT  470

Query  1149  PAPG-DLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLP  973
                  DL   Q       GQ K+       + D     GG+        +    G+ Q  
Sbjct  471   RGRAKDLNTAQTPEFMVAGQSKVTCISHKFKTDEE---GGTGFRIEPPRR----GIQQNG  523

Query  972   MFCSSAAPHPAAIGLDLCREDISVNSHWHR---LAMKCN----RVIDNESDHHYQNDEQK  814
                +S   HP+             ++ W+R   +  K N      +    D    +  + 
Sbjct  524   YAHASTVVHPSV-----------ADTEWNRGGSIKRKTNAELKSRVTQTGDLSGDSGRRS  572

Query  813   PRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKK  643
               +D   G  P+   IHYSGPL+P GGN+DEMLKEHEKQIQ AVRKAR++K+ + ++
Sbjct  573   SSRDYSTGNAPRKNRIHYSGPLMPPGGNLDEMLKEHEKQIQQAVRKARVEKSGQQQR  629



>emb|CAB39625.1| putative protein kinase [Arabidopsis thaliana]
 emb|CAB78124.1| putative protein kinase [Arabidopsis thaliana]
Length=649

 Score =   154 bits (389),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 113/294 (38%), Positives = 161/294 (55%), Gaps = 25/294 (9%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFK CGSPSD++W+ +KL  AT FKP++ Y+R + ETFK+L PS+L+L+D LLSLEP +
Sbjct  368   KIFKFCGSPSDDYWQKTKLPLATSFKPQQPYKRVLLETFKNLPPSALALVDKLLSLEPAK  427

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGTASS L ++FFT  PLPC+ S+LPKYPP KE DA++RDE  RR+     K +  E   
Sbjct  428   RGTASSTLSSKFFTMEPLPCNVSSLPKYPPSKELDAKVRDEEARRKKSETVKGRGPESVR  487

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
                 D        K      +    G   +   ++R    E SR        G   Q   
Sbjct  488   RGSRDF-------KSTATTPEFVASGQSKDTITTKRFNPQEDSR----TGLRGDRDQKGF  536

Query  969   FCSSAAPHPAAIGL----DLCREDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKP--R  808
               +++  HP+        + CR ++        + +K  R  +      Y +   K    
Sbjct  537   SHTNSMIHPSITATWSKNESCRNNV--------VELKATRSSNVPMTGRYLSPSHKEDVA  588

Query  807   KDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAK  646
               T   YV +   +H SGPL+P GGNI+++LK+HE+QIQ AVRK+RL+K++  K
Sbjct  589   VQTTTTYVRKKNRMHCSGPLMPPGGNIEDILKDHERQIQEAVRKSRLEKSATRK  642



>emb|CDX68307.1| BnaA07g23470D [Brassica napus]
Length=617

 Score =   154 bits (388),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 113/286 (40%), Positives = 153/286 (53%), Gaps = 20/286 (7%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++WK + L  AT FKP   Y+  +AETF     S+L+L++ LL++EPE+
Sbjct  347   KIFKLCGSPSEDYWKRATLPLATSFKPSHPYKPVLAETFSHFPASALTLINKLLAIEPEK  406

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+A+SAL +EFFTT PLP DPS LP+Y P KE DA++R+E  R+      K +  E  T
Sbjct  407   RGSAASALRSEFFTTEPLPADPSNLPRYQPSKELDAKLRNEEARKLRAEDKKRRRGETVT  466

Query  1149  PA-PGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLP  973
                P D+   Q       GQ K+       + D     GG+          R GG  Q  
Sbjct  467   RGQPKDVKTAQTPELMAAGQSKVTCISHKFKTDEE---GGTGFRIE---PPRRGGSQQNG  520

Query  972   MFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQ--NDEQKPRKDT  799
                +S+  HP+             ++ W+R      +   +      Q  N      +D 
Sbjct  521   YAQASSVVHPSV-----------ADTEWNRGGSIKRQTNADMKSRIVQTGNLSGGSNRDY  569

Query  798   MMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDK  661
               G  P    I YSGPL+P GGN++EMLKEHEKQIQ AVRKAR++K
Sbjct  570   STGNAPMKNRIIYSGPLMPPGGNLEEMLKEHEKQIQQAVRKARVEK  615



>ref|XP_006286675.1| hypothetical protein CARUB_v10002640mg [Capsella rubella]
 gb|EOA19573.1| hypothetical protein CARUB_v10002640mg [Capsella rubella]
Length=655

 Score =   153 bits (387),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 116/298 (39%), Positives = 166/298 (56%), Gaps = 14/298 (5%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSP +++W+ +KL  AT FKP++ Y+R + ETFK+L  S+L+L+D LLSLEPE+
Sbjct  370   KIFKLCGSPCNDYWQKTKLPLATSFKPQQPYKRVLLETFKNLPSSALALVDKLLSLEPEK  429

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGTASS L ++FFT  PLPCD S+LPKYPP KE DA++RDE  RR+     K +  E   
Sbjct  430   RGTASSTLSSKFFTMEPLPCDVSSLPKYPPSKELDAKVRDEEARRKKAETVKGRGPESVR  489

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
                 D        K      +    G   +   +RR    E SR       G G      
Sbjct  490   RGSRDF-------KSTTTTPEFVASGKPKDTIITRRFNPQEDSRTGLRGEMGRGDRDKGF  542

Query  969   FCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQK--PRKDTM  796
               +++  HP+ I     + +   +S  + + +K  R  +   +  Y +   K     +  
Sbjct  543   SHTNSMIHPS-IAATWSKNE---SSRHNVVELKATRSSNVPMNGRYLSPSHKDDAAIEPT  598

Query  795   MGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQ  622
               YV +   +H SGPL+P GGNI+++LK+HE+QIQ AVRK+RL+K S  KK N  + +
Sbjct  599   TTYVRKKNRMHCSGPLMPPGGNIEDILKDHERQIQEAVRKSRLEK-SATKKNNRTFAK  655



>ref|XP_010499920.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Camelina sativa]
Length=609

 Score =   153 bits (386),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 113/294 (38%), Positives = 163/294 (55%), Gaps = 37/294 (13%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS++FW+ +K   AT +KP++ Y R + ETFK+L  SSL+LLD LLS+EPE+
Sbjct  351   KIFKLCGSPSEDFWETTKFPQATSYKPQQPYTRVLLETFKNLPSSSLALLDKLLSVEPEK  410

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             R +ASS L +EFFTT PLPC  S+LPKYPP KE DA++R E  +R+     K +  E   
Sbjct  411   RCSASSTLLSEFFTTEPLPCHISSLPKYPPSKELDAKVRGEESKRKKAEAVKWRGHESVR  470

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
                 D     D I      + +          N +R  G+    H S ++    VG++  
Sbjct  471   RGSRDSKVTPDFIASGHSNVSI----NTPAFKNEKRFTGTNSVIHPSSRS---NVGEVKA  523

Query  969   FCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKPRKDTMMG  790
               S+  P             +++  +    + K N V            +++P K     
Sbjct  524   SRSNNVP-------------VTMKDYLASSSQKENVV-----------SKEQPTKT----  555

Query  789   YVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDY  628
             Y+ +   +HYSGPL+P GGNI++M+K+HE++IQ AVRK+RL+KT  A K N D+
Sbjct  556   YMRKKNRMHYSGPLMPPGGNIEDMMKDHERRIQEAVRKSRLEKT--ATKKNKDF  607



>gb|KFK43257.1| hypothetical protein AALP_AA1G100400 [Arabis alpina]
Length=972

 Score =   155 bits (393),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 140/343 (41%), Positives = 185/343 (54%), Gaps = 60/343 (17%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +ATIFKP+  Y+R +AETFK L  S+L+L++SLL++EP+ 
Sbjct  380   KIFKLCGSPSEEYWKRSKLPDATIFKPQHPYQRSVAETFKSLPSSALALVESLLAVEPDT  439

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSE---  1159
             RGT +SALE+EFFTT P   DPS+LPKY P KE+D ++++E  +R+ GS  K  DS+   
Sbjct  440   RGTTASALESEFFTTKPFASDPSSLPKYQPRKEFDVKLKEEEEKRKKGSSSKQNDSKQVS  499

Query  1158  GATPAPGDLAKLQDAIKKWQGQ------------LKLKKCG---------GMSEVD---N  1051
              A PAP   A+L  +++K QGQ            ++  K G         GMS V+    
Sbjct  500   KAVPAPDANAELLSSVQKRQGQNNQISTSENFNPVEPLKSGTATNGYTRYGMSSVNINGE  559

Query  1050  SRRLGGS------ELSRHVSFKARGGGVGQLPMFCSSAAPHPA---AIGLDLCREDISVN  898
             S  +G S      EL    SF  RG    QL  F +S A       AI      ED   N
Sbjct  560   SVMMGSSRSPPRKELRTQRSFVQRGS--AQLSRFSNSVAARDGSHFAIANPRWLEDSYHN  617

Query  897   SHWHRLAMKCNRVIDNESDHHYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEM  718
              +  R          N+ D   Q    KP++ T      +       G L+ AGGN+DEM
Sbjct  618   YNGRR----------NDGDWS-QRLMVKPKESTK----AKASTPAEKGLLVSAGGNLDEM  662

Query  717   LKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQTESLLQYVGNA  589
             LKEHE+QIQ AVRKA+       K    D GQT++ L   G +
Sbjct  663   LKEHERQIQVAVRKAK-------KTNRDDKGQTQASLAANGRS  698



>ref|XP_006415063.1| hypothetical protein EUTSA_v10007077mg [Eutrema salsugineum]
 gb|ESQ33416.1| hypothetical protein EUTSA_v10007077mg [Eutrema salsugineum]
Length=623

 Score =   152 bits (385),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 118/298 (40%), Positives = 165/298 (55%), Gaps = 39/298 (13%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPSD+FW+ +K   AT ++P+ TY+R + ETFK+L  SSL+LLD LLS+EPER
Sbjct  353   KIFKLCGSPSDDFWETTKFPQATSYRPQHTYKRVLLETFKNLPSSSLALLDQLLSVEPER  412

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             R +ASS L +EFFTT PLPC  S+LPKYPP KE DA+ R+E  RR        K SE   
Sbjct  413   RCSASSTLMSEFFTTEPLPCHISSLPKYPPSKELDAKNRNEEARR--------KKSEAV-  463

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGG---SELSRHVSFKARGGGVGQ  979
                           KW+G   +++    S+V       G     ++  V FK   G    
Sbjct  464   --------------KWRGHESVRRGSRDSKVTPEFLASGHSNVSINTPVGFKKDRGK---  506

Query  978   LPMFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDH---HYQNDEQKPR  808
              P   +++A H      +    ++         A + N V     D+     Q +    R
Sbjct  507   -PFSDNNSAIHTPTWNKNESSSNVG-----EVKASRSNNVPGTMGDYLSSSSQKENVASR  560

Query  807   KDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNI  634
             + T   Y+ +   +HYSGPL+P GGNI++M+KEHE++IQ AVRK+RL+K++  K  +I
Sbjct  561   QPTTT-YMRKKNRMHYSGPLMPPGGNIEDMMKEHERRIQEAVRKSRLEKSATKKNKDI  617



>ref|NP_001146380.1| uncharacterized protein LOC100279958 [Zea mays]
 gb|ACL53832.1| unknown [Zea mays]
Length=488

 Score =   152 bits (383),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 118/323 (37%), Positives = 169/323 (52%), Gaps = 54/323 (17%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ SKL +ATIFKP+  Y RR+ ETFK+    +L+L+D LLS++P  
Sbjct  143   KIFKLCGSPSEDYWRKSKLPHATIFKPQHPYARRVPETFKEFPVPALALVDVLLSVDPAD  202

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYK--------  1174
             RGTASSAL++EFFTT P  C+PS+LP+YPP KE+DA+ R+E  RRQ  +G K        
Sbjct  203   RGTASSALQSEFFTTKPYACNPSSLPRYPPSKEFDAKRREEEARRQGVTGGKQHKHDPER  262

Query  1173  -CKDSEGATPAPGDLAKLQDAIKKWQGQLKLKKCGGM-----------------------  1066
               ++S  A PAP   A+L  +++K Q Q   +    M                       
Sbjct  263   RTRESR-AVPAPEANAELVSSLQKRQAQANTRSRSEMFNPCKEDSASGFRIEPPRPTPVT  321

Query  1065  -SEVDNSRRL------GGSELSRHVSFKARGG--------GVGQLPMFCSS-AAPHPAAI  934
              S  D  R         G  +++    KA GG        GV   P+  S+ + P     
Sbjct  322   ESSEDPQRAYPTRIFHSGPLVNQSQPSKAGGGKNGEPQVPGVANHPVVLSTRSGPRADDS  381

Query  933   GLDLCREDISVNSHWHRLAMKCNRVIDNESDHHY---QNDEQKPRKDTMMGYVPQTGHIH  763
             G  +  +     +H  RL+   N    N   +     + D++  R D  +GY  +   IH
Sbjct  382   GRTMVAQ-AEAFAHGRRLSESINEHFSNSGKYDQVFPKKDDRNIRADGAIGYGSKGSKIH  440

Query  762   YSGPLI-PAGGNIDEMLKEHEKQ  697
             +SGPL  P+G N+DEMLKE+++Q
Sbjct  441   HSGPLTCPSGSNVDEMLKENDRQ  463



>gb|ABG21910.1| transposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
Length=422

 Score =   150 bits (380),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 122/306 (40%), Positives = 162/306 (53%), Gaps = 28/306 (9%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSP D++ K SK+    +FKP+  Y R +AETFK    S++ L+DSLLSL+PE 
Sbjct  119   KIFKLCGSPMDDYCKKSKVPETAMFKPQHQYRRCVAETFKVFPTSAVVLIDSLLSLDPEA  178

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGTA+SAL+++FFT  P  CDPS+LPK PP KEYD R+R E  RRQ  +    + +E   
Sbjct  179   RGTAASALQSDFFTKEPFACDPSSLPKLPPSKEYDVRLRQEEARRQKTAALAGQGAESVR  238

Query  1149  PAPGDLAKLQDAIKKWQGQLKLK---KCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQ  979
             P   D       I    G+LK +        SEV N      S     V  + R   V Q
Sbjct  239   PE-NDNRVTNRTISGVNGELKQQTHTSSKSNSEVFNQE---DSVPGFRVEPRERPTAV-Q  293

Query  978   LPMFCSS------AAPHPAAIGLDLC----------REDISVNSHWHRLAMKCNRVIDNE  847
             LP + S+          P   G   C          R+  S +S   +      R     
Sbjct  294   LPGYSSTWNNMEGDNDQPTVPGRACCSVRVANPCGIRKKGSSHSLIPQFGATDLRSTVEA  353

Query  846   SDHH---YQNDEQK-PRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVR  679
             +DH+    ++DE K P     M +  +   IH+SGPL+P GGN+++MLKEHE+QIQ AVR
Sbjct  354   TDHNDSPDRHDENKNPEVKDGMNHGRKYRRIHHSGPLMPPGGNVEDMLKEHERQIQEAVR  413

Query  678   KARLDK  661
             KAR+ K
Sbjct  414   KARVSK  419



>ref|XP_010455394.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Camelina sativa]
Length=657

 Score =   152 bits (384),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 115/293 (39%), Positives = 162/293 (55%), Gaps = 13/293 (4%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSP +++W+ +KL  AT FKP++ Y+R + ETFK+L PS+L+L+D LLSLEPE 
Sbjct  371   KIFKLCGSPCNDYWQKTKLPLATSFKPQQPYKRVLLETFKNLQPSALALVDKLLSLEPEM  430

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGT+SS L ++FFTT PLPCD S+LPKYPP KE D ++RDE  RR+     K +  E   
Sbjct  431   RGTSSSTLSSKFFTTEPLPCDVSSLPKYPPSKELDEKVRDEEARRKKAETVKGRGPESVR  490

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
                 D        K      +    G   +   +RR    E SR       G G      
Sbjct  491   RGSRDF-------KSTATTPEFVASGQAKDTITNRRYNPQEDSRTGLRGEMGRGDRDKGF  543

Query  969   FCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKP--RKDTM  796
               +++  HP  I     + D   +S  + + +K  R  +      Y +   K     +  
Sbjct  544   SHTNSMIHPN-IAATWSKND---SSRHNVVELKATRSSNVPIAGRYLSPSHKEDVSLEPT  599

Query  795   MGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGN  637
               YV +   +H SGPL+P GGNI+++LK+HE+QIQ AVRK+RL+K++  K  N
Sbjct  600   TTYVRKKNRMHCSGPLMPPGGNIEDILKDHERQIQEAVRKSRLEKSATKKNNN  652



>gb|KFK32036.1| hypothetical protein AALP_AA6G191700 [Arabis alpina]
Length=646

 Score =   152 bits (384),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 114/303 (38%), Positives = 166/303 (55%), Gaps = 44/303 (15%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPSD++W+ +KL  AT FKP + Y+R + ETFK L  S+L+L+D LLSLEP +
Sbjct  368   KIFKLCGSPSDDYWQKTKLPLATSFKPHQPYKRVLLETFKSLPSSALALVDKLLSLEPGK  427

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+ASS L+++FFTT PLPCD S+LPKYPP KE DA++R+E  RR+     K +  E   
Sbjct  428   RGSASSTLKSKFFTTEPLPCDVSSLPKYPPSKELDAKVREEEARRKRAETVKGRGPESVR  487

Query  1149  PAPGDL-AKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLP  973
                 D  + +        GQ K      M+  ++SR     E  R    + R  G     
Sbjct  488   RGSRDFKSTVTTPEFIASGQSK----ATMTTQEDSRTGFRGETGR----RDREKGYSH--  537

Query  972   MFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDH--------------H  835
                +++  HP            S+ + W +     N V++ +S                H
Sbjct  538   ---TNSVAHP------------SITATWSKNESSRNNVVELKSTRSSNVPMTGRYLSPSH  582

Query  834   YQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTS  655
              ++   +P       Y+ +   +H SGPL+P GGNI+++LK+HE+QIQ AVRK+RL+K++
Sbjct  583   KEDVAGEP----TTTYIRKKNRMHCSGPLMPPGGNIEDILKDHERQIQEAVRKSRLEKSA  638

Query  654   KAK  646
               K
Sbjct  639   TKK  641



>ref|XP_007156995.1| hypothetical protein PHAVU_002G034800g [Phaseolus vulgaris]
 gb|ESW28989.1| hypothetical protein PHAVU_002G034800g [Phaseolus vulgaris]
Length=636

 Score =   152 bits (383),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 108/291 (37%), Positives = 159/291 (55%), Gaps = 27/291 (9%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ +KL +AT FKP+  Y R+++ETFK+LSP +L+L+D LL++EPE 
Sbjct  358   KIFKLCGSPSEDYWQKTKLPHATSFKPQHPYNRQVSETFKNLSPPALALVDKLLTIEPEG  417

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+A+SALE+EFFTT PLPCDPS+LPK+ P KE+D++ RD+   R+N    + +      
Sbjct  418   RGSATSALESEFFTTNPLPCDPSSLPKFSPSKEFDSKRRDKEATRKNQEAVRGRAPASVL  477

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMS---------EVDNSRRLGGSELSRHVSFKAR  997
                GD   L        G + +++    S         E       GG  +S H      
Sbjct  478   RGAGDTKALGSPQYNAHGNISMRRKPNTSMYRQKYLCQENGEPNENGGGIVSVH------  531

Query  996   GGGVGQLPMFCSSAAPHPAAIGLDLCR--EDISVNSHWHRLAMKCNRVIDNESDHHYQND  823
             GG      M  +S A   +     +C+  E    N   H      N+   N      + +
Sbjct  532   GGYTHATTMMHNSVAGSSS-----VCKRPESYLTNQRSH-----LNQATANLCTSSVKKE  581

Query  822   EQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKAR  670
                  +++ MG +P+   IH SGPL+  GGN+D+MLKEHEK +Q+  R  +
Sbjct  582   PGSSARESSMGPMPKKNRIHCSGPLMRPGGNLDDMLKEHEKLMQDVFRSVK  632



>ref|XP_006357474.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Solanum tuberosum]
Length=716

 Score =   152 bits (385),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 127/353 (36%), Positives = 175/353 (50%), Gaps = 64/353 (18%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+ +WK  KL ++T FKP   Y RR+ ETFKD   S++ L+D+LLS++PE 
Sbjct  345   KIFKLCGSPSENYWKKEKLHHSTAFKPLHPYRRRLGETFKDFPLSAVRLMDTLLSIDPEL  404

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEG--  1156
             RGTA  ALE+EFFTT PLPCDPS+LPKYPP KE DA++RDE  RRQ  +G K +  EG  
Sbjct  405   RGTAVGALESEFFTTRPLPCDPSSLPKYPPSKEIDAKLRDEEARRQGAAGVKNQFDEGHM  464

Query  1155  -------ATPAPGDLAKLQDAIKKWQGQ------------LKLKKCGGMSE----VDNSR  1045
                    A PAP   A+L  ++++ Q               K   CG   +    +  S+
Sbjct  465   RGSKEPRAVPAPDANAELARSMQRRQSSSNPKSRSEHFYPYKEAPCGFPIDQHKPLQPSK  524

Query  1044  RLGGSELSRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDIS-------------  904
               GG  L  H    +  G +     +  S   +   I +   R D+S             
Sbjct  525   EKGGDHLENHSERFSHSGPLAPGFGWAKSGKKYDHDISVGSNRADLSKFSTLVASRSVVT  584

Query  903   -------VNSHWH--RLAMKCNRVIDNES-----DHHYQNDEQKPRKDTMMGYVPQT---  775
                    V S     R   +  R++D  S         QN     + D     + +    
Sbjct  585   GDARDRFVASQVESGRQVERPVRLLDEHSRKQDWKRQMQNHASSRQFDNGRASIKEQNLH  644

Query  774   GHIH--------YSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKG  640
             GH H        +SGPL+     +D+MLKEH+++IQ A R+ARL+K ++A KG
Sbjct  645   GHTHGHKGNTIHFSGPLLVQPNKVDQMLKEHDRRIQEAARRARLEK-ARAGKG  696



>emb|CDY58380.1| BnaC09g51600D [Brassica napus]
Length=586

 Score =   151 bits (381),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 121/300 (40%), Positives = 169/300 (56%), Gaps = 47/300 (16%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdls-psslslldsllslepE  1333
             KIFKLCGSPS+E+W+ S+L++A IFKP+  Y+R +A+T+KD   PS+L+LL+ LL +EPE
Sbjct  305   KIFKLCGSPSEEYWRRSRLRHAAIFKPQHQYKRCLADTYKDHIPPSALALLEVLLVVEPE  364

Query  1332  RRGTASSALENEFFTTTPLPCDPSALPKY-PPCKEYDARMRDEMLRRQNGSGYK------  1174
              RGT SSAL++EFFTT P P +PS+LP+Y  P KE+D ++R+E  RR+ G+  K      
Sbjct  365   ARGTTSSALQSEFFTTMPFPSEPSSLPRYHQPRKEFDIKLREEEARRRKGASNKQNEAKC  424

Query  1173  -CKDSEGATPAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSF-KA  1000
               +DS  A PAP   A+L  +I+K  G+          E+     L  +  S H  F   
Sbjct  425   FSRDSR-AVPAPSANAELLASIQKRLGEANQTSVSEKFEI-----LVLASGSNHWRFGSV  478

Query  999   RGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCN---RVIDNESDHHYQ  829
             R   V Q                   C ED S N         CN   R ++  +    +
Sbjct  479   RDALVNQ------------------RCLEDGSGN---------CNLSQRFLEKPNGLRKE  511

Query  828   NDEQKPRKDTMMGYV-PQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSK  652
             +      K+++MGY   +   IHYSGPLIP  GN+DEMLKEHE+QI  AVR+A+ D+  +
Sbjct  512   DGPSSSSKESIMGYEGGKRERIHYSGPLIPGEGNLDEMLKEHERQILLAVRRAQSDEAKR  571



>ref|XP_006356565.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Solanum tuberosum]
Length=637

 Score =   151 bits (381),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 122/307 (40%), Positives = 167/307 (54%), Gaps = 42/307 (14%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W  SKL  AT FK +  Y+R IA+TFKDL P++L+L+D+LLS+EPE 
Sbjct  347   KIFKLCGSPSEEYWSKSKLPLATSFKQQNPYKRGIADTFKDLPPTALALVDTLLSIEPEN  406

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGTAS AL +EFF   PLPCDP +LPKYPP KEYD ++R +  RR+     K   +E   
Sbjct  407   RGTASCALNSEFFKANPLPCDPYSLPKYPPSKEYDTKVRHQEARRRKAEAGKGHGAE---  463

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKA----RGGGVG  982
                          KK  GQ K +    ++   N+   G +  S  V + A    R G   
Sbjct  464   -----------TTKKSSGQAKEE----LATEFNAHGQGQTSKSIRVKYNALEDNRAGFSI  508

Query  981   QLP-----MFCSSAAPHPAAIGL---DLCREDISV-----------NSHWHRLAMKCNRV  859
             + P     +  S++  HP   G    +  +ED S               + R      R 
Sbjct  509   EPPALRYGLTHSNSVIHPNTSGYTWTNKAKEDSSAINERAYPASQHGVEFSRQGSHKPRA  568

Query  858   IDNESDHHYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVR  679
                 S    + D++    D+ + YVP+   + +SGPL+P GG++++MLKEHE+QIQ AVR
Sbjct  569   AGEFSSIRSRRDDRSSGGDSTV-YVPKRSRLLHSGPLMPQGGSMEDMLKEHERQIQEAVR  627

Query  678   KARLDKT  658
             KAR DKT
Sbjct  628   KARQDKT  634



>ref|XP_009113591.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Brassica rapa]
Length=617

 Score =   151 bits (381),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 112/290 (39%), Positives = 157/290 (54%), Gaps = 37/290 (13%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPSD++W+ +KL  AT FKP++ Y+R + ETFK L  S+L+L+D LLSLEPE+
Sbjct  357   KIFKLCGSPSDDYWRKTKLPLATSFKPQQPYKRVLLETFKSLPSSALALVDKLLSLEPEK  416

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+ SS L ++FFTT PLPC+ S+LPKYPP KE DA++RDE  RR+     K +++E   
Sbjct  417   RGSTSSTLNSKFFTTEPLPCEVSSLPKYPPSKELDAKVRDEEARRKRAETVKGREAESVR  476

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
              A                               SR     E SR  S    G G      
Sbjct  477   RA-------------------------------SRDFNPEEASRTGSRGETGRGDRDKGF  505

Query  969   FCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKPRK--DTM  796
               +++  HP+        E    +S  + + +K  R  +      Y +   K     +  
Sbjct  506   SHTNSMIHPSITATWSKNE----SSRHNVVELKATRSSNVPVTARYLSPSYKDDAAIEPT  561

Query  795   MGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAK  646
               Y  +   +H SGPL+P GGNI+++LKEHE+QIQ AVRK+RL+K++  K
Sbjct  562   TTYRRKKNRMHCSGPLMPPGGNIEDILKEHERQIQEAVRKSRLEKSATKK  611



>emb|CDX86879.1| BnaA09g22690D [Brassica napus]
Length=617

 Score =   150 bits (380),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 112/290 (39%), Positives = 157/290 (54%), Gaps = 37/290 (13%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPSD++W+ +KL  AT FKP++ Y+R + ETFK L  S+L+L+D LLSLEPE+
Sbjct  357   KIFKLCGSPSDDYWRKTKLPLATSFKPQQPYKRVLLETFKSLPSSALALVDKLLSLEPEK  416

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+ SS L ++FFTT PLPC+ S+LPKYPP KE DA++RDE  RR+     K +++E   
Sbjct  417   RGSTSSTLNSKFFTTEPLPCEVSSLPKYPPSKELDAKVRDEEARRKRAETVKGREAESVR  476

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
              A                               SR     E SR  S    G G      
Sbjct  477   RA-------------------------------SRDFNPEEASRTGSRGETGRGDRDKGF  505

Query  969   FCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQK--PRKDTM  796
               +++  HP+        E    +S  + + +K  R  +      Y +   K     +  
Sbjct  506   SHTNSMIHPSITATWSKNE----SSRHNVVELKATRSSNVPVTARYLSPSYKDDAAIEPT  561

Query  795   MGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAK  646
               Y  +   +H SGPL+P GGNI+++LKEHE+QIQ AVRK+RL+K++  K
Sbjct  562   TTYRRKKNRMHCSGPLMPPGGNIEDILKEHERQIQEAVRKSRLEKSATKK  611



>ref|XP_004511499.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Cicer arietinum]
Length=632

 Score =   150 bits (379),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 105/294 (36%), Positives = 162/294 (55%), Gaps = 29/294 (10%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ +KL  AT +KP+ +Y+R++ +TFK+   S+L+L+D LLS+EP  
Sbjct  350   KIFKLCGSPSEDYWQRTKLPYATSYKPQNSYKRQVTDTFKNFPSSALTLVDKLLSMEPAE  409

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+A+SAL++EFFTT PLPCDPS++PK+PP KE+D + RD+   R+N    + +      
Sbjct  410   RGSATSALKSEFFTTDPLPCDPSSMPKFPPSKEFDVKRRDKESIRKNTEAIQGRGPVTVL  469

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSR-------------RLGGSELSRHVS  1009
                G+   L+       G + L+   G S +  SR             +   S +S H  
Sbjct  470   RGAGNTKALETPEYNAPGDMSLR---GKSNIRTSRFKYEFQEDDETNHKCEPSRISMHNG  526

Query  1008  FKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSHWHRLAM-KCNRVIDNESDHHY  832
             +     G   L     S  P  +   +   R   +  S+ ++  +   N  I  E +   
Sbjct  527   YTHSTTGPSSL-----SKRPESSWKNIPELR---TQRSNLNQATIDSANIFIKKEQEQ--  576

Query  831   QNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKAR  670
               ++    ++T MGY P+   IH SGPL+P GGNID+MLKEHE+ +Q+  R  +
Sbjct  577   --EQGMSGQETGMGYKPKKNRIHCSGPLMPPGGNIDDMLKEHERLMQDVFRSVK  628



>gb|ABA96101.2| transposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
Length=671

 Score =   150 bits (379),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 122/306 (40%), Positives = 162/306 (53%), Gaps = 28/306 (9%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSP D++ K SK+    +FKP+  Y R +AETFK    S++ L+DSLLSL+PE 
Sbjct  368   KIFKLCGSPMDDYCKKSKVPETAMFKPQHQYRRCVAETFKVFPTSAVVLIDSLLSLDPEA  427

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGTA+SAL+++FFT  P  CDPS+LPK PP KEYD R+R E  RRQ  +    + +E   
Sbjct  428   RGTAASALQSDFFTKEPFACDPSSLPKLPPSKEYDVRLRQEEARRQKTAALAGQGAESVR  487

Query  1149  PAPGDLAKLQDAIKKWQGQLKLK---KCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQ  979
             P   D       I    G+LK +        SEV N      S     V  + R   V Q
Sbjct  488   PE-NDNRVTNRTISGVNGELKQQTHTSSKSNSEVFNQE---DSVPGFRVEPRERPTAV-Q  542

Query  978   LPMFCSS------AAPHPAAIGLDLC----------REDISVNSHWHRLAMKCNRVIDNE  847
             LP + S+          P   G   C          R+  S +S   +      R     
Sbjct  543   LPGYSSTWNNMEGDNDQPTVPGRACCSVRVANPCGIRKKGSSHSLIPQFGATDLRSTVEA  602

Query  846   SDHH---YQNDEQK-PRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVR  679
             +DH+    ++DE K P     M +  +   IH+SGPL+P GGN+++MLKEHE+QIQ AVR
Sbjct  603   TDHNDSPDRHDENKNPEVKDGMNHGRKYRRIHHSGPLMPPGGNVEDMLKEHERQIQEAVR  662

Query  678   KARLDK  661
             KAR+ K
Sbjct  663   KARVSK  668



>emb|CDX99520.1| BnaC09g24720D [Brassica napus]
Length=614

 Score =   149 bits (377),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 113/290 (39%), Positives = 155/290 (53%), Gaps = 37/290 (13%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPSD++W  +KL  AT FKP++ Y+R + ETFK L  S+L+L+D LLSLEPE+
Sbjct  354   KIFKLCGSPSDDYWLKTKLPLATSFKPQQPYKRVLLETFKSLPSSALALVDKLLSLEPEK  413

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+ SS L ++FFTT PLPCD S LPKYPP KE DA++RDE  RR+     K +++E   
Sbjct  414   RGSTSSTLNSKFFTTEPLPCDVSILPKYPPSKELDAKVRDEEARRKRAQTVKGREAELVR  473

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
              A                               SR     E SR  S    G G      
Sbjct  474   KA-------------------------------SRDFNPEEASRTGSRGETGRGDRDKGF  502

Query  969   FCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQK--PRKDTM  796
               +++  HP+        E    +S  + + +K  R  +      Y +   K     +  
Sbjct  503   SHTNSMIHPSITATWSKNE----SSRHNVVELKATRSSNVPVTARYLSPSYKDDAAIEPT  558

Query  795   MGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAK  646
               Y  +   +H SGPL+P GGNI+++LKEHE+QIQ AVRK+RL+K++  K
Sbjct  559   TTYRRKKNRMHCSGPLMPPGGNIEDILKEHERQIQEAVRKSRLEKSATKK  608



>emb|CDY48795.1| BnaA05g20750D [Brassica napus]
Length=513

 Score =   148 bits (374),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 113/292 (39%), Positives = 163/292 (56%), Gaps = 29/292 (10%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS++FW+ +K   AT ++P+  Y+R + ETFK+L  SSL+LLD LLS+EPE+
Sbjct  241   KIFKLCGSPSEDFWETTKFPQATSYRPQHPYKRVLLETFKNLPSSSLALLDRLLSVEPEK  300

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             R +ASS L +EFFTT PLPC  S+LPKYPP KE DA+ R+E  +R+     K        
Sbjct  301   RCSASSTLLSEFFTTEPLPCHISSLPKYPPSKELDAKKRNEEAKRKKAEAVK--------  352

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGG-SELSRHVSFKARG-GGVGQL  976
                            W+G    ++ G  S+V       G S +S +  +  +   G G+L
Sbjct  353   ---------------WRGHESARRGGRDSKVTPEFMASGHSNVSINTPYGFKKENGRGKL  397

Query  975   PMFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRV--IDNESDHHYQNDEQKPRKD  802
                 SS+  HP+ +   L +   S +S     A + N V  I           E  P ++
Sbjct  398   -FSASSSVIHPS-LTATLNKNKTSRSSVGEVRANRSNNVPVITGGYSSSSSQKESVPSRE  455

Query  801   TMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAK  646
                 Y+ +   +H SGPL+P GGNI++M+K+HE++IQ AVRK+RL+K+   K
Sbjct  456   PTTRYMRKKNRMHCSGPLMPPGGNIEDMMKDHERRIQEAVRKSRLEKSVTKK  507



>ref|XP_002441983.1| hypothetical protein SORBIDRAFT_08g006390 [Sorghum bicolor]
 gb|EES15821.1| hypothetical protein SORBIDRAFT_08g006390 [Sorghum bicolor]
Length=646

 Score =   148 bits (374),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 117/298 (39%), Positives = 162/298 (54%), Gaps = 14/298 (5%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+ ++K SK+    +FKP++ Y R + ETFKDL PS++ L+DSLLSLEPE 
Sbjct  351   KIFKLCGSPSENYYKKSKVPETAMFKPQQQYRRCVTETFKDLPPSAVLLIDSLLSLEPEV  410

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGTA+SAL+++FF T P  CDPS+LPK PP KEYD R+R E  RRQ  +    + +E   
Sbjct  411   RGTAASALQSDFFRTKPFACDPSSLPKLPPSKEYDIRLRQEEARRQRNAALGRQGAESIK  470

Query  1149  P-----APGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGV  985
             P     A      +   +K+         C   +  D+    G     R +    +    
Sbjct  471   PGNENHAASRAIDIAAEVKQPTHNTSKSTCEKFNTEDSVP--GFRVEPRALPTSMQVPEC  528

Query  984   GQLPMFCSSAAPHPAAIG-----LDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQNDE  820
             G         A H + +G     + + R+  S NS+  +      R     +DH+ Q D 
Sbjct  529   GSTWNNTGGYADHRSVLGRVYSSVRVARKKGSSNSNIPQYDAADLRNDIEITDHNQQVDR  588

Query  819   --QKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSK  652
                  +K+    +  +   IHYSGPL+P GGNI++MLKEHE+ IQ AVRKARL K S+
Sbjct  589   PVSSQKKEQQEDHGRKHKRIHYSGPLMPPGGNIEDMLKEHERHIQEAVRKARLSKGSR  646



>ref|NP_174637.1| protein kinase family protein [Arabidopsis thaliana]
 gb|AAF97284.1|AC010164_6 Putative protein kinase [Arabidopsis thaliana]
 gb|AEE31622.1| protein kinase family protein [Arabidopsis thaliana]
Length=614

 Score =   148 bits (373),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 114/292 (39%), Positives = 155/292 (53%), Gaps = 36/292 (12%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+EFW  +K   AT +KP+  Y+R + ETFK+LS SSL LLD LLS+EPE+
Sbjct  353   KIFKLCGSPSEEFWNTTKFPQATSYKPQHPYKRVLLETFKNLSSSSLDLLDKLLSVEPEK  412

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             R +ASS L +EFFTT PLPC  S+LPKYPP KE DA++RDE  +R+     K +  E   
Sbjct  413   RCSASSTLLSEFFTTEPLPCHISSLPKYPPSKELDAKVRDEEAKRKKAEAVKWRGHESVR  472

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
                 D     + I      + L       E    +R   +    H S ++  G V     
Sbjct  473   RGLRDSKVTPEFIASGNSNVSLTTPSFKKE----KRFTDTNSVIHPSSRSNVGEVKP---  525

Query  969   FCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKPRKDTMMG  790
               S +   PA +G  L                         S    +N   +    T   
Sbjct  526   --SRSNNVPATMGDYLA------------------------SSSQKENIVSRAPATT---  556

Query  789   YVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNI  634
             Y+ +   +HYSGPL+P GGNI++M+KEHE++IQ AVRK+RL+K++  K  +I
Sbjct  557   YMRKKNRMHYSGPLMPPGGNIEDMMKEHERRIQEAVRKSRLEKSATKKNKDI  608



>ref|XP_006307022.1| hypothetical protein CARUB_v10008607mg [Capsella rubella]
 gb|EOA39920.1| hypothetical protein CARUB_v10008607mg [Capsella rubella]
Length=616

 Score =   147 bits (372),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 112/298 (38%), Positives = 165/298 (55%), Gaps = 45/298 (15%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+EFW+ +K   AT ++P+  Y+R + ETFK+L  SSL+LLD LLS+EPE+
Sbjct  354   KIFKLCGSPSEEFWETTKFPQATSYRPQHPYKRVLLETFKNLPSSSLALLDKLLSVEPEK  413

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             R +ASS L +EFFTT PLPC  S+LPKYPP KE DA++RDE  +R+     K +  E   
Sbjct  414   RCSASSTLLSEFFTTEPLPCHISSLPKYPPSKELDAKVRDEESKRKKAEAVKWRGHESVR  473

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHV-SFKARGGGVGQLP  973
                 D     D I                        G S +S +  +FK       + P
Sbjct  474   RGSRDSKITPDFIAS----------------------GHSNVSINTPAFKK------EKP  505

Query  972   MFCSSAAPHPAA---IGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKPRKD  802
                +++  HP++   +G      ++  +S  + + +     + + S       E    ++
Sbjct  506   FSDTNSLIHPSSRSNVG------EVKASSRSNNVPVTVGDYLASSS-----QKENVALRE  554

Query  801   TMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDY  628
                 Y+ +   +HYSGPL+P GGNI++M+K+HE++IQ AVRK+RL+KT  A K N D+
Sbjct  555   PTTTYMRKKKRMHYSGPLMPPGGNIEDMMKDHERRIQEAVRKSRLEKT--ATKKNKDF  610



>ref|XP_004242255.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Solanum lycopersicum]
Length=649

 Score =   148 bits (373),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 118/303 (39%), Positives = 168/303 (55%), Gaps = 34/303 (11%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W  SKL  AT FK +  Y+R IA+TFKDL P++L+L+D+LLS+EPE+
Sbjct  359   KIFKLCGSPSEEYWSKSKLPLATSFKQQNPYKRGIADTFKDLPPTALALVDALLSIEPEK  418

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGTASSAL +EFF T PLPCDP +LPKYPP KEYD ++RD+  RR+     K   +E   
Sbjct  419   RGTASSALSSEFFKTNPLPCDPYSLPKYPPSKEYDTKVRDQEARRRKAEAGKAHGAE---  475

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLP-  973
                          KK  GQ K +     +     +   G  +  +     R G   + P 
Sbjct  476   -----------TTKKSSGQAKEEPATEFNAHGQGQTSKGIRVKYNALEDNRAGFSIEPPA  524

Query  972   ----MFCSSAAPHPAAIGL---DLCREDIS--------VNSHWHRLAMKCN---RVIDNE  847
                 +  S++  HP   G    +  ++D S         + H   L+ + +   R     
Sbjct  525   LRYGLTHSNSVIHPNTSGYTWNNKAKDDSSAINERAYPASQHGVELSRQGSHKPRATGEF  584

Query  846   SDHHYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARL  667
             S+   + D++    D+ + YV +   + +SGPL+  GG++++MLKEHE+QIQ AVRKA  
Sbjct  585   SNIRSRRDDRSSGGDSTV-YVSKRSRLLHSGPLMSQGGSMEDMLKEHERQIQEAVRKACQ  643

Query  666   DKT  658
             DKT
Sbjct  644   DKT  646



>gb|KHG26788.1| hypothetical protein F383_02840 [Gossypium arboreum]
Length=538

 Score =   146 bits (369),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 107/283 (38%), Positives = 159/283 (56%), Gaps = 17/283 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLC SPS+E+W+ +KL +AT FKP++ Y R + + F++   S+LSL+D LLS+EPE 
Sbjct  272   KIFKLCSSPSEEYWQKTKLPHATSFKPQQPYRRHVTDMFRNFPQSALSLVDKLLSMEPED  331

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGTA+SAL +EFFTT P PCDPS LPK+ PCKE D ++RDE  RR+     K +  E   
Sbjct  332   RGTAASALNSEFFTTEPFPCDPSDLPKHSPCKELDIKLRDEEARRKRAEAAKGRGPESVR  391

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
                 D   ++      +GQ K+ + G + +  +   +   +++             Q  +
Sbjct  392   RGTSDFKGVRTLEFIEEGQSKI-RAGHIEDGASGFHIDTHDITL------------QNCL  438

Query  969   FCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKPRKDTMMG  790
               SS+  H  A+G    ++ +   +    L  + + +       H   D       T + 
Sbjct  439   SQSSSMIHRNAVG--TWKKSVPTRTSVD-LRPQPSLMPQATKASHKTQDTATNEDPTSVR  495

Query  789   YVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDK  661
              + +T  IH SGPL+P GGNI+++LKEHE+ IQ AVRKARL+K
Sbjct  496   ALRKT-RIHCSGPLMPPGGNIEDILKEHERHIQQAVRKARLEK  537



>emb|CDY70545.1| BnaAnng34090D [Brassica napus]
Length=626

 Score =   147 bits (370),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 112/292 (38%), Positives = 163/292 (56%), Gaps = 29/292 (10%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS++FW+ +K   AT ++P+  Y+R + ETFK+L  SSL+LLD LLS+EPE+
Sbjct  354   KIFKLCGSPSEDFWETTKFPQATSYRPQHPYKRVLLETFKNLPSSSLALLDRLLSVEPEK  413

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             R +ASS L +EFFTT PLPC  S+LPKYPP KE DA+ R++  +R+     K        
Sbjct  414   RCSASSTLLSEFFTTEPLPCHISSLPKYPPSKELDAKKRNDEAKRKKAEAVK--------  465

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGG-SELSRHVSFK-ARGGGVGQL  976
                            W+G    ++ G  S+V       G S +S +  +   +  G G+L
Sbjct  466   ---------------WRGHESARRGGRDSKVTPEFMASGHSNVSINTPYGFKKENGRGKL  510

Query  975   PMFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRV--IDNESDHHYQNDEQKPRKD  802
                 SS+  HP+ +   L +   S +S     A + N V  I           E  P ++
Sbjct  511   -FSASSSVIHPS-LTATLNKNKTSRSSVGEVRANRSNNVPVITGGYSSSSSQKESVPSRE  568

Query  801   TMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAK  646
                 Y+ +   +H SGPL+P GGNI++M+K+HE++IQ AVRK+RL+K+   K
Sbjct  569   PTTRYMRKKNRMHCSGPLMPPGGNIEDMMKDHERRIQEAVRKSRLEKSVTKK  620



>gb|EEC69001.1| hypothetical protein OsI_37782 [Oryza sativa Indica Group]
Length=1322

 Score =   149 bits (376),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 118/308 (38%), Positives = 160/308 (52%), Gaps = 32/308 (10%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSP D++ K SK+    +FKP+  Y R +AETFK L  S++ L+DSLLSL+PE 
Sbjct  1019  KIFKLCGSPMDDYCKKSKVPETAMFKPQHQYRRCVAETFKVLPTSAVVLIDSLLSLDPEA  1078

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGTA+SAL+++FFT  P  CDPS+LPK PP KEYD R+R E  RRQ  +    + +E   
Sbjct  1079  RGTAASALQSDFFTKEPFACDPSSLPKLPPSKEYDVRLRQEEARRQKTAALAGQGAESVR  1138

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
             P   +       I    G+LK +          +     S     V  + R   V QLP 
Sbjct  1139  PENENRVT-NHTISGVNGELKQQTHTSSKSNSEAFNQEDSVPGFRVESRERPTAV-QLPG  1196

Query  969   F---------------------CSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVID  853
             +                     CS    +P  I     R+  S +S   +      R   
Sbjct  1197  YSSTWNNMEGDNDQRTVPGRGCCSVRVANPCGI-----RKKGSSHSLIPQFGATDLRSTV  1251

Query  852   NESDHH---YQNDEQK-PRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNA  685
               +DH+    ++DE K P     M +  +   IH+SGPL+P GGN+++MLKEHE+QIQ A
Sbjct  1252  EATDHNDSPDRHDENKNPEVKDAMNHGRKYRRIHHSGPLMPPGGNVEDMLKEHERQIQEA  1311

Query  684   VRKARLDK  661
             VRKAR+ K
Sbjct  1312  VRKARVSK  1319



>ref|XP_009151479.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Brassica rapa]
 emb|CDY70577.1| BnaAnng34220D [Brassica napus]
Length=626

 Score =   146 bits (368),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 113/292 (39%), Positives = 162/292 (55%), Gaps = 29/292 (10%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS++FW+ +K   AT ++P+  Y+R + ETFK+L  SSL+LLD LLS+EPE+
Sbjct  354   KIFKLCGSPSEDFWETTKFPQATSYRPQHPYKRVLLETFKNLPSSSLALLDRLLSVEPEK  413

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             R +ASS L +EFFTT PLPC  S+LPKYPP KE DA+ R+E  +R+     K        
Sbjct  414   RCSASSTLLSEFFTTEPLPCHISSLPKYPPSKELDAKKRNEEAKRKKAEAVK--------  465

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGG-SELSRHVSFK-ARGGGVGQL  976
                            W+G    ++ G  S+V       G S +S +  +   +  G G+L
Sbjct  466   ---------------WRGHESARRGGRDSKVTPEFMASGHSNVSINTPYGFKKENGRGKL  510

Query  975   PMFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRV--IDNESDHHYQNDEQKPRKD  802
                 SS+  HP+ +   L +   S  S     A + N V  I           E  P ++
Sbjct  511   -FSASSSVIHPS-LTATLNKNKSSRISVGEVRANRSNNVPVITGGYSSSSSQKESVPSRE  568

Query  801   TMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAK  646
                 Y+ +   +H SGPL+P GGNI++M+K+HE++IQ AVRK+RL+K+   K
Sbjct  569   PTTRYMRKKNRMHCSGPLMPPGGNIEDMMKDHERRIQEAVRKSRLEKSVTKK  620



>gb|EPS73453.1| hypothetical protein M569_01299, partial [Genlisea aurea]
Length=491

 Score =   145 bits (365),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 111/158 (70%), Gaps = 10/158 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ SKL +ATIFKP++ Y+RR+AET+KD    +L L++ LLS++P  
Sbjct  287   KIFKLCGSPSEEYWRKSKLPHATIFKPQQPYKRRVAETYKDFPSPALQLIEILLSIDPAD  346

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYK----CKDS  1162
             RG+A+ AL+NEFF+T PLPCDPS+LPKYPP KE+DA++RDE  RRQ  +G +    C + 
Sbjct  347   RGSAACALKNEFFSTRPLPCDPSSLPKYPPSKEFDAKLRDEEARRQAAAGIRGEKHCNEK  406

Query  1161  EG------ATPAPGDLAKLQDAIKKWQGQLKLKKCGGM  1066
              G      A PAP   A+L  +++K   Q  LK    M
Sbjct  407   RGAARESRAVPAPEANAELMSSMQKRHSQSNLKSRSEM  444



>gb|EEE52923.1| hypothetical protein OsJ_35543 [Oryza sativa Japonica Group]
Length=1348

 Score =   148 bits (374),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 122/311 (39%), Positives = 162/311 (52%), Gaps = 38/311 (12%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSP D++ K SK+    +FKP+  Y R +AETFK    S++ L+DSLLSL+PE 
Sbjct  1045  KIFKLCGSPMDDYCKKSKVPETAMFKPQHQYRRCVAETFKVFPTSAVVLIDSLLSLDPEA  1104

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGTA+SAL+++FFT  P  CDPS+LPK PP KEYD R+R E  RRQ  +    + +E   
Sbjct  1105  RGTAASALQSDFFTKEPFACDPSSLPKLPPSKEYDVRLRQEEARRQKTAALAGQGAESVR  1164

Query  1149  PAPGDLAKLQDAIKKWQGQLKLK---KCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQ  979
             P   D       I    G+LK +        SEV N      S     V  + R   V Q
Sbjct  1165  P-ENDNRVTNRTISGVNGELKQQTHTSSKSNSEVFNQE---DSVPGFRVEPRERPTAV-Q  1219

Query  978   LPMF---------------------CSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNR  862
             LP +                     CS    +P  I     R+  S +S   +      R
Sbjct  1220  LPGYSSTWNNMEGDNDQPTVPGRACCSVRVANPCGI-----RKKGSSHSLIPQFGATDLR  1274

Query  861   VIDNESDHH---YQNDEQK-PRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQI  694
                  +DH+    ++DE K P     M +  +   IH+SGPL+P GGN+++MLKEHE+QI
Sbjct  1275  STVEATDHNDSPDRHDENKNPEVKDGMNHGRKYRRIHHSGPLMPPGGNVEDMLKEHERQI  1334

Query  693   QNAVRKARLDK  661
             Q AVRKAR+ K
Sbjct  1335  QEAVRKARVSK  1345



>ref|XP_011087653.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
isoform X3 [Sesamum indicum]
Length=511

 Score =   144 bits (364),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 126/325 (39%), Positives = 174/325 (54%), Gaps = 51/325 (16%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KI+KLCGSPS+E+W  SKL    IFKP++ Y+RR+AE FK+L PS+L+LL++LL+ EPE 
Sbjct  177   KIYKLCGSPSEEYWNKSKLPLTAIFKPQQPYKRRVAEAFKNLPPSALALLETLLAFEPEN  236

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQ---NGSGYKCKDSE  1159
             RG+ +SAL++EFF T PLPCDPS+L KYPP KEYD ++R E  +RQ    G+G++ + S 
Sbjct  237   RGSTTSALQSEFFLTNPLPCDPSSLLKYPPSKEYDTKVRCEEAKRQLAACGNGHELESSR  296

Query  1158  ------GATPAPGDLAKLQDAIKKWQGQLKLKKC----------GGMSEVDNSRRLGGSE  1027
                    A PAP   A+LQ +I+K + Q    K           G    +   RR+G S 
Sbjct  297   KGSKELKAVPAPEANAELQLSIQKLKIQPNPSKNSEKYNPEEDGGSGVPIKRFRRMGESR  356

Query  1026  LSR-----------HVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSH-WHR  883
              S            H  F          P       P  AA GL   +   SV +H   +
Sbjct  357   HSLDVIDERPHADPHAPFGTSENNELTTPRL---YKPQEAASGLS--KPSCSVTAHDGSQ  411

Query  882   LAMKCNRVIDNESDHHYQNDEQK-----------PRKDTMMGYVPQTGHIHYSGPLIPAG  736
             L  K      +       N   K           P   T+   + QT  I+YSGPL+  G
Sbjct  412   LDFKTETSDASHEQEQCSNTRYKQLNIGKCRQVHPENRTICA-LKQTP-INYSGPLL--G  467

Query  735   GNIDEMLKEHEKQIQNAVRKARLDK  661
             G++++ML++HEKQIQ AVRKA+++K
Sbjct  468   GSVEKMLEDHEKQIQIAVRKAQMNK  492



>gb|EYU29815.1| hypothetical protein MIMGU_mgv1a018704mg [Erythranthe guttata]
Length=584

 Score =   145 bits (365),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 107/286 (37%), Positives = 161/286 (56%), Gaps = 44/286 (15%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSP++E+W+ +KL +   FK ++ Y+RR+A+ FKD   S+L+L+  LLS++PE 
Sbjct  337   KIFKLCGSPTEEYWRKTKLPHTGSFKSQRVYKRRVADAFKDFPSSALNLVQVLLSIDPEL  396

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+ASSAL+++FFT+ PLPC PS+LPKY P KE+D ++R++  RR+  +  +     GA 
Sbjct  397   RGSASSALKSQFFTSDPLPCAPSSLPKYRPSKEFDVKLREQEARRRKAASVR---EVGAE  453

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPM  970
                 +  K +  ++      K  K  G   +D+      S L R +S  + G G  QL  
Sbjct  454   YVASNTRKTKATME----ADKHPKSVGRKLMDDDDDDVHSILVRTLS--SSGSGAQQL--  505

Query  969   FCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKPRKDTMMG  790
                                 +   S  H++      VI+  S++H  ND +  ++     
Sbjct  506   --------------------MKQASQLHQI------VIEPSSNYHSNNDPKVVKE-----  534

Query  789   YVPQTGHIHYSGPLIPAG--GNIDEMLKEHEKQIQNAVRKARLDKT  658
             Y P+   I  SGPL+P G  GN+++MLKEHE+QIQ  VRKARL K+
Sbjct  535   YAPKRNRIFCSGPLMPTGGAGNMEDMLKEHERQIQQVVRKARLHKS  580



>ref|XP_010230587.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Brachypodium distachyon]
Length=690

 Score =   145 bits (367),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 126/336 (38%), Positives = 180/336 (54%), Gaps = 54/336 (16%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ SKL +ATIFKP+  Y RR+ +TFKD  P + +L+D LLS++P  
Sbjct  318   KIFKLCGSPSEDYWRKSKLPHATIFKPQHPYARRVTDTFKDFPPPARALVDVLLSVDPAE  377

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYK------CK  1168
             R TASSAL++EFF T P  C+PS+LP+YPP KEYDA+ R+E  RRQ  +G K       +
Sbjct  378   RQTASSALQSEFFATKPYACNPSSLPRYPPSKEYDAKRREEESRRQRIAGGKQHPERQTR  437

Query  1167  DSEGATPAPGDLAKLQDAIKKWQGQLKLKKCGGM--------------SEVDNSRRLGGS  1030
             +S+ A PAP   A+L  +++K Q Q   K    M                  ++  +  S
Sbjct  438   ESK-AVPAPEANAELASSLQKRQAQANTKSRSEMFNPCKEDSASGFPIEPPGSTHVIESS  496

Query  1029  ELSRHV----------------SFKARGGGVGQLPMFCSSAAPH-PAAI-GLDLCREDIS  904
             E S+HV                + K+     G L + C +  P+ P  + G    R D S
Sbjct  497   EGSKHVYPARTFHSGPLVNHNHASKSGPSKNGGLHVPCVADPPNFPVVVSGRSNIRPDDS  556

Query  903   ---------VNSHWHRLAMKCNRVIDNESDH---HYQNDEQKPRKDTMMGYVPQTGHIHY  760
                        +H  RL+   N    +   +     Q DE+  R D  +GY  +   IH+
Sbjct  557   NGTGVTQAEAFAHGRRLSESINGHFGSSGKYDQVFNQKDEKSGRMDGAIGYGSKGNKIHH  616

Query  759   SGPLI--PAGGNIDEMLKEHEKQIQNAVRKARLDKT  658
             SGPL   PA GN+DEMLKE+++QIQ   R+ R++K+
Sbjct  617   SGPLTSCPA-GNVDEMLKENDRQIQEVFRRTRVEKS  651



>ref|XP_010235557.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Brachypodium distachyon]
Length=737

 Score =   146 bits (368),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 123/352 (35%), Positives = 173/352 (49%), Gaps = 84/352 (24%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W  +KL + T+FKP++ Y RRIAETF+D  P+ L LLD+LL++EP  
Sbjct  387   KIFKLCGSPSEEYWAKAKLPDVTLFKPQRPYRRRIAETFRDFPPTGLDLLDTLLAIEPSD  446

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEY-------DARMR--------------  1213
             RGTA+SAL++EFF T PL CDPS+LPK+PP KEY       +A MR              
Sbjct  447   RGTAASALDSEFFRTKPLACDPSSLPKHPPSKEYDAKLRGKEAMMRQNAAAIGGKGSISV  506

Query  1212  --------------------DEMLRRQNGSGYKCKDSEG-----------------ATPA  1144
                                 D   R+Q  +    K S                   A PA
Sbjct  507   KPGRNEAMPKAAPAQEAIGVDHQRRQQAAARVNTKSSSHHYTALEDSVAGFRMEPPAAPA  566

Query  1143  PGDL-AKLQDAIK---KWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQL  976
             P  +  ++Q A +    W  + +  + GGM    +S R+    ++ H++           
Sbjct  567   PSTMQMQMQSAGQFGSTWYRKDEHHQRGGMKRTTSSLRVSNLPVAHHLT-----------  615

Query  975   PMFCSSAAPHPAAIGLDLCREDISV---NSHWHRL-AMKCNRVIDNESDHHYQND---EQ  817
                 S  +  P+  G DL     +V   NS ++RL   +    +D       + D     
Sbjct  616   ----SQRSCAPSRGGTDLHPSSSAVRNTNSKYNRLDVAEPANALDRPGPGAGKKDMGIRD  671

Query  816   KPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDK  661
              P      G+  +   ++YSGPL+P GGN+D+MLKEHE+QIQ AVRKAR+DK
Sbjct  672   APSAYQGQGFGGRNRRMNYSGPLVPPGGNMDDMLKEHERQIQQAVRKARVDK  723



>ref|XP_010089557.1| putative serine/threonine-protein kinase [Morus notabilis]
 gb|EXB38003.1| putative serine/threonine-protein kinase [Morus notabilis]
Length=708

 Score =   145 bits (366),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 110/350 (31%), Positives = 176/350 (50%), Gaps = 61/350 (17%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPSDE+W    L+ + + KP + Y R +AETFK+    ++ L+++LL+++P  
Sbjct  347   KIFKLCGSPSDEYWSKLHLRRSIVMKPPQPYRRCVAETFKEFPAPAVQLMETLLAVDPAN  406

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKC-------  1171
             RGTA+ A+++EFFTT PL CDPS+LPKYPP KE DA+ R+E  RRQ   G +        
Sbjct  407   RGTAAFAVKSEFFTTKPLACDPSSLPKYPPSKEIDAKFREEEARRQGTLGGRAHKVDLER  466

Query  1170  ---KDSEGATPAPGDLAKLQDAI------KKWQGQLKLKKCGG--------MSEVDNSRR  1042
                ++++       + A+ QD        + +  + + K   G        +  V +SR+
Sbjct  467   RGQREAQAIQAPNTNAARRQDYYGTNSHSEIFNRRREEKSVSGFLVDPTKQLRAVKDSRK  526

Query  1041  LGGSELSRHVSF----------KARGGGVGQLPMFCSSAA--------------------  952
               G +L+R VS           +  G      P+  S+ A                    
Sbjct  527   DSGDDLNRKVSLSGPLVHGPGRRRSGRECDNDPLVASTRANLSKLSGLVAARTVSSDDQQ  586

Query  951   -----PHPAAIGLDLCREDISVN-SHWHRLAMKCNRVIDNESDHHYQNDEQKPRKDTMMG  790
                  PHP  +  DL R   S+N +   R+  + +R    E      ++    ++ ++ G
Sbjct  587   ENPDPPHPGTVS-DLGRFRGSMNEAESARMQDRKHRSKKVEYSRPPADETPCTKESSLHG  645

Query  789   YVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKG  640
             + P+T  I+ SGPL+ +  ++D+MLKEH+++IQ   R+ RLDKT    +G
Sbjct  646   HGPKTNKIYVSGPLLVSSNSVDQMLKEHDRRIQEFARRTRLDKTKPGAQG  695



>ref|XP_008794127.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
isoform X3 [Phoenix dactylifera]
Length=535

 Score =   143 bits (361),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 109/152 (72%), Gaps = 9/152 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPSDE+W+ SKL +ATIFKP++ Y R +AETFKD   S+L+L+D LLS++P  
Sbjct  158   KIFKLCGSPSDEYWRKSKLPHATIFKPQQPYRRCVAETFKDFPASALALMDVLLSIDPAD  217

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCK--DSEG  1156
             RGT+ SAL++EFFTT PL CDPS+LPKYPP KE+DA+ RDE  RRQ  +G K    D E 
Sbjct  218   RGTSDSALKSEFFTTKPLSCDPSSLPKYPPSKEFDAKRRDEEARRQGAAGGKVHRLDLEK  277

Query  1155  -------ATPAPGDLAKLQDAIKKWQGQLKLK  1081
                    A PAP   A+L  +++K QGQL  K
Sbjct  278   RGLRESRAIPAPDANAELASSLQKRQGQLNTK  309


 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 44/68 (65%), Gaps = 3/68 (4%)
 Frame = -2

Query  840  HHYQNDEQKPRKD--TMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARL  667
            +H + DE+    D  T   Y P+   IHYSGPL    GNID+MLK+H++QIQ   R+ARL
Sbjct  429  YHRKEDERNSNMDQYTQQSYGPKGNKIHYSGPLPRPSGNIDQMLKDHDRQIQEVFRRARL  488

Query  666  DKTSKAKK  643
            DK SK +K
Sbjct  489  DK-SKVRK  495



>ref|XP_011087652.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Sesamum indicum]
Length=691

 Score =   144 bits (364),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 126/325 (39%), Positives = 174/325 (54%), Gaps = 51/325 (16%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KI+KLCGSPS+E+W  SKL    IFKP++ Y+RR+AE FK+L PS+L+LL++LL+ EPE 
Sbjct  357   KIYKLCGSPSEEYWNKSKLPLTAIFKPQQPYKRRVAEAFKNLPPSALALLETLLAFEPEN  416

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQ---NGSGYKCKDSE  1159
             RG+ +SAL++EFF T PLPCDPS+L KYPP KEYD ++R E  +RQ    G+G++ + S 
Sbjct  417   RGSTTSALQSEFFLTNPLPCDPSSLLKYPPSKEYDTKVRCEEAKRQLAACGNGHELESSR  476

Query  1158  ------GATPAPGDLAKLQDAIKKWQGQLKLKK----------CGGMSEVDNSRRLGGSE  1027
                    A PAP   A+LQ +I+K + Q    K           G    +   RR+G S 
Sbjct  477   KGSKELKAVPAPEANAELQLSIQKLKIQPNPSKNSEKYNPEEDGGSGVPIKRFRRMGESR  536

Query  1026  LSR-----------HVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSH-WHR  883
              S            H  F          P       P  AA GL   +   SV +H   +
Sbjct  537   HSLDVIDERPHADPHAPFGTSENNELTTPRL---YKPQEAASGLS--KPSCSVTAHDGSQ  591

Query  882   LAMKCNRVIDNESDHHYQNDEQK-----------PRKDTMMGYVPQTGHIHYSGPLIPAG  736
             L  K      +       N   K           P   T+   + QT  I+YSGPL+  G
Sbjct  592   LDFKTETSDASHEQEQCSNTRYKQLNIGKCRQVHPENRTICA-LKQTP-INYSGPLL--G  647

Query  735   GNIDEMLKEHEKQIQNAVRKARLDK  661
             G++++ML++HEKQIQ AVRKA+++K
Sbjct  648   GSVEKMLEDHEKQIQIAVRKAQMNK  672



>ref|XP_011087651.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Sesamum indicum]
Length=699

 Score =   144 bits (363),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 124/326 (38%), Positives = 174/326 (53%), Gaps = 53/326 (16%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KI+KLCGSPS+E+W  SKL    IFKP++ Y+RR+AE FK+L PS+L+LL++LL+ EPE 
Sbjct  365   KIYKLCGSPSEEYWNKSKLPLTAIFKPQQPYKRRVAEAFKNLPPSALALLETLLAFEPEN  424

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQ---NGSGYKCKDSE  1159
             RG+ +SAL++EFF T PLPCDPS+L KYPP KEYD ++R E  +RQ    G+G++ + S 
Sbjct  425   RGSTTSALQSEFFLTNPLPCDPSSLLKYPPSKEYDTKVRCEEAKRQLAACGNGHELESSR  484

Query  1158  ------GATPAPGDLAKLQDAIKKWQGQLKLKK----------CGGMSEVDNSRRLGGSE  1027
                    A PAP   A+LQ +I+K + Q    K           G    +   RR+G S 
Sbjct  485   KGSKELKAVPAPEANAELQLSIQKLKIQPNPSKNSEKYNPEEDGGSGVPIKRFRRMGESR  544

Query  1026  LSR-----------HVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSH-WHR  883
              S            H  F          P       P  AA GL   +   SV +H   +
Sbjct  545   HSLDVIDERPHADPHAPFGTSENNELTTPRL---YKPQEAASGLS--KPSCSVTAHDGSQ  599

Query  882   LAMKCNRVIDNESDHHYQNDEQKPRKDTMMGYVPQT------------GHIHYSGPLIPA  739
             L  K      +++ H  +       K   +G   Q               I+YSGPL+  
Sbjct  600   LDFKTE---TSDASHEQEQCSNTRYKQLNIGKCRQVHPENRTICALKQTPINYSGPLL--  654

Query  738   GGNIDEMLKEHEKQIQNAVRKARLDK  661
             GG++++ML++HEKQIQ AVRKA+++K
Sbjct  655   GGSVEKMLEDHEKQIQIAVRKAQMNK  680



>ref|XP_010694981.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=744

 Score =   144 bits (362),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 107/148 (72%), Gaps = 9/148 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ SKL +ATIFKP++ Y RR+AETFKD    +L LL++LLS++P  
Sbjct  374   KIFKLCGSPSEEYWRKSKLPHATIFKPQQPYIRRVAETFKDFPAPALGLLETLLSIDPAD  433

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCK--DSEG  1156
             RG+ASSAL+NEFF T PLPCDPS+LPKYPP KE+DA+MRDE  RRQ   G +    D E 
Sbjct  434   RGSASSALKNEFFATKPLPCDPSSLPKYPPSKEFDAKMRDEEARRQGAGGSRAHRGDPEK  493

Query  1155  -------ATPAPGDLAKLQDAIKKWQGQ  1093
                    A PAP   A+L  +++K Q Q
Sbjct  494   KGTRESRAIPAPDANAELVVSMQKRQAQ  521


 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 51/83 (61%), Gaps = 1/83 (1%)
 Frame = -2

Query  846  SDHHYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARL  667
            S H  ++     +   ++GY  +   IHYSGPLI   GN+D+MLK+H++QIQ AVR+AR+
Sbjct  660  SSHQNEDGRSSNKDPVLLGYGSKGNKIHYSGPLIVPSGNMDQMLKDHDRQIQEAVRRARI  719

Query  666  DKTSKAKKGNIDYGQTESLLQYV  598
            DK +K +K   +  Q  +   +V
Sbjct  720  DK-AKLRKMQAEGNQVSNTSLFV  741



>emb|CDY20686.1| BnaC08g13720D [Brassica napus]
Length=657

 Score =   143 bits (360),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 113/294 (38%), Positives = 155/294 (53%), Gaps = 33/294 (11%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +AT+FKP++ Y+R +AETFK L  S+L L++ LL++EP  
Sbjct  370   KIFKLCGSPSEEYWKGSKLPHATVFKPQQPYKRCVAETFKSLPSSALELVEVLLAVEPHA  429

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKD-----  1165
             RGT + AL++EFFTT P   DPS+LPKY P KE D +++ E  RR+ G+  K  +     
Sbjct  430   RGTTALALKSEFFTTKPFASDPSSLPKYQPRKELDVKLQKEEARRKKGTISKENEMKQVA  489

Query  1164  -SEGATPAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDN--------SRRLGGS------  1030
                 A PAP   A+L  +I+K QG+        MSE  N        S  + GS      
Sbjct  490   RESKAEPAPDANAELVASIQKRQGE---NNQTSMSEKFNPNDDTALKSVMVRGSSRSPPR  546

Query  1029  -ELSRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVID  853
              EL    SF  RG    QL  F +S A   A+            N  W        +   
Sbjct  547   KELRMQRSFVQRGS--AQLTKFSNSVAARDAS-------HFAIANPRWFEDKYNNKKEKQ  597

Query  852   NESDHHYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQ  691
              + D   ++ E   +K+ +         ++ SGPL+ AG N+D M KEHE+QIQ
Sbjct  598   KDGDDCTKDKEYAGKKNILTINCLCYVRMNISGPLVSAGENLDVMFKEHERQIQ  651



>ref|XP_006664429.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Oryza brachyantha]
Length=649

 Score =   142 bits (358),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 120/304 (39%), Positives = 163/304 (54%), Gaps = 27/304 (9%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSP D++ K SK+    +FKP+  Y R +AETFK    S++ L+DSLLSL+PE 
Sbjct  349   KIFKLCGSPMDDYCKKSKVPETAMFKPQHQYRRCVAETFKVFPTSAVVLIDSLLSLDPEA  408

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGTA+SAL+++FF   P  CDPS+LPK PP KEYD R+R E  RRQ  +    + +E   
Sbjct  409   RGTAASALQSDFFKKEPFACDPSSLPKLPPSKEYDVRLRQEEARRQKNAALGGQGAESVR  468

Query  1149  PAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLG--GSELSRHVSFKARGGGVGQL  976
               PG+   + +      G+LK +     S   NS  L    S     V  +AR   V QL
Sbjct  469   --PGNENHVTNRAIADAGELKQQT--HTSSKSNSDDLNPEDSVPGFRVESRARPTTV-QL  523

Query  975   PMFCSSA-------APHPAAIG--------LDLC--REDISVNSHWHRLAMKCNRVIDNE  847
             P  CSSA          P   G         + C  R+  S +S   +      R     
Sbjct  524   PG-CSSAWNNMEGDNDQPTVPGRSCSSVRVANACATRKKGSSHSLIPQFGATDLRSTVEA  582

Query  846   SDHHYQNDEQKPRKDTMM--GYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKA  673
             +DH++  D     K+  +   +  +   IH+SGPL+P GGN+++MLKEHE+ IQ AVRKA
Sbjct  583   ADHNHPPDRDGGNKNPEVKDNHGRKYRRIHHSGPLMPPGGNVEDMLKEHERHIQEAVRKA  642

Query  672   RLDK  661
             R+ K
Sbjct  643   RVGK  646



>ref|XP_008794125.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Phoenix dactylifera]
Length=736

 Score =   143 bits (360),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 109/152 (72%), Gaps = 9/152 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPSDE+W+ SKL +ATIFKP++ Y R +AETFKD   S+L+L+D LLS++P  
Sbjct  359   KIFKLCGSPSDEYWRKSKLPHATIFKPQQPYRRCVAETFKDFPASALALMDVLLSIDPAD  418

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCK--DSEG  1156
             RGT+ SAL++EFFTT PL CDPS+LPKYPP KE+DA+ RDE  RRQ  +G K    D E 
Sbjct  419   RGTSDSALKSEFFTTKPLSCDPSSLPKYPPSKEFDAKRRDEEARRQGAAGGKVHRLDLEK  478

Query  1155  -------ATPAPGDLAKLQDAIKKWQGQLKLK  1081
                    A PAP   A+L  +++K QGQL  K
Sbjct  479   RGLRESRAIPAPDANAELASSLQKRQGQLNTK  510


 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 44/68 (65%), Gaps = 3/68 (4%)
 Frame = -2

Query  840  HHYQNDEQKPRKD--TMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARL  667
            +H + DE+    D  T   Y P+   IHYSGPL    GNID+MLK+H++QIQ   R+ARL
Sbjct  630  YHRKEDERNSNMDQYTQQSYGPKGNKIHYSGPLPRPSGNIDQMLKDHDRQIQEVFRRARL  689

Query  666  DKTSKAKK  643
            DK SK +K
Sbjct  690  DK-SKVRK  696



>ref|XP_008794126.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Phoenix dactylifera]
Length=735

 Score =   143 bits (360),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 109/152 (72%), Gaps = 9/152 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPSDE+W+ SKL +ATIFKP++ Y R +AETFKD   S+L+L+D LLS++P  
Sbjct  359   KIFKLCGSPSDEYWRKSKLPHATIFKPQQPYRRCVAETFKDFPASALALMDVLLSIDPAD  418

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCK--DSEG  1156
             RGT+ SAL++EFFTT PL CDPS+LPKYPP KE+DA+ RDE  RRQ  +G K    D E 
Sbjct  419   RGTSDSALKSEFFTTKPLSCDPSSLPKYPPSKEFDAKRRDEEARRQGAAGGKVHRLDLEK  478

Query  1155  -------ATPAPGDLAKLQDAIKKWQGQLKLK  1081
                    A PAP   A+L  +++K QGQL  K
Sbjct  479   RGLRESRAIPAPDANAELASSLQKRQGQLNTK  510


 Score = 62.4 bits (150),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 43/67 (64%), Gaps = 2/67 (3%)
 Frame = -2

Query  840  HHYQNDEQKPRKDT-MMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLD  664
            +H + DE+    D     Y P+   IHYSGPL    GNID+MLK+H++QIQ   R+ARLD
Sbjct  630  YHRKEDERNSNMDQYTQSYGPKGNKIHYSGPLPRPSGNIDQMLKDHDRQIQEVFRRARLD  689

Query  663  KTSKAKK  643
            K SK +K
Sbjct  690  K-SKVRK  695



>gb|EYU26381.1| hypothetical protein MIMGU_mgv1a002080mg [Erythranthe guttata]
Length=718

 Score =   142 bits (359),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 107/149 (72%), Gaps = 10/149 (7%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ SKL +ATIFKP++ Y+RR+AETFK+    +L+L++ LL+++P  
Sbjct  347   KIFKLCGSPSEEYWRKSKLPHATIFKPQQPYKRRVAETFKEFPAPALALIEILLAIDPID  406

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSG-----YKCKD  1165
             RG+A+SAL +EFF TTP PCDPS+LPKYPP KE+DA++RDE  RRQ   G     Y   D
Sbjct  407   RGSAASALTSEFFNTTPHPCDPSSLPKYPPSKEFDAKVRDEEARRQAAVGSKGQRYNNPD  466

Query  1164  SEG-----ATPAPGDLAKLQDAIKKWQGQ  1093
               G     A PAP   A+L  +++K  GQ
Sbjct  467   KRGSRESRAVPAPDANAELVSSMQKRHGQ  495


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  768  IHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDK  661
            IHYSGPL+   G +D++LK+H++QIQ AVR+AR+DK
Sbjct  660  IHYSGPLLVPSGKVDQILKDHDRQIQEAVRRARMDK  695



>gb|KDP27060.1| hypothetical protein JCGZ_20995 [Jatropha curcas]
Length=713

 Score =   142 bits (357),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 109/148 (74%), Gaps = 9/148 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ SKL +ATIFKP++ Y R +AETFK+    +L+L+++LLS++P  
Sbjct  344   KIFKLCGSPSEDYWRKSKLPHATIFKPQQPYRRCVAETFKEFPAPALALMETLLSIDPAD  403

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSE---  1159
             RGTA+SAL++EFFT  PLPCDPS+LPKYPP KE+DA+MRDE  RRQ  +G K +  +   
Sbjct  404   RGTAASALKSEFFTIKPLPCDPSSLPKYPPSKEFDAKMRDEEARRQGAAGSKGQRPDIER  463

Query  1158  ------GATPAPGDLAKLQDAIKKWQGQ  1093
                    A PAP   A+L  +++K QGQ
Sbjct  464   KGMRESRAVPAPDANAELVLSMQKRQGQ  491


 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = -2

Query  801  TMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQ  622
             ++GY  +   IHYSGPL+   GN+D+MLK+H++QIQ AVR+AR+DK +K +K  ++  Q
Sbjct  644  ILVGYGSKGHKIHYSGPLLLPSGNVDQMLKDHDRQIQEAVRRARIDK-AKVRKVQVEGNQ  702

Query  621  TESLLQYV  598
              +   +V
Sbjct  703  ISTNSIFV  710



>ref|XP_004151412.1| PREDICTED: uncharacterized protein LOC101214435 [Cucumis sativus]
 gb|KGN50770.1| hypothetical protein Csa_5G247650 [Cucumis sativus]
Length=309

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 112/308 (36%), Positives = 149/308 (48%), Gaps = 76/308 (25%)
 Frame = -2

Query  1308  LENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEM---------LRRQNGSGYKCKDSEG  1156
             L  +FFTT PLP DPS LPKYPPCKE+D ++RDE          + R++ +  K      
Sbjct  11    LRTKFFTTKPLPSDPSDLPKYPPCKEFDVKLRDEEARRRRAPINVAREHEAARKFPRESK  70

Query  1155  ATPAPGDLAKLQDAIKKWQGQ----------------------------LKLKKCGGMSE  1060
             A PAP   A+LQ +I+K Q Q                             +++  G  S 
Sbjct  71    AIPAPHANAELQASIQKKQAQQNSTSVSEKYSHEEDGGSGFCIEPRKETTQMQPTGLGSS  130

Query  1059  VDNSRRLG-----------GSELSRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCRE  913
              + +  LG           G+EL +  SF   G   GQL  + +S A    +   D C  
Sbjct  131   QNLNGNLGDNQRGSSVGAKGAELRKQRSFIQHG--AGQLSRYSNSVAVRGGSR-FD-CGG  186

Query  912   DISVNSHWHRLAMKCNRVIDNE------SDHH-------------YQNDEQKPRKDTMMG  790
             + S NSHW     +C  V  N       S+ H             Y+ DEQ   K++   
Sbjct  187   ESSANSHW---PEECFNVSYNHFNGGESSEKHEWSRHLLGRPKSSYKMDEQSSGKESTTC  243

Query  789   YVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQTESL  610
             Y P+   IHYSGPL+P GGN++EMLKEHEKQIQ+AVRKAR+DK +K KK   D GQ E+L
Sbjct  244   YAPKK-RIHYSGPLMPPGGNLEEMLKEHEKQIQHAVRKARIDK-AKTKKTYDDKGQMEAL  301

Query  609   LQYVGNAS  586
             L +V N +
Sbjct  302   LHHVKNGN  309



>ref|XP_009784583.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Nicotiana sylvestris]
Length=712

 Score =   140 bits (354),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 119/372 (32%), Positives = 181/372 (49%), Gaps = 75/372 (20%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ S+L +ATIFKP++ Y R +AETFK+    +L+L+++LLS++P  
Sbjct  345   KIFKLCGSPSEEYWRKSRLPHATIFKPQQPYRRCVAETFKEFPAPALALIETLLSIDPAD  404

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYP-------------------------------  1243
             RG+++SAL++EFFTT PLPCDP +LPKYP                               
Sbjct  405   RGSSASALKSEFFTTKPLPCDPLSLPKYPPSKEFDAKVRDEEARRQAAAGNKGHRYDLER  464

Query  1242  ---------PCKEYDARMRDEMLRRQNGSGYKCKDS-------EGATPAPGDLAKLQDAI  1111
                      P  E +A +   M +RQ  S  K +         E A+  P D  +    +
Sbjct  465   RGTRESRAVPAPEANAELVSSMQKRQGQSNSKSRSEMFNSHQEEVASGFPIDPPRPSQVV  524

Query  1110  KKWQG--QLKLKKCGGMS--------------EVDNSRRLGGSELSRHVSFKARGGGVGQ  979
             ++     Q +L K G  S               ++++ +L  ++LS      A      +
Sbjct  525   EEANNDPQARLHKRGSHSGPLTHRAAWAKAGKNMEDAPKLSVADLSAMSGLVA-----AR  579

Query  978   LPMFCSS----AAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKP  811
               MF       + PH   +   + R   S     H  AMK  +   + +  H   D +  
Sbjct  580   RSMFSEDRPDKSGPHKQEVPKLIARFPGSFKEVSHS-AMKQEQKNHSLASSHQNEDGRTS  638

Query  810   RKD-TMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNI  634
               D  ++GY  +   IHYSGPL+   G +D+MLK+H++ +Q AVR+ARLDK +KAKK  I
Sbjct  639   NNDPVLLGYGSKGNKIHYSGPLLVPSGKMDQMLKDHDRHVQEAVRRARLDK-AKAKKIQI  697

Query  633   DYGQTESLLQYV  598
             +  Q  +   +V
Sbjct  698   EGNQLSANSLFV  709



>emb|CDY15287.1| BnaC06g07730D [Brassica napus]
Length=618

 Score =   140 bits (352),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 115/295 (39%), Positives = 160/295 (54%), Gaps = 33/295 (11%)
 Frame = -2

Query  1506  IFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepERR  1327
             IFKLCGS ++EFW+ +K   AT ++P+  Y+R + ETFK+L  SSL+LLD LLS+EPE R
Sbjct  347   IFKLCGSATEEFWETTKFPQATSYRPQHPYKRVLQETFKNLPSSSLALLDKLLSVEPETR  406

Query  1326  GTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGATP  1147
              +ASS L +EFFTT PLPC  S+LPKYPP KE DA+ R+E  RR+     K +  E A  
Sbjct  407   CSASSTLMSEFFTTEPLPCHISSLPKYPPSKELDAKKRNEEARRKRAEAVKWRGHESARR  466

Query  1146  APGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPMF  967
                D     + +             G S V  +  LG         FK   G       F
Sbjct  467   GLRDSKITPEFL-----------ASGHSNVLINTPLG---------FKKSSG-----KHF  501

Query  966   CSS-AAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDH---HYQNDEQKPRKDT  799
               + +  HP+A      +   S ++     A + N V+    D+     Q +    RK T
Sbjct  502   ADTKSMIHPSAA---WNKNGGSKSNVGEVRASRSNNVLVTMGDYLSSSSQKENVASRKPT  558

Query  798   MMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNI  634
                Y+ +   +H SGPL+P GGNI++M+K+HE+ IQ AVRK+RLDK++  KK +I
Sbjct  559   TT-YMRKKNIMHCSGPLMPPGGNIEDMMKDHERGIQEAVRKSRLDKSAAKKKNDI  612



>ref|XP_011004643.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Populus euphratica]
 ref|XP_011004644.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Populus euphratica]
Length=713

 Score =   140 bits (354),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 108/148 (73%), Gaps = 9/148 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ SKL +ATIFKP++ Y R +AETFK+    +L+L+++LL+++P  
Sbjct  344   KIFKLCGSPSEDYWRKSKLPHATIFKPQQPYRRCVAETFKEFPAPALALMETLLAIDPAD  403

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEG--  1156
             RG+A+SAL NEFFTT PLPCDPS+LP YPP KE+DA+MRDE  RRQ  +G K + S+   
Sbjct  404   RGSAASALRNEFFTTKPLPCDPSSLPDYPPSKEFDAKMRDEEARRQGAAGSKGQKSDMER  463

Query  1155  -------ATPAPGDLAKLQDAIKKWQGQ  1093
                    A PAP   A+L  +++K  G+
Sbjct  464   RGQRESRAVPAPDANAELVLSMQKRHGR  491


 Score = 65.5 bits (158),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -2

Query  801  TMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKT  658
             ++GY  +   IHYSGPLI   GN+D+MLK+H++QIQ AVR+ARLDK 
Sbjct  644  VLLGYGSKAHKIHYSGPLIVPSGNMDQMLKDHDRQIQEAVRRARLDKA  691



>ref|XP_007149459.1| hypothetical protein PHAVU_005G071900g [Phaseolus vulgaris]
 gb|ESW21453.1| hypothetical protein PHAVU_005G071900g [Phaseolus vulgaris]
Length=708

 Score =   140 bits (353),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 110/148 (74%), Gaps = 9/148 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ SKL +ATIFKP++ Y R ++ETFKD    ++ L+++LLS++P  
Sbjct  343   KIFKLCGSPSEDYWRKSKLPHATIFKPQQPYRRCVSETFKDFPTPAIELIETLLSIDPAD  402

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCK--DSE-  1159
             RGT++SAL +EFF+T PLPCDPS+LPKYPP KE+DA++RDE  RRQ G+G K +  D E 
Sbjct  403   RGTSASALSSEFFSTKPLPCDPSSLPKYPPSKEFDAKVRDEEARRQGGAGVKGQRHDPER  462

Query  1158  ------GATPAPGDLAKLQDAIKKWQGQ  1093
                    A PAP   A+L  +++K QGQ
Sbjct  463   KGTRESRAIPAPDANAELVLSMQKRQGQ  490


 Score = 60.1 bits (144),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -2

Query  801  TMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKT  658
            +++GY  +   IHYSGPL+    N+D+MLK+H++QIQ AVR++RLDK 
Sbjct  640  SLVGYGSKGHKIHYSGPLLVPSSNMDQMLKDHDRQIQEAVRRSRLDKA  687



>gb|KHN36823.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=580

 Score =   139 bits (349),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 107/148 (72%), Gaps = 9/148 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ SKL +ATIFKP++ Y R ++ETFK+    ++ L++ LLS++P  
Sbjct  214   KIFKLCGSPSEDYWRKSKLPHATIFKPQQPYRRCVSETFKEFPAPAIELIEILLSIDPAD  273

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSE---  1159
             RGT++SAL +EFF+T PLPCDPS+LPKYPP KE+DA++RDE  RRQ  +G K +  +   
Sbjct  274   RGTSASALNSEFFSTKPLPCDPSSLPKYPPSKEFDAKVRDEEARRQGAAGSKGQRHDIER  333

Query  1158  ------GATPAPGDLAKLQDAIKKWQGQ  1093
                    A PAP   A+L  +I+K QGQ
Sbjct  334   RGARESRAIPAPDANAELVLSIQKRQGQ  361


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  810  RKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKT  658
            +   ++GY  +   IHYSGPL+    N D+MLK+H++QIQ AVR+ARLDK 
Sbjct  509  KDSNLVGYGSKGHKIHYSGPLLVPSSNHDQMLKDHDRQIQEAVRRARLDKA  559



>ref|XP_010535099.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Tarenaya hassleriana]
 ref|XP_010535100.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Tarenaya hassleriana]
Length=677

 Score =   139 bits (351),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 106/143 (74%), Gaps = 8/143 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPSD++W+ SKL +ATIFKP++ Y R ++ETFK+    +LSLL++LLS+ P+ 
Sbjct  344   KIFKLCGSPSDDYWRKSKLPHATIFKPQQPYRRVVSETFKEFPEPALSLLETLLSVNPDD  403

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSG---YKCKDSE  1159
             RGTA+SAL++EFFTT P PCDPS+LPKY PCKE DARMRDE  RRQ   G   +K ++  
Sbjct  404   RGTAASALQSEFFTTKPFPCDPSSLPKYHPCKELDARMRDEEARRQAAGGNKDHKQQERR  463

Query  1158  G-----ATPAPGDLAKLQDAIKK  1105
             G     A PAP   A+L  +++K
Sbjct  464   GMKESRAVPAPDANAELAASMQK  486


 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 43/65 (66%), Gaps = 3/65 (5%)
 Frame = -2

Query  852  NESDHHYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKA  673
            N+ D    N ++ P    ++GY  +   IHYSGPL+   GN+++MLK+H++ IQ AVR+A
Sbjct  595  NQRDEGRSNKKKDP---ILLGYGSKGHKIHYSGPLVVPSGNMEQMLKDHDRHIQEAVRRA  651

Query  672  RLDKT  658
            R+DK 
Sbjct  652  RIDKA  656



>ref|XP_006590470.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Glycine max]
Length=623

 Score =   139 bits (349),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 102/283 (36%), Positives = 161/283 (57%), Gaps = 24/283 (8%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ +KL +AT FKP+  Y R+++ETFK+ SP++L+L+D LL++EPE 
Sbjct  358   KIFKLCGSPSEDYWQRTKLPHATSFKPQHPYNRQVSETFKNFSPTALALVDMLLTIEPED  417

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RG+A+SALE++FFTT PLPC+PS+LPK+ P KE+D++ R++   R+N    K +      
Sbjct  418   RGSATSALESQFFTTNPLPCNPSSLPKFSPTKEFDSKRREKEATRKNAESIKGRGPASVY  477

Query  1149  PAPGDLAKLQDAIKKWQGQLKL--KKCGGMSEVDN-SRRLGGSELSRHVSFKARGGGVGQ  979
                 D   +       +G + +  K    MS V + S   GGS  +   +  +      Q
Sbjct  478   RGAADTKVMGSPKYIARGDISMRGKSNTRMSHVKHQSEEDGGSNDNGEATMISLHNAYTQ  537

Query  978   LPMFCSSAAPHPAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKPRKDT  799
             +     S+   P+++     R++  + +H H  A      +  E             ++ 
Sbjct  538   M----QSSMAGPSSL-----RKNSELPTH-HAAAEFSTSSVKKEPGMSV--------REP  579

Query  798   MMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKAR  670
              +GY+P+   IH SGPL   GGNID+MLKEHE+ +Q+  R  +
Sbjct  580   GVGYMPKKNRIHCSGPL---GGNIDDMLKEHERLMQDVFRSVK  619



>ref|XP_010694982.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=743

 Score =   140 bits (352),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 105/144 (73%), Gaps = 9/144 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ SKL +ATIFKP++ Y RR+AETFKD    +L LL++LLS++P  
Sbjct  374   KIFKLCGSPSEEYWRKSKLPHATIFKPQQPYIRRVAETFKDFPAPALGLLETLLSIDPAD  433

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCK--DSEG  1156
             RG+ASSAL+NEFF T PLPCDPS+LPKYPP KE+DA+MRDE  RRQ   G +    D E 
Sbjct  434   RGSASSALKNEFFATKPLPCDPSSLPKYPPSKEFDAKMRDEEARRQGAGGSRAHRGDPEK  493

Query  1155  -------ATPAPGDLAKLQDAIKK  1105
                    A PAP   A+L  ++++
Sbjct  494   KGTRESRAIPAPDANAELVVSMQR  517


 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 51/83 (61%), Gaps = 1/83 (1%)
 Frame = -2

Query  846  SDHHYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARL  667
            S H  ++     +   ++GY  +   IHYSGPLI   GN+D+MLK+H++QIQ AVR+AR+
Sbjct  659  SSHQNEDGRSSNKDPVLLGYGSKGNKIHYSGPLIVPSGNMDQMLKDHDRQIQEAVRRARI  718

Query  666  DKTSKAKKGNIDYGQTESLLQYV  598
            DK +K +K   +  Q  +   +V
Sbjct  719  DK-AKLRKMQAEGNQVSNTSLFV  740



>ref|XP_010925563.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Elaeis guineensis]
Length=736

 Score =   140 bits (352),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 108/148 (73%), Gaps = 9/148 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPSDE+W+ SKL +ATIFKP++ Y R +AETFKD  PS+L+L+D LLS++P  
Sbjct  359   KIFKLCGSPSDEYWRKSKLPHATIFKPQQPYRRCVAETFKDFPPSALALMDVLLSIDPAD  418

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCK--DSEG  1156
             RGTA+SAL+NEFF+  PL CDPS+LPKYPP KE+DA+ RDE  RRQ  +G K    D E 
Sbjct  419   RGTAASALKNEFFSMKPLACDPSSLPKYPPSKEFDAKRRDEEARRQGAAGGKVHRLDLEK  478

Query  1155  -------ATPAPGDLAKLQDAIKKWQGQ  1093
                    A PAP   A+L  +++K QGQ
Sbjct  479   RGLRESRAIPAPDANAELASSLQKRQGQ  506


 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 3/76 (4%)
 Frame = -2

Query  840  HHYQNDEQKPRKDTMM--GYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARL  667
            +H + DE+    D  +   Y P+   IHYSGPL+   GN D+MLK+H++QIQ   R+ARL
Sbjct  630  YHGKEDERNSNMDQYIQQSYGPKGTKIHYSGPLLRPSGNFDQMLKDHDRQIQEVFRRARL  689

Query  666  DKTSKAKKGNIDYGQT  619
            DK SKA+K   D  Q 
Sbjct  690  DK-SKARKVQGDGNQI  704



>ref|XP_007021485.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOY13010.1| Kinase superfamily protein [Theobroma cacao]
Length=707

 Score =   139 bits (351),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 110/148 (74%), Gaps = 9/148 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ SKL +ATIFKP++ Y R +AETFK+    +L+L+++LLS++P  
Sbjct  344   KIFKLCGSPSEDYWRKSKLPHATIFKPQQPYRRCVAETFKEFPAPALALMETLLSIDPAD  403

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCK----DS  1162
             RG+A+SAL++EFF   PLPCDPS+LPKYPP KE+DA++RDE +RRQ  +G K +    D 
Sbjct  404   RGSATSALKSEFFIVKPLPCDPSSLPKYPPSKEFDAKIRDEEVRRQGAAGSKGQRPDLDR  463

Query  1161  EG-----ATPAPGDLAKLQDAIKKWQGQ  1093
              G     A PAP   A+L  +++K QGQ
Sbjct  464   RGTRESRAIPAPDANAELVLSMQKRQGQ  491


 Score = 65.1 bits (157),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 54/90 (60%), Gaps = 4/90 (4%)
 Frame = -2

Query  858  IDNESDHHYQNDE---QKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQN  688
            I  +  H+ Q  E      +   ++GY  +   IHYSGPLI   GN+D++LK+H++QIQ 
Sbjct  616  IQQDQKHNLQQKEDGRSNSKDPVLLGYGSKGHKIHYSGPLIVPSGNMDQVLKDHDRQIQE  675

Query  687  AVRKARLDKTSKAKKGNIDYGQTESLLQYV  598
            AVR+ARLDK +K +K  ++  Q  +   +V
Sbjct  676  AVRRARLDK-AKMRKVQLEGNQISTNSLFV  704



>ref|XP_006392837.1| hypothetical protein EUTSA_v10011275mg [Eutrema salsugineum]
 gb|ESQ30123.1| hypothetical protein EUTSA_v10011275mg [Eutrema salsugineum]
Length=700

 Score =   139 bits (351),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 111/336 (33%), Positives = 167/336 (50%), Gaps = 63/336 (19%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W  S+L +ATIFKP + Y+R + ETFK+    +L+LL++LLS+ P+ 
Sbjct  348   KIFKLCGSPSEDYWVKSRLPHATIFKPTQPYKRVVDETFKEFPQPALALLETLLSVNPDD  407

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYD-------------------------  1225
             RGTA+SAL++EFF+T PLPCDP +LPKYPP KE D                         
Sbjct  408   RGTANSALQSEFFSTRPLPCDPLSLPKYPPSKELDARMRDEESRRQVGGNRDHQRHQERR  467

Query  1224  --------------ARMRDEMLRRQNGSGYKCKDSEGATPAPGDLA------------KL  1123
                           A +   M +RQ+ S  + + SE   P P ++A            + 
Sbjct  468   GTKESRAIPAPDANAELVSSMQKRQSQSTNRSR-SEKFNPHPEEVASGFPIDPPRPSSQA  526

Query  1122  QDAIKKWQGQLKLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPMFCSS-AAPH  946
              +  ++ QG + +           SRR   ++  RH           Q P   SS AA +
Sbjct  527   FEPNRESQGNIIIPHKRASHSGPLSRRSASAKGRRHYQ---------QDPQKVSSVAADY  577

Query  945   PAAIGLDLCREDISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKPRKD-TMMGYVPQTGH  769
              A  G    R   S       +        +   + + + + +  +KD  ++GY  +   
Sbjct  578   SAMPGFAATRTGASQQETCRGMTRLPGSFKETSDETNQEENGRSNKKDPILLGYGSKGHK  637

Query  768   IHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDK  661
             IHYSGPL+   GN+D++LK+H++ IQ AVR+AR+DK
Sbjct  638   IHYSGPLVVPSGNMDQVLKDHDRHIQEAVRRARIDK  673



>ref|XP_006348252.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006348253.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X2 [Solanum tuberosum]
Length=705

 Score =   139 bits (351),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 111/149 (74%), Gaps = 11/149 (7%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ S+L +ATIFKP++ Y R +AETFK+    +L+L+++LLS++P  
Sbjct  337   KIFKLCGSPSEEYWRKSRLPHATIFKPQQPYRRCVAETFKEFPAPALALIETLLSIDPVD  396

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYK--------  1174
             RG+++SAL++EFFTT PLPCDPS+LPKYPP KE+DA++RDE  RRQ  +G K        
Sbjct  397   RGSSASALKSEFFTTKPLPCDPSSLPKYPPSKEFDAKVRDEEARRQAAAGGKGHRYDPER  456

Query  1173  --CKDSEGATPAPGDLAKLQDAIKKWQGQ  1093
                ++S  A PAP   A+L  +++K QGQ
Sbjct  457   RGTRESR-AVPAPEANAELVSSMQKRQGQ  484


 Score = 65.1 bits (157),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 48/73 (66%), Gaps = 2/73 (3%)
 Frame = -2

Query  846  SDHHYQNDEQKPRKD-TMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKAR  670
            S HH   D +    D  ++GY  +   IHYSGPL+   G +D++LK+H++ IQ AVR+AR
Sbjct  620  SSHHQNEDGRTSNNDPVLLGYGSKGNKIHYSGPLLVPSGKMDQVLKDHDRHIQEAVRRAR  679

Query  669  LDKTSKAKKGNID  631
            LDK +KAKK  ++
Sbjct  680  LDK-AKAKKIQVE  691



>ref|XP_002533553.1| Cell division protein kinase, putative [Ricinus communis]
 gb|EEF28833.1| Cell division protein kinase, putative [Ricinus communis]
Length=649

 Score =   139 bits (349),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 108/148 (73%), Gaps = 9/148 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ SKL +ATIFKP++ Y R +AETFK+    +L+L+++LL+++P  
Sbjct  345   KIFKLCGSPSEDYWRKSKLPHATIFKPQQPYRRCVAETFKEFPAPALALMETLLAIDPAD  404

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSE---  1159
             RGTA+SAL++EFF T PLPCDPS+LPKYPP KE+DA+MRDE  RRQ   G + +  +   
Sbjct  405   RGTAASALKSEFFATKPLPCDPSSLPKYPPSKEFDAKMRDEEARRQGPGGSRGQRPDIER  464

Query  1158  ------GATPAPGDLAKLQDAIKKWQGQ  1093
                    A PAP   A+L  +++K QGQ
Sbjct  465   RGTRESRAIPAPDANAELVLSMQKRQGQ  492



>emb|CDP05922.1| unnamed protein product [Coffea canephora]
Length=617

 Score =   138 bits (347),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 110/148 (74%), Gaps = 9/148 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ SKL +ATIFKP++ Y+R +A+TFKD    +L+L++ LLS++P  
Sbjct  249   KIFKLCGSPSEEYWRKSKLPHATIFKPQQPYKRCVADTFKDFPAPALALMEVLLSIDPAD  308

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKC----KDS  1162
             RG+ASSAL++EFF T PLPCDPS+LPKYPP KE+DA++RDE  RR   +G K     ++ 
Sbjct  309   RGSASSALQSEFFITKPLPCDPSSLPKYPPSKEFDAKVRDEEARRHAAAGSKGHRYDQER  368

Query  1161  EG-----ATPAPGDLAKLQDAIKKWQGQ  1093
             +G     A PAP   A+L  +++K QGQ
Sbjct  369   KGTRESRAVPAPDANAELVLSMQKRQGQ  396


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 49/73 (67%), Gaps = 3/73 (4%)
 Frame = -2

Query  834  YQNDEQKPRKD--TMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDK  661
            YQN++ +   +   ++GY  +   IHYSGP+I   G +D+M+K+H++Q+Q AVR+ARLDK
Sbjct  535  YQNEDGRTSNNDPVLIGYGSKGNKIHYSGPIIVPSGKMDQMMKDHDRQVQEAVRRARLDK  594

Query  660  TSKAKKGNIDYGQ  622
             +K +K   D  Q
Sbjct  595  -AKLRKSQADGNQ  606



>ref|XP_003596750.1| Serine/threonine protein kinase cdk9 [Medicago truncatula]
 gb|AES67001.1| cyclin-dependent kinase [Medicago truncatula]
Length=712

 Score =   138 bits (348),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 109/148 (74%), Gaps = 9/148 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ SKL +ATIFKP++ Y R +AETFK+    ++ L+++LLS++P  
Sbjct  346   KIFKLCGSPSEDYWRKSKLPHATIFKPQQPYRRCVAETFKEFPAPAIELIETLLSIDPAD  405

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCK--DSE-  1159
             RGT++SAL +EFF+T PLPCDPS+LPKYPP KE+DA++RDE  RRQ  +G K +  D E 
Sbjct  406   RGTSASALISEFFSTKPLPCDPSSLPKYPPSKEFDAKVRDEEARRQGAAGSKGQRHDPER  465

Query  1158  ------GATPAPGDLAKLQDAIKKWQGQ  1093
                    A PAP   A+L  +++K QGQ
Sbjct  466   RGVRESRAVPAPDANAELVVSMQKRQGQ  493


 Score = 59.3 bits (142),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -2

Query  795  MGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKT  658
            +GY  +   IHYSGPL+    N+D+MLK+H++QIQ AVR+ARLDK 
Sbjct  646  VGYGSKGYKIHYSGPLLVPSSNMDQMLKDHDRQIQEAVRRARLDKA  691



>ref|XP_003527250.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X1 [Glycine max]
Length=710

 Score =   138 bits (348),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 111/152 (73%), Gaps = 9/152 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ SKL +ATIFKP++ Y R +A+TFKD +  +L+L+++LLS++P  
Sbjct  346   KIFKLCGSPSEDYWRKSKLPHATIFKPQQPYRRCVADTFKDFAAPALALMETLLSIDPAD  405

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSE---  1159
             RGTA+SAL++EFFTT PLPCDPS+LPKYPP KE DA++RDE  RRQ  +G K +  +   
Sbjct  406   RGTAASALKSEFFTTKPLPCDPSSLPKYPPSKELDAKLRDEQARRQGATGSKGQRHDLER  465

Query  1158  ------GATPAPGDLAKLQDAIKKWQGQLKLK  1081
                    A PAP   A+L  +++K Q Q + K
Sbjct  466   RGARESRAVPAPDANAELPLSMQKRQSQAQSK  497


 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 2/48 (4%)
 Frame = -2

Query  801  TMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKT  658
             ++GY  +   IHYSGPL     N+D++LK+H++QIQ AVR+ARLDK 
Sbjct  644  VLVGYGSKGHKIHYSGPL--TSSNMDQVLKDHDRQIQEAVRRARLDKA  689



>ref|XP_003543242.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X1 [Glycine max]
 ref|XP_006594767.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X2 [Glycine max]
Length=712

 Score =   138 bits (347),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 107/148 (72%), Gaps = 9/148 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ SKL +ATIFKP++ Y R ++ETFK+    ++ L++ LLS++P  
Sbjct  346   KIFKLCGSPSEDYWRKSKLPHATIFKPQQPYRRCVSETFKEFPAPAIELIEILLSIDPAD  405

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSE---  1159
             RGT++SAL +EFF+T PLPCDPS+LPKYPP KE+DA++RDE  RRQ  +G K +  +   
Sbjct  406   RGTSASALNSEFFSTKPLPCDPSSLPKYPPSKEFDAKVRDEEARRQGAAGSKGQRHDIER  465

Query  1158  ------GATPAPGDLAKLQDAIKKWQGQ  1093
                    A PAP   A+L  +I+K QGQ
Sbjct  466   RGARESRAIPAPDANAELVLSIQKRQGQ  493


 Score = 58.5 bits (140),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = -2

Query  801  TMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKT  658
             ++GY  +   IHYSGPL+    N D+MLK+H++QIQ AVR+ARLDK 
Sbjct  644  NLVGYGSKGHKIHYSGPLLVPSSNHDQMLKDHDRQIQEAVRRARLDKA  691



>ref|XP_009804117.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Nicotiana sylvestris]
Length=566

 Score =   136 bits (343),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 104/150 (69%), Gaps = 12/150 (8%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPSDE+WK  KL NAT+FKP++ Y+R IA+TFKD   SS  L+++LL+++P+ 
Sbjct  303   KIFKLCGSPSDEYWKKFKLPNATLFKPQQPYKRCIADTFKDFPSSSHPLVETLLAIDPDE  362

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEG--  1156
             RGTA++AL +EFFTT P PC+PS+LPKYPP KE D ++RDE  RRQ G   K +  +G  
Sbjct  363   RGTATAALNSEFFTTEPYPCEPSSLPKYPPSKEMDVKLRDEAARRQRGLHGKSQAVDGTR  422

Query  1155  ----------ATPAPGDLAKLQDAIKKWQG  1096
                       A PAP   A+LQ  + +W+ 
Sbjct  423   KVRIRERASRAIPAPEANAELQPNLDRWRA  452



>ref|XP_011098308.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Sesamum indicum]
 ref|XP_011098309.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Sesamum indicum]
Length=708

 Score =   138 bits (347),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 110/148 (74%), Gaps = 9/148 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ SKL +ATIFKP++ Y+RR+AETFKD    +L+L++ LLS++P  
Sbjct  346   KIFKLCGSPSEEYWRKSKLPHATIFKPQQPYKRRVAETFKDFPAPALALIEILLSIDPAD  405

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSE---  1159
             RG+A+ AL++EFF+T P PC+PS+LPKYPP KE+DA++RDE  RRQ  +G K + ++   
Sbjct  406   RGSAALALKSEFFSTKPHPCEPSSLPKYPPSKEFDAKVRDEEARRQVAAGSKGQRNDLEK  465

Query  1158  ------GATPAPGDLAKLQDAIKKWQGQ  1093
                    A PAP   A+L  +++K QGQ
Sbjct  466   RGSRESRAVPAPDANAELISSMQKRQGQ  493


 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -2

Query  855  DNESDHHYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRK  676
            D++ ++  Q DE+      ++G   +   IHYSGPL+   G +D+MLK+H++QIQ AVR+
Sbjct  621  DHQKNNGLQEDEKGNNNPVLVGRGSKGNKIHYSGPLLVPSGKVDQMLKDHDRQIQEAVRR  680

Query  675  ARLDK  661
            ARLDK
Sbjct  681  ARLDK  685



>ref|XP_006451848.1| hypothetical protein CICLE_v10007617mg [Citrus clementina]
 ref|XP_006451849.1| hypothetical protein CICLE_v10007617mg [Citrus clementina]
 ref|XP_006451850.1| hypothetical protein CICLE_v10007617mg [Citrus clementina]
 gb|ESR65088.1| hypothetical protein CICLE_v10007617mg [Citrus clementina]
 gb|ESR65089.1| hypothetical protein CICLE_v10007617mg [Citrus clementina]
 gb|ESR65090.1| hypothetical protein CICLE_v10007617mg [Citrus clementina]
Length=709

 Score =   138 bits (347),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 109/150 (73%), Gaps = 7/150 (5%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ SKL +ATIFKP++ Y+R +AETFKD    +L+L+++LLS++P  
Sbjct  344   KIFKLCGSPSEDYWRKSKLPHATIFKPQQPYKRCVAETFKDFPAPALALMETLLSIDPAD  403

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSE---  1159
             RG+A+SAL +EFFT  PLPCDPS+LPKYPP KE+DA++RDE  RRQ GS  +  D E   
Sbjct  404   RGSAASALRSEFFTMKPLPCDPSSLPKYPPSKEFDAKIRDEEARRQGGSKGQRMDLERRG  463

Query  1158  ----GATPAPGDLAKLQDAIKKWQGQLKLK  1081
                  A PAP   A+L  +++K Q Q   K
Sbjct  464   TRESRAIPAPDANAELVLSMQKRQSQYNSK  493


 Score = 66.2 bits (160),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 53/80 (66%), Gaps = 4/80 (5%)
 Frame = -2

Query  837  HYQNDEQKPRKD-TMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDK  661
            H + D +   KD  ++GY  +   IHYSGPLI   GN+D+MLK+H++QIQ AVR+AR+DK
Sbjct  627  HQKEDGRIGNKDPILLGYGSKGHKIHYSGPLIVPSGNVDQMLKDHDRQIQEAVRRARVDK  686

Query  660  TSKAKKGNIDYGQ--TESLL  607
             +K +K  ++  Q  T SL 
Sbjct  687  -AKVRKVQMEGNQLSTNSLF  705



>ref|XP_002316895.2| hypothetical protein POPTR_0011s12010g [Populus trichocarpa]
 gb|EEE97507.2| hypothetical protein POPTR_0011s12010g [Populus trichocarpa]
Length=631

 Score =   137 bits (345),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 108/148 (73%), Gaps = 9/148 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ SKL +ATIFKP++ Y R +A+TFK+  P +L+L+++LLS++P  
Sbjct  262   KIFKLCGSPSEDYWRKSKLPHATIFKPQQPYRRCVADTFKEFPPPALALMETLLSIDPAD  321

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEG--  1156
             RG+A+SAL +EFF T PLPCDPS+ PKYPP KE+DA+MRDE  RRQ  +G K + S+   
Sbjct  322   RGSAASALRSEFFITKPLPCDPSSFPKYPPSKEFDAKMRDEEARRQGAAGSKGQKSDMER  381

Query  1155  -------ATPAPGDLAKLQDAIKKWQGQ  1093
                    A PAP   A+L  +++K  GQ
Sbjct  382   RGRRESRAVPAPDANAELVLSMQKRHGQ  409


 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 51/81 (63%), Gaps = 2/81 (2%)
 Frame = -2

Query  837  HYQNDEQKPRKD-TMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDK  661
            H + D +   KD  ++GY  +   IHYSGPLI   GN+D+MLK+H++QIQ AVR+ARLDK
Sbjct  549  HQKEDGRNSSKDPVLLGYGSKGHKIHYSGPLIVPSGNVDQMLKDHDRQIQEAVRRARLDK  608

Query  660  TSKAKKGNIDYGQTESLLQYV  598
              K +K   +  Q  +   +V
Sbjct  609  -EKVRKVQAESNQISTNSLFV  628



>ref|XP_006464753.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Citrus sinensis]
 gb|KDO62493.1| hypothetical protein CISIN_1g004999mg [Citrus sinensis]
 gb|KDO62494.1| hypothetical protein CISIN_1g004999mg [Citrus sinensis]
Length=709

 Score =   138 bits (347),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 109/150 (73%), Gaps = 7/150 (5%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ SKL +ATIFKP++ Y+R +AETFKD    +L+L+++LLS++P  
Sbjct  344   KIFKLCGSPSEDYWRKSKLPHATIFKPQQPYKRCVAETFKDFPAPALALMETLLSIDPAD  403

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSE---  1159
             RG+A+SAL +EFFT  PLPCDPS+LPKYPP KE+DA++RDE  RRQ GS  +  D E   
Sbjct  404   RGSAASALRSEFFTMKPLPCDPSSLPKYPPSKEFDAKIRDEEARRQGGSKGQRMDLERRG  463

Query  1158  ----GATPAPGDLAKLQDAIKKWQGQLKLK  1081
                  A PAP   A+L  +++K Q Q   K
Sbjct  464   TRESRAIPAPDANAELVLSMQKRQSQYNSK  493


 Score = 65.9 bits (159),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 52/80 (65%), Gaps = 4/80 (5%)
 Frame = -2

Query  837  HYQNDEQKPRKD-TMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDK  661
            H + D +   KD  ++GY  +   IHYSGPLI   GN+D+MLK+H++QIQ AVR+AR DK
Sbjct  627  HQKEDGRIGNKDPILLGYGSKGHKIHYSGPLIVPSGNVDQMLKDHDRQIQEAVRRARFDK  686

Query  660  TSKAKKGNIDYGQ--TESLL  607
             +K +K  ++  Q  T SL 
Sbjct  687  -AKVRKVQMEGNQLSTNSLF  705



>ref|XP_008791720.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Phoenix dactylifera]
Length=737

 Score =   138 bits (347),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 108/152 (71%), Gaps = 9/152 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPSDE+W+ SKL +ATIFKP++ Y R + ETFKD  PS+L+L+D LLS++P  
Sbjct  354   KIFKLCGSPSDEYWRKSKLPHATIFKPQQPYRRCVPETFKDFPPSALALIDVLLSIDPAD  413

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCK--DSEG  1156
             RGTASSAL++EFFTT PL CDPS LPKYPP KE+DA+ RDE  RRQ  +G K    D E 
Sbjct  414   RGTASSALKSEFFTTKPLACDPSCLPKYPPSKEFDAKRRDEEARRQGAAGGKVHRLDLEK  473

Query  1155  -------ATPAPGDLAKLQDAIKKWQGQLKLK  1081
                    A PAP   A+L  +++K Q Q  +K
Sbjct  474   RGLRESRAIPAPDANAELATSLQKKQSQSNIK  505


 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = -2

Query  768  IHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKK  643
            IHYSGPL+   GN+D+MLK+H++QIQ   R+ARLDK SK +K
Sbjct  657  IHYSGPLLRPSGNVDQMLKDHDRQIQEVFRRARLDK-SKVRK  697



>ref|XP_008791729.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Phoenix dactylifera]
Length=736

 Score =   138 bits (347),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 108/152 (71%), Gaps = 9/152 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPSDE+W+ SKL +ATIFKP++ Y R + ETFKD  PS+L+L+D LLS++P  
Sbjct  354   KIFKLCGSPSDEYWRKSKLPHATIFKPQQPYRRCVPETFKDFPPSALALIDVLLSIDPAD  413

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCK--DSEG  1156
             RGTASSAL++EFFTT PL CDPS LPKYPP KE+DA+ RDE  RRQ  +G K    D E 
Sbjct  414   RGTASSALKSEFFTTKPLACDPSCLPKYPPSKEFDAKRRDEEARRQGAAGGKVHRLDLEK  473

Query  1155  -------ATPAPGDLAKLQDAIKKWQGQLKLK  1081
                    A PAP   A+L  +++K Q Q  +K
Sbjct  474   RGLRESRAIPAPDANAELATSLQKKQSQSNIK  505


 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = -2

Query  768  IHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKK  643
            IHYSGPL+   GN+D+MLK+H++QIQ   R+ARLDK SK +K
Sbjct  656  IHYSGPLLRPSGNVDQMLKDHDRQIQEVFRRARLDK-SKVRK  696



>ref|XP_008339473.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Malus domestica]
Length=645

 Score =   137 bits (345),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 106/139 (76%), Gaps = 4/139 (3%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+WK SKL +ATIFKP   Y+R +AETFKD   S+L+LL+ LL +EPE 
Sbjct  348   KIFKLCGSPSEEYWKRSKLPHATIFKPTHPYKRCVAETFKDFPXSTLALLEVLLDVEPEG  407

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGTASSAL++EFFT+ PLPCDPS+LPKYPP KE+DA++RDE  RR+  +G K   S+ + 
Sbjct  408   RGTASSALQSEFFTSLPLPCDPSSLPKYPPSKEFDAKLRDEEARRRKAAGGKGGSSKDSK  467

Query  1149  PAPGDLAKLQDAIKKWQGQ  1093
               P   A   +AI++ QGQ
Sbjct  468   VVPASDA---NAIQR-QGQ  482



>gb|KDO62492.1| hypothetical protein CISIN_1g004999mg [Citrus sinensis]
Length=720

 Score =   137 bits (346),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 109/150 (73%), Gaps = 7/150 (5%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ SKL +ATIFKP++ Y+R +AETFKD    +L+L+++LLS++P  
Sbjct  355   KIFKLCGSPSEDYWRKSKLPHATIFKPQQPYKRCVAETFKDFPAPALALMETLLSIDPAD  414

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSE---  1159
             RG+A+SAL +EFFT  PLPCDPS+LPKYPP KE+DA++RDE  RRQ GS  +  D E   
Sbjct  415   RGSAASALRSEFFTMKPLPCDPSSLPKYPPSKEFDAKIRDEEARRQGGSKGQRMDLERRG  474

Query  1158  ----GATPAPGDLAKLQDAIKKWQGQLKLK  1081
                  A PAP   A+L  +++K Q Q   K
Sbjct  475   TRESRAIPAPDANAELVLSMQKRQSQYNSK  504


 Score = 65.9 bits (159),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 52/80 (65%), Gaps = 4/80 (5%)
 Frame = -2

Query  837  HYQNDEQKPRKD-TMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDK  661
            H + D +   KD  ++GY  +   IHYSGPLI   GN+D+MLK+H++QIQ AVR+AR DK
Sbjct  638  HQKEDGRIGNKDPILLGYGSKGHKIHYSGPLIVPSGNVDQMLKDHDRQIQEAVRRARFDK  697

Query  660  TSKAKKGNIDYGQ--TESLL  607
             +K +K  ++  Q  T SL 
Sbjct  698  -AKVRKVQMEGNQLSTNSLF  716



>ref|XP_010060566.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Eucalyptus grandis]
 ref|XP_010060567.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Eucalyptus grandis]
 gb|KCW67346.1| hypothetical protein EUGRSUZ_F01130 [Eucalyptus grandis]
 gb|KCW67347.1| hypothetical protein EUGRSUZ_F01130 [Eucalyptus grandis]
Length=713

 Score =   137 bits (346),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 109/148 (74%), Gaps = 9/148 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ SKL +ATIFKP++ Y R +AETFKD    +L L++ LLS++P  
Sbjct  345   KIFKLCGSPSEDYWRKSKLPHATIFKPQQPYRRCVAETFKDFPEPALDLVEKLLSIDPAD  404

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCK--DSE-  1159
             RG+A+SAL+++FFTTTPLPCDPS+LPKYPP KE+DA++RDE  RRQ  +G + +  D E 
Sbjct  405   RGSAASALKSQFFTTTPLPCDPSSLPKYPPSKEFDAKIRDEEARRQGAAGNRGQRLDHER  464

Query  1158  ------GATPAPGDLAKLQDAIKKWQGQ  1093
                    A PAP   A+L  +++K Q Q
Sbjct  465   RGGRESRAVPAPDANAELVASMQKRQVQ  492


 Score = 63.5 bits (153),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = -2

Query  837  HYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKT  658
            H ++     +   ++GY  +   IHYSGPL+   GN+D+MLK+H++ IQ A R+AR+DK 
Sbjct  632  HKEDGRTSDKDPILLGYGSKGNKIHYSGPLLVPSGNMDQMLKDHDRHIQEASRRARIDK-  690

Query  657  SKAKKGNIDYGQTESLLQYV  598
            +KA+K  +D  Q  +   +V
Sbjct  691  AKARKIQVDGNQILASSLFV  710



>ref|XP_010112974.1| putative serine/threonine-protein kinase [Morus notabilis]
 gb|EXC35133.1| putative serine/threonine-protein kinase [Morus notabilis]
Length=897

 Score =   138 bits (348),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 107/147 (73%), Gaps = 8/147 (5%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ SKL +ATIFKP++ Y R +A+TFK+    +L+L++ LLS++P  
Sbjct  343   KIFKLCGSPSEDYWRKSKLPHATIFKPQQPYRRCVADTFKEFPEPALALMEILLSIDPAD  402

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSE---  1159
             RG+A+SAL +EFFTT PLPCDPS+LPKYPP KE+DA++RDE  RRQ   G K +  +   
Sbjct  403   RGSAASALNSEFFTTKPLPCDPSSLPKYPPSKEFDAKVRDEEARRQGAVGSKGQRVDLER  462

Query  1158  -----GATPAPGDLAKLQDAIKKWQGQ  1093
                   A PAP   A+L  +++K QGQ
Sbjct  463   RTRESRAVPAPDANAELVLSMRKRQGQ  489


 Score = 60.1 bits (144),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 44/83 (53%), Gaps = 4/83 (5%)
 Frame = -2

Query  795  MGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQTE  616
            +GY  +   IHYSGPL+    N+D+MLK+H++Q+Q AVR+ARLDK    K   +      
Sbjct  642  IGYGSKGHKIHYSGPLLVPSSNMDQMLKDHDRQVQEAVRRARLDKAKIRKAQGLFLALFF  701

Query  615  SLLQYVGNAS*LLGFQTRFILNG  547
            S L ++            F  NG
Sbjct  702  SQLLFIFQ----FASSVEFTFNG  720



>ref|XP_009604687.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Nicotiana tomentosiformis]
Length=712

 Score =   137 bits (346),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 110/149 (74%), Gaps = 11/149 (7%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ S+L +ATIFKP++ Y R +AETFK+    +L+L+++LLS++P  
Sbjct  345   KIFKLCGSPSEEYWRKSRLPHATIFKPQQPYRRCVAETFKEFPAPALALIETLLSIDPAD  404

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYK--------  1174
             RG+++SAL++EFFTT PLPCDP +LPKYPP KE+DA++RDE  RRQ  +G K        
Sbjct  405   RGSSASALKSEFFTTKPLPCDPLSLPKYPPSKEFDAKVRDEEARRQAAAGNKGPRYDLER  464

Query  1173  --CKDSEGATPAPGDLAKLQDAIKKWQGQ  1093
                ++S  A PAP   A+L  +++K QGQ
Sbjct  465   RGTRESR-AVPAPEANAELVSSMQKRQGQ  492



>gb|KHN28061.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=708

 Score =   137 bits (346),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 108/148 (73%), Gaps = 9/148 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ SKL +ATIFKP++ Y R ++ETFK+    ++ L+++LLS++P  
Sbjct  343   KIFKLCGSPSEDYWRKSKLPHATIFKPQQPYRRCVSETFKEFPAPAIELIETLLSIDPAD  402

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSE---  1159
             RGT++SAL +EFF+T PLPCDPS+LPKYPP KE+DA++RDE  RRQ  +G K +  +   
Sbjct  403   RGTSASALNSEFFSTKPLPCDPSSLPKYPPSKEFDAKVRDEEARRQGAAGSKGQRHDLER  462

Query  1158  ------GATPAPGDLAKLQDAIKKWQGQ  1093
                    A PAP   A+L  +++K QGQ
Sbjct  463   RGARESRAIPAPDANAELVLSMQKRQGQ  490


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  798  MMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKT  658
            ++GY  +   IH+SGPL+    N D+MLK+H++QIQ  VR+ARLDK 
Sbjct  641  LVGYGSKGHKIHHSGPLLVPSSNHDQMLKDHDRQIQEVVRRARLDKA  687



>ref|XP_003540463.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Glycine max]
Length=708

 Score =   137 bits (346),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 108/148 (73%), Gaps = 9/148 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ SKL +ATIFKP++ Y R ++ETFK+    ++ L+++LLS++P  
Sbjct  343   KIFKLCGSPSEDYWRKSKLPHATIFKPQQPYRRCVSETFKEFPAPAIELIETLLSIDPAD  402

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSE---  1159
             RGT++SAL +EFF+T PLPCDPS+LPKYPP KE+DA++RDE  RRQ  +G K +  +   
Sbjct  403   RGTSASALNSEFFSTKPLPCDPSSLPKYPPSKEFDAKVRDEEARRQGAAGSKGQRHDLER  462

Query  1158  ------GATPAPGDLAKLQDAIKKWQGQ  1093
                    A PAP   A+L  +++K QGQ
Sbjct  463   RGARESRAIPAPDANAELVLSMQKRQGQ  490


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = -2

Query  801  TMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKT  658
             ++GY  +   IH+SGPL+    N D+MLK+H++QIQ  VR+ARLDK 
Sbjct  640  NLVGYGSKGHKIHHSGPLLVPSSNHDQMLKDHDRQIQEVVRRARLDKA  687



>emb|CDY50511.1| BnaC06g10110D [Brassica napus]
Length=691

 Score =   137 bits (345),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 108/150 (72%), Gaps = 13/150 (9%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W  S+L +ATIFKP + Y+R + ETFK+    +L+LL++LLS+ P+ 
Sbjct  336   KIFKLCGSPSEDYWVKSRLPHATIFKPTQPYKRIVDETFKEFPQPALALLETLLSVNPDD  395

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKC-------  1171
             RGTA+SAL++EFF+  PLPCDPS+LPKYPP KE DARMRDE +RRQ G G KC       
Sbjct  396   RGTANSALQSEFFSARPLPCDPSSLPKYPPSKELDARMRDEEIRRQAG-GNKCDQRHQER  454

Query  1170  ----KDSEGATPAPGDLAKLQDAIKKWQGQ  1093
                 KDS  A PAP   A+L  +++K Q Q
Sbjct  455   RGGTKDSR-AIPAPDANAELVASMQKRQSQ  483


 Score = 61.6 bits (148),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  852  NESDHHYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKA  673
            +E  +  +N  +  +   ++GY  +   IHYSGPL+   GN+D++LK+H++ IQ AVR+A
Sbjct  601  SEEANQEENGRRNKQDSVLLGYGSKGHKIHYSGPLVVPSGNMDQVLKDHDRHIQEAVRRA  660

Query  672  RLDKT  658
            R+DK 
Sbjct  661  RIDKA  665



>ref|XP_003540111.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X1 [Glycine max]
 gb|KHN44914.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=710

 Score =   137 bits (345),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 112/153 (73%), Gaps = 11/153 (7%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ SKL +ATIFKP++ Y R +A+TFKD    +L+L+++LLS++P  
Sbjct  346   KIFKLCGSPSEDYWRKSKLPHATIFKPRQPYWRCVADTFKDFPAPALALMETLLSIDPAD  405

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYK--------  1174
             RGTA+SAL+++FFTT PLPCDPS+LPKYPP KE+DA++RDE  RRQ  +G +        
Sbjct  406   RGTAASALKSDFFTTKPLPCDPSSLPKYPPSKEFDAKLRDEQARRQGATGSRGQRHDLER  465

Query  1173  --CKDSEGATPAPGDLAKLQDAIKKWQGQLKLK  1081
                K+S  A PAP   A+L  +++K Q Q + K
Sbjct  466   RGAKESR-AVPAPDANAELPLSMQKRQSQAQSK  497


 Score = 55.5 bits (132),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 44/76 (58%), Gaps = 11/76 (14%)
 Frame = -2

Query  858  IDNESDHHYQNDEQKPRKD---------TMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEH  706
            I  +  HH Q      +K+          ++GY  +   IHYSGPL  +  N+D++LK+H
Sbjct  616  IKQDQRHHVQGQVGTSQKEEGRSSNKDLVLVGYGSEGHKIHYSGPLTSS--NMDQVLKDH  673

Query  705  EKQIQNAVRKARLDKT  658
            ++QIQ AVR+ARLDK 
Sbjct  674  DRQIQEAVRRARLDKA  689



>ref|XP_009356808.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Pyrus x bretschneideri]
 ref|XP_009356809.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Pyrus x bretschneideri]
Length=704

 Score =   137 bits (345),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 106/145 (73%), Gaps = 8/145 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ SKL +ATIFKP++ Y R +AETFKD    +L+L+++LLS++P  
Sbjct  343   KIFKLCGSPSEEYWRKSKLPHATIFKPQQPYRRCVAETFKDFPAPALALMETLLSIDPAD  402

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSG--------YK  1174
             RG+A+SAL++EFFTT PLPCDPS+LPKYPP KE+DA++RDE  RRQ  +G         +
Sbjct  403   RGSAASALKSEFFTTKPLPCDPSSLPKYPPSKEFDAKVRDEEARRQGAAGKGQRLDHERR  462

Query  1173  CKDSEGATPAPGDLAKLQDAIKKWQ  1099
                   A PAP   A+L  ++KK Q
Sbjct  463   GTRESRAVPAPDANAELVMSMKKRQ  487


 Score = 60.5 bits (145),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 51/79 (65%), Gaps = 2/79 (3%)
 Frame = -2

Query  831  QNDEQKPRKD-TMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTS  655
            Q ++ +  KD  ++GY  +   +HYSGPL+   GN D+MLK+H+ Q+Q AVR+ARLDK +
Sbjct  624  QKEDIRSNKDPIIVGYGSKGHKMHYSGPLLVPSGNTDQMLKDHDLQVQEAVRRARLDK-A  682

Query  654  KAKKGNIDYGQTESLLQYV  598
            K +K + +  Q  +   +V
Sbjct  683  KVRKFHAEANQISTNSLFV  701



>ref|XP_002285008.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Vitis vinifera]
Length=713

 Score =   137 bits (345),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 106/147 (72%), Gaps = 8/147 (5%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ SKL +ATIFKP++ Y R +AETFKD    +L L+++LLS++P  
Sbjct  344   KIFKLCGSPSEDYWRKSKLPHATIFKPQQPYRRCVAETFKDFPTPALGLMETLLSIDPAD  403

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSG--------YK  1174
             RG+A+SAL++EFFT  PLPCDPS+LPKYPP KE+DA++RDE  RRQ  +G         K
Sbjct  404   RGSAASALKSEFFTVKPLPCDPSSLPKYPPSKEFDAKVRDEEARRQGATGKGQRLDHERK  463

Query  1173  CKDSEGATPAPGDLAKLQDAIKKWQGQ  1093
                   A PAP   A+L  +++K QGQ
Sbjct  464   GIRESRAVPAPDANAELVLSMQKRQGQ  490


 Score = 58.9 bits (141),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  801  TMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDK  661
             ++GY  +   IHYSGPL+   G +D+MLK+H++QIQ+A R+ARLD+
Sbjct  644  VLLGYGSKGHKIHYSGPLLVPSGKVDQMLKDHDRQIQDAERRARLDR  690



>ref|XP_011029485.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Populus euphratica]
Length=714

 Score =   137 bits (345),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 108/148 (73%), Gaps = 9/148 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ SKL +ATIFKP++ Y R +A+TFK+  P +L+L+++LLS++P  
Sbjct  345   KIFKLCGSPSEDYWRKSKLPHATIFKPQQPYRRCVADTFKEFPPPALALMETLLSIDPAD  404

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEG--  1156
             RG+A+SAL +EFF T PLPCDPS+ PKYPP KE+DA+MRDE  RRQ  +G K + S+   
Sbjct  405   RGSAASALRSEFFITKPLPCDPSSFPKYPPSKEFDAKMRDEEARRQGAAGSKGQKSDMER  464

Query  1155  -------ATPAPGDLAKLQDAIKKWQGQ  1093
                    A PAP   A+L  +++K  GQ
Sbjct  465   RGRRESRAVPAPDANAELVLSMQKRHGQ  492


 Score = 65.1 bits (157),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = -2

Query  837  HYQNDEQKPRKD-TMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDK  661
            H + D +   KD  ++GY  +   IHYSGPLI   GN+D+ML +H++QIQ AVR+ARLDK
Sbjct  632  HQKEDGRNSSKDPVLLGYGSKGHKIHYSGPLIVPSGNMDQMLNDHDRQIQEAVRRARLDK  691

Query  660  TSKAKKGNIDYGQTESLLQYV  598
              K +K   +  Q  +   +V
Sbjct  692  -EKVRKVQAESNQISTNSLFV  711



>ref|XP_009757170.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
isoform X4 [Nicotiana sylvestris]
Length=587

 Score =   135 bits (341),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 109/338 (32%), Positives = 168/338 (50%), Gaps = 61/338 (18%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSP+ ++WK +KL  + +FKP + Y+RRI E FK+L PS++ LL++LLS++P  
Sbjct  245   KIFKLCGSPTADYWKKTKLSYSAVFKPVQPYKRRIGERFKELPPSAVGLLETLLSIDPSL  304

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQ-NGSGYKCKDSEGA  1153
             RGTA+ ALE+EFFTT P  CDP  LP YPP KE DA++R+E  +RQ   +G K + +   
Sbjct  305   RGTAAGALESEFFTTKPFACDPLTLPTYPPSKEIDAKLREEEAKRQPTANGSKERQA---  361

Query  1152  TPAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGS---------------ELSR  1018
               AP D A  + A    QG+         S+  N +++  S                ++ 
Sbjct  362   --APADDANAKLARSMQQGKQTSSNPKSQSDRFNPQKVAASGFRNDPPKASQAVKETVNN  419

Query  1017  HV-SFKARGGGVGQLPMFCSSAAPHPAAIG------------LDLCREDIS---------  904
             H+ +   R      L    S + P    +G            + L R DIS         
Sbjct  420   HLENLSERFSANEDLSETFSHSVPLALGVGCAKSGMKYDDISIGLNRADISNLAASRSVV  479

Query  903   ---VNSHWHRLAMKCNRVIDNES--------------DHHYQNDEQKPRKDTMMGYVPQT  775
                     H++  +  R++D  S               H +++     ++  M G+  + 
Sbjct  480   SGDARDAAHQVERRA-RLLDEHSRKQDGKYLTQNYTGSHQFESGRTSLKEANMNGHDYEG  538

Query  774   GHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDK  661
               I++SG L+     +D+MLK+H++QIQ A R+ARL+K
Sbjct  539   NKIYFSGSLLVQSSKVDQMLKDHDRQIQEAARRARLEK  576



>emb|CBI20299.3| unnamed protein product [Vitis vinifera]
Length=712

 Score =   137 bits (344),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 106/147 (72%), Gaps = 8/147 (5%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ SKL +ATIFKP++ Y R +AETFKD    +L L+++LLS++P  
Sbjct  343   KIFKLCGSPSEDYWRKSKLPHATIFKPQQPYRRCVAETFKDFPTPALGLMETLLSIDPAD  402

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSG--------YK  1174
             RG+A+SAL++EFFT  PLPCDPS+LPKYPP KE+DA++RDE  RRQ  +G         K
Sbjct  403   RGSAASALKSEFFTVKPLPCDPSSLPKYPPSKEFDAKVRDEEARRQGATGKGQRLDHERK  462

Query  1173  CKDSEGATPAPGDLAKLQDAIKKWQGQ  1093
                   A PAP   A+L  +++K QGQ
Sbjct  463   GIRESRAVPAPDANAELVLSMQKRQGQ  489


 Score = 58.9 bits (141),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  801  TMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDK  661
             ++GY  +   IHYSGPL+   G +D+MLK+H++QIQ+A R+ARLD+
Sbjct  643  VLLGYGSKGHKIHYSGPLLVPSGKVDQMLKDHDRQIQDAERRARLDR  689



>ref|XP_009341042.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Pyrus x bretschneideri]
Length=704

 Score =   137 bits (344),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 106/145 (73%), Gaps = 8/145 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ SKL +ATIFKP++ Y R +AETFKD    +L+L+++LLS++P  
Sbjct  343   KIFKLCGSPSEEYWRKSKLPHATIFKPQQPYRRCVAETFKDFPAPALALMETLLSIDPAD  402

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSG--------YK  1174
             RG+A+SAL++EFFTT PLPCDPS+LPKYPP KE+DA++RDE  RRQ  +G         +
Sbjct  403   RGSAASALKSEFFTTKPLPCDPSSLPKYPPSKEFDAKVRDEEARRQGAAGKGQRLDHERR  462

Query  1173  CKDSEGATPAPGDLAKLQDAIKKWQ  1099
                   A PAP   A+L  ++KK Q
Sbjct  463   GTRESRAIPAPDANAELVMSMKKRQ  487


 Score = 62.8 bits (151),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -2

Query  837  HYQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKT  658
            H + D +  +   ++GY  +   +HYSGPL+   GN+D+MLK+H+ Q+Q AVR+ARLDK 
Sbjct  623  HQKEDIRSNKDPIIVGYGSRGHKMHYSGPLLVPSGNVDQMLKDHDLQVQEAVRRARLDK-  681

Query  657  SKAKKGNIDYGQTESLLQYV  598
            +K +K + +  Q  +   +V
Sbjct  682  AKVRKFHAEANQISTNSLFV  701



>ref|XP_004243358.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Solanum lycopersicum]
Length=716

 Score =   137 bits (344),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 103/146 (71%), Gaps = 9/146 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+ +W+  KL ++T FKP   Y RR+ ETFKD  PS++ L+D+LLS++PE 
Sbjct  345   KIFKLCGSPSENYWRKEKLHHSTAFKPLHPYRRRLGETFKDFPPSAVRLMDTLLSIDPEL  404

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEG--  1156
             RGTA SALE+EFFTT PLPCDPS+LPKYPP KE DA++RDE  RRQ  +G K    EG  
Sbjct  405   RGTAVSALESEFFTTKPLPCDPSSLPKYPPSKEIDAKLRDEEARRQGAAGVKNHFDEGHM  464

Query  1155  -------ATPAPGDLAKLQDAIKKWQ  1099
                    A PAP   A+L  +I++ Q
Sbjct  465   RGSKEPRAVPAPDANAELARSIQRRQ  490



>ref|XP_008386179.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Malus domestica]
Length=703

 Score =   137 bits (344),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 106/145 (73%), Gaps = 8/145 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ SKL +ATIFKP++ Y R +AETFKD    +L+L+++LLS++P  
Sbjct  343   KIFKLCGSPSEEYWRKSKLPHATIFKPQQPYRRCVAETFKDFPAPALALMETLLSIDPAD  402

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSG--------YK  1174
             RG+A+SAL++EFFTT PLPCDPS+LPKYPP KE+DA++RDE  RRQ  +G         +
Sbjct  403   RGSAASALKSEFFTTKPLPCDPSSLPKYPPSKEFDAKVRDEEARRQGAAGKGQRFDHERR  462

Query  1173  CKDSEGATPAPGDLAKLQDAIKKWQ  1099
                   A PAP   A+L  ++KK Q
Sbjct  463   GTRESRAIPAPDANAELVMSMKKRQ  487


 Score = 62.8 bits (151),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = -2

Query  834  YQNDEQKPRKDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTS  655
            +Q D +  +   ++GY  +   +HYSGPL+   GN+D+MLK+H+ Q+Q AVR+ARLDK +
Sbjct  623  HQKDIRSNKDPIIVGYGSKGHKMHYSGPLLVPSGNVDQMLKDHDLQVQEAVRRARLDK-A  681

Query  654  KAKKGNIDYGQTESLLQYV  598
            K +K + +  Q  +   +V
Sbjct  682  KVRKFHAEANQISTNSLFV  700



>ref|XP_009757169.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X3 [Nicotiana sylvestris]
Length=653

 Score =   136 bits (342),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 109/339 (32%), Positives = 168/339 (50%), Gaps = 61/339 (18%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSP+ ++WK +KL  + +FKP + Y+RRI E FK+L PS++ LL++LLS++P  
Sbjct  311   KIFKLCGSPTADYWKKTKLSYSAVFKPVQPYKRRIGERFKELPPSAVGLLETLLSIDPSL  370

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQ-NGSGYKCKDSEGA  1153
             RGTA+ ALE+EFFTT P  CDP  LP YPP KE DA++R+E  +RQ   +G K + +   
Sbjct  371   RGTAAGALESEFFTTKPFACDPLTLPTYPPSKEIDAKLREEEAKRQPTANGSKERQA---  427

Query  1152  TPAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGS---------------ELSR  1018
               AP D A  + A    QG+         S+  N +++  S                ++ 
Sbjct  428   --APADDANAKLARSMQQGKQTSSNPKSQSDRFNPQKVAASGFRNDPPKASQAVKETVNN  485

Query  1017  HV-SFKARGGGVGQLPMFCSSAAPHPAAIG------------LDLCREDIS---------  904
             H+ +   R      L    S + P    +G            + L R DIS         
Sbjct  486   HLENLSERFSANEDLSETFSHSVPLALGVGCAKSGMKYDDISIGLNRADISNLAASRSVV  545

Query  903   ---VNSHWHRLAMKCNRVIDNES--------------DHHYQNDEQKPRKDTMMGYVPQT  775
                     H++  +  R++D  S               H +++     ++  M G+  + 
Sbjct  546   SGDARDAAHQVERRA-RLLDEHSRKQDGKYLTQNYTGSHQFESGRTSLKEANMNGHDYEG  604

Query  774   GHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKT  658
               I++SG L+     +D+MLK+H++QIQ A R+ARL+K 
Sbjct  605   NKIYFSGSLLVQSSKVDQMLKDHDRQIQEAARRARLEKA  643



>ref|XP_006370257.1| hypothetical protein POPTR_0001s41040g [Populus trichocarpa]
 gb|ERP66826.1| hypothetical protein POPTR_0001s41040g [Populus trichocarpa]
Length=713

 Score =   136 bits (343),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 107/148 (72%), Gaps = 9/148 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W+ SKL +ATIFKP++ Y R +AETFK+    +L+L+++LL+++P  
Sbjct  344   KIFKLCGSPSEDYWRKSKLPHATIFKPQQPYRRCVAETFKEFPAPALALMETLLAIDPVD  403

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEG--  1156
             RG+A+SAL +EFFTT PLPCDPS+LP YPP KE+DA+MRDE  RRQ  +G K +  +   
Sbjct  404   RGSAASALRSEFFTTKPLPCDPSSLPDYPPSKEFDAKMRDEEARRQGAAGSKGQKPDMER  463

Query  1155  -------ATPAPGDLAKLQDAIKKWQGQ  1093
                    A PAP   A+L  +++K  G+
Sbjct  464   RGQRESRAVPAPDANAELVLSMQKRHGR  491


 Score = 65.5 bits (158),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = -2

Query  837  HYQNDEQKPRKD-TMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDK  661
            H + D +   KD  ++GY  +   IHYSGPLI   GN+D+MLK+H++QIQ AVR+AR DK
Sbjct  631  HQKEDGRNNSKDPVLLGYGSKAHKIHYSGPLIVPSGNMDQMLKDHDRQIQEAVRRARFDK  690

Query  660  T  658
             
Sbjct  691  A  691



>ref|XP_009757166.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009757167.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Nicotiana sylvestris]
Length=680

 Score =   136 bits (342),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 109/339 (32%), Positives = 168/339 (50%), Gaps = 61/339 (18%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSP+ ++WK +KL  + +FKP + Y+RRI E FK+L PS++ LL++LLS++P  
Sbjct  338   KIFKLCGSPTADYWKKTKLSYSAVFKPVQPYKRRIGERFKELPPSAVGLLETLLSIDPSL  397

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQ-NGSGYKCKDSEGA  1153
             RGTA+ ALE+EFFTT P  CDP  LP YPP KE DA++R+E  +RQ   +G K + +   
Sbjct  398   RGTAAGALESEFFTTKPFACDPLTLPTYPPSKEIDAKLREEEAKRQPTANGSKERQA---  454

Query  1152  TPAPGDLAKLQDAIKKWQGQLKLKKCGGMSEVDNSRRLGGS---------------ELSR  1018
               AP D A  + A    QG+         S+  N +++  S                ++ 
Sbjct  455   --APADDANAKLARSMQQGKQTSSNPKSQSDRFNPQKVAASGFRNDPPKASQAVKETVNN  512

Query  1017  HV-SFKARGGGVGQLPMFCSSAAPHPAAIG------------LDLCREDIS---------  904
             H+ +   R      L    S + P    +G            + L R DIS         
Sbjct  513   HLENLSERFSANEDLSETFSHSVPLALGVGCAKSGMKYDDISIGLNRADISNLAASRSVV  572

Query  903   ---VNSHWHRLAMKCNRVIDNES--------------DHHYQNDEQKPRKDTMMGYVPQT  775
                     H++  +  R++D  S               H +++     ++  M G+  + 
Sbjct  573   SGDARDAAHQVERRA-RLLDEHSRKQDGKYLTQNYTGSHQFESGRTSLKEANMNGHDYEG  631

Query  774   GHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKT  658
               I++SG L+     +D+MLK+H++QIQ A R+ARL+K 
Sbjct  632   NKIYFSGSLLVQSSKVDQMLKDHDRQIQEAARRARLEKA  670



>ref|XP_010479840.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Camelina sativa]
Length=689

 Score =   136 bits (342),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 107/324 (33%), Positives = 164/324 (51%), Gaps = 43/324 (13%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W  S+L +ATIFKP + Y+R + ETFK+    +L+LL++LLS+ P+ 
Sbjct  340   KIFKLCGSPSEDYWVKSRLPHATIFKPTQPYKRLVGETFKEFPQPALALLETLLSVNPDD  399

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYP-------------------------------  1243
             RGTAS+AL++EFF+T PLPCDPS+LPKYP                               
Sbjct  400   RGTASAALKSEFFSTRPLPCDPSSLPKYPPSKELDARMRDEESRRQVGGNRDQRHQERRG  459

Query  1242  -------PCKEYDARMRDEMLRRQNGSGYKCKDSEGATPAPGDLAK--LQDAIKKWQGQL  1090
                    P  + +A +   M +RQ+ S  + + SE   P P ++A     D  +      
Sbjct  460   TKESRAIPAPDANAELVTSMQKRQSQSTNRSR-SEKFNPHPEEVASGFPIDPPRPSSQAF  518

Query  1089  KLKKCGGMSEVDNSRRLGGSELSRHVSFKARGGGVGQLPMFCSSAAPHPAAIGLDLCRED  910
             +  +    + + + R      LSR  S  A+G    Q     SS A + A  G    R  
Sbjct  519   EPNRESQGNIIPHKRASHSGPLSRR-SASAKGRRNYQDSQKVSSIADYSAMPGFATTRTG  577

Query  909   ISVNSHWHRLAMKCNRVIDNESDHHYQNDEQKPRKD-TMMGYVPQTGHIHYSGPLIPAGG  733
                      +        +   + + + + +  +KD  ++GY  +   IHYSGPL+   G
Sbjct  578   APQQETCRGMTRLPGSFKETSEEANQEENGRNNKKDPILLGYGSKGHKIHYSGPLVVPSG  637

Query  732   NIDEMLKEHEKQIQNAVRKARLDK  661
             N+D++LK+H++ IQ AVR+AR+DK
Sbjct  638   NMDQVLKDHDRHIQEAVRRARIDK  661



>gb|AFW71848.1| putative protein kinase superfamily protein [Zea mays]
Length=734

 Score =   136 bits (343),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 103/140 (74%), Gaps = 3/140 (2%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W  +KL + T+FKP++ Y R+IAETFKD  PS+L+LLD+LL++EP  
Sbjct  403   KIFKLCGSPSEDYWAKAKLPDVTLFKPQRPYRRKIAETFKDFPPSALALLDTLLAIEPSA  462

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGT +SAL++EFF T PL CDP++LPKYPPCKEYDA++R + + RQN +G   K S    
Sbjct  463   RGTVASALDSEFFRTKPLACDPASLPKYPPCKEYDAKLRGQEVSRQNAAGLGGKGSVSVK  522

Query  1149  PAPGD---LAKLQDAIKKWQ  1099
             P   D    A  QDAI  +Q
Sbjct  523   PGRDDAKGAAPAQDAIADYQ  542


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  807  KDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDK  661
            +D   G+  +   +HYSGPL+P GGN+D+MLKEHE+QIQ AVRKAR++K
Sbjct  678  RDASAGFGGRNKRMHYSGPLVPPGGNMDDMLKEHERQIQQAVRKARVEK  726



>ref|XP_008645824.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Zea mays]
Length=705

 Score =   136 bits (342),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 103/140 (74%), Gaps = 3/140 (2%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W  +KL + T+FKP++ Y R+IAETFKD  PS+L+LLD+LL++EP  
Sbjct  374   KIFKLCGSPSEDYWAKAKLPDVTLFKPQRPYRRKIAETFKDFPPSALALLDTLLAIEPSA  433

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGT +SAL++EFF T PL CDP++LPKYPPCKEYDA++R + + RQN +G   K S    
Sbjct  434   RGTVASALDSEFFRTKPLACDPASLPKYPPCKEYDAKLRGQEVSRQNAAGLGGKGSVSVK  493

Query  1149  PAPGD---LAKLQDAIKKWQ  1099
             P   D    A  QDAI  +Q
Sbjct  494   PGRDDAKGAAPAQDAIADYQ  513


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  807  KDTMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDK  661
            +D   G+  +   +HYSGPL+P GGN+D+MLKEHE+QIQ AVRKAR++K
Sbjct  649  RDASAGFGGRNKRMHYSGPLVPPGGNMDDMLKEHERQIQQAVRKARVEK  697



>ref|XP_006836804.1| hypothetical protein AMTR_s00099p00026630 [Amborella trichopoda]
 gb|ERM99657.1| hypothetical protein AMTR_s00099p00026630 [Amborella trichopoda]
Length=730

 Score =   136 bits (342),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 105/149 (70%), Gaps = 6/149 (4%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+ +W+ SKL +ATIFKP+  YER   ETFK+   S+L LLDSLL++EPE 
Sbjct  354   KIFKLCGSPSEGYWRKSKLPHATIFKPQHPYERCFVETFKEFPSSALVLLDSLLAIEPED  413

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSEGAT  1150
             RGTASSAL++EFFTT P  CDPS+LPKYPP KE+DA++RDE  RRQ  +G K      A+
Sbjct  414   RGTASSALKSEFFTTKPFACDPSSLPKYPPSKEFDAKLRDEEARRQRAAGEKADSVSKAS  473

Query  1149  ------PAPGDLAKLQDAIKKWQGQLKLK  1081
                   PAP   A+L  +++K Q   K K
Sbjct  474   RESRAVPAPDANAELPSSVQKRQANSKPK  502


 Score = 88.6 bits (218),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 69/115 (60%), Gaps = 19/115 (17%)
 Frame = -2

Query  906  SVNSHW--HRLAMKCNRV-IDNESD-----HHY-------QNDEQKPRKDTMMGYVPQTG  772
            + N HW  HR   K N++ ID  SD     HH        + DE+   KD   GY P+  
Sbjct  610  TTNQHWPEHR---KLNQLEIDGPSDKSEWTHHLLDQPTTSKKDERMGNKDMPSGYAPKKN  666

Query  771  HIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTSKAKKGNIDYGQTESLL  607
             IHYSGPL+P  GNID++LKEHE+QIQ+AVRKARLDK  K KK   +  Q E+LL
Sbjct  667  RIHYSGPLLPPSGNIDDLLKEHERQIQHAVRKARLDKV-KTKKHQGEMTQLEALL  720



>ref|XP_008366989.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Malus domestica]
 ref|XP_008366997.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Malus domestica]
Length=704

 Score =   136 bits (342),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 107/145 (74%), Gaps = 8/145 (6%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+E+W+ SKL +ATIFKP++ Y R +AETFKD    +L+L+++LLS++P  
Sbjct  343   KIFKLCGSPSEEYWRKSKLPHATIFKPQQPYRRCVAETFKDFPAPALALMETLLSIDPAD  402

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCK-DSE--  1159
             RG+A+SAL++EFFTT PLPCDPS+LPKYPP KE+DA+ RDE  RRQ  +G   + D E  
Sbjct  403   RGSAASALKSEFFTTKPLPCDPSSLPKYPPSKEFDAKARDEEARRQGAAGKGQRLDHERR  462

Query  1158  -----GATPAPGDLAKLQDAIKKWQ  1099
                   A PAP   A+L  ++KK Q
Sbjct  463   GTREYRAVPAPDANAELVMSMKKRQ  487


 Score = 60.5 bits (145),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 51/79 (65%), Gaps = 2/79 (3%)
 Frame = -2

Query  831  QNDEQKPRKD-TMMGYVPQTGHIHYSGPLIPAGGNIDEMLKEHEKQIQNAVRKARLDKTS  655
            Q ++ +  KD  ++GY  +   +HYSGPL+   GN D+MLK+H+ Q+Q AVR+ARLDK +
Sbjct  624  QKEDIRSNKDPIIVGYGSKGHKMHYSGPLLVPSGNTDQMLKDHDLQVQEAVRRARLDK-A  682

Query  654  KAKKGNIDYGQTESLLQYV  598
            K +K + +  Q  +   +V
Sbjct  683  KVRKFHAEANQISTNSLFV  701



>ref|XP_010462163.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Camelina sativa]
Length=691

 Score =   135 bits (339),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 104/146 (71%), Gaps = 7/146 (5%)
 Frame = -2

Query  1509  KIFKLCGSPSDEFWKNSKLQNATIFKPKKTYERRIAETFKdlspsslslldsllslepER  1330
             KIFKLCGSPS+++W  S+L +ATIFKP + Y+R + ETFK+    +L+LL++LLS+ P+ 
Sbjct  342   KIFKLCGSPSEDYWVKSRLPHATIFKPTQPYKRLVGETFKEFPQPALALLETLLSVNPDD  401

Query  1329  RGTASSALENEFFTTTPLPCDPSALPKYPPCKEYDARMRDEMLRRQNGSGYKCKDSE---  1159
             RGTA++AL++EFF+T PLPCDPS+LPKYPP KE DARMRDE  RRQ G     +  E   
Sbjct  402   RGTAAAALKSEFFSTRPLPCDPSSLPKYPPSKELDARMRDEESRRQAGGNRDQRHQERRG  461

Query  1158  ----GATPAPGDLAKLQDAIKKWQGQ  1093
                  A PAP   A+L  +++K Q Q
Sbjct  462   TKESRAIPAPDANAELVTSMQKRQSQ  487



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4161078891900