BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13530_g1_i1 len=1711 path=[1722:0-1710]

Length=1711
                                                                      Score     E

ref|XP_011003423.1|  PREDICTED: metal transporter Nramp5-like           728   0.0      
ref|XP_011102329.1|  PREDICTED: metal transporter Nramp5-like iso...    726   0.0      
ref|XP_004149810.1|  PREDICTED: metal transporter Nramp5-like           726   0.0      
ref|XP_008459158.1|  PREDICTED: metal transporter Nramp5-like           721   0.0      
ref|XP_006473026.1|  PREDICTED: metal transporter Nramp5-like           721   0.0      
ref|XP_006434252.1|  hypothetical protein CICLE_v10000736mg             721   0.0      
ref|NP_001234318.1|  root-specific metal transporter                    717   0.0      
gb|KDP32832.1|  hypothetical protein JCGZ_12124                         718   0.0      
ref|XP_002307453.2|  hypothetical protein POPTR_0005s20320g             718   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010270254.1|  PREDICTED: metal transporter Nramp5-like           717   0.0      
ref|XP_006351140.1|  PREDICTED: metal transporter Nramp5-like           716   0.0      
gb|AFQ37304.1|  natural resistance-associated macrophage protein 1      715   0.0      
ref|XP_007019147.1|  Nramp transporter                                  715   0.0      
ref|XP_009783885.1|  PREDICTED: metal transporter Nramp5-like           714   0.0      
ref|XP_009620069.1|  PREDICTED: metal transporter Nramp5-like           713   0.0      
ref|XP_006386365.1|  hypothetical protein POPTR_0002s08090g             713   0.0      
ref|XP_008219602.1|  PREDICTED: metal transporter Nramp5-like           712   0.0      
ref|XP_007225779.1|  hypothetical protein PRUPE_ppa003816mg             712   0.0      
ref|XP_008466781.1|  PREDICTED: metal transporter Nramp5-like           711   0.0      
ref|XP_002284556.1|  PREDICTED: metal transporter Nramp5                709   0.0      Vitis vinifera
ref|XP_004290899.1|  PREDICTED: metal transporter Nramp5-like           707   0.0      
ref|XP_011027484.1|  PREDICTED: metal transporter Nramp5-like           707   0.0      
dbj|BAM34952.1|  metal transporter Nramp1                               706   0.0      
gb|EYU32513.1|  hypothetical protein MIMGU_mgv1a004213mg                706   0.0      
ref|XP_011027698.1|  PREDICTED: metal transporter Nramp5-like           706   0.0      
dbj|BAM34953.1|  metal transporter Nramp1                               704   0.0      
ref|XP_008361001.1|  PREDICTED: metal transporter Nramp5-like           703   0.0      
ref|XP_006386366.1|  hypothetical protein POPTR_0002s08100g             702   0.0      
ref|XP_002307454.1|  root-specific metal transporter family protein     703   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002520334.1|  metal transporter, putative                        698   0.0      Ricinus communis
ref|XP_003526645.1|  PREDICTED: metal transporter Nramp5-like           699   0.0      
ref|XP_009341347.1|  PREDICTED: metal transporter Nramp5-like           698   0.0      
gb|AAU00158.1|  root-specific metal transporter                         697   0.0      Malus baccata [shan jing zi]
ref|XP_009359447.1|  PREDICTED: metal transporter Nramp5-like           696   0.0      
ref|XP_004502516.1|  PREDICTED: metal transporter Nramp5-like           695   0.0      
ref|XP_002284550.1|  PREDICTED: metal transporter Nramp5-like iso...    695   0.0      Vitis vinifera
ref|XP_007137450.1|  hypothetical protein PHAVU_009G127900g             694   0.0      
ref|XP_009341351.1|  PREDICTED: metal transporter Nramp5-like           694   0.0      
ref|XP_010530206.1|  PREDICTED: metal transporter Nramp5-like           692   0.0      
emb|CDP10962.1|  unnamed protein product                                692   0.0      
ref|XP_003602053.1|  Metal transporter                                  688   0.0      
ref|XP_010664181.1|  PREDICTED: metal transporter Nramp5-like iso...    684   0.0      
ref|XP_006842029.1|  hypothetical protein AMTR_s00203p00024670          682   0.0      
emb|CBI18987.3|  unnamed protein product                                679   0.0      
ref|XP_010041727.1|  PREDICTED: metal transporter Nramp5-like           675   0.0      
ref|XP_009402651.1|  PREDICTED: metal transporter Nramp5-like           672   0.0      
ref|XP_004502502.1|  PREDICTED: metal transporter Nramp5-like           669   0.0      
ref|XP_007019143.1|  Nramp transporter isoform 2                        667   0.0      
ref|XP_009385111.1|  PREDICTED: metal transporter Nramp5-like           667   0.0      
gb|KCW44123.1|  hypothetical protein EUGRSUZ_L02462                     664   0.0      
emb|CDP10958.1|  unnamed protein product                                665   0.0      
gb|EPS72193.1|  root-specific metal transporter                         662   0.0      
ref|XP_010063416.1|  PREDICTED: metal transporter Nramp5-like           664   0.0      
ref|XP_003557325.1|  PREDICTED: metal transporter Nramp5-like           662   0.0      
gb|KCW71239.1|  hypothetical protein EUGRSUZ_F04336                     662   0.0      
ref|XP_008799200.1|  PREDICTED: metal transporter Nramp5-like           662   0.0      
ref|XP_010063940.1|  PREDICTED: metal transporter Nramp5-like iso...    662   0.0      
ref|XP_010677475.1|  PREDICTED: metal transporter Nramp5-like           661   0.0      
ref|XP_007019142.1|  Nramp transporter isoform 1                        659   0.0      
ref|NP_001059312.1|  Os07g0257200                                       655   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_009386677.1|  PREDICTED: metal transporter Nramp5-like           655   0.0      
ref|XP_002461772.1|  hypothetical protein SORBIDRAFT_02g007870          654   0.0      Sorghum bicolor [broomcorn]
ref|XP_010908505.1|  PREDICTED: metal transporter Nramp5-like           652   0.0      
ref|XP_003602055.1|  Metal transporter                                  652   0.0      
ref|XP_011069333.1|  PREDICTED: metal transporter Nramp5-like iso...    645   0.0      
gb|EPS69341.1|  hypothetical protein M569_05424                         642   0.0      
dbj|BAJ95577.1|  predicted protein                                      644   0.0      
ref|XP_002520333.1|  metal transporter, putative                        642   0.0      Ricinus communis
ref|XP_006657596.1|  PREDICTED: metal transporter Nramp5-like           641   0.0      
gb|EMT15840.1|  Metal transporter Nramp6                                640   0.0      
gb|EEE66904.1|  hypothetical protein OsJ_23749                          639   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_004955906.1|  PREDICTED: metal transporter Nramp5-like           637   0.0      
ref|XP_003630459.1|  Root-specific metal transporter                    629   0.0      
ref|XP_003561268.1|  PREDICTED: LOW QUALITY PROTEIN: metal transp...    627   0.0      
gb|EMT08332.1|  Metal transporter Nramp1                                626   0.0      
dbj|BAM45315.1|  Nramp metal transporter                                625   0.0      
gb|AAB36424.1|  OsNramp1                                                624   0.0      Oryza sativa [red rice]
gb|EAZ03422.1|  hypothetical protein OsI_25561                          623   0.0      Oryza sativa Indica Group [Indian rice]
gb|AER41612.1|  metal+transporter+Nramp6                                621   0.0      
ref|NP_001059315.1|  Os07g0258400                                       621   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|AER41592.1|  metal+transporter+Nramp6                                620   0.0      
dbj|BAC83021.1|  rice Nramp1 protein(Natural-resistance-associate...    615   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|ABD85292.1|  metal transporter                                       614   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|KDP32831.1|  hypothetical protein JCGZ_12123                         612   0.0      
ref|XP_008670085.1|  PREDICTED: metal transporter Nramp1-like iso...    612   0.0      
ref|XP_004959136.1|  PREDICTED: metal transporter Nramp1-like           611   0.0      
ref|XP_006658451.1|  PREDICTED: metal transporter Nramp1-like           610   0.0      
ref|XP_002459640.1|  hypothetical protein SORBIDRAFT_02g007890          608   0.0      Sorghum bicolor [broomcorn]
ref|XP_010095424.1|  Metal transporter Nramp5                           604   0.0      
gb|KCW71240.1|  hypothetical protein EUGRSUZ_F04337                     603   0.0      
ref|XP_008670084.1|  PREDICTED: metal transporter Nramp1-like iso...    602   0.0      
gb|AER41570.1|  metal+transporter+Nramp6                                600   0.0      
emb|CAN60104.1|  hypothetical protein VITISV_017979                     618   0.0      Vitis vinifera
gb|AER41588.1|  metal+transporter+Nramp6                                587   0.0      
gb|AER41569.1|  metal+transporter+Nramp6                                580   0.0      
ref|XP_010063941.1|  PREDICTED: metal transporter Nramp5-like iso...    571   0.0      
gb|KEH35320.1|  NRAMP metal ion transporter 6                           568   0.0      
ref|XP_004952002.1|  PREDICTED: metal transporter NRAT1-like            566   0.0      
ref|XP_008799201.1|  PREDICTED: metal transporter Nramp5-like           554   0.0      
ref|XP_006646836.1|  PREDICTED: metal transporter NRAT1-like            553   0.0      
ref|XP_010265996.1|  PREDICTED: metal transporter Nramp5-like iso...    551   0.0      
ref|NP_001045794.1|  Os02g0131800                                       553   0.0      Oryza sativa Japonica Group [Japonica rice]
tpg|DAA39781.1|  TPA: hypothetical protein ZEAMMB73_104976              551   0.0      
gb|EMS57810.1|  Metal transporter Nramp5                                550   0.0      
ref|XP_002966631.1|  hypothetical protein SELMODRAFT_85390              540   0.0      
ref|XP_002973463.1|  hypothetical protein SELMODRAFT_173368             540   0.0      
ref|XP_002438846.1|  hypothetical protein SORBIDRAFT_10g027130          541   0.0      Sorghum bicolor [broomcorn]
gb|KEH35319.1|  NRAMP metal ion transporter 6                           536   0.0      
ref|XP_002978111.1|  hypothetical protein SELMODRAFT_443808             540   0.0      
ref|XP_002451480.1|  hypothetical protein SORBIDRAFT_04g002610          539   0.0      Sorghum bicolor [broomcorn]
ref|XP_002267072.1|  PREDICTED: metal transporter Nramp5                537   0.0      Vitis vinifera
ref|NP_001132120.1|  uncharacterized protein LOC100193537               538   0.0      Zea mays [maize]
gb|EMT32916.1|  Metal transporter Nramp1                                538   0.0      
gb|KDP41977.1|  hypothetical protein JCGZ_26995                         537   0.0      
gb|EMS48033.1|  Metal transporter Nramp1                                542   0.0      
ref|XP_006427619.1|  hypothetical protein CICLE_v10025318mg             536   0.0      
ref|XP_004966199.1|  PREDICTED: metal transporter Nramp3-like iso...    537   0.0      
ref|XP_008681153.1|  PREDICTED: uncharacterized protein LOC100193...    539   0.0      
gb|KHG03378.1|  Metal transporter Nramp1 -like protein                  536   0.0      
ref|XP_011097461.1|  PREDICTED: metal transporter Nramp1-like           534   0.0      
ref|XP_006493353.1|  PREDICTED: metal transporter Nramp1-like           535   0.0      
ref|XP_008228792.1|  PREDICTED: metal transporter Nramp6-like           535   0.0      
ref|XP_004966198.1|  PREDICTED: metal transporter Nramp3-like iso...    536   0.0      
ref|XP_010240753.1|  PREDICTED: metal transporter Nramp3                535   0.0      
ref|XP_002986694.1|  hypothetical protein SELMODRAFT_124573             535   0.0      
sp|Q653V6.1|NRAM3_ORYSJ  RecName: Full=Metal transporter Nramp3; ...    533   1e-180   Oryza sativa Japonica Group [Japonica rice]
gb|EEC72418.1|  hypothetical protein OsI_05729                          550   2e-180   Oryza sativa Indica Group [Indian rice]
gb|KHN31883.1|  Metal transporter Nramp6                                533   2e-180   
ref|XP_006656371.1|  PREDICTED: metal transporter Nramp3-like           531   7e-180   
ref|XP_003543701.1|  PREDICTED: metal transporter Nramp6-like           531   9e-180   
ref|XP_006307246.1|  hypothetical protein CARUB_v10008854mg             530   9e-180   
ref|XP_007150803.1|  hypothetical protein PHAVU_005G182000g             530   2e-179   
gb|KHN04176.1|  Metal transporter Nramp1                                530   3e-179   
gb|KDO41576.1|  hypothetical protein CISIN_1g008955mg                   530   3e-179   
emb|CDO98224.1|  unnamed protein product                                529   4e-179   
ref|XP_004486616.1|  PREDICTED: metal transporter Nramp6-like iso...    529   4e-179   
ref|XP_007217247.1|  hypothetical protein PRUPE_ppa003835mg             529   5e-179   
ref|XP_003530275.1|  PREDICTED: metal transporter Nramp1-like iso...    529   6e-179   
ref|XP_003546914.1|  PREDICTED: metal transporter Nramp6-like           528   8e-179   
emb|CDP20210.1|  unnamed protein product                                527   8e-179   
ref|XP_008354189.1|  PREDICTED: metal transporter Nramp6-like           528   8e-179   
gb|KEH39634.1|  NRAMP metal ion transporter 6                           528   1e-178   
ref|XP_006585608.1|  PREDICTED: metal transporter Nramp6-like iso...    528   2e-178   
ref|XP_002527300.1|  metal transporter, putative                        528   2e-178   Ricinus communis
gb|KEH39635.1|  NRAMP metal ion transporter 6                           528   2e-178   
ref|XP_010065138.1|  PREDICTED: metal transporter Nramp5-like           522   3e-178   
ref|XP_002966634.1|  Nramp family protein                               526   4e-178   
ref|XP_009387822.1|  PREDICTED: metal transporter Nramp3-like           526   4e-178   
ref|XP_008806825.1|  PREDICTED: metal transporter Nramp3-like iso...    526   5e-178   
ref|XP_004161407.1|  PREDICTED: metal transporter Nramp1-like           525   1e-177   
ref|XP_007135815.1|  hypothetical protein PHAVU_010G160800g             526   1e-177   
ref|XP_010265997.1|  PREDICTED: metal transporter Nramp6-like iso...    520   2e-177   
ref|XP_002273263.1|  PREDICTED: metal transporter Nramp6                525   2e-177   Vitis vinifera
gb|KGN58625.1|  hypothetical protein Csa_3G702630                       523   3e-177   
ref|XP_010926919.1|  PREDICTED: metal transporter Nramp3-like iso...    525   3e-177   
ref|XP_010910516.1|  PREDICTED: metal transporter Nramp5-like           518   3e-177   
ref|XP_002978108.1|  hypothetical protein SELMODRAFT_418073             525   4e-177   
gb|EMS65084.1|  Metal transporter Nramp3                                525   6e-177   
ref|XP_008652227.1|  PREDICTED: metal transporter Nramp5                520   6e-177   
gb|KFK43835.1|  hypothetical protein AALP_AA1G179700                    521   1e-176   
ref|XP_010537873.1|  PREDICTED: metal transporter Nramp6                522   1e-176   
gb|AAM63430.1|  metal ion transporter                                   522   1e-176   Arabidopsis thaliana [mouse-ear cress]
ref|NP_178198.1|  metal transporter Nramp1                              522   2e-176   Arabidopsis thaliana [mouse-ear cress]
gb|AAD54417.1|  metal ion transporter                                   522   2e-176   Arabidopsis thaliana [mouse-ear cress]
ref|NP_173048.3|  metal transporter Nramp6                              520   5e-176   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004486619.1|  PREDICTED: metal transporter Nramp6-like iso...    519   7e-176   
ref|XP_010459132.1|  PREDICTED: metal transporter Nramp6-like iso...    520   7e-176   
ref|XP_010497540.1|  PREDICTED: metal transporter Nramp6                520   9e-176   
ref|XP_002887809.1|  NRAMP1                                             520   1e-175   
ref|XP_010034028.1|  PREDICTED: metal transporter Nramp6 isoform X1     520   1e-175   
ref|XP_004160334.1|  PREDICTED: LOW QUALITY PROTEIN: metal transp...    520   2e-175   
ref|XP_010258654.1|  PREDICTED: metal transporter Nramp6-like           520   2e-175   
ref|XP_007023419.1|  NRAMP metal ion transporter 6 isoform 1            519   4e-175   
gb|KGN58662.1|  hypothetical protein Csa_3G714870                       520   6e-175   
ref|XP_011034541.1|  PREDICTED: metal transporter Nramp6-like           518   7e-175   
ref|XP_009354189.1|  PREDICTED: metal transporter Nramp1-like           518   1e-174   
ref|XP_011082346.1|  PREDICTED: metal transporter Nramp6-like iso...    518   1e-174   
ref|XP_011082336.1|  PREDICTED: metal transporter Nramp6-like iso...    517   2e-174   
ref|XP_006368514.1|  Metal transporter Nramp1 family protein            517   2e-174   
ref|XP_006301485.1|  hypothetical protein CARUB_v10021908mg             516   3e-174   
ref|XP_009104491.1|  PREDICTED: metal transporter Nramp1-like           515   6e-174   
ref|XP_006389836.1|  hypothetical protein EUTSA_v10018389mg             515   8e-174   
ref|XP_010472867.1|  PREDICTED: metal transporter Nramp1                514   1e-173   
gb|KFK42462.1|  hypothetical protein AALP_AA2G260000                    514   2e-173   
ref|XP_009149038.1|  PREDICTED: metal transporter Nramp6                512   2e-173   
ref|XP_010429896.1|  PREDICTED: metal transporter Nramp1-like           514   2e-173   
gb|KFK42470.1|  hypothetical protein AALP_AA2G261200                    514   3e-173   
ref|XP_010034031.1|  PREDICTED: metal transporter Nramp6 isoform X3     512   4e-173   
emb|CDY63970.1|  BnaC02g46600D                                          511   2e-172   
gb|KDO41580.1|  hypothetical protein CISIN_1g008955mg                   507   4e-172   
ref|XP_010691589.1|  PREDICTED: metal transporter Nramp6-like           510   1e-171   
ref|XP_006416859.1|  hypothetical protein EUTSA_v10009815mg             509   2e-171   
dbj|BAE48710.1|  NRAMP family metal transporter                         509   2e-171   Chengiopanax sciadophylloides
ref|XP_008360386.1|  PREDICTED: metal transporter Nramp5-like           505   2e-171   
gb|EYU24597.1|  hypothetical protein MIMGU_mgv1a004193mg                509   3e-171   
ref|XP_009594426.1|  PREDICTED: LOW QUALITY PROTEIN: metal transp...    509   3e-171   
ref|XP_009774026.1|  PREDICTED: LOW QUALITY PROTEIN: metal transp...    508   3e-171   
dbj|BAH66919.1|  metal transporter                                      507   1e-170   Nicotiana tabacum [American tobacco]
ref|XP_009128390.1|  PREDICTED: metal transporter Nramp1                507   2e-170   
ref|XP_006341345.1|  PREDICTED: LOW QUALITY PROTEIN: metal transp...    506   4e-170   
emb|CDY39940.1|  BnaC06g40180D                                          505   4e-170   
ref|XP_009106714.1|  PREDICTED: metal transporter Nramp1-like           504   6e-170   
ref|XP_008392949.1|  PREDICTED: metal transporter Nramp5-like           500   8e-170   
ref|XP_010926920.1|  PREDICTED: metal transporter Nramp3-like iso...    503   9e-170   
emb|CCM80484.1|  Nramp1.1                                               504   9e-170   
gb|AAF18493.1|AC010924_6  Strong similarity to gi|2130080 Nramp1 ...    504   1e-169   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008645206.1|  PREDICTED: metal transporter NRAT1-like            504   3e-169   
ref|XP_004235940.1|  PREDICTED: LOW QUALITY PROTEIN: metal transp...    503   6e-169   
ref|XP_010459131.1|  PREDICTED: metal transporter Nramp6-like iso...    503   9e-169   
ref|XP_011082369.1|  PREDICTED: metal transporter Nramp6-like iso...    499   1e-168   
gb|EYU24596.1|  hypothetical protein MIMGU_mgv1a004193mg                497   4e-168   
gb|EMT07132.1|  Metal transporter Nramp6                                499   2e-167   
emb|CDX79348.1|  BnaC06g19550D                                          499   2e-167   
emb|CDY33364.1|  BnaC05g12190D                                          497   3e-167   
ref|XP_004303243.1|  PREDICTED: LOW QUALITY PROTEIN: metal transp...    487   2e-162   
ref|XP_002985555.1|  hypothetical protein SELMODRAFT_122391             484   2e-162   
ref|XP_010230920.1|  PREDICTED: metal transporter Nramp4-like iso...    484   2e-161   
ref|XP_010230921.1|  PREDICTED: metal transporter Nramp4-like iso...    482   2e-161   
gb|EEC70718.1|  hypothetical protein OsI_02097                          484   2e-161   Oryza sativa Indica Group [Indian rice]
ref|XP_006645926.1|  PREDICTED: metal transporter Nramp4-like           482   6e-161   
ref|NP_001043139.1|  Os01g0503400                                       483   7e-161   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004486618.1|  PREDICTED: metal transporter Nramp6-like iso...    479   4e-160   
emb|CAN78852.1|  hypothetical protein VITISV_034005                     481   1e-159   Vitis vinifera
ref|XP_002987015.1|  hypothetical protein SELMODRAFT_125213             477   2e-159   
ref|XP_002966281.1|  hypothetical protein SELMODRAFT_407690             478   3e-159   
ref|XP_002978291.1|  hypothetical protein SELMODRAFT_418064             477   5e-159   
ref|XP_008681155.1|  PREDICTED: uncharacterized protein LOC100193...    474   1e-158   
ref|XP_010034030.1|  PREDICTED: metal transporter Nramp6 isoform X2     471   4e-157   
ref|XP_009127640.1|  PREDICTED: metal transporter Nramp6-like           469   7e-157   
ref|XP_004975312.1|  PREDICTED: metal transporter Nramp4-like           473   2e-156   
gb|KDO41579.1|  hypothetical protein CISIN_1g008955mg                   468   1e-155   
ref|XP_004486620.1|  PREDICTED: metal transporter Nramp6-like iso...    464   2e-155   
ref|XP_006836387.1|  hypothetical protein AMTR_s00092p00132440          464   1e-154   
ref|XP_002889256.1|  hypothetical protein ARALYDRAFT_895871             462   4e-154   
ref|XP_011082362.1|  PREDICTED: metal transporter Nramp1-like iso...    462   3e-153   
ref|XP_010092194.1|  Metal transporter Nramp6                           447   2e-147   
ref|XP_010419378.1|  PREDICTED: metal transporter Nramp1-like           443   4e-146   
emb|CDP10960.1|  unnamed protein product                                435   3e-145   
gb|AFW69006.1|  hypothetical protein ZEAMMB73_198457                    432   1e-143   
ref|XP_010926921.1|  PREDICTED: metal transporter Nramp3-like iso...    428   5e-142   
ref|XP_008681156.1|  PREDICTED: uncharacterized protein LOC100193...    431   5e-142   
dbj|BAM45316.1|  Nramp metal transporter                                425   4e-141   
ref|XP_008806828.1|  PREDICTED: metal transporter Nramp3-like iso...    423   5e-140   
gb|ACR16683.1|  natural resistance-associated macrophage protein 1.4    421   6e-140   Brassica juncea [brown mustard]
gb|ACL83360.1|  natural resistance associated macrophage protein 1.1    421   2e-139   Brassica juncea [brown mustard]
gb|ACR16686.1|  natural resistance-associated macrophage protein 1.2    419   5e-139   Brassica juncea [brown mustard]
gb|AFW69999.1|  hypothetical protein ZEAMMB73_660809                    422   5e-139   
gb|ACR16687.1|  natural resistance-associated macrophage protein 1.3    416   7e-138   Brassica juncea [brown mustard]
gb|ACO24484.1|  natural resistance associated macrophage protein 6.2    406   6e-134   Brassica juncea [brown mustard]
gb|AAC49720.1|  integral membrane protein OsNramp3                      406   2e-133   Oryza sativa [red rice]
ref|XP_008670762.1|  PREDICTED: metal transporter Nramp4-like iso...    410   3e-132   
gb|ACO24483.1|  natural resistance associated macrophage protein 6.1    397   2e-130   Brassica juncea [brown mustard]
dbj|BAG91006.1|  unnamed protein product                                398   5e-130   Oryza sativa Japonica Group [Japonica rice]
emb|CAN63972.1|  hypothetical protein VITISV_004328                     394   2e-129   Vitis vinifera
ref|XP_010230922.1|  PREDICTED: metal transporter Nramp4-like iso...    396   4e-129   
gb|ACR16684.1|  natural resistance-associated macrophage protein 6.4    385   1e-125   Brassica juncea [brown mustard]
gb|KCW70643.1|  hypothetical protein EUGRSUZ_F03813                     385   6e-124   
gb|ACR16685.1|  natural resistance-associated macrophage protein 6.3    377   1e-122   Brassica juncea [brown mustard]
gb|KDO41581.1|  hypothetical protein CISIN_1g008955mg                   376   2e-121   
gb|ACN35544.1|  unknown                                                 366   5e-118   Zea mays [maize]
ref|XP_008461761.1|  PREDICTED: metal transporter Nramp1-like           362   4e-117   
ref|XP_008465154.1|  PREDICTED: metal transporter Nramp1                360   4e-116   
emb|CDY64859.1|  BnaA02g36240D                                          362   1e-112   
gb|EPS63655.1|  hypothetical protein M569_11128                         344   7e-110   
tpg|DAA42050.1|  TPA: hypothetical protein ZEAMMB73_081069              338   5e-106   
ref|XP_004149623.1|  PREDICTED: uncharacterized protein LOC101211618    357   4e-104   
gb|ETM00675.1|  hypothetical protein L917_02619                         329   3e-101   
ref|XP_008362176.1|  PREDICTED: metal transporter Nramp5-like           319   6e-101   
gb|ETI54351.1|  hypothetical protein F443_02814                         328   1e-100   
gb|AFK44028.1|  unknown                                                 320   3e-100   
gb|ETK94195.1|  hypothetical protein L915_02704                         325   1e-99    
ref|XP_002906059.1|  Metal Ion (Mn2 -iron) Transporter (Nramp) Fa...    323   4e-99    
gb|KDO80533.1|  hypothetical protein CISIN_1g0202162mg                  310   6e-99    
gb|AEA86280.1|  metal transporter NRAMP                                 308   2e-97    
ref|XP_001421422.1|  Nramp family transporter: metal ion                314   2e-96    Ostreococcus lucimarinus CCE9901
dbj|GAM26349.1|  hypothetical protein SAMD00019534_095240               313   1e-95    
ref|XP_009536103.1|  hypothetical protein PHYSODRAFT_527737             314   2e-95    
ref|XP_003057563.1|  metal ion transporter family                       311   6e-95    
gb|EJY76241.1|  hypothetical protein OXYTRI_02252                       311   8e-95    
ref|XP_005820483.1|  hypothetical protein GUITHDRAFT_90722              307   5e-93    
ref|XP_003083269.1|  NRAM6_ARATH Metal transporter Nramp6 (ISS)         306   1e-92    
ref|XP_009176925.1|  hypothetical protein T265_11863                    308   2e-92    
emb|CEG01750.1|  Natural resistance-associated macrophage like          306   2e-92    
ref|XP_005111053.1|  PREDICTED: natural resistance-associated mac...    307   2e-92    
ref|XP_002501569.1|  metal ion transporter family                       301   3e-92    
gb|AAO17058.1|  integral membrane protein Nramp1                        294   5e-92    
gb|KFP97088.1|  Natural resistance-associated macrophage protein 2      301   8e-92    
ref|XP_008900019.1|  hypothetical protein PPTG_07496                    301   1e-91    
ref|XP_007155868.1|  hypothetical protein PHAVU_003G238600g             300   2e-91    
ref|XP_009924493.1|  PREDICTED: natural resistance-associated mac...    303   2e-91    
emb|CBN78636.1|  divalent metal transporter                             305   2e-91    
ref|XP_007018563.1|  NRAMP metal ion transporter 2 isoform 1            303   2e-91    
gb|ELU16207.1|  hypothetical protein CAPTEDRAFT_224895                  303   3e-91    
gb|ERZ95213.1|  hypothetical protein GLOINDRAFT_313253                  301   3e-91    
ref|XP_009924513.1|  PREDICTED: natural resistance-associated mac...    303   3e-91    
gb|KFQ62774.1|  Natural resistance-associated macrophage protein 2      300   4e-91    
ref|XP_007155869.1|  hypothetical protein PHAVU_003G238600g             301   4e-91    
emb|CAX82461.1|  Natural resistance-associated macrophage protein 2     303   5e-91    
ref|XP_642974.1|  solute carrier family 11 member 1                     301   5e-91    
ref|XP_002524950.1|  natural resistance-associated macrophage pro...    301   5e-91    
ref|XP_004346469.1|  hypothetical protein ACA1_225890                   302   6e-91    
gb|EKC38127.1|  Protein Malvolio                                        301   1e-90    
ref|XP_007514651.1|  manganese transport protein MntH                   303   1e-90    
ref|XP_010549258.1|  PREDICTED: metal transporter Nramp2-like           301   1e-90    
ref|NP_001236727.1|  ferrous ion membrane transport protein DMT1        300   2e-90    
ref|XP_009760309.1|  PREDICTED: metal transporter Nramp2-like           300   2e-90    
ref|XP_002464246.1|  hypothetical protein SORBIDRAFT_01g014870          296   2e-90    
ref|XP_001750777.1|  hypothetical protein                               300   2e-90    
ref|XP_009484233.1|  PREDICTED: natural resistance-associated mac...    301   2e-90    
ref|XP_009393845.1|  PREDICTED: metal transporter Nramp2-like           299   3e-90    
ref|XP_004151394.1|  PREDICTED: metal transporter Nramp1-like           297   5e-90    
ref|XP_003524672.1|  PREDICTED: metal transporter Nramp3-like           298   6e-90    
gb|AEP81324.1|  divalent metal transporter 1                            298   7e-90    
gb|KFK44636.1|  hypothetical protein AALP_AA1G284700                    298   7e-90    
gb|AFK48919.1|  unknown                                                 298   7e-90    
ref|XP_002510129.1|  natural resistance-associated macrophage pro...    296   7e-90    
gb|ABR16507.1|  unknown                                                 298   7e-90    
dbj|BAD99106.1|  divalent metal transporter                             298   8e-90    
ref|XP_003400903.1|  PREDICTED: protein Malvolio-like                   300   9e-90    
ref|XP_010936565.1|  PREDICTED: metal transporter Nramp2-like           298   9e-90    
ref|XP_006307222.1|  hypothetical protein CARUB_v10008822mg             298   1e-89    
gb|KHG09167.1|  Metal transporter Nramp3 -like protein                  297   1e-89    
ref|XP_006393610.1|  hypothetical protein EUTSA_v10011381mg             296   1e-89    
ref|XP_009620156.1|  PREDICTED: metal transporter Nramp2-like           298   1e-89    
gb|ABD76399.1|  metal transporter protein                               297   2e-89    
gb|KFK28396.1|  hypothetical protein AALP_AA8G509600                    297   2e-89    
gb|ABR27747.1|  metal transporter NRAMP4                                296   2e-89    
ref|XP_004238113.1|  PREDICTED: metal transporter Nramp2                298   2e-89    
ref|XP_006362075.1|  PREDICTED: metal transporter Nramp2-like           297   2e-89    
ref|XP_007156751.1|  hypothetical protein PHAVU_002G014300g             296   3e-89    
ref|XP_003736950.1|  GA17603, isoform B                                 297   3e-89    
ref|XP_003636821.1|  Natural resistance-associated macrophage pro...    297   3e-89    
ref|XP_007205063.1|  hypothetical protein PRUPE_ppa004490mg             296   3e-89    
ref|XP_004287980.1|  PREDICTED: metal transporter Nramp3-like           296   3e-89    
gb|AAD41078.1|AF141204_1  Nramp2                                        296   3e-89    
gb|KDP41655.1|  hypothetical protein JCGZ_16062                         297   4e-89    
gb|EFX78626.1|  hypothetical protein DAPPUDRAFT_347258                  297   4e-89    
ref|NP_175157.1|  metal transporter NRAMP2                              296   4e-89    
ref|XP_010538133.1|  PREDICTED: metal transporter Nramp2-like           297   4e-89    
gb|EFN77522.1|  Protein Malvolio                                        298   5e-89    
ref|XP_008787132.1|  PREDICTED: metal transporter Nramp2-like           296   5e-89    
gb|KFK32770.1|  hypothetical protein AALP_AA6G286400                    296   5e-89    
ref|XP_009062480.1|  hypothetical protein LOTGIDRAFT_128586             292   5e-89    
gb|EFN64791.1|  Protein Malvolio                                        297   5e-89    
ref|XP_004509092.1|  PREDICTED: metal transporter Nramp3-like           296   5e-89    
dbj|BAC80141.1|  Nramp metal transporter homolog                        295   6e-89    
ref|XP_004362919.1|  solute carrier family 11 member 1                  296   6e-89    
ref|XP_009124591.1|  PREDICTED: metal transporter Nramp2                296   6e-89    
ref|XP_010271562.1|  PREDICTED: metal transporter Nramp3-like           296   7e-89    
ref|XP_010461517.1|  PREDICTED: metal transporter Nramp2 isoform X1     296   7e-89    
emb|CDY17036.1|  BnaA08g04000D                                          296   7e-89    
ref|XP_010500241.1|  PREDICTED: metal transporter Nramp2-like           296   8e-89    
ref|XP_002894035.1|  NRAMP2                                             296   8e-89    
ref|XP_010679565.1|  PREDICTED: metal transporter Nramp3                295   8e-89    
gb|ACF22090.2|  natural resistance associated macrophage protein        295   8e-89    
ref|XP_006393611.1|  hypothetical protein EUTSA_v10011381mg             296   9e-89    
ref|XP_003747582.1|  PREDICTED: protein Malvolio-like                   296   1e-88    
ref|XP_009536098.1|  hypothetical protein PHYSODRAFT_306066             296   1e-88    
ref|XP_009103429.1|  PREDICTED: metal transporter Nramp4                295   1e-88    
ref|XP_010277149.1|  PREDICTED: metal transporter Nramp3-like           295   1e-88    
emb|CDY47594.1|  BnaC08g04640D                                          295   1e-88    
ref|XP_001360063.2|  GA17603, isoform A                                 297   1e-88    
dbj|GAM24393.1|  hypothetical protein SAMD00019534_075680               295   1e-88    
ref|XP_008220291.1|  PREDICTED: metal transporter Nramp2-like           295   1e-88    
ref|XP_010688292.1|  PREDICTED: metal transporter Nramp2-like           295   1e-88    
dbj|BAD73195.1|  integral membrane protein-like                         286   2e-88    
ref|XP_010417070.1|  PREDICTED: metal transporter Nramp3-like           294   2e-88    
ref|XP_001979348.1|  GG14948                                            297   2e-88    
ref|XP_008455821.1|  PREDICTED: metal transporter Nramp3-like           294   2e-88    
ref|XP_002019949.1|  GL12685                                            297   2e-88    
emb|CDY17090.1|  BnaC06g00230D                                          295   2e-88    
ref|XP_003579243.1|  PREDICTED: metal transporter Nramp6                295   2e-88    
ref|XP_010087278.1|  Metal transporter Nramp3                           295   2e-88    
ref|XP_003539319.1|  PREDICTED: metal transporter Nramp3-like           294   2e-88    
ref|XP_006280329.1|  hypothetical protein CARUB_v10026252mg             294   2e-88    
dbj|BAK06844.1|  predicted protein                                      295   2e-88    
ref|XP_005188230.1|  PREDICTED: protein Malvolio-like isoform X3        296   2e-88    
ref|XP_005188231.1|  PREDICTED: protein Malvolio-like isoform X4        296   3e-88    
ref|XP_007420784.1|  PREDICTED: natural resistance-associated mac...    294   3e-88    
ref|XP_002880485.1|  predicted protein                                  293   3e-88    
ref|XP_010028144.1|  PREDICTED: metal transporter Nramp3                294   3e-88    
ref|XP_008351981.1|  PREDICTED: metal transporter Nramp2-like           294   3e-88    
ref|XP_008780919.1|  PREDICTED: metal transporter Nramp6-like           294   3e-88    
ref|XP_005188228.1|  PREDICTED: protein Malvolio-like isoform X1        296   4e-88    
ref|XP_001600967.1|  PREDICTED: protein Malvolio-like                   296   4e-88    
ref|XP_010472314.1|  PREDICTED: metal transporter Nramp3                293   4e-88    
ref|XP_005188229.1|  PREDICTED: protein Malvolio-like isoform X2        296   4e-88    
gb|EZA59942.1|  hypothetical protein X777_16145                         295   4e-88    
gb|KFW76278.1|  Natural resistance-associated macrophage protein 2      291   4e-88    
ref|XP_010105472.1|  Metal transporter Nramp2                           294   4e-88    
ref|XP_010479120.1|  PREDICTED: metal transporter Nramp2-like           294   4e-88    
ref|XP_009360261.1|  PREDICTED: metal transporter Nramp2-like           294   4e-88    
ref|XP_010429259.1|  PREDICTED: metal transporter Nramp3                293   5e-88    
ref|XP_007222320.1|  hypothetical protein PRUPE_ppa003966mg             294   5e-88    
ref|XP_007420783.1|  PREDICTED: natural resistance-associated mac...    295   5e-88    
ref|XP_006616726.1|  PREDICTED: protein Malvolio-like isoform X2        295   5e-88    
ref|XP_008393759.1|  PREDICTED: metal transporter Nramp2-like           294   5e-88    
ref|XP_003485198.1|  PREDICTED: protein Malvolio-like                   295   5e-88    
gb|EYU44458.1|  hypothetical protein MIMGU_mgv1a004774mg                293   6e-88    
ref|XP_004453731.1|  PREDICTED: natural resistance-associated mac...    295   6e-88    
ref|XP_008238525.1|  PREDICTED: metal transporter Nramp3                293   7e-88    
ref|XP_010464211.1|  PREDICTED: metal transporter Nramp4-like           293   7e-88    
ref|XP_006829295.1|  hypothetical protein AMTR_s00001p00273040          293   8e-88    
ref|XP_010879451.1|  PREDICTED: natural resistance-associated mac...    294   8e-88    
ref|XP_006404784.1|  hypothetical protein EUTSA_v10000132mg             293   8e-88    
ref|XP_010059862.1|  PREDICTED: metal transporter Nramp2-like           293   8e-88    
ref|NP_179896.1|  metal transporter Nramp3                              292   8e-88    
ref|XP_010444665.1|  PREDICTED: metal transporter Nramp4                293   9e-88    
ref|XP_007047433.1|  Natural resistance-associated macrophage pro...    292   9e-88    
ref|XP_006386486.1|  hypothetical protein POPTR_0002s12200g             291   9e-88    
ref|XP_010879449.1|  PREDICTED: natural resistance-associated mac...    294   9e-88    
ref|XP_003611648.1|  Natural resistance-associated macrophage pro...    292   1e-87    
ref|XP_008555613.1|  PREDICTED: protein Malvolio isoform X2             295   1e-87    
ref|XP_006393930.1|  hypothetical protein EUTSA_v10004033mg             292   1e-87    
ref|XP_008555611.1|  PREDICTED: protein Malvolio isoform X1             295   1e-87    
ref|XP_004692806.1|  PREDICTED: natural resistance-associated mac...    293   1e-87    
ref|XP_004292748.1|  PREDICTED: metal transporter Nramp2-like           293   1e-87    
ref|XP_010484517.1|  PREDICTED: metal transporter Nramp4-like           292   1e-87    
ref|XP_003694454.1|  PREDICTED: protein Malvolio-like                   294   1e-87    
ref|WP_020248904.1|  hypothetical protein                               295   1e-87    
ref|XP_003517323.1|  PREDICTED: metal transporter Nramp3-like           292   1e-87    
ref|XP_002866708.1|  metal transporter Nramp4                           292   1e-87    
ref|XP_010879448.1|  PREDICTED: natural resistance-associated mac...    294   1e-87    
ref|XP_004511877.1|  PREDICTED: metal transporter Nramp3-like           292   1e-87    
gb|AAB61961.1|  integral membrane protein                               290   1e-87    
ref|XP_009117297.1|  PREDICTED: metal transporter Nramp3                292   1e-87    
gb|EGI70861.1|  Protein Malvolio                                        293   2e-87    
gb|AAA82593.1|  malvolio                                                291   2e-87    
ref|XP_006616725.1|  PREDICTED: protein Malvolio-like isoform X1        295   2e-87    
ref|WP_011687308.1|  iron transporter                                   295   2e-87    
gb|EEC75719.1|  hypothetical protein OsI_12567                          291   2e-87    
ref|XP_009052584.1|  hypothetical protein LOTGIDRAFT_143684             291   2e-87    
gb|AAF13278.1|AF202539_1  metal transporter Nramp3                      291   2e-87    
ref|XP_001994131.1|  GH23182                                            294   2e-87    
ref|XP_003294053.1|  natural resistance-associated macrophage pro...    292   2e-87    
ref|XP_011049749.1|  PREDICTED: protein Malvolio isoform X3             293   2e-87    
tpg|DAA47240.1|  TPA: hypothetical protein ZEAMMB73_011944              292   2e-87    
ref|XP_005804321.1|  PREDICTED: natural resistance-associated mac...    293   2e-87    
ref|XP_006294004.1|  hypothetical protein CARUB_v10022990mg             292   2e-87    
ref|XP_623946.2|  PREDICTED: protein Malvolio isoform X3                293   2e-87    
gb|EEC74730.1|  hypothetical protein OsI_10466                          291   2e-87    
ref|XP_009133991.1|  PREDICTED: metal transporter Nramp3                291   2e-87    
ref|XP_010939679.1|  PREDICTED: metal transporter Nramp6-like           293   2e-87    
ref|XP_002443431.1|  hypothetical protein SORBIDRAFT_08g019400          292   2e-87    
ref|XP_011049741.1|  PREDICTED: protein Malvolio isoform X2             293   3e-87    
gb|AAN77306.1|  Putative integral membrane protein                      290   3e-87    
emb|CDY12837.1|  BnaC07g15960D                                          295   3e-87    
gb|EGW10510.1|  Natural resistance-associated macrophage protein 2      290   3e-87    
ref|XP_010547534.1|  PREDICTED: metal transporter Nramp4                291   3e-87    
ref|XP_006563114.1|  PREDICTED: protein Malvolio isoform X1             293   3e-87    
ref|XP_008354049.1|  PREDICTED: metal transporter Nramp3-like           291   3e-87    
emb|CDS16751.1|  divalent metal transporter DMT1B                       293   3e-87    
ref|XP_007561255.1|  PREDICTED: natural resistance-associated mac...    292   4e-87    
ref|XP_008101734.1|  PREDICTED: natural resistance-associated mac...    293   4e-87    
emb|CDY21478.1|  BnaC03g27190D                                          290   4e-87    
ref|XP_011049686.1|  PREDICTED: protein Malvolio isoform X1             293   4e-87    
gb|AAW47269.1|  Nramp metal transporter-like protein                    291   4e-87    
ref|XP_007561253.1|  PREDICTED: natural resistance-associated mac...    292   4e-87    
ref|XP_008108433.1|  PREDICTED: natural resistance-associated mac...    291   4e-87    
gb|EZA44716.1|  protein Malvolio-like protein                           294   5e-87    
ref|XP_007561252.1|  PREDICTED: natural resistance-associated mac...    292   5e-87    
ref|XP_005908744.1|  PREDICTED: natural resistance-associated mac...    291   5e-87    
gb|KDO81583.1|  hypothetical protein CISIN_1g009526mg                   291   5e-87    
gb|AAF13279.1|AF202540_1  metal transporter Nramp4                      290   5e-87    
gb|ABR27746.1|  metal transporter NRAMP3                                290   5e-87    
ref|NP_201534.1|  metal transporter Nramp4                              290   5e-87    
ref|XP_006581255.1|  PREDICTED: metal transporter Nramp2-like iso...    289   5e-87    
ref|XP_002000579.1|  GI10306                                            293   5e-87    
ref|XP_008338402.1|  PREDICTED: metal transporter Nramp3-like           290   5e-87    
ref|XP_009367820.1|  PREDICTED: metal transporter Nramp3-like           290   5e-87    
ref|XP_002302424.2|  hypothetical protein POPTR_0002s12200g             291   6e-87    
gb|KHF99297.1|  Metal transporter Nramp2 -like protein                  291   6e-87    
ref|XP_002096501.1|  Mvl                                                293   6e-87    
ref|XP_006472260.1|  PREDICTED: metal transporter Nramp2-like iso...    291   7e-87    
ref|XP_004501538.1|  PREDICTED: metal transporter Nramp2-like           291   7e-87    
ref|XP_002465667.1|  hypothetical protein SORBIDRAFT_01g043400          290   7e-87    
ref|XP_008358309.1|  PREDICTED: metal transporter Nramp3-like           290   7e-87    
ref|XP_004347021.1|  ferrous ion membrane transporter DMT1              292   7e-87    
ref|XP_009346707.1|  PREDICTED: metal transporter Nramp3-like           290   7e-87    
ref|XP_004692805.1|  PREDICTED: natural resistance-associated mac...    292   7e-87    
emb|CDX76871.1|  BnaC08g34570D                                          290   8e-87    
ref|XP_003523990.1|  PREDICTED: metal transporter Nramp2-like           290   8e-87    
ref|XP_009123511.1|  PREDICTED: metal transporter Nramp2-like           290   9e-87    
emb|CDX83202.1|  BnaA03g23040D                                          291   9e-87    
gb|ADB91426.1|  MIP15667p                                               292   1e-86    
ref|XP_004151871.1|  PREDICTED: metal transporter Nramp4-like           290   1e-86    
ref|XP_008101733.1|  PREDICTED: natural resistance-associated mac...    292   1e-86    
ref|NP_001049330.1|  Os03g0208500                                       290   1e-86    
gb|ESA02266.1|  hypothetical protein GLOINDRAFT_337501                  289   1e-86    
ref|XP_003790423.1|  PREDICTED: natural resistance-associated mac...    290   1e-86    
emb|CDJ04494.1|  divalent metal transporter DMT1B                       292   1e-86    
ref|XP_008072290.1|  PREDICTED: natural resistance-associated mac...    291   1e-86    
ref|XP_008101731.1|  PREDICTED: natural resistance-associated mac...    292   1e-86    
ref|XP_004985263.1|  PREDICTED: metal transporter Nramp2-like           290   1e-86    
ref|XP_009336076.1|  PREDICTED: metal transporter Nramp3                289   1e-86    
ref|XP_001751446.1|  predicted protein                                  290   1e-86    
ref|XP_010566825.1|  PREDICTED: natural resistance-associated mac...    291   1e-86    
ref|XP_010550345.1|  PREDICTED: metal transporter Nramp4-like           289   1e-86    
gb|KFW01444.1|  Natural resistance-associated macrophage protein 2      288   1e-86    
ref|NP_001121912.1|  natural resistance-associated macrophage pro...    291   1e-86    



>ref|XP_011003423.1| PREDICTED: metal transporter Nramp5-like [Populus euphratica]
 ref|XP_011003424.1| PREDICTED: metal transporter Nramp5-like [Populus euphratica]
 ref|XP_011003426.1| PREDICTED: metal transporter Nramp5-like [Populus euphratica]
Length=553

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/487 (84%), Positives = 452/487 (93%), Gaps = 0/487 (0%)
 Frame = +2

Query  143   LDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVF  322
             L+L++ +++KPGWRKFLSYVGPGF+VSLAYLDPGNLETDLQAGA+HRYELLWV+LIGL+F
Sbjct  41    LELEDPNHQKPGWRKFLSYVGPGFLVSLAYLDPGNLETDLQAGANHRYELLWVILIGLIF  100

Query  323   ALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNI  502
             ALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAE+AVIAADIPEVIGTAFALNI
Sbjct  101   ALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAEIAVIAADIPEVIGTAFALNI  160

Query  503   LFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDV  682
             LFHIP+WVGVLCTG STLLLL LQ+YGVRKLELLIAVLVF+MAACFFGEM YVKP A  V
Sbjct  161   LFHIPVWVGVLCTGCSTLLLLGLQKYGVRKLELLIAVLVFIMAACFFGEMGYVKPSATGV  220

Query  683   FKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIE  862
              KGMFIPKLSGQGAT DAIALLGAL+MPHNLFLHSALVL+RK+PNS RG+NDACRYFLIE
Sbjct  221   LKGMFIPKLSGQGATGDAIALLGALIMPHNLFLHSALVLSRKMPNSARGINDACRYFLIE  280

Query  863   SGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVY  1042
             SGFALF+AFLIN+AV+SVSGTVCS   LS ++ D C DL+LNSASFLL+NVLGKSSS +Y
Sbjct  281   SGFALFIAFLINLAVISVSGTVCSAQNLSSENADRCGDLTLNSASFLLQNVLGKSSSKIY  340

Query  1043  AIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssga  1222
             AIALLASGQSSTITGTYAGQYIMQGFL+LKM+KW RNL+TRCIAI PSL+VSIIGGSSGA
Sbjct  341   AIALLASGQSSTITGTYAGQYIMQGFLELKMRKWIRNLVTRCIAIAPSLVVSIIGGSSGA  400

Query  1223  grliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyyl  1402
             GRLIIIASMILSFELPFALIPLLKFSSS+TKMGP+KNSIYIIV+SWILGLGIIGINIYYL
Sbjct  401   GRLIIIASMILSFELPFALIPLLKFSSSTTKMGPHKNSIYIIVISWILGLGIIGINIYYL  460

Query  1403  sTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMD  1582
             ST FV WLI NNLPK GNV + I+VFPLMAIY++AVIYL FRKD VVTF+ PN +D + +
Sbjct  461   STGFVGWLIDNNLPKVGNVFIAIIVFPLMAIYILAVIYLTFRKDSVVTFLGPNKNDPQQE  520

Query  1583  NNVNNNV  1603
              N+ N +
Sbjct  521   ANMENGL  527



>ref|XP_011102329.1| PREDICTED: metal transporter Nramp5-like isoform X1 [Sesamum 
indicum]
Length=544

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/528 (81%), Positives = 470/528 (89%), Gaps = 14/528 (3%)
 Frame = +2

Query  20    MGSLqqqqagvvgggSHRIVAVDEsplpssnnnpDSINKLQLDLQEE-HNKKPGWRKFLS  196
             MGSLQQQQ    GG +HRIV+V E+               + D ++    +KPGWR FLS
Sbjct  1     MGSLQQQQGSGAGGNNHRIVSVAET---------PPAGSREFDGKDYVLAEKPGWRNFLS  51

Query  197   YVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAANLGVSTGKH  376
             YVGPGF+VSLAYLDPGNLETDLQAGA+H YELLWV+LIGL+FALIIQSLAANLGVSTGKH
Sbjct  52    YVGPGFLVSLAYLDPGNLETDLQAGANHGYELLWVILIGLIFALIIQSLAANLGVSTGKH  111

Query  377   LSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvgvlctglstl  556
             LSELCKAEYP  VKYCLW+LAE+AVIAADIPEVIGTAFALNILFHIP+WVGVLCTG STL
Sbjct  112   LSELCKAEYPMLVKYCLWVLAEVAVIAADIPEVIGTAFALNILFHIPVWVGVLCTGCSTL  171

Query  557   lllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADA  736
             LL+ LQ+YGVRKLELLIA+LVF+MAACFFGE++YVKPPA  V KGMFIPKLSG+ AT DA
Sbjct  172   LLIGLQKYGVRKLELLIAILVFIMAACFFGELSYVKPPATKVIKGMFIPKLSGKSATGDA  231

Query  737   IALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAFLINVAVVSV  916
             IALLGALVMPHNLFLHSALVL+RK+PNSVRG+NDACRYFLIESGFALFVAFLINVAVVSV
Sbjct  232   IALLGALVMPHNLFLHSALVLSRKIPNSVRGINDACRYFLIESGFALFVAFLINVAVVSV  291

Query  917   SGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYA  1096
             SGTVCS   LS ++ DHC DL+LNSASFLLKNVLG+SSSTVYAIALLASGQSSTITGTYA
Sbjct  292   SGTVCSADNLSSENKDHCDDLTLNSASFLLKNVLGRSSSTVYAIALLASGQSSTITGTYA  351

Query  1097  GQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasMILSFELPFA  1276
             GQ+IMQGFLDLKM+KW RNLMTRCIAITPSLIVSIIGGSSGAGRLIIIASMILSFELPFA
Sbjct  352   GQFIMQGFLDLKMRKWIRNLMTRCIAITPSLIVSIIGGSSGAGRLIIIASMILSFELPFA  411

Query  1277  LIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLIHNNLPKAGN  1456
             LIPLLKFSSSSTKMGP+KNSIYIIVVSWILGLGIIGIN+YYL T FVDWL+HN+LPK GN
Sbjct  412   LIPLLKFSSSSTKMGPHKNSIYIIVVSWILGLGIIGINVYYLITGFVDWLMHNSLPKVGN  471

Query  1457  VLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDD----SKMDNN  1588
             V +G++VFPLM +YVV+VIYLMFRKDKVVTFI+P   D    ++M+N 
Sbjct  472   VFIGMIVFPLMGVYVVSVIYLMFRKDKVVTFIEPTKLDPVAQTRMENG  519



>ref|XP_004149810.1| PREDICTED: metal transporter Nramp5-like [Cucumis sativus]
 ref|XP_004160719.1| PREDICTED: metal transporter Nramp5-like [Cucumis sativus]
 gb|KGN47700.1| hypothetical protein Csa_6G382880 [Cucumis sativus]
Length=549

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/507 (81%), Positives = 456/507 (90%), Gaps = 11/507 (2%)
 Frame = +2

Query  152   QEEHN---KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVF  322
             QE  N   +KPGWRKFLSYVGPGF+VSLAYLDPGNLETDLQAGA+H +ELLWVVLIGL+F
Sbjct  38    QEGKNTTHQKPGWRKFLSYVGPGFLVSLAYLDPGNLETDLQAGANHGFELLWVVLIGLIF  97

Query  323   ALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNI  502
             ALIIQSLAANLGVSTGKHLSE+CKAEYPK+VKYCLWLLAE+AVIAADIPEVIGTAFALNI
Sbjct  98    ALIIQSLAANLGVSTGKHLSEVCKAEYPKFVKYCLWLLAEVAVIAADIPEVIGTAFALNI  157

Query  503   LFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDV  682
             LFHIP+W GVL TGLSTLLLL LQRYG RKLELLIA+LVF+MAACFFGEM+YVKPPA  V
Sbjct  158   LFHIPVWAGVLLTGLSTLLLLGLQRYGARKLELLIAILVFVMAACFFGEMSYVKPPASGV  217

Query  683   FKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIE  862
              KGMF+PKL G+GATADAIALLGALVMPHNLFLHSALVL+RKVPNSVRG+NDACRYFLIE
Sbjct  218   LKGMFVPKLKGEGATADAIALLGALVMPHNLFLHSALVLSRKVPNSVRGINDACRYFLIE  277

Query  863   SGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVY  1042
             SG ALF+AFLINVAVVSVSGTVC+ G +++   D CSD++LNSASFLL+NVLGKSSST+Y
Sbjct  278   SGIALFIAFLINVAVVSVSGTVCTVGNVTQTTADQCSDITLNSASFLLQNVLGKSSSTIY  337

Query  1043  AIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssga  1222
             AIAL ASGQSS+ITGTYAGQ+IMQGFLDLKMK W+RNLMTR IAITPSLIVSIIGG  GA
Sbjct  338   AIALFASGQSSSITGTYAGQFIMQGFLDLKMKTWARNLMTRSIAITPSLIVSIIGGPQGA  397

Query  1223  grliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyyl  1402
             GRLIIIASMILSFELPFALIPLLKFSSSSTKMGP+KNSIYIIV+SWILGL IIGINIYYL
Sbjct  398   GRLIIIASMILSFELPFALIPLLKFSSSSTKMGPHKNSIYIIVISWILGLAIIGINIYYL  457

Query  1403  sTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDD----  1570
             STAFVDWLIHNNLPK  NV +GI VFPLMA Y+ AVIYLMFRKD+VVT+I+P  DD    
Sbjct  458   STAFVDWLIHNNLPKVANVFIGIAVFPLMAAYIGAVIYLMFRKDRVVTYIEPEKDDAVAQ  517

Query  1571  SKMDNNVNNNVC---MTPID-HNDFSH  1639
             + +++ +NN+     +TP+    D +H
Sbjct  518   AHLESGLNNSFGPRDVTPLPFREDLAH  544



>ref|XP_008459158.1| PREDICTED: metal transporter Nramp5-like [Cucumis melo]
 ref|XP_008459159.1| PREDICTED: metal transporter Nramp5-like [Cucumis melo]
Length=549

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/537 (78%), Positives = 466/537 (87%), Gaps = 21/537 (4%)
 Frame = +2

Query  65    SHRIVAVDEsplpssnnnpDSINKLQL-DLQEEHN---KKPGWRKFLSYVGPGFMVSLAY  232
             S+RI AV+             IN + L + QEE N   +KPGWRKF+S+VGPGF+VSLAY
Sbjct  17    SNRIAAVN---------ITTPINAVNLQNHQEEKNTTHQKPGWRKFVSHVGPGFLVSLAY  67

Query  233   LDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKY  412
             LDPGNLETDLQAGA+H +ELLWVVLIGL+FALIIQSLAANLGVSTGKHLSE+CKAEYP +
Sbjct  68    LDPGNLETDLQAGANHGFELLWVVLIGLIFALIIQSLAANLGVSTGKHLSEVCKAEYPIF  127

Query  413   VKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvgvlctglstllllslQRYGVRK  592
             VKYCLWLLAE+AVIAADIPEVIGTAFALNILFHIP+W GVL TGLSTLLLL LQRYG RK
Sbjct  128   VKYCLWLLAEVAVIAADIPEVIGTAFALNILFHIPVWAGVLLTGLSTLLLLGLQRYGARK  187

Query  593   LELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHN  772
             LELLIA+LVF+MAACFFGEM+YVKPPA  V KGMF+PKL G+GATADAIALLGALVMPHN
Sbjct  188   LELLIAILVFVMAACFFGEMSYVKPPASSVLKGMFVPKLKGEGATADAIALLGALVMPHN  247

Query  773   LFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSK  952
             LFLHSALVL+RKVPNSVRG+NDACRYFLIESG ALF+AFLINVAVVSVSGTVC+ G +++
Sbjct  248   LFLHSALVLSRKVPNSVRGINDACRYFLIESGIALFIAFLINVAVVSVSGTVCTVGNVAQ  307

Query  953   DDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLK  1132
                D CSD++LNSASFLL+NVLGKSSST+YAIAL ASGQSS+ITGTYAGQ+IMQGFLDLK
Sbjct  308   TTADQCSDITLNSASFLLQNVLGKSSSTIYAIALFASGQSSSITGTYAGQFIMQGFLDLK  367

Query  1133  MKKWSRNLMTRCIAITPslivsiiggssgagrliiiasMILSFELPFALIPLLKFSSSST  1312
             MK W+RNLMTR IAITPSLIVSIIGG  GAGRLIIIASMILSFELPFALIPLLKFSSSST
Sbjct  368   MKTWARNLMTRSIAITPSLIVSIIGGPQGAGRLIIIASMILSFELPFALIPLLKFSSSST  427

Query  1313  KMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMA  1492
             KMGP+KNSIYIIV+SWILGL IIGINIYYLSTAFVDWLIHNNL K  NV +GI VFPLMA
Sbjct  428   KMGPHKNSIYIIVISWILGLAIIGINIYYLSTAFVDWLIHNNLHKVANVFIGIAVFPLMA  487

Query  1493  IYVVAVIYLMFRKDKVVTFIQPNDDD----SKMDNNVNNNVC---MTPID-HNDFSH  1639
              Y+ AVIYLMFRKD+VVT+I+P  DD    + ++  +NN+     +TP+    D +H
Sbjct  488   AYIGAVIYLMFRKDRVVTYIEPEKDDAMAQAHLETGLNNSFGPRDVTPVPFREDLAH  544



>ref|XP_006473026.1| PREDICTED: metal transporter Nramp5-like [Citrus sinensis]
Length=559

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/485 (84%), Positives = 447/485 (92%), Gaps = 4/485 (1%)
 Frame = +2

Query  155   EEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALII  334
             + ++KKPGWR+FLS+VGPGF+VSLAYLDPGNLETDLQAGA+HRYELLWVVLIGL+FALII
Sbjct  53    DPNHKKPGWRRFLSFVGPGFLVSLAYLDPGNLETDLQAGANHRYELLWVVLIGLIFALII  112

Query  335   QSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHI  514
             QSLAANLGVSTGKHLSELCKAEYP  VKYCLWLLAE+AVIAADIPEVIGTAFALNILF+I
Sbjct  113   QSLAANLGVSTGKHLSELCKAEYPIIVKYCLWLLAEIAVIAADIPEVIGTAFALNILFNI  172

Query  515   PLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGM  694
             P+WVGVL TG STLLLL LQ+YGVRKLE+LI VLVF+MAACFFGEM+YVKPPA DV KGM
Sbjct  173   PVWVGVLLTGGSTLLLLGLQKYGVRKLEMLITVLVFIMAACFFGEMSYVKPPAADVLKGM  232

Query  695   FIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFA  874
             F+PKLSGQGAT DAIALLGALVMPHNLFLHSALVL+RKVPNSVRG+NDACR+FLIESG A
Sbjct  233   FVPKLSGQGATGDAIALLGALVMPHNLFLHSALVLSRKVPNSVRGINDACRFFLIESGLA  292

Query  875   LFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIAL  1054
             L VAFLINVAV+SVSGTVCS   LS D+   CSD++LNSASFLL+NVLGKSS  VYAIAL
Sbjct  293   LLVAFLINVAVISVSGTVCSATNLSNDNKHQCSDITLNSASFLLQNVLGKSSKIVYAIAL  352

Query  1055  LASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrli  1234
             LASGQSSTITGTYAGQYIMQGFL+LKM+KW RNLMTRCIAITPSLIVSIIGGS GAGRLI
Sbjct  353   LASGQSSTITGTYAGQYIMQGFLELKMRKWLRNLMTRCIAITPSLIVSIIGGSQGAGRLI  412

Query  1235  iiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAF  1414
             IIASMILSFELPFALIPLLKFSSS+TKMGP+KNSIYIIV+SWILGLGIIGINIYYLST F
Sbjct  413   IIASMILSFELPFALIPLLKFSSSATKMGPHKNSIYIIVISWILGLGIIGINIYYLSTGF  472

Query  1415  VDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDD----SKMD  1582
             VDWLIHN+LPK GNV +GI+VFPLMA+Y++AVIYL FRKD VVTFI P  DD    ++M+
Sbjct  473   VDWLIHNSLPKVGNVFIGIIVFPLMAVYMIAVIYLTFRKDTVVTFIDPTKDDTAAQTRME  532

Query  1583  NNVNN  1597
               + N
Sbjct  533   TGLGN  537



>ref|XP_006434252.1| hypothetical protein CICLE_v10000736mg [Citrus clementina]
 gb|ESR47492.1| hypothetical protein CICLE_v10000736mg [Citrus clementina]
Length=559

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/485 (84%), Positives = 447/485 (92%), Gaps = 4/485 (1%)
 Frame = +2

Query  155   EEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALII  334
             + ++KKPGWR+FLS+VGPGF+VSLAYLDPGNLETDLQAGA+HRYELLWVVLIGL+FALII
Sbjct  53    DPNHKKPGWRRFLSFVGPGFLVSLAYLDPGNLETDLQAGANHRYELLWVVLIGLIFALII  112

Query  335   QSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHI  514
             QSLAANLGVSTGKHLSELCKAEYP  VKYCLWLLAE+AVIAADIPEVIGTAFALNILF+I
Sbjct  113   QSLAANLGVSTGKHLSELCKAEYPIIVKYCLWLLAEIAVIAADIPEVIGTAFALNILFNI  172

Query  515   PLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGM  694
             P+W+GVL TG STLLLL LQ+YGVRKLE+LI VLVF+MAACFFGEM+YVKPPA DV KGM
Sbjct  173   PVWIGVLLTGGSTLLLLGLQKYGVRKLEMLITVLVFIMAACFFGEMSYVKPPAADVLKGM  232

Query  695   FIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFA  874
             F+PKLSGQGAT DAIALLGALVMPHNLFLHSALVL+RKVPNSVRG+NDACR+FLIESG A
Sbjct  233   FVPKLSGQGATGDAIALLGALVMPHNLFLHSALVLSRKVPNSVRGINDACRFFLIESGLA  292

Query  875   LFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIAL  1054
             L VAFLINVAV+SVSGTVCS   LS D+   CSD++LNSASFLL+NVLGKSS  VYAIAL
Sbjct  293   LLVAFLINVAVISVSGTVCSAANLSYDNKHQCSDITLNSASFLLQNVLGKSSKIVYAIAL  352

Query  1055  LASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrli  1234
             LASGQSSTITGTYAGQYIMQGFL+LKM+KW RNLMTRCIAITPSL+VSIIGGS GAGRLI
Sbjct  353   LASGQSSTITGTYAGQYIMQGFLELKMRKWLRNLMTRCIAITPSLVVSIIGGSQGAGRLI  412

Query  1235  iiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAF  1414
             IIASMILSFELPFALIPLLKFSSS+TKMGP+KNSIYIIV+SWILGLGIIGINIYYLST F
Sbjct  413   IIASMILSFELPFALIPLLKFSSSATKMGPHKNSIYIIVISWILGLGIIGINIYYLSTGF  472

Query  1415  VDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDD----SKMD  1582
             VDWLIHN+LPK GNV +GI+VFPLMA+Y++AVIYL FRKD VVTFI P  DD    ++M+
Sbjct  473   VDWLIHNSLPKVGNVFIGIIVFPLMAVYMIAVIYLTFRKDTVVTFIDPTKDDPAAQTRME  532

Query  1583  NNVNN  1597
               + N
Sbjct  533   TGLGN  537



>ref|NP_001234318.1| root-specific metal transporter [Solanum lycopersicum]
 gb|AAP21818.1| root-specific metal transporter [Solanum lycopersicum]
Length=530

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/484 (85%), Positives = 449/484 (93%), Gaps = 2/484 (0%)
 Frame = +2

Query  146   DLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFA  325
             D   EH K  GW+ F +YVGPGF+VSLAYLDPGNLETDLQAGA+HRYELLWV+LIGL+FA
Sbjct  29    DHHIEHQKH-GWKNFFAYVGPGFLVSLAYLDPGNLETDLQAGANHRYELLWVILIGLIFA  87

Query  326   LIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNIL  505
             LIIQSLAANLGVSTGKHLSELC+AEYP +VKYCLWLLAE+AVIAADIPEVIGTAFALNIL
Sbjct  88    LIIQSLAANLGVSTGKHLSELCRAEYPVFVKYCLWLLAEVAVIAADIPEVIGTAFALNIL  147

Query  506   FHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVF  685
             FHIP+W GVLCTG+STLL + LQRYGVRKLELLIA+LVF+MAACFFGEM+YVKPPA ++F
Sbjct  148   FHIPVWAGVLCTGVSTLLFIGLQRYGVRKLELLIAILVFVMAACFFGEMSYVKPPANELF  207

Query  686   KGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIES  865
             KGMFIPKL+G GATADAIALLGALVMPHNLFLHSALVL+RK+PNSVRG+NDAC++FLIES
Sbjct  208   KGMFIPKLNGDGATADAIALLGALVMPHNLFLHSALVLSRKIPNSVRGINDACKFFLIES  267

Query  866   GFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYA  1045
             GFALFV+FLINVAVVSVSGTVC    LS  + + CSD++LNSASFLLKNVLGKSSSTVYA
Sbjct  268   GFALFVSFLINVAVVSVSGTVCGADNLSDQNKESCSDITLNSASFLLKNVLGKSSSTVYA  327

Query  1046  IALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgag  1225
             IALLASGQSSTITGTYAGQ+IMQGFLDLKMK W RNL TR IAITPSL+VSIIGGSSGAG
Sbjct  328   IALLASGQSSTITGTYAGQFIMQGFLDLKMKTWLRNLFTRLIAITPSLVVSIIGGSSGAG  387

Query  1226  rliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyyls  1405
             RLIIIASMILSFELPFALIPLLKFSSSSTK+GP+KNSIYIIV+SWILGLGIIGINIYYLS
Sbjct  388   RLIIIASMILSFELPFALIPLLKFSSSSTKLGPHKNSIYIIVISWILGLGIIGINIYYLS  447

Query  1406  TAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMDN  1585
             TAFV WLI NNLPK GNVL+GIVVFPLMAIY++AVIYLMFRKDKVVT+I P  DD  M+N
Sbjct  448   TAFVGWLISNNLPKVGNVLIGIVVFPLMAIYILAVIYLMFRKDKVVTYIDPIKDD-HMEN  506

Query  1586  NVNN  1597
              +N+
Sbjct  507   GINS  510



>gb|KDP32832.1| hypothetical protein JCGZ_12124 [Jatropha curcas]
Length=546

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/492 (82%), Positives = 449/492 (91%), Gaps = 4/492 (1%)
 Frame = +2

Query  164   NKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSL  343
             ++KPGWR FLSYVGPGF+VSLAYLDPGNLETD+QAGA+H YELLWV+LIGL+FALIIQSL
Sbjct  41    HQKPGWRNFLSYVGPGFLVSLAYLDPGNLETDMQAGANHGYELLWVILIGLIFALIIQSL  100

Query  344   AANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLW  523
             AANLGVSTGKHLSELCKAEYPKYVK CLWLLAE+AVIAADIPEVIGTAFALNILF+IP+W
Sbjct  101   AANLGVSTGKHLSELCKAEYPKYVKLCLWLLAEVAVIAADIPEVIGTAFALNILFNIPVW  160

Query  524   vgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIP  703
             VGVL TG STLLLL LQRYGVRKLELLIA+LVF+MA CFFGEM+YVKPPA +V KGMFIP
Sbjct  161   VGVLITGCSTLLLLGLQRYGVRKLELLIAILVFIMAGCFFGEMSYVKPPAVEVIKGMFIP  220

Query  704   KLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFV  883
             +L G GAT DAIALLGALVMPHNLFLHSALVL+RKVPNSVRG+NDACR+FLIESGFALFV
Sbjct  221   RLKGSGATGDAIALLGALVMPHNLFLHSALVLSRKVPNSVRGINDACRFFLIESGFALFV  280

Query  884   AFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLAS  1063
             AFLIN++++SV+ TVC +  L+  D+D CSDL+LNSASFLL+NVLG+SSST+YAIALLAS
Sbjct  281   AFLINLSIISVTATVCLSKNLAPGDVDRCSDLNLNSASFLLQNVLGRSSSTIYAIALLAS  340

Query  1064  GQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiia  1243
             GQSSTITGTYAGQYIMQGFLDLKMKKW+RNLMTRCIAI PSL+VSIIGGSSGAGRLIIIA
Sbjct  341   GQSSTITGTYAGQYIMQGFLDLKMKKWTRNLMTRCIAIAPSLVVSIIGGSSGAGRLIIIA  400

Query  1244  sMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDW  1423
             SMILSFELPFALIPLLKFSS STKMGPYKNSIY+IV+SW LGL IIGINIYYLST FVDW
Sbjct  401   SMILSFELPFALIPLLKFSSGSTKMGPYKNSIYVIVISWTLGLMIIGINIYYLSTGFVDW  460

Query  1424  LIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDD----SKMDNNV  1591
             LIHNNLPK GNV +GI+VFPLMAIY+++VIYL FRKD VVT+I+P +D+    + M++ +
Sbjct  461   LIHNNLPKVGNVFIGIIVFPLMAIYIISVIYLTFRKDTVVTYIEPVNDEQIGQATMESGL  520

Query  1592  NNNVCMTPIDHN  1627
               +     IDH 
Sbjct  521   KKSGDPLEIDHQ  532



>ref|XP_002307453.2| hypothetical protein POPTR_0005s20320g [Populus trichocarpa]
 gb|EEE94449.2| hypothetical protein POPTR_0005s20320g [Populus trichocarpa]
Length=569

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/508 (78%), Positives = 444/508 (87%), Gaps = 21/508 (4%)
 Frame = +2

Query  143   LDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVF  322
             LDL++ +++KPGWRKFLSYVGPGF+VSLAYLDPGNLETDLQAGA+HRYELLWV+LIGL+F
Sbjct  42    LDLEDPNHQKPGWRKFLSYVGPGFLVSLAYLDPGNLETDLQAGANHRYELLWVILIGLIF  101

Query  323   ALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPE----------  472
             ALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAE+AVIAADIPE          
Sbjct  102   ALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAEIAVIAADIPEGIISSLLYYF  161

Query  473   --------VIGTAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLM  628
                     +IGTAFALNILFHIP+WVGVLCTG STLLLL LQ+YGVRKLELLIAVLVF+M
Sbjct  162   KLILDTYLLIGTAFALNILFHIPVWVGVLCTGCSTLLLLGLQKYGVRKLELLIAVLVFVM  221

Query  629   AACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRK  808
             AACFFGEM+YVKP A DV KGMFIPKLSGQGAT DAIALLGAL+MPHNLFLHSALVL+RK
Sbjct  222   AACFFGEMSYVKPSATDVLKGMFIPKLSGQGATGDAIALLGALIMPHNLFLHSALVLSRK  281

Query  809   VPNSVRGVNDACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLN  988
             +PNSVRG+NDACRYFLIESGFALF+AFLIN+AV+SVSGTVCS   LS ++ D C DL+LN
Sbjct  282   MPNSVRGINDACRYFLIESGFALFIAFLINLAVISVSGTVCSAQNLSSENADRCGDLTLN  341

Query  989   SASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRC  1168
             SASFLL+NVLGKSSS +YAIALLASGQSSTITGTYAGQYIMQGFL+LKM+KW RNL+TRC
Sbjct  342   SASFLLQNVLGKSSSKIYAIALLASGQSSTITGTYAGQYIMQGFLELKMRKWIRNLVTRC  401

Query  1169  IAITPslivsi---iggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSI  1339
             IAI PSL+VSI     G+     +  +  MILSFELPFALIPLLKFSSS+TKMGP+KNSI
Sbjct  402   IAIAPSLVVSIIGGSSGAGRLIIIASVLQMILSFELPFALIPLLKFSSSTTKMGPHKNSI  461

Query  1340  YiivvswilglgiiginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYL  1519
             YIIV+SWILGLGIIG+NIYYLST FV WLI NNLPK GNV +GI+VFPLMAIY++AVIYL
Sbjct  462   YIIVISWILGLGIIGVNIYYLSTGFVGWLIDNNLPKVGNVFIGIIVFPLMAIYILAVIYL  521

Query  1520  MFRKDKVVTFIQPNDDDSKMDNNVNNNV  1603
              FRKD VVTF+ PN +D +   N+ N +
Sbjct  522   TFRKDSVVTFLGPNKNDPQQQANMENGL  549



>ref|XP_010270254.1| PREDICTED: metal transporter Nramp5-like [Nelumbo nucifera]
Length=563

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/485 (84%), Positives = 444/485 (92%), Gaps = 5/485 (1%)
 Frame = +2

Query  122   DSINKLQLDLQEEHNK--KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELL  295
             D  NK   D QEE  K  KPGWRKFL YVGPGF+VSLAYLDPGNLETDLQAGA+HRYELL
Sbjct  47    DHSNK---DFQEEDPKHQKPGWRKFLPYVGPGFLVSLAYLDPGNLETDLQAGANHRYELL  103

Query  296   WVVLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEV  475
             WVVLIGL+FA IIQSLAANLGV+TGKHLSELCK EYPK+V+YCLWLLAELAVIAADIPEV
Sbjct  104   WVVLIGLIFAFIIQSLAANLGVATGKHLSELCKIEYPKHVRYCLWLLAELAVIAADIPEV  163

Query  476   IGTAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMA  655
             +GTAFALNILFHIP+W GVL TGLSTLLLL LQRYGVRKLE+LIA+LVF+MA C+FGEM+
Sbjct  164   VGTAFALNILFHIPVWAGVLLTGLSTLLLLGLQRYGVRKLEMLIALLVFVMAGCYFGEMS  223

Query  656   YVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVN  835
             YVKPPA +V KGMF+P+LSG GAT DAIALLGALVMPHNLFLHSALVL+RKVP SVRGVN
Sbjct  224   YVKPPATEVLKGMFLPRLSGNGATPDAIALLGALVMPHNLFLHSALVLSRKVPQSVRGVN  283

Query  836   DACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNV  1015
             DACR+FLIESGFALF+AFLINVAVVSVSGTVCS   LS +D DHCSDL+LNSA+FLLKNV
Sbjct  284   DACRFFLIESGFALFIAFLINVAVVSVSGTVCSAPNLSHEDSDHCSDLTLNSAAFLLKNV  343

Query  1016  LGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPsliv  1195
             LGKSSST+YAIALLASGQSSTITGTYAGQYIMQGFLDL+M+KW RNLMTRC+AITPSL+V
Sbjct  344   LGKSSSTIYAIALLASGQSSTITGTYAGQYIMQGFLDLQMRKWLRNLMTRCVAITPSLVV  403

Query  1196  siiggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglg  1375
             SIIGGSSGA RLIIIASMILSFELPFALIPLLKFSSSSTKMGP+KNSIYII++SWILGL 
Sbjct  404   SIIGGSSGAARLIIIASMILSFELPFALIPLLKFSSSSTKMGPHKNSIYIILISWILGLC  463

Query  1376  iiginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQ  1555
             IIGIN+YYLST FV WLIHNNLPK  NV +GI+VFPLMA+Y++AV+YL FRKD  VTF++
Sbjct  464   IIGINVYYLSTGFVGWLIHNNLPKVANVFIGIIVFPLMALYILAVLYLSFRKDTAVTFME  523

Query  1556  PNDDD  1570
             P   D
Sbjct  524   PPKLD  528



>ref|XP_006351140.1| PREDICTED: metal transporter Nramp5-like [Solanum tuberosum]
Length=530

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/511 (82%), Positives = 459/511 (90%), Gaps = 13/511 (3%)
 Frame = +2

Query  65    SHRIVAVDEsplpssnnnpDSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPG  244
             S RIVAV ES LPS+N           D   EH K  GW+ F +YVGPGF+VSLAYLDPG
Sbjct  13    SKRIVAVTESTLPSNN-----------DHHIEHQKH-GWKNFFAYVGPGFLVSLAYLDPG  60

Query  245   NLETDLQAGADHRYELLWVVLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYC  424
             NLETDLQAGA+HRYELLWV+LIGL+FALIIQSLAANLGVSTGKHLSELC+AEYP +VKYC
Sbjct  61    NLETDLQAGANHRYELLWVILIGLIFALIIQSLAANLGVSTGKHLSELCRAEYPVFVKYC  120

Query  425   LWLLAELAVIAADIPEVIGTAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELL  604
             LWLLAE+AVIAADIPEVIGTAFALNILFHIP+W GVLCTG+STLL + LQRYGVRKLELL
Sbjct  121   LWLLAEVAVIAADIPEVIGTAFALNILFHIPVWAGVLCTGVSTLLFIGLQRYGVRKLELL  180

Query  605   IAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLH  784
             IA+LVF+MAACFFGEM+YVKPPA ++FKGMFIPKL+G GATADAIALLGALVMPHNLFLH
Sbjct  181   IAILVFVMAACFFGEMSYVKPPANELFKGMFIPKLNGDGATADAIALLGALVMPHNLFLH  240

Query  785   SALVLTRKVPNSVRGVNDACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLD  964
             SALVL+RK+PNSVRGVNDAC++FLIESGFALFV+FLINVAVVSVSGTVC    LS  + +
Sbjct  241   SALVLSRKIPNSVRGVNDACKFFLIESGFALFVSFLINVAVVSVSGTVCGADNLSDQNKE  300

Query  965   HCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKW  1144
              CSD++LNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQ+IMQGFLDLKMK W
Sbjct  301   SCSDITLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQFIMQGFLDLKMKTW  360

Query  1145  SRNLMTRCIAITPslivsiiggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGP  1324
              RNL TR IAITPSL+VSIIGG SGAGRLIIIASMILSFELPFALIPLLKFSSSSTK+GP
Sbjct  361   LRNLFTRLIAITPSLVVSIIGGPSGAGRLIIIASMILSFELPFALIPLLKFSSSSTKLGP  420

Query  1325  YKNSIYiivvswilglgiiginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVV  1504
             +KNSIYIIV+SW+LGLGIIGINIYYLSTAFV WLI NNLPK GNVL+GIVVFPLMAIY++
Sbjct  421   HKNSIYIIVISWVLGLGIIGINIYYLSTAFVGWLISNNLPKVGNVLIGIVVFPLMAIYIL  480

Query  1505  AVIYLMFRKDKVVTFIQPNDDDSKMDNNVNN  1597
             +VIYLMFRKD VVT++ P  DD  M+N  NN
Sbjct  481   SVIYLMFRKDTVVTYVDPIKDD-HMENGTNN  510



>gb|AFQ37304.1| natural resistance-associated macrophage protein 1 [Arachis hypogaea]
Length=545

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/509 (80%), Positives = 456/509 (90%), Gaps = 9/509 (2%)
 Frame = +2

Query  65    SHRIVAVDEsplpssnnnpDSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPG  244
             ++R+VAV+ +P        ++I  +  D    H KK GW+KFLS++GPGF+VSLAYLDPG
Sbjct  17    NNRVVAVNATPP-------NNILHIHADASSNHEKK-GWKKFLSFIGPGFLVSLAYLDPG  68

Query  245   NLETDLQAGADHRYELLWVVLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYC  424
             NLETDLQAGA+HRYELLWV+LIGL+FALIIQSLAANLGVSTGKHLSE+CKAEYP+ V+YC
Sbjct  69    NLETDLQAGANHRYELLWVILIGLIFALIIQSLAANLGVSTGKHLSEICKAEYPRLVRYC  128

Query  425   LWLLAELAVIAADIPEVIGTAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELL  604
             LWLLAELAVIAADIPEVIGTAFALNILFHIP+W GVL TG STLLLL LQR+GVRKLELL
Sbjct  129   LWLLAELAVIAADIPEVIGTAFALNILFHIPVWGGVLVTGCSTLLLLGLQRFGVRKLELL  188

Query  605   IAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLH  784
             I+ LVF+MAACFFGEM+YVKPPA  V KGMF PKLSGQGATADAIALLGALVMPHNLFLH
Sbjct  189   ISTLVFVMAACFFGEMSYVKPPASGVIKGMFTPKLSGQGATADAIALLGALVMPHNLFLH  248

Query  785   SALVLTRKVPNSVRGVNDACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLD  964
             SALVL+RKVPN+VRG+NDAC+YFLIESGFALFVAFLINVAV+SVSGTVCS   LS  + D
Sbjct  249   SALVLSRKVPNTVRGINDACKYFLIESGFALFVAFLINVAVISVSGTVCSASNLSSANTD  308

Query  965   HCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKW  1144
             HC+DL+LNSASFLLKNVLG+SSST+YAIALLASGQSS ITGTYAGQYIMQGFLDLKMK+W
Sbjct  309   HCTDLTLNSASFLLKNVLGRSSSTIYAIALLASGQSSAITGTYAGQYIMQGFLDLKMKRW  368

Query  1145  SRNLMTRCIAITPslivsiiggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGP  1324
              RNLMTR IAI PSL+VSIIGGSSGAGRLI+IASMILSFELPFALIPLLKFSSSSTKMGP
Sbjct  369   IRNLMTRTIAIAPSLVVSIIGGSSGAGRLIVIASMILSFELPFALIPLLKFSSSSTKMGP  428

Query  1325  YKNSIYiivvswilglgiiginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVV  1504
             +KNS+ IIV+SWILGLGIIGIN+YYL TAFVDWLIHN+LPK GNV +GI+VFPLMAIYV 
Sbjct  429   HKNSMIIIVISWILGLGIIGINVYYLITAFVDWLIHNSLPKVGNVFIGIIVFPLMAIYVG  488

Query  1505  AVIYLMFRKDKVVTFIQPNDDDSKMDNNV  1591
             +VIYL FRKD V T+I+   D++ M  +V
Sbjct  489   SVIYLTFRKDTVQTYIE-TKDNTAMQTHV  516



>ref|XP_007019147.1| Nramp transporter [Theobroma cacao]
 gb|EOY16372.1| Nramp transporter [Theobroma cacao]
Length=557

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/515 (80%), Positives = 463/515 (90%), Gaps = 5/515 (1%)
 Frame = +2

Query  65    SHRIVAVDEsplpssnnnpDSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPG  244
             S+RI AV+       +   +       D   +H +KPGWRKFLS+VGPGF+VSLAYLDPG
Sbjct  21    SNRIAAVNVEGSTPESFPSNDNKSSDHDHDPDH-EKPGWRKFLSFVGPGFLVSLAYLDPG  79

Query  245   NLETDLQAGADHRYELLWVVLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYC  424
             NLETD+QAGA+H YELLWVVLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYP  +KYC
Sbjct  80    NLETDMQAGANHGYELLWVVLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPVLIKYC  139

Query  425   LWLLAELAVIAADIPEVIGTAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELL  604
             LWLLAELAVIAADIPEVIGTAFALNILFH+P+W GVLCTGLSTLLLLSLQRYG+RKLE+L
Sbjct  140   LWLLAELAVIAADIPEVIGTAFALNILFHVPVWAGVLCTGLSTLLLLSLQRYGIRKLEML  199

Query  605   IAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLH  784
             IAV+VF+MAACFFGEM+YVKPPA  V KGMF+PKLSGQGAT DAIALLGALVMPHNLFLH
Sbjct  200   IAVMVFVMAACFFGEMSYVKPPATGVLKGMFVPKLSGQGATGDAIALLGALVMPHNLFLH  259

Query  785   SALVLTRKVPNSVRGVNDACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLD  964
             SALVL+RKVPNSVRG+N ACRYFL+ESGFALFVAFLINVAVVSV+GTVC    LS +D D
Sbjct  260   SALVLSRKVPNSVRGINAACRYFLMESGFALFVAFLINVAVVSVTGTVCLADNLSSEDQD  319

Query  965   HCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKW  1144
              CS+L+L+SASF+L++VLGKSSST+YA+ALLASGQSSTITGTYAGQ+IMQGFLDLKMKKW
Sbjct  320   RCSNLTLDSASFMLQHVLGKSSSTLYAVALLASGQSSTITGTYAGQFIMQGFLDLKMKKW  379

Query  1145  SRNLMTRCIAITPslivsiiggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGP  1324
              RNLMTR IAITPSLIVSIIGGS GAGRLIIIASMILSFELPFALIPLLKFSSSSTKMGP
Sbjct  380   VRNLMTRSIAITPSLIVSIIGGSQGAGRLIIIASMILSFELPFALIPLLKFSSSSTKMGP  439

Query  1325  YKNSIYiivvswilglgiiginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVV  1504
             YKNSIYIIV+SWILGLGIIGIN+YYLSTAFV WLIHN+LPK GNV +GI+VFPLMAIY++
Sbjct  440   YKNSIYIIVISWILGLGIIGINVYYLSTAFVGWLIHNDLPKVGNVFIGIIVFPLMAIYIL  499

Query  1505  AVIYLMFRKDKVVTFIQPNDDD----SKMDNNVNN  1597
             +VIYL FRKD VVT+I+P+ +D    ++M++ ++N
Sbjct  500   SVIYLTFRKDTVVTYIEPDKNDPTAQARMESGLSN  534



>ref|XP_009783885.1| PREDICTED: metal transporter Nramp5-like [Nicotiana sylvestris]
Length=535

 Score =   714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/516 (80%), Positives = 460/516 (89%), Gaps = 18/516 (3%)
 Frame = +2

Query  65    SHRIVAVDEsplpssnnnpDSINKLQLDLQEEHN-KKPGWRKFLSYVGPGFMVSLAYLDP  241
             S RIVAV E             + L     + H  +K GW+ F +YVGPGF+VSLAYLDP
Sbjct  13    SKRIVAVAE-------------SPLPSSNNDHHEPQKHGWKNFFAYVGPGFLVSLAYLDP  59

Query  242   GNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKY  421
             GNLETDLQAGA+H YELLWV+LIGL+FALIIQSLAANLGVSTGKHLSELC+AEYP +VKY
Sbjct  60    GNLETDLQAGANHGYELLWVILIGLIFALIIQSLAANLGVSTGKHLSELCRAEYPIFVKY  119

Query  422   CLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvgvlctglstllllslQRYGVRKLEL  601
             CLW+LAE+AVIAADIPEVIGTAFALNILFHIP+WVGVLCTG+STLL + LQRYGVRKLEL
Sbjct  120   CLWILAEVAVIAADIPEVIGTAFALNILFHIPVWVGVLCTGVSTLLFIGLQRYGVRKLEL  179

Query  602   LIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFL  781
             LIAVLVF+MAACFFGEM+YVKPPA++V KGMFIPKL+G GATADAIALLGALVMPHNLFL
Sbjct  180   LIAVLVFVMAACFFGEMSYVKPPAKEVVKGMFIPKLNGNGATADAIALLGALVMPHNLFL  239

Query  782   HSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDL  961
             HSALVL+RK+P+SVRG+NDAC+YFLIESGFALFVAFLINVAV+SVSGTVC    LS+++ 
Sbjct  240   HSALVLSRKIPHSVRGINDACKYFLIESGFALFVAFLINVAVISVSGTVCGADNLSQENK  299

Query  962   DHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKK  1141
             D CSD++LNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQ+IMQGFLDLKMK 
Sbjct  300   DSCSDITLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQFIMQGFLDLKMKT  359

Query  1142  WSRNLMTRCIAITPslivsiiggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMG  1321
             W RNL+TR IAITPSL+VSIIGGSSGAGRLIIIASMILSFELPFALIPLLKFSSSSTK+G
Sbjct  360   WLRNLITRLIAITPSLVVSIIGGSSGAGRLIIIASMILSFELPFALIPLLKFSSSSTKLG  419

Query  1322  PYKNSIYiivvswilglgiiginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYV  1501
             P+KNSIYIIV+SWILGLGIIGINIYYL+TAFVDWLIHNNLPK GNV +GIVVFPLMAIY+
Sbjct  420   PHKNSIYIIVISWILGLGIIGINIYYLTTAFVDWLIHNNLPKVGNVFIGIVVFPLMAIYI  479

Query  1502  VAVIYLMFRKDKVVTFIQPNDDDSK----MDNNVNN  1597
             +AVIYLMFRKD VVT+I P  D+      M++  NN
Sbjct  480   LAVIYLMFRKDTVVTYIDPIKDNPNAQRYMEDGTNN  515



>ref|XP_009620069.1| PREDICTED: metal transporter Nramp5-like [Nicotiana tomentosiformis]
Length=538

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/515 (81%), Positives = 467/515 (91%), Gaps = 13/515 (3%)
 Frame = +2

Query  65    SHRIVAVDEsplpssnnnpDSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPG  244
             S RIVAV ESPLPSS N  +  ++ Q         K GW+ F +YVGPGF+VSLAYLDPG
Sbjct  13    SKRIVAVAESPLPSSTNPNNDYHEPQ---------KHGWKNFFAYVGPGFLVSLAYLDPG  63

Query  245   NLETDLQAGADHRYELLWVVLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYC  424
             NLETDLQAGA+H YELLWV+LIGL+FALIIQSLAANLGVSTGKHLSELC+AEYP +VKYC
Sbjct  64    NLETDLQAGANHGYELLWVILIGLIFALIIQSLAANLGVSTGKHLSELCRAEYPVFVKYC  123

Query  425   LWLLAELAVIAADIPEVIGTAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELL  604
             LW+LAE+AVIAADIPEVIGTAFALNILFHIP+WVGVLCTG+STLL + LQRYGVRKLELL
Sbjct  124   LWILAEVAVIAADIPEVIGTAFALNILFHIPVWVGVLCTGVSTLLFIGLQRYGVRKLELL  183

Query  605   IAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLH  784
             IAVLVF+MAACFFGEM+YVKPPA++V KGMFIPKL+G GATADAIALLGALVMPHNLFLH
Sbjct  184   IAVLVFVMAACFFGEMSYVKPPAKEVLKGMFIPKLNGNGATADAIALLGALVMPHNLFLH  243

Query  785   SALVLTRKVPNSVRGVNDACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLD  964
             SALVL+RK+P+SVRG+NDAC+YFLIESGFALFVAFLINVAV+SVSGTVC    LS+++ D
Sbjct  244   SALVLSRKIPHSVRGINDACKYFLIESGFALFVAFLINVAVISVSGTVCGADNLSQENKD  303

Query  965   HCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKW  1144
              CSD++LNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQ+IMQGFLDLKMK W
Sbjct  304   SCSDITLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQFIMQGFLDLKMKTW  363

Query  1145  SRNLMTRCIAITPslivsiiggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGP  1324
              RNL+TR IAITPSL+VSIIGGSSGAGRLIIIASMILSFELPFALIPLLKFSSSSTK+GP
Sbjct  364   LRNLVTRLIAITPSLVVSIIGGSSGAGRLIIIASMILSFELPFALIPLLKFSSSSTKLGP  423

Query  1325  YKNSIYiivvswilglgiiginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVV  1504
             +KNSIYIIV+SWILGLGIIGINIYYL+TAFVDWLIHNNLPK GNV +GIVVFPLMAIY++
Sbjct  424   HKNSIYIIVISWILGLGIIGINIYYLTTAFVDWLIHNNLPKVGNVFIGIVVFPLMAIYIL  483

Query  1505  AVIYLMFRKDKVVTFIQPNDDDSK----MDNNVNN  1597
             +VIYLMFRKD VVT+I P  D+      M++ +NN
Sbjct  484   SVIYLMFRKDTVVTYIDPIKDNPNAQRYMEDGINN  518



>ref|XP_006386365.1| hypothetical protein POPTR_0002s08090g [Populus trichocarpa]
 gb|ERP64162.1| hypothetical protein POPTR_0002s08090g [Populus trichocarpa]
Length=552

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/486 (83%), Positives = 448/486 (92%), Gaps = 0/486 (0%)
 Frame = +2

Query  146   DLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFA  325
             +L++  ++K GWRKFLSYVGPGF+VSLAYLDPGNLETDLQAGA+H YELLWVVL+GL+FA
Sbjct  41    ELKDPSHQKSGWRKFLSYVGPGFLVSLAYLDPGNLETDLQAGANHGYELLWVVLVGLIFA  100

Query  326   LIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNIL  505
             L IQSLAANLGVSTGKHLSELC+AEYP++VKYCLWLLAE+AV+AADIPEVIGTAFALNIL
Sbjct  101   LTIQSLAANLGVSTGKHLSELCRAEYPRHVKYCLWLLAEIAVMAADIPEVIGTAFALNIL  160

Query  506   FHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVF  685
             F+IP+W GVLCTG STLLLL LQ+YGVRKLELLIAVLVF+MAACFFGEM YVKPPA DV 
Sbjct  161   FNIPVWFGVLCTGCSTLLLLGLQKYGVRKLELLIAVLVFVMAACFFGEMRYVKPPATDVL  220

Query  686   KGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIES  865
             KGMFIPKLSGQG+T DAIALLGALVMPHNLFLHSALVL+RK PNSVRG+NDACRYFLIES
Sbjct  221   KGMFIPKLSGQGSTGDAIALLGALVMPHNLFLHSALVLSRKTPNSVRGINDACRYFLIES  280

Query  866   GFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYA  1045
             G ALFVAFLIN+AV+SVSGTVCS   LS ++ D C DL+LNSASFLL+NVLGKSSS +YA
Sbjct  281   GLALFVAFLINLAVISVSGTVCSAQNLSSENADRCGDLTLNSASFLLQNVLGKSSSKIYA  340

Query  1046  IALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgag  1225
             IA+LASGQSSTITGTYAGQYIM+GFL+L+M+KW RNL+TRCIAITPSLIVSIIGGSSGAG
Sbjct  341   IAVLASGQSSTITGTYAGQYIMEGFLELRMRKWIRNLVTRCIAITPSLIVSIIGGSSGAG  400

Query  1226  rliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyyls  1405
             RLIIIASMILSFELPFALIPLLKFSSS+TKMGP+KNSIYIIV+SWILGLGIIGINIYYLS
Sbjct  401   RLIIIASMILSFELPFALIPLLKFSSSTTKMGPHKNSIYIIVLSWILGLGIIGINIYYLS  460

Query  1406  TAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMDN  1585
             T FV WLI NNLPK  NV +GI+VFPLMAIY++AVIYL FRKD VVTF++PN +D +   
Sbjct  461   TGFVGWLIDNNLPKVANVFIGIIVFPLMAIYILAVIYLTFRKDTVVTFMEPNKNDPQQQT  520

Query  1586  NVNNNV  1603
             N+ N +
Sbjct  521   NMENGL  526



>ref|XP_008219602.1| PREDICTED: metal transporter Nramp5-like [Prunus mume]
Length=546

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/483 (82%), Positives = 442/483 (92%), Gaps = 0/483 (0%)
 Frame = +2

Query  155   EEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALII  334
             ++  +KPGWRKFL++VGPGF+VSLAYLDPGNLETDLQAGA+HRYELLWV+LIGL+FALII
Sbjct  43    KDDQQKPGWRKFLAHVGPGFLVSLAYLDPGNLETDLQAGANHRYELLWVILIGLIFALII  102

Query  335   QSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHI  514
             QSL+ANLGV+TGKHLSELCKAEYPK+VKYCLWLLAE+AVIAADIPEVIGTAFALNILF+I
Sbjct  103   QSLSANLGVTTGKHLSELCKAEYPKFVKYCLWLLAEVAVIAADIPEVIGTAFALNILFNI  162

Query  515   PLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGM  694
             P+W GVL TG STLLLL LQRYGVRKLELLIAVLVF+MAACFFGEM YVKPPA  V KGM
Sbjct  163   PVWTGVLLTGFSTLLLLGLQRYGVRKLELLIAVLVFVMAACFFGEMGYVKPPASGVLKGM  222

Query  695   FIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFA  874
             FIPKL+GQGAT DAIALLGALVMPHNLFLHSALVL+RK+P SV G+NDACRYFLIESGFA
Sbjct  223   FIPKLNGQGATGDAIALLGALVMPHNLFLHSALVLSRKIPKSVHGINDACRYFLIESGFA  282

Query  875   LFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIAL  1054
             LFVAFLINVA+VSVSGTVC +  LS  D   CSDL+LNSASFLL+NVLG+SS  +YAIAL
Sbjct  283   LFVAFLINVAIVSVSGTVCHDTNLSDKDTKTCSDLTLNSASFLLQNVLGRSSKVIYAIAL  342

Query  1055  LASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrli  1234
             LASGQSSTITGTYAGQ++MQGFLD+KMKKW+RNLMTRCIAITPSLIVSIIGG SGAGRLI
Sbjct  343   LASGQSSTITGTYAGQFVMQGFLDIKMKKWARNLMTRCIAITPSLIVSIIGGPSGAGRLI  402

Query  1235  iiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAF  1414
             IIASMILSFELPFALIPLLKFSSS+TKMGP+KNSIYIIVVSWILG+GIIGINIYYLST F
Sbjct  403   IIASMILSFELPFALIPLLKFSSSTTKMGPHKNSIYIIVVSWILGMGIIGINIYYLSTGF  462

Query  1415  VDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMDNNVN  1594
             V WLIH++LPK  NV +GI+VFPLMAIY++AVIYL  RKD VVTFI+P  +D    N + 
Sbjct  463   VGWLIHSSLPKVANVFIGIIVFPLMAIYILAVIYLTLRKDSVVTFIEPTKNDPAAQNQME  522

Query  1595  NNV  1603
             + +
Sbjct  523   SGL  525



>ref|XP_007225779.1| hypothetical protein PRUPE_ppa003816mg [Prunus persica]
 gb|EMJ26978.1| hypothetical protein PRUPE_ppa003816mg [Prunus persica]
Length=546

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/483 (82%), Positives = 442/483 (92%), Gaps = 0/483 (0%)
 Frame = +2

Query  155   EEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALII  334
             ++  +KPGWRKFL++VGPGF+VSLAYLDPGNLETDLQAGA+HRYELLWV+LIGLVFALII
Sbjct  43    KDDQQKPGWRKFLAHVGPGFLVSLAYLDPGNLETDLQAGANHRYELLWVILIGLVFALII  102

Query  335   QSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHI  514
             QSL+ANLGV+TGKHLSELCKAEYP++VKYCLWLLAE+AVIAADIPEVIGTAFALNILF++
Sbjct  103   QSLSANLGVTTGKHLSELCKAEYPQFVKYCLWLLAEVAVIAADIPEVIGTAFALNILFNV  162

Query  515   PLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGM  694
             P+W GVL TG STLLLL LQRYGVRKLELLIAVLVF+MAACFFGEM YVKPPA  V KGM
Sbjct  163   PVWTGVLLTGFSTLLLLGLQRYGVRKLELLIAVLVFVMAACFFGEMGYVKPPASGVLKGM  222

Query  695   FIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFA  874
             FIPKL+GQGAT DAIALLGALVMPHNLFLHSALVL+RK+P SV G+NDACRYFLIESGFA
Sbjct  223   FIPKLNGQGATGDAIALLGALVMPHNLFLHSALVLSRKIPKSVHGINDACRYFLIESGFA  282

Query  875   LFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIAL  1054
             LFVAFLINVA+VSVSGTVC +  LS  D   CSDL+LNSASFLL+NVLG+SS  +YAIAL
Sbjct  283   LFVAFLINVAIVSVSGTVCHDTNLSDKDTKTCSDLTLNSASFLLQNVLGRSSKVIYAIAL  342

Query  1055  LASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrli  1234
             LASGQSSTITGTYAGQ++MQGFLD+KMKKW+RNLMTRCIAITPSLIVSIIGG SGAGRLI
Sbjct  343   LASGQSSTITGTYAGQFVMQGFLDIKMKKWARNLMTRCIAITPSLIVSIIGGPSGAGRLI  402

Query  1235  iiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAF  1414
             IIASMILSFELPFALIPLLKFSSS+TKMGP+KNSIYIIVVSWILG+GIIGINIYYLST F
Sbjct  403   IIASMILSFELPFALIPLLKFSSSTTKMGPHKNSIYIIVVSWILGMGIIGINIYYLSTGF  462

Query  1415  VDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMDNNVN  1594
             V WLIH++LPK  NV +GI+VFPLMAIY++AVIYL  RKD VVTFI+P  +D    N + 
Sbjct  463   VGWLIHSSLPKVANVFIGIIVFPLMAIYILAVIYLTLRKDSVVTFIEPTKNDPAAQNQME  522

Query  1595  NNV  1603
             + +
Sbjct  523   SGI  525



>ref|XP_008466781.1| PREDICTED: metal transporter Nramp5-like [Cucumis melo]
Length=525

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/507 (79%), Positives = 453/507 (89%), Gaps = 11/507 (2%)
 Frame = +2

Query  152   QEEHN---KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVF  322
             ++E N   +KPGWRKF++YVGPGF+VSLAYLDPGNLETDLQAGA+H +ELLWVVLIGL+F
Sbjct  14    EKEKNTTHQKPGWRKFVAYVGPGFLVSLAYLDPGNLETDLQAGANHGFELLWVVLIGLIF  73

Query  323   ALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNI  502
             ALIIQSL+ANLGVSTGKHLSE+CK+EYP +VKYCLWLLAE+AVIAADIPEV+GTAFALNI
Sbjct  74    ALIIQSLSANLGVSTGKHLSEVCKSEYPIFVKYCLWLLAEVAVIAADIPEVVGTAFALNI  133

Query  503   LFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDV  682
             LFHIP+W GVL TGLST+LLL LQRYG RKLELLIA+LVF+MAACFFGEM+YVKPPA  V
Sbjct  134   LFHIPVWAGVLLTGLSTILLLGLQRYGARKLELLIAILVFVMAACFFGEMSYVKPPASGV  193

Query  683   FKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIE  862
              KGMF+PKL G+GATADAIALLGALVMPHNLFLHSALVL+RKVPNSV G+NDACRYFLIE
Sbjct  194   LKGMFVPKLKGEGATADAIALLGALVMPHNLFLHSALVLSRKVPNSVSGINDACRYFLIE  253

Query  863   SGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVY  1042
             SG ALF+AFLINVAVVSVSGTVC+ G +++   D CSD++LNSASFLL+NVLGKSSST+Y
Sbjct  254   SGIALFIAFLINVAVVSVSGTVCTVGNVAQTTTDQCSDITLNSASFLLQNVLGKSSSTIY  313

Query  1043  AIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssga  1222
             AIAL ASGQSS+ITGTYAGQ+IMQGFLDLKMK W+RNLMTR IAITPSLIVSIIGG  GA
Sbjct  314   AIALFASGQSSSITGTYAGQFIMQGFLDLKMKTWARNLMTRSIAITPSLIVSIIGGPQGA  373

Query  1223  grliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyyl  1402
             GRLIIIASMILSFELPFALIPLLKFSSSSTKMGP+KNSIYIIV+SWILGL IIGINIYYL
Sbjct  374   GRLIIIASMILSFELPFALIPLLKFSSSSTKMGPHKNSIYIIVISWILGLAIIGINIYYL  433

Query  1403  sTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDD----  1570
             STAFVDWLIHNNL K  NV +GI VFPLMA Y+ AVIYLMFRKD+VVT+I+P  DD    
Sbjct  434   STAFVDWLIHNNLRKVANVFIGIAVFPLMAAYIGAVIYLMFRKDRVVTYIEPEKDDAIAQ  493

Query  1571  SKMDNNVNNNVC---MTPID-HNDFSH  1639
             + ++  +NN+     +TP+    D +H
Sbjct  494   AHLEIGLNNSFGPGDITPVPFREDLAH  520



>ref|XP_002284556.1| PREDICTED: metal transporter Nramp5 [Vitis vinifera]
 emb|CBI18985.3| unnamed protein product [Vitis vinifera]
Length=542

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/491 (82%), Positives = 444/491 (90%), Gaps = 3/491 (1%)
 Frame = +2

Query  140   QLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLV  319
              LDL ++   KPGWRKFL++VGPGF+VSLAYLDPGNLETDLQAGA+H +ELLWVVLIGL+
Sbjct  33    HLDLDDQ---KPGWRKFLAFVGPGFLVSLAYLDPGNLETDLQAGANHGFELLWVVLIGLI  89

Query  320   FALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALN  499
             FALIIQSLAANLGVSTGKHLSELCKAEYP  VKYCLWLLAE+AVIAADIPEVIGTAFALN
Sbjct  90    FALIIQSLAANLGVSTGKHLSELCKAEYPIIVKYCLWLLAEIAVIAADIPEVIGTAFALN  149

Query  500   ILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAED  679
             ILF +P+W GVL TG STLLLL LQRYGVRKLELLIAVLVF+MA CFFGEM+YVKPPA  
Sbjct  150   ILFKVPVWAGVLFTGFSTLLLLGLQRYGVRKLELLIAVLVFIMAGCFFGEMSYVKPPATG  209

Query  680   VFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLI  859
             V KGMFIPKL GQGAT DAIALLGALVMPHNLFLHSALVL+RKVPNSVRG+N+ACRYFLI
Sbjct  210   VLKGMFIPKLKGQGATGDAIALLGALVMPHNLFLHSALVLSRKVPNSVRGINEACRYFLI  269

Query  860   ESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTV  1039
             ESG ALFVAFLINVAVVSVSGTVCS   LS+++LD C+DL+LNSASFLLKNVLG SS  V
Sbjct  270   ESGLALFVAFLINVAVVSVSGTVCSADNLSQENLDQCNDLNLNSASFLLKNVLGGSSKVV  329

Query  1040  YAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssg  1219
             YAIAL ASGQSSTITGTYAGQ+IMQGFLD+KM+KW RNLMTR IAITPSLIVSIIGGS+G
Sbjct  330   YAIALFASGQSSTITGTYAGQFIMQGFLDIKMRKWLRNLMTRSIAITPSLIVSIIGGSAG  389

Query  1220  agrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyy  1399
             AGRLIIIASMILSFELPFALIPLLKFSSS+TKMGP+KNSIYIIV+SWILG GIIGINIYY
Sbjct  390   AGRLIIIASMILSFELPFALIPLLKFSSSNTKMGPHKNSIYIIVISWILGFGIIGINIYY  449

Query  1400  lsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKM  1579
             LST+FV WL+HNNLPK GNV +GI+VFPLMAIY+++VIYL  RKD VVTFI+P  +D  +
Sbjct  450   LSTSFVGWLLHNNLPKVGNVFIGIIVFPLMAIYILSVIYLTTRKDTVVTFIEPEKNDPNV  509

Query  1580  DNNVNNNVCMT  1612
              N++ N    T
Sbjct  510   QNHMENGFDQT  520



>ref|XP_004290899.1| PREDICTED: metal transporter Nramp5-like [Fragaria vesca subsp. 
vesca]
Length=541

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/486 (81%), Positives = 445/486 (92%), Gaps = 4/486 (1%)
 Frame = +2

Query  155   EEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALII  334
             +  NKKPGWRKF+ +VGPGF+VSLAYLDPGNLETDLQAGA+HRYELLWV+LIGL+FALII
Sbjct  38    DPENKKPGWRKFMEHVGPGFLVSLAYLDPGNLETDLQAGANHRYELLWVILIGLIFALII  97

Query  335   QSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHI  514
             QSLAANLGVSTGKHLSELCKAEYP +V+YCLWLLAE+AVIAADIPEVIGTAFALNILF+I
Sbjct  98    QSLAANLGVSTGKHLSELCKAEYPSFVRYCLWLLAEVAVIAADIPEVIGTAFALNILFNI  157

Query  515   PLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGM  694
             P+W GVL TGLSTLLLL LQRYG+RKLE+LIAVLVF+MAACFFGEM +VKPPA  V +GM
Sbjct  158   PVWSGVLITGLSTLLLLGLQRYGIRKLEMLIAVLVFVMAACFFGEMGFVKPPASGVVEGM  217

Query  695   FIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFA  874
             F+PKLSGQGAT DAIALLGALVMPHNLFLHSALVL+RKVPNSVRG+NDACRYFLIESGFA
Sbjct  218   FVPKLSGQGATGDAIALLGALVMPHNLFLHSALVLSRKVPNSVRGINDACRYFLIESGFA  277

Query  875   LFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIAL  1054
             LFVAFLINVA++SVSGTVC    LS +D   CSDL+LN+ASFLL+NVLGKSS  +YA+AL
Sbjct  278   LFVAFLINVAIISVSGTVCFADNLSDNDSKTCSDLTLNNASFLLQNVLGKSSKVIYAVAL  337

Query  1055  LASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrli  1234
             LASGQSSTITGTYAGQ++MQGFLD+KMKKW+RNLMTRCIAITPSLIVSIIGG+SGAGRLI
Sbjct  338   LASGQSSTITGTYAGQFVMQGFLDIKMKKWTRNLMTRCIAITPSLIVSIIGGASGAGRLI  397

Query  1235  iiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAF  1414
             IIASMILSFELPFALIPLLKFSSS+TKMGP+KNSIYIIV+SWILG+GIIGINIYYLST F
Sbjct  398   IIASMILSFELPFALIPLLKFSSSATKMGPHKNSIYIIVMSWILGMGIIGINIYYLSTGF  457

Query  1415  VDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDS----KMD  1582
             V W+IH++LPK   V +GI+VFPLMAIY+VAVIYL  RKD VVTFI+P  +D     +M+
Sbjct  458   VGWIIHSSLPKVATVFIGILVFPLMAIYIVAVIYLTVRKDTVVTFIEPTKNDPAAQIEME  517

Query  1583  NNVNNN  1600
             + + N 
Sbjct  518   SGITNT  523



>ref|XP_011027484.1| PREDICTED: metal transporter Nramp5-like [Populus euphratica]
Length=545

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/483 (82%), Positives = 436/483 (90%), Gaps = 0/483 (0%)
 Frame = +2

Query  149   LQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFAL  328
             + +   +KPGWRKFL YVGPGF+VSLAYLDPGNLETDLQAGA+H YELLWV+LIGL+FAL
Sbjct  37    IDDYDQQKPGWRKFLPYVGPGFLVSLAYLDPGNLETDLQAGANHGYELLWVILIGLIFAL  96

Query  329   IIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILF  508
             IIQSLAANLGVSTG+HL+ELCKAEYPKYV++ LWLLAE+AVIAADIPEVIGTAFALNILF
Sbjct  97    IIQSLAANLGVSTGRHLAELCKAEYPKYVRWSLWLLAEVAVIAADIPEVIGTAFALNILF  156

Query  509   HIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFK  688
             HIP+W GVL TGLSTLLLL LQ+YG+RKLELLI+VLVF MAACFFGE++YVKPPA  V K
Sbjct  157   HIPIWAGVLMTGLSTLLLLGLQKYGIRKLELLISVLVFTMAACFFGELSYVKPPASGVLK  216

Query  689   GMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESG  868
             GMFIPKLSGQGAT DAIALLGALVMPHNLFLHSALVL+RKVPNSVRG+NDACRYFLIESG
Sbjct  217   GMFIPKLSGQGATGDAIALLGALVMPHNLFLHSALVLSRKVPNSVRGINDACRYFLIESG  276

Query  869   FALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAI  1048
             FALFVAFLINV++VSVSGTVC    LS ++ D C DL+L  ASFLLKNVLGKSSST+YAI
Sbjct  277   FALFVAFLINVSIVSVSGTVCLAKNLSPENADQCGDLTLKGASFLLKNVLGKSSSTIYAI  336

Query  1049  ALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagr  1228
             ALLASGQSSTITGTYAGQYIMQGFLDLKM+KW RNLMTRCIAI PSL VSIIGGSSGA R
Sbjct  337   ALLASGQSSTITGTYAGQYIMQGFLDLKMRKWLRNLMTRCIAILPSLFVSIIGGSSGASR  396

Query  1229  liiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsT  1408
             LIIIASMILSFELPFALIPLLKFSSS+ KMGP+KNSIYIIV+SW LGL IIGIN+YYLST
Sbjct  397   LIIIASMILSFELPFALIPLLKFSSSNPKMGPHKNSIYIIVISWTLGLMIIGINVYYLST  456

Query  1409  AFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMDNN  1588
              FV WL HNNLPK GNV++GI+VFPLMAIY++A+IYL FRKD  VT+I P  +D  ++ N
Sbjct  457   EFVGWLTHNNLPKVGNVIIGIIVFPLMAIYILAIIYLTFRKDTAVTYIDPVKNDPNLEAN  516

Query  1589  VNN  1597
               N
Sbjct  517   KEN  519



>dbj|BAM34952.1| metal transporter Nramp1 [Solanum torvum]
Length=534

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/511 (81%), Positives = 460/511 (90%), Gaps = 9/511 (2%)
 Frame = +2

Query  65    SHRIVAVDEsplpssnnnpDSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPG  244
             S RIVAV E+P PSS N  +       D    H K  GW+ F +YVGPGF+VSLAYLDPG
Sbjct  13    SKRIVAVTETPSPSSTNPNN-------DHHVGHQKH-GWKNFFAYVGPGFLVSLAYLDPG  64

Query  245   NLETDLQAGADHRYELLWVVLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYC  424
             NLETDLQAG+ H YELLWV+LIGL+FALIIQSLAANLGVSTGKHLSELC AEYP +VKYC
Sbjct  65    NLETDLQAGSSHGYELLWVILIGLIFALIIQSLAANLGVSTGKHLSELCSAEYPVFVKYC  124

Query  425   LWLLAELAVIAADIPEVIGTAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELL  604
             LWLLAE+AVIAADIPEVIGTAFALNILFHIP+WVGVLCTG+STLL + LQRYGVRKLELL
Sbjct  125   LWLLAEVAVIAADIPEVIGTAFALNILFHIPVWVGVLCTGVSTLLFIGLQRYGVRKLELL  184

Query  605   IAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLH  784
             IA+LVF+MAACFFGEM+YVKPPA+++FKGMFIPKL G GATADAIALLGALVMPHNLFLH
Sbjct  185   IAILVFVMAACFFGEMSYVKPPAKELFKGMFIPKLKGDGATADAIALLGALVMPHNLFLH  244

Query  785   SALVLTRKVPNSVRGVNDACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLD  964
             SALVL+RK+PNS+RG+NDACR+FLIESGFALFV+FLINVAVVSVSGTVC    LS+ + +
Sbjct  245   SALVLSRKIPNSIRGINDACRFFLIESGFALFVSFLINVAVVSVSGTVCGADNLSEQNKE  304

Query  965   HCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKW  1144
              C+D++LNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQ+IMQGFLDLKMK W
Sbjct  305   SCNDITLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQFIMQGFLDLKMKTW  364

Query  1145  SRNLMTRCIAITPslivsiiggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGP  1324
              RNL TR IAITPSL+VSIIGG SGAGRLIIIASMILSFELPFALIPLLKFSSSSTK+GP
Sbjct  365   LRNLFTRLIAITPSLVVSIIGGPSGAGRLIIIASMILSFELPFALIPLLKFSSSSTKLGP  424

Query  1325  YKNSIYiivvswilglgiiginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVV  1504
             +KNSIYIIV+SWILGLGIIGINIYYLSTAFV WL++N+LPK GNVL+GIVVFPLMAIY++
Sbjct  425   HKNSIYIIVISWILGLGIIGINIYYLSTAFVGWLLNNHLPKVGNVLIGIVVFPLMAIYIL  484

Query  1505  AVIYLMFRKDKVVTFIQPNDDDSKMDNNVNN  1597
             AVIYLMFRKD+VVT+I P  DD  M+N  N+
Sbjct  485   AVIYLMFRKDRVVTYINPIKDD-HMENGTNS  514



>gb|EYU32513.1| hypothetical protein MIMGU_mgv1a004213mg [Erythranthe guttata]
Length=539

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/502 (81%), Positives = 449/502 (89%), Gaps = 12/502 (2%)
 Frame = +2

Query  65    SHRIVAVDEsplpssnnnpDSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPG  244
             +HRIV+V E+P               +D  +   +K GWR FL YVGPGF+VSLAYLDPG
Sbjct  16    THRIVSVAETPPS------------GVDQDDSLKQKSGWRNFLPYVGPGFLVSLAYLDPG  63

Query  245   NLETDLQAGADHRYELLWVVLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYC  424
             NLETDLQAGA+H YELLWV+LIGL+FALIIQSLAANLGVSTGKHLSELCKAEYP +VKYC
Sbjct  64    NLETDLQAGANHGYELLWVILIGLIFALIIQSLAANLGVSTGKHLSELCKAEYPVFVKYC  123

Query  425   LWLLAELAVIAADIPEVIGTAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELL  604
             LWLLAE+AVIAADIPEVIGTAFALNILFHIP+WVGVL TGLSTLLLL LQRYGVRKLELL
Sbjct  124   LWLLAEVAVIAADIPEVIGTAFALNILFHIPVWVGVLLTGLSTLLLLGLQRYGVRKLELL  183

Query  605   IAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLH  784
             IA+LVF+MAACFFGE++YVKPPA+ V KG+FIPKL+GQ AT DAIALLGALVMPHNLFLH
Sbjct  184   IAILVFVMAACFFGELSYVKPPAKQVLKGLFIPKLNGQDATGDAIALLGALVMPHNLFLH  243

Query  785   SALVLTRKVPNSVRGVNDACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLD  964
             SALVL+RKVPNSVRG+NDACRYFLIESGFALFVAFLINVA+VSVS TVC   +L  DD +
Sbjct  244   SALVLSRKVPNSVRGINDACRYFLIESGFALFVAFLINVAIVSVSATVCLVDELKPDDKE  303

Query  965   HCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKW  1144
              CSDL+LNSASFLLKNVLG SSSTVYAIALLASGQSSTITGTYAGQ+IMQGFLDLKM+ W
Sbjct  304   RCSDLTLNSASFLLKNVLGGSSSTVYAIALLASGQSSTITGTYAGQFIMQGFLDLKMRTW  363

Query  1145  SRNLMTRCIAITPslivsiiggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGP  1324
              RNL+TRCIAI PSL+VSIIGG SGAGRLIIIASMILSFELPFALIPLLKFSS +TKMGP
Sbjct  364   LRNLVTRCIAIAPSLVVSIIGGPSGAGRLIIIASMILSFELPFALIPLLKFSSGTTKMGP  423

Query  1325  YKNSIYiivvswilglgiiginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVV  1504
             +KNSIYIIVVSW+LGLGIIGIN+YYLSTAFV W+IHNNLPK GNV +GI+VFPLMA+Y+ 
Sbjct  424   HKNSIYIIVVSWVLGLGIIGINVYYLSTAFVGWIIHNNLPKVGNVFIGILVFPLMAVYIG  483

Query  1505  AVIYLMFRKDKVVTFIQPNDDD  1570
             +VIYLMFRKDKVVT+I P+  D
Sbjct  484   SVIYLMFRKDKVVTYIDPSKSD  505



>ref|XP_011027698.1| PREDICTED: metal transporter Nramp5-like [Populus euphratica]
Length=549

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/486 (81%), Positives = 444/486 (91%), Gaps = 0/486 (0%)
 Frame = +2

Query  146   DLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFA  325
             +L++  ++K GWRKFLSYVGPGF+VSLAYLDPGNLETDLQAGA HRYELLWVVL GL+FA
Sbjct  38    ELKDPSHQKSGWRKFLSYVGPGFLVSLAYLDPGNLETDLQAGASHRYELLWVVLAGLIFA  97

Query  326   LIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNIL  505
             L IQSLAANLGVSTGKHLSELC+AEYP++VKYCLWLLAE+AV+AADIPEVIGTAFALNIL
Sbjct  98    LTIQSLAANLGVSTGKHLSELCRAEYPRHVKYCLWLLAEIAVMAADIPEVIGTAFALNIL  157

Query  506   FHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVF  685
             F+IP+W GVLCTG STLLLL LQ+YGVRKLELLIA+LVF+MAACFFGEM +VKPPA DV 
Sbjct  158   FNIPVWSGVLCTGCSTLLLLGLQKYGVRKLELLIALLVFVMAACFFGEMRHVKPPATDVL  217

Query  686   KGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIES  865
             KGMFIPKLSGQG+T DAIALLGALVMPHNLFLHSALVL+RK PNSVRG+NDACRYFLIES
Sbjct  218   KGMFIPKLSGQGSTGDAIALLGALVMPHNLFLHSALVLSRKTPNSVRGINDACRYFLIES  277

Query  866   GFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYA  1045
             G ALFVAFLIN+AV+SVSGTVCS   LS ++ D C DL+LNSASFLL+NVLGKSSS +YA
Sbjct  278   GLALFVAFLINLAVISVSGTVCSAQNLSSENADRCGDLTLNSASFLLQNVLGKSSSKIYA  337

Query  1046  IALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgag  1225
             IA+LASGQSSTITGTYAGQYIM+GFL+L+M+KW RNL+TRCIAITPSLIVSII GSSGAG
Sbjct  338   IAVLASGQSSTITGTYAGQYIMEGFLELRMRKWIRNLVTRCIAITPSLIVSIIDGSSGAG  397

Query  1226  rliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyyls  1405
             RLIIIASMILSFELPFALIPLLKFSSS+TKMGP+KNSIYII +SWILGLGIIGINIYYLS
Sbjct  398   RLIIIASMILSFELPFALIPLLKFSSSTTKMGPHKNSIYIIALSWILGLGIIGINIYYLS  457

Query  1406  TAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMDN  1585
             T FV WLI +NLPK  NV +GI+VFPLMA+Y++ VIYL FRKD VVTF++PN +D +   
Sbjct  458   TGFVGWLIDSNLPKVANVFIGIIVFPLMAVYILTVIYLTFRKDTVVTFMEPNKNDPQNKT  517

Query  1586  NVNNNV  1603
             N+ N +
Sbjct  518   NMENGL  523



>dbj|BAM34953.1| metal transporter Nramp1 [Solanum melongena]
Length=531

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/489 (82%), Positives = 448/489 (92%), Gaps = 1/489 (0%)
 Frame = +2

Query  164   NKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSL  343
             ++K GW+ F +YVGPGF+VSLAYLDPGNLETDLQAG+ H YELLWV+LIGLVFALIIQSL
Sbjct  35    HQKHGWKNFFAYVGPGFLVSLAYLDPGNLETDLQAGSSHGYELLWVILIGLVFALIIQSL  94

Query  344   AANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLW  523
             AANLGVSTGKHLSELC AEYP +VKYCLWLLAE+AVIAADIPEVIGTAFALNILFHIP+W
Sbjct  95    AANLGVSTGKHLSELCSAEYPVFVKYCLWLLAEVAVIAADIPEVIGTAFALNILFHIPVW  154

Query  524   vgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIP  703
             VGVLCTG+STLL + LQRYGVRKLELLIA+LV +MAACFFGEM+YVKPPA+++FKGMFIP
Sbjct  155   VGVLCTGVSTLLFIGLQRYGVRKLELLIAMLVLVMAACFFGEMSYVKPPAKELFKGMFIP  214

Query  704   KLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFV  883
             KL G GAT DAIALLGALVMPHNLFLHSALVL+RK+PNS+RG+NDACR+FLIESGFALF+
Sbjct  215   KLKGDGATGDAIALLGALVMPHNLFLHSALVLSRKIPNSIRGINDACRFFLIESGFALFI  274

Query  884   AFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLAS  1063
             +FLINVAVVSVSGTVC    LS+ + + CSD++LNSASFLLKNVLGKSSSTVYAIALLAS
Sbjct  275   SFLINVAVVSVSGTVCGAHNLSQQNKESCSDITLNSASFLLKNVLGKSSSTVYAIALLAS  334

Query  1064  GQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiia  1243
             GQSSTITGTYAGQ+IMQGFLDLKMK W RNL TR IAITPSL+VSIIGG SGAGRLIIIA
Sbjct  335   GQSSTITGTYAGQFIMQGFLDLKMKTWLRNLFTRLIAITPSLVVSIIGGPSGAGRLIIIA  394

Query  1244  sMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDW  1423
             SMILSFELPFALIPLLKFSSSSTK+GP+KNSIYIIV+SWILGLGIIGINIYYLSTAFV W
Sbjct  395   SMILSFELPFALIPLLKFSSSSTKLGPHKNSIYIIVISWILGLGIIGINIYYLSTAFVGW  454

Query  1424  LIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMDNNVNNNV  1603
             L++N+LPK GNVL+GI+VFPLMAIY++AVIYLMFRKDKVVT+I P   D  M+N  NN  
Sbjct  455   LLNNSLPKVGNVLIGILVFPLMAIYILAVIYLMFRKDKVVTYIDP-IKDHHMENGTNNME  513

Query  1604  CMTPIDHND  1630
              + P+ + +
Sbjct  514   LVDPVPYRE  522



>ref|XP_008361001.1| PREDICTED: metal transporter Nramp5-like [Malus domestica]
Length=550

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/492 (80%), Positives = 445/492 (90%), Gaps = 5/492 (1%)
 Frame = +2

Query  143   LDLQ-----EEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVL  307
             LDLQ     ++  +KPGWRKFL++VGPGF+VSLAYLDPGNLETDLQAGA+HRYELLWV+L
Sbjct  38    LDLQHTIDPKDEPQKPGWRKFLAHVGPGFLVSLAYLDPGNLETDLQAGANHRYELLWVIL  97

Query  308   IGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTA  487
             IGLVFALIIQSL+ANLGV+TGKHLSELCKAEYP +VKYCLWLLAE+AVIAADIPEVIGTA
Sbjct  98    IGLVFALIIQSLSANLGVTTGKHLSELCKAEYPPFVKYCLWLLAEVAVIAADIPEVIGTA  157

Query  488   FALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKP  667
             FALN+LF+IP+W GVL TG STLLLL LQRYGVRKLE+LIAVLVF+MAACFFGEM+YVKP
Sbjct  158   FALNLLFNIPVWTGVLLTGFSTLLLLGLQRYGVRKLEILIAVLVFVMAACFFGEMSYVKP  217

Query  668   PAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACR  847
             PA  V +GMFIPKLSGQ AT DAIALLGALVMPHNLFLHSALVL+RK+P SVRG+NDACR
Sbjct  218   PASGVLQGMFIPKLSGQRATGDAIALLGALVMPHNLFLHSALVLSRKIPKSVRGINDACR  277

Query  848   YFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKS  1027
             YFLIESGFALFVAFLINVA++SVSGTVC    LS  +   CSDL+LNSASFLL+NVLG+S
Sbjct  278   YFLIESGFALFVAFLINVAIISVSGTVCHQNNLSGTEDKTCSDLTLNSASFLLQNVLGRS  337

Query  1028  SSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiig  1207
             S   YAIALLASGQSSTITGTYAGQ++MQGFLD+KMKKW+RNL+TRCIAITPSLIVSIIG
Sbjct  338   SKIFYAIALLASGQSSTITGTYAGQFVMQGFLDIKMKKWARNLLTRCIAITPSLIVSIIG  397

Query  1208  gssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiigi  1387
             GSSGAGRLIIIASMILSFELPFALIPLLKFSSS+TKMGP+KNSIYIIV+SWILG+GIIGI
Sbjct  398   GSSGAGRLIIIASMILSFELPFALIPLLKFSSSATKMGPHKNSIYIIVISWILGMGIIGI  457

Query  1388  niyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDD  1567
             NIYYLST FV W+IH++LPK   V +GI+VFPLMAIY++AV+YL  RKD VVTFI+P ++
Sbjct  458   NIYYLSTGFVGWIIHSSLPKVATVFIGILVFPLMAIYILAVVYLTLRKDTVVTFIEPTNN  517

Query  1568  DSKMDNNVNNNV  1603
             D    N + N +
Sbjct  518   DPAAQNQMENGL  529



>ref|XP_006386366.1| hypothetical protein POPTR_0002s08100g [Populus trichocarpa]
 gb|ERP64163.1| hypothetical protein POPTR_0002s08100g [Populus trichocarpa]
Length=546

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/498 (79%), Positives = 439/498 (88%), Gaps = 6/498 (1%)
 Frame = +2

Query  122   DSINKLQLDLQ------EEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHR  283
             + I  L LD Q      +   +KPGWRKFL YVGPGF+VSLAYLDPGNLETDLQAGA+H 
Sbjct  22    NRIAALNLDGQSPPCIDDYDQQKPGWRKFLPYVGPGFLVSLAYLDPGNLETDLQAGANHG  81

Query  284   YELLWVVLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAAD  463
             YELLWV+LIGL+FALIIQSLAANLGVSTG+HL+ELCKAEYPKYV++ LWLLAE+AVIAAD
Sbjct  82    YELLWVILIGLIFALIIQSLAANLGVSTGRHLAELCKAEYPKYVRWSLWLLAEVAVIAAD  141

Query  464   IPEVIGTAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFF  643
             IPEVIGTAFALNILFHIP+W GVL TGLSTLLLL LQ+YG+RKLELLI+ LVF MAACFF
Sbjct  142   IPEVIGTAFALNILFHIPVWAGVLMTGLSTLLLLGLQKYGIRKLELLISALVFTMAACFF  201

Query  644   GEMAYVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSV  823
             GE++YVKPPA  V KG+FIPKLSGQGAT DAIALLGALVMPHNLFLHSALVL+RKVPNSV
Sbjct  202   GELSYVKPPASGVLKGLFIPKLSGQGATGDAIALLGALVMPHNLFLHSALVLSRKVPNSV  261

Query  824   RGVNDACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFL  1003
             RG+NDACRYFLIESGFALFVAFLINV+++SVSGTVC    LS ++ D C DL+L  ASFL
Sbjct  262   RGINDACRYFLIESGFALFVAFLINVSIISVSGTVCLAKNLSPENADQCGDLTLKGASFL  321

Query  1004  LKNVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITP  1183
             LKNVLGKSSST+YAIALLASGQSSTITGTYAGQYIMQGFLDLKM+KW RNL TRCIAI P
Sbjct  322   LKNVLGKSSSTIYAIALLASGQSSTITGTYAGQYIMQGFLDLKMRKWLRNLTTRCIAILP  381

Query  1184  slivsiiggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswi  1363
             SL VSIIGGSSGA RLIIIASMILSFELPFALIPLLKFSSS+ KMGP+KNSIYIIV+SW 
Sbjct  382   SLFVSIIGGSSGASRLIIIASMILSFELPFALIPLLKFSSSNPKMGPHKNSIYIIVISWT  441

Query  1364  lglgiiginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVV  1543
             LG  IIGIN+YYLST FV WL HNNLPK GNV++GI+VFPLMAIY++A+IYL FRKD  V
Sbjct  442   LGFMIIGINVYYLSTGFVGWLTHNNLPKVGNVIIGIIVFPLMAIYILAIIYLTFRKDTAV  501

Query  1544  TFIQPNDDDSKMDNNVNN  1597
             T+I P  +D  ++ N+ N
Sbjct  502   TYIDPVKNDPNLEANMEN  519



>ref|XP_002307454.1| root-specific metal transporter family protein [Populus trichocarpa]
 gb|EEE94450.1| root-specific metal transporter family protein [Populus trichocarpa]
Length=585

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/520 (76%), Positives = 441/520 (85%), Gaps = 33/520 (6%)
 Frame = +2

Query  143   LDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVF  322
             LDLQ+ +++KPGWRKFLSYVGPGF+VSLAYLDPGNLETDLQAGA+HRYELLWV+LIGL+F
Sbjct  41    LDLQDPNHQKPGWRKFLSYVGPGFLVSLAYLDPGNLETDLQAGANHRYELLWVILIGLIF  100

Query  323   ALIIQSLAANLGVSTGK------------HLSELCKAEYPKYVKYCLWLLAELAVIAADI  466
             ALIIQSLAANLGVSTGK            HLSELCK EYPKYVKYCLWLLAE++VIAADI
Sbjct  101   ALIIQSLAANLGVSTGKTFKHHTSWILGKHLSELCKTEYPKYVKYCLWLLAEISVIAADI  160

Query  467   PE------------------VIGTAFALNILFHIPLWvgvlctglstllllslQRYGVRK  592
             PE                  +IGTAFALNILFHIP+WVGVLCTG STL+LL LQ+YGVRK
Sbjct  161   PEGIISSLLHYFKLILDTYLLIGTAFALNILFHIPVWVGVLCTGCSTLVLLGLQKYGVRK  220

Query  593   LELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHN  772
             LELLIAVLVF+MAACFFGEM+YVKP A DV KGMFIPKLSGQGAT DAIALLGAL+MPHN
Sbjct  221   LELLIAVLVFVMAACFFGEMSYVKPSATDVLKGMFIPKLSGQGATGDAIALLGALIMPHN  280

Query  773   LFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSK  952
             LFLHSALVL+RK+PNSVRG+NDAC YFLIESGFALF+AFLIN+AV+SVSGTVCS   LS 
Sbjct  281   LFLHSALVLSRKMPNSVRGINDACHYFLIESGFALFIAFLINLAVISVSGTVCSAQNLSS  340

Query  953   DDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLK  1132
             ++ D C DL+LNSASFLL+NVLGKSSS +YAIALLASGQSSTITGTYAGQYIMQGFL+LK
Sbjct  341   ENADRCGDLTLNSASFLLQNVLGKSSSKIYAIALLASGQSSTITGTYAGQYIMQGFLELK  400

Query  1133  MKKWSRNLMTRCIAITPslivsi---iggssgagrliiiasMILSFELPFALIPLLKFSS  1303
             M+KW RNL+TRCIAI PSL+VSI     G+     +  +  MILSFELPFALIPLLKFSS
Sbjct  401   MRKWIRNLVTRCIAIAPSLVVSIIGGSSGAGRLIIIASVLQMILSFELPFALIPLLKFSS  460

Query  1304  SSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFP  1483
             S+TKMGP+KNSIYIIV+SWILGLGIIGINIYYLST FV WLI NNLPK GNV + I+VFP
Sbjct  461   STTKMGPHKNSIYIIVISWILGLGIIGINIYYLSTGFVGWLIDNNLPKVGNVFIAIIVFP  520

Query  1484  LMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMDNNVNNNV  1603
             LMAIY++AVIYL FRKD VVTF+ PN +D +   N+ N +
Sbjct  521   LMAIYILAVIYLTFRKDSVVTFLGPNKNDPQQQANMENGL  560



>ref|XP_002520334.1| metal transporter, putative [Ricinus communis]
 gb|EEF42120.1| metal transporter, putative [Ricinus communis]
Length=528

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/494 (81%), Positives = 443/494 (90%), Gaps = 1/494 (0%)
 Frame = +2

Query  125   SINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVV  304
             S+ K Q   ++  ++K GWRKF+SYVGPGF+VSLAYLDPGNLETDLQAGA+H+YELLWV+
Sbjct  20    SVGKPQPCNEQPTHQKSGWRKFISYVGPGFLVSLAYLDPGNLETDLQAGANHKYELLWVI  79

Query  305   LIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGT  484
             LI L+FALIIQSLAANLGVSTGKHLSELCKAEYPK+VKYCLWLLAE+AVIAADIPEVIGT
Sbjct  80    LIALIFALIIQSLAANLGVSTGKHLSELCKAEYPKHVKYCLWLLAEIAVIAADIPEVIGT  139

Query  485   AFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVK  664
             AFALNILFHIPLWVGVLCTGLSTL+LL LQ+YGVRKLE+LIAVLVF+MAACFF EM++V+
Sbjct  140   AFALNILFHIPLWVGVLCTGLSTLILLGLQKYGVRKLEMLIAVLVFVMAACFFAEMSHVQ  199

Query  665   PPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDAC  844
             PPA  V KGMF+PKLSGQGAT DAIALLGALVMPHNLFLHSALVL+RKVPNS+ G NDAC
Sbjct  200   PPASGVIKGMFVPKLSGQGATGDAIALLGALVMPHNLFLHSALVLSRKVPNSIHGANDAC  259

Query  845   RYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGK  1024
             RYFL+ESGFALF+AFLINVAVVSVSGTVCS   LS  + D C DL+LNSASFLL+NVLGK
Sbjct  260   RYFLVESGFALFIAFLINVAVVSVSGTVCSAHTLSHKNEDQCRDLTLNSASFLLQNVLGK  319

Query  1025  SSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsii  1204
             SSS +YAIALLASGQSSTI+GTYAGQYIMQGFLD+KM+KW RNLMTRCIAITPSLI SII
Sbjct  320   SSSILYAIALLASGQSSTISGTYAGQYIMQGFLDIKMRKWIRNLMTRCIAITPSLIASII  379

Query  1205  ggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiig  1384
             GGS GAG LIIIASMILSFELPFALIPLLKFSSSS KMGP+KNSI++IV SWILGLGIIG
Sbjct  380   GGSQGAGHLIIIASMILSFELPFALIPLLKFSSSSIKMGPHKNSIFVIVFSWILGLGIIG  439

Query  1385  iniyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQP-N  1561
             INIYYLST FV WLI N+LPK G +L+GI VFPLM IY++AVI+L  RKD VVTFI+P  
Sbjct  440   INIYYLSTGFVGWLIDNDLPKVGKLLIGIAVFPLMIIYLLAVIFLAIRKDTVVTFIEPVK  499

Query  1562  DDDSKMDNNVNNNV  1603
             DD + +  N+   V
Sbjct  500   DDPTTVQPNMEQGV  513



>ref|XP_003526645.1| PREDICTED: metal transporter Nramp5-like [Glycine max]
 gb|KHN46998.1| Metal transporter Nramp5 [Glycine soja]
Length=544

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/473 (83%), Positives = 436/473 (92%), Gaps = 0/473 (0%)
 Frame = +2

Query  155   EEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALII  334
               +++KPGW+KFLSYVGPGF+VSLAYLDPGN+ETDLQAGADH+YELLWV+LIGLVFALII
Sbjct  39    SSNHQKPGWKKFLSYVGPGFLVSLAYLDPGNMETDLQAGADHKYELLWVILIGLVFALII  98

Query  335   QSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHI  514
             QSLAANLGV+TGKHLSELCKAEYP  VKYCLWLLAELAVIAADIPEVIGTAFALNILFHI
Sbjct  99    QSLAANLGVTTGKHLSELCKAEYPLLVKYCLWLLAELAVIAADIPEVIGTAFALNILFHI  158

Query  515   PLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGM  694
             P+W GVL TG STLL L LQR+GVRKLELLI++LVF+MA CFFGEM+YVKPPA  V KGM
Sbjct  159   PVWAGVLITGCSTLLFLGLQRFGVRKLELLISILVFVMAGCFFGEMSYVKPPASGVLKGM  218

Query  695   FIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFA  874
             F+PKLSGQGAT DAIALLGALVMPHNLFLHSALVL+RKVP+SVRG+NDACRYFL+ESGFA
Sbjct  219   FVPKLSGQGATGDAIALLGALVMPHNLFLHSALVLSRKVPSSVRGINDACRYFLMESGFA  278

Query  875   LFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIAL  1054
             LFVAFLINVA++SV+GTVCS   LS ++ D CSDL+LNSASFLLKNVLG+SSST+YAIAL
Sbjct  279   LFVAFLINVAMISVAGTVCSADNLSAENADQCSDLTLNSASFLLKNVLGRSSSTIYAIAL  338

Query  1055  LASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrli  1234
             LASGQSS ITGTYAGQYIMQGFLD++MK+W RN +TRCIAI PSLIVSIIGGS GAGRLI
Sbjct  339   LASGQSSAITGTYAGQYIMQGFLDMRMKRWIRNFVTRCIAIAPSLIVSIIGGSQGAGRLI  398

Query  1235  iiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAF  1414
             IIASMILSFELPFALIPLLKFSSSSTKMGP+KNSI IIV+SWILGLGIIGIN+YYLSTAF
Sbjct  399   IIASMILSFELPFALIPLLKFSSSSTKMGPHKNSIIIIVISWILGLGIIGINVYYLSTAF  458

Query  1415  VDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDS  1573
             V WLIH++LPK  NV +GI+VFPLMA+YV AVIYL FRKD V T+I+  ++ +
Sbjct  459   VGWLIHSSLPKVANVFIGIIVFPLMALYVAAVIYLTFRKDTVKTYIETKNEPA  511



>ref|XP_009341347.1| PREDICTED: metal transporter Nramp5-like [Pyrus x bretschneideri]
Length=550

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/492 (80%), Positives = 444/492 (90%), Gaps = 5/492 (1%)
 Frame = +2

Query  143   LDLQ-----EEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVL  307
             LDLQ     ++  +KPGWRKFL++VGPGF+VSLAYLDPGNLETDLQAGA+HRYELLWV+L
Sbjct  38    LDLQHTIDPKDEPQKPGWRKFLAHVGPGFLVSLAYLDPGNLETDLQAGANHRYELLWVIL  97

Query  308   IGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTA  487
             IGLVFALIIQSL+ANLGV+TGKHLSELCKAEYP +VKYCLWLLAE+AVIAADIPEVIGTA
Sbjct  98    IGLVFALIIQSLSANLGVTTGKHLSELCKAEYPPFVKYCLWLLAEVAVIAADIPEVIGTA  157

Query  488   FALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKP  667
             FALN+LF+IP+W GVL TG STLLLL LQRYGVRKLE+LIAVLVF+MAACFFGEM+YVKP
Sbjct  158   FALNLLFNIPVWTGVLLTGFSTLLLLGLQRYGVRKLEILIAVLVFVMAACFFGEMSYVKP  217

Query  668   PAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACR  847
             PA  V +GMFIPKLSGQ AT DAIALLGALVMPHNLFLHSALVL+RK+P SVRG+NDACR
Sbjct  218   PASSVLQGMFIPKLSGQRATGDAIALLGALVMPHNLFLHSALVLSRKIPKSVRGINDACR  277

Query  848   YFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKS  1027
             YFLIESGFALFVAFLINVA++SVSGTVC    LS  +   CSDL+LNSASFLL+NVLG+S
Sbjct  278   YFLIESGFALFVAFLINVAIISVSGTVCHQNDLSDTEDKTCSDLTLNSASFLLQNVLGRS  337

Query  1028  SSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiig  1207
             S   YAIALLASGQSSTITGTYAGQ++MQGFLD+KM KW+RNL+TRCIAITPSLIVSIIG
Sbjct  338   SKIFYAIALLASGQSSTITGTYAGQFVMQGFLDIKMNKWARNLLTRCIAITPSLIVSIIG  397

Query  1208  gssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiigi  1387
             GSSGAGRLIIIASMILSFELPFALIPLLKFSSS+TKMGP+KNSIYIIV+SWILG+GIIGI
Sbjct  398   GSSGAGRLIIIASMILSFELPFALIPLLKFSSSATKMGPHKNSIYIIVISWILGMGIIGI  457

Query  1388  niyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDD  1567
             NIYYLST FV W+IH++LPK   V +GI+VFPLMAIY++AV+YL  RKD VVTFI+P ++
Sbjct  458   NIYYLSTGFVGWIIHSSLPKVATVFIGILVFPLMAIYILAVVYLTLRKDTVVTFIEPTNN  517

Query  1568  DSKMDNNVNNNV  1603
             D    N + + +
Sbjct  518   DPAAQNQMESGL  529



>gb|AAU00158.1| root-specific metal transporter [Malus baccata]
Length=551

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/495 (79%), Positives = 444/495 (90%), Gaps = 7/495 (1%)
 Frame = +2

Query  140   QLDLQEEHN-------KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLW  298
               DL+ +HN       +KPG RKFL++VGPGF+VSLAYLDPGNLETDLQAGA+HRYELLW
Sbjct  36    HFDLELDHNTDPKDEPQKPGLRKFLAHVGPGFLVSLAYLDPGNLETDLQAGANHRYELLW  95

Query  299   VVLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVI  478
             V+LIGL+FALIIQSL+ANLGV TGKHLSELCKAEYP +VKYCLWLLAE+AVIAADIPEVI
Sbjct  96    VILIGLIFALIIQSLSANLGVITGKHLSELCKAEYPPFVKYCLWLLAEVAVIAADIPEVI  155

Query  479   GTAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAY  658
             GTAFALNILF+IP+W GVL TG STLLLL LQ+YGVRKLE+LIAVLVF+MAACFFGEM+Y
Sbjct  156   GTAFALNILFNIPVWTGVLLTGFSTLLLLGLQKYGVRKLEMLIAVLVFVMAACFFGEMSY  215

Query  659   VKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVND  838
             VKPPA  V KGMFIPKLSGQGAT DAIALLGAL+MPHNLFLHSALVL+RK+PNSVRG+ND
Sbjct  216   VKPPASGVLKGMFIPKLSGQGATGDAIALLGALIMPHNLFLHSALVLSRKIPNSVRGMND  275

Query  839   ACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVL  1018
             ACRYFLIESGFALFVAFLINVA++SVSGTVC    LS  + D CSDL+LNSASFLL+NVL
Sbjct  276   ACRYFLIESGFALFVAFLINVAIISVSGTVCHQSNLSDKNNDTCSDLTLNSASFLLQNVL  335

Query  1019  GKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivs  1198
             G+SS  +YAIALLASGQSSTITGTYAGQ++MQGFLD+KMKKW+RNLMTRCIAITPSLIVS
Sbjct  336   GRSSKILYAIALLASGQSSTITGTYAGQFVMQGFLDIKMKKWARNLMTRCIAITPSLIVS  395

Query  1199  iiggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgi  1378
             IIGGSSGAGRLIIIASMILSFELPFALIPLLKFS S+TKMGP+KNSIYIIV+SWI+G+ I
Sbjct  396   IIGGSSGAGRLIIIASMILSFELPFALIPLLKFSGSATKMGPHKNSIYIIVISWIIGMAI  455

Query  1379  iginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQP  1558
             IGINIYYLST FV W+IH++LPK   V +GI+VFP+MAIY++AV+YL  RKD VVTF++P
Sbjct  456   IGINIYYLSTGFVGWIIHSSLPKVATVFIGILVFPIMAIYILAVLYLALRKDSVVTFVEP  515

Query  1559  NDDDSKMDNNVNNNV  1603
               +D    N + N +
Sbjct  516   TKNDPAAQNQMENGL  530



>ref|XP_009359447.1| PREDICTED: metal transporter Nramp5-like [Pyrus x bretschneideri]
Length=549

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/495 (79%), Positives = 442/495 (89%), Gaps = 7/495 (1%)
 Frame = +2

Query  140   QLDLQEEHN-------KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLW  298
               DL  +HN       +KPGWRKFL++VGPGF+VSLAYLDPGNLETDLQAGA HRYELLW
Sbjct  34    HFDLDLDHNTDPKDEPQKPGWRKFLAHVGPGFLVSLAYLDPGNLETDLQAGASHRYELLW  93

Query  299   VVLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVI  478
             V+LIGL+FALIIQSLAANLGV+TGKHLSELCKAEYP +VKYCLWLLAE+AVIAADIPEVI
Sbjct  94    VILIGLIFALIIQSLAANLGVTTGKHLSELCKAEYPPFVKYCLWLLAEVAVIAADIPEVI  153

Query  479   GTAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAY  658
             GTAFALNILF+IP+W GVL TG+STLLLL LQ+YGVRKLE+LIAVLVF+MAACFFGEM+Y
Sbjct  154   GTAFALNILFNIPVWTGVLLTGVSTLLLLGLQKYGVRKLEMLIAVLVFVMAACFFGEMSY  213

Query  659   VKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVND  838
             VKPPA  V +GMFIPKL GQGAT DAIALLGAL+MPHNLFLHSALVL+RK+P SVRG+ND
Sbjct  214   VKPPASGVLEGMFIPKLKGQGATGDAIALLGALIMPHNLFLHSALVLSRKIPKSVRGIND  273

Query  839   ACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVL  1018
             ACRYFLIESGFALFVAFLINVA++SVSGTVC    LS    D CS+L+LNSASFLL+NVL
Sbjct  274   ACRYFLIESGFALFVAFLINVAIISVSGTVCHQSNLSDKYNDICSNLTLNSASFLLQNVL  333

Query  1019  GKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivs  1198
             G+SS  +YAIAL ASGQSSTITGTYAGQ++MQGFLD+KMKKW+RNLMTRCIAITPSLIVS
Sbjct  334   GRSSKILYAIALFASGQSSTITGTYAGQFVMQGFLDIKMKKWARNLMTRCIAITPSLIVS  393

Query  1199  iiggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgi  1378
             IIGGSSGAGRLIIIASMILSFELPFALIPLLKFS S+TKMGP+KNSIYIIV+SWILG+GI
Sbjct  394   IIGGSSGAGRLIIIASMILSFELPFALIPLLKFSGSATKMGPHKNSIYIIVISWILGMGI  453

Query  1379  iginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQP  1558
             IGINIYYLST FV W+IH++LPK   V +GI+VFPLMAIY++A++YL  RKD VVTF++P
Sbjct  454   IGINIYYLSTGFVGWIIHSSLPKVATVFIGILVFPLMAIYILAILYLTLRKDSVVTFVEP  513

Query  1559  NDDDSKMDNNVNNNV  1603
               +D    N + N +
Sbjct  514   TKNDPAAQNQMENGL  528



>ref|XP_004502516.1| PREDICTED: metal transporter Nramp5-like [Cicer arietinum]
Length=522

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/484 (79%), Positives = 436/484 (90%), Gaps = 1/484 (0%)
 Frame = +2

Query  152   QEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALI  331
               E +K  GWRKFL Y+GPGF+VSLAYLDPGN+ETDLQAGA+H+YELLW+VLIGL+FALI
Sbjct  16    NHETHKSSGWRKFLPYIGPGFLVSLAYLDPGNMETDLQAGANHKYELLWLVLIGLIFALI  75

Query  332   IQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFH  511
             IQSLAANLGV+TGKHLSE+CK EYP +VKYCLWLLAE+AVIAADIPEVIGTAFALNILFH
Sbjct  76    IQSLAANLGVTTGKHLSEVCKIEYPLFVKYCLWLLAEVAVIAADIPEVIGTAFALNILFH  135

Query  512   IPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKG  691
             IPLW GVL TG STLLLLSLQR+GVRKLELLI +LVF+MAACFF EM+YV PPA  V KG
Sbjct  136   IPLWAGVLLTGCSTLLLLSLQRFGVRKLELLITILVFVMAACFFAEMSYVNPPASGVLKG  195

Query  692   MFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGF  871
             MF+PKLSG GA  DAIALLGAL+MPHNLFLHSALVL+RKVP+SVRG+NDACRYFL ESGF
Sbjct  196   MFVPKLSGSGAVGDAIALLGALIMPHNLFLHSALVLSRKVPSSVRGINDACRYFLYESGF  255

Query  872   ALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIA  1051
             ALFVAFLINVA++SVSGTVCS   LS ++ D C++L+LNSASFLLKNVLG+SSST+YAIA
Sbjct  256   ALFVAFLINVAMISVSGTVCSASDLSGENADRCNNLTLNSASFLLKNVLGRSSSTIYAIA  315

Query  1052  LLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrl  1231
             LLASGQSSTITGTYAGQYIMQGFL+++MK+W RNLMTRCIAI PSL+VSI+GGSSG+ +L
Sbjct  316   LLASGQSSTITGTYAGQYIMQGFLNIRMKRWKRNLMTRCIAIAPSLVVSIVGGSSGSSQL  375

Query  1232  iiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTA  1411
             IIIASMILSFELPFALIPLLKFSSSSTKMGP+KNS+ II +SWILG GIIGIN+YYLSTA
Sbjct  376   IIIASMILSFELPFALIPLLKFSSSSTKMGPHKNSMIIITISWILGAGIIGINVYYLSTA  435

Query  1412  FVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMDNNV  1591
             FV WLIH++LPK  NV +GI+VFPLM IY+V+VIYL FRKD VVTFI+   +D+ M +NV
Sbjct  436   FVKWLIHSSLPKVANVFIGIIVFPLMVIYIVSVIYLTFRKDTVVTFIE-TKNDTVMQSNV  494

Query  1592  NNNV  1603
                +
Sbjct  495   EKGI  498



>ref|XP_002284550.1| PREDICTED: metal transporter Nramp5-like isoform X1 [Vitis vinifera]
Length=544

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/512 (77%), Positives = 442/512 (86%), Gaps = 3/512 (1%)
 Frame = +2

Query  140   QLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLV  319
             +LDL   +++KPGWR FL++VGPGF+VSLAYLDPGNLETDLQAG++H YELLWVVLIGL+
Sbjct  19    RLDL---NHQKPGWRNFLAFVGPGFLVSLAYLDPGNLETDLQAGSNHGYELLWVVLIGLI  75

Query  320   FALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALN  499
             FAL+IQSLAANLGV TGKHLSELC+AEYPKYVKYCLWLLAE+AVIAADIPEVIGTAFALN
Sbjct  76    FALVIQSLAANLGVITGKHLSELCRAEYPKYVKYCLWLLAEIAVIAADIPEVIGTAFALN  135

Query  500   ILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAED  679
             ILF +P+W GVL TGLSTLLLL LQRYGVRKLE+LIA LVF+MA CFF EM+YVKPPA  
Sbjct  136   ILFKVPVWAGVLFTGLSTLLLLGLQRYGVRKLEMLIAGLVFIMAGCFFAEMSYVKPPASR  195

Query  680   VFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLI  859
             V KGM IPKL G  AT DAIAL GALVMPHNLFLHSALVL+RKVPNSVRGVN+ACRYFLI
Sbjct  196   VIKGMLIPKLKGSTATTDAIALFGALVMPHNLFLHSALVLSRKVPNSVRGVNEACRYFLI  255

Query  860   ESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTV  1039
             ESG AL VAF INVAVVSVSGT+CS   LS++++D CSDL+LNSASFLLKNVLG SS  V
Sbjct  256   ESGMALMVAFCINVAVVSVSGTICSVNNLSRENMDQCSDLNLNSASFLLKNVLGGSSKVV  315

Query  1040  YAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssg  1219
             YAIAL ASGQSSTITGTYAGQYIMQGFL+LKMK+W RNLMTRCIAITPSLIVSII GS+G
Sbjct  316   YAIALFASGQSSTITGTYAGQYIMQGFLNLKMKRWLRNLMTRCIAITPSLIVSIISGSAG  375

Query  1220  agrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyy  1399
             AGRLIIIASMILSFELPFALIPLLKFSSSSTKMGP+KNSIY+IV SWILG G++GINIYY
Sbjct  376   AGRLIIIASMILSFELPFALIPLLKFSSSSTKMGPHKNSIYVIVFSWILGFGLMGINIYY  435

Query  1400  lsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKM  1579
             L+T FV+WL+HN+LPK GNV +GI+VFPLMA+YV+AV+YL FRKD VVTFI+   D+   
Sbjct  436   LATGFVNWLLHNDLPKVGNVFIGIIVFPLMAVYVLAVLYLTFRKDTVVTFIEAEKDEHSA  495

Query  1580  DNNVNNNVCMTPIDHNDFSHTLP*LSRPDQYF  1675
               +V   +     D +  +H    L   +  F
Sbjct  496   RTHVEKKLEAEKYDQSARTHVEKKLDNSNHTF  527



>ref|XP_007137450.1| hypothetical protein PHAVU_009G127900g [Phaseolus vulgaris]
 gb|ESW09444.1| hypothetical protein PHAVU_009G127900g [Phaseolus vulgaris]
Length=538

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/470 (83%), Positives = 433/470 (92%), Gaps = 0/470 (0%)
 Frame = +2

Query  164   NKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSL  343
             ++KPGW+KF++YVGPGF+VSLAYLDPGN+ETDLQAGADH+YELLWV+LIGLVFALIIQSL
Sbjct  36    HEKPGWKKFMAYVGPGFLVSLAYLDPGNMETDLQAGADHKYELLWVILIGLVFALIIQSL  95

Query  344   AANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLW  523
             AANLGVSTGKHLSELCKAEYP  VKYCLWLLAELAVIAADIPEVIGTAFALNILFHIP+W
Sbjct  96    AANLGVSTGKHLSELCKAEYPLLVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPVW  155

Query  524   vgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIP  703
              GVL TG STLL L LQR+GVRKLELLI+VLVF+MA CFFGEM+YVKPPA  V KGMFIP
Sbjct  156   AGVLITGCSTLLFLGLQRFGVRKLELLISVLVFVMAGCFFGEMSYVKPPASGVLKGMFIP  215

Query  704   KLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFV  883
             KLSGQGAT DAIALLGALVMPHNLFLHSALVL+RKVP+SVRG+NDACRYFLIESGFALFV
Sbjct  216   KLSGQGATGDAIALLGALVMPHNLFLHSALVLSRKVPSSVRGINDACRYFLIESGFALFV  275

Query  884   AFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLAS  1063
             AFLINVA++SVSGTVC+   +S ++   CSDL+LNSASFLLKNVLG+SSST+YAIALLAS
Sbjct  276   AFLINVAMISVSGTVCAAENISAENAHQCSDLTLNSASFLLKNVLGRSSSTIYAIALLAS  335

Query  1064  GQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiia  1243
             GQSS ITGTYAGQ+IMQGFLD++MK W RN +TRCIAITPSLIVSIIGGS GAGRLIIIA
Sbjct  336   GQSSAITGTYAGQFIMQGFLDMRMKTWIRNFVTRCIAITPSLIVSIIGGSQGAGRLIIIA  395

Query  1244  sMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDW  1423
             SMILSFELPFALIPLLKFSSSSTKMGP+KNS+ IIV+SWILGLGIIGIN+YYLSTAFV W
Sbjct  396   SMILSFELPFALIPLLKFSSSSTKMGPHKNSMIIIVISWILGLGIIGINVYYLSTAFVGW  455

Query  1424  LIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDS  1573
             LI N+LPK  NV +GI+VFPLMA+YV AVIYL FRKD V T+I+  ++ +
Sbjct  456   LIKNSLPKVANVFIGIIVFPLMALYVGAVIYLTFRKDTVKTYIERKNEGA  505



>ref|XP_009341351.1| PREDICTED: metal transporter Nramp5-like [Pyrus x bretschneideri]
Length=551

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/493 (80%), Positives = 444/493 (90%), Gaps = 6/493 (1%)
 Frame = +2

Query  143   LDLQ-----EEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVL  307
             LDLQ     ++  +KPGWRKFL++VGPGF+VSLAYLDPGNLETDLQAGA+HRYELLWV+L
Sbjct  38    LDLQHTIDPKDEPQKPGWRKFLAHVGPGFLVSLAYLDPGNLETDLQAGANHRYELLWVIL  97

Query  308   IGLVFALIIQSLAANLGVSTG-KHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGT  484
             IGLVFALIIQSL+ANLGV+TG KHLSELCKAEYP +VKYCLWLLAE+AVIAADIPEVIGT
Sbjct  98    IGLVFALIIQSLSANLGVTTGMKHLSELCKAEYPPFVKYCLWLLAEVAVIAADIPEVIGT  157

Query  485   AFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVK  664
             AFALN+LF+IP+W GVL TG STLLLL LQRYGVRKLE+LIAVLVF+MAACFFGEM+YVK
Sbjct  158   AFALNLLFNIPVWTGVLLTGFSTLLLLGLQRYGVRKLEILIAVLVFVMAACFFGEMSYVK  217

Query  665   PPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDAC  844
             PPA  V +GMFIPKLSGQ AT DAIALLGALVMPHNLFLHSALVL+RK+P SVRG+NDAC
Sbjct  218   PPASSVLQGMFIPKLSGQRATGDAIALLGALVMPHNLFLHSALVLSRKIPKSVRGINDAC  277

Query  845   RYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGK  1024
             RYFLIESGFALFVAFLINVA++SVSGTVC    LS  +   CSDL+LNSASFLL+NVLG+
Sbjct  278   RYFLIESGFALFVAFLINVAIISVSGTVCHQNDLSDTEDKTCSDLTLNSASFLLQNVLGR  337

Query  1025  SSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsii  1204
             SS   YAIALLASGQSSTITGTYAGQ++MQGFLD+KM KW+RNL+TRCIAITPSLIVSII
Sbjct  338   SSKIFYAIALLASGQSSTITGTYAGQFVMQGFLDIKMNKWARNLLTRCIAITPSLIVSII  397

Query  1205  ggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiig  1384
             GGSSGAGRLIIIASMILSFELPFALIPLLKFSSS+TKMGP+KNSIYIIV+SWILG+GIIG
Sbjct  398   GGSSGAGRLIIIASMILSFELPFALIPLLKFSSSATKMGPHKNSIYIIVISWILGMGIIG  457

Query  1385  iniyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPND  1564
             INIYYLST FV W+IH++LPK   V +GI+VFPLMAIY++AV+YL  RKD VVTFI+P +
Sbjct  458   INIYYLSTGFVGWIIHSSLPKVATVFIGILVFPLMAIYILAVVYLTLRKDTVVTFIEPTN  517

Query  1565  DDSKMDNNVNNNV  1603
             +D    N + + +
Sbjct  518   NDPAAQNQMESGL  530



>ref|XP_010530206.1| PREDICTED: metal transporter Nramp5-like [Tarenaya hassleriana]
Length=522

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/472 (82%), Positives = 429/472 (91%), Gaps = 4/472 (1%)
 Frame = +2

Query  155   EEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALII  334
             +EH    GWRKFL++VGPGFMVSLAYLDPGNLETDLQAGA+H+YELLWVVLIGLVFALII
Sbjct  33    DEH----GWRKFLTFVGPGFMVSLAYLDPGNLETDLQAGANHKYELLWVVLIGLVFALII  88

Query  335   QSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHI  514
             QSLAANLGV+TGKHLSE+CKAEYPK+VKYCLW LAELAVIAADIPEVIGTAFALNILFH+
Sbjct  89    QSLAANLGVTTGKHLSEICKAEYPKFVKYCLWFLAELAVIAADIPEVIGTAFALNILFHV  148

Query  515   PLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGM  694
             P+W GVL TGLSTLLLL LQRYGVRKLE+LIA+LV +MAACFFGEMAYVKPPA++V  GM
Sbjct  149   PVWSGVLLTGLSTLLLLGLQRYGVRKLEMLIAILVLVMAACFFGEMAYVKPPAKEVINGM  208

Query  695   FIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFA  874
             F+P L+GQGA ADAIALLGAL+MPHNLFLHSALVL+RKVPNSV G+N+ACR+FLIES  A
Sbjct  209   FVPTLNGQGAVADAIALLGALIMPHNLFLHSALVLSRKVPNSVGGINNACRFFLIESALA  268

Query  875   LFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIAL  1054
             LFVAFLINVAVVSVSGTVCS   LS +  + CSDL+LNSASFLL+NVLGKSSST+YAIAL
Sbjct  269   LFVAFLINVAVVSVSGTVCSVDNLSPESSNQCSDLTLNSASFLLQNVLGKSSSTLYAIAL  328

Query  1055  LASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrli  1234
             LASGQSS ITGTYAGQ+IMQGFLDLKMKKW RNL+TRCIAI PSL+VS+IGGS GAGRLI
Sbjct  329   LASGQSSAITGTYAGQFIMQGFLDLKMKKWIRNLVTRCIAIIPSLVVSVIGGSQGAGRLI  388

Query  1235  iiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAF  1414
             +IASMILSFELPFALIPLLKFSSSSTKMGP+KNSI+II+ SW+LG GIIGIN+YYLST F
Sbjct  389   VIASMILSFELPFALIPLLKFSSSSTKMGPHKNSIFIIITSWVLGFGIIGINVYYLSTGF  448

Query  1415  VDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDD  1570
             + WLIHN+LPK GN+ +GI VFPLM  YV AVIYL FRKD V TF+ PN + 
Sbjct  449   IGWLIHNSLPKVGNIFIGITVFPLMGAYVFAVIYLTFRKDTVATFVDPNKNS  500



>emb|CDP10962.1| unnamed protein product [Coffea canephora]
Length=547

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/531 (79%), Positives = 463/531 (87%), Gaps = 22/531 (4%)
 Frame = +2

Query  65    SHRIVAVDEsplpssnnnpDSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPG  244
             S RIVAVDE+         D      LD  E   +KPGWRKFLS+VGPGF+VS+AYLDPG
Sbjct  15    SKRIVAVDENRPSI-----DESKHFDLD-HEPQEEKPGWRKFLSFVGPGFLVSMAYLDPG  68

Query  245   NLETDLQAGADHRYE----LLWVVLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKY  412
             NLETDLQAGA+H YE    LLW++LIGL+FALIIQSLAANLGV+TG+HLSELCKAEYPKY
Sbjct  69    NLETDLQAGANHGYEASKDLLWIILIGLIFALIIQSLAANLGVTTGRHLSELCKAEYPKY  128

Query  413   VKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvgvlctglstllllslQRYGVRK  592
             VKY LWLLAE+AVIAADIPEVIGTAF LNILFHIPLWVGVLCTG+STLLLL LQ+YGVRK
Sbjct  129   VKYSLWLLAEVAVIAADIPEVIGTAFGLNILFHIPLWVGVLCTGMSTLLLLGLQKYGVRK  188

Query  593   LELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHN  772
             LELL+AVLVF+MAACFFGE++YVKPPA+DV KGMF+PKL G  ATADAIALLGALVMPHN
Sbjct  189   LELLVAVLVFVMAACFFGELSYVKPPAKDVLKGMFVPKLKGNSATADAIALLGALVMPHN  248

Query  773   LFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSK  952
             LFLHSALVL+RKVPNSVRG+NDACR+FLIESGFALFVAFLINVA+VSVSG VCS   LS+
Sbjct  249   LFLHSALVLSRKVPNSVRGINDACRFFLIESGFALFVAFLINVAIVSVSGAVCSGENLSQ  308

Query  953   DDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLK  1132
             + ++ C+DLSL+SASFLLKNVLG+SSST+YAIALLASGQSSTITGTYAGQ+IMQGFLDLK
Sbjct  309   EIIESCNDLSLDSASFLLKNVLGRSSSTIYAIALLASGQSSTITGTYAGQFIMQGFLDLK  368

Query  1133  MKKWSRNLMTRCIAITPslivsiiggssgagrliiiasMILSFELPFALIPLLKFSSSST  1312
             MKKW RNLMTRCIAITPSLIVSIIGGSSGAGRLIIIASMILSFELPFALIPLLKFSSS+T
Sbjct  369   MKKWLRNLMTRCIAITPSLIVSIIGGSSGAGRLIIIASMILSFELPFALIPLLKFSSSTT  428

Query  1313  KMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMA  1492
             KMGPYKNSIYIIV+SWILGLG+IGINIYYLST FV WLIHN+LPK GNV +GI+VFPLMA
Sbjct  429   KMGPYKNSIYIIVISWILGLGLIGINIYYLSTGFVGWLIHNSLPKVGNVFIGILVFPLMA  488

Query  1493  IYVVAVIYLMFRKDKVVTFIQ-----PNDDDSKMDNNVNNNVCMTPIDHND  1630
             +Y++AVIYLMFRKD V TF +     PN      D N+N        DH D
Sbjct  489   VYILAVIYLMFRKDTVNTFEESAKHDPNAQIHMEDGNLNR-------DHGD  532



>ref|XP_003602053.1| Metal transporter [Medicago truncatula]
 gb|AES72304.1| NRAMP metal ion transporter 6 [Medicago truncatula]
Length=531

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/484 (78%), Positives = 431/484 (89%), Gaps = 1/484 (0%)
 Frame = +2

Query  152   QEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALI  331
               E  +K GWRKFL Y+GPGF+VSLAYLDPGN+ETDLQAGA+H YELLW+VLIGL+FALI
Sbjct  25    NHEETQKSGWRKFLPYIGPGFLVSLAYLDPGNMETDLQAGANHGYELLWLVLIGLIFALI  84

Query  332   IQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFH  511
             IQSLAANLGV+TGKHLSE+C+ EYP +VKYCLWLLAE+AVIAADIPEVIGTAFALNILF+
Sbjct  85    IQSLAANLGVTTGKHLSEVCEVEYPLFVKYCLWLLAEVAVIAADIPEVIGTAFALNILFN  144

Query  512   IPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKG  691
             IPLW GVL TG STLLLLSLQR+GVRKLELLI +LVF+MA CFF EM+YV PPA  V KG
Sbjct  145   IPLWAGVLLTGFSTLLLLSLQRFGVRKLELLITILVFVMAGCFFAEMSYVNPPASGVLKG  204

Query  692   MFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGF  871
             MF+PKL+G+GA ADAIALLGAL+MPHNLFLHSALVL+RKVP SVRG+N+ACRYFL ESGF
Sbjct  205   MFVPKLAGEGAVADAIALLGALIMPHNLFLHSALVLSRKVPKSVRGINEACRYFLYESGF  264

Query  872   ALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIA  1051
             ALFVAFLINVA++SVSGTVCS   LS D+++ C+DL+LNSASFLLKNVLG+SSST+YAIA
Sbjct  265   ALFVAFLINVAMISVSGTVCSANDLSGDNVERCNDLTLNSASFLLKNVLGRSSSTIYAIA  324

Query  1052  LLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrl  1231
             LLASGQSSTITGTYAGQYIMQGFLD++MK+W RNLMTRCIAI PSL V+IIGGSSG+ RL
Sbjct  325   LLASGQSSTITGTYAGQYIMQGFLDIRMKRWKRNLMTRCIAIAPSLAVAIIGGSSGSSRL  384

Query  1232  iiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTA  1411
             IIIASMILSFELPFALIPLLKFSSSSTKMGP+KNS+ II +SWILG GII IN+YYLSTA
Sbjct  385   IIIASMILSFELPFALIPLLKFSSSSTKMGPHKNSMIIITISWILGFGIISINVYYLSTA  444

Query  1412  FVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMDNNV  1591
             FV W+IH++LPK  NV +GI+VFPLMAIY+ +VIYL FRKD V  FI+   +D+ M N V
Sbjct  445   FVKWIIHSSLPKVANVFIGIIVFPLMAIYIASVIYLTFRKDTVEMFIE-TKNDTVMQNQV  503

Query  1592  NNNV  1603
                +
Sbjct  504   EKGI  507



>ref|XP_010664181.1| PREDICTED: metal transporter Nramp5-like isoform X2 [Vitis vinifera]
Length=540

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/512 (76%), Positives = 439/512 (86%), Gaps = 7/512 (1%)
 Frame = +2

Query  140   QLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLV  319
             +LDL   +++KPGWR FL++VGPGF+VSLAYLDPGNLETDLQAG++H YELLWVVLIGL+
Sbjct  19    RLDL---NHQKPGWRNFLAFVGPGFLVSLAYLDPGNLETDLQAGSNHGYELLWVVLIGLI  75

Query  320   FALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALN  499
             FAL+IQSLAANLG    KHLSELC+AEYPKYVKYCLWLLAE+AVIAADIPEVIGTAFALN
Sbjct  76    FALVIQSLAANLG----KHLSELCRAEYPKYVKYCLWLLAEIAVIAADIPEVIGTAFALN  131

Query  500   ILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAED  679
             ILF +P+W GVL TGLSTLLLL LQRYGVRKLE+LIA LVF+MA CFF EM+YVKPPA  
Sbjct  132   ILFKVPVWAGVLFTGLSTLLLLGLQRYGVRKLEMLIAGLVFIMAGCFFAEMSYVKPPASR  191

Query  680   VFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLI  859
             V KGM IPKL G  AT DAIAL GALVMPHNLFLHSALVL+RKVPNSVRGVN+ACRYFLI
Sbjct  192   VIKGMLIPKLKGSTATTDAIALFGALVMPHNLFLHSALVLSRKVPNSVRGVNEACRYFLI  251

Query  860   ESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTV  1039
             ESG AL VAF INVAVVSVSGT+CS   LS++++D CSDL+LNSASFLLKNVLG SS  V
Sbjct  252   ESGMALMVAFCINVAVVSVSGTICSVNNLSRENMDQCSDLNLNSASFLLKNVLGGSSKVV  311

Query  1040  YAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssg  1219
             YAIAL ASGQSSTITGTYAGQYIMQGFL+LKMK+W RNLMTRCIAITPSLIVSII GS+G
Sbjct  312   YAIALFASGQSSTITGTYAGQYIMQGFLNLKMKRWLRNLMTRCIAITPSLIVSIISGSAG  371

Query  1220  agrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyy  1399
             AGRLIIIASMILSFELPFALIPLLKFSSSSTKMGP+KNSIY+IV SWILG G++GINIYY
Sbjct  372   AGRLIIIASMILSFELPFALIPLLKFSSSSTKMGPHKNSIYVIVFSWILGFGLMGINIYY  431

Query  1400  lsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKM  1579
             L+T FV+WL+HN+LPK GNV +GI+VFPLMA+YV+AV+YL FRKD VVTFI+   D+   
Sbjct  432   LATGFVNWLLHNDLPKVGNVFIGIIVFPLMAVYVLAVLYLTFRKDTVVTFIEAEKDEHSA  491

Query  1580  DNNVNNNVCMTPIDHNDFSHTLP*LSRPDQYF  1675
               +V   +     D +  +H    L   +  F
Sbjct  492   RTHVEKKLEAEKYDQSARTHVEKKLDNSNHTF  523



>ref|XP_006842029.1| hypothetical protein AMTR_s00203p00024670 [Amborella trichopoda]
 gb|ERN03704.1| hypothetical protein AMTR_s00203p00024670 [Amborella trichopoda]
Length=544

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/468 (82%), Positives = 424/468 (91%), Gaps = 0/468 (0%)
 Frame = +2

Query  161   HNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQS  340
               K+PGWRKFL+Y+GPGF+VSLAYLDPGNLETDLQAGA ++YELLWVVLIGL+FALIIQS
Sbjct  42    EQKEPGWRKFLAYIGPGFLVSLAYLDPGNLETDLQAGASYQYELLWVVLIGLIFALIIQS  101

Query  341   LAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPL  520
              AANLGV+TGKHL+E CK EYPK+V YCLW+LAE+AVIAADIPEVIGTAFALNILFHIPL
Sbjct  102   FAANLGVTTGKHLAEHCKQEYPKFVNYCLWILAEVAVIAADIPEVIGTAFALNILFHIPL  161

Query  521   WvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFI  700
             WVGVL TGLSTLLLL LQRYGVRKLELLIA LVFLMAAC+FGEMAY +P A +V KGMFI
Sbjct  162   WVGVLITGLSTLLLLGLQRYGVRKLELLIASLVFLMAACYFGEMAYAQPKASEVLKGMFI  221

Query  701   PKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALF  880
             PKLSG GAT  AIAL+GALVMPHNLFLHSALVL+RKVP SV G+N ACRYFLIESGFALF
Sbjct  222   PKLSGSGATGAAIALIGALVMPHNLFLHSALVLSRKVPQSVHGINSACRYFLIESGFALF  281

Query  881   VAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLA  1060
             VAFLINVAVVSVSGTVCS   +S +D   C +L L+SASFLLKNVLG SSSTVYAIALLA
Sbjct  282   VAFLINVAVVSVSGTVCSMSNISLEDKSRCDNLDLSSASFLLKNVLGSSSSTVYAIALLA  341

Query  1061  SGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliii  1240
             SGQSSTITGTYAGQYIMQGFL+L+MKKW RNLMTRCIAITPSL+V+IIGGSSGAGRLIII
Sbjct  342   SGQSSTITGTYAGQYIMQGFLELRMKKWMRNLMTRCIAITPSLVVAIIGGSSGAGRLIII  401

Query  1241  asMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVD  1420
             ASMILSFELPFALIPLLKFSS  TKMGPYKNSIYII+V+W+LG GIIGINIYYLST FV 
Sbjct  402   ASMILSFELPFALIPLLKFSSGRTKMGPYKNSIYIIIVTWVLGFGIIGINIYYLSTGFVG  461

Query  1421  WLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPND  1564
             WLIHN LPK  +VL+GI+VFPLMA Y++AVIYL  RKD+VVTF++  +
Sbjct  462   WLIHNQLPKFASVLIGIIVFPLMAAYIIAVIYLTLRKDRVVTFVEAQE  509



>emb|CBI18987.3| unnamed protein product [Vitis vinifera]
Length=535

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/518 (75%), Positives = 438/518 (85%), Gaps = 18/518 (3%)
 Frame = +2

Query  164   NKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSL  343
             + KPGWR FL++VGPGF+VSLAYLDPGNLETDLQAG++H YELLWVVLIGL+FAL+IQSL
Sbjct  11    SNKPGWRNFLAFVGPGFLVSLAYLDPGNLETDLQAGSNHGYELLWVVLIGLIFALVIQSL  70

Query  344   AANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVI------GTAFALNIL  505
             AANLGV TGKHLSELC+AEYPKYVKYCLWLLAE+AVIAADIPE I       TAFALNIL
Sbjct  71    AANLGVITGKHLSELCRAEYPKYVKYCLWLLAEIAVIAADIPEGIFITYSLRTAFALNIL  130

Query  506   FHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVF  685
             F +P+W GVL TGLSTLLLL LQRYGVRKLE+LIA LVF+MA CFF EM+YVKPPA  V 
Sbjct  131   FKVPVWAGVLFTGLSTLLLLGLQRYGVRKLEMLIAGLVFIMAGCFFAEMSYVKPPASRVI  190

Query  686   KGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIES  865
             KGM IPKL G  AT DAIAL GALVMPHNLFLHSALVL+RKVPNSVRGVN+ACRYFLIES
Sbjct  191   KGMLIPKLKGSTATTDAIALFGALVMPHNLFLHSALVLSRKVPNSVRGVNEACRYFLIES  250

Query  866   GFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYA  1045
             G AL VAF INVAVVSVSGT+CS   LS++++D CSDL+LNSASFLLKNVLG SS  VYA
Sbjct  251   GMALMVAFCINVAVVSVSGTICSVNNLSRENMDQCSDLNLNSASFLLKNVLGGSSKVVYA  310

Query  1046  IALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgag  1225
             IAL ASGQSSTITGTYAGQYIMQGFL+LKMK+W RNLMTRCIAITPSLIVSII GS+GAG
Sbjct  311   IALFASGQSSTITGTYAGQYIMQGFLNLKMKRWLRNLMTRCIAITPSLIVSIISGSAGAG  370

Query  1226  rliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyyls  1405
             RLIIIASMILSFELPFALIPLLKFSSSSTKMGP+KNSIY+IV SWILG G++GINIYYL+
Sbjct  371   RLIIIASMILSFELPFALIPLLKFSSSSTKMGPHKNSIYVIVFSWILGFGLMGINIYYLA  430

Query  1406  TAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMDN  1585
             T FV+WL+HN+LPK GNV +GI+VFPLMA+YV+AV+YL FRKD VVTFI+   D+ ++ N
Sbjct  431   TGFVNWLLHNDLPKVGNVFIGIIVFPLMAVYVLAVLYLTFRKDTVVTFIEAEKDEHRIIN  490

Query  1586  --------NVNNNVCMTPIDHNDFSHTLP*LSRPDQYF  1675
                       N N C+        S     +S  ++YF
Sbjct  491   IYDHGDWLTWNVNTCVERPHQPSVSK----ISHHEEYF  524



>ref|XP_010041727.1| PREDICTED: metal transporter Nramp5-like [Eucalyptus grandis]
Length=542

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/479 (80%), Positives = 433/479 (90%), Gaps = 3/479 (1%)
 Frame = +2

Query  140   QLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLV  319
             + D Q+ H++KPGWR  LS+VGPGF+VSLAYLDPGNLETDLQAGA+H YELLW++LIGL+
Sbjct  33    EFDQQDSHDQKPGWRALLSFVGPGFLVSLAYLDPGNLETDLQAGANHGYELLWIILIGLI  92

Query  320   FALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALN  499
             FALIIQSLAANLGVSTGKHLSELCKAEYP  VKYCLW LAE+AVIAADIPEVIGTAFALN
Sbjct  93    FALIIQSLAANLGVSTGKHLSELCKAEYPPLVKYCLWFLAEVAVIAADIPEVIGTAFALN  152

Query  500   ILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAED  679
             ILFHIP+W G+L TG ST+ LL LQ YG+RKLE+LIA LVF+MAACFFGEM+YVKPPA +
Sbjct  153   ILFHIPVWAGILLTGFSTIALLGLQTYGIRKLEMLIATLVFIMAACFFGEMSYVKPPATE  212

Query  680   VFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLI  859
             V +GMFIPKLSG  AT DAIA+LGALVMPHNLFLHSALVL+RKVP SVRGVNDACR+FLI
Sbjct  213   VLEGMFIPKLSGNSATGDAIAMLGALVMPHNLFLHSALVLSRKVPRSVRGVNDACRFFLI  272

Query  860   ESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTV  1039
             ESGFALFVAFLINVAVVSVSGTVCS   LS ++   C+DL+LNSA+FLLKN+LG+SSSTV
Sbjct  273   ESGFALFVAFLINVAVVSVSGTVCSANNLSSENASQCNDLTLNSAAFLLKNMLGRSSSTV  332

Query  1040  YAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssg  1219
             YAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKW RNL+TRC AIT SLIV+I+ GSSG
Sbjct  333   YAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWMRNLVTRCAAITSSLIVAIMSGSSG  392

Query  1220  agrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyy  1399
             A RLIIIASMILSFELPFALIPLLKFSSS+TKMGP+KNSIYIIV+SWILG+G+IGINIYY
Sbjct  393   ASRLIIIASMILSFELPFALIPLLKFSSSATKMGPHKNSIYIIVISWILGVGLIGINIYY  452

Query  1400  lsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSK  1576
             LST FV WLI+N++PK  NV +GI+VFPLMA+Y+VAVIYL FRKD ++TF   +DD  K
Sbjct  453   LSTGFVGWLINNSVPKVANVFIGILVFPLMAVYIVAVIYLTFRKDTIITF---SDDPVK  508



>ref|XP_009402651.1| PREDICTED: metal transporter Nramp5-like [Musa acuminata subsp. 
malaccensis]
Length=558

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/508 (77%), Positives = 450/508 (89%), Gaps = 13/508 (3%)
 Frame = +2

Query  146   DLQEE------HNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVL  307
             D+ EE        +KP W+KFL++VGPGF+VSLAYLDPGNLETDLQAGA+H+YELLWV+L
Sbjct  45    DVNEEKSCSQPQEQKPXWKKFLAHVGPGFLVSLAYLDPGNLETDLQAGANHKYELLWVIL  104

Query  308   IGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTA  487
             IGLVFALIIQSLAANLGV+TGKHL+ELCKAEYP++VKYCLW++AELAVIAADIPEVIGTA
Sbjct  105   IGLVFALIIQSLAANLGVTTGKHLAELCKAEYPRFVKYCLWVVAELAVIAADIPEVIGTA  164

Query  488   FALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKP  667
             FALNILFHIPLW GVL TGLSTLLLL LQRYGVRKLELLI++LVF+MAAC+FGE++YVKP
Sbjct  165   FALNILFHIPLWAGVLITGLSTLLLLGLQRYGVRKLELLISILVFIMAACYFGELSYVKP  224

Query  668   PAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACR  847
             PA +V KG+F+PKL+G+ AT+DAIALLGALVMPHNLFLHSALVL+RK P SV+G+NDACR
Sbjct  225   PASEVMKGLFVPKLNGKSATSDAIALLGALVMPHNLFLHSALVLSRKTPPSVKGINDACR  284

Query  848   YFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKS  1027
             YFL+ESGFALFVA LIN+AVVSVSGTVC+   LS DD D CSDL+LNSASFLLKNVLGKS
Sbjct  285   YFLVESGFALFVALLINIAVVSVSGTVCAADNLSSDDSDRCSDLTLNSASFLLKNVLGKS  344

Query  1028  SSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiig  1207
             SS VY IALLASGQSSTITGTYAGQYIMQGFLD+KM+ W +NLMTRC+AI PSLIVSIIG
Sbjct  345   SSIVYGIALLASGQSSTITGTYAGQYIMQGFLDIKMRMWLQNLMTRCVAIGPSLIVSIIG  404

Query  1208  gssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiigi  1387
             GS+GAG+LIIIASMILSFELPFALIPLLKFSSS TKMGP+KNSIY+IVVSW+LG G+IGI
Sbjct  405   GSAGAGKLIIIASMILSFELPFALIPLLKFSSSQTKMGPHKNSIYVIVVSWVLGFGVIGI  464

Query  1388  niyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDD  1567
             NIY+LST+FVDW+IH++LPKA  +LVGIVVFP MA+Y++A+IYL FRKD  VTFI  +D 
Sbjct  465   NIYFLSTSFVDWIIHSSLPKAVTILVGIVVFPFMAVYILAIIYLTFRKDTAVTFIDKSDS  524

Query  1568  DS-KMDNNVNNNVCMTPIDHNDFSHTLP  1648
                +M+N +  +      D N  +  +P
Sbjct  525   SQIEMENGMRRS------DGNRGTEVVP  546



>ref|XP_004502502.1| PREDICTED: metal transporter Nramp5-like [Cicer arietinum]
Length=534

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/505 (76%), Positives = 445/505 (88%), Gaps = 4/505 (1%)
 Frame = +2

Query  161   HNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQS  340
             H+++PGWRKFLSY+GPGF+VSLAYLDPGN+ETDLQAGA+HRYELLW++LIGL+FALIIQS
Sbjct  27    HDQRPGWRKFLSYIGPGFLVSLAYLDPGNMETDLQAGANHRYELLWIILIGLIFALIIQS  86

Query  341   LAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPL  520
             LAANLGV TGKHLSE+CKAEYP +VKYCLW+LAELAVIAADIPEVIGTAFALNILF IP+
Sbjct  87    LAANLGVCTGKHLSEVCKAEYPLFVKYCLWILAELAVIAADIPEVIGTAFALNILFKIPV  146

Query  521   WvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFI  700
             WVGVL TG STLL L LQR+GVRKLELLI++LVF+MAACFFGEM+YVKPPA  V +GMF+
Sbjct  147   WVGVLLTGCSTLLFLGLQRFGVRKLELLISILVFVMAACFFGEMSYVKPPASGVIEGMFV  206

Query  701   PKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALF  880
             PKL+G GA ADAIALLGAL+MPHNLFLHSALVL+RK+P SVRG+NDACRYFLIES FALF
Sbjct  207   PKLNGDGAVADAIALLGALIMPHNLFLHSALVLSRKIPGSVRGINDACRYFLIESAFALF  266

Query  881   VAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLA  1060
             VAFLINVA++SV+GTVCS   LS DD D CSDL+LNSASFLL+NVLG+SSST+YAIALLA
Sbjct  267   VAFLINVAMISVTGTVCSADNLSADDTDRCSDLTLNSASFLLQNVLGRSSSTIYAIALLA  326

Query  1061  SGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliii  1240
             SGQSS ITGTYAGQ+IMQGFLDLKMKKW RNL+TR IAI PSL+VSIIGGSSGAG+LI+I
Sbjct  327   SGQSSAITGTYAGQFIMQGFLDLKMKKWIRNLVTRIIAIAPSLVVSIIGGSSGAGKLIVI  386

Query  1241  asMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVD  1420
             ASMILSFELPFALIPLLKFSSSSTKMGP+KNS+ IIV+SWILG GII IN+YYL TAFV 
Sbjct  387   ASMILSFELPFALIPLLKFSSSSTKMGPHKNSMIIIVISWILGFGIISINVYYLITAFVG  446

Query  1421  WLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMDNNVNN-  1597
             W+IH++LPK   V +GI+VFPLMA+Y+V+VIYL FRKD V TF++  DD + M  +V   
Sbjct  447   WIIHSSLPKVATVFIGIIVFPLMALYIVSVIYLTFRKDVVKTFVEVKDDPA-MQTHVEKG  505

Query  1598  --NVCMTPIDHNDFSHTLP*LSRPD  1666
               N     ++H  +   L  ++ P+
Sbjct  506   FVNNGQVELNHAPYREDLADIALPE  530



>ref|XP_007019143.1| Nramp transporter isoform 2 [Theobroma cacao]
 gb|EOY16368.1| Nramp transporter isoform 2 [Theobroma cacao]
Length=557

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/515 (74%), Positives = 443/515 (86%), Gaps = 5/515 (1%)
 Frame = +2

Query  65    SHRIVAVDEsplpssnnnpDSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPG  244
             S+RI AV+       +   +       D   +H +KPGWRKF S+VGPG +VSLAY+DPG
Sbjct  21    SNRIAAVNVEGSTPESFPSNDNKSSDHDHDPDH-EKPGWRKFWSFVGPGLLVSLAYIDPG  79

Query  245   NLETDLQAGADHRYELLWVVLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYC  424
             +LETDLQA A+H YELLWVV IGLVFALIIQSLAANLGVSTGKHLSELCKAEYP  +KYC
Sbjct  80    SLETDLQAAANHGYELLWVVFIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPILIKYC  139

Query  425   LWLLAELAVIAADIPEVIGTAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELL  604
             LWLLAE AVI+AD+PEVIGTAFALNILFH+P+W GVLCTGLSTLLLLSLQRYGVRKLE+L
Sbjct  140   LWLLAEFAVISADVPEVIGTAFALNILFHVPVWAGVLCTGLSTLLLLSLQRYGVRKLEML  199

Query  605   IAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLH  784
             +AV++ +MAACFFGEM+YVKPPA  V KGM +PKLSGQGAT DAIALLGALVMPHNLFLH
Sbjct  200   MAVMISVMAACFFGEMSYVKPPATGVLKGMLVPKLSGQGATGDAIALLGALVMPHNLFLH  259

Query  785   SALVLTRKVPNSVRGVNDACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLD  964
             SALVL+RKVPNSVRG+N ACRYFLIE+GFALFVA LINVAVVSV+GTVC    LS DD D
Sbjct  260   SALVLSRKVPNSVRGINAACRYFLIETGFALFVALLINVAVVSVAGTVCLANNLSSDDSD  319

Query  965   HCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKW  1144
              CS+L+LNSASF+L++VLGKSSST+YAIALLASGQSS+I  TYAGQ+IMQGFLDLKMKKW
Sbjct  320   RCSNLTLNSASFMLQHVLGKSSSTLYAIALLASGQSSSIADTYAGQFIMQGFLDLKMKKW  379

Query  1145  SRNLMTRCIAITPslivsiiggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGP  1324
              RNL+TR IAI PSLIVSIIGGS GA RLIII+SMILS+ LPF  IPLLKFS+SS KMGP
Sbjct  380   VRNLVTRSIAIAPSLIVSIIGGSQGAARLIIISSMILSYVLPFTFIPLLKFSNSSAKMGP  439

Query  1325  YKNSIYiivvswilglgiiginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVV  1504
             +KNSIYIIV+SWILGLG+ GIN+YYL T FV WLIH++LPK GNV +GI+VFPLMAIY++
Sbjct  440   HKNSIYIIVISWILGLGMFGINVYYLITTFVGWLIHDDLPKVGNVFIGIIVFPLMAIYIL  499

Query  1505  AVIYLMFRKDKVVTFIQPNDDD----SKMDNNVNN  1597
             ++IYL FRKD VVT+I+P  +D    ++M++ ++N
Sbjct  500   SMIYLTFRKDTVVTYIEPEMNDPAAQARMESGLSN  534



>ref|XP_009385111.1| PREDICTED: metal transporter Nramp5-like [Musa acuminata subsp. 
malaccensis]
Length=560

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/529 (73%), Positives = 454/529 (86%), Gaps = 7/529 (1%)
 Frame = +2

Query  65    SHRIVAVDEsplpssnnnpDSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPG  244
             S R+ A +E           S+    ++  E    K GW+KFL++VGPGF+VSLAYLDPG
Sbjct  26    SRRVAAAEEEINGLPAVKASSVETSDMNKDESQELKAGWKKFLAHVGPGFLVSLAYLDPG  85

Query  245   NLETDLQAGADHRYELLWVVLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYC  424
             NLETDLQAGA+HRYELLWV+LIGL+FALIIQSLAANLGV+TGKHL+ELCKAEYPK+VKYC
Sbjct  86    NLETDLQAGANHRYELLWVILIGLIFALIIQSLAANLGVTTGKHLAELCKAEYPKFVKYC  145

Query  425   LWLLAELAVIAADIPEVIGTAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELL  604
             LW++AELAVIAADIPEVIGT+FALNILFHIP+W GVL TGLSTLLLL LQRYGVRKLELL
Sbjct  146   LWVVAELAVIAADIPEVIGTSFALNILFHIPVWAGVLITGLSTLLLLGLQRYGVRKLELL  205

Query  605   IAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLH  784
             I+VLVF+MAACFFGE++YVKPPA +V +G+F+P+L G  AT+DAIALLGALVMPHNLFLH
Sbjct  206   ISVLVFVMAACFFGELSYVKPPASEVIRGLFVPRLKGDSATSDAIALLGALVMPHNLFLH  265

Query  785   SALVLTRKVPNSVRGVNDACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLD  964
             SALVL+RK P SV+G+N ACRYFL+ESGFAL VA LIN+AVVSVSGTVC+   LS DD D
Sbjct  266   SALVLSRKTPPSVKGINVACRYFLLESGFALLVALLINIAVVSVSGTVCATDNLSSDDSD  325

Query  965   HCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKW  1144
              CSDL+LNSASFLLKNVLGKSSS VY IALLASGQSSTITGTYAGQYIMQGFLD+KM+ W
Sbjct  326   TCSDLTLNSASFLLKNVLGKSSSIVYGIALLASGQSSTITGTYAGQYIMQGFLDIKMRMW  385

Query  1145  SRNLMTRCIAITPslivsiiggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGP  1324
              +NLMTRC+AI PSLIVSIIGGS+GAG+LIIIASMILSFELPFALIPLLKFSSS TKMGP
Sbjct  386   LQNLMTRCVAIGPSLIVSIIGGSAGAGKLIIIASMILSFELPFALIPLLKFSSSRTKMGP  445

Query  1325  YKNSIYiivvswilglgiiginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVV  1504
             +KNS++IIV+SWILG+G+IGINIY+LST+FVDW+ H++LP+   VL+GIVVFP MA+Y++
Sbjct  446   HKNSVFIIVISWILGVGLIGINIYFLSTSFVDWITHSSLPRPVTVLIGIVVFPFMAVYML  505

Query  1505  AVIYLMFRKDKVVTFIQPNDDDS-KMDNNVNNNVCMTPIDHNDFSHTLP  1648
             A++YL FRKD+VVTF+  +D    +M++ V+      P D N  +  +P
Sbjct  506   AILYLAFRKDRVVTFVDKSDSSQIEMEDGVH------PSDGNKATEVMP  548



>gb|KCW44123.1| hypothetical protein EUGRSUZ_L02462, partial [Eucalyptus grandis]
Length=500

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/469 (81%), Positives = 426/469 (91%), Gaps = 3/469 (1%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             KPGWR  LS+VGPGF+VSLAYLDPGNLETDLQAGA+H YELLW++LIGL+FALIIQSLAA
Sbjct  1     KPGWRALLSFVGPGFLVSLAYLDPGNLETDLQAGANHGYELLWIILIGLIFALIIQSLAA  60

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGVSTGKHLSELCKAEYP  VKYCLW LAE+AVIAADIPEVIGTAFALNILFHIP+W G
Sbjct  61    NLGVSTGKHLSELCKAEYPPLVKYCLWFLAEVAVIAADIPEVIGTAFALNILFHIPVWAG  120

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             +L TG ST+ LL LQ YG+RKLE+LIA LVF+MAACFFGEM+YVKPPA +V +GMFIPKL
Sbjct  121   ILLTGFSTIALLGLQTYGIRKLEMLIATLVFIMAACFFGEMSYVKPPATEVLEGMFIPKL  180

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
             SG  AT DAIA+LGALVMPHNLFLHSALVL+RKVP SVRGVNDACR+FLIESGFALFVAF
Sbjct  181   SGNSATGDAIAMLGALVMPHNLFLHSALVLSRKVPRSVRGVNDACRFFLIESGFALFVAF  240

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LINVAVVSVSGTVCS   LS ++   C+DL+LNSA+FLLKN+LG+SSSTVYAIALLASGQ
Sbjct  241   LINVAVVSVSGTVCSANNLSSENASQCNDLTLNSAAFLLKNMLGRSSSTVYAIALLASGQ  300

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQYIMQGFLDLKMKKW RNL+TRC AIT SLIV+I+ GSSGA RLIIIASM
Sbjct  301   SSTITGTYAGQYIMQGFLDLKMKKWMRNLVTRCAAITSSLIVAIMSGSSGASRLIIIASM  360

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFALIPLLKFSSS+TKMGP+KNSIYIIV+SWILG+G+IGINIYYLST FV WLI
Sbjct  361   ILSFELPFALIPLLKFSSSATKMGPHKNSIYIIVISWILGVGLIGINIYYLSTGFVGWLI  420

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSK  1576
             +N++PK  NV +GI+VFPLMA+Y+VAVIYL FRKD ++TF   +DD  K
Sbjct  421   NNSVPKVANVFIGILVFPLMAVYIVAVIYLTFRKDTIITF---SDDPVK  466



>emb|CDP10958.1| unnamed protein product [Coffea canephora]
Length=548

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/526 (73%), Positives = 445/526 (85%), Gaps = 27/526 (5%)
 Frame = +2

Query  65    SHRIVAVDEsplpssnnnpDSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPG  244
             S RIVAVDE             +    D  +  ++KPGWRKF S+VGPGF+VS+AYLDPG
Sbjct  13    SKRIVAVDE-------------SPPPTDPGKHFDQKPGWRKFFSFVGPGFLVSMAYLDPG  59

Query  245   NLETDLQAGADHRYE--------------LLWVVLIGLVFALIIQSLAANLGVSTGKHLS  382
             N+ETD+QAGADHRYE              LLWV+LIGLVFALIIQSLAANLGV+TGKHL+
Sbjct  60    NMETDMQAGADHRYEIYVKLPCENILSSILLWVILIGLVFALIIQSLAANLGVTTGKHLA  119

Query  383   ELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvgvlctglstlll  562
             E+C+AEYPKYV YCLW LAE+AVIAADIPEVIGTAFALNILFHIPLW GVLCTG STLLL
Sbjct  120   EVCRAEYPKYVIYCLWALAEVAVIAADIPEVIGTAFALNILFHIPLWAGVLCTGSSTLLL  179

Query  563   lslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADAIA  742
             L LQRYGVRKLEL++++LV LMAACFFGEM+YVKPPA+DV KG+F+PKLSG  AT DAIA
Sbjct  180   LGLQRYGVRKLELVVSMLVLLMAACFFGEMSYVKPPAKDVLKGIFVPKLSGHSATGDAIA  239

Query  743   LLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAFLINVAVVSVSG  922
             L+GALVMPHNLFLHSALVL+RKVPNSVRG+NDACR+FLIESG AL VAF INVA++SV+G
Sbjct  240   LIGALVMPHNLFLHSALVLSRKVPNSVRGINDACRFFLIESGLALLVAFFINVAIISVTG  299

Query  923   TVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQ  1102
              VCS   LS++  D C++++LNSASFLLKNVLGKSSS +YA+ALLASGQSS ITGTYAGQ
Sbjct  300   AVCSATNLSQETSDSCNNITLNSASFLLKNVLGKSSSILYAVALLASGQSSAITGTYAGQ  359

Query  1103  YIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasMILSFELPFALI  1282
             ++MQGFLDLKMK W RN++TR IAITPSLIVSIIGGSSGAG+LIIIASMILSFELPF+L+
Sbjct  360   FVMQGFLDLKMKIWLRNIVTRSIAITPSLIVSIIGGSSGAGQLIIIASMILSFELPFSLM  419

Query  1283  PLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLIHNNLPKAGNVL  1462
             PLLKFSSS++KMGP+KNSIYII+VSWILGLGIIGINIYYLST FV WL +N+LP+ GNV 
Sbjct  420   PLLKFSSSTSKMGPHKNSIYIIIVSWILGLGIIGINIYYLSTGFVGWLTNNSLPRVGNVF  479

Query  1463  VGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMDNNVNNN  1600
             +GI+VFPLMA Y++AVIYLMFRKD  VTF +P   D     ++ N 
Sbjct  480   IGILVFPLMAAYILAVIYLMFRKDHAVTFKEPITFDPNAQVDMENG  525



>gb|EPS72193.1| root-specific metal transporter, partial [Genlisea aurea]
Length=481

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/481 (79%), Positives = 423/481 (88%), Gaps = 13/481 (3%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYE-------------LLWVVL  307
             KK GWR FLSYVGPGF+VSLAYLDPGNLETDLQAGA+HRYE             LLWV+L
Sbjct  1     KKSGWRNFLSYVGPGFLVSLAYLDPGNLETDLQAGANHRYEASTFFRRRSTLIDLLWVIL  60

Query  308   IGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTA  487
             IGL+FALIIQSLAANLGVSTGKHL+E+C+AEYP+ V  CLWLLAE AVIAADIPEVIGTA
Sbjct  61    IGLIFALIIQSLAANLGVSTGKHLAEVCRAEYPRVVNICLWLLAETAVIAADIPEVIGTA  120

Query  488   FALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKP  667
             FALNILF IP+W+GVLCTG STLLLL LQR+GVRKLELLIAVLVF+MA CFFGE+++VKP
Sbjct  121   FALNILFRIPVWIGVLCTGFSTLLLLGLQRFGVRKLELLIAVLVFIMAGCFFGEISFVKP  180

Query  668   PAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACR  847
             P  DV KG  +PKL+G  AT DAIALLGALVMPHNLFLHSALVL+RK+PNSVRG+NDACR
Sbjct  181   PMGDVLKGTIVPKLTGNSATGDAIALLGALVMPHNLFLHSALVLSRKIPNSVRGINDACR  240

Query  848   YFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKS  1027
             YFLIESGFALFVA LIN+A+V+VSGTVC    L+ D+ D CS+L+LN+ASFLLKNVLG+S
Sbjct  241   YFLIESGFALFVALLINIAIVTVSGTVCYQDNLTPDNADRCSNLTLNNASFLLKNVLGRS  300

Query  1028  SSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiig  1207
             SSTVYAIALLASGQSSTITGTYAGQ+IM+GFLDLKMK   RNL+TR IAITPSLIV+ IG
Sbjct  301   SSTVYAIALLASGQSSTITGTYAGQFIMEGFLDLKMKVVIRNLLTRSIAITPSLIVATIG  360

Query  1208  gssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiigi  1387
             G + AG+LIIIASMILSFELPFALIPLLKFSSS  KMGP+KNSIYIIVVSW LGLGIIGI
Sbjct  361   GPAAAGQLIIIASMILSFELPFALIPLLKFSSSEPKMGPHKNSIYIIVVSWFLGLGIIGI  420

Query  1388  niyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDD  1567
             N+YYLSTAFV+WLIHN+L +  NVLV IVVFPLMA YV +VIYLMFRKD+VVTFI+P   
Sbjct  421   NVYYLSTAFVNWLIHNSLRRVWNVLVSIVVFPLMAAYVASVIYLMFRKDRVVTFIEPEKV  480

Query  1568  D  1570
             D
Sbjct  481   D  481



>ref|XP_010063416.1| PREDICTED: metal transporter Nramp5-like [Eucalyptus grandis]
Length=576

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/489 (78%), Positives = 432/489 (88%), Gaps = 6/489 (1%)
 Frame = +2

Query  155   EEHN------KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGL  316
             +EHN      +K GWRKF+S+VGPGF+VSLAYLDPGN+ETDLQAGA + YELLWVVLIG+
Sbjct  63    KEHNDHHQPHQKAGWRKFMSFVGPGFLVSLAYLDPGNMETDLQAGASYGYELLWVVLIGM  122

Query  317   VFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFAL  496
             VFALIIQSLAANLGVSTGKHL+ELCKAEYP  VKYCLWLLAE+AVIAAD+PEVIGTAFAL
Sbjct  123   VFALIIQSLAANLGVSTGKHLAELCKAEYPIAVKYCLWLLAEVAVIAADVPEVIGTAFAL  182

Query  497   NILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAE  676
             NILFHIPL+VGVL TG STLLLL LQRYGVRKLE+LI +LVF MAACFFGEM+YVKPPA 
Sbjct  183   NILFHIPLFVGVLLTGCSTLLLLGLQRYGVRKLEMLITLLVFTMAACFFGEMSYVKPPAS  242

Query  677   DVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFL  856
             DV KGMF+PKLSGQGAT   +ALLGALVMPHNLFLHSALVL+RKVP SVRG+NDACRYFL
Sbjct  243   DVLKGMFVPKLSGQGATGSTVALLGALVMPHNLFLHSALVLSRKVPRSVRGINDACRYFL  302

Query  857   IESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSST  1036
             IE+GFAL VAFLINVA+VSVS  VCS   LS  + D C++L+LN+AS LLKNVLG+SSST
Sbjct  303   IETGFALVVAFLINVAMVSVSAAVCSANNLSSSNSDTCNNLTLNNASDLLKNVLGRSSST  362

Query  1037  VYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggss  1216
             +YAIALLASGQSSTITGTY+GQYIMQGFL+LKMKKW RNL+TRCIAITPSLIVSIIGGSS
Sbjct  363   IYAIALLASGQSSTITGTYSGQYIMQGFLNLKMKKWKRNLLTRCIAITPSLIVSIIGGSS  422

Query  1217  gagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiy  1396
             GAG+LIIIASMILSFELPFALIPLLKFSSS++KMGP+KNS  I+V+SWILG GII INIY
Sbjct  423   GAGQLIIIASMILSFELPFALIPLLKFSSSTSKMGPHKNSAIIMVISWILGFGIIAINIY  482

Query  1397  ylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSK  1576
             YLS +FV WLIHN+LP+  N+ VGI+VFPLMA+Y+ A+IYL FR+D V+TF +P   D  
Sbjct  483   YLSDSFVGWLIHNSLPRVANIFVGIIVFPLMAVYIFAIIYLTFRRDAVITFTEPIKHDPT  542

Query  1577  MDNNVNNNV  1603
                N+ + +
Sbjct  543   KSCNIESGL  551



>ref|XP_003557325.1| PREDICTED: metal transporter Nramp5-like [Brachypodium distachyon]
Length=544

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/483 (76%), Positives = 428/483 (89%), Gaps = 0/483 (0%)
 Frame = +2

Query  140   QLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLV  319
             +L+  E+  K+P W++FL++VGPGFMVSLAYLDPGNLETDLQAGA+HRYELLWV+L+GL+
Sbjct  28    KLEDSEQIIKRPSWKRFLAHVGPGFMVSLAYLDPGNLETDLQAGANHRYELLWVILVGLI  87

Query  320   FALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALN  499
             FALIIQSLAANLGV TG+HL+E+CK+EYPK+V  CLWLLAE+AVIAADIPEVIGTAFA  
Sbjct  88    FALIIQSLAANLGVVTGRHLAEICKSEYPKFVMICLWLLAEVAVIAADIPEVIGTAFAFY  147

Query  500   ILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAED  679
             +LF IP+W+GVL TG STLLLL LQRYGVRKLE ++++LVF+MAACFFGEM+ VKPPA++
Sbjct  148   LLFGIPVWIGVLITGSSTLLLLGLQRYGVRKLEFVVSMLVFVMAACFFGEMSIVKPPAKE  207

Query  680   VFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLI  859
             V KG+FIP+L G GATADAIALLGALVMPHNLFLHSALVL+RK P SVRG+ DAC YFL 
Sbjct  208   VLKGLFIPRLKGDGATADAIALLGALVMPHNLFLHSALVLSRKTPASVRGIKDACSYFLY  267

Query  860   ESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTV  1039
             ESGFALFVA LIN+AVVSVSGTVCS   LS  D D CSDLSL+++SFLLKNVLG+SSS V
Sbjct  268   ESGFALFVALLINIAVVSVSGTVCSGDNLSPGDADKCSDLSLDNSSFLLKNVLGRSSSIV  327

Query  1040  YAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssg  1219
             Y +ALLASGQSSTITGTYAGQYIMQGFLD++MK W RNLMTRCIAI PSL+VSIIGGS+G
Sbjct  328   YGVALLASGQSSTITGTYAGQYIMQGFLDIRMKTWMRNLMTRCIAIAPSLVVSIIGGSNG  387

Query  1220  agrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyy  1399
             AGRLIIIASMILSFELPFALIPLLKFSSS++KMGP+KNSIYIIV SW LGL +IGIN+Y+
Sbjct  388   AGRLIIIASMILSFELPFALIPLLKFSSSTSKMGPHKNSIYIIVFSWTLGLMLIGINVYF  447

Query  1400  lsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKM  1579
             LST+FV WLI+N+LPK  NVLVG+ VFPLM +Y++AVIYL FRKD V+TF+  + D  K 
Sbjct  448   LSTSFVGWLINNSLPKYANVLVGVAVFPLMLVYLIAVIYLTFRKDTVITFVADSGDAEKA  507

Query  1580  DNN  1588
              N 
Sbjct  508   GNG  510



>gb|KCW71239.1| hypothetical protein EUGRSUZ_F04336 [Eucalyptus grandis]
Length=542

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/510 (76%), Positives = 443/510 (87%), Gaps = 8/510 (2%)
 Frame = +2

Query  65    SHRIVAVDEsplpssnnnpDSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPG  244
             S+RIVA++        + PD+ ++     ++  N+KPG R FLS+VGPGF+VS+AY+DPG
Sbjct  13    SNRIVAINVKGTMPPFDPPDNTHQ-----EDSQNQKPGLRHFLSFVGPGFLVSIAYIDPG  67

Query  245   NLETDLQAGADHRYELLWVVLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYC  424
             NLETD+QAGA+H YELLWV+L+G++FALIIQSLAANLGV+TGKHL+ELCK EYP  VKYC
Sbjct  68    NLETDMQAGANHVYELLWVILVGMIFALIIQSLAANLGVTTGKHLAELCKVEYPPLVKYC  127

Query  425   LWLLAELAVIAADIPEVIGTAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELL  604
             LWLLAE+AVIAADIPEVIGTAFAL ILFHIPLW GVL TG STL+L+SLQRYG+RKLELL
Sbjct  128   LWLLAEVAVIAADIPEVIGTAFALKILFHIPLWAGVLLTGCSTLVLISLQRYGIRKLELL  187

Query  605   IAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLH  784
             IA+LV  +AACFF EM YVKPP   V KGMFIPKLSG  AT DAIALLGALVMPHNLFLH
Sbjct  188   IAILVLALAACFFAEMGYVKPPTSKVLKGMFIPKLSGNSATGDAIALLGALVMPHNLFLH  247

Query  785   SALVLTRKVPNSVRGVNDACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLD  964
             SALVL+RKV  SVRG+NDACRYFLIESGFALFVAFLINV++VSVSGTVCS+  LSKD+  
Sbjct  248   SALVLSRKVQRSVRGINDACRYFLIESGFALFVAFLINVSIVSVSGTVCSSDNLSKDNAS  307

Query  965   HCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKW  1144
              C +L+L+SA+FLLKNVLG+SSSTVYAIALLASGQSSTITGTYAGQ+IMQGFL+LKMK+W
Sbjct  308   RCGNLALDSAAFLLKNVLGRSSSTVYAIALLASGQSSTITGTYAGQFIMQGFLELKMKQW  367

Query  1145  SRNLMTRCIAITPslivsiiggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGP  1324
              RNL+TRCIAI PSLIVSI+GGSSGAGRLIIIASMILSFELPFALIPLLKFSSS+TKMGP
Sbjct  368   KRNLLTRCIAIAPSLIVSIVGGSSGAGRLIIIASMILSFELPFALIPLLKFSSSATKMGP  427

Query  1325  YKNSIYiivvswilglgiiginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVV  1504
             +KNSI+IIV+SW+LG G+I INIYYLST FVDWLIHN+LPK  N+ +GI+VFPLMAIY++
Sbjct  428   HKNSIFIIVISWLLGAGLISINIYYLSTGFVDWLIHNSLPKIANIFIGILVFPLMAIYII  487

Query  1505  AVIYLMFRKDKVVTFIQPNDDDSKMDNNVN  1594
             AVIYL FRKD  VTF    DD  K   +V 
Sbjct  488   AVIYLTFRKDSFVTF---TDDPVKHATSVT  514



>ref|XP_008799200.1| PREDICTED: metal transporter Nramp5-like [Phoenix dactylifera]
Length=543

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/484 (78%), Positives = 430/484 (89%), Gaps = 9/484 (2%)
 Frame = +2

Query  146   DLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFA  325
             D  +   + PGW+KF+++VGPGF+VSLAYLDPGN        ++HRYELLWV+LIGLVFA
Sbjct  44    DNGDTKEQGPGWKKFIAHVGPGFLVSLAYLDPGN--------SNHRYELLWVILIGLVFA  95

Query  326   LIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNIL  505
             LIIQSLAANLGV+TGKHL+ELCKAEYPKYVK CLWLLAE+AVIAADIPEVIGTAFALNIL
Sbjct  96    LIIQSLAANLGVTTGKHLAELCKAEYPKYVKLCLWLLAEVAVIAADIPEVIGTAFALNIL  155

Query  506   FHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVF  685
             FHIP+W GVL TGLSTL+LL LQRYGVRKLE LI++LVF+MAAC+FGEM YVKPPA +V 
Sbjct  156   FHIPVWTGVLITGLSTLVLLGLQRYGVRKLEFLISMLVFVMAACYFGEMGYVKPPASEVL  215

Query  686   KGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIES  865
             KG+F+P+L+G GATADAIALLGALVMPHNLFLHSALVL+RK P S +G+N+ACRYFL+ES
Sbjct  216   KGLFVPRLNGSGATADAIALLGALVMPHNLFLHSALVLSRKTPPSSKGINNACRYFLLES  275

Query  866   GFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYA  1045
              FAL VA LIN+AVVSVSG VCS   LS+++ D CSDL+LNSASFLLKNVLGKSSS VYA
Sbjct  276   AFALLVALLINIAVVSVSGAVCSADNLSQENSDRCSDLTLNSASFLLKNVLGKSSSIVYA  335

Query  1046  IALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgag  1225
             IALLASGQSSTITGTYAGQYIMQGFLD+KM+KW RNLMTRCIAITPSLIVSIIGGSSGAG
Sbjct  336   IALLASGQSSTITGTYAGQYIMQGFLDIKMRKWLRNLMTRCIAITPSLIVSIIGGSSGAG  395

Query  1226  rliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyyls  1405
             RLIIIASMILSFELPFALIPLLKFSSS TKMGP+KNSI+II+VSWILGLGIIGINIY+LS
Sbjct  396   RLIIIASMILSFELPFALIPLLKFSSSRTKMGPHKNSIFIIIVSWILGLGIIGINIYFLS  455

Query  1406  TAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQ-PNDDDSKMD  1582
             T FV+WLIH++LPK  NV +GI+VFPLMAIY++AV YL FRKD  VTF+  P+    +M+
Sbjct  456   TQFVEWLIHSSLPKVANVFIGIIVFPLMAIYILAVTYLTFRKDTAVTFVDTPDSQQIEME  515

Query  1583  NNVN  1594
               ++
Sbjct  516   KGMH  519



>ref|XP_010063940.1| PREDICTED: metal transporter Nramp5-like isoform X1 [Eucalyptus 
grandis]
Length=548

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/510 (76%), Positives = 443/510 (87%), Gaps = 8/510 (2%)
 Frame = +2

Query  65    SHRIVAVDEsplpssnnnpDSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPG  244
             S+RIVA++        + PD+ ++     ++  N+KPG R FLS+VGPGF+VS+AY+DPG
Sbjct  19    SNRIVAINVKGTMPPFDPPDNTHQ-----EDSQNQKPGLRHFLSFVGPGFLVSIAYIDPG  73

Query  245   NLETDLQAGADHRYELLWVVLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYC  424
             NLETD+QAGA+H YELLWV+L+G++FALIIQSLAANLGV+TGKHL+ELCK EYP  VKYC
Sbjct  74    NLETDMQAGANHVYELLWVILVGMIFALIIQSLAANLGVTTGKHLAELCKVEYPPLVKYC  133

Query  425   LWLLAELAVIAADIPEVIGTAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELL  604
             LWLLAE+AVIAADIPEVIGTAFAL ILFHIPLW GVL TG STL+L+SLQRYG+RKLELL
Sbjct  134   LWLLAEVAVIAADIPEVIGTAFALKILFHIPLWAGVLLTGCSTLVLISLQRYGIRKLELL  193

Query  605   IAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLH  784
             IA+LV  +AACFF EM YVKPP   V KGMFIPKLSG  AT DAIALLGALVMPHNLFLH
Sbjct  194   IAILVLALAACFFAEMGYVKPPTSKVLKGMFIPKLSGNSATGDAIALLGALVMPHNLFLH  253

Query  785   SALVLTRKVPNSVRGVNDACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLD  964
             SALVL+RKV  SVRG+NDACRYFLIESGFALFVAFLINV++VSVSGTVCS+  LSKD+  
Sbjct  254   SALVLSRKVQRSVRGINDACRYFLIESGFALFVAFLINVSIVSVSGTVCSSDNLSKDNAS  313

Query  965   HCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKW  1144
              C +L+L+SA+FLLKNVLG+SSSTVYAIALLASGQSSTITGTYAGQ+IMQGFL+LKMK+W
Sbjct  314   RCGNLALDSAAFLLKNVLGRSSSTVYAIALLASGQSSTITGTYAGQFIMQGFLELKMKQW  373

Query  1145  SRNLMTRCIAITPslivsiiggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGP  1324
              RNL+TRCIAI PSLIVSI+GGSSGAGRLIIIASMILSFELPFALIPLLKFSSS+TKMGP
Sbjct  374   KRNLLTRCIAIAPSLIVSIVGGSSGAGRLIIIASMILSFELPFALIPLLKFSSSATKMGP  433

Query  1325  YKNSIYiivvswilglgiiginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVV  1504
             +KNSI+IIV+SW+LG G+I INIYYLST FVDWLIHN+LPK  N+ +GI+VFPLMAIY++
Sbjct  434   HKNSIFIIVISWLLGAGLISINIYYLSTGFVDWLIHNSLPKIANIFIGILVFPLMAIYII  493

Query  1505  AVIYLMFRKDKVVTFIQPNDDDSKMDNNVN  1594
             AVIYL FRKD  VTF    DD  K   +V 
Sbjct  494   AVIYLTFRKDSFVTF---TDDPVKHATSVT  520



>ref|XP_010677475.1| PREDICTED: metal transporter Nramp5-like [Beta vulgaris subsp. 
vulgaris]
Length=539

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/478 (78%), Positives = 425/478 (89%), Gaps = 1/478 (0%)
 Frame = +2

Query  152   QEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALI  331
             +    K P W+KFLS+VGPGF+VSLAYLDPGN+ETDLQAGA+HR+ELLWV+LIGL+FALI
Sbjct  55    ESPTQKGPKWKKFLSFVGPGFLVSLAYLDPGNMETDLQAGANHRFELLWVILIGLIFALI  114

Query  332   IQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFH  511
             IQSLAANLGVSTGKHLSE CKAEYP  VKYCLWLLAE+AVIAADIPEVIGTAFALNILFH
Sbjct  115   IQSLAANLGVSTGKHLSEHCKAEYPVIVKYCLWLLAEVAVIAADIPEVIGTAFALNILFH  174

Query  512   IPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKG  691
             IP+W GVL TGLSTLLLL LQ+YG+RKLELLIA+LV +M ACFFGEM+YVKPPA+DV KG
Sbjct  175   IPVWAGVLITGLSTLLLLGLQKYGIRKLELLIAILVLIMGACFFGEMSYVKPPAKDVLKG  234

Query  692   MFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGF  871
             MFIPKLSGQGAT DAIAL+GALVMPHNLFLHSALVL+R V  S +G+N AC+YFL+ESGF
Sbjct  235   MFIPKLSGQGATGDAIALMGALVMPHNLFLHSALVLSRTVTKSKKGINQACKYFLLESGF  294

Query  872   ALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLG-KSSSTVYAI  1048
             ALF+AF INVA++SVSGTVCS+  L++ +   CSDL+LN+AS LL+NVLG K++S  Y I
Sbjct  295   ALFIAFWINVAIISVSGTVCSSRNLTQQEAGICSDLTLNNASVLLQNVLGRKTASIFYGI  354

Query  1049  ALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagr  1228
             AL ASGQSSTITGTYAGQYIMQGFLDLKMK W RNL+TR IAITPSLIVSIIGGS+ AG 
Sbjct  355   ALFASGQSSTITGTYAGQYIMQGFLDLKMKSWQRNLVTRSIAITPSLIVSIIGGSAAAGN  414

Query  1229  liiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsT  1408
             LIIIASMILSFELPFALIPLLKFSS +TKMGP++NSI IIV+SWILGLGIIGINIYYL T
Sbjct  415   LIIIASMILSFELPFALIPLLKFSSGTTKMGPHQNSIIIIVISWILGLGIIGINIYYLIT  474

Query  1409  AFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMD  1582
             AF+ WLIHN+LPK GNV +GI VFPLMAIYV+++IYLM RKD+VVT+I P +   K D
Sbjct  475   AFIGWLIHNDLPKVGNVFIGIAVFPLMAIYVLSIIYLMLRKDRVVTYIDPTNSAIKED  532



>ref|XP_007019142.1| Nramp transporter isoform 1 [Theobroma cacao]
 gb|EOY16367.1| Nramp transporter isoform 1 [Theobroma cacao]
Length=561

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/487 (77%), Positives = 431/487 (89%), Gaps = 10/487 (2%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             +KPGWRKF S+VGPG +VSLAY+DPG+LETDLQA A+H YELLWVV IGLVFALIIQSLA
Sbjct  52    QKPGWRKFWSFVGPGLLVSLAYIDPGSLETDLQAAANHGYELLWVVFIGLVFALIIQSLA  111

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGVSTGKHLSELCKAEYP  +KYCLWLLAE AVI+AD+PEVIGTAFALNILFH+P+W 
Sbjct  112   ANLGVSTGKHLSELCKAEYPILIKYCLWLLAEFAVISADVPEVIGTAFALNILFHVPVWA  171

Query  527   gvlctglstllllslQRYGV------RKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFK  688
             GVLCTGLSTLLLLSLQRYGV      RKLE+L+AV++ +MAACFFGEM+YVKPPA  V K
Sbjct  172   GVLCTGLSTLLLLSLQRYGVIKLYFVRKLEMLMAVMISVMAACFFGEMSYVKPPATGVLK  231

Query  689   GMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESG  868
             GM +PKLSGQGAT DAIALLGALVMPHNLFLHSALVL+RKVPNSVRG+N ACRYFLIE+G
Sbjct  232   GMLVPKLSGQGATGDAIALLGALVMPHNLFLHSALVLSRKVPNSVRGINAACRYFLIETG  291

Query  869   FALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAI  1048
             FALFVA LINVAVVSV+GTVC    LS DD D CS+L+LNSASF+L++VLGKSSST+YAI
Sbjct  292   FALFVALLINVAVVSVAGTVCLANNLSSDDSDRCSNLTLNSASFMLQHVLGKSSSTLYAI  351

Query  1049  ALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagr  1228
             ALLASGQSS+I  TYAGQ+IMQGFLDLKMKKW RNL+TR IAI PSLIVSIIGGS GA R
Sbjct  352   ALLASGQSSSIADTYAGQFIMQGFLDLKMKKWVRNLVTRSIAIAPSLIVSIIGGSQGAAR  411

Query  1229  liiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsT  1408
             LIII+SMILS+ LPF  IPLLKFS+SS KMGP+KNSIYIIV+SWILGLG+ GIN+YYL T
Sbjct  412   LIIISSMILSYVLPFTFIPLLKFSNSSAKMGPHKNSIYIIVISWILGLGMFGINVYYLIT  471

Query  1409  AFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDD----SK  1576
              FV WLIH++LPK GNV +GI+VFPLMAIY++++IYL FRKD VVT+I+P  +D    ++
Sbjct  472   TFVGWLIHDDLPKVGNVFIGIIVFPLMAIYILSMIYLTFRKDTVVTYIEPEMNDPAAQAR  531

Query  1577  MDNNVNN  1597
             M++ ++N
Sbjct  532   MESGLSN  538



>ref|NP_001059312.1| Os07g0257200 [Oryza sativa Japonica Group]
 sp|Q8H4H5.1|NRAM5_ORYSJ RecName: Full=Metal transporter Nramp5 [Oryza sativa Japonica 
Group]
 dbj|BAC21413.1| putative Nramp1 protein [Oryza sativa Japonica Group]
 dbj|BAF21226.1| Os07g0257200 [Oryza sativa Japonica Group]
 dbj|BAG92143.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81816.1| hypothetical protein OsI_25556 [Oryza sativa Indica Group]
 dbj|BAM31261.1| Nramp metal transporter [Oryza sativa Japonica Group]
 dbj|BAM45314.1| Nramp metal transporter [Oryza sativa Japonica Group]
Length=538

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/462 (79%), Positives = 419/462 (91%), Gaps = 0/462 (0%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             K+P W++FL++VGPGFMVSLAYLDPGNLETDLQAGA+HRYELLWV+LIGL+FALIIQSLA
Sbjct  37    KEPAWKRFLAHVGPGFMVSLAYLDPGNLETDLQAGANHRYELLWVILIGLIFALIIQSLA  96

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGV TG+HL+E+CK+EYPK+VK  LWLLAELAVIAADIPEVIGTAFA NILFHIP+WV
Sbjct  97    ANLGVVTGRHLAEICKSEYPKFVKIFLWLLAELAVIAADIPEVIGTAFAFNILFHIPVWV  156

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL TG STLLLL LQ+YGVRKLE LI++LVF+MAACFFGE++ VKPPA++V KG+FIP+
Sbjct  157   GVLITGTSTLLLLGLQKYGVRKLEFLISMLVFVMAACFFGELSIVKPPAKEVMKGLFIPR  216

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             L+G GATADAIALLGALVMPHNLFLHSALVL+RK P SVRG+ D CR+FL ESGFALFVA
Sbjct  217   LNGDGATADAIALLGALVMPHNLFLHSALVLSRKTPASVRGIKDGCRFFLYESGFALFVA  276

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
              LIN+AVVSVSGT CS+  LS++D D C++LSL+++SFLLKNVLGKSS+ VY +ALLASG
Sbjct  277   LLINIAVVSVSGTACSSANLSQEDADKCANLSLDTSSFLLKNVLGKSSAIVYGVALLASG  336

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiias  1246
             QSSTITGTYAGQYIMQGFLD++M+KW RNLMTR IAI PSLIVSIIGGS GAGRLIIIAS
Sbjct  337   QSSTITGTYAGQYIMQGFLDIRMRKWLRNLMTRTIAIAPSLIVSIIGGSRGAGRLIIIAS  396

Query  1247  MILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWL  1426
             MILSFELPFALIPLLKFSSS +KMGP+KNSIYIIV SW LGL IIGIN+Y+LST+FV WL
Sbjct  397   MILSFELPFALIPLLKFSSSKSKMGPHKNSIYIIVFSWFLGLLIIGINMYFLSTSFVGWL  456

Query  1427  IHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFI  1552
             IHN+LPK  NVLVG  VFP M +Y+VAV+YL  RKD VVTF+
Sbjct  457   IHNDLPKYANVLVGAAVFPFMLVYIVAVVYLTIRKDSVVTFV  498



>ref|XP_009386677.1| PREDICTED: metal transporter Nramp5-like [Musa acuminata subsp. 
malaccensis]
Length=554

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/513 (73%), Positives = 438/513 (85%), Gaps = 6/513 (1%)
 Frame = +2

Query  65    SHRIVAVDEsplpssnnnpDSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPG  244
             S R+VA DE      + +  S ++      E  ++KPGW+KFL++VGPGF+VSLAYLDPG
Sbjct  25    SKRVVAGDEEGDNGEDRDDKSCSQ-----DEPQDQKPGWKKFLAHVGPGFLVSLAYLDPG  79

Query  245   NLETDLQAGADHRYELLWVVLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYC  424
             NLETDLQAGA HRYELLWVVLIGL FALIIQSLAANLGV+TGKHL+ELCKAEYPKYV YC
Sbjct  80    NLETDLQAGAKHRYELLWVVLIGLAFALIIQSLAANLGVATGKHLAELCKAEYPKYVNYC  139

Query  425   LWLLAELAVIAADIPEVIGTAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELL  604
             LW++AE+AVIAADIPEVIGTAFALNILF IP+  GVL TGLSTLLLL LQRYGVRKLELL
Sbjct  140   LWVMAEVAVIAADIPEVIGTAFALNILFRIPVSAGVLITGLSTLLLLGLQRYGVRKLELL  199

Query  605   IAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLH  784
             I++LVF+MAAC+FGE++YV PPA  V KG+F+P+L G GAT+DA+ALLGALVMPHNLFLH
Sbjct  200   ISMLVFVMAACYFGELSYVNPPATQVMKGLFVPRLGGDGATSDAVALLGALVMPHNLFLH  259

Query  785   SALVLTRKVPNSVRGVNDACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLD  964
             SALVL+RK P S  G+NDACRYFL+ESGFAL VA LINVAVVSVSGTVC+   L  +D +
Sbjct  260   SALVLSRKTPPSAEGINDACRYFLLESGFALSVALLINVAVVSVSGTVCAGRSLPPEDSE  319

Query  965   HCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKW  1144
              CS+L+LNSASFLLKN+LGKSSS VY IALLASGQSSTI+GTYAGQYIMQGFLD+KM+ W
Sbjct  320   TCSNLTLNSASFLLKNLLGKSSSIVYGIALLASGQSSTISGTYAGQYIMQGFLDVKMRMW  379

Query  1145  SRNLMTRCIAITPslivsiiggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGP  1324
              +NLMTRCIAI PSL+VSIIGG +GAGRLIII SMILSFELPFALIPLLKFSSS TKM P
Sbjct  380   LQNLMTRCIAIGPSLVVSIIGGPAGAGRLIIITSMILSFELPFALIPLLKFSSSGTKMRP  439

Query  1325  YKNSIYiivvswilglgiiginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVV  1504
             +KNSIYIIV+SWILG G+IGIN+Y+LST+FV+W+  ++LPK    LVG++VFP MA+Y++
Sbjct  440   HKNSIYIIVISWILGFGVIGINVYFLSTSFVEWITSSSLPKPATALVGVIVFPFMAVYIL  499

Query  1505  AVIYLMFRKDKVVTFIQPNDDDSK-MDNNVNNN  1600
             AVIYL FRKD  VTF+  +D   K M++ V+ +
Sbjct  500   AVIYLTFRKDTAVTFVDKSDSSLKEMEDGVHRS  532



>ref|XP_002461772.1| hypothetical protein SORBIDRAFT_02g007870 [Sorghum bicolor]
 gb|EER98293.1| hypothetical protein SORBIDRAFT_02g007870 [Sorghum bicolor]
Length=535

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/485 (78%), Positives = 439/485 (91%), Gaps = 3/485 (1%)
 Frame = +2

Query  131   NKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLI  310
             +K +LD  ++  K+P W++FL++VGPGFMVSLAYLDPGNLETDLQAGA+HRYELLWV+LI
Sbjct  25    SKTKLDGGDQLMKEPAWKRFLAHVGPGFMVSLAYLDPGNLETDLQAGANHRYELLWVILI  84

Query  311   GLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAF  490
             GL+FALIIQSLAANLGV TG+HL+E+CK+EYPK+V+ CLW+LAE+AVIAADIPEVIGTAF
Sbjct  85    GLIFALIIQSLAANLGVVTGRHLAEICKSEYPKFVRICLWILAEVAVIAADIPEVIGTAF  144

Query  491   ALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPP  670
             A N+LFHIP+WVGVL TG STLLLL LQRYGVRKLE LI++LVF+MAACFFGE++ VKPP
Sbjct  145   AFNLLFHIPVWVGVLITGSSTLLLLGLQRYGVRKLEFLISMLVFVMAACFFGELSIVKPP  204

Query  671   AEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRY  850
             A +V KG+FIP+L G GATADAIALLGALVMPHNLFLHSALVL+RK P+SVRG+ DACR+
Sbjct  205   AVEVIKGLFIPRLKGDGATADAIALLGALVMPHNLFLHSALVLSRKTPSSVRGIKDACRF  264

Query  851   FLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSS  1030
             FL ESGFALFVA LIN+AV+SVSGTVC +G LS +D D CSDLSL+S+SFLLKNVLG+SS
Sbjct  265   FLYESGFALFVALLINIAVISVSGTVCFSGNLSPEDADKCSDLSLDSSSFLLKNVLGRSS  324

Query  1031  STVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiigg  1210
             S VY +ALLASGQSSTITGTY+GQYIMQGFLD++MKKW RNLMTRCIAI PSL+VSIIGG
Sbjct  325   SIVYGVALLASGQSSTITGTYSGQYIMQGFLDIRMKKWLRNLMTRCIAIAPSLVVSIIGG  384

Query  1211  ssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiigin  1390
             SSGAGRLIIIASMILSFELPFALIPLLKFSSS +KMGP+KNSIYIIV SW+LGL IIGIN
Sbjct  385   SSGAGRLIIIASMILSFELPFALIPLLKFSSSRSKMGPHKNSIYIIVFSWLLGLMIIGIN  444

Query  1391  iyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDD  1570
             +Y+LST+FV WLIHN+LP   NVLVG+V+FPLM IYV+AVIYL FRKD VVTF+    D 
Sbjct  445   MYFLSTSFVGWLIHNSLPIYANVLVGLVIFPLMLIYVLAVIYLTFRKDTVVTFVA---DS  501

Query  1571  SKMDN  1585
             +++DN
Sbjct  502   NQLDN  506



>ref|XP_010908505.1| PREDICTED: metal transporter Nramp5-like [Elaeis guineensis]
Length=513

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/469 (78%), Positives = 424/469 (90%), Gaps = 0/469 (0%)
 Frame = +2

Query  146   DLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFA  325
             D  +   ++PGW+ FL++VGPGF+VSLAY+DPGNLETDLQAGA+HRY+LLWV+LIGLVFA
Sbjct  39    DSGDNKEQEPGWKIFLAHVGPGFLVSLAYIDPGNLETDLQAGANHRYQLLWVILIGLVFA  98

Query  326   LIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNIL  505
             LIIQSLAAN+GV+TGKHL+ELCKAEYP YVK+CLWLLAE+AVIAADIPEVIGTAFA+NIL
Sbjct  99    LIIQSLAANIGVTTGKHLAELCKAEYPNYVKFCLWLLAEVAVIAADIPEVIGTAFAVNIL  158

Query  506   FHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVF  685
             F+IP W+GVL TG STLL L LQRYGVRKLE L+++LVF+M AC+FGE+AYVKPPA +V 
Sbjct  159   FNIPQWMGVLITGFSTLLFLGLQRYGVRKLEFLMSMLVFVMVACYFGELAYVKPPASEVL  218

Query  686   KGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIES  865
             KG+F P+++G GAT DAIALLGALVMPHNLFLHSALVL+RK P S + +N+ACRYFL ES
Sbjct  219   KGLFAPRINGSGATGDAIALLGALVMPHNLFLHSALVLSRKTPPSAKEINNACRYFLFES  278

Query  866   GFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYA  1045
              FALFVA LIN+AVVSVSGTVC+   LS+++ D CS+L+LNSASFLL+N+LGKSSS VYA
Sbjct  279   AFALFVALLINIAVVSVSGTVCAADNLSQENSDRCSNLTLNSASFLLRNILGKSSSVVYA  338

Query  1046  IALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgag  1225
             IALLASGQSS ITGTYAGQYIM+GFLD+KM+KW RNLMTRCIAI PSLIVSIIGGSSGAG
Sbjct  339   IALLASGQSSAITGTYAGQYIMEGFLDIKMRKWLRNLMTRCIAIAPSLIVSIIGGSSGAG  398

Query  1226  rliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyyls  1405
             RLIIIASMILSFELPFALIPLLKFSSS TKMGP+KNSI+II+ SWILGL IIGINIY+LS
Sbjct  399   RLIIIASMILSFELPFALIPLLKFSSSRTKMGPHKNSIFIIIFSWILGLCIIGINIYFLS  458

Query  1406  TAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFI  1552
             T FV+WLIH++LP   NV +GI++FPLMA+Y++AVIYL FRKD VVT+I
Sbjct  459   TQFVEWLIHSSLPSVANVFIGIIIFPLMAVYMLAVIYLTFRKDTVVTYI  507



>ref|XP_003602055.1| Metal transporter [Medicago truncatula]
 ref|XP_003630457.1| Metal transporter [Medicago truncatula]
 gb|AES72306.1| NRAMP metal ion transporter 6 [Medicago truncatula]
Length=542

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/537 (72%), Positives = 457/537 (85%), Gaps = 12/537 (2%)
 Frame = +2

Query  65    SHRIVAVDEsplpssnnnpDSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPG  244
             ++RIVAV+          P S      D   + ++KPGW+KFL+YVGPGF+VSLAYLDPG
Sbjct  11    NNRIVAVN--------VTPSSTPSYNHDDSSKQDQKPGWKKFLAYVGPGFLVSLAYLDPG  62

Query  245   NLETDLQAGADHRYELLWVVLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYC  424
             N+ETDLQAGA+H YELLW++LIGL+FA IIQSLAANLGV TGKHLSE+CKAEYP +VKYC
Sbjct  63    NMETDLQAGANHGYELLWIILIGLIFACIIQSLAANLGVCTGKHLSEICKAEYPWFVKYC  122

Query  425   LWLLAELAVIAADIPEVIGTAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELL  604
             LW+LAELAVIAADIPEVIGTAFALNILFH+P+W GVL TG STLL L LQR+GVRKLELL
Sbjct  123   LWILAELAVIAADIPEVIGTAFALNILFHVPVWGGVLLTGCSTLLFLGLQRFGVRKLELL  182

Query  605   IAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLH  784
             I++LVF+MAACFFGE++YVKPPA+ V +GMF+PKL+G GA  DAIALLGAL+MPHNLFLH
Sbjct  183   ISILVFVMAACFFGELSYVKPPAKGVIEGMFVPKLNGNGAVGDAIALLGALIMPHNLFLH  242

Query  785   SALVLTRKVPNSVRGVNDACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLD  964
             SALVL+RK+P + RG+NDACRYFLIESGFALFVAFLINVA++SV+GTVC    +S +++D
Sbjct  243   SALVLSRKIPGTKRGINDACRYFLIESGFALFVAFLINVAMISVTGTVCKADDISGENVD  302

Query  965   HCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKW  1144
              C+D++LNSASFLL+NVLG+SSST+YAIALLASGQSS ITGTYAGQ+IMQGFLDLKMKKW
Sbjct  303   RCNDITLNSASFLLQNVLGRSSSTIYAIALLASGQSSAITGTYAGQFIMQGFLDLKMKKW  362

Query  1145  SRNLMTRCIAITPslivsiiggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGP  1324
              RNL+TR +AI PSL+VSIIGGSSGAGRLIIIASMILSFELPFALIPLLKFSSS TKMGP
Sbjct  363   IRNLVTRIVAIAPSLVVSIIGGSSGAGRLIIIASMILSFELPFALIPLLKFSSSRTKMGP  422

Query  1325  YKNSIYiivvswilglgiiginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVV  1504
             +KNSI II++SWILGLGIIGIN+YYL TAFV W+IHN+LPK  NV +G++VFPLMA+Y+V
Sbjct  423   HKNSIIIIIISWILGLGIIGINVYYLITAFVGWIIHNSLPKVANVFIGLIVFPLMALYIV  482

Query  1505  AVIYLMFRKDKVVTFIQPNDDDSKMDNNVNN---NVCMTPIDHNDFSHTLP*LSRPD  1666
             +VIYL FRKD VVTF++  DD S M  +V     N     + +  +   L  ++RP+
Sbjct  483   SVIYLTFRKDTVVTFVEVKDDPS-MQTHVEKGFVNDGQLELSYTPYREDLADITRPE  538



>ref|XP_011069333.1| PREDICTED: metal transporter Nramp5-like isoform X2 [Sesamum 
indicum]
Length=438

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/442 (83%), Positives = 397/442 (90%), Gaps = 10/442 (2%)
 Frame = +2

Query  20    MGSLqqqqagvvgggSHRIVAVDEsplpssnnnpDSINKLQLDLQEE-HNKKPGWRKFLS  196
             MGSLQQQQ    GG +HRIV+V E+               + D ++    +KPGWR FLS
Sbjct  1     MGSLQQQQGSGAGGNNHRIVSVAET---------PPAGSREFDGKDYVLAEKPGWRNFLS  51

Query  197   YVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAANLGVSTGKH  376
             YVGPGF+VSLAYLDPGNLETDLQAGA+H YELLWV+LIGL+FALIIQSLAANLGVSTGKH
Sbjct  52    YVGPGFLVSLAYLDPGNLETDLQAGANHGYELLWVILIGLIFALIIQSLAANLGVSTGKH  111

Query  377   LSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvgvlctglstl  556
             LSELCKAEYP  VKYCLW+LAE+AVIAADIPEVIGTAFALNILFHIP+WVGVLCTG STL
Sbjct  112   LSELCKAEYPMLVKYCLWVLAEVAVIAADIPEVIGTAFALNILFHIPVWVGVLCTGCSTL  171

Query  557   lllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADA  736
             LL+ LQ+YGVRKLELLIA+LVF+MAACFFGE++YVKPPA  V KGMFIPKLSG+ AT DA
Sbjct  172   LLIGLQKYGVRKLELLIAILVFIMAACFFGELSYVKPPATKVIKGMFIPKLSGKSATGDA  231

Query  737   IALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAFLINVAVVSV  916
             IALLGALVMPHNLFLHSALVL+RK+PNSVRG+NDACRYFLIESGFALFVAFLINVAVVSV
Sbjct  232   IALLGALVMPHNLFLHSALVLSRKIPNSVRGINDACRYFLIESGFALFVAFLINVAVVSV  291

Query  917   SGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYA  1096
             SGTVCS   LS ++ DHC DL+LNSASFLLKNVLG+SSSTVYAIALLASGQSSTITGTYA
Sbjct  292   SGTVCSADNLSSENKDHCDDLTLNSASFLLKNVLGRSSSTVYAIALLASGQSSTITGTYA  351

Query  1097  GQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasMILSFELPFA  1276
             GQ+IMQGFLDLKM+KW RNLMTRCIAITPSLIVSIIGGSSGAGRLIIIASMILSFELPFA
Sbjct  352   GQFIMQGFLDLKMRKWIRNLMTRCIAITPSLIVSIIGGSSGAGRLIIIASMILSFELPFA  411

Query  1277  LIPLLKFSSSSTKMGPYKNSIY  1342
             LIPLLKFSSSSTKMGP+KNSIY
Sbjct  412   LIPLLKFSSSSTKMGPHKNSIY  433



>gb|EPS69341.1| hypothetical protein M569_05424, partial [Genlisea aurea]
Length=480

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/479 (76%), Positives = 420/479 (88%), Gaps = 0/479 (0%)
 Frame = +2

Query  164   NKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSL  343
               K GWR FLSY+GPGF+VSLAY+DPGN+ET LQAGA +RYELLWV+LIGL+F LIIQSL
Sbjct  2     QSKKGWRNFLSYIGPGFLVSLAYIDPGNMETALQAGASYRYELLWVILIGLIFGLIIQSL  61

Query  344   AANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLW  523
             AANLGV TGKHL+E C+AEYP+ V +CLW+L E+AVIAADIPEVIGTAFALNILF IP+W
Sbjct  62    AANLGVCTGKHLAEACRAEYPRVVNFCLWILGEIAVIAADIPEVIGTAFALNILFRIPVW  121

Query  524   vgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIP  703
              GVLCTG STLLLL+LQRYGVRKLELLI+VLVF+MAACFFGEM +VKPP  +V KG  +P
Sbjct  122   AGVLCTGCSTLLLLALQRYGVRKLELLISVLVFIMAACFFGEMGFVKPPVGEVLKGTVVP  181

Query  704   KLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFV  883
             KLSG GAT +AIALLGALVMPHNLFLHSALVL+RK+P +VRG+NDACRYFLIE+GFALF+
Sbjct  182   KLSGSGATGNAIALLGALVMPHNLFLHSALVLSRKIPATVRGINDACRYFLIETGFALFI  241

Query  884   AFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLAS  1063
             A LIN+A+V+V+GTVC    L  ++ D C++L+LN+ASFLLKNVLGKSSS VYA+ALLAS
Sbjct  242   ALLINIAMVAVTGTVCFGDNLKAENTDQCNNLTLNNASFLLKNVLGKSSSIVYAVALLAS  301

Query  1064  GQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiia  1243
             GQSS ITGTYAGQ+IMQGFLDLKMK   RN+MTR IAITPSLIVSIIGGS+GAGRLIIIA
Sbjct  302   GQSSAITGTYAGQFIMQGFLDLKMKLVYRNMMTRTIAITPSLIVSIIGGSAGAGRLIIIA  361

Query  1244  sMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDW  1423
             SMILSFELPFAL+PLLKFSSS+ KMGP+KNSI+IIVVSWILGL IIGIN+YYLST FV W
Sbjct  362   SMILSFELPFALLPLLKFSSSAYKMGPHKNSIFIIVVSWILGLAIIGINVYYLSTGFVGW  421

Query  1424  LIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMDNNVNNN  1600
             LIH+ L +  NVL+ IVVFPLMA YV++VIYLMFRKD+ VTFI P + D+   + + N 
Sbjct  422   LIHSPLRRVWNVLISIVVFPLMAAYVLSVIYLMFRKDRAVTFIDPENKDAAAIDVMENG  480



>dbj|BAJ95577.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=546

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/479 (78%), Positives = 424/479 (89%), Gaps = 3/479 (1%)
 Frame = +2

Query  146   DLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFA  325
             D  E   K+P W++FLS+VGPGFMVSLAYLDPGNLETDLQAGA+HRYELLWV+LIGL+FA
Sbjct  34    DGDETFVKEPAWKRFLSHVGPGFMVSLAYLDPGNLETDLQAGANHRYELLWVILIGLIFA  93

Query  326   LIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNIL  505
             LIIQSLAANLGV TGKHL+E+CK+EYPK V  CLWLLAE+AVIAADIPEVIGTAFA  +L
Sbjct  94    LIIQSLAANLGVVTGKHLAEICKSEYPKPVMICLWLLAEVAVIAADIPEVIGTAFAFYLL  153

Query  506   FHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVF  685
             F IP+W+GVL TG STLLLL LQRYGVRKLE LI++LVF+MAACFFGE++ VKPPA++V 
Sbjct  154   FRIPVWIGVLITGSSTLLLLGLQRYGVRKLEFLISMLVFVMAACFFGELSIVKPPAKEVL  213

Query  686   KGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIES  865
             KG+FIPKL G GATADAIALLGALVMPHNLFLHSALVL+RK P+SVRG+ DACR+FL ES
Sbjct  214   KGLFIPKLKGNGATADAIALLGALVMPHNLFLHSALVLSRKTPSSVRGIKDACRFFLYES  273

Query  866   GFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYA  1045
             GFALFVA LIN+AVVSVSGTVC    LS +D+D CSDLSL+++SFLLKNVLG+SSS VY 
Sbjct  274   GFALFVALLINIAVVSVSGTVCFGENLSAEDIDKCSDLSLDNSSFLLKNVLGRSSSIVYG  333

Query  1046  IALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgag  1225
             +ALLASGQSSTITGTYAGQYIMQGFLD+KMK W RNLMTRCIAI PSL+VSIIGGS+GAG
Sbjct  334   VALLASGQSSTITGTYAGQYIMQGFLDIKMKTWLRNLMTRCIAIAPSLVVSIIGGSNGAG  393

Query  1226  rliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyyls  1405
             RLIIIASMILSFELPFALIPLLKFSSSS+KMGP+KNSIYIIV SW LGL +IGIN+Y+LS
Sbjct  394   RLIIIASMILSFELPFALIPLLKFSSSSSKMGPHKNSIYIIVFSWTLGLMLIGINVYFLS  453

Query  1406  TAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMD  1582
             T+F+ WLI+++LP    VLVG+VV PLM +Y+VAV+YL FRKD VVTF+    D  K D
Sbjct  454   TSFMGWLINSSLPTYAKVLVGVVVCPLMLVYLVAVVYLTFRKDTVVTFVA---DSCKAD  509



>ref|XP_002520333.1| metal transporter, putative [Ricinus communis]
 gb|EEF42119.1| metal transporter, putative [Ricinus communis]
Length=498

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/397 (88%), Positives = 373/397 (94%), Gaps = 0/397 (0%)
 Frame = +2

Query  143   LDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVF  322
             +D      +KPGWRKFLSYVGPGF+VSLAYLDPGNLETDLQAGA+H YELLWV+LIGL+F
Sbjct  39    IDQGNTSPEKPGWRKFLSYVGPGFLVSLAYLDPGNLETDLQAGANHGYELLWVILIGLIF  98

Query  323   ALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNI  502
             ALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAE+AVIAADIPEVIGTAFALNI
Sbjct  99    ALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAEIAVIAADIPEVIGTAFALNI  158

Query  503   LFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDV  682
             LF IPLWVGVLCTG+STLL L LQRYGVRKLE+LIA LVF+MAACFFGEM++VKPPA  V
Sbjct  159   LFDIPLWVGVLCTGVSTLLFLGLQRYGVRKLEMLIATLVFVMAACFFGEMSHVKPPASGV  218

Query  683   FKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIE  862
              KGMF+PKLSGQGAT DAIALLGALVMPHNLFLHSALVL+RKVPNSVRG+NDACRYFLIE
Sbjct  219   IKGMFVPKLSGQGATGDAIALLGALVMPHNLFLHSALVLSRKVPNSVRGINDACRYFLIE  278

Query  863   SGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVY  1042
             SGFALF+AFLINVAVVSVSGTVC+   L++ D D CSDL+LNSASFLL+NVLGKSSST+Y
Sbjct  279   SGFALFIAFLINVAVVSVSGTVCTVQNLTQKDADRCSDLTLNSASFLLQNVLGKSSSTLY  338

Query  1043  AIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssga  1222
             AIALLASGQSSTITGTYAGQYIMQGFLDLKM+KW RNLMTRC+AI PSLIVSIIGGS GA
Sbjct  339   AIALLASGQSSTITGTYAGQYIMQGFLDLKMRKWIRNLMTRCVAIAPSLIVSIIGGSQGA  398

Query  1223  grliiiasMILSFELPFALIPLLKFSSSSTKMGPYKN  1333
             GRLIIIASMILSFELPFALIPLLKFSSSSTKMGP+KN
Sbjct  399   GRLIIIASMILSFELPFALIPLLKFSSSSTKMGPHKN  435



>ref|XP_006657596.1| PREDICTED: metal transporter Nramp5-like [Oryza brachyantha]
Length=548

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/483 (76%), Positives = 426/483 (88%), Gaps = 6/483 (1%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             K+P W++FL++VGPGFMVSLAYLDPGNLETDLQAGA+HRYELLWV+LIGL+FALIIQSLA
Sbjct  37    KEPAWKRFLAHVGPGFMVSLAYLDPGNLETDLQAGANHRYELLWVILIGLIFALIIQSLA  96

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGV TG+HL+E+CK+EYPK+VK  LWLLAELAVIAADIPEVIGTAFA NILFHIP+WV
Sbjct  97    ANLGVVTGRHLAEICKSEYPKFVKIFLWLLAELAVIAADIPEVIGTAFAFNILFHIPVWV  156

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL TG STLLLL LQ+YGVRKLE LI++LVF+MAACFFGE++ VKPPA++V KG+F+P+
Sbjct  157   GVLITGSSTLLLLGLQKYGVRKLEFLISMLVFVMAACFFGELSIVKPPAKEVMKGLFVPR  216

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             L+G GAT DAIALLGALVMPHNLFLHSALVL+RK P SVRG+ D CR+FL ESGFALFVA
Sbjct  217   LTGAGATGDAIALLGALVMPHNLFLHSALVLSRKTPASVRGIKDGCRFFLYESGFALFVA  276

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
              LIN+AVVSVSGT C +  +S++D   C+DLSL+++SFLL+NVLGKSS+ VY +ALLASG
Sbjct  277   LLINIAVVSVSGTACYSPTISQEDAGKCADLSLDTSSFLLRNVLGKSSAIVYGVALLASG  336

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiias  1246
             QSSTITGTYAGQYIMQGFLD++M+KW RNLMTR IAI PSLIVSIIGGS GAGRLIIIAS
Sbjct  337   QSSTITGTYAGQYIMQGFLDIRMRKWLRNLMTRTIAIAPSLIVSIIGGSKGAGRLIIIAS  396

Query  1247  MILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWL  1426
             MILSFELPFALIPLLKFSSSS+KMGP+KNSIYIIV SW+LGL IIGIN+Y+LST+FV WL
Sbjct  397   MILSFELPFALIPLLKFSSSSSKMGPHKNSIYIIVFSWVLGLLIIGINMYFLSTSFVGWL  456

Query  1427  IHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFI------QPNDDDSKMDNN  1588
             IHN LPK  NVLVG  VFP M +Y+VAV+YL  RKD VVTF+       P D D++   +
Sbjct  457   IHNGLPKYANVLVGAAVFPFMLVYIVAVVYLTIRKDSVVTFVADSSLAAPLDVDAEKATS  516

Query  1589  VNN  1597
             +++
Sbjct  517   ISD  519



>gb|EMT15840.1| Metal transporter Nramp6 [Aegilops tauschii]
Length=538

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/479 (76%), Positives = 418/479 (87%), Gaps = 3/479 (1%)
 Frame = +2

Query  146   DLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFA  325
             D  E   K+P W++FLS+VGPGFMVSLAYLDPGNLETDLQAGA+HRYELLWV+LIGL+FA
Sbjct  30    DGDETLVKEPAWKRFLSHVGPGFMVSLAYLDPGNLETDLQAGANHRYELLWVILIGLIFA  89

Query  326   LIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNIL  505
             LIIQSLAANLGV TGKHL+E+CK+EYPK V  CLWLLAE+AVIAADIPEVIGTAFA  +L
Sbjct  90    LIIQSLAANLGVVTGKHLAEICKSEYPKPVMICLWLLAEVAVIAADIPEVIGTAFAFYLL  149

Query  506   FHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVF  685
             F IP+W+GVL TG STLLLL LQRYGVRKLE LI++LVF+MAACFFGE++ VKPPA++V 
Sbjct  150   FRIPVWIGVLITGSSTLLLLGLQRYGVRKLEFLISMLVFVMAACFFGELSIVKPPAKEVL  209

Query  686   KGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIES  865
             KG+FIPKL G GAT DAIALLGALVMPHNLFLHSALVL+RK P+SVRG+ DAC +FL ES
Sbjct  210   KGLFIPKLKGNGATGDAIALLGALVMPHNLFLHSALVLSRKTPSSVRGIKDACGFFLYES  269

Query  866   GFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYA  1045
             GFALFVA LIN+AV+SVSGTVC    LS +D+D CSDLSL+++SFLLKNVLG+SSS VY 
Sbjct  270   GFALFVALLINIAVISVSGTVCFGENLSAEDIDKCSDLSLDNSSFLLKNVLGRSSSIVYG  329

Query  1046  IALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgag  1225
             +ALLASGQSSTITGTYAGQYIMQGFLD+KMK W RNLMTRCIAI PSL+VSIIGG  G  
Sbjct  330   VALLASGQSSTITGTYAGQYIMQGFLDIKMKTWLRNLMTRCIAIAPSLVVSIIGGGEGGR  389

Query  1226  rliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyyls  1405
             RLIIIASMILSFELPFALIPLLKFSSSS+KMGP+KNSIYIIV SW LGL +IGIN+Y+LS
Sbjct  390   RLIIIASMILSFELPFALIPLLKFSSSSSKMGPHKNSIYIIVFSWTLGLMLIGINVYFLS  449

Query  1406  TAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMD  1582
             T+F+ WLIH++LP    VLVG+VV PLM +Y++AV+YL FRKD VVTF+    D  K D
Sbjct  450   TSFMGWLIHSSLPTYAKVLVGVVVCPLMIVYLIAVVYLTFRKDTVVTFVA---DSCKAD  505



>gb|EEE66904.1| hypothetical protein OsJ_23749 [Oryza sativa Japonica Group]
Length=546

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/470 (77%), Positives = 416/470 (89%), Gaps = 8/470 (2%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             K+P W++FL++VGPGFMVSLAYLDPGNLETDLQAGA+HRYELLWV+LIGL+FALIIQSLA
Sbjct  37    KEPAWKRFLAHVGPGFMVSLAYLDPGNLETDLQAGANHRYELLWVILIGLIFALIIQSLA  96

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGV TG+HL+E+CK+EYPK+VK  LWLLAELAVIAADIPEVIGTAFA NILFHIP+WV
Sbjct  97    ANLGVVTGRHLAEICKSEYPKFVKIFLWLLAELAVIAADIPEVIGTAFAFNILFHIPVWV  156

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL TG STLLLL LQ+YGVRKLE LI++LVF+MAACFFGE++ VKPPA++V KG+FIP+
Sbjct  157   GVLITGTSTLLLLGLQKYGVRKLEFLISMLVFVMAACFFGELSIVKPPAKEVMKGLFIPR  216

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             L+G GATADAIALLGALVMPHNLFLHSALVL+RK P SVRG+ D CR+FL ESGFALFVA
Sbjct  217   LNGDGATADAIALLGALVMPHNLFLHSALVLSRKTPASVRGIKDGCRFFLYESGFALFVA  276

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
              LIN+AVVSVSGT CS+  LS++D D C++LSL+++SFLLKNVLGKSS+ VY +ALLASG
Sbjct  277   LLINIAVVSVSGTACSSANLSQEDADKCANLSLDTSSFLLKNVLGKSSAIVYGVALLASG  336

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiias  1246
             QSSTITGTYAGQYIMQGFLD++M+KW RNLMTR IAI PSLIVSIIGGS GAGRLIIIAS
Sbjct  337   QSSTITGTYAGQYIMQGFLDIRMRKWLRNLMTRTIAIAPSLIVSIIGGSRGAGRLIIIAS  396

Query  1247  MILSFELPFALIPLLKFSSSSTKMGPYK--------NSIYiivvswilglgiiginiyyl  1402
             MILSFELPFALIPLLKFSSS +KMGP +        N+  IIV SW LGL IIGIN+Y+L
Sbjct  397   MILSFELPFALIPLLKFSSSKSKMGPTRTLSITAGANAGQIIVFSWFLGLLIIGINMYFL  456

Query  1403  sTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFI  1552
             ST+FV WLIHN+LPK  NVLVG  VFP M +Y+VAV+YL  RKD VVTF+
Sbjct  457   STSFVGWLIHNDLPKYANVLVGAAVFPFMLVYIVAVVYLTIRKDSVVTFV  506



>ref|XP_004955906.1| PREDICTED: metal transporter Nramp5-like [Setaria italica]
Length=532

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/481 (78%), Positives = 434/481 (90%), Gaps = 3/481 (1%)
 Frame = +2

Query  140   QLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLV  319
             +L+  +   K+P W++FL+++GPGFMVSLAYLDPGNLETDLQAGA+HRYELLWV+LIGL+
Sbjct  27    KLEDSDHLIKEPAWKRFLAHIGPGFMVSLAYLDPGNLETDLQAGANHRYELLWVILIGLI  86

Query  320   FALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALN  499
             FALIIQSLAANLGV TG+HL+E+CK+EYPK+VK CLW+LAE+AVIAADIPEVIGTAFA N
Sbjct  87    FALIIQSLAANLGVVTGRHLAEICKSEYPKFVKICLWILAEVAVIAADIPEVIGTAFAFN  146

Query  500   ILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAED  679
             +LFHIP+W+GVL TG STLLLL LQRYGVRKLE LI++LVF+MAACFFGEM++VKPPA +
Sbjct  147   LLFHIPVWIGVLITGSSTLLLLGLQRYGVRKLEFLISMLVFVMAACFFGEMSFVKPPAVE  206

Query  680   VFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLI  859
             V KG+FIP+L G GAT DAIALLGAL+MPHNLFLHSALVL+RK P+SVRG+ DACR+FL 
Sbjct  207   VIKGLFIPRLKGPGATGDAIALLGALIMPHNLFLHSALVLSRKTPSSVRGIKDACRFFLY  266

Query  860   ESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTV  1039
             ESGFALFVA LIN+AV+SVSGTVC    LS +D + CSDLSL+S+SFLLKNVLG+SS+ V
Sbjct  267   ESGFALFVALLINIAVISVSGTVCFADNLSPEDAEKCSDLSLDSSSFLLKNVLGRSSAIV  326

Query  1040  YAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssg  1219
             Y +ALLASGQSSTITGTY+GQYIMQGFLD++MKKW RNLMTRCIAI PSL+VSIIGGSSG
Sbjct  327   YGVALLASGQSSTITGTYSGQYIMQGFLDIRMKKWLRNLMTRCIAIAPSLVVSIIGGSSG  386

Query  1220  agrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyy  1399
             AGRLIIIASMILSFELPFALIPLLKFSSSS+KMGP+KNSIYIIV SW+LGL IIGIN+Y+
Sbjct  387   AGRLIIIASMILSFELPFALIPLLKFSSSSSKMGPHKNSIYIIVFSWLLGLMIIGINMYF  446

Query  1400  lsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKM  1579
             LST+FV WLIHN+LPK  NVLVG+VVFPLM IY++AVIYL FRKD VVTF+    D ++ 
Sbjct  447   LSTSFVGWLIHNSLPKYANVLVGLVVFPLMLIYILAVIYLTFRKDTVVTFVA---DSAQA  503

Query  1580  D  1582
             D
Sbjct  504   D  504



>ref|XP_003630459.1| Root-specific metal transporter [Medicago truncatula]
Length=559

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/522 (68%), Positives = 408/522 (78%), Gaps = 39/522 (7%)
 Frame = +2

Query  137   LQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGL  316
             ++     E  +K GWRKFL Y+GPGF+VSLAYLDPGN+ETDLQAGA+H YELLW+VLIGL
Sbjct  20    METSSNHEETQKSGWRKFLPYIGPGFLVSLAYLDPGNMETDLQAGANHGYELLWLVLIGL  79

Query  317   VFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFAL  496
             +FALIIQSLAANLGV+TGKHLSE+C+ EYP +VKYCLWLLAE+AVIAADIPEVIGTAFAL
Sbjct  80    IFALIIQSLAANLGVTTGKHLSEVCEVEYPLFVKYCLWLLAEVAVIAADIPEVIGTAFAL  139

Query  497   NILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAE  676
             NILF+IPLW GVL TG STLLLLSLQR+GVRKLELLI +LVF+MA CFF EM+YV PPA 
Sbjct  140   NILFNIPLWAGVLLTGFSTLLLLSLQRFGVRKLELLITILVFVMAGCFFAEMSYVNPPAS  199

Query  677   DVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFL  856
              V KGMF+PKL+G+GA ADAIALLGAL+MPHNLFLHSALVL+RKVP SVRG+N+ACRYFL
Sbjct  200   GVLKGMFVPKLAGEGAVADAIALLGALIMPHNLFLHSALVLSRKVPKSVRGINEACRYFL  259

Query  857   IESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSST  1036
              ESGFALFVAFLINVA++SVSGTVCS   LS D+++ C+DL+LNSASFLLKNVLG+SSST
Sbjct  260   YESGFALFVAFLINVAMISVSGTVCSANDLSGDNVERCNDLTLNSASFLLKNVLGRSSST  319

Query  1037  VYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggss  1216
             +YAIALLASGQSSTITGTYAGQYIMQ       K    NLMTRCIAI PSL V+IIGGSS
Sbjct  320   IYAIALLASGQSSTITGTYAGQYIMQ-----DEKNGKGNLMTRCIAIAPSLAVAIIGGSS  374

Query  1217  gagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNS------------IYiivvsw  1360
             G+ RLIIIASMILSFELPFALIPLLKFSSSSTKMGP+KNS            I  I +  
Sbjct  375   GSSRLIIIASMILSFELPFALIPLLKFSSSSTKMGPHKNSMIVSCPFPSSICIAKIGLEI  434

Query  1361  ilglgiiginiyylsTAFVDWLI---------------------HNNLPKAGNVLVGIVV  1477
              L       +  YL    + W++                     H++LPK  NV +GI+V
Sbjct  435   FLVKYRKKCDTIYLQIITISWILGFGIISINVYYLSTAFVKWIIHSSLPKVANVFIGIIV  494

Query  1478  FPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMDNNVNNNV  1603
             FPLMAIY+ +VIYL FRKD V  FI+   +D+ M N V   +
Sbjct  495   FPLMAIYIASVIYLTFRKDTVEMFIE-TKNDTVMQNQVEKGI  535



>ref|XP_003561268.1| PREDICTED: LOW QUALITY PROTEIN: metal transporter Nramp1-like 
[Brachypodium distachyon]
Length=519

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/489 (72%), Positives = 414/489 (85%), Gaps = 2/489 (0%)
 Frame = +2

Query  137   LQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGL  316
             + ++      ++P WR+FL +VGPGFMVSLAYLDPGNLETDLQAGA+HRYELLWV+LIGL
Sbjct  18    VDIEAHAAAQQEPAWRRFLRHVGPGFMVSLAYLDPGNLETDLQAGANHRYELLWVILIGL  77

Query  317   VFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFAL  496
             VFALIIQSL+ANLGV TG+HL+ELCK+EYP +V  CLWLLAE+AVIAADIPEVIGTAFA 
Sbjct  78    VFALIIQSLSANLGVVTGRHLAELCKSEYPAWVNXCLWLLAEVAVIAADIPEVIGTAFAF  137

Query  497   NILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAE  676
             N+LFHIP+W+GVL  G STLLLL LQ+YG+RKLE L+A+LVF+MAACFF EM+ VKPPA+
Sbjct  138   NLLFHIPVWIGVLIAGSSTLLLLGLQKYGIRKLEFLVALLVFVMAACFFVEMSIVKPPAK  197

Query  677   DVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFL  856
             +V KG+FIPKL+G  AT DAIALLGALVMPHNLFLHSALVL+R  P +VRG+NDACR+FL
Sbjct  198   EVIKGLFIPKLNGSSATGDAIALLGALVMPHNLFLHSALVLSRDTPATVRGMNDACRFFL  257

Query  857   IESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSST  1036
              ESG ALFVA L+N+A++SVSGTVC+ G LS ++   C+DL+L+S+SFLLKNVLG+SS+ 
Sbjct  258   FESGIALFVALLVNIAIISVSGTVCNAGNLSPENAAKCADLTLDSSSFLLKNVLGRSSAI  317

Query  1037  VYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggss  1216
             VY +ALLASGQSSTITGTYAGQYIMQGFLD+KMKKW+RNLMTR IAI PSL+VSIIGGSS
Sbjct  318   VYGVALLASGQSSTITGTYAGQYIMQGFLDIKMKKWTRNLMTRSIAIVPSLVVSIIGGSS  377

Query  1217  gagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiy  1396
             GAGRLIIIASMILSFELPFALIPLLKFSSS  KMG   NS+YII  SW LG  IIGIN+Y
Sbjct  378   GAGRLIIIASMILSFELPFALIPLLKFSSSRNKMGQNNNSVYIIGFSWALGFVIIGINVY  437

Query  1397  ylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKD--KVVTFIQPNDDD  1570
             +LS+  + W++HN+LP   N+LVGI +FP M +Y+VAVIYL FRKD  K V+  +  D D
Sbjct  438   FLSSKLIGWILHNSLPTYANILVGITLFPAMLLYIVAVIYLTFRKDTVKFVSRRELQDVD  497

Query  1571  SKMDNNVNN  1597
             +     V N
Sbjct  498   NTEKARVAN  506



>gb|EMT08332.1| Metal transporter Nramp1 [Aegilops tauschii]
Length=525

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/489 (72%), Positives = 415/489 (85%), Gaps = 4/489 (1%)
 Frame = +2

Query  122   DSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWV  301
             +++  L+ D    +++ P W++FL ++GPGFMVSLAYLDPGNLETDLQAGA+HRYELLWV
Sbjct  19    EAVAGLRGDGSGVNSQDPAWKRFLRHIGPGFMVSLAYLDPGNLETDLQAGANHRYELLWV  78

Query  302   VLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIG  481
             +LIGLVFALIIQSL+ANLGV TG+HL+ELCK+EYP +VK CLWLLAE+AVIAADIPEVIG
Sbjct  79    ILIGLVFALIIQSLSANLGVVTGRHLAELCKSEYPVWVKICLWLLAEVAVIAADIPEVIG  138

Query  482   TAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYV  661
             TAFA N+LF+IP+W+GVL  G STLLLL LQRYGVRKLE L+A+LVF+MAACFF EM+ V
Sbjct  139   TAFAFNLLFNIPVWIGVLIAGSSTLLLLGLQRYGVRKLEFLVALLVFVMAACFFVEMSIV  198

Query  662   KPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDA  841
             KPPA++V KG+FIP+L+G  ATADAIALLGALVMPHNLFLHSALVL+R  P SVRG+NDA
Sbjct  199   KPPAKEVMKGLFIPRLNGSSATADAIALLGALVMPHNLFLHSALVLSRDTPASVRGMNDA  258

Query  842   CRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLG  1021
             CR+FL ESG ALFVA L+N+A++SVSGTVC+ G LS +D   C DL+L+S+SFLLKNVLG
Sbjct  259   CRFFLFESGIALFVALLVNIAIISVSGTVCNAGNLSPEDAAKCGDLTLDSSSFLLKNVLG  318

Query  1022  KSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsi  1201
             +SS+ VY +ALLASGQSS+ITGTYAGQYIMQGFLD+KMKKW RNLMTR IAI PSL+VSI
Sbjct  319   RSSAIVYGVALLASGQSSSITGTYAGQYIMQGFLDIKMKKWVRNLMTRSIAIVPSLVVSI  378

Query  1202  iggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgii  1381
             IGGSSGAGRLIIIASMILSFELPFALIPLLKFSSS  KMG   NSIYI+  SW LG  II
Sbjct  379   IGGSSGAGRLIIIASMILSFELPFALIPLLKFSSSRNKMGQCNNSIYIVGFSWTLGFIII  438

Query  1382  giniyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTF----  1549
             GIN+Y+LS+  + W++HN+LP   NVLVG+ +FPLM +YV AV+YL FRKD V       
Sbjct  439   GINVYFLSSKLIGWILHNSLPTYANVLVGVTLFPLMLLYVAAVVYLTFRKDTVKFMSRRE  498

Query  1550  IQPNDDDSK  1576
             +Q  DD  K
Sbjct  499   LQDIDDTEK  507



>dbj|BAM45315.1| Nramp metal transporter [Oryza sativa Japonica Group]
Length=544

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/468 (76%), Positives = 412/468 (88%), Gaps = 6/468 (1%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             K+P W++FL++VGPGFMVSLAYLDPGNLETDLQAGA+HRYELLWV+LIGL+FALIIQSLA
Sbjct  37    KEPAWKRFLAHVGPGFMVSLAYLDPGNLETDLQAGANHRYELLWVILIGLIFALIIQSLA  96

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGV TG+HL+E+CK+EYPK+VK  LWLLAELAVIAADIPEVIGTAFA NILFHIP+WV
Sbjct  97    ANLGVVTGRHLAEICKSEYPKFVKIFLWLLAELAVIAADIPEVIGTAFAFNILFHIPVWV  156

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL TG STLLLL LQ+YGVRKLE LI++LVF+MAACFFGE++ VKPPA++V KG+FIP+
Sbjct  157   GVLITGTSTLLLLGLQKYGVRKLEFLISMLVFVMAACFFGELSIVKPPAKEVMKGLFIPR  216

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             L+G GATADAIALLGALVMPHNLFLHSALVL+RK P SVRG+ D CR+FL ESGFALFVA
Sbjct  217   LNGDGATADAIALLGALVMPHNLFLHSALVLSRKTPASVRGIKDGCRFFLYESGFALFVA  276

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
              LIN+AVVSVSGT CS+  LS++D D C++LSL+++SFLLKNVLGKSS+ VY +ALLASG
Sbjct  277   LLINIAVVSVSGTACSSANLSQEDADKCANLSLDTSSFLLKNVLGKSSAIVYGVALLASG  336

Query  1067  QSSTITGTYAG------QYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagr  1228
             QSSTI     G       +++ GFLD++M+KW RNLMTR IAI PSLIVSIIGGS GAGR
Sbjct  337   QSSTIRPVTMGVSLVCHAHLIGGFLDIRMRKWLRNLMTRTIAIAPSLIVSIIGGSRGAGR  396

Query  1229  liiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsT  1408
             LIIIASMILSFELPFALIPLLKFSSS +KMGP+KNSIYIIV SW LGL IIGIN+Y+LST
Sbjct  397   LIIIASMILSFELPFALIPLLKFSSSKSKMGPHKNSIYIIVFSWFLGLLIIGINMYFLST  456

Query  1409  AFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFI  1552
             +FV WLIHN+LPK  NVLVG  VFP M +Y+VAV+YL  RKD VVTF+
Sbjct  457   SFVGWLIHNDLPKYANVLVGAAVFPFMLVYIVAVVYLTIRKDSVVTFV  504



>gb|AAB36424.1| OsNramp1 [Oryza sativa]
 gb|AAB62273.1| integral membrane protein [Oryza sativa]
Length=517

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/476 (74%), Positives = 407/476 (86%), Gaps = 6/476 (1%)
 Frame = +2

Query  164   NKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSL  343
              K+P W+KFLS++GPGFMV LAYLDPGN+ETDLQAGA+H+YELLWV+LIGL+FALIIQSL
Sbjct  26    RKEPAWKKFLSHIGPGFMVCLAYLDPGNMETDLQAGANHKYELLWVILIGLIFALIIQSL  85

Query  344   AANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLW  523
             +ANLGV TG+HL+ELCK EYP +VK CLWLLAELAVIA+DIPEVIGT FA N+LFHIP+W
Sbjct  86    SANLGVVTGRHLAELCKTEYPVWVKTCLWLLAELAVIASDIPEVIGTGFAFNLLFHIPVW  145

Query  524   vgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIP  703
              GVL  G STLLLL LQRYGVRKLE+++A+LVF+MA CFF EM+ VKPP  +V +G+FIP
Sbjct  146   TGVLIAGSSTLLLLGLQRYGVRKLEVVVALLVFVMAGCFFVEMSIVKPPVNEVLQGLFIP  205

Query  704   KLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFV  883
             +LSG GAT D+IALLGALVMPHNLFLHSALVL+R  P S +G+ DACR+FL ESG ALFV
Sbjct  206   RLSGPGATGDSIALLGALVMPHNLFLHSALVLSRNTPASAKGMKDACRFFLFESGIALFV  265

Query  884   AFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLAS  1063
             A L+N+A++SVSGTVC+   LS +D   CSDL+L+S+SFLL+NVLGKSS+TVY +ALLAS
Sbjct  266   ALLVNIAIISVSGTVCNATNLSPEDAVKCSDLTLDSSSFLLRNVLGKSSATVYGVALLAS  325

Query  1064  GQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiia  1243
             GQSSTITGTYAGQY+MQGFLD+KMK+W RNLMTR IAI PSLIVSIIGGSSGAGRLI+IA
Sbjct  326   GQSSTITGTYAGQYVMQGFLDIKMKQWLRNLMTRSIAIVPSLIVSIIGGSSGAGRLIVIA  385

Query  1244  sMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDW  1423
             SMILSFELPFALIPLLKFSSSS KMG  KNSIYI+  SW+LG  IIGINIY+LST  V W
Sbjct  386   SMILSFELPFALIPLLKFSSSSNKMGENKNSIYIVGFSWVLGFVIIGINIYFLSTKLVGW  445

Query  1424  LIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFI-----QPNDDDSK  1576
             ++HN LP   NVL+GIV+FPLM +YVVAVIYL FRKD  V F+     Q  DD  K
Sbjct  446   ILHNALPTFANVLIGIVLFPLMLLYVVAVIYLTFRKDT-VKFVSRRELQAGDDTEK  500



>gb|EAZ03422.1| hypothetical protein OsI_25561 [Oryza sativa Indica Group]
Length=518

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/476 (74%), Positives = 407/476 (86%), Gaps = 6/476 (1%)
 Frame = +2

Query  164   NKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSL  343
              K+P W+KFLS++GPGFMV LAYLDPGN+ETDLQAGA+H+YELLWV+LIGL+FALIIQSL
Sbjct  27    RKEPAWKKFLSHIGPGFMVCLAYLDPGNMETDLQAGANHKYELLWVILIGLIFALIIQSL  86

Query  344   AANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLW  523
             +ANLGV TG+HL+ELCK EYP +VK CLWLLAELAVIA+DIPEVIGT FA N+LFHIP+W
Sbjct  87    SANLGVVTGRHLAELCKTEYPVWVKTCLWLLAELAVIASDIPEVIGTGFAFNLLFHIPVW  146

Query  524   vgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIP  703
              GVL  G STLLLL LQRYGVRKLE+++A+LVF+MA CFF EM+ VKPP  +V +G+FIP
Sbjct  147   TGVLIAGSSTLLLLGLQRYGVRKLEVVVALLVFVMAGCFFVEMSIVKPPVNEVLQGLFIP  206

Query  704   KLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFV  883
             +LSG GAT D+IALLGALVMPHNLFLHSALVL+R  P S +G+ DACR+FL ESG ALFV
Sbjct  207   RLSGPGATGDSIALLGALVMPHNLFLHSALVLSRNTPASAKGMKDACRFFLFESGIALFV  266

Query  884   AFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLAS  1063
             A L+N+A++SVSGTVC+   LS +D   CSDL+L+S+SFLL+NVLGKSS+TVY +ALLAS
Sbjct  267   ALLVNIAIISVSGTVCNATNLSPEDAVKCSDLTLDSSSFLLRNVLGKSSATVYGVALLAS  326

Query  1064  GQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiia  1243
             GQSSTITGTYAGQY+MQGFLD+KMK+W RNLMTR IAI PSLIVSIIGGSSGAGRLI+IA
Sbjct  327   GQSSTITGTYAGQYVMQGFLDIKMKQWLRNLMTRSIAIVPSLIVSIIGGSSGAGRLIVIA  386

Query  1244  sMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDW  1423
             SMILSFELPFALIPLLKFSSSS KMG  KNSIYI+  SW+LG  IIGINIY+LST  V W
Sbjct  387   SMILSFELPFALIPLLKFSSSSNKMGENKNSIYIVGFSWVLGFVIIGINIYFLSTKLVGW  446

Query  1424  LIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFI-----QPNDDDSK  1576
             ++HN LP   NVL+GIV+FPLM +YVVAVIYL FRKD  V F+     Q  DD  K
Sbjct  447   ILHNALPTFANVLIGIVLFPLMLLYVVAVIYLTFRKDT-VKFVSRRELQAGDDTEK  501



>gb|AER41612.1| metal+transporter+Nramp6 [Oryza glumipatula]
Length=518

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/476 (73%), Positives = 406/476 (85%), Gaps = 6/476 (1%)
 Frame = +2

Query  164   NKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSL  343
              K+P W++FLS++GPGFMV LAYLDPGN+ETDLQAGA+H+YELLWV+LIGL+FALIIQSL
Sbjct  27    RKEPAWKRFLSHIGPGFMVCLAYLDPGNMETDLQAGANHKYELLWVILIGLIFALIIQSL  86

Query  344   AANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLW  523
             +ANLGV TG+HL+ELCK EYP +VK CLWLLAELAVIA+DIPEVIGT FA N+LFHIP+W
Sbjct  87    SANLGVVTGRHLAELCKTEYPVWVKTCLWLLAELAVIASDIPEVIGTGFAFNLLFHIPVW  146

Query  524   vgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIP  703
              GVL  G STLLLL LQRYGVRKLE+++A+LVF+MA CFF EM+ VKPP  +V +G+FIP
Sbjct  147   TGVLIAGSSTLLLLGLQRYGVRKLEVVVALLVFVMAGCFFVEMSIVKPPVNEVLQGLFIP  206

Query  704   KLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFV  883
             +LSG GAT D+IALLGALVMPHNLFLHSALVL+R  P S +G+ DACR+FL ESG ALFV
Sbjct  207   RLSGPGATGDSIALLGALVMPHNLFLHSALVLSRNTPASAKGMKDACRFFLFESGIALFV  266

Query  884   AFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLAS  1063
             A L+N+A++SVSGTVC+   LS +D   CSDL+L+S+SFLL+NVLGKSS+TVY +ALLAS
Sbjct  267   ALLVNIAIISVSGTVCNATNLSPEDAVKCSDLTLDSSSFLLRNVLGKSSATVYGVALLAS  326

Query  1064  GQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiia  1243
             GQSSTITGTYAGQY+MQGFLD+KMK+W RNLMTR IAI PSLIVSIIGGSSGAGRLI+IA
Sbjct  327   GQSSTITGTYAGQYVMQGFLDIKMKQWLRNLMTRSIAIVPSLIVSIIGGSSGAGRLIVIA  386

Query  1244  sMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDW  1423
             SMILSFELPFALIPLLKFSSSS KMG  KNSIYI+  SW+LG  IIGIN+Y+LST  V W
Sbjct  387   SMILSFELPFALIPLLKFSSSSNKMGENKNSIYIVGFSWVLGFIIIGINVYFLSTKLVGW  446

Query  1424  LIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFI-----QPNDDDSK  1576
             ++HN LP   NVL+GIV+FPLM +YV AVIYL FRKD  V F+     Q  DD  K
Sbjct  447   ILHNALPTFANVLIGIVLFPLMLLYVAAVIYLTFRKDT-VKFVSRRELQTGDDTEK  501



>ref|NP_001059315.1| Os07g0258400 [Oryza sativa Japonica Group]
 sp|Q0D7E4.1|NRAM1_ORYSJ RecName: Full=Metal transporter Nramp1; Short=OsNramp1 [Oryza 
sativa Japonica Group]
 dbj|BAF21229.1| Os07g0258400 [Oryza sativa Japonica Group]
 gb|EEE66907.1| hypothetical protein OsJ_23752 [Oryza sativa Japonica Group]
Length=518

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/476 (73%), Positives = 406/476 (85%), Gaps = 6/476 (1%)
 Frame = +2

Query  164   NKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSL  343
              K+P W++FLS++GPGFMV LAYLDPGN+ETDLQAGA+H+YELLWV+LIGL+FALIIQSL
Sbjct  27    RKEPAWKRFLSHIGPGFMVCLAYLDPGNMETDLQAGANHKYELLWVILIGLIFALIIQSL  86

Query  344   AANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLW  523
             +ANLGV TG+HL+ELCK EYP +VK CLWLLAELAVIA+DIPEVIGT FA N+LFHIP+W
Sbjct  87    SANLGVVTGRHLAELCKTEYPVWVKTCLWLLAELAVIASDIPEVIGTGFAFNLLFHIPVW  146

Query  524   vgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIP  703
              GVL  G STLLLL LQRYGVRKLE+++A+LVF+MA CFF EM+ VKPP  +V +G+FIP
Sbjct  147   TGVLIAGSSTLLLLGLQRYGVRKLEVVVALLVFVMAGCFFVEMSIVKPPVNEVLQGLFIP  206

Query  704   KLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFV  883
             +LSG GAT D+IALLGALVMPHNLFLHSALVL+R  P S +G+ D CR+FL ESG ALFV
Sbjct  207   RLSGPGATGDSIALLGALVMPHNLFLHSALVLSRNTPASAKGMKDVCRFFLFESGIALFV  266

Query  884   AFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLAS  1063
             A L+N+A++SVSGTVC+   LS +D   CSDL+L+S+SFLL+NVLGKSS+TVY +ALLAS
Sbjct  267   ALLVNIAIISVSGTVCNATNLSPEDAVKCSDLTLDSSSFLLRNVLGKSSATVYGVALLAS  326

Query  1064  GQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiia  1243
             GQSSTITGTYAGQY+MQGFLD+KMK+W RNLMTR IAI PSLIVSIIGGSSGAGRLI+IA
Sbjct  327   GQSSTITGTYAGQYVMQGFLDIKMKQWLRNLMTRSIAIVPSLIVSIIGGSSGAGRLIVIA  386

Query  1244  sMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDW  1423
             SMILSFELPFALIPLLKFSSSS KMG  KNSIYI+  SW+LG  IIGINIY+LST  V W
Sbjct  387   SMILSFELPFALIPLLKFSSSSNKMGENKNSIYIVGFSWVLGFVIIGINIYFLSTKLVGW  446

Query  1424  LIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFI-----QPNDDDSK  1576
             ++HN LP   NVL+GIV+FPLM +YVVAVIYL FRKD  V F+     Q  DD  K
Sbjct  447   ILHNALPTFANVLIGIVLFPLMLLYVVAVIYLTFRKDT-VKFVSRRELQAGDDTEK  501



>gb|AER41592.1| metal+transporter+Nramp6 [Oryza glaberrima]
Length=520

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/476 (73%), Positives = 405/476 (85%), Gaps = 6/476 (1%)
 Frame = +2

Query  164   NKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSL  343
              K+P W++FLS++GPGFMV LAYLDPGN+ETDLQAGA+H+YELLWV+LIGL+FALIIQSL
Sbjct  29    RKEPAWKRFLSHIGPGFMVCLAYLDPGNMETDLQAGANHKYELLWVILIGLIFALIIQSL  88

Query  344   AANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLW  523
             +ANLGV TG+HL+ELCK EYP +VK CLWLLAELAVIA+DIPEVIGT FA N+LFHIP+W
Sbjct  89    SANLGVVTGRHLAELCKTEYPVWVKTCLWLLAELAVIASDIPEVIGTGFAFNLLFHIPVW  148

Query  524   vgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIP  703
              GVL  G STLLLL LQRYGVRKLE+++A+LVF+MA CFF EM+ VKPP  +V +G+FIP
Sbjct  149   TGVLIAGSSTLLLLGLQRYGVRKLEVVVALLVFVMAGCFFVEMSIVKPPVNEVLQGLFIP  208

Query  704   KLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFV  883
             +LSG GAT D+IALLGALVMPHNLFLHSALVL+R  P S +G+ DACR+FL ESG ALFV
Sbjct  209   RLSGPGATGDSIALLGALVMPHNLFLHSALVLSRNTPASAKGMKDACRFFLFESGIALFV  268

Query  884   AFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLAS  1063
             A L+N+A++SVSGTVC+   LS +D   CSDL+L+S+SFLL+NVLGKSS+TVY +ALLAS
Sbjct  269   ALLVNIAIISVSGTVCNATNLSPEDAVKCSDLTLDSSSFLLRNVLGKSSATVYGVALLAS  328

Query  1064  GQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiia  1243
             GQSSTITGTYAGQY+MQGFLD+KMK+W RNLMTR IAI PSLIVSIIGGSSGAG LI+IA
Sbjct  329   GQSSTITGTYAGQYVMQGFLDIKMKQWLRNLMTRSIAIVPSLIVSIIGGSSGAGHLIVIA  388

Query  1244  sMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDW  1423
             SMILSFELPFALIPLLKFSSSS KMG  KNSIYI+  SW+LG  IIGIN+Y+LST  V W
Sbjct  389   SMILSFELPFALIPLLKFSSSSNKMGENKNSIYIVGFSWVLGFIIIGINVYFLSTKLVGW  448

Query  1424  LIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFI-----QPNDDDSK  1576
             ++HN LP   NVL+GIV+FPLM +YV AVIYL FRKD  V F+     Q  DD  K
Sbjct  449   ILHNALPTFANVLIGIVLFPLMLLYVAAVIYLTFRKDT-VKFVSRRELQAGDDTEK  503



>dbj|BAC83021.1| rice Nramp1 protein(Natural-resistance-associated macrophage 
protein 1) [Oryza sativa Japonica Group]
Length=519

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/477 (73%), Positives = 405/477 (85%), Gaps = 7/477 (1%)
 Frame = +2

Query  164   NKKPGWRKFLSYVGPGFMVSLAYLDPGN-LETDLQAGADHRYELLWVVLIGLVFALIIQS  340
              K+P W++FLS++GPGFMV LAYLDPGN +ETDLQAGA+H+YELLWV+LIGL+FALIIQS
Sbjct  27    RKEPAWKRFLSHIGPGFMVCLAYLDPGNSVETDLQAGANHKYELLWVILIGLIFALIIQS  86

Query  341   LAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPL  520
             L+ANLGV TG HL+ELCK EYP +VK CLWLLAELAVIA+DIPEVIGT FA N+LFHIP+
Sbjct  87    LSANLGVVTGSHLAELCKTEYPVWVKTCLWLLAELAVIASDIPEVIGTGFAFNLLFHIPV  146

Query  521   WvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFI  700
             W GVL  G STLLLL LQRYGVRKLE+++A+LVF+MA CFF EM+ VKPP  +V +G+FI
Sbjct  147   WTGVLIAGSSTLLLLGLQRYGVRKLEVVVALLVFVMAGCFFVEMSIVKPPVNEVLQGLFI  206

Query  701   PKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALF  880
             P+LSG GAT D+IALLGALVMPHNLFLHSALVL+R  P S +G+ D CR+FL ESG ALF
Sbjct  207   PRLSGPGATGDSIALLGALVMPHNLFLHSALVLSRNTPASAKGMKDVCRFFLFESGIALF  266

Query  881   VAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLA  1060
             VA L+N+A++SVSGTVC+   LS +D   CSDL+L+S+SFLL+NVLGKSS+TVY +ALLA
Sbjct  267   VALLVNIAIISVSGTVCNATNLSPEDAVKCSDLTLDSSSFLLRNVLGKSSATVYGVALLA  326

Query  1061  SGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliii  1240
             SGQSSTITGTYAGQY+MQGFLD+KMK+W RNLMTR IAI PSLIVSIIGGSSGAGRLI+I
Sbjct  327   SGQSSTITGTYAGQYVMQGFLDIKMKQWLRNLMTRSIAIVPSLIVSIIGGSSGAGRLIVI  386

Query  1241  asMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVD  1420
             ASMILSFELPFALIPLLKFSSSS KMG  KNSIYI+  SW+LG  IIGINIY+LST  V 
Sbjct  387   ASMILSFELPFALIPLLKFSSSSNKMGENKNSIYIVGFSWVLGFVIIGINIYFLSTKLVG  446

Query  1421  WLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFI-----QPNDDDSK  1576
             W++HN LP   NVL+GIV+FPLM +YVVAVIYL FRKD  V F+     Q  DD  K
Sbjct  447   WILHNALPTFANVLIGIVLFPLMLLYVVAVIYLTFRKDT-VKFVSRRELQAGDDTEK  502



>gb|ABD85292.1| metal transporter [Oryza sativa Japonica Group]
Length=518

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/476 (73%), Positives = 405/476 (85%), Gaps = 6/476 (1%)
 Frame = +2

Query  164   NKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSL  343
              K+P W++FLS++GPGFMV LAYLDPGN+ETDLQAGA+H+YELLWV+LIGL+ ALIIQSL
Sbjct  27    RKEPAWKRFLSHIGPGFMVCLAYLDPGNMETDLQAGANHKYELLWVILIGLISALIIQSL  86

Query  344   AANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLW  523
             +ANLGV TG+HL+ELCK EYP +VK CLWLLAELAVIA+DIPEVIGT FA N+LFHIP+W
Sbjct  87    SANLGVVTGRHLAELCKTEYPVWVKTCLWLLAELAVIASDIPEVIGTGFAFNLLFHIPVW  146

Query  524   vgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIP  703
              GVL  G STLLLL L+RYGVRKLE+++A+LVF+MA CFF EM+ VKPP  +V +G+FIP
Sbjct  147   TGVLIAGSSTLLLLGLRRYGVRKLEVVVALLVFVMAGCFFVEMSIVKPPVNEVLQGLFIP  206

Query  704   KLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFV  883
             +LSG GAT D+IALLGALVMPHNLFLHSALVL+R  P S +G+ D CR+FL ESG ALFV
Sbjct  207   RLSGPGATGDSIALLGALVMPHNLFLHSALVLSRNTPASAKGMKDVCRFFLFESGIALFV  266

Query  884   AFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLAS  1063
             A L+N+A++SVSGTVC+   LS +D   CSDL+L+S+SFLL+NVLGKSS+TVY +ALLAS
Sbjct  267   ALLVNIAIISVSGTVCNATNLSPEDAVKCSDLTLDSSSFLLRNVLGKSSATVYGVALLAS  326

Query  1064  GQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiia  1243
             GQSSTITGTYAGQY+MQGFLD+KMK+W RNLMTR IAI PSLIVSIIGGSSGAGRLI+IA
Sbjct  327   GQSSTITGTYAGQYVMQGFLDIKMKQWLRNLMTRSIAIVPSLIVSIIGGSSGAGRLIVIA  386

Query  1244  sMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDW  1423
             SMILSFELPFALIPLLKFSSSS K+G  KNSIYI+  SW+LG  IIGINIY+LST  V W
Sbjct  387   SMILSFELPFALIPLLKFSSSSNKIGENKNSIYIVGFSWVLGFVIIGINIYFLSTKLVGW  446

Query  1424  LIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFI-----QPNDDDSK  1576
             ++HN LP   NVL+GIV+FPLM +YVVAVIYL FRKD  V F+     Q  DD  K
Sbjct  447   ILHNALPTFANVLIGIVLFPLMLLYVVAVIYLTFRKDT-VKFVSRRELQAGDDTEK  501



>gb|KDP32831.1| hypothetical protein JCGZ_12123 [Jatropha curcas]
Length=509

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/492 (75%), Positives = 414/492 (84%), Gaps = 38/492 (8%)
 Frame = +2

Query  140   QLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLV  319
             Q D ++  ++KPGWRKFLSYVGPGF+VSLAYLDPGNLETDLQAGA+H YELLWV+LIGL+
Sbjct  35    QNDNEDRSHQKPGWRKFLSYVGPGFLVSLAYLDPGNLETDLQAGANHGYELLWVILIGLI  94

Query  320   FALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALN  499
             FALIIQSLAANLGVST                                   VIGTAFALN
Sbjct  95    FALIIQSLAANLGVST-----------------------------------VIGTAFALN  119

Query  500   ILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAED  679
             ILFHIPLWVGVLCTGLSTLLLL LQ+YGVRKLE+LIA+LVF+MA CFFGEM++VKPPA +
Sbjct  120   ILFHIPLWVGVLCTGLSTLLLLGLQKYGVRKLEMLIALLVFVMAGCFFGEMSHVKPPATE  179

Query  680   VFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLI  859
             V KGMFIPKLSGQGAT DAIALLGALVMPHNLFLHSALVL+RKVPNSVRGVN+ACR+FLI
Sbjct  180   VIKGMFIPKLSGQGATGDAIALLGALVMPHNLFLHSALVLSRKVPNSVRGVNEACRFFLI  239

Query  860   ESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTV  1039
             ESGFAL +AFLIN+AVVSVSGTVC+   LS++D + CSDL+LNSASFLL+N+LGKSSS +
Sbjct  240   ESGFALLIAFLINLAVVSVSGTVCTAQNLSQNDANRCSDLTLNSASFLLQNMLGKSSSIL  299

Query  1040  YAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssg  1219
             Y IALLASGQSSTI+GTYAGQYIMQ +  LKM+KW RNLMTRCIAITPSLIVSIIGGS G
Sbjct  300   YGIALLASGQSSTISGTYAGQYIMQAY--LKMRKWIRNLMTRCIAITPSLIVSIIGGSQG  357

Query  1220  agrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyy  1399
             AGRLIIIASMILSFELPFALIPLLKFSSSSTKMGP+ NSI+IIV SWILGLGIIGINIYY
Sbjct  358   AGRLIIIASMILSFELPFALIPLLKFSSSSTKMGPHSNSIFIIVFSWILGLGIIGINIYY  417

Query  1400  lsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQP-NDDDSK  1576
             LST FV WLI NNLPKAGNV +GI+VFPLMA+YV AVIYL  R+D VVTFI+P  ++ S+
Sbjct  418   LSTGFVGWLIDNNLPKAGNVFIGIIVFPLMAVYVFAVIYLTLREDTVVTFIEPMKENGSR  477

Query  1577  MDNNVNNNVCMT  1612
             +  N+   +  +
Sbjct  478   LQANLEEGLVQS  489



>ref|XP_008670085.1| PREDICTED: metal transporter Nramp1-like isoform X2 [Zea mays]
Length=519

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/482 (73%), Positives = 408/482 (85%), Gaps = 7/482 (1%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             K P W++FL +VGPGFMV LAYLDPGNL TDLQAGADHRYELLWV LIGL+FALIIQSL+
Sbjct  30    KGPAWKRFLYHVGPGFMVCLAYLDPGNLGTDLQAGADHRYELLWVTLIGLIFALIIQSLS  89

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGV TG+HL+ELCK EYP +V+ CLWLLAELAVIAADIPEVIGTAFA NILFH+PLWV
Sbjct  90    ANLGVVTGRHLAELCKTEYPAWVRICLWLLAELAVIAADIPEVIGTAFAFNILFHVPLWV  149

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL TG STLLLL LQ+YGVRKLELL+ +LVF+MAACFF EM+ VKPPAE+V  G+FIP 
Sbjct  150   GVLITGSSTLLLLGLQKYGVRKLELLVGLLVFVMAACFFIEMSIVKPPAEEVIHGLFIPS  209

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             LSG GAT D IALLGALVMPHNLFLHSALVL+R  P+SVRG+NDACR+FL+ESG A+FVA
Sbjct  210   LSGPGATGDTIALLGALVMPHNLFLHSALVLSRNTPSSVRGINDACRFFLLESGVAMFVA  269

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
              +IN+ ++SVSGTVC++  +S DD   CSD++L+S+SFLL+NVLG SS+ VY +ALLA G
Sbjct  270   LIINICIISVSGTVCNSSNVSPDDSAKCSDITLDSSSFLLRNVLGNSSAVVYGVALLACG  329

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiias  1246
              SS+ITGTYAGQYIMQGFLD+KM++W RNLMTR IAI PSLIV+IIGGSSGAGRL+IIAS
Sbjct  330   ISSSITGTYAGQYIMQGFLDIKMRQWLRNLMTRSIAIIPSLIVAIIGGSSGAGRLVIIAS  389

Query  1247  MILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWL  1426
             MILSFELPFALIPLLKFSSSS+ MG +KNSI+II  SWILG  IIGINIY+LS+ FV W+
Sbjct  390   MILSFELPFALIPLLKFSSSSSTMGQHKNSIFIIGFSWILGFVIIGINIYFLSSKFVGWI  449

Query  1427  IHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPND------DDSKMDNN  1588
             +HN+L    N+L+GIVVFPLM IYV AVIYL  RK+  + F+   +      D SK+ N 
Sbjct  450   LHNSLQIYANILIGIVVFPLMLIYVCAVIYLTLRKET-IKFVACGELQTIETDKSKLANG  508

Query  1589  VN  1594
              N
Sbjct  509   SN  510



>ref|XP_004959136.1| PREDICTED: metal transporter Nramp1-like [Setaria italica]
Length=516

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/485 (72%), Positives = 408/485 (84%), Gaps = 7/485 (1%)
 Frame = +2

Query  164   NKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSL  343
              K+P W++FL +VGPGFMV LAYLDPGNLETDLQAGA+H+YELLWV+LIGL+FALIIQSL
Sbjct  26    TKEPAWKRFLCHVGPGFMVCLAYLDPGNLETDLQAGANHKYELLWVILIGLIFALIIQSL  85

Query  344   AANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLW  523
             +ANLGV TG+HL+ELCK EYP++V+ CLWLLAELAVIAADIPEVIGTAFA N+LFHIP+W
Sbjct  86    SANLGVVTGRHLAELCKTEYPRWVRICLWLLAELAVIAADIPEVIGTAFAFNLLFHIPVW  145

Query  524   vgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIP  703
             VGVL TG STLLLL LQ+YGVRKLELL+A+LVF+MAACFF EM+ VKPP+E+V  G+F+P
Sbjct  146   VGVLITGSSTLLLLGLQKYGVRKLELLVALLVFIMAACFFIEMSIVKPPSEEVIHGLFVP  205

Query  704   KLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFV  883
              LSG GAT D +ALLGALVMPHNLFLHSALVL+R   +SVRG+ DACR+FL ESG ALFV
Sbjct  206   SLSGSGATGDTVALLGALVMPHNLFLHSALVLSRNTSSSVRGIKDACRFFLFESGIALFV  265

Query  884   AFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLAS  1063
             A LIN+ ++SVSGTVC++  LS DD   CSD++L+S+SFLL+NVLGK+ + VY +ALLA 
Sbjct  266   ALLINICIISVSGTVCNSRNLSPDDSAKCSDITLDSSSFLLRNVLGKNGAVVYGVALLAC  325

Query  1064  GQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiia  1243
             G SSTITGTYAGQYIMQGFLD+KMK+W RNLMTR IAI PSLIV+IIGGSSGAG LIIIA
Sbjct  326   GISSTITGTYAGQYIMQGFLDIKMKQWLRNLMTRSIAIVPSLIVAIIGGSSGAGHLIIIA  385

Query  1244  sMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDW  1423
             SMILS ELPFALIPLLKFSSSS KMG  KNSIYII  SWILG  IIGINIY+LS+  V W
Sbjct  386   SMILSVELPFALIPLLKFSSSSNKMGENKNSIYIIGFSWILGFIIIGINIYFLSSKLVGW  445

Query  1424  LIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPND------DDSKMDN  1585
             ++HN LP   NVL+GI++FPLM +Y+ AVIYL FRKD  V F    +      D SK+ N
Sbjct  446   ILHNKLPIYTNVLIGIIMFPLMLLYISAVIYLTFRKDT-VKFASRGELQAIETDKSKVAN  504

Query  1586  NVNNN  1600
             + +N 
Sbjct  505   DSSNE  509



>ref|XP_006658451.1| PREDICTED: metal transporter Nramp1-like [Oryza brachyantha]
Length=550

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/459 (75%), Positives = 395/459 (86%), Gaps = 0/459 (0%)
 Frame = +2

Query  164   NKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSL  343
              ++P W++FL ++GPGFMV LAY+DPGNLETDLQAGA+H+YELLWV+LIGL+FALIIQSL
Sbjct  60    QREPAWKRFLRHIGPGFMVCLAYIDPGNLETDLQAGANHKYELLWVILIGLIFALIIQSL  119

Query  344   AANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLW  523
             +ANLGV TG+HL+ELCK EYP +VK CLWLLAELAVIA+DIPEVIGT FA N+LFHIP+W
Sbjct  120   SANLGVVTGRHLAELCKTEYPVWVKTCLWLLAELAVIASDIPEVIGTGFAFNLLFHIPVW  179

Query  524   vgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIP  703
              GVL  G STLLLL LQRYGVR LE+++A+LVF MAACFF EM+ VKPP ++V  G+FIP
Sbjct  180   SGVLIAGSSTLLLLGLQRYGVRNLEVVVALLVFTMAACFFVEMSIVKPPVKEVLHGLFIP  239

Query  704   KLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFV  883
              LSG GAT D+IALLGALVMPHNLFLHSALVL+R  P S +G+ DACR+FL ESG ALFV
Sbjct  240   GLSGPGATGDSIALLGALVMPHNLFLHSALVLSRNTPASAKGMKDACRFFLFESGIALFV  299

Query  884   AFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLAS  1063
             A L+N+AV+SVSGTVC+   LS DD   C DL+L+S+SFLL+NVLGKSS+TVY IALLAS
Sbjct  300   ALLVNIAVISVSGTVCNATNLSPDDAAKCGDLTLDSSSFLLRNVLGKSSATVYGIALLAS  359

Query  1064  GQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiia  1243
             GQSSTITGTYAGQY+MQGFLD+KMK+W RNLMTR IAI PSLIVSIIGGSSGAGRLIIIA
Sbjct  360   GQSSTITGTYAGQYVMQGFLDIKMKQWLRNLMTRSIAIVPSLIVSIIGGSSGAGRLIIIA  419

Query  1244  sMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDW  1423
             SMILSFELPFALIPLLKFSSSS KMG  KNSIYI+  SW+LG  IIGINIY+LST  V W
Sbjct  420   SMILSFELPFALIPLLKFSSSSNKMGENKNSIYIVGFSWVLGFIIIGINIYFLSTKLVGW  479

Query  1424  LIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKV  1540
             ++HN LP   NVL+GIV+FPLM +YV AVIYL  RKD V
Sbjct  480   ILHNALPTYANVLIGIVLFPLMLLYVAAVIYLTLRKDTV  518



>ref|XP_002459640.1| hypothetical protein SORBIDRAFT_02g007890 [Sorghum bicolor]
 gb|EER96161.1| hypothetical protein SORBIDRAFT_02g007890 [Sorghum bicolor]
Length=525

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/484 (71%), Positives = 407/484 (84%), Gaps = 7/484 (1%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             K P W++FL +VGPGFMV LAYLDPGNL TDLQAGADHRYELLWV LIGL+FALIIQSL+
Sbjct  33    KGPAWKRFLYHVGPGFMVCLAYLDPGNLGTDLQAGADHRYELLWVTLIGLIFALIIQSLS  92

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGV TG+HL+ELCK EYP +V+ CLWLLAELAVIAADIPEVIGTAFA N+LFHIPLWV
Sbjct  93    ANLGVVTGRHLAELCKTEYPAWVRICLWLLAELAVIAADIPEVIGTAFAFNLLFHIPLWV  152

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL TG STLLLL +Q+YGVRKLELL+ +LVF+MAACFF EM+ VKPPA++V  G+F+P 
Sbjct  153   GVLITGSSTLLLLGMQKYGVRKLELLVGLLVFVMAACFFIEMSIVKPPAKEVIYGLFVPS  212

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             LSG GAT D IALLGALVMPHNLFLHSALVL+R  P+SVRG+ DACR+FL+ESG A+FVA
Sbjct  213   LSGSGATGDTIALLGALVMPHNLFLHSALVLSRNTPSSVRGIKDACRFFLLESGVAMFVA  272

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
              LIN+ ++SVSGTVC++  LS  D   CSD++L+S+SFLL+NVLG +S+ VY +ALLA G
Sbjct  273   LLINICIISVSGTVCNSSNLSSVDSAKCSDITLDSSSFLLRNVLGNNSAVVYGVALLACG  332

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiias  1246
              SS+ITGTYAGQYIMQGFLD+KMK+W RNLMTR IAI PSLIV+IIGGSSGAGRLIIIAS
Sbjct  333   ISSSITGTYAGQYIMQGFLDIKMKQWLRNLMTRSIAIVPSLIVAIIGGSSGAGRLIIIAS  392

Query  1247  MILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWL  1426
             MILSFELPFALIPLLKFSSSS  MG +KNSIYII  SWILG  IIGINIY+L + FV W+
Sbjct  393   MILSFELPFALIPLLKFSSSSNTMGQHKNSIYIIGFSWILGSVIIGINIYFLCSKFVGWI  452

Query  1427  IHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPND------DDSKMDNN  1588
             +HN+LP   N+L+GI+VFPLM +Y+ AVIYL  RK+  + F+   +      D SK+ ++
Sbjct  453   LHNSLPIYANILIGIIVFPLMLLYICAVIYLTLRKET-IKFVPCGELQAIETDKSKVADD  511

Query  1589  VNNN  1600
              NN 
Sbjct  512   SNNE  515



>ref|XP_010095424.1| Metal transporter Nramp5 [Morus notabilis]
 gb|EXB60116.1| Metal transporter Nramp5 [Morus notabilis]
Length=511

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/521 (74%), Positives = 426/521 (82%), Gaps = 40/521 (8%)
 Frame = +2

Query  65    SHRIVAVDEsplpssnnnpDSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPG  244
             ++RI AVD +P PS N    S +         +++KPGWRKFL+YVGPGF+VSLAYLDPG
Sbjct  15    ANRIAAVDRTPPPSVNMTATSSDNNNYHFNT-NDQKPGWRKFLAYVGPGFLVSLAYLDPG  73

Query  245   NLETDLQAGADHRYELLWVVLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYC  424
             NLETDLQAGA+H YELLW++LIGL+FALIIQSLAANLGV+T                   
Sbjct  74    NLETDLQAGANHGYELLWIILIGLIFALIIQSLAANLGVTT-------------------  114

Query  425   LWLLAELAVIAADIPEVIGTAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELL  604
                             VIGTAFALNILF+IP+WVGVL TG STLLLL LQRYGVRKLELL
Sbjct  115   ----------------VIGTAFALNILFNIPVWVGVLLTGCSTLLLLGLQRYGVRKLELL  158

Query  605   IAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLH  784
             I+VLVF+MAACFFGEM+YVKPPA  V KGMFIPKL+G  AT DAIALLGAL+MPHNLFLH
Sbjct  159   ISVLVFIMAACFFGEMSYVKPPASGVLKGMFIPKLNGHDATGDAIALLGALIMPHNLFLH  218

Query  785   SALVLTRKVPNSVRGVNDACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLD  964
             SALVL+RKVPNSVRG+NDACR+FLIESGFALFVAFLINVAV+SVSGTVCS   LS DD D
Sbjct  219   SALVLSRKVPNSVRGINDACRFFLIESGFALFVAFLINVAVISVSGTVCSANNLSSDDAD  278

Query  965   HCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKW  1144
              CSDL+LNSASFLL+NVLGKSS  +YAIALLASGQSS ITGTYAGQYIMQGFLDLKMK W
Sbjct  279   RCSDLTLNSASFLLQNVLGKSSKIIYAIALLASGQSSAITGTYAGQYIMQGFLDLKMKTW  338

Query  1145  SRNLMTRCIAITPslivsiiggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGP  1324
              RNLMTR IAITPSLIVSIIGGSSGAGRLIIIASMILSFELPFALIPLLKFSSS+TKMGP
Sbjct  339   MRNLMTRSIAITPSLIVSIIGGSSGAGRLIIIASMILSFELPFALIPLLKFSSSATKMGP  398

Query  1325  YKNSIYiivvswilglgiiginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVV  1504
             +KNSIYIIV SWILG GIIGINIYYLSTAFVDWLIH++LPK  NV +GIVVFPLMAIY+V
Sbjct  399   HKNSIYIIVFSWILGFGIIGINIYYLSTAFVDWLIHSSLPKVANVFIGIVVFPLMAIYIV  458

Query  1505  AVIYLMFRKDKVVTFIQPNDDDS----KMDNNVNNNVCMTP  1615
             +VIYL FRKD VVTFI+   +D     +M++   +NV + P
Sbjct  459   SVIYLTFRKDAVVTFIESEKNDPFAQIQMESGQISNVGVVP  499



>gb|KCW71240.1| hypothetical protein EUGRSUZ_F04337 [Eucalyptus grandis]
Length=519

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/504 (74%), Positives = 417/504 (83%), Gaps = 39/504 (8%)
 Frame = +2

Query  65    SHRIVAVDEsplpssnnnpDSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPG  244
             S+RIVAVD        + P+S +  Q D ++   +KPGWRKFLS+VGPGF+VSLAYLDPG
Sbjct  21    SNRIVAVDVEGPTPPLDLPNSTDG-QSDQEDSPEQKPGWRKFLSFVGPGFLVSLAYLDPG  79

Query  245   NLETDLQAGADHRYELLWVVLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYC  424
             NLETDLQAGA+H YELLW++LIGL+FALIIQSLAANLGVST                   
Sbjct  80    NLETDLQAGANHGYELLWIILIGLIFALIIQSLAANLGVST-------------------  120

Query  425   LWLLAELAVIAADIPEVIGTAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELL  604
                             VIGTAFALNILFHIP+W GVL TG ST+ LL LQRYG+RKLELL
Sbjct  121   ----------------VIGTAFALNILFHIPVWAGVLLTGFSTIALLGLQRYGIRKLELL  164

Query  605   IAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLH  784
             IA LVF+MAACFFGEM+YVKPPA +V KGMFIPKLSG  AT DAIALLGALVMPHNLFLH
Sbjct  165   IATLVFIMAACFFGEMSYVKPPATEVLKGMFIPKLSGNSATGDAIALLGALVMPHNLFLH  224

Query  785   SALVLTRKVPNSVRGVNDACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLD  964
             SALVL+RKVP SVRGVNDACR+FLIESGFALFVAFLINVAVVSVSGTVCS   LS ++  
Sbjct  225   SALVLSRKVPRSVRGVNDACRFFLIESGFALFVAFLINVAVVSVSGTVCSANNLSSENAS  284

Query  965   HCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKW  1144
              C+DL+LNSA+FLLKN+LG+SSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKW
Sbjct  285   QCNDLTLNSAAFLLKNMLGRSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKW  344

Query  1145  SRNLMTRCIAITPslivsiiggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGP  1324
              RNL+TRC+AITPSLIV+I+ GSSGA RLIIIASMILSFELPFALIPLLKFSSS+TKMGP
Sbjct  345   IRNLVTRCVAITPSLIVAILSGSSGASRLIIIASMILSFELPFALIPLLKFSSSATKMGP  404

Query  1325  YKNSIYiivvswilglgiiginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVV  1504
             +KNSIYIIV+SWILG+G+IGINIYYLST FV WLI+N++PK  NV +GI+VFPLMA+Y+V
Sbjct  405   HKNSIYIIVISWILGVGLIGINIYYLSTGFVGWLINNSVPKVANVFIGILVFPLMAVYIV  464

Query  1505  AVIYLMFRKDKVVTFIQPNDDDSK  1576
             AVIYL FRKD +VTF   +DD  K
Sbjct  465   AVIYLTFRKDTIVTF---SDDPVK  485



>ref|XP_008670084.1| PREDICTED: metal transporter Nramp1-like isoform X1 [Zea mays]
Length=535

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/498 (70%), Positives = 408/498 (82%), Gaps = 23/498 (5%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             K P W++FL +VGPGFMV LAYLDPGNL TDLQAGADHRYELLWV LIGL+FALIIQSL+
Sbjct  30    KGPAWKRFLYHVGPGFMVCLAYLDPGNLGTDLQAGADHRYELLWVTLIGLIFALIIQSLS  89

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGV TG+HL+ELCK EYP +V+ CLWLLAELAVIAADIPEVIGTAFA NILFH+PLWV
Sbjct  90    ANLGVVTGRHLAELCKTEYPAWVRICLWLLAELAVIAADIPEVIGTAFAFNILFHVPLWV  149

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL TG STLLLL LQ+YGVRKLELL+ +LVF+MAACFF EM+ VKPPAE+V  G+FIP 
Sbjct  150   GVLITGSSTLLLLGLQKYGVRKLELLVGLLVFVMAACFFIEMSIVKPPAEEVIHGLFIPS  209

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             LSG GAT D IALLGALVMPHNLFLHSALVL+R  P+SVRG+NDACR+FL+ESG A+FVA
Sbjct  210   LSGPGATGDTIALLGALVMPHNLFLHSALVLSRNTPSSVRGINDACRFFLLESGVAMFVA  269

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
              +IN+ ++SVSGTVC++  +S DD   CSD++L+S+SFLL+NVLG SS+ VY +ALLA G
Sbjct  270   LIINICIISVSGTVCNSSNVSPDDSAKCSDITLDSSSFLLRNVLGNSSAVVYGVALLACG  329

Query  1067  QSSTITGTYAGQYIM----------------QGFLDLKMKKWSRNLMTRCIAITPslivs  1198
              SS+ITGTYAGQYIM                QGFLD+KM++W RNLMTR IAI PSLIV+
Sbjct  330   ISSSITGTYAGQYIMQIVILEARFACVWLLAQGFLDIKMRQWLRNLMTRSIAIIPSLIVA  389

Query  1199  iiggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgi  1378
             IIGGSSGAGRL+IIASMILSFELPFALIPLLKFSSSS+ MG +KNSI+II  SWILG  I
Sbjct  390   IIGGSSGAGRLVIIASMILSFELPFALIPLLKFSSSSSTMGQHKNSIFIIGFSWILGFVI  449

Query  1379  iginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQP  1558
             IGINIY+LS+ FV W++HN+L    N+L+GIVVFPLM IYV AVIYL  RK+  + F+  
Sbjct  450   IGINIYFLSSKFVGWILHNSLQIYANILIGIVVFPLMLIYVCAVIYLTLRKET-IKFVAC  508

Query  1559  ND------DDSKMDNNVN  1594
              +      D SK+ N  N
Sbjct  509   GELQTIETDKSKLANGSN  526



>gb|AER41570.1| metal+transporter+Nramp6 [Oryza brachyantha]
Length=545

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/485 (71%), Positives = 396/485 (82%), Gaps = 24/485 (5%)
 Frame = +2

Query  158   EHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQ  337
             +  K+P W++FL ++GPGFMV LAY+DPGNLETDLQAGA+H+YELLWV+LIGL+FALIIQ
Sbjct  29    DRRKEPAWKRFLRHIGPGFMVCLAYIDPGNLETDLQAGANHKYELLWVILIGLIFALIIQ  88

Query  338   SLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIP  517
             SL+ANLGV TG+HL+ELCK EYP +VK CLWLLAELAVIA+DIPEVIGT FA N+LFHIP
Sbjct  89    SLSANLGVVTGRHLAELCKTEYPVWVKTCLWLLAELAVIASDIPEVIGTGFAFNLLFHIP  148

Query  518   LWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMF  697
             +W GVL  G STLLLL LQRYGVR LE+++A+LVF MAACFF EM+ VKPP ++V  G+F
Sbjct  149   VWSGVLIAGSSTLLLLGLQRYGVRNLEVVVALLVFTMAACFFVEMSIVKPPVKEVLHGLF  208

Query  698   IPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFAL  877
             IP LSG GAT D+IALLGALVMPHNLFLHSALVL+R  P S +G+ DACR+FL ESG AL
Sbjct  209   IPGLSGPGATGDSIALLGALVMPHNLFLHSALVLSRNTPASAKGMKDACRFFLFESGIAL  268

Query  878   FVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLK----------------  1009
             FVA L+N+AV+SVSGTVC+   LS DD   C DL+L+S+SFLL+                
Sbjct  269   FVALLVNIAVISVSGTVCNATNLSPDDAAKCGDLTLDSSSFLLRVLHIYAKFITISTIDS  328

Query  1010  --------NVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTR  1165
                     NVLGKSS+TVY IALLASGQSSTITGTYAGQY+MQGFLD+KMK+W RNLMTR
Sbjct  329   PVTDLWSLNVLGKSSATVYGIALLASGQSSTITGTYAGQYVMQGFLDIKMKQWLRNLMTR  388

Query  1166  CIAITPslivsiiggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYi  1345
              IAI PSLIVSIIGGSSGAGRLIIIASMILSFELPFALIPLLKFSSSS KMG  KNSIYI
Sbjct  389   SIAIVPSLIVSIIGGSSGAGRLIIIASMILSFELPFALIPLLKFSSSSNKMGENKNSIYI  448

Query  1346  ivvswilglgiiginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMF  1525
             +  SW+LG  IIGINIY+LST  V W++HN LP   NVL+GIV+FPLM +YV AVIYL  
Sbjct  449   VGFSWVLGFIIIGINIYFLSTKLVGWILHNALPTYANVLIGIVLFPLMLLYVAAVIYLTL  508

Query  1526  RKDKV  1540
             RKD V
Sbjct  509   RKDTV  513



>emb|CAN60104.1| hypothetical protein VITISV_017979 [Vitis vinifera]
Length=1091

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/522 (68%), Positives = 393/522 (75%), Gaps = 71/522 (14%)
 Frame = +2

Query  140   QLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLV  319
              LDL ++   KPGWRKFL++VGPGF+VSLAYLDPGNLETDLQAGA+H +ELLWVVLIGL+
Sbjct  33    HLDLDDQ---KPGWRKFLAFVGPGFLVSLAYLDPGNLETDLQAGANHGFELLWVVLIGLI  89

Query  320   FALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAF---  490
             FALIIQSLAANLGVSTGKHLSELCKAEYP  VKYCLWLLAE+AVIAADIPE  GT     
Sbjct  90    FALIIQSLAANLGVSTGKHLSELCKAEYPIIVKYCLWLLAEIAVIAADIPE--GTKLQMI  147

Query  491   --------------------ALNILFHIPL-WvgvlctglstllllslQRYG-------V  586
                                 +L+ L H P  W   +       +  ++  YG       V
Sbjct  148   HDRDSLCTEYTFQGPRVGWGSLHWLQHSPASWPAKIWGZQRQNIXDNMISYGGTSNTAHV  207

Query  587   RKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMP  766
             RKLELLIAVLVF+MA CFFGEM+YVKPPA  V KGMFIPKL GQGAT DAIALLGALVMP
Sbjct  208   RKLELLIAVLVFIMAGCFFGEMSYVKPPATGVLKGMFIPKLKGQGATGDAIALLGALVMP  267

Query  767   HNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKL  946
             HNLFLHSALVL+RKVPNSVRG+N+ACRYFLIESG ALFVAFLINVAVVSVSGTVCS   L
Sbjct  268   HNLFLHSALVLSRKVPNSVRGINEACRYFLIESGLALFVAFLINVAVVSVSGTVCSADNL  327

Query  947   SKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLD  1126
             S+++LD C+DL+LNSASFLLKNVLG SS  VYAIAL ASGQSSTITGTYAGQ+IMQGFLD
Sbjct  328   SQENLDQCNDLNLNSASFLLKNVLGGSSKVVYAIALFASGQSSTITGTYAGQFIMQGFLD  387

Query  1127  LKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasMILSFELPFALIPLLKFSSS  1306
             +KM+KW RNLMTR IAITPSLIVSIIGGS+GAGRLIIIASMILSFELPFALIPLLKFSSS
Sbjct  388   IKMRKWLRNLMTRSIAITPSLIVSIIGGSAGAGRLIIIASMILSFELPFALIPLLKFSSS  447

Query  1307  STKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPL  1486
             +TKMGP+KNSIY                                    GNV +GI+VFPL
Sbjct  448   NTKMGPHKNSIY-----------------------------------VGNVFIGIIVFPL  472

Query  1487  MAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMDNNVNNNVCMT  1612
             MAIY++ VIYL  RKD VVTFI+P  +D  + N++ N    T
Sbjct  473   MAIYILXVIYLTTRKDTVVTFIEPEKNDPNVQNHMENGFDQT  514


 Score =   197 bits (500),  Expect(3) = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +2

Query  680   VFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLI  859
             V KGMFIPKL GQ AT DAIA+LGALVMPHNLFLHSALVL+RK+PNSVRG+N+ACRYFLI
Sbjct  606   VIKGMFIPKLKGQCATGDAIAILGALVMPHNLFLHSALVLSRKMPNSVRGINEACRYFLI  665

Query  860   ESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTV  1039
             ES   LFVAFLINVAVVS+SGTVCS   LSK++LD C++L+LNSASFLLKNVLG SS  V
Sbjct  666   ESRLTLFVAFLINVAVVSMSGTVCSADNLSKENLDRCNNLNLNSASFLLKNVLGGSSKVV  725

Query  1040  YAIAL  1054
              AIAL
Sbjct  726   XAIAL  730


 Score = 43.5 bits (101),  Expect(3) = 2e-60, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 18/20 (90%), Gaps = 0/20 (0%)
 Frame = +1

Query  1060  LRPKLHHHRYICWTVYHAGI  1119
             LRPK HHHR++CWT+YHA I
Sbjct  732   LRPKFHHHRHLCWTIYHAVI  751


 Score = 42.7 bits (99),  Expect(3) = 2e-60, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +1

Query  472  SDWDGLCT*YIVPHPTVGWSFVYRLEHPLTTQPPEIWGKEA*TVDSSASVSngclllwgn  651
            +D D LCT Y      +GW  ++ L+H   + P +IWG+E   VDSSA + NG L  W N
Sbjct  536  NDRDSLCTEYTFQGXRMGWGSLHWLQHSPASWPAKIWGEEVRNVDSSAGIHNGWLFPWRN  595

Query  652  glcEASCRRCIQRNV  696
             LCEAS  RC+ + +
Sbjct  596  ELCEASSLRCVIKGM  610



>gb|AER41588.1| metal+transporter+Nramp6 [Oryza glaberrima]
Length=506

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/463 (70%), Positives = 382/463 (83%), Gaps = 34/463 (7%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             K+P W++FL++VGPGFMVSLAYLDPGNLETDLQAGA+HRYELLWV+LIGL+FALIIQSLA
Sbjct  37    KEPAWKRFLAHVGPGFMVSLAYLDPGNLETDLQAGANHRYELLWVILIGLIFALIIQSLA  96

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGV TG+HL+E+CK+EYPK+VK  LWLLAELAVIAADIPEVIGTAFA NILFHIP+WV
Sbjct  97    ANLGVVTGRHLAEICKSEYPKFVKIFLWLLAELAVIAADIPEVIGTAFAFNILFHIPVWV  156

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL TG STLLLL LQ+YGVRKLE LI++LVF+MAACFFGE++ VKPPA++V KG+FIP+
Sbjct  157   GVLITGTSTLLLLGLQKYGVRKLEFLISMLVFVMAACFFGELSIVKPPAKEVMKGLFIPR  216

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             L+G GATADAIALLGALVMPHNLFLHSALVL+RK P SVRG+ D CR+FL ESGFALFVA
Sbjct  217   LNGDGATADAIALLGALVMPHNLFLHSALVLSRKTPASVRGIKDGCRFFLYESGFALFVA  276

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
              LIN+AVVSVSGT CS+G LS++D D C++LSL+++SFLLKNVLGKSS+ VY +ALLASG
Sbjct  277   LLINIAVVSVSGTACSSGNLSQEDADKCANLSLDTSSFLLKNVLGKSSAIVYGVALLASG  336

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiias  1246
             QSSTITGTYAGQYIMQGFLD++M+KW RNLMTR IAI PSLIVSIIGGS GAGRLIIIAS
Sbjct  337   QSSTITGTYAGQYIMQGFLDIRMRKWLRNLMTRTIAIAPSLIVSIIGGSRGAGRLIIIAS  396

Query  1247  MIL-SFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDW  1423
             +I+ S+ L   +I +  +  S++ +G                                 W
Sbjct  397   IIVFSWFLGLLIIGINMYFLSTSFVG---------------------------------W  423

Query  1424  LIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFI  1552
             LIHN+LPK  NVLVG  VFP M +Y+VAV+YL  RKD VVTF+
Sbjct  424   LIHNDLPKYANVLVGAAVFPFMLVYIVAVVYLTIRKDSVVTFV  466



>gb|AER41569.1| metal+transporter+Nramp6 [Oryza brachyantha]
Length=516

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/485 (67%), Positives = 387/485 (80%), Gaps = 42/485 (9%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             K+P W++FL++VGPGFMVSLAYLDPGNLETDLQAGA+HRYELLWV+LIGL+FALIIQSLA
Sbjct  37    KEPAWKRFLAHVGPGFMVSLAYLDPGNLETDLQAGANHRYELLWVILIGLIFALIIQSLA  96

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGV TG+HL+E+CK+EYPK+VK  LWLLAELAVIAADIPEVIGTAFA NILFHIP+WV
Sbjct  97    ANLGVVTGRHLAEICKSEYPKFVKIFLWLLAELAVIAADIPEVIGTAFAFNILFHIPVWV  156

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL TG STLLLL LQ+YGVRKLE LI++LVF+MAACFFGE++ VKPPA++V KG+F+P+
Sbjct  157   GVLITGSSTLLLLGLQKYGVRKLEFLISMLVFVMAACFFGELSIVKPPAKEVMKGLFVPR  216

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             L+G GAT DAIALLGALVMPHNLFLHSALVL+RK P SVRG+ D CR+FL ESGFALFVA
Sbjct  217   LTGAGATGDAIALLGALVMPHNLFLHSALVLSRKTPASVRGIKDGCRFFLYESGFALFVA  276

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
              LIN+AVVSVSGT C +  +S++D   C+DLSL+++SFLL+NVLGKSS+ VY +ALLASG
Sbjct  277   LLINIAVVSVSGTACYSPTISQEDAGKCADLSLDTSSFLLRNVLGKSSAIVYGVALLASG  336

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiias  1246
             QSSTITGTYAGQYIMQGFLD++M+KW RNLMTR IAI PSLIVSIIGGS GAGRLIIIAS
Sbjct  337   QSSTITGTYAGQYIMQGFLDIRMRKWLRNLMTRTIAIAPSLIVSIIGGSKGAGRLIIIAS  396

Query  1247  MIL-SFELPFALIPL-LKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVD  1420
             +I+ S+ L   +I + + F S+S                                  FV 
Sbjct  397   IIVFSWVLGLLIIGINMYFLSTS----------------------------------FVG  422

Query  1421  WLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFI------QPNDDDSKMD  1582
             WLIHN LPK  NVLVG  VFP M +Y+VAV+YL  RKD VVTF+       P D D++  
Sbjct  423   WLIHNGLPKYANVLVGAAVFPFMLVYIVAVVYLTIRKDSVVTFVADSSLAAPLDVDAEKA  482

Query  1583  NNVNN  1597
              ++++
Sbjct  483   TSISD  487



>ref|XP_010063941.1| PREDICTED: metal transporter Nramp5-like isoform X2 [Eucalyptus 
grandis]
Length=452

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/427 (80%), Positives = 380/427 (89%), Gaps = 3/427 (1%)
 Frame = +2

Query  314   LVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFA  493
             ++FALIIQSLAANLGV+TGKHL+ELCK EYP  VKYCLWLLAE+AVIAADIPEVIGTAFA
Sbjct  1     MIFALIIQSLAANLGVTTGKHLAELCKVEYPPLVKYCLWLLAEVAVIAADIPEVIGTAFA  60

Query  494   LNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPA  673
             L ILFHIPLW GVL TG STL+L+SLQRYG+RKLELLIA+LV  +AACFF EM YVKPP 
Sbjct  61    LKILFHIPLWAGVLLTGCSTLVLISLQRYGIRKLELLIAILVLALAACFFAEMGYVKPPT  120

Query  674   EDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYF  853
               V KGMFIPKLSG  AT DAIALLGALVMPHNLFLHSALVL+RKV  SVRG+NDACRYF
Sbjct  121   SKVLKGMFIPKLSGNSATGDAIALLGALVMPHNLFLHSALVLSRKVQRSVRGINDACRYF  180

Query  854   LIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSS  1033
             LIESGFALFVAFLINV++VSVSGTVCS+  LSKD+   C +L+L+SA+FLLKNVLG+SSS
Sbjct  181   LIESGFALFVAFLINVSIVSVSGTVCSSDNLSKDNASRCGNLALDSAAFLLKNVLGRSSS  240

Query  1034  TVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggs  1213
             TVYAIALLASGQSSTITGTYAGQ+IMQGFL+LKMK+W RNL+TRCIAI PSLIVSI+GGS
Sbjct  241   TVYAIALLASGQSSTITGTYAGQFIMQGFLELKMKQWKRNLLTRCIAIAPSLIVSIVGGS  300

Query  1214  sgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiigini  1393
             SGAGRLIIIASMILSFELPFALIPLLKFSSS+TKMGP+KNSI+IIV+SW+LG G+I INI
Sbjct  301   SGAGRLIIIASMILSFELPFALIPLLKFSSSATKMGPHKNSIFIIVISWLLGAGLISINI  360

Query  1394  yylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDS  1573
             YYLST FVDWLIHN+LPK  N+ +GI+VFPLMAIY++AVIYL FRKD  VTF    DD  
Sbjct  361   YYLSTGFVDWLIHNSLPKIANIFIGILVFPLMAIYIIAVIYLTFRKDSFVTF---TDDPV  417

Query  1574  KMDNNVN  1594
             K   +V 
Sbjct  418   KHATSVT  424



>gb|KEH35320.1| NRAMP metal ion transporter 6 [Medicago truncatula]
Length=393

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/344 (81%), Positives = 315/344 (92%), Gaps = 0/344 (0%)
 Frame = +2

Query  152   QEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALI  331
               E  +K GWRKFL Y+GPGF+VSLAYLDPGN+ETDLQAGA+H YELLW+VLIGL+FALI
Sbjct  25    NHEETQKSGWRKFLPYIGPGFLVSLAYLDPGNMETDLQAGANHGYELLWLVLIGLIFALI  84

Query  332   IQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFH  511
             IQSLAANLGV+TGKHLSE+C+ EYP +VKYCLWLLAE+AVIAADIPEVIGTAFALNILF+
Sbjct  85    IQSLAANLGVTTGKHLSEVCEVEYPLFVKYCLWLLAEVAVIAADIPEVIGTAFALNILFN  144

Query  512   IPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKG  691
             IPLW GVL TG STLLLLSLQR+GVRKLELLI +LVF+MA CFF EM+YV PPA  V KG
Sbjct  145   IPLWAGVLLTGFSTLLLLSLQRFGVRKLELLITILVFVMAGCFFAEMSYVNPPASGVLKG  204

Query  692   MFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGF  871
             MF+PKL+G+GA ADAIALLGAL+MPHNLFLHSALVL+RKVP SVRG+N+ACRYFL ESGF
Sbjct  205   MFVPKLAGEGAVADAIALLGALIMPHNLFLHSALVLSRKVPKSVRGINEACRYFLYESGF  264

Query  872   ALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIA  1051
             ALFVAFLINVA++SVSGTVCS   LS D+++ C+DL+LNSASFLLKNVLG+SSST+YAIA
Sbjct  265   ALFVAFLINVAMISVSGTVCSANDLSGDNVERCNDLTLNSASFLLKNVLGRSSSTIYAIA  324

Query  1052  LLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITP  1183
             LLASGQSSTITGTYAGQYIMQGFLD++MK+W RNLMTRCIAI P
Sbjct  325   LLASGQSSTITGTYAGQYIMQGFLDIRMKRWKRNLMTRCIAIAP  368



>ref|XP_004952002.1| PREDICTED: metal transporter NRAT1-like [Setaria italica]
Length=543

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/472 (64%), Positives = 383/472 (81%), Gaps = 0/472 (0%)
 Frame = +2

Query  137   LQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGL  316
             ++L+  E+   +P WRKFL++VGPG +V++ +LDP NLETD+QAGAD +YELLWVVL+G+
Sbjct  33    VELEKDEQFQGQPKWRKFLAHVGPGALVAIGFLDPSNLETDMQAGADFKYELLWVVLVGM  92

Query  317   VFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFAL  496
             +FAL+IQ+LAANLGV TG+HL+ELC+ EYP+YV  CLW++AELAVI+ DIPEV+GTAFA 
Sbjct  93    IFALLIQTLAANLGVKTGRHLAELCREEYPRYVNICLWIIAELAVISDDIPEVLGTAFAF  152

Query  497   NILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAE  676
             NIL  IP+W GV+ T  STLLLL +QR+G RKLE +IA  +F MAACFFGE++Y++P A+
Sbjct  153   NILLKIPVWAGVILTVFSTLLLLGVQRFGARKLEFIIAAFMFTMAACFFGELSYLRPSAK  212

Query  677   DVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFL  856
             +V KGMF+P L G+GA A+AIAL GA++ P+NLFLHSALVL+RK P SV+ +  ACRYFL
Sbjct  213   EVVKGMFVPSLQGKGAAANAIALFGAIITPYNLFLHSALVLSRKTPRSVKSIRAACRYFL  272

Query  857   IESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSST  1036
             IE   A  VAFLINV+VV V+GT+C+   LS  D + CSDL+L SA  LL+NVLG+SSS 
Sbjct  273   IECSLAFIVAFLINVSVVVVAGTICNADNLSPTDSNTCSDLTLQSAPMLLRNVLGRSSSV  332

Query  1037  VYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggss  1216
             VYA+ALLASGQS+TI+ T+AGQ IMQGFLD+KMK W RNL+TR IAI PSLIVSI+ G S
Sbjct  333   VYAVALLASGQSTTISCTFAGQVIMQGFLDMKMKNWVRNLITRVIAIAPSLIVSIVSGPS  392

Query  1217  gagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiy  1396
             GAG+LII +SM+LSFE+PFALIPLLKF +SS K+GP K SIY +V++WIL   +I +N Y
Sbjct  393   GAGKLIIFSSMVLSFEMPFALIPLLKFCNSSKKVGPLKESIYTVVIAWILSFALIVVNTY  452

Query  1397  ylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFI  1552
             +L   +VDWL+HN+LPK  N LV IVVF LMA Y+V V+YL FR+D V T++
Sbjct  453   FLVWTYVDWLVHNHLPKYANALVSIVVFALMAAYLVFVVYLTFRRDTVSTYV  504



>ref|XP_008799201.1| PREDICTED: metal transporter Nramp5-like [Phoenix dactylifera]
Length=536

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/420 (76%), Positives = 377/420 (90%), Gaps = 0/420 (0%)
 Frame = +2

Query  272   ADHRYELLWVVLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAV  451
             A+HRYELLWV+LIGLVFALIIQSLAANLGV+TGKHL+ELCKAEYPKYV  CLWLLAE+  
Sbjct  96    ANHRYELLWVILIGLVFALIIQSLAANLGVTTGKHLAELCKAEYPKYVNLCLWLLAEMLA  155

Query  452   IAADIPEVIGTAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMA  631
             IA DIPEVIGTAFALNIL +IP+W GVL TGLSTL+LL LQRYGVRKLE LI++L+ +MA
Sbjct  156   IATDIPEVIGTAFALNILLNIPVWTGVLITGLSTLVLLGLQRYGVRKLEFLISMLLLVMA  215

Query  632   ACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKV  811
             AC+FGEM YVKPPA +V KG+F+P+L+G GAT D IALLGAL+ PHNLFLHSALVL+RK 
Sbjct  216   ACYFGEMGYVKPPASEVLKGLFVPRLNGSGATGDLIALLGALISPHNLFLHSALVLSRKT  275

Query  812   PNSVRGVNDACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNS  991
             P S +G+N+ACRYFL+ES FA+ VA LIN+AVVSVSG VCS   LS+++ D CS+L+LNS
Sbjct  276   PPSTKGINNACRYFLLESTFAMLVALLINIAVVSVSGYVCSAENLSQENSDRCSNLTLNS  335

Query  992   ASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCI  1171
             ASFLL++VLGKSSS +YAIALLASGQSSTITGTYAGQYI+QGFLD+K + W  N+M RCI
Sbjct  336   ASFLLEDVLGKSSSVIYAIALLASGQSSTITGTYAGQYIIQGFLDIKTRPWLGNVMIRCI  395

Query  1172  AITPslivsiiggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiiv  1351
             +ITPSLIVSIIGGSSGAGRLIIIASMILSF+LPF+LIPLLKFSSS TKMGP+KNSI+II+
Sbjct  396   SITPSLIVSIIGGSSGAGRLIIIASMILSFQLPFSLIPLLKFSSSRTKMGPHKNSIFIII  455

Query  1352  vswilglgiiginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRK  1531
             +SWILG GIIGINIY+LST FV+WLIH++LPK  NV +GI+VFPLMAIY++A++YL+ RK
Sbjct  456   ISWILGCGIIGINIYFLSTQFVEWLIHSSLPKVANVFIGIIVFPLMAIYILAIMYLVLRK  515



>ref|XP_006646836.1| PREDICTED: metal transporter NRAT1-like [Oryza brachyantha]
Length=542

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/461 (64%), Positives = 375/461 (81%), Gaps = 0/461 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             +P WRKFL++VGPG +V++ +LDP N+ETD+QAGAD +YELLWV+L+G++FAL+IQ+LAA
Sbjct  45    QPKWRKFLAHVGPGALVAIGFLDPSNMETDMQAGADFKYELLWVILVGMIFALLIQTLAA  104

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TG+HL+ELC+ EYP+YV   LW++AELAVI+ DIPEV+GTAFA NIL  IP+W G
Sbjct  105   NLGVKTGRHLAELCREEYPRYVNIFLWIVAELAVISDDIPEVLGTAFAFNILLKIPVWAG  164

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             V+ T  STLLLL +QR+G RKLE +IA  +F MAACFFGE++Y++P A +V KGMF+P L
Sbjct  165   VILTVFSTLLLLGVQRFGARKLEFIIAAFMFTMAACFFGELSYLRPSAGEVVKGMFVPSL  224

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G+GA A+AIAL GA++ P+NLFLHSALVL+RK P S + +  ACRYFLIE   A  VAF
Sbjct  225   QGKGAAANAIALFGAIITPYNLFLHSALVLSRKTPRSYKSIRAACRYFLIECSLAFIVAF  284

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LINV+VV V+G++C+   LS  D + CSDL+L S   LL+NVLG+SSS VYA+ALLASGQ
Sbjct  285   LINVSVVVVAGSICNANNLSSADANTCSDLTLQSTPLLLRNVLGRSSSVVYAVALLASGQ  344

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             S+TI+ T+AGQ IMQGFLD+KMK W RNL+TR IAI PSLIVSI+ G SGAG+LII++SM
Sbjct  345   STTISCTFAGQVIMQGFLDMKMKNWVRNLITRVIAIAPSLIVSIVSGPSGAGKLIILSSM  404

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFALIPLLKF +SS K+GP K SIY +V++WIL   +I +N Y+L   +VDWL+
Sbjct  405   ILSFELPFALIPLLKFCNSSKKVGPLKESIYTVVIAWILSFALIVVNTYFLVWTYVDWLV  464

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFI  1552
             HN+LPK  N LV ++VF LMA Y+VAV+YL FRKD V T++
Sbjct  465   HNSLPKYANALVSVLVFALMAAYLVAVVYLTFRKDTVATYV  505



>ref|XP_010265996.1| PREDICTED: metal transporter Nramp5-like isoform X1 [Nelumbo 
nucifera]
Length=511

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/461 (67%), Positives = 386/461 (84%), Gaps = 0/461 (0%)
 Frame = +2

Query  164   NKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSL  343
              + P W+K L +VGPGF+VS AYLDPGNLETDLQAGADH++ELLWVVL+G+ FALIIQS 
Sbjct  8     QETPRWKKILGFVGPGFLVSAAYLDPGNLETDLQAGADHKHELLWVVLVGVSFALIIQSR  67

Query  344   AANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLW  523
             +ANLGV+TGKHLSE CKAEYP+ V YCLW+LAE+AVIAADIPEVIGTAFALNIL +IP+W
Sbjct  68    SANLGVATGKHLSEHCKAEYPRPVNYCLWVLAEIAVIAADIPEVIGTAFALNILLNIPIW  127

Query  524   vgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIP  703
              GVL  GL+TLLLL LQR+G+RKLE+ I VL+ +M  CFFG MA+ KP   ++ KGMF+P
Sbjct  128   SGVLLAGLNTLLLLGLQRFGIRKLEIAIGVLLLMMGGCFFGVMAHAKPDPREIVKGMFVP  187

Query  704   KLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFV  883
             KL G GAT DA+ALLGAL+MPHNLFLHSALV +RK+P S  G+N ACR+FLIE G AL V
Sbjct  188   KLKGDGATRDAVALLGALIMPHNLFLHSALVTSRKIPRSFNGINSACRHFLIEGGIALLV  247

Query  884   AFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLAS  1063
             AFLINV+VVSVS +VC +  LS ++  HC D++LNSA+FLLKN LGK SS +YA++LLAS
Sbjct  248   AFLINVSVVSVSSSVCYSPGLSLENKTHCEDITLNSAAFLLKNALGKWSSRLYALSLLAS  307

Query  1064  GQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiia  1243
             GQSST+TGTYAGQYIMQGFLDLKM+ W RNL+TRCIAI PSL+ SI+GGSSGAG+LIIIA
Sbjct  308   GQSSTVTGTYAGQYIMQGFLDLKMELWIRNLLTRCIAIAPSLVASIVGGSSGAGKLIIIA  367

Query  1244  sMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDW  1423
             SMILSFELPFAL+PLL+F+SS TKMG +KNS+ + ++SW+LG  +IGIN+Y+L+T+ ++W
Sbjct  368   SMILSFELPFALVPLLRFTSSKTKMGHHKNSLTVSIISWVLGFSVIGINMYFLATSVLNW  427

Query  1424  LIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVT  1546
             +  N LPK  ++  G++VFP+M +Y+  +IYL  +++   T
Sbjct  428   MSSNRLPKVASIFTGVMVFPVMFLYMGMLIYLTLKRETEQT  468



>ref|NP_001045794.1| Os02g0131800 [Oryza sativa Japonica Group]
 sp|Q6ZG85.1|NRAT1_ORYSJ RecName: Full=Metal transporter NRAT1; AltName: Full=Protein 
NRAMP ALUMINUM TRANSPORTER 1 [Oryza sativa Japonica Group]
 dbj|BAD07752.1| putative root-specific metal transporter [Oryza sativa Japonica 
Group]
 dbj|BAF07708.1| Os02g0131800 [Oryza sativa Japonica Group]
 gb|EEE56244.1| hypothetical protein OsJ_05257 [Oryza sativa Japonica Group]
 dbj|BAJ22943.1| Nramp aluminum transporter 1 [Oryza sativa Japonica Group]
Length=545

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/461 (64%), Positives = 373/461 (81%), Gaps = 0/461 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             +P WRKFL++VGPG +V++ +LDP NLETD+QAGAD +YELLWV+L+G+VFAL+IQ+LAA
Sbjct  45    QPRWRKFLAHVGPGALVAIGFLDPSNLETDMQAGADFKYELLWVILVGMVFALLIQTLAA  104

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TG+HL+ELC+ EYP YV   LW++AELAVI+ DIPEV+GTAFA NIL  IP+W G
Sbjct  105   NLGVKTGRHLAELCREEYPHYVNIFLWIIAELAVISDDIPEVLGTAFAFNILLKIPVWAG  164

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             V+ T  STLLLL +QR+G RKLE +IA  +F MAACFFGE++Y++P A +V KGMF+P L
Sbjct  165   VILTVFSTLLLLGVQRFGARKLEFIIAAFMFTMAACFFGELSYLRPSAGEVVKGMFVPSL  224

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G+GA A+AIAL GA++ P+NLFLHSALVL+RK P S + +  ACRYFLIE   A  VAF
Sbjct  225   QGKGAAANAIALFGAIITPYNLFLHSALVLSRKTPRSDKSIRAACRYFLIECSLAFIVAF  284

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LINV+VV V+G++C+   LS  D + C DL+L S   LL+NVLG+SSS VYA+ALLASGQ
Sbjct  285   LINVSVVVVAGSICNANNLSPADANTCGDLTLQSTPLLLRNVLGRSSSVVYAVALLASGQ  344

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             S+TI+ T+AGQ IMQGFLD+KMK W RNL+TR IAI PSLIVSI+ G SGAG+LII++SM
Sbjct  345   STTISCTFAGQVIMQGFLDMKMKNWVRNLITRVIAIAPSLIVSIVSGPSGAGKLIILSSM  404

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFALIPLLKF +SS K+GP K SIY +V++WIL   +I +N Y+L   +VDWL+
Sbjct  405   ILSFELPFALIPLLKFCNSSKKVGPLKESIYTVVIAWILSFALIVVNTYFLVWTYVDWLV  464

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFI  1552
             HNNLPK  N L+ +VVF LMA Y+VAV+YL FRKD V T++
Sbjct  465   HNNLPKYANGLISVVVFALMAAYLVAVVYLTFRKDTVATYV  505



>tpg|DAA39781.1| TPA: hypothetical protein ZEAMMB73_104976 [Zea mays]
Length=536

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/482 (68%), Positives = 386/482 (80%), Gaps = 31/482 (6%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             K P W++FL +VGPGFM                        LLWV LIGL+FALIIQSL+
Sbjct  71    KGPAWKRFLYHVGPGFM------------------------LLWVTLIGLIFALIIQSLS  106

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGV TG+HL+ELCK EYP +V+ CLWLLAELAVIAADIPEVIGTAFA NILFH+PLWV
Sbjct  107   ANLGVVTGRHLAELCKTEYPAWVRICLWLLAELAVIAADIPEVIGTAFAFNILFHVPLWV  166

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL TG STLLLL LQ+YGVRKLELL+ +LVF+MAACFF EM+ VKPPAE+V  G+FIP 
Sbjct  167   GVLITGSSTLLLLGLQKYGVRKLELLVGLLVFVMAACFFIEMSIVKPPAEEVIHGLFIPS  226

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             LSG GAT D IALLGALVMPHNLFLHSALVL+R  P+SVRG+NDACR+FL+ESG A+FVA
Sbjct  227   LSGPGATGDTIALLGALVMPHNLFLHSALVLSRNTPSSVRGINDACRFFLLESGVAMFVA  286

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
              +IN+ ++SVSGTVC++  +S DD   CSD++L+S+SFLL+NVLG SS+ VY +ALLA G
Sbjct  287   LIINICIISVSGTVCNSSNVSPDDSAKCSDITLDSSSFLLRNVLGNSSAVVYGVALLACG  346

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiias  1246
              SS+ITGTYAGQYIMQGFLD+KM++W RNLMTR IAI PSLIV+IIGGSSGAGRL+IIAS
Sbjct  347   ISSSITGTYAGQYIMQGFLDIKMRQWLRNLMTRSIAIIPSLIVAIIGGSSGAGRLVIIAS  406

Query  1247  MILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWL  1426
             MILSFELPFALIPLLKFSSSS+ MG +KNSI+II  SWILG  IIGINIY+LS+ FV W+
Sbjct  407   MILSFELPFALIPLLKFSSSSSTMGQHKNSIFIIGFSWILGFVIIGINIYFLSSKFVGWI  466

Query  1427  IHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPND------DDSKMDNN  1588
             +HN+L    N+L+GIVVFPLM IYV AVIYL  RK+  + F+   +      D SK+ N 
Sbjct  467   LHNSLQIYANILIGIVVFPLMLIYVCAVIYLTLRKET-IKFVACGELQTIETDKSKLANG  525

Query  1589  VN  1594
              N
Sbjct  526   SN  527



>gb|EMS57810.1| Metal transporter Nramp5 [Triticum urartu]
Length=527

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/501 (68%), Positives = 391/501 (78%), Gaps = 60/501 (12%)
 Frame = +2

Query  146   DLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGN----------------------LETD  259
             D  E   K+P W++FLS+VGPGFMVSLAYLDPGN                      +ETD
Sbjct  32    DGDETLVKEPAWKRFLSHVGPGFMVSLAYLDPGNSLAFIIVHTSGHGSHGDGTVDAVETD  91

Query  260   LQAGADHRYELLWVVLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLA  439
             LQAGA+HRYELLWV+LIGL+FALIIQSLAANLGV T                        
Sbjct  92    LQAGANHRYELLWVILIGLIFALIIQSLAANLGVVT------------------------  127

Query  440   ELAVIAADIPEVIGTAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLV  619
                        VIGTAFA  +LF IP+W+GVL TG STLLLL LQRYGVRKLE LI++LV
Sbjct  128   -----------VIGTAFAFYLLFRIPVWIGVLITGSSTLLLLGLQRYGVRKLEFLISMLV  176

Query  620   FLMAACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVL  799
             F+MAACFFGE++ VKPPA++V KG+FIPKL G GAT DAIALLGALVMPHNLFLHSALVL
Sbjct  177   FVMAACFFGELSIVKPPAKEVLKGLFIPKLKGNGATGDAIALLGALVMPHNLFLHSALVL  236

Query  800   TRKVPNSVRGVNDACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDL  979
             +RK P+SVRG+ DACR+FL ESGFALFVA LIN+AV+SVSGTVC    LS +D+D CSDL
Sbjct  237   SRKTPSSVRGIKDACRFFLYESGFALFVALLINIAVISVSGTVCFGENLSAEDIDKCSDL  296

Query  980   SLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLM  1159
             SL+++SFLLKNVLG+SSS VY +ALLASGQSSTITGTYAGQYIMQGFLD+KMK W RNLM
Sbjct  297   SLDNSSFLLKNVLGRSSSIVYGVALLASGQSSTITGTYAGQYIMQGFLDIKMKTWLRNLM  356

Query  1160  TRCIAITPslivsiiggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSI  1339
             TRCIAI PSL+VSIIGGS+GAGRLIIIASMILSFELPFALIPLLKFSSSS+KMGP+KNSI
Sbjct  357   TRCIAIAPSLVVSIIGGSNGAGRLIIIASMILSFELPFALIPLLKFSSSSSKMGPHKNSI  416

Query  1340  YiivvswilglgiiginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYL  1519
             YIIV SW LGL +IGIN+Y+LST+F+ WLI+++LP    VLVG+VV PLM +Y+VAV+YL
Sbjct  417   YIIVFSWTLGLMLIGINVYFLSTSFMGWLINSSLPTYAKVLVGVVVCPLMLVYLVAVVYL  476

Query  1520  MFRKDKVVTFIQPNDDDSKMD  1582
              FRKD VVTF+    D  K D
Sbjct  477   TFRKDTVVTFVA---DSCKAD  494



>ref|XP_002966631.1| hypothetical protein SELMODRAFT_85390, partial [Selaginella moellendorffii]
 gb|EFJ32658.1| hypothetical protein SELMODRAFT_85390, partial [Selaginella moellendorffii]
Length=507

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/492 (60%), Positives = 390/492 (79%), Gaps = 10/492 (2%)
 Frame = +2

Query  164   NKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSL  343
             ++K GWRK L+++GPGF+V +AY+DPGN E+DLQ+GA+++YELLW++L+  V ALIIQSL
Sbjct  3     DQKEGWRKLLAFLGPGFLVCIAYIDPGNFESDLQSGAEYQYELLWIILVASVSALIIQSL  62

Query  344   AANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLW  523
             AANLGV TGKHL+E C+ EYPK V   LW+LAE+AVI+ADIPEVIGTAFALNILF +P+W
Sbjct  63    AANLGVVTGKHLAEHCRTEYPKVVSILLWILAEVAVISADIPEVIGTAFALNILFSVPIW  122

Query  524   vgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIP  703
             +GVL TGLSTLLLL+LQ+YGVRKLEL+IA LV +M  CFF E+ Y KP A  V KG+F+P
Sbjct  123   IGVLLTGLSTLLLLALQQYGVRKLELIIAALVMIMTGCFFAELGYAKPNAALVLKGLFVP  182

Query  704   KLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFV  883
             +L G GAT  AI+LLGA++MPHNLFLHSALVLTR++P S +G+   C+Y++ ESGFALF 
Sbjct  183   QLKGDGATGLAISLLGAMIMPHNLFLHSALVLTRRIPRSDKGIKQGCKYYMFESGFALFF  242

Query  884   AFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLAS  1063
             AFLINV V++VSG+VCS   LS ++  +C+DL LN ASFLL+NVLG+ S  ++ +ALLAS
Sbjct  243   AFLINVCVIAVSGSVCSQPDLSAENRANCNDLDLNRASFLLQNVLGRWSKILFGVALLAS  302

Query  1064  GQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiia  1243
             GQSSTITGTYAGQY+MQGFL+L+ K W RNL+TR +AI PSLIV++IGGSS AG+LIII 
Sbjct  303   GQSSTITGTYAGQYVMQGFLNLRFKPWIRNLLTRAVAIVPSLIVALIGGSSAAGQLIIIV  362

Query  1244  sMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDW  1423
             SM+LSF LPF LIPLLKF+SS  KMGPY NS  ++  +W++G  ++ IN+YYL++ FV W
Sbjct  363   SMVLSFVLPFVLIPLLKFTSSKVKMGPYANSWPVMCTTWLIGGAVMSINVYYLTSLFVKW  422

Query  1424  LIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMDNNVNNNV  1603
             L+ ++L     V++GI+VF ++ +Y++AV YL FR D+ +T++  +D+ S MD       
Sbjct  423   LLKSSLAMVAQVMIGILVFGMILVYLIAVGYLAFRVDREITYLIVSDEPSNMD-------  475

Query  1604  CMTPIDHNDFSH  1639
                PI+  +  H
Sbjct  476   ---PINLEELGH  484



>ref|XP_002973463.1| hypothetical protein SELMODRAFT_173368 [Selaginella moellendorffii]
 gb|EFJ25837.1| hypothetical protein SELMODRAFT_173368 [Selaginella moellendorffii]
Length=522

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/479 (61%), Positives = 389/479 (81%), Gaps = 0/479 (0%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             ++ GWRK  +YVGPG++V +AY+DP N E+DLQ+GA+ +YELLWV+LI  + ALIIQSLA
Sbjct  29    ERKGWRKLAAYVGPGYLVCIAYIDPANFESDLQSGANFKYELLWVLLIASISALIIQSLA  88

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGV T KHL+E C+ EY + + + LW+LAE+ +IA+DIPEVIGTAFALNILF +P+W+
Sbjct  89    ANLGVVTRKHLAEHCRIEYARPLNFVLWILAEVCIIASDIPEVIGTAFALNILFRLPVWI  148

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL TG STL+LL++Q+YGVRKLEL++A+ VF+MA CFF E+ Y KP A +V KG+F+P+
Sbjct  149   GVLLTGFSTLILLAIQQYGVRKLELVVALFVFIMAGCFFVELGYAKPDAGEVLKGLFVPR  208

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             L+G GAT  AI+LLGA+VMPHNLFLHSA+VLTRK+P S  G+ D CRY+++ESGFALF+A
Sbjct  209   LNGHGATGIAISLLGAMVMPHNLFLHSAIVLTRKIPYSTNGIKDGCRYYIMESGFALFLA  268

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
             FLIN+AV+ VS +VC+N  LS    D C DL LN ASFLL+NVLG+ SS V+ +ALLASG
Sbjct  269   FLINIAVICVSASVCNNRHLSSVYKDDCGDLDLNRASFLLRNVLGQWSSVVFGVALLASG  328

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiias  1246
             QSSTITGT+AGQY+MQGFLDL++K W RNL+TR +AI PSL V++I GS GAG+LII++S
Sbjct  329   QSSTITGTFAGQYVMQGFLDLRLKPWIRNLLTRLVAIIPSLAVALISGSRGAGKLIIVSS  388

Query  1247  MILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWL  1426
             MIL+F+LPFAL+PLLKF+SSS KMGP+ NS+++ V++W++G+G+I IN+Y+L T+FV WL
Sbjct  389   MILAFQLPFALVPLLKFTSSSMKMGPHMNSLWLTVLTWLIGMGVITINMYFLITSFVKWL  448

Query  1427  IHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMDNNVNNNV  1603
             IH +L KAG V++G++VF  +  Y+V + YL FR +   T+I P ++  K     +N +
Sbjct  449   IHGHLAKAGRVVIGVLVFKAILAYLVTLCYLAFRTETKPTYIVPPNEGGKSPQPDSNGM  507



>ref|XP_002438846.1| hypothetical protein SORBIDRAFT_10g027130 [Sorghum bicolor]
 gb|EER90213.1| hypothetical protein SORBIDRAFT_10g027130 [Sorghum bicolor]
Length=550

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/479 (64%), Positives = 385/479 (80%), Gaps = 6/479 (1%)
 Frame = +2

Query  122   DSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWV  301
             +SI+  Q+ + E+++    W+   SY+GPGF+VS+AY+DPGN ETDLQAGA ++YELLW+
Sbjct  32    ESIDVDQIVIPEKNS----WKNLFSYIGPGFLVSIAYIDPGNFETDLQAGAQYKYELLWI  87

Query  302   VLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIG  481
             +L+    ALIIQSLAA LGV TGKHL+E C+AEYPK   + LW+LAELAV+A DIPEVIG
Sbjct  88    ILVASCAALIIQSLAARLGVVTGKHLAEHCRAEYPKVTNFVLWILAELAVVACDIPEVIG  147

Query  482   TAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYV  661
             TAFALN+LF IP+W GVL TGLSTL+LL LQ+YGVRKLE LIA LVFL+A CF  E+ Y 
Sbjct  148   TAFALNMLFRIPVWCGVLITGLSTLMLLLLQQYGVRKLEFLIAFLVFLIATCFLVELGYS  207

Query  662   KPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDA  841
             KP A +V +G+F+P+L G GAT  AI+LLGA+VMPHNLFLHSALVL+RKVP SV G+ +A
Sbjct  208   KPNASEVVRGLFVPELKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKVPRSVHGIKEA  267

Query  842   CRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLG  1021
             CR++ IES FAL +AFLIN++++SVSG VC +G L+ +D  +CSDL LN ASFLLKNVLG
Sbjct  268   CRFYTIESAFALTIAFLINISIISVSGVVCGSGNLNPEDQVNCSDLDLNKASFLLKNVLG  327

Query  1022  KSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsi  1201
               SS ++A+ALLASGQSSTITGTYAGQY+MQGFLDL+MK W RNL+TR +AI PSLIVSI
Sbjct  328   NWSSKLFAVALLASGQSSTITGTYAGQYVMQGFLDLRMKPWIRNLVTRSLAILPSLIVSI  387

Query  1202  iggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgii  1381
             IGGSS AG+LIIIASMILSFELPFAL+PLLKF+SS TKMG + NSI+  V++W++G  I+
Sbjct  388   IGGSSAAGQLIIIASMILSFELPFALVPLLKFTSSKTKMGQHTNSIFTSVLTWVIGSFIV  447

Query  1382  giniyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQP  1558
              IN Y+L T+FV  L+H+ L     V  GI  F  M IY+VA++YL+FR+++  T  QP
Sbjct  448   VINTYFLITSFVKLLLHSGLSTVSQVFSGIFGFLGMLIYIVAILYLVFRRNRKST--QP  504



>gb|KEH35319.1| NRAMP metal ion transporter 6 [Medicago truncatula]
Length=421

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/373 (74%), Positives = 326/373 (87%), Gaps = 8/373 (2%)
 Frame = +2

Query  65    SHRIVAVDEsplpssnnnpDSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPG  244
             ++RIVAV+          P S      D   + ++KPGW+KFL+YVGPGF+VSLAYLDPG
Sbjct  11    NNRIVAVN--------VTPSSTPSYNHDDSSKQDQKPGWKKFLAYVGPGFLVSLAYLDPG  62

Query  245   NLETDLQAGADHRYELLWVVLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYC  424
             N+ETDLQAGA+H YELLW++LIGL+FA IIQSLAANLGV TGKHLSE+CKAEYP +VKYC
Sbjct  63    NMETDLQAGANHGYELLWIILIGLIFACIIQSLAANLGVCTGKHLSEICKAEYPWFVKYC  122

Query  425   LWLLAELAVIAADIPEVIGTAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELL  604
             LW+LAELAVIAADIPEVIGTAFALNILFH+P+W GVL TG STLL L LQR+GVRKLELL
Sbjct  123   LWILAELAVIAADIPEVIGTAFALNILFHVPVWGGVLLTGCSTLLFLGLQRFGVRKLELL  182

Query  605   IAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLH  784
             I++LVF+MAACFFGE++YVKPPA+ V +GMF+PKL+G GA  DAIALLGAL+MPHNLFLH
Sbjct  183   ISILVFVMAACFFGELSYVKPPAKGVIEGMFVPKLNGNGAVGDAIALLGALIMPHNLFLH  242

Query  785   SALVLTRKVPNSVRGVNDACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLD  964
             SALVL+RK+P + RG+NDACRYFLIESGFALFVAFLINVA++SV+GTVC    +S +++D
Sbjct  243   SALVLSRKIPGTKRGINDACRYFLIESGFALFVAFLINVAMISVTGTVCKADDISGENVD  302

Query  965   HCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKW  1144
              C+D++LNSASFLL+NVLG+SSST+YAIALLASGQSS ITGTYAGQ+IMQGFLDLKMKKW
Sbjct  303   RCNDITLNSASFLLQNVLGRSSSTIYAIALLASGQSSAITGTYAGQFIMQGFLDLKMKKW  362

Query  1145  SRNLMTRCIAITP  1183
              RNL+TR +AI P
Sbjct  363   IRNLVTRIVAIAP  375



>ref|XP_002978111.1| hypothetical protein SELMODRAFT_443808 [Selaginella moellendorffii]
 gb|EFJ20768.1| hypothetical protein SELMODRAFT_443808 [Selaginella moellendorffii]
Length=546

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/506 (60%), Positives = 395/506 (78%), Gaps = 14/506 (3%)
 Frame = +2

Query  122   DSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWV  301
             D   K Q+D+ E    K GWRK L+++GPGF+V +AY+DPGN E+DLQ+GA+++YELLW+
Sbjct  32    DEPMKNQVDVVE----KEGWRKLLAFLGPGFLVCIAYIDPGNFESDLQSGAEYQYELLWI  87

Query  302   VLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIG  481
             +L+  V ALIIQSLAANLGV TGKHL+E C+ EYPK V   LW+LAE+AVI+ADIPEVIG
Sbjct  88    ILVASVSALIIQSLAANLGVVTGKHLAEHCRTEYPKVVSILLWILAEVAVISADIPEVIG  147

Query  482   TAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYV  661
             TAFALNILF +P+W+GVL TGLSTLLLL+LQ+YGVRKLEL+IA LV +M  CFF E+ Y 
Sbjct  148   TAFALNILFSVPIWIGVLLTGLSTLLLLALQQYGVRKLELIIAALVMIMTGCFFAELGYA  207

Query  662   KPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDA  841
             KP A  V KG+F+P+L G GAT  AI+LLGA++MPHNLFLHSALVLTR++P S +G+   
Sbjct  208   KPNAALVLKGLFVPQLKGDGATGLAISLLGAMIMPHNLFLHSALVLTRRIPRSDKGIKQG  267

Query  842   CRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLG  1021
             C+Y++ ESGFALF AFLINV V++VSG+VCS   LS ++  +C+DL LN ASFLL+NVLG
Sbjct  268   CKYYMFESGFALFFAFLINVCVIAVSGSVCSQPDLSAENRANCNDLDLNRASFLLQNVLG  327

Query  1022  KSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsi  1201
             + S  ++ +ALLASGQSSTITGTYAGQY+MQGFL+L+ K W RNL+TR +AI PSLIV++
Sbjct  328   RWSKILFGVALLASGQSSTITGTYAGQYVMQGFLNLRFKPWIRNLLTRAVAIVPSLIVAL  387

Query  1202  iggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgii  1381
             IGGSS AG+LIII SM+LSF LPF LIPLLKF+SS  KMGPY NS  ++  +W++G  ++
Sbjct  388   IGGSSAAGQLIIIVSMVLSFVLPFVLIPLLKFTSSKVKMGPYANSWPVMCTTWLIGGAVM  447

Query  1382  giniyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPN  1561
              IN+YYL++ FV WLI ++L     V++GI+VF ++ +Y++AV YL FR D+ +T++  +
Sbjct  448   SINVYYLTSLFVKWLIKSSLAMGAQVMIGILVFGMILVYLIAVGYLAFRVDREITYLIVS  507

Query  1562  DDDSKMDNNVNNNVCMTPIDHNDFSH  1639
             D+ S MD          PI+  +  H
Sbjct  508   DEPSNMD----------PINLEELGH  523



>ref|XP_002451480.1| hypothetical protein SORBIDRAFT_04g002610 [Sorghum bicolor]
 gb|EES04456.1| hypothetical protein SORBIDRAFT_04g002610 [Sorghum bicolor]
Length=547

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/478 (60%), Positives = 376/478 (79%), Gaps = 4/478 (1%)
 Frame = +2

Query  131   NKLQLDLQEEHN--KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVV  304
             +K  +D +E+     +P WRKFL++VGPG +V++ +LDP NLETD+QAGAD +Y+LLWV+
Sbjct  31    DKTVVDSEEDEQFLVQPKWRKFLAHVGPGALVAIGFLDPSNLETDMQAGADFKYQLLWVI  90

Query  305   LIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGT  484
             L+G++FAL+IQ+LAANLGV TG HL+ELC+ EYP++V  CLW++AELAVI+ DIP+V+GT
Sbjct  91    LVGMIFALLIQTLAANLGVKTGMHLAELCREEYPRFVNICLWIIAELAVISDDIPKVLGT  150

Query  485   AFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVK  664
             AFA NIL  IP+W GV+ T  STLLLL +QR+G RKLE +IA  +F MAACFFGE++Y++
Sbjct  151   AFAFNILLKIPVWSGVILTVFSTLLLLGVQRFGARKLEFIIAAFMFTMAACFFGELSYLR  210

Query  665   PPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDAC  844
             P A +V KGMF+P L G+GA A+AIAL GA++ P+NLFLHSALVL+RK P S + V  AC
Sbjct  211   PSAREVVKGMFVPTLHGKGAAANAIALFGAIITPYNLFLHSALVLSRKTPRSAKSVRAAC  270

Query  845   RYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGK  1024
             RYFL E   A  VAFLINV VV V+ T+C+   LS DD D C DL+L S   LL+NVLG+
Sbjct  271   RYFLAECSLAFVVAFLINVTVVIVAATICNADNLSPDDADTCGDLTLQSTPLLLRNVLGR  330

Query  1025  SSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsii  1204
             SSS VYA+ALLASGQS+TI+ T+AGQ IM+GFLD++MK W RNL+TR IAI PSL+VSI+
Sbjct  331   SSSVVYAVALLASGQSTTISCTFAGQVIMEGFLDMRMKSWVRNLITRVIAIAPSLVVSIV  390

Query  1205  ggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiig  1384
              G SGAG+LI+ +SM+LSFELPFALIPLLKF +SS K+GP K SIY +V++W+L   +I 
Sbjct  391   SGPSGAGKLIVFSSMVLSFELPFALIPLLKFCNSSNKVGPLKESIYTVVIAWMLSFALIV  450

Query  1385  iniyylsTAFVDWLIHNN--LPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFI  1552
             +N Y+L   +VDWL+H++  LPK    L+ +VVF LMA Y+V V+YL FR+D V T++
Sbjct  451   VNTYFLVWTYVDWLVHSDGRLPKYATALLSVVVFALMAAYLVFVVYLTFRRDAVATYV  508



>ref|XP_002267072.1| PREDICTED: metal transporter Nramp5 [Vitis vinifera]
 emb|CBI40851.3| unnamed protein product [Vitis vinifera]
Length=510

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/458 (67%), Positives = 382/458 (83%), Gaps = 0/458 (0%)
 Frame = +2

Query  164   NKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSL  343
              + P W+K LSYVGPGF+VS+AYLDPGNLETDLQAGA+H+YELLW+VL+GL+FA IIQS 
Sbjct  7     QETPLWKKLLSYVGPGFLVSVAYLDPGNLETDLQAGANHKYELLWIVLVGLIFAFIIQSR  66

Query  344   AANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLW  523
             +ANLGV+TGKHLSE C+ EYPK V YCLW+LAE+AVIAADIPEVIGTAFA+NILFH+P+W
Sbjct  67    SANLGVATGKHLSEHCRMEYPKPVNYCLWILAEVAVIAADIPEVIGTAFAINILFHVPIW  126

Query  524   vgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIP  703
              GVL  GLSTLLLL LQRYG+RKLE+ I  LV ++  CF   M + +P A+DV  GMF+P
Sbjct  127   GGVLLAGLSTLLLLGLQRYGIRKLEVAIGGLVLVVGGCFCSVMVHARPSAKDVVTGMFVP  186

Query  704   KLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFV  883
             KL+G GAT DAIALLGAL+MPHNLFLHSALV +RK+P+S   +  A +YF+IESG ALF+
Sbjct  187   KLNGDGATRDAIALLGALIMPHNLFLHSALVTSRKIPHSFHAIRSASKYFIIESGLALFI  246

Query  884   AFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLAS  1063
             A LINVAVVSVSG+VCSN   S  + DHC D++L SASFLL N LG  SS +YA++LLAS
Sbjct  247   ALLINVAVVSVSGSVCSNPHASSQNKDHCEDITLESASFLLNNALGNWSSKLYAVSLLAS  306

Query  1064  GQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiia  1243
             GQSST+TGTYAGQYIMQGFLDLKM+ W RNL+TRCIAI PSL+V IIGGSSGA RLIIIA
Sbjct  307   GQSSTVTGTYAGQYIMQGFLDLKMRLWLRNLVTRCIAIAPSLMVCIIGGSSGAARLIIIA  366

Query  1244  sMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDW  1423
             SMILSFELPFALIPLL+F+SS  KMG +++SI + ++SW+LG G IGINIY+LS++ + W
Sbjct  367   SMILSFELPFALIPLLRFTSSKAKMGAHRSSIMVTLLSWLLGFGSIGINIYFLSSSLIGW  426

Query  1424  LIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDK  1537
             + +N++PK G++L G+V+FP+M +Y   ++YL  +++ 
Sbjct  427   MTNNDIPKTGSILAGVVIFPVMMLYAAMLVYLTTKRES  464



>ref|NP_001132120.1| uncharacterized protein LOC100193537 [Zea mays]
 ref|XP_008681154.1| PREDICTED: uncharacterized protein LOC100193537 isoform X1 [Zea 
mays]
 gb|ACF80824.1| unknown [Zea mays]
 gb|AFW69005.1| hypothetical protein ZEAMMB73_198457 [Zea mays]
Length=550

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/479 (64%), Positives = 385/479 (80%), Gaps = 6/479 (1%)
 Frame = +2

Query  122   DSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWV  301
             +SI+  Q+ + E+++    W+   SY+GPGF+VS+AY+DPGN ETDLQAGA ++YELLW+
Sbjct  32    ESIDVDQIVIPEKNS----WKNLFSYIGPGFLVSIAYIDPGNFETDLQAGAQYKYELLWI  87

Query  302   VLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIG  481
             +L+    ALIIQSLAA LGV TGKHL+E C+AEYPK   + LW+LAELAV+A DIPEVIG
Sbjct  88    ILVASCAALIIQSLAARLGVVTGKHLAEHCRAEYPKVTNFVLWILAELAVVACDIPEVIG  147

Query  482   TAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYV  661
             TAFALN+LF IP+W GVL TGLSTL+LL LQ+YGVRKLE LIA LVFL+A CF  E+ Y 
Sbjct  148   TAFALNMLFRIPVWCGVLITGLSTLMLLLLQQYGVRKLEFLIAFLVFLIATCFLVELGYS  207

Query  662   KPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDA  841
             KP A +V +G+F+P+L G GAT  AI+LLGA+VMPHNLFLHSALVL+RKVP SV G+ +A
Sbjct  208   KPNAPEVVRGLFVPELKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKVPRSVHGIKEA  267

Query  842   CRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLG  1021
             CR++ IES FAL VAFLIN++++SVSG+VC +G L+ +D  +CSDL LN ASFLLKNVLG
Sbjct  268   CRFYTIESAFALTVAFLINISIISVSGSVCGSGNLNPEDQANCSDLDLNKASFLLKNVLG  327

Query  1022  KSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsi  1201
               SS ++A+ALLASGQSSTITGTYAGQY+MQGFLDL+MK W RNL+TR +AI PSLIVSI
Sbjct  328   NWSSKLFAVALLASGQSSTITGTYAGQYVMQGFLDLRMKPWIRNLVTRSLAILPSLIVSI  387

Query  1202  iggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgii  1381
             IGGSS AG+LIIIASMILSFELPFAL+PLLKF+SS TKMG + NSI+  V++W++G  I+
Sbjct  388   IGGSSAAGQLIIIASMILSFELPFALVPLLKFTSSKTKMGQHTNSIFTAVLTWMIGSFIV  447

Query  1382  giniyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQP  1558
              IN Y+L T+FV  L+ + L     V  GI  F  M IY+VA++YL+FR+++  T  QP
Sbjct  448   VINTYFLITSFVKLLVQSGLTTISQVFSGIFGFLGMLIYIVAILYLVFRRNRKST--QP  504



>gb|EMT32916.1| Metal transporter Nramp1 [Aegilops tauschii]
Length=548

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/476 (64%), Positives = 383/476 (80%), Gaps = 4/476 (1%)
 Frame = +2

Query  122   DSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWV  301
             DSI+  Q+ + E+++    W+   SY+GPGF+VS+AY+DPGN ETDLQAGA ++YELLW+
Sbjct  33    DSIDVDQIVIPEKNS----WKNLFSYIGPGFLVSIAYIDPGNFETDLQAGAQYKYELLWI  88

Query  302   VLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIG  481
             +LI    AL+IQSLAA+LGV TGKHL+E C+AEYPK   + LW+LAELAV+A DIPEVIG
Sbjct  89    ILIASCAALVIQSLAASLGVVTGKHLAEHCRAEYPKVTNFILWILAELAVVACDIPEVIG  148

Query  482   TAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYV  661
             TAFALN+LF IP+W GVL TGLSTL+LL LQ+YGVRKLE LIA LVFL+A CF  E+ Y 
Sbjct  149   TAFALNMLFKIPIWCGVLITGLSTLMLLFLQQYGVRKLEFLIAFLVFLIATCFLVELGYS  208

Query  662   KPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDA  841
             KP + +V +G+F+P++ G GAT  AI+LLGA+VMPHNLFLHSALVL+RKVP SV G+ +A
Sbjct  209   KPNSSEVVRGLFVPEIKGDGATGLAISLLGAMVMPHNLFLHSALVLSRKVPRSVHGIKEA  268

Query  842   CRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLG  1021
             CR+++IES FAL VAFLIN++++SVSG VCS   L+ +D  +C+DL LN ASFLLKNVLG
Sbjct  269   CRFYMIESAFALTVAFLINISIISVSGAVCSADNLNPEDRMNCNDLDLNKASFLLKNVLG  328

Query  1022  KSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsi  1201
               SS V+AIALLASGQSSTITGTYAGQY+MQGFLDL+M  W RNL+TR +AI PSLIVS+
Sbjct  329   NWSSKVFAIALLASGQSSTITGTYAGQYVMQGFLDLRMTPWLRNLLTRSLAIVPSLIVSL  388

Query  1202  iggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgii  1381
             IGGSS AG+LIIIASMILSFELPFAL+PLLKF+SS TKMGP+ NS +I V++W +G  I+
Sbjct  389   IGGSSAAGKLIIIASMILSFELPFALVPLLKFTSSKTKMGPHTNSRFIAVLTWAIGSFIM  448

Query  1382  giniyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTF  1549
              INIY+L T+FV  L+H+ L     V  GI  F  M IY+ A++YL+FRK++  T 
Sbjct  449   VINIYFLITSFVRLLLHSGLSTVSQVFSGIFGFLGMLIYIAAILYLVFRKNRKCTL  504



>gb|KDP41977.1| hypothetical protein JCGZ_26995 [Jatropha curcas]
Length=542

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/459 (65%), Positives = 373/459 (81%), Gaps = 0/459 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             +  W+   +Y+GPGF+VS+AY+DPGN ETDLQAGA ++Y LLW++L+    AL+IQSLAA
Sbjct  39    RKSWKNLFAYMGPGFLVSIAYIDPGNFETDLQAGAQYKYGLLWIILVASCAALVIQSLAA  98

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E CKAEYP+   + LW+LAE+A++A DIPEVIGTAFALN+LF IP+W+G
Sbjct  99    NLGVVTGKHLAEHCKAEYPRVPNFILWILAEIAIVACDIPEVIGTAFALNMLFRIPIWIG  158

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLSTL+LL+LQRYGVRKLE LIA LVF +A CFF E+ Y KP A +V  G+F+P+L
Sbjct  159   VLLTGLSTLVLLALQRYGVRKLEFLIAFLVFTIAVCFFVELGYAKPAANEVLYGLFVPQL  218

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SVRG+ +ACRY+LIES FAL VAF
Sbjct  219   KGDGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVRGIKEACRYYLIESAFALAVAF  278

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LINV+V+SVSG VC++  L+ +D  +C DL LN ASFLLKNVLG  SS ++AIALLASGQ
Sbjct  279   LINVSVISVSGAVCNSSNLNAEDQSNCKDLDLNKASFLLKNVLGSWSSKLFAIALLASGQ  338

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDL++  W RN +TRC+AI PSLIV++IGGSSGAG+LIIIASM
Sbjct  339   SSTITGTYAGQYVMQGFLDLRLTPWIRNFLTRCLAIVPSLIVALIGGSSGAGKLIIIASM  398

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFALIPLLKF+S  TKMG Y NS  I  ++W++G  I+ IN+Y+L+T F+  L+
Sbjct  399   ILSFELPFALIPLLKFTSCKTKMGMYANSTTISALTWLVGSLIMSINVYFLATGFIKLLL  458

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVT  1546
             H +L     V +GI  F  MA+Y+ A+ YL+FRK+K  T
Sbjct  459   HGHLKVVAAVFLGIFGFSAMALYLAAIAYLIFRKNKGAT  497



>gb|EMS48033.1| Metal transporter Nramp1 [Triticum urartu]
Length=679

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/473 (67%), Positives = 375/473 (79%), Gaps = 35/473 (7%)
 Frame = +2

Query  122   DSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWV  301
             +++  L+ D    +++ P W++FL ++GPGFMVSLAYLDPGNLETDLQAGA+HRYELLWV
Sbjct  19    EAVAGLRRDDCGVNSQDPAWKRFLRHIGPGFMVSLAYLDPGNLETDLQAGANHRYELLWV  78

Query  302   VLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIG  481
             +LIGL+FALIIQSL+ANLGV T                                   VIG
Sbjct  79    ILIGLIFALIIQSLSANLGVVT-----------------------------------VIG  103

Query  482   TAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYV  661
             TAFA N+LF++P+W+GVL  G STLLLL LQRYGVRKLE L+A+LVF+MA CFF EM+ V
Sbjct  104   TAFAFNLLFNVPVWIGVLIAGSSTLLLLGLQRYGVRKLEFLVALLVFVMAGCFFVEMSIV  163

Query  662   KPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDA  841
             KPPA++V KG+FIP+L+G  ATADAIALLGALVMPHNLFLHSALVL+R  P SVRG+NDA
Sbjct  164   KPPAKEVMKGLFIPRLNGSSATADAIALLGALVMPHNLFLHSALVLSRDTPASVRGMNDA  223

Query  842   CRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLG  1021
             CR+FL ESG ALFVA L+N+A++SVSGTVC+ G LS +D   C DL+L+S+SFLLKNVLG
Sbjct  224   CRFFLFESGIALFVALLVNIAIISVSGTVCNAGNLSPEDAAKCGDLTLDSSSFLLKNVLG  283

Query  1022  KSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsi  1201
             +SS+ VY +ALLASGQSS+ITGTYAGQYIMQGFLD+KMKKW RNLMTR IAI PSL+VSI
Sbjct  284   RSSAIVYGVALLASGQSSSITGTYAGQYIMQGFLDIKMKKWVRNLMTRSIAIVPSLVVSI  343

Query  1202  iggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgii  1381
             IGG SGAGRLIIIASMILSFELPFALIPLLKFSSS  KMG   NSIYI+  SW LG  II
Sbjct  344   IGGPSGAGRLIIIASMILSFELPFALIPLLKFSSSRNKMGQCNNSIYIVGFSWTLGFIII  403

Query  1382  giniyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKV  1540
             GIN+Y+LS+  + W++HN+LP   NVLVGI +FPLM +Y+ AV+YL FRKD V
Sbjct  404   GINVYFLSSKLIGWILHNSLPTYANVLVGITLFPLMLLYIAAVVYLTFRKDTV  456



>ref|XP_006427619.1| hypothetical protein CICLE_v10025318mg [Citrus clementina]
 gb|ESR40859.1| hypothetical protein CICLE_v10025318mg [Citrus clementina]
Length=543

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/495 (61%), Positives = 386/495 (78%), Gaps = 2/495 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             K  W+   +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    ALIIQSLAA
Sbjct  40    KTSWKNLFAYIGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALIIQSLAA  99

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E C+ EYPK   + LW+LAE+A++A DIPEVIGTAFALN+LF IP+W+G
Sbjct  100   NLGVVTGKHLAEHCRNEYPKVPNFILWVLAEIAIVACDIPEVIGTAFALNMLFKIPVWIG  159

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TG STL+LL+LQ+YGVRKLE LIA LVF MA CFF E+ Y KP A++V  G+F+P+L
Sbjct  160   VLLTGFSTLILLALQQYGVRKLEFLIAFLVFTMAGCFFAELGYAKPEAKEVLHGLFVPQL  219

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SVR + +ACR+++IESGFAL VAF
Sbjct  220   KGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVRSIKEACRFYMIESGFALAVAF  279

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LINV+V+SVSG VCS+  L+ +D   C DL LN ASFLL+NVLG  SS ++AIALLASGQ
Sbjct  280   LINVSVISVSGAVCSSSNLNPEDQASCKDLDLNKASFLLRNVLGSWSSKLFAIALLASGQ  339

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDL++K W RN +TRC+AI PSLIV++IGGS+GAG+LIIIASM
Sbjct  340   SSTITGTYAGQYVMQGFLDLRLKPWLRNFLTRCLAIVPSLIVALIGGSAGAGQLIIIASM  399

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFAL+PLLKF+SS  KMG + NSI I  ++WI+G  I+ IN+YYL+T+F+ +L 
Sbjct  400   ILSFELPFALVPLLKFTSSKVKMGMHANSIAITAITWIIGSLIMIINVYYLATSFIKFLF  459

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVT-FIQPNDDDSKMDNNVNNNVC  1606
             H NL     V +GI  F  MA+Y+  V YL+ RK+K  +  +     +++   N + N  
Sbjct  460   HGNLKLVEVVFLGIFGFSAMAVYLAGVAYLVLRKNKEASHLLALTTHENQHSTNESGNAS  519

Query  1607  MTPIDHNDF-SHTLP  1648
             +  +   D  S  LP
Sbjct  520   LYSLPREDIASMQLP  534



>ref|XP_004966199.1| PREDICTED: metal transporter Nramp3-like isoform X2 [Setaria 
italica]
Length=551

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/479 (64%), Positives = 383/479 (80%), Gaps = 6/479 (1%)
 Frame = +2

Query  122   DSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWV  301
             +SI+  Q+ + E+++    W+   SY+GPGF+VS+AY+DPGN ETDLQAGA ++YELLW+
Sbjct  32    ESIDVDQIVIPEKNS----WKNLFSYIGPGFLVSIAYIDPGNFETDLQAGAQYKYELLWI  87

Query  302   VLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIG  481
             +L+    ALIIQSLAA LGV TGKHL+E C+AEYPK   + LW+LAELAV+A DIPEVIG
Sbjct  88    ILVASCAALIIQSLAARLGVVTGKHLAEHCRAEYPKVTNFVLWILAELAVVACDIPEVIG  147

Query  482   TAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYV  661
             TAFALN+LF IP+W GVL TGLSTL+LL LQ+YGVRKLE LIA LVFL+A CF  E+ Y 
Sbjct  148   TAFALNMLFRIPVWCGVLITGLSTLMLLLLQQYGVRKLEFLIAFLVFLIATCFLVELGYS  207

Query  662   KPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDA  841
             KP A +V +G+F+P+L G GAT  AI+LLGA+VMPHNLFLHSALVL+RKVP SV G+ +A
Sbjct  208   KPDASEVVRGLFVPELKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKVPRSVHGIKEA  267

Query  842   CRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLG  1021
             CR++ IES FAL VAFLIN++++SVSG VC +G L+ +D  +CSDL LN ASFLLKNVLG
Sbjct  268   CRFYTIESAFALTVAFLINISIISVSGAVCGSGNLNPEDQANCSDLDLNKASFLLKNVLG  327

Query  1022  KSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsi  1201
               SS ++A+ALLASGQSSTITGTYAGQY+MQGFLDL+M  W RNL+TR +AI PSLIVSI
Sbjct  328   TWSSKLFAVALLASGQSSTITGTYAGQYVMQGFLDLRMTPWIRNLVTRSLAILPSLIVSI  387

Query  1202  iggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgii  1381
             IGGSS AG+LIIIASMILSFELPFAL+PLLKF+SS TKMG + NSI+  V++W++G  I+
Sbjct  388   IGGSSAAGQLIIIASMILSFELPFALVPLLKFTSSKTKMGQHTNSIFTSVLTWVIGSLIV  447

Query  1382  giniyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQP  1558
              IN Y+L T+FV  L+H+ L     V  GI  F  M IY+ A++YL+FR+++  T  QP
Sbjct  448   IINTYFLVTSFVKLLLHSGLSTVSQVFSGIFGFLGMLIYMAAILYLVFRRNRKST--QP  504



>ref|XP_008681153.1| PREDICTED: uncharacterized protein LOC100193537 isoform X2 [Zea 
mays]
Length=624

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/479 (64%), Positives = 385/479 (80%), Gaps = 6/479 (1%)
 Frame = +2

Query  122   DSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWV  301
             +SI+  Q+ + E+++    W+   SY+GPGF+VS+AY+DPGN ETDLQAGA ++YELLW+
Sbjct  106   ESIDVDQIVIPEKNS----WKNLFSYIGPGFLVSIAYIDPGNFETDLQAGAQYKYELLWI  161

Query  302   VLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIG  481
             +L+    ALIIQSLAA LGV TGKHL+E C+AEYPK   + LW+LAELAV+A DIPEVIG
Sbjct  162   ILVASCAALIIQSLAARLGVVTGKHLAEHCRAEYPKVTNFVLWILAELAVVACDIPEVIG  221

Query  482   TAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYV  661
             TAFALN+LF IP+W GVL TGLSTL+LL LQ+YGVRKLE LIA LVFL+A CF  E+ Y 
Sbjct  222   TAFALNMLFRIPVWCGVLITGLSTLMLLLLQQYGVRKLEFLIAFLVFLIATCFLVELGYS  281

Query  662   KPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDA  841
             KP A +V +G+F+P+L G GAT  AI+LLGA+VMPHNLFLHSALVL+RKVP SV G+ +A
Sbjct  282   KPNAPEVVRGLFVPELKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKVPRSVHGIKEA  341

Query  842   CRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLG  1021
             CR++ IES FAL VAFLIN++++SVSG+VC +G L+ +D  +CSDL LN ASFLLKNVLG
Sbjct  342   CRFYTIESAFALTVAFLINISIISVSGSVCGSGNLNPEDQANCSDLDLNKASFLLKNVLG  401

Query  1022  KSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsi  1201
               SS ++A+ALLASGQSSTITGTYAGQY+MQGFLDL+MK W RNL+TR +AI PSLIVSI
Sbjct  402   NWSSKLFAVALLASGQSSTITGTYAGQYVMQGFLDLRMKPWIRNLVTRSLAILPSLIVSI  461

Query  1202  iggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgii  1381
             IGGSS AG+LIIIASMILSFELPFAL+PLLKF+SS TKMG + NSI+  V++W++G  I+
Sbjct  462   IGGSSAAGQLIIIASMILSFELPFALVPLLKFTSSKTKMGQHTNSIFTAVLTWMIGSFIV  521

Query  1382  giniyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQP  1558
              IN Y+L T+FV  L+ + L     V  GI  F  M IY+VA++YL+FR+++  T  QP
Sbjct  522   VINTYFLITSFVKLLVQSGLTTISQVFSGIFGFLGMLIYIVAILYLVFRRNRKST--QP  578



>gb|KHG03378.1| Metal transporter Nramp1 -like protein [Gossypium arboreum]
Length=540

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/494 (62%), Positives = 389/494 (79%), Gaps = 1/494 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             +  W+ F +Y+GPGF+VS+AY+DPGN ETDLQAGA ++Y LLW++L+    AL+IQSLAA
Sbjct  39    RKSWKNFFAYMGPGFLVSIAYIDPGNFETDLQAGAQYKYGLLWIILVASCAALVIQSLAA  98

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E C+ EYP+   + LW+LAE+A++A DIPEVIGTAFALN+LF+IP+W+G
Sbjct  99    NLGVVTGKHLAEHCRTEYPRGPNFVLWVLAEIAIVACDIPEVIGTAFALNMLFNIPVWIG  158

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLSTL+LL+LQ+YGVRKLE LIA LV  +A CFF EM Y KP A +V  G+F+P+L
Sbjct  159   VLLTGLSTLVLLALQQYGVRKLEFLIAFLVLTIAGCFFAEMNYAKPVASEVLDGLFVPQL  218

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SVRG+ +ACR+++IESGFAL VAF
Sbjct  219   KGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVRGIKEACRFYMIESGFALMVAF  278

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LIN++V+SVSG VC++  L+++D D C DL LN ASFLL+NVLG  SS ++A+ALLASGQ
Sbjct  279   LINISVISVSGAVCNSSNLNQEDQDSCEDLDLNKASFLLRNVLGSWSSKLFAVALLASGQ  338

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDL++  W RN++TRC+AI PSLIV+IIGGS+GAG+LIIIASM
Sbjct  339   SSTITGTYAGQYVMQGFLDLRLTPWIRNMLTRCLAIVPSLIVAIIGGSAGAGKLIIIASM  398

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFALIPLLKF+SS TKMG Y NSI +  ++WI+G  I+GINIYYL T F+  L+
Sbjct  399   ILSFELPFALIPLLKFTSSKTKMGAYVNSIAVSAITWIIGSLIMGINIYYLMTNFIHLLL  458

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMDNNVNNNVCM  1609
             HN+      V +GI  F  +AIY+ A+ YL+FR +K  T +     +++   +   N  M
Sbjct  459   HNHWELVAVVFLGIFGFSGVAIYLAAIAYLVFRPNKEATHLLALTSENQHMVDDAGNTSM  518

Query  1610  TPIDHNDF-SHTLP  1648
               +   D  S  LP
Sbjct  519   YCLPREDIVSMQLP  532



>ref|XP_011097461.1| PREDICTED: metal transporter Nramp1-like [Sesamum indicum]
Length=505

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/463 (63%), Positives = 369/463 (80%), Gaps = 0/463 (0%)
 Frame = +2

Query  158   EHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQ  337
             E  +KP W+K L Y+GPGF+VS+AYLDPGNLETDLQAGADH+Y+LLW+VL GL FALIIQ
Sbjct  6     EIQEKPTWKKALGYIGPGFLVSVAYLDPGNLETDLQAGADHKYQLLWIVLAGLGFALIIQ  65

Query  338   SLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIP  517
             S +ANLGV+TGKHLSE CK EYP  + YCLW+LAE+AVIAA++P+VIGTAFA NILF++P
Sbjct  66    SRSANLGVATGKHLSEHCKTEYPNPINYCLWILAEIAVIAAEVPQVIGTAFAFNILFNVP  125

Query  518   LWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMF  697
             +W GVL  GL+TLLLL LQRYG+RKLE+ I VLV ++  CF   MA  KP  E++ KGMF
Sbjct  126   IWSGVLLAGLNTLLLLGLQRYGIRKLEVAIGVLVLVVGGCFCSVMANAKPNVEEIMKGMF  185

Query  698   IPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFAL  877
             IPKLS   AT DAIALLGAL+MPHNLFLHSALV++RK+  SV G+  A +YFL+ES  AL
Sbjct  186   IPKLSTSSATRDAIALLGALIMPHNLFLHSALVISRKISRSVDGIRSASKYFLLESALAL  245

Query  878   FVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALL  1057
             F+AFLINVAV+SV+G+VCSN  +S ++ DHC +++LNSA+FLLKN LG  SS +YA++LL
Sbjct  246   FIAFLINVAVISVTGSVCSNPNISTENKDHCQNITLNSAAFLLKNALGNWSSKLYAVSLL  305

Query  1058  ASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrlii  1237
             ASGQSST+TGTYAGQYIMQGFL+ KMK W RNL+TRCI I PSL+  IIGG S A +LII
Sbjct  306   ASGQSSTVTGTYAGQYIMQGFLEFKMKLWLRNLLTRCIVIAPSLVACIIGGPSAASKLII  365

Query  1238  iasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFV  1417
             IASMILSFELPFAL+PLLKF+SS  KMG +KNS  + ++ W LG G I IN+Y+L ++ +
Sbjct  366   IASMILSFELPFALVPLLKFTSSEAKMGQHKNSKMVTLILWTLGFGSIVINMYFLGSSLL  425

Query  1418  DWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVT  1546
              WL  N + KA  +   I++ P++ +Y+  ++YL F+ +   T
Sbjct  426   GWLTSNRMSKAAAISAAILILPVIILYITMLLYLTFKPETPTT  468



>ref|XP_006493353.1| PREDICTED: metal transporter Nramp1-like [Citrus sinensis]
 gb|KDO41577.1| hypothetical protein CISIN_1g008955mg [Citrus sinensis]
 gb|KDO41578.1| hypothetical protein CISIN_1g008955mg [Citrus sinensis]
Length=543

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/495 (61%), Positives = 386/495 (78%), Gaps = 2/495 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             K  W+   +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    ALIIQSLAA
Sbjct  40    KTSWKNLFAYIGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALIIQSLAA  99

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E C+ EYPK   + LW+LAE+A++A DIPEVIGTAFALN+LF IP+W+G
Sbjct  100   NLGVVTGKHLAEHCRNEYPKVPNFILWVLAEIAIVACDIPEVIGTAFALNMLFKIPVWIG  159

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TG STL+LL+LQ+YGVRKLE LIA LVF MA CFF E+ Y KP A++V  G+F+P+L
Sbjct  160   VLLTGFSTLILLALQQYGVRKLEFLIAFLVFTMAGCFFAELGYAKPEAKEVLHGLFVPQL  219

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SVR + +ACR+++IESGFAL VAF
Sbjct  220   KGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVRSIKEACRFYMIESGFALAVAF  279

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LINV+V+SVSG VCS+  ++ +D   C DL LN ASFLL+NVLG  SS ++AIALLASGQ
Sbjct  280   LINVSVISVSGAVCSSSNINPEDQASCKDLDLNKASFLLRNVLGSWSSKLFAIALLASGQ  339

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDL++K W RN +TRC+AI PSLIV++IGGS+GAG+LIIIASM
Sbjct  340   SSTITGTYAGQYVMQGFLDLRLKPWLRNFLTRCLAIVPSLIVALIGGSAGAGQLIIIASM  399

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFAL+PLLKF+SS  KMG + NSI I  ++WI+G  I+ IN+YYL+T+F+ +L 
Sbjct  400   ILSFELPFALVPLLKFTSSKVKMGMHANSIAITAITWIIGSLIMIINVYYLATSFIKFLF  459

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVT-FIQPNDDDSKMDNNVNNNVC  1606
             H NL     V +GI  F  MA+Y+  V YL+ RK+K  +  +     +++   N + N  
Sbjct  460   HGNLKLVEVVFLGIFGFSAMAVYLAGVAYLVLRKNKEASHLLALTTHENQHSTNESGNAS  519

Query  1607  MTPIDHNDF-SHTLP  1648
             +  +   D  S  LP
Sbjct  520   LYSLPREDIASMQLP  534



>ref|XP_008228792.1| PREDICTED: metal transporter Nramp6-like [Prunus mume]
 ref|XP_008228793.1| PREDICTED: metal transporter Nramp6-like [Prunus mume]
 ref|XP_008228794.1| PREDICTED: metal transporter Nramp6-like [Prunus mume]
Length=545

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/496 (61%), Positives = 385/496 (78%), Gaps = 3/496 (1%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             K  W+   +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++Y LLW++L+    ALIIQSLAA
Sbjct  41    KTSWKNLFAYMGPGFLVSIAYIDPGNFETDLQSGAQYKYGLLWIILVASCAALIIQSLAA  100

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E C+AEYP+   + LW+LAE++V+A DIPEVIGTAFALN+LF+IP+W+G
Sbjct  101   NLGVVTGKHLAEHCRAEYPRVTNFILWVLAEISVVACDIPEVIGTAFALNMLFNIPIWIG  160

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLSTLLLL LQ+YGVRKLE LIA LV  +A CFF E+ Y KP   +V KG+F+P+L
Sbjct  161   VLLTGLSTLLLLVLQQYGVRKLEFLIAFLVLTIAGCFFAELGYAKPDGTEVLKGLFVPQL  220

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SVRG+ +ACR+++IESGFAL VAF
Sbjct  221   KGSGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVRGIKEACRFYMIESGFALMVAF  280

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LINV+V+SVSG VC++  L+ +D  +C DL LN ASFLL+NVLG  SS ++A+ALLASGQ
Sbjct  281   LINVSVISVSGAVCNSADLNAEDQMNCQDLDLNKASFLLRNVLGSWSSKLFAVALLASGQ  340

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQYIMQGFLDL++K W RN +TRC+AI PSLIV++IGGS+GAG+LIIIASM
Sbjct  341   SSTITGTYAGQYIMQGFLDLRLKPWLRNFLTRCLAIVPSLIVAVIGGSAGAGKLIIIASM  400

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFALIPLLKF+SS TKMG Y NS  I  ++WI+G  ++ IN+YYL + F+  L+
Sbjct  401   ILSFELPFALIPLLKFTSSETKMGAYANSTAISAITWIIGSLLMAINVYYLISGFIKLLL  460

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQP--NDDDSKMDNNVNNNV  1603
             H++      V +GI+ F  M +Y+  + YL+FRK+K  T +      +  ++ N    N 
Sbjct  461   HSHFKVLAVVFLGILGFSGMGLYLAGIAYLVFRKNKEATHLLALTTPESRQLANEQQGNA  520

Query  1604  CMTPIDHNDF-SHTLP  1648
              M  +   D  S  LP
Sbjct  521   SMYCLAREDIVSMQLP  536



>ref|XP_004966198.1| PREDICTED: metal transporter Nramp3-like isoform X1 [Setaria 
italica]
Length=578

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/479 (64%), Positives = 383/479 (80%), Gaps = 6/479 (1%)
 Frame = +2

Query  122   DSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWV  301
             +SI+  Q+ + E+++    W+   SY+GPGF+VS+AY+DPGN ETDLQAGA ++YELLW+
Sbjct  59    ESIDVDQIVIPEKNS----WKNLFSYIGPGFLVSIAYIDPGNFETDLQAGAQYKYELLWI  114

Query  302   VLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIG  481
             +L+    ALIIQSLAA LGV TGKHL+E C+AEYPK   + LW+LAELAV+A DIPEVIG
Sbjct  115   ILVASCAALIIQSLAARLGVVTGKHLAEHCRAEYPKVTNFVLWILAELAVVACDIPEVIG  174

Query  482   TAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYV  661
             TAFALN+LF IP+W GVL TGLSTL+LL LQ+YGVRKLE LIA LVFL+A CF  E+ Y 
Sbjct  175   TAFALNMLFRIPVWCGVLITGLSTLMLLLLQQYGVRKLEFLIAFLVFLIATCFLVELGYS  234

Query  662   KPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDA  841
             KP A +V +G+F+P+L G GAT  AI+LLGA+VMPHNLFLHSALVL+RKVP SV G+ +A
Sbjct  235   KPDASEVVRGLFVPELKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKVPRSVHGIKEA  294

Query  842   CRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLG  1021
             CR++ IES FAL VAFLIN++++SVSG VC +G L+ +D  +CSDL LN ASFLLKNVLG
Sbjct  295   CRFYTIESAFALTVAFLINISIISVSGAVCGSGNLNPEDQANCSDLDLNKASFLLKNVLG  354

Query  1022  KSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsi  1201
               SS ++A+ALLASGQSSTITGTYAGQY+MQGFLDL+M  W RNL+TR +AI PSLIVSI
Sbjct  355   TWSSKLFAVALLASGQSSTITGTYAGQYVMQGFLDLRMTPWIRNLVTRSLAILPSLIVSI  414

Query  1202  iggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgii  1381
             IGGSS AG+LIIIASMILSFELPFAL+PLLKF+SS TKMG + NSI+  V++W++G  I+
Sbjct  415   IGGSSAAGQLIIIASMILSFELPFALVPLLKFTSSKTKMGQHTNSIFTSVLTWVIGSLIV  474

Query  1382  giniyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQP  1558
              IN Y+L T+FV  L+H+ L     V  GI  F  M IY+ A++YL+FR+++  T  QP
Sbjct  475   IINTYFLVTSFVKLLLHSGLSTVSQVFSGIFGFLGMLIYMAAILYLVFRRNRKST--QP  531



>ref|XP_010240753.1| PREDICTED: metal transporter Nramp3 [Brachypodium distachyon]
Length=551

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/475 (63%), Positives = 382/475 (80%), Gaps = 4/475 (1%)
 Frame = +2

Query  122   DSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWV  301
             DS++  Q+ + E+++    W+   SY+GPGF+VS+AY+DPGN ETDLQAGA ++Y+LLW+
Sbjct  32    DSVDVDQIVISEKNS----WKNLFSYIGPGFLVSIAYIDPGNFETDLQAGALYKYQLLWI  87

Query  302   VLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIG  481
             +LI    AL+IQSLAA+LGV TGKHL+E C+AEYPK   + LW+LAELAV+A DIPEVIG
Sbjct  88    ILIASCAALVIQSLAASLGVVTGKHLAEHCRAEYPKVTNFILWILAELAVVACDIPEVIG  147

Query  482   TAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYV  661
             TAFALN+LF IP+W GVL TG STL+LL LQ+YGVRKLE LIA LVFL+A CF  E+ Y 
Sbjct  148   TAFALNMLFKIPIWCGVLITGFSTLMLLFLQQYGVRKLEFLIAFLVFLIATCFLVELGYS  207

Query  662   KPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDA  841
             KP + +V +G+F+P++ G GAT  AI+LLGA+VMPHNLFLHSALVL+RKVP SV G+ +A
Sbjct  208   KPNSSEVMRGLFVPEIKGNGATGSAISLLGAMVMPHNLFLHSALVLSRKVPRSVNGIKEA  267

Query  842   CRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLG  1021
             CR+++IES FAL VAFLIN++++SVSG VC++  L+ +D  +C+DL LN ASFLLKNVLG
Sbjct  268   CRFYMIESAFALTVAFLINISIISVSGAVCNSNNLNPEDQMNCTDLDLNKASFLLKNVLG  327

Query  1022  KSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsi  1201
               SS V+AIALLASGQSSTITGTYAGQY+MQGFLDL+M  W RNL+TR +AI PSLIVS+
Sbjct  328   NWSSKVFAIALLASGQSSTITGTYAGQYVMQGFLDLRMTSWLRNLLTRSLAIVPSLIVSL  387

Query  1202  iggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgii  1381
             IGGSS AG+LII ASMILSFELPFAL+PLLKF+SS TKMG + NS +I V++W +G  I+
Sbjct  388   IGGSSAAGQLIITASMILSFELPFALVPLLKFTSSKTKMGQHVNSRFISVLTWAIGSFIV  447

Query  1382  giniyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVT  1546
              INIY+L T+F++ L+H+ L     V  GI  F  M IY+ A++YL+FRK++  T
Sbjct  448   IINIYFLITSFLNVLLHSGLSTVSQVFAGIFGFLGMLIYIAAILYLVFRKNRKAT  502



>ref|XP_002986694.1| hypothetical protein SELMODRAFT_124573 [Selaginella moellendorffii]
 gb|EFJ12257.1| hypothetical protein SELMODRAFT_124573 [Selaginella moellendorffii]
Length=574

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/482 (61%), Positives = 389/482 (81%), Gaps = 3/482 (1%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             ++ GWRK  +YVGPG++V +AY+DP N E+DLQ+GA+ +YELLWV+LI  + ALIIQSLA
Sbjct  78    QRKGWRKLAAYVGPGYLVCIAYIDPANFESDLQSGANFKYELLWVLLIASISALIIQSLA  137

Query  347   ANLGVSTGK---HLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIP  517
             ANLGV T K   HL+E C+ EY + + + LW+LAE+ +IA+DIPEVIGTAFALNILF +P
Sbjct  138   ANLGVVTRKFAHHLAEHCRIEYARPLNFVLWILAEVCIIASDIPEVIGTAFALNILFRLP  197

Query  518   LWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMF  697
             +W+GVL TG STL+LL++Q+YGVRKLEL++A+ VF+MA CFF E+ Y KP A +V KG+F
Sbjct  198   VWIGVLLTGFSTLILLAIQQYGVRKLELVVALFVFIMAGCFFVELGYAKPDAGEVLKGLF  257

Query  698   IPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFAL  877
             +P+L+G GAT  AI+LLGA+VMPHNLFLHSA+VLTRK+P S  G+ D CRY+++ESGFAL
Sbjct  258   VPRLNGHGATGIAISLLGAMVMPHNLFLHSAIVLTRKIPYSTNGIKDGCRYYIMESGFAL  317

Query  878   FVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALL  1057
             F+AFLIN+AV+ VS +VC+N  LS    D C DL LN ASFLL+NVLGK SS V+ +ALL
Sbjct  318   FLAFLINIAVICVSASVCNNPHLSSVYKDDCGDLDLNRASFLLRNVLGKWSSVVFGVALL  377

Query  1058  ASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrlii  1237
             ASGQSSTITGT+AGQY+MQGFLDL++K W RNL+TR +AI PSL V++I GS GAG+LII
Sbjct  378   ASGQSSTITGTFAGQYVMQGFLDLRLKPWIRNLLTRLVAIIPSLAVALISGSRGAGKLII  437

Query  1238  iasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFV  1417
             ++SMIL+F+LPFAL+PLLKF+SSS KMGP+ NS+++ V++W++G+G+I IN+Y+L T+FV
Sbjct  438   VSSMILAFQLPFALVPLLKFTSSSMKMGPHMNSLWLTVLTWLIGMGVITINMYFLITSFV  497

Query  1418  DWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMDNNVNN  1597
              WLIH +L KAG V++G++VF  +  Y+V + YL FR +   T+I P ++  K     +N
Sbjct  498   KWLIHGHLAKAGRVVIGLLVFKAILAYLVTLCYLAFRTETKPTYIVPPNEGGKSPQPDSN  557

Query  1598  NV  1603
              +
Sbjct  558   GM  559



>sp|Q653V6.1|NRAM3_ORYSJ RecName: Full=Metal transporter Nramp3; Short=OsNramp3 [Oryza 
sativa Japonica Group]
 dbj|BAD45911.1| putative NRAMP metal ion transporter 1 [Oryza sativa Japonica 
Group]
 gb|EAZ02068.1| hypothetical protein OsI_24146 [Oryza sativa Indica Group]
 gb|EAZ38005.1| hypothetical protein OsJ_22349 [Oryza sativa Japonica Group]
 dbj|BAG92038.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAN82348.1| metal transporter Nramp3 [Oryza sativa Japonica Group]
Length=550

 Score =   533 bits (1373),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 306/476 (64%), Positives = 379/476 (80%), Gaps = 4/476 (1%)
 Frame = +2

Query  122   DSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWV  301
             DSI+  Q+ + E+++    W+   SY+GPGF+VS+AY+DPGN ETDLQAGA ++YELLW+
Sbjct  32    DSIDVDQIVIPEKNS----WKNLFSYIGPGFLVSIAYIDPGNFETDLQAGAQYKYELLWI  87

Query  302   VLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIG  481
             +LI    ALIIQSLAA LGV TGKHL+E C+AEYPK   + LW+LAELAV+A DIPEVIG
Sbjct  88    ILIASCAALIIQSLAARLGVVTGKHLAEHCRAEYPKATNFILWILAELAVVACDIPEVIG  147

Query  482   TAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYV  661
             TAFALN+LF IP+W GVL TGLSTL+LL LQ+YGVRKLE LIA+LV L+A CF  E+ Y 
Sbjct  148   TAFALNMLFKIPVWCGVLITGLSTLMLLLLQQYGVRKLEFLIAILVSLIATCFLVELGYS  207

Query  662   KPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDA  841
             KP + +V +G+F+P+L G GAT  AI+LLGA+VMPHNLFLHSALVL+RKVP SV G+ +A
Sbjct  208   KPNSSEVVRGLFVPELKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKVPRSVHGIKEA  267

Query  842   CRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLG  1021
             CR+++IES FAL +AFLIN++++SVSG VC +  LS +D  +CSDL LN ASFLLKNVLG
Sbjct  268   CRFYMIESAFALTIAFLINISIISVSGAVCGSDNLSPEDQMNCSDLDLNKASFLLKNVLG  327

Query  1022  KSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsi  1201
               SS ++A+ALLASGQSSTITGTYAGQY+MQGFLDL+M  W RNL+TR +AI PSLIVSI
Sbjct  328   NWSSKLFAVALLASGQSSTITGTYAGQYVMQGFLDLRMTPWIRNLLTRSLAILPSLIVSI  387

Query  1202  iggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgii  1381
             IGGSS AG+LIIIASMILSFELPFAL+PLLKF+SS TKMG + NS  I V++W +G  I+
Sbjct  388   IGGSSAAGQLIIIASMILSFELPFALVPLLKFTSSRTKMGQHTNSKAISVITWGIGSFIV  447

Query  1382  giniyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTF  1549
              IN Y+L T+FV  L+HN L     V  GI  F  M IY+ A++YL+FRK++  T 
Sbjct  448   VINTYFLITSFVKLLLHNGLSTVSQVFSGIFGFLGMLIYMAAILYLVFRKNRKATL  503



>gb|EEC72418.1| hypothetical protein OsI_05729 [Oryza sativa Indica Group]
Length=1067

 Score =   550 bits (1417),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 297/461 (64%), Positives = 373/461 (81%), Gaps = 0/461 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             +P WRKFL++VGPG +V++ +LDP NLETD+QAGAD +YELLWV+L+G+VFAL+IQ+LAA
Sbjct  45    QPRWRKFLAHVGPGALVAIGFLDPSNLETDMQAGADFKYELLWVILVGMVFALLIQTLAA  104

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TG+HL+ELC+ EYP YV   LW++AELAVI+ DIPEV+GTAFA NIL  IP+W G
Sbjct  105   NLGVKTGRHLAELCREEYPHYVNIFLWIIAELAVISDDIPEVLGTAFAFNILLKIPVWAG  164

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             V+ T  STLLLL +QR+G RKLE +IA  +F MAACFFGE++Y++P A +V KGMF+P L
Sbjct  165   VILTVFSTLLLLGVQRFGARKLEFIIAAFMFTMAACFFGELSYLRPSAGEVVKGMFVPSL  224

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G+GA A+AIAL GA++ P+NLFLHSALVL+RK P S + +  ACRYFLIE   A  VAF
Sbjct  225   QGKGAAANAIALFGAIITPYNLFLHSALVLSRKTPRSDKSIRAACRYFLIECSLAFIVAF  284

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LINV+VV V+G++C+   LS  D + C DL+L S   LL+NVLG+SSS VYA+ALLASGQ
Sbjct  285   LINVSVVVVAGSICNANNLSPADANTCGDLTLQSTPLLLRNVLGRSSSVVYAVALLASGQ  344

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             S+TI+ T+AGQ IMQGFLD+KMK W RNL+TR IAI PSLIVSI+ G SGAG+LII++SM
Sbjct  345   STTISCTFAGQVIMQGFLDMKMKNWVRNLITRVIAIAPSLIVSIVSGPSGAGKLIILSSM  404

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFALIPLLKF +SS K+GP K SIY +V++WIL   +I +N Y+L   +VDWL+
Sbjct  405   ILSFELPFALIPLLKFCNSSKKVGPLKESIYTVVIAWILSFALIVVNTYFLVWTYVDWLV  464

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFI  1552
             HNNLPK  N L+ +VVF LMA Y+VAV+YL FRKD V T++
Sbjct  465   HNNLPKYANGLISVVVFALMAAYLVAVVYLTFRKDTVATYV  505



>gb|KHN31883.1| Metal transporter Nramp6 [Glycine soja]
Length=544

 Score =   533 bits (1372),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 299/500 (60%), Positives = 390/500 (78%), Gaps = 2/500 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             +  W+   +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    AL+IQS+AA
Sbjct  41    RKSWKNLFAYMGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILLASCVALVIQSMAA  100

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E C+AEYP+   + LW++AE+A++A DIPEVIGTAFALN+LF+IP+W+G
Sbjct  101   NLGVVTGKHLAEHCRAEYPRVPNFILWIIAEIAIVACDIPEVIGTAFALNMLFNIPVWIG  160

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLSTL+LL+LQ+YGVRKLE LIA LVF +AACF  E+ Y KP A++V KG+F+P L
Sbjct  161   VLLTGLSTLMLLALQQYGVRKLEFLIAFLVFTIAACFMVELGYAKPDAKEVLKGLFVPGL  220

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SV+G+ +ACR+++IES FAL VAF
Sbjct  221   KGSGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVQGIREACRFYMIESAFALMVAF  280

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LINV V+SVSG VC++  L+ +D   C DL LN ASFLL+NVLGK SS ++ IAL ASGQ
Sbjct  281   LINVCVISVSGAVCNSSNLNAEDQMSCQDLDLNKASFLLRNVLGKWSSKLFGIALFASGQ  340

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDL+++ W RN++TRC+AI PSLIV++IGGS+GAG+LII+ASM
Sbjct  341   SSTITGTYAGQYVMQGFLDLRLEPWIRNMLTRCLAIVPSLIVAVIGGSAGAGKLIIVASM  400

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFAL+PLLKF+SS TKMG + NS  I  V+WI+G  ++ INIYYL T F+  L+
Sbjct  401   ILSFELPFALVPLLKFTSSKTKMGTHVNSTMISAVTWIIGTLLMAINIYYLITGFIKLLL  460

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQP--NDDDSKMDNNVNNNV  1603
             H++L  A  V +GI+ F  MA+Y+  + YL+ RK+K  T +      ++ +M N   N  
Sbjct  461   HSHLKIAAKVFLGILGFSGMAMYLAGITYLVLRKNKEATHLLALTATENQQMTNEQGNGS  520

Query  1604  CMTPIDHNDFSHTLP*LSRP  1663
               +    +  S  LP  S P
Sbjct  521   IYSLPREDIVSMQLPQRSTP  540



>ref|XP_006656371.1| PREDICTED: metal transporter Nramp3-like [Oryza brachyantha]
Length=550

 Score =   531 bits (1368),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 305/476 (64%), Positives = 379/476 (80%), Gaps = 4/476 (1%)
 Frame = +2

Query  122   DSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWV  301
             DSI+  Q+ + E+++    W+   SY+GPGF+VS+AY+DPGN ETDLQAGA ++YELLW+
Sbjct  32    DSIDVDQIVIPEKNS----WKNLFSYIGPGFLVSIAYIDPGNFETDLQAGAQYKYELLWI  87

Query  302   VLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIG  481
             +LI    ALIIQSLAA LGV TGKHL+E C+AEYPK   + LW+LAELAV+A DIPEVIG
Sbjct  88    ILIASCAALIIQSLAARLGVVTGKHLAEHCRAEYPKATNFILWILAELAVVACDIPEVIG  147

Query  482   TAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYV  661
             TAFALN+LF IP+W GVL TGLSTL+LL LQ+YGVRKLE LIA LV L+A CF  E+ Y 
Sbjct  148   TAFALNMLFKIPVWCGVLITGLSTLMLLFLQQYGVRKLEFLIAFLVSLIATCFLVELGYS  207

Query  662   KPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDA  841
             KP + +V +G+F+P+L G GAT  AI+LLGA+VMPHNLFLHSALVL+RKVP SV G+ +A
Sbjct  208   KPNSSEVVRGLFVPELKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKVPRSVHGIKEA  267

Query  842   CRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLG  1021
             CR+++IES FAL +AFLIN++++SVSG VC +  L+ +D  +CSDL LN ASFLLKNVLG
Sbjct  268   CRFYMIESAFALTIAFLINISIISVSGAVCGSDNLNPEDQMNCSDLDLNKASFLLKNVLG  327

Query  1022  KSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsi  1201
               SS ++A+ALLASGQSSTITGTYAGQY+MQGFLDL+M  W RNL+TR +AI PSLIVSI
Sbjct  328   NWSSKLFAVALLASGQSSTITGTYAGQYVMQGFLDLRMTPWLRNLLTRSLAILPSLIVSI  387

Query  1202  iggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgii  1381
             IGGSS AG+LIIIASMILSFELPFAL+PLLKF+SS TKMG + NS +I V++W +G  I+
Sbjct  388   IGGSSAAGKLIIIASMILSFELPFALVPLLKFTSSRTKMGQHTNSKFISVITWGIGSFIV  447

Query  1382  giniyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTF  1549
              IN Y+L T+FV  L+H+ L     V  GI  F  M IY+ A++YL+FRK+K  T 
Sbjct  448   VINTYFLITSFVKLLLHSGLSTVSQVFSGIFGFLGMLIYMAAILYLVFRKNKTATL  503



>ref|XP_003543701.1| PREDICTED: metal transporter Nramp6-like [Glycine max]
Length=544

 Score =   531 bits (1367),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 299/500 (60%), Positives = 390/500 (78%), Gaps = 2/500 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             +  W+   +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    AL+IQS+AA
Sbjct  41    RKSWKNLFAYMGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILLASCAALVIQSMAA  100

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E C+AEYP+   + LW++AE+A++A DIPEVIGTAFALN+LF+IP+W+G
Sbjct  101   NLGVVTGKHLAEHCRAEYPRVPNFILWIIAEIAIVACDIPEVIGTAFALNMLFNIPVWIG  160

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLSTL+LL+LQ+YGVRKLE LIA LVF +AACF  E+ Y KP A++V KG+F P+L
Sbjct  161   VLLTGLSTLMLLALQQYGVRKLEFLIAFLVFTIAACFMVELGYAKPDAKEVLKGLFEPEL  220

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SV+G+ +ACR+++IES FAL VAF
Sbjct  221   KGSGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVQGIREACRFYMIESAFALMVAF  280

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LINV V+SVSG VC++  L+ +D   C DL LN ASFLL+NVLGK SS ++ IAL ASGQ
Sbjct  281   LINVCVISVSGAVCNSSNLNAEDQMSCQDLDLNKASFLLRNVLGKWSSKLFGIALFASGQ  340

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDL+++ W RN++TRC+AI PSLIV++IGGS+GAG+LII+ASM
Sbjct  341   SSTITGTYAGQYVMQGFLDLRLEPWIRNMLTRCLAIVPSLIVAVIGGSAGAGKLIIVASM  400

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFAL+PLLKF+SS TKMG + NS  I  V+WI+G  ++ INIYYL T F+  L+
Sbjct  401   ILSFELPFALVPLLKFTSSKTKMGTHVNSTMISAVTWIIGTLLMAINIYYLITGFIKLLL  460

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQP--NDDDSKMDNNVNNNV  1603
             H++L  A  V +GI+ F  MA+Y+  + YL+ RK+K  T +      ++ +M N   N  
Sbjct  461   HSHLKIAAKVFLGILGFSGMAMYLAGITYLVLRKNKEATHLLALTATENQQMTNEQGNGS  520

Query  1604  CMTPIDHNDFSHTLP*LSRP  1663
               +    +  S  LP  S P
Sbjct  521   IYSLPREDIVSMQLPQRSTP  540



>ref|XP_006307246.1| hypothetical protein CARUB_v10008854mg [Capsella rubella]
 gb|EOA40144.1| hypothetical protein CARUB_v10008854mg [Capsella rubella]
Length=522

 Score =   530 bits (1365),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 301/457 (66%), Positives = 378/457 (83%), Gaps = 0/457 (0%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             +K  W+ F SY+GPGF+VS+AY+DPGN ETDLQAGA ++YELLW++L+    AL+IQSLA
Sbjct  30    EKKSWKNFFSYLGPGFLVSIAYIDPGNFETDLQAGAQYKYELLWIILVASCAALVIQSLA  89

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGV TGKHL+E C+AEYPK   + LW++AE+AV+A DIPEVIGTAFALNILF+IP+W+
Sbjct  90    ANLGVVTGKHLAEHCRAEYPKVPNFMLWVVAEIAVVACDIPEVIGTAFALNILFNIPVWI  149

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL TGLSTL+LL+LQRYG+RKLE LIA LV  +A CFF E+ Y KP  ++V  G+F+P+
Sbjct  150   GVLLTGLSTLILLALQRYGIRKLEFLIAFLVLTIALCFFVELHYSKPDPKEVLYGLFVPQ  209

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SV G+ +ACRY+LIESG AL +A
Sbjct  210   LKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVTGIKEACRYYLIESGLALGMA  269

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
             FLINV+V+SVSG VC+   LS +D   C DL LN ASFLL+NV+GK SS ++AIALLASG
Sbjct  270   FLINVSVISVSGAVCNASDLSPEDRASCEDLDLNKASFLLRNVVGKWSSKLFAIALLASG  329

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiias  1246
             QSSTITGTYAGQY+MQGFLDLK+K W RN +TRC+AI PSLIV++IGGS+GAG+LIIIAS
Sbjct  330   QSSTITGTYAGQYVMQGFLDLKLKPWLRNFLTRCLAIIPSLIVALIGGSAGAGQLIIIAS  389

Query  1247  MILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWL  1426
             MILSFELPFAL+PLLKF+SS TKMG + NS+ I  V+WI+G  I+GINIYYL ++F+  L
Sbjct  390   MILSFELPFALVPLLKFTSSRTKMGSHANSLLISSVTWIIGGLIMGINIYYLVSSFIKLL  449

Query  1427  IHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDK  1537
             +H ++    NV +GI+ F  +AIY+ A+ YL+ RK++
Sbjct  450   LHGHMKLVANVFIGILGFLGIAIYLAAIGYLVLRKNR  486



>ref|XP_007150803.1| hypothetical protein PHAVU_005G182000g [Phaseolus vulgaris]
 ref|XP_007150804.1| hypothetical protein PHAVU_005G182000g [Phaseolus vulgaris]
 gb|ESW22797.1| hypothetical protein PHAVU_005G182000g [Phaseolus vulgaris]
 gb|ESW22798.1| hypothetical protein PHAVU_005G182000g [Phaseolus vulgaris]
Length=544

 Score =   530 bits (1366),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 299/500 (60%), Positives = 390/500 (78%), Gaps = 2/500 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             K  W+   +Y+GPGF+VS+AY+DPGN ETDLQAGA ++YELLW++L+    AL+IQS+AA
Sbjct  41    KRSWKNLFAYMGPGFLVSIAYIDPGNFETDLQAGAQYKYELLWIILVASCAALVIQSMAA  100

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E C+ EYP+   + LW++AE+A++A DIPEVIGTAFALN+LF+IP+W+G
Sbjct  101   NLGVVTGKHLAEHCRTEYPRVPNFILWIIAEIAIVACDIPEVIGTAFALNMLFNIPVWIG  160

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLSTL+LL+LQ+YGVRKLE LIA LVF +AACF  E+ Y KP A++V KG+F+P+L
Sbjct  161   VLLTGLSTLILLALQQYGVRKLEFLIAFLVFTIAACFMAELGYAKPDAKEVIKGLFVPEL  220

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SVRG+N+ACR+++IES FAL VAF
Sbjct  221   KGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVRGINEACRFYMIESAFALMVAF  280

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LINV+V+SVSG VC++  L+ +D   C DL LN ASFLL+NVLGK SS ++ IALLASGQ
Sbjct  281   LINVSVISVSGAVCNSSNLNAEDRMSCQDLDLNEASFLLRNVLGKWSSKLFGIALLASGQ  340

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFL+L+++ W RN++TRC+AI PSLIV++IGGS+GAG+LIIIASM
Sbjct  341   SSTITGTYAGQYVMQGFLNLRLEPWIRNMLTRCLAIVPSLIVAVIGGSAGAGKLIIIASM  400

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFAL+PLLKF+S  TKMG + NS  I  V+WI+G  I+ INIYYL T F+  L+
Sbjct  401   ILSFELPFALVPLLKFTSCKTKMGTHVNSTMISAVTWIIGSLIMVINIYYLITGFIKLLL  460

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQP--NDDDSKMDNNVNNNV  1603
              +++     VL+G++ F  +AIY+  + YL+ RK+   T +      ++ +M N   N  
Sbjct  461   QSHIKIVAKVLLGMLGFSGIAIYLAGITYLVIRKNTEATHLLALTASENQQMTNEQGNGS  520

Query  1604  CMTPIDHNDFSHTLP*LSRP  1663
               +    +  S  LP  S P
Sbjct  521   IYSLPREDIVSMQLPQRSTP  540



>gb|KHN04176.1| Metal transporter Nramp1 [Glycine soja]
Length=545

 Score =   530 bits (1364),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 299/459 (65%), Positives = 376/459 (82%), Gaps = 0/459 (0%)
 Frame = +2

Query  176   GWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAANL  355
             GW+   +YVGPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    AL+IQ++AANL
Sbjct  44    GWKNLFAYVGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALLIQTMAANL  103

Query  356   GVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvgvl  535
             GV TG HL+E CKAEY +   + LW++AE+A++A DIPEVIGTAFALN+LF+IP+WVGVL
Sbjct  104   GVVTGMHLAEHCKAEYSRVPNFILWVIAEIAIVACDIPEVIGTAFALNMLFNIPVWVGVL  163

Query  536   ctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSG  715
              TG STL+LL+LQ+YGVRKLE  IA LVF +A CF  E+ Y KP A++V  G+F+PKL G
Sbjct  164   LTGFSTLILLALQQYGVRKLEFFIAFLVFTIAGCFMAELGYAKPVAKEVVTGLFVPKLQG  223

Query  716   QGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAFLI  895
              GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SVRG+ +ACR+++IES FAL VAFLI
Sbjct  224   HGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVRGIKEACRFYMIESAFALTVAFLI  283

Query  896   NVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSS  1075
             N++V+SVSG VC++  LS +D + C DL LN ASFLL+NVLGK SS ++AIALLASGQSS
Sbjct  284   NISVISVSGAVCNSSNLSVEDQNSCQDLDLNKASFLLRNVLGKWSSKLFAIALLASGQSS  343

Query  1076  TITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasMIL  1255
             TITGTYAGQY+MQGFLDL++K W RNL+TRC+AI PSLIV++IGGS+GAG LIIIASMIL
Sbjct  344   TITGTYAGQYVMQGFLDLRLKSWIRNLLTRCLAIVPSLIVALIGGSAGAGELIIIASMIL  403

Query  1256  SFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLIHN  1435
             SFELPFALIPLLKF+SS  KMG + NSI I  V+WI+G  I+GINIYYL T+FV  L+H 
Sbjct  404   SFELPFALIPLLKFTSSKIKMGEHVNSISISAVTWIIGSLIMGINIYYLLTSFVKLLLHV  463

Query  1436  NLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFI  1552
             +L     V +GI+ F  +A+Y+  + YL+FRK+K  T I
Sbjct  464   HLKIVTKVFLGILGFSGVALYMGGIAYLVFRKNKKTTHI  502



>gb|KDO41576.1| hypothetical protein CISIN_1g008955mg [Citrus sinensis]
Length=547

 Score =   530 bits (1364),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 303/499 (61%), Positives = 386/499 (77%), Gaps = 6/499 (1%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             K  W+   +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    ALIIQSLAA
Sbjct  40    KTSWKNLFAYIGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALIIQSLAA  99

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E C+ EYPK   + LW+LAE+A++A DIPEVIGTAFALN+LF IP+W+G
Sbjct  100   NLGVVTGKHLAEHCRNEYPKVPNFILWVLAEIAIVACDIPEVIGTAFALNMLFKIPVWIG  159

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TG STL+LL+LQ+YGVRKLE LIA LVF MA CFF E+ Y KP A++V  G+F+P+L
Sbjct  160   VLLTGFSTLILLALQQYGVRKLEFLIAFLVFTMAGCFFAELGYAKPEAKEVLHGLFVPQL  219

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGV----NDACRYFLIESGFAL  877
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SVR +     +ACR+++IESGFAL
Sbjct  220   KGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVRSIKSICKEACRFYMIESGFAL  279

Query  878   FVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALL  1057
              VAFLINV+V+SVSG VCS+  ++ +D   C DL LN ASFLL+NVLG  SS ++AIALL
Sbjct  280   AVAFLINVSVISVSGAVCSSSNINPEDQASCKDLDLNKASFLLRNVLGSWSSKLFAIALL  339

Query  1058  ASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrlii  1237
             ASGQSSTITGTYAGQY+MQGFLDL++K W RN +TRC+AI PSLIV++IGGS+GAG+LII
Sbjct  340   ASGQSSTITGTYAGQYVMQGFLDLRLKPWLRNFLTRCLAIVPSLIVALIGGSAGAGQLII  399

Query  1238  iasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFV  1417
             IASMILSFELPFAL+PLLKF+SS  KMG + NSI I  ++WI+G  I+ IN+YYL+T+F+
Sbjct  400   IASMILSFELPFALVPLLKFTSSKVKMGMHANSIAITAITWIIGSLIMIINVYYLATSFI  459

Query  1418  DWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVT-FIQPNDDDSKMDNNVN  1594
              +L H NL     V +GI  F  MA+Y+  V YL+ RK+K  +  +     +++   N +
Sbjct  460   KFLFHGNLKLVEVVFLGIFGFSAMAVYLAGVAYLVLRKNKEASHLLALTTHENQHSTNES  519

Query  1595  NNVCMTPIDHNDF-SHTLP  1648
              N  +  +   D  S  LP
Sbjct  520   GNASLYSLPREDIASMQLP  538



>emb|CDO98224.1| unnamed protein product [Coffea canephora]
Length=536

 Score =   529 bits (1362),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 303/476 (64%), Positives = 379/476 (80%), Gaps = 2/476 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             K  WR F +Y+GPGF+VS+AY+DPGN +TDLQ+GA ++Y LLW++L+  + ALIIQSLAA
Sbjct  39    KKSWRNFFAYLGPGFLVSIAYIDPGNFQTDLQSGAQYKYGLLWIILLASIAALIIQSLAA  98

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E C+ EYPK     LW+LAE+A++A DIPEVIGTAFALN+LF IP+W G
Sbjct  99    NLGVVTGKHLAEHCRKEYPKVANIILWILAEIAIVACDIPEVIGTAFALNMLFKIPIWCG  158

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLSTL+LL LQ+YGVRKLE+LI +LV +MAACFF E+ Y KP + +V  G+F+P+L
Sbjct  159   VLITGLSTLVLLLLQQYGVRKLEILITLLVLIMAACFFVELGYAKPKSSEVLYGLFVPQL  218

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SV G+ +ACR++L+ESGFAL VAF
Sbjct  219   KGSGATKLAISLLGAMVMPHNLFLHSALVLSRKIPRSVSGIKEACRFYLLESGFALMVAF  278

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LINV+V+SVSG VC++  L+ +D  +C DL LN ASFLLK+VLG  SS V+AIALLASGQ
Sbjct  279   LINVSVISVSGAVCNSPDLNPEDEQNCQDLDLNKASFLLKHVLGSWSSKVFAIALLASGQ  338

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDL+MK W RN +TRC+AI PSLIV++IGGS+GAG LIIIASM
Sbjct  339   SSTITGTYAGQYVMQGFLDLQMKPWIRNFLTRCLAIVPSLIVALIGGSAGAGNLIIIASM  398

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFALIPLLKF+SS TKMG + NSI+I   +WI+G  I+GINIYYL+   V  L 
Sbjct  399   ILSFELPFALIPLLKFTSSKTKMGMHANSIWISAATWIIGSLIMGINIYYLAEKLVTTLT  458

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMDNNVNN  1597
             H++L   G V  GI+ F  + +Y+  ++YL+ RK K V  + P  +  +M N   N
Sbjct  459   HSHLRVVGIVFCGILGFSAVLVYLAGILYLVVRKTKKVDILLP--ESLQMANESGN  512



>ref|XP_004486616.1| PREDICTED: metal transporter Nramp6-like isoform X1 [Cicer arietinum]
 ref|XP_004486617.1| PREDICTED: metal transporter Nramp6-like isoform X2 [Cicer arietinum]
Length=552

 Score =   529 bits (1363),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 297/502 (59%), Positives = 394/502 (78%), Gaps = 6/502 (1%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             +  W+ F +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    AL+IQS+AA
Sbjct  49    RSSWKNFFAYMGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALVIQSMAA  108

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E C+AEY +   + LW++AE+A++A DIPEVIGTAFALN+LF+IP+W+G
Sbjct  109   NLGVVTGKHLAEHCRAEYSRVSNFILWIIAEIAIVACDIPEVIGTAFALNMLFNIPVWIG  168

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLSTL+LL+LQ+YGVRKLE LIA LVF +AACF+ E+ Y KP A++V KG+F+P+L
Sbjct  169   VLLTGLSTLMLLALQQYGVRKLEFLIAFLVFTIAACFWAELGYAKPDAKEVVKGLFVPQL  228

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SVRG+ +ACR+++IES FAL VAF
Sbjct  229   KGSGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVRGIKEACRFYMIESAFALMVAF  288

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LINV+V+SVSG +C++  L+++D   C DL LN ASFLL+NVLGK SS ++ +ALLASGQ
Sbjct  289   LINVSVISVSGAICNSSNLNEEDQMSCQDLDLNKASFLLRNVLGKWSSKLFGVALLASGQ  348

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDL++  W RN++TRC+AI PSLIV++IGGS+GAG+LIIIASM
Sbjct  349   SSTITGTYAGQYVMQGFLDLRLTPWIRNMLTRCLAIVPSLIVAVIGGSTGAGKLIIIASM  408

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFAL+PLLKF++S TKMG + NS  I  V+WI+G  I+ INIYYL T F+  L+
Sbjct  409   ILSFELPFALVPLLKFTNSKTKMGAHVNSTMISTVTWIVGSLIMVINIYYLMTGFIKLLL  468

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDK----VVTFIQPNDDDSKMDNNVNN  1597
             H+++     V +GI+ F  MA+Y+  + YL+ RK+K    ++    P +     +  VN 
Sbjct  469   HSDIEMVAKVFLGILGFSGMALYLAGIGYLVLRKNKEGAHLLALTAP-ESQQMANQQVNG  527

Query  1598  NVCMTPIDHNDFSHTLP*LSRP  1663
             ++   P   +  +  LP  S P
Sbjct  528   SIYSLP-REDIVNMQLPQRSSP  548



>ref|XP_007217247.1| hypothetical protein PRUPE_ppa003835mg [Prunus persica]
 gb|EMJ18446.1| hypothetical protein PRUPE_ppa003835mg [Prunus persica]
Length=545

 Score =   529 bits (1362),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 299/496 (60%), Positives = 386/496 (78%), Gaps = 3/496 (1%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             K  W+   +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++Y LLW++L+    ALIIQSLAA
Sbjct  41    KTSWKNLFAYMGPGFLVSIAYIDPGNFETDLQSGAQYKYGLLWIILVASCAALIIQSLAA  100

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E C+AEYP+   + LW+LAE++++A DIPEVIGTAFALN+LF+IP+W+G
Sbjct  101   NLGVVTGKHLAEHCRAEYPRVTNFILWVLAEISIVACDIPEVIGTAFALNMLFNIPIWIG  160

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLSTLLLL+LQ+YGVRKLE LIA LV  +A CFF E+ Y KP A +V  G+F+P+L
Sbjct  161   VLLTGLSTLLLLALQQYGVRKLEFLIAFLVLTIAGCFFAELGYAKPDAAEVLNGLFVPQL  220

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SV G+ +ACR+++IESGFAL VAF
Sbjct  221   KGSGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVCGIKEACRFYMIESGFALMVAF  280

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LINV+V+SVSG VC++  L+ +D  +C+DL LN ASFLL+NVLG  SS ++A+ALLASGQ
Sbjct  281   LINVSVISVSGAVCNSADLNAEDQMNCTDLDLNKASFLLRNVLGSWSSKLFAVALLASGQ  340

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDL++K W RN +TRC+AI PSLIV++IGGS+GAG+LIIIASM
Sbjct  341   SSTITGTYAGQYVMQGFLDLRLKPWLRNFLTRCLAIVPSLIVAVIGGSAGAGKLIIIASM  400

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFALIPLLKF+SS TKMG Y NS  I  ++WI+G  ++ IN+YYL + F+  L+
Sbjct  401   ILSFELPFALIPLLKFTSSKTKMGAYANSTAISAITWIIGSLLMAINVYYLISRFIKLLL  460

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQP--NDDDSKMDNNVNNNV  1603
             H++      V +GI+ F  M +Y+  + YL+FRK+K  T +      +  ++ N    N 
Sbjct  461   HSHFKVLAVVFLGILGFSGMGLYLAGIAYLVFRKNKEATHLLALTTPESRQLANEQQGNA  520

Query  1604  CMTPIDHNDF-SHTLP  1648
              M  +   D  S  LP
Sbjct  521   SMYCLAREDIVSMQLP  536



>ref|XP_003530275.1| PREDICTED: metal transporter Nramp1-like isoform X1 [Glycine 
max]
 ref|XP_006583092.1| PREDICTED: metal transporter Nramp1-like isoform X2 [Glycine 
max]
Length=545

 Score =   529 bits (1362),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 298/459 (65%), Positives = 376/459 (82%), Gaps = 0/459 (0%)
 Frame = +2

Query  176   GWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAANL  355
             GW+   +YVGPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    AL+IQ++AANL
Sbjct  44    GWKNLFAYVGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALLIQTMAANL  103

Query  356   GVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvgvl  535
             GV TG HL+E C+AEY +   + LW++AE+A++A DIPEVIGTAFALN+LF+IP+WVGVL
Sbjct  104   GVVTGMHLAEHCRAEYSRVPNFILWVIAEIAIVACDIPEVIGTAFALNMLFNIPVWVGVL  163

Query  536   ctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSG  715
              TG STL+LL+LQ+YGVRKLE  IA LVF +A CF  E+ Y KP A++V  G+F+PKL G
Sbjct  164   LTGFSTLILLALQQYGVRKLEFFIAFLVFTIAGCFMAELGYAKPVAKEVVAGLFVPKLQG  223

Query  716   QGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAFLI  895
              GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SVRG+ +ACR+++IES FAL VAFLI
Sbjct  224   HGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVRGIKEACRFYMIESAFALTVAFLI  283

Query  896   NVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSS  1075
             N++V+SVSG VC++  LS +D + C DL LN ASFLL+NVLGK SS ++AIALLASGQSS
Sbjct  284   NISVISVSGAVCNSSNLSVEDQNSCQDLDLNKASFLLRNVLGKWSSKLFAIALLASGQSS  343

Query  1076  TITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasMIL  1255
             TITGTYAGQY+MQGFLDL++K W RNL+TRC+AI PSLIV++IGGS+GAG LIIIASMIL
Sbjct  344   TITGTYAGQYVMQGFLDLRLKSWIRNLLTRCLAIVPSLIVALIGGSAGAGELIIIASMIL  403

Query  1256  SFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLIHN  1435
             SFELPFALIPLLKF+SS  KMG + NSI I  V+WI+G  I+GINIYYL T+FV  L+H 
Sbjct  404   SFELPFALIPLLKFTSSKIKMGEHVNSISISAVTWIIGSLIMGINIYYLLTSFVKLLLHV  463

Query  1436  NLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFI  1552
             +L     V +GI+ F  +A+Y+  + YL+FRK+K  T I
Sbjct  464   HLKIVTKVFLGILGFSGVALYMGGIAYLVFRKNKKTTHI  502



>ref|XP_003546914.1| PREDICTED: metal transporter Nramp6-like [Glycine max]
 gb|KHN22404.1| Metal transporter Nramp6 [Glycine soja]
Length=546

 Score =   528 bits (1361),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 299/500 (60%), Positives = 390/500 (78%), Gaps = 2/500 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             +  W+   +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    AL+IQS+AA
Sbjct  41    RRSWKNLFAYMGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILLASCAALVIQSMAA  100

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E C++EYP+   + LW++AE+A++A DIPEVIGTAFALN+LF+IP+W+G
Sbjct  101   NLGVVTGKHLAEHCRSEYPRVPNFILWIIAEIAIVACDIPEVIGTAFALNMLFNIPVWIG  160

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLSTL+LL+LQ+YGVRKLE LIA LVF +AACF  E+ Y KP A++V KG+F+P L
Sbjct  161   VLLTGLSTLILLALQQYGVRKLEFLIAFLVFTIAACFMVELGYAKPDAKEVLKGLFVPGL  220

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SV G+ +ACR+++IES FAL VAF
Sbjct  221   KGSGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVLGIREACRFYMIESAFALMVAF  280

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LIN+ V+SVSGTVC++  L+ +D   C DL LN ASFLL+NVLGK SS ++ IALLASGQ
Sbjct  281   LINICVISVSGTVCNSSNLNAEDQLSCQDLDLNKASFLLRNVLGKWSSKLFGIALLASGQ  340

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDL+++ W RN++TRC+AI PSLIV++IGGS+GAG+LIIIASM
Sbjct  341   SSTITGTYAGQYVMQGFLDLRLEPWIRNMLTRCLAIVPSLIVAVIGGSAGAGKLIIIASM  400

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFAL+PLLKF+SS TKMG + NS  I  V+WI+G  ++ INIYYL T F+  L+
Sbjct  401   ILSFELPFALVPLLKFTSSKTKMGTHVNSTMISAVTWIIGTLLMAINIYYLITGFIKLLL  460

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQP--NDDDSKMDNNVNNNV  1603
             H++L     V +GI+ F  MA+Y+    YL+ RK+K  T +      ++ +M N + N  
Sbjct  461   HSHLKIVAKVFLGILGFSGMAMYLAGTTYLVLRKNKEATHLLALTAPENQQMTNELGNGS  520

Query  1604  CMTPIDHNDFSHTLP*LSRP  1663
               +    +  S  LP  S P
Sbjct  521   IYSLPREDIVSMQLPQRSTP  540



>emb|CDP20210.1| unnamed protein product [Coffea canephora]
Length=509

 Score =   527 bits (1357),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 297/498 (60%), Positives = 384/498 (77%), Gaps = 7/498 (1%)
 Frame = +2

Query  149   LQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFAL  328
             +Q +    P W+K L Y+GPG +VS+AYLDPGNLETDLQAGADH+YELLW+V  GL+FAL
Sbjct  5     VQIKETSSP-WKKLLGYIGPGILVSVAYLDPGNLETDLQAGADHKYELLWIVFAGLLFAL  63

Query  329   IIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILF  508
             +IQS +ANLGV+TGKHLSE CK EYPK V  CLW+LAE+AVIAADIPEVIGTAFALNILF
Sbjct  64    LIQSRSANLGVATGKHLSEHCKKEYPKSVNICLWMLAEIAVIAADIPEVIGTAFALNILF  123

Query  509   HIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFK  688
              IP+W GVL  GL+TL+LL LQRYG+R LE +I++L+ ++  CFF  M + +P  +++  
Sbjct  124   RIPIWSGVLLAGLNTLVLLGLQRYGIRLLEGVISILLLVLGGCFFSVMVHARPSVKEIAM  183

Query  689   GMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESG  868
             G+ IP+LSG  AT DA+ALLGAL+MPHNLFLHSALV++RK+  S  G+  A R FL+ES 
Sbjct  184   GLVIPRLSGGSATRDAVALLGALIMPHNLFLHSALVISRKITRSPDGIRSASRCFLLESS  243

Query  869   FALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAI  1048
              AL  AFLINVAV++VSG+VCS   +S +    C +++L+SA+FLLK+ LGK SS +YAI
Sbjct  244   LALLFAFLINVAVIAVSGSVCSYPNISSESKKQCKNITLDSAAFLLKDALGKWSSKLYAI  303

Query  1049  ALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagr  1228
             +LLASGQSST+TGTYAGQYIMQGFLDL+MK W RNL+TRCIAI PSL+V  +GGS+GAGR
Sbjct  304   SLLASGQSSTVTGTYAGQYIMQGFLDLRMKLWLRNLLTRCIAIAPSLVVCSVGGSAGAGR  363

Query  1229  liiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsT  1408
             LIIIASMILSFELPFALIPLLKF+ S+ KMG +KNSI + + +W+LGL  I INIY+LST
Sbjct  364   LIIIASMILSFELPFALIPLLKFTGSAAKMGLHKNSIVVSLCTWLLGLCSIAINIYFLST  423

Query  1409  AFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMDNN  1588
             + + W+ +  +PKA ++L G+++FPL+ +Y+  + YL+ + +           D   D+N
Sbjct  424   SLLGWITNKKMPKAASILSGLLIFPLITLYIALLAYLILKPETA----SQGSSDFDADSN  479

Query  1589  VNNNVCMTPIDHNDFSHT  1642
              ++     P    +F+HT
Sbjct  480   HHDEAESEP--RAEFNHT  495



>ref|XP_008354189.1| PREDICTED: metal transporter Nramp6-like [Malus domestica]
 ref|XP_008354190.1| PREDICTED: metal transporter Nramp6-like [Malus domestica]
 ref|XP_008354191.1| PREDICTED: metal transporter Nramp6-like [Malus domestica]
Length=545

 Score =   528 bits (1361),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 291/459 (63%), Positives = 374/459 (81%), Gaps = 0/459 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             K  W+   +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++Y LLW++L+    AL+IQSLAA
Sbjct  41    KTSWKNLFAYMGPGFLVSIAYIDPGNFETDLQSGAQYKYGLLWIILVASCAALVIQSLAA  100

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E C+AEYP+   + LW+LAE++++A DIPEVIGTAFALN+LF+IP+W+G
Sbjct  101   NLGVVTGKHLAEHCRAEYPRVTNFILWVLAEISIVACDIPEVIGTAFALNMLFNIPIWIG  160

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLSTL+LL+LQ+YGVRKLE LIA LV  +A CFF E+ Y KP A +V  G+F+P+L
Sbjct  161   VLLTGLSTLILLALQQYGVRKLEFLIAFLVLTIAGCFFAELGYAKPDATEVLGGLFVPQL  220

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SVRG+ +ACR+++IESGFAL VAF
Sbjct  221   KGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVRGIKEACRFYMIESGFALMVAF  280

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LINV+V+SVSG VC++  L+ +D  +C DL LN ASFLL+NVLG  SS ++A+ALLASGQ
Sbjct  281   LINVSVISVSGAVCNSPDLNAEDKMNCQDLDLNKASFLLRNVLGSWSSKLFAVALLASGQ  340

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDL++K W RN +TRC+AI PSLIV++IGGSSGAG+LIIIASM
Sbjct  341   SSTITGTYAGQYVMQGFLDLRLKPWLRNFLTRCLAIVPSLIVAVIGGSSGAGKLIIIASM  400

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFALIPLLKF+S  TKMG + NS  I  ++WI+G  ++ IN+YYL + F+  L+
Sbjct  401   ILSFELPFALIPLLKFTSCKTKMGTHANSTAISALTWIIGSLLMAINVYYLMSRFIKLLL  460

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVT  1546
             HN+    G V +G++ F  M +Y+  + YL+FRK+K  T
Sbjct  461   HNHFKVVGIVFLGMLGFSGMGLYLAGIAYLVFRKNKEAT  499



>gb|KEH39634.1| NRAMP metal ion transporter 6 [Medicago truncatula]
Length=545

 Score =   528 bits (1360),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 301/516 (58%), Positives = 399/516 (77%), Gaps = 6/516 (1%)
 Frame = +2

Query  122   DSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWV  301
             DS N  Q+ + +    +  W+   +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW+
Sbjct  30    DSTNTDQIVVPD----RTSWKNLFAYMGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWI  85

Query  302   VLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIG  481
             +L+    AL+IQS+AANLGV TGKHL+E C+AEY +   + LW++AE+A++A DIPEVIG
Sbjct  86    ILVASCAALVIQSMAANLGVVTGKHLAEHCRAEYSRVSNFILWVIAEIAIVACDIPEVIG  145

Query  482   TAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYV  661
             TAFALN+LF++P+W+GVL TGLSTL+LL+LQ+YGVRKLE LIA LVF +AACF+ E+ Y 
Sbjct  146   TAFALNMLFNVPVWIGVLLTGLSTLMLLALQQYGVRKLEFLIAFLVFTIAACFWAELGYA  205

Query  662   KPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDA  841
             KP A++V KG+F+P+L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SVRG+ +A
Sbjct  206   KPDAKEVVKGLFVPQLKGSGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVRGIKEA  265

Query  842   CRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLG  1021
             CR+++IES FAL VAFLINV+V+SVSG VC++  ++++D   C DL LN ASFLL+NVLG
Sbjct  266   CRFYMIESAFALMVAFLINVSVISVSGAVCNSPNINEEDQMSCQDLDLNKASFLLRNVLG  325

Query  1022  KSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsi  1201
             K SS ++ +ALLASGQSSTITGTYAGQY+MQGFLDL++  W RN++TRC+AI PSLIV++
Sbjct  326   KWSSKLFGVALLASGQSSTITGTYAGQYVMQGFLDLRLTPWIRNMLTRCLAIVPSLIVAV  385

Query  1202  iggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgii  1381
             IGGS+GAG+LIIIASMILSFELPFAL+PLLKF+SS TKMG + NSI I  ++WI+G  I+
Sbjct  386   IGGSAGAGKLIIIASMILSFELPFALVPLLKFTSSKTKMGVHVNSIMISAITWIIGSLIM  445

Query  1382  giniyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVT-FIQP  1558
              INIYYL   F+  LIH+++     V +GI+ F  MA+Y+  + YL+ RK+K  T  +  
Sbjct  446   VINIYYLMNGFIKLLIHSDIEIVAKVFLGILGFSGMAVYLAGIAYLVLRKNKEGTHLLAL  505

Query  1559  NDDDSKMDNNVNNNVCMTPIDHNDF-SHTLP*LSRP  1663
                +S+   N   N  +  +   D  +  LP  S P
Sbjct  506   TAPESQQMTNEQVNGSIYSLQREDIVNMQLPQRSSP  541



>ref|XP_006585608.1| PREDICTED: metal transporter Nramp6-like isoform X1 [Glycine 
max]
 ref|XP_006585609.1| PREDICTED: metal transporter Nramp6-like isoform X2 [Glycine 
max]
 gb|KHN38037.1| Metal transporter Nramp6 [Glycine soja]
Length=550

 Score =   528 bits (1360),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 301/499 (60%), Positives = 388/499 (78%), Gaps = 2/499 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             +  W+   +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    AL+IQ++AA
Sbjct  42    RTSWKNLFAYIGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALLIQTMAA  101

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TG HL+E C+AEY +   + LW++AE+AV+A DIPEVIGTAFALN+LF+IP+W+G
Sbjct  102   NLGVVTGMHLAEHCRAEYSRVPNFILWVIAEIAVVACDIPEVIGTAFALNMLFNIPVWIG  161

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TG STL+LL+LQ+YG+RKLE  IA LVF +A CF  E+ Y KP A++V  G+F+PKL
Sbjct  162   VLLTGSSTLILLALQQYGIRKLEFFIAFLVFTIAGCFMAELGYAKPVAKEVVTGLFVPKL  221

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SVRG+ +ACR+++IES FAL VAF
Sbjct  222   QGHGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVRGIKEACRFYMIESAFALTVAF  281

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LIN++V+SVSG VC++  LS  D + C DL LN ASFLL+NVLGK SS ++AIALLASGQ
Sbjct  282   LINISVISVSGAVCNSSNLSAGDQNSCQDLDLNKASFLLRNVLGKWSSKLFAIALLASGQ  341

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDL++K W RNL+TRC+AI PSLIV++IGGS+GAG LIIIASM
Sbjct  342   SSTITGTYAGQYVMQGFLDLRLKSWIRNLLTRCLAIVPSLIVALIGGSAGAGELIIIASM  401

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFALIPLLKF+SS  KMG + NSI I  ++WI+G  I+GINIYYL T+FV  L+
Sbjct  402   ILSFELPFALIPLLKFTSSKIKMGEHVNSITISAITWIIGSLIMGINIYYLLTSFVKLLL  461

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVT-FIQPNDDDSKMDNNVNNNVC  1606
             H +L     V +GI+ F  + +Y+  + YL+FRK+K  T F+     + +   N   ++ 
Sbjct  462   HVHLKIVTKVFLGILGFSGVTLYMGGIAYLVFRKNKKTTHFLAFRTSEEQQVANEQGDIS  521

Query  1607  MTPIDHNDF-SHTLP*LSR  1660
             M  +   D  S  LP  SR
Sbjct  522   MYNLPREDIVSMQLPQNSR  540



>ref|XP_002527300.1| metal transporter, putative [Ricinus communis]
 gb|EEF35052.1| metal transporter, putative [Ricinus communis]
Length=546

 Score =   528 bits (1359),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 292/455 (64%), Positives = 371/455 (82%), Gaps = 0/455 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             +  W+   +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++Y LLW++L+    AL+IQSLAA
Sbjct  43    RKSWKNLFAYMGPGFLVSIAYIDPGNFETDLQSGAQYKYGLLWIILVASCAALVIQSLAA  102

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E C+ EYP+   + LW+LAE+A++A DIPEVIGTAFALN+LF IP+W+G
Sbjct  103   NLGVVTGKHLAEHCRIEYPRVPNFILWVLAEIAIVACDIPEVIGTAFALNMLFKIPVWIG  162

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLSTL+LL+LQ+YGVRKLE LIA LV  MAACFF E+ Y KP A +V +G+F+P+L
Sbjct  163   VLLTGLSTLILLALQQYGVRKLEFLIAFLVLTMAACFFAELGYAKPAAPEVLEGLFVPQL  222

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SVRG+ +ACR++ IES FAL VAF
Sbjct  223   KGDGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVRGIKEACRFYFIESAFALSVAF  282

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LINV+V+SVSG VC++  L+ +D   C DL LN ASFLLKNVLG  SS ++AIALLASGQ
Sbjct  283   LINVSVISVSGAVCNSPNLNPEDQSKCEDLDLNKASFLLKNVLGSWSSKLFAIALLASGQ  342

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDL++  W RN +TRC+AI PSLIV+++GGS+GAG+LIIIASM
Sbjct  343   SSTITGTYAGQYVMQGFLDLRLVPWVRNFLTRCLAIVPSLIVALVGGSAGAGKLIIIASM  402

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFALIPLLKF+S  TKMG Y NSI I  ++WI+G  ++ IN+YYL TAF+  L 
Sbjct  403   ILSFELPFALIPLLKFTSCKTKMGAYANSIAISAITWIIGSLLMLINVYYLGTAFIKILF  462

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKD  1534
             H++L +   V +G+  F  MA+Y+ A+ YL+FR++
Sbjct  463   HSHLTRVAAVFLGLFGFGAMALYLAAIAYLVFRRN  497



>gb|KEH39635.1| NRAMP metal ion transporter 6 [Medicago truncatula]
Length=570

 Score =   528 bits (1360),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 301/516 (58%), Positives = 399/516 (77%), Gaps = 6/516 (1%)
 Frame = +2

Query  122   DSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWV  301
             DS N  Q+ + +    +  W+   +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW+
Sbjct  55    DSTNTDQIVVPD----RTSWKNLFAYMGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWI  110

Query  302   VLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIG  481
             +L+    AL+IQS+AANLGV TGKHL+E C+AEY +   + LW++AE+A++A DIPEVIG
Sbjct  111   ILVASCAALVIQSMAANLGVVTGKHLAEHCRAEYSRVSNFILWVIAEIAIVACDIPEVIG  170

Query  482   TAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYV  661
             TAFALN+LF++P+W+GVL TGLSTL+LL+LQ+YGVRKLE LIA LVF +AACF+ E+ Y 
Sbjct  171   TAFALNMLFNVPVWIGVLLTGLSTLMLLALQQYGVRKLEFLIAFLVFTIAACFWAELGYA  230

Query  662   KPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDA  841
             KP A++V KG+F+P+L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SVRG+ +A
Sbjct  231   KPDAKEVVKGLFVPQLKGSGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVRGIKEA  290

Query  842   CRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLG  1021
             CR+++IES FAL VAFLINV+V+SVSG VC++  ++++D   C DL LN ASFLL+NVLG
Sbjct  291   CRFYMIESAFALMVAFLINVSVISVSGAVCNSPNINEEDQMSCQDLDLNKASFLLRNVLG  350

Query  1022  KSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsi  1201
             K SS ++ +ALLASGQSSTITGTYAGQY+MQGFLDL++  W RN++TRC+AI PSLIV++
Sbjct  351   KWSSKLFGVALLASGQSSTITGTYAGQYVMQGFLDLRLTPWIRNMLTRCLAIVPSLIVAV  410

Query  1202  iggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgii  1381
             IGGS+GAG+LIIIASMILSFELPFAL+PLLKF+SS TKMG + NSI I  ++WI+G  I+
Sbjct  411   IGGSAGAGKLIIIASMILSFELPFALVPLLKFTSSKTKMGVHVNSIMISAITWIIGSLIM  470

Query  1382  giniyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVT-FIQP  1558
              INIYYL   F+  LIH+++     V +GI+ F  MA+Y+  + YL+ RK+K  T  +  
Sbjct  471   VINIYYLMNGFIKLLIHSDIEIVAKVFLGILGFSGMAVYLAGIAYLVLRKNKEGTHLLAL  530

Query  1559  NDDDSKMDNNVNNNVCMTPIDHNDF-SHTLP*LSRP  1663
                +S+   N   N  +  +   D  +  LP  S P
Sbjct  531   TAPESQQMTNEQVNGSIYSLQREDIVNMQLPQRSSP  566



>ref|XP_010065138.1| PREDICTED: metal transporter Nramp5-like [Eucalyptus grandis]
Length=427

 Score =   522 bits (1345),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 317/390 (81%), Positives = 351/390 (90%), Gaps = 7/390 (2%)
 Frame = +2

Query  419   YCLWLLAELAVIAADI----PEVIGTAFALNILFHIPLWvgvlctglstllllslQRYGV  586
             YCLW LAE+AVIAADI    PEVIGTAFALNILFHIP+W GVL TG ST+ LL LQRYG+
Sbjct  7     YCLWFLAEVAVIAADIAADIPEVIGTAFALNILFHIPVWAGVLLTGFSTIALLGLQRYGI  66

Query  587   RKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMP  766
             RKLELLIA LVF+MAACFFGEM+YVKPPA +V KGMFIPKLSG  AT DAIALLGALVMP
Sbjct  67    RKLELLIATLVFIMAACFFGEMSYVKPPATEVLKGMFIPKLSGNSATGDAIALLGALVMP  126

Query  767   HNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKL  946
             HNLFLHSALVL+RKVP SVRGVNDACR+FLIESGFALFVAFLINVAVVSVSGTVCS   L
Sbjct  127   HNLFLHSALVLSRKVPRSVRGVNDACRFFLIESGFALFVAFLINVAVVSVSGTVCSANNL  186

Query  947   SKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLD  1126
             S ++   C+DL+LNSA+FLLKN+LG+SSSTVYAIALLASGQSSTITGTYAGQYIMQGFLD
Sbjct  187   SSENASQCNDLTLNSAAFLLKNMLGRSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLD  246

Query  1127  LKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasMILSFELPFALIPLLKFSSS  1306
             LKMKKW RNL+TRC+AITPSLIV+I+ GSSGA RLIIIASMILSFELPFALIPLLKFSSS
Sbjct  247   LKMKKWIRNLVTRCVAITPSLIVAILSGSSGASRLIIIASMILSFELPFALIPLLKFSSS  306

Query  1307  STKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPL  1486
             +TKMGP+KNSIYIIV+SWILG+G+IGINIYYLST FV WLI+N++PK  NV +GI+VFPL
Sbjct  307   ATKMGPHKNSIYIIVISWILGVGLIGINIYYLSTGFVGWLINNSVPKVANVFIGILVFPL  366

Query  1487  MAIYVVAVIYLMFRKDKVVTFIQPNDDDSK  1576
             MA+Y+VAVIYL FRKD +VTF   +DD  K
Sbjct  367   MAVYIVAVIYLTFRKDTIVTF---SDDPVK  393



>ref|XP_002966634.1| Nramp family protein [Selaginella moellendorffii]
 gb|EFJ32661.1| Nramp family protein [Selaginella moellendorffii]
Length=533

 Score =   526 bits (1355),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 292/483 (60%), Positives = 377/483 (78%), Gaps = 3/483 (1%)
 Frame = +2

Query  122   DSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWV  301
             D   K Q+++ E+   K GWRK L+++GPGF+V +AY+DPGN E+DLQ+GA+++YELLW+
Sbjct  28    DEPTKYQIEVGEQ---KKGWRKALAFLGPGFLVCIAYIDPGNCESDLQSGAEYKYELLWI  84

Query  302   VLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIG  481
             +L+  V ALIIQSLAANLGV TGKHL+E C+ EYPK V Y LWLLAE++VIAADIPEVIG
Sbjct  85    ILVASVSALIIQSLAANLGVVTGKHLAEHCRTEYPKAVNYVLWLLAEVSVIAADIPEVIG  144

Query  482   TAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYV  661
             TAFALNIL  IP+W+GV+ TG STL+LL+LQ YGVRKLE +I  LV  M  CFF E+ Y 
Sbjct  145   TAFALNILVKIPIWIGVILTGFSTLMLLALQTYGVRKLEFVITGLVMTMTVCFFAELGYA  204

Query  662   KPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDA  841
             KP ++++ KGMF+P+L G GATA AI+LLGA++MPHNL+LHSA+VLTRK+  + RG+ +A
Sbjct  205   KPDSKELLKGMFVPQLRGNGATALAISLLGAMIMPHNLYLHSAIVLTRKISRTPRGLKEA  264

Query  842   CRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLG  1021
             CR+ L ESGFALF AFLINV V+SVSG +CSN  +S+++ D C +L LN ASFLL+NVLG
Sbjct  265   CRFCLFESGFALFFAFLINVCVISVSGAICSNPGISQENKDKCDNLDLNEASFLLQNVLG  324

Query  1022  KSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsi  1201
             + S  ++ IALLASGQSSTITGTYAGQY+MQGFL L+ K W RNLMTR +AI PSLIV++
Sbjct  325   RFSKILFGIALLASGQSSTITGTYAGQYVMQGFLHLRFKPWIRNLMTRAVAIVPSLIVAL  384

Query  1202  iggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgii  1381
             IGGS  AG LII+ SMILSF LPF LIP+LKF+ S  KMGPY NS  I V++W +G G++
Sbjct  385   IGGSRAAGNLIIVCSMILSFVLPFVLIPMLKFTGSKVKMGPYANSWIITVITWGIGGGVM  444

Query  1382  giniyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPN  1561
              IN++YLS++F  WLIH ++   G V++GI V+  + +Y+  V YL  R D+  T+   +
Sbjct  445   AINVWYLSSSFTKWLIHGSMVMGGKVVLGICVYATIVLYMALVAYLTLRIDRENTYCGED  504

Query  1562  DDD  1570
             D +
Sbjct  505   DKE  507



>ref|XP_009387822.1| PREDICTED: metal transporter Nramp3-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009387823.1| PREDICTED: metal transporter Nramp3-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009387824.1| PREDICTED: metal transporter Nramp3-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009387825.1| PREDICTED: metal transporter Nramp3-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009387826.1| PREDICTED: metal transporter Nramp3-like [Musa acuminata subsp. 
malaccensis]
Length=543

 Score =   526 bits (1356),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 302/496 (61%), Positives = 378/496 (76%), Gaps = 4/496 (1%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             ++  W+   +Y+GPGF+VS+AY+DPGN ETDLQAGA   YELLW++L+    AL+IQSLA
Sbjct  41    ERKSWKNLFAYMGPGFLVSIAYIDPGNFETDLQAGAQFTYELLWIILLASCSALVIQSLA  100

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             A LGV TGKHL+E C+AEYPK   + LW+LAELAV+A DIPEVIGTAFALN+LF IP+W 
Sbjct  101   AKLGVVTGKHLAEHCRAEYPKIPNFILWVLAELAVVACDIPEVIGTAFALNMLFKIPVWC  160

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL TGLSTLLLL LQ+YGVRKLE  IA LV  MA CFF E+ Y KP + +V KG+F+P+
Sbjct  161   GVLLTGLSTLLLLLLQQYGVRKLEFFIAFLVLTMAGCFFAELGYAKPKSSEVLKGLFVPQ  220

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P S+ G+ +ACR+++IES FAL VA
Sbjct  221   LKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSIHGIKEACRFYIIESAFALAVA  280

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
             FLINV+V+SVSG VCS+  L+ +D  +CSDL LN ASFLL+NVLG  SS ++AIALLASG
Sbjct  281   FLINVSVISVSGAVCSSEGLNPEDQRNCSDLDLNKASFLLRNVLGNWSSKLFAIALLASG  340

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiias  1246
             QSSTITGTYAGQY+MQGFLDL++  W RNL+TR +AI PSLIV++IGGS+ AG+LIIIAS
Sbjct  341   QSSTITGTYAGQYVMQGFLDLRITPWIRNLLTRSLAIVPSLIVALIGGSTAAGKLIIIAS  400

Query  1247  MILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWL  1426
             MILSFELPFAL+PLLKF+SS TKMG + NS+ I   +WI+   I+ IN YYL T F++ L
Sbjct  401   MILSFELPFALVPLLKFTSSKTKMGSHANSLMIAATTWIISSLIVIINTYYLVTGFINLL  460

Query  1427  IHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQP-NDDDSKMDNNVNNNV  1603
             +H+ L        G+  F  M +YV A++YL+FR ++  T  QP   DDS+      +N 
Sbjct  461   LHSGLHTVSIAFAGVFGFSGMLVYVAAILYLVFRTNRKST--QPLLHDDSQFGQTCESNN  518

Query  1604  CMTPIDHNDF-SHTLP  1648
              +  +   D  S  LP
Sbjct  519   GIYDLPREDIASMQLP  534



>ref|XP_008806825.1| PREDICTED: metal transporter Nramp3-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008806827.1| PREDICTED: metal transporter Nramp3-like isoform X1 [Phoenix 
dactylifera]
Length=550

 Score =   526 bits (1356),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 307/510 (60%), Positives = 395/510 (77%), Gaps = 11/510 (2%)
 Frame = +2

Query  122   DSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWV  301
             D+I+  Q+ + E    +  W+   +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW+
Sbjct  32    DNIDAEQIIVPE----RKSWKNLFAYIGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWI  87

Query  302   VLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIG  481
             +L+    ALIIQSLAA LGV TGKHL+E C+AEYPK   + LW+LAELAV+A DIPEVIG
Sbjct  88    ILVASCAALIIQSLAAKLGVVTGKHLAEHCRAEYPKVPNFILWILAELAVVACDIPEVIG  147

Query  482   TAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYV  661
             TAFALN+LF IP+W GVL TGLSTL+LL LQ+YG+RKLELLIA LVF MA+CFF E+ Y 
Sbjct  148   TAFALNMLFRIPIWCGVLITGLSTLMLLLLQQYGIRKLELLIAFLVFTMASCFFVELGYA  207

Query  662   KPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDA  841
             KP + +V KG+FIP+L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P S+ G+ +A
Sbjct  208   KPSSSEVLKGLFIPQLKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSIHGLKEA  267

Query  842   CRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLG  1021
               ++ +ES FAL VAFLIN++V+SVSG VCS+  LS +D  +C DL LN ASFLL++VLG
Sbjct  268   YWFYTVESAFALSVAFLINISVISVSGAVCSSENLSPEDQRNCEDLDLNKASFLLRHVLG  327

Query  1022  KSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsi  1201
             K SS ++AIALLASGQSSTITGTYAGQY+MQGFLDL++  W RN++TR +AI PSLIV++
Sbjct  328   KWSSKLFAIALLASGQSSTITGTYAGQYVMQGFLDLRITPWIRNMLTRSLAIVPSLIVAL  387

Query  1202  iggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgii  1381
             IGGSS AG+LIIIASMILSFELPFAL+PLLKF+SS TKMG Y NSI I  ++WI+   I+
Sbjct  388   IGGSSAAGQLIIIASMILSFELPFALVPLLKFTSSKTKMGSYANSIIISSITWIISSSIM  447

Query  1382  giniyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQP-  1558
              IN YYL TAF+  L+H+ L     V  G+V F  + +Y VA++YL+FRK++  T  QP 
Sbjct  448   AINTYYLVTAFIKLLLHSGLKTVSIVFAGMVGFSGILVYTVAILYLVFRKNRKST--QPL  505

Query  1559  NDDDSKMDNNVNNNVCMTPIDHNDFSHTLP  1648
                D+++  + NN    +  + N+ ++ LP
Sbjct  506   WLGDAELGQSCNN----SGTEINNSTYALP  531



>ref|XP_004161407.1| PREDICTED: metal transporter Nramp1-like [Cucumis sativus]
Length=521

 Score =   525 bits (1351),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 301/459 (66%), Positives = 378/459 (82%), Gaps = 0/459 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             K  W+   +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++Y LLWV+L+    ALIIQSLAA
Sbjct  41    KESWKNLFAYMGPGFLVSIAYIDPGNFETDLQSGAKYKYGLLWVILVASFAALIIQSLAA  100

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E CKAEYPK   + LW+LAE+A++A DIPEVIGTAFALN+LF IP+W G
Sbjct  101   NLGVVTGKHLAEHCKAEYPKVQNFILWVLAEIAIVACDIPEVIGTAFALNMLFSIPVWCG  160

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLSTLLLL+LQ+YG+RKLE LIA LV  +A CFF E+ Y KP A ++F G+F+P+L
Sbjct  161   VLLTGLSTLLLLALQQYGIRKLEFLIAFLVLTIAVCFFLELGYAKPDAGEIFYGLFVPQL  220

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P S+ G+ +ACR+++IESGFAL VAF
Sbjct  221   KGSGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSLSGIKEACRFYMIESGFALMVAF  280

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LINV+V+SVSG VCS+  L+K+D   C+DL LN ASFLL+NVLGK SS ++AIALLASGQ
Sbjct  281   LINVSVISVSGAVCSSPDLNKEDQMSCNDLDLNKASFLLRNVLGKWSSKIFAIALLASGQ  340

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDLK+  W RN++TR +AI PSLIV++IGGSSGAG+LIIIASM
Sbjct  341   SSTITGTYAGQYVMQGFLDLKLTPWIRNILTRSLAIIPSLIVALIGGSSGAGKLIIIASM  400

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFAL+PLLKF+SS  KMGP+ NS  I V++WI+GL I+ INIYYL   F+D L+
Sbjct  401   ILSFELPFALVPLLKFTSSKAKMGPHVNSTAITVLTWIIGLLIMAINIYYLMGRFIDVLL  460

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVT  1546
             HN+L  A  VL+G++ F  +A+Y+  + YL+ +K K ++
Sbjct  461   HNDLHLAAVVLIGVLGFSGVALYLAGIAYLVLKKTKKIS  499



>ref|XP_007135815.1| hypothetical protein PHAVU_010G160800g [Phaseolus vulgaris]
 ref|XP_007135816.1| hypothetical protein PHAVU_010G160800g [Phaseolus vulgaris]
 ref|XP_007135817.1| hypothetical protein PHAVU_010G160800g [Phaseolus vulgaris]
 gb|ESW07809.1| hypothetical protein PHAVU_010G160800g [Phaseolus vulgaris]
 gb|ESW07810.1| hypothetical protein PHAVU_010G160800g [Phaseolus vulgaris]
 gb|ESW07811.1| hypothetical protein PHAVU_010G160800g [Phaseolus vulgaris]
Length=544

 Score =   526 bits (1354),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 303/496 (61%), Positives = 385/496 (78%), Gaps = 4/496 (1%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             +  W+   +YVGPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    AL+IQ++AA
Sbjct  41    RTSWKNLFAYVGPGFLVSIAYIDPGNFETDLQSGAKYKYELLWIILVASCAALLIQTMAA  100

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TG HL+E C+AEY +   + LW++AE+AV+A DIPEVIGTAFALN+LF+IP+W+G
Sbjct  101   NLGVVTGMHLAEHCRAEYSRLPNFILWVIAEIAVVACDIPEVIGTAFALNMLFNIPVWIG  160

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TG STL+LL+LQ+YGVRKLE  IA LVF +A CF  E+ Y KP A++V  G+F+PKL
Sbjct  161   VLLTGFSTLVLLALQQYGVRKLEFFIAFLVFTIAGCFMAELGYAKPVAKEVVTGLFVPKL  220

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SVRG+ +ACR++++ES  AL VAF
Sbjct  221   EGHGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVRGIKEACRFYMMESALALTVAF  280

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LIN++V+SVSG VCS+  LS +D + C DL LN ASFLL+NVLGK SS ++AIALLASGQ
Sbjct  281   LINISVISVSGAVCSSSNLSAEDQNSCQDLDLNKASFLLRNVLGKWSSKLFAIALLASGQ  340

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDL++K W RNL+TR +AI PSLIV++IGGS+GAG LIIIASM
Sbjct  341   SSTITGTYAGQYVMQGFLDLRLKSWIRNLLTRSLAIVPSLIVALIGGSAGAGELIIIASM  400

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFALIPLLKF+SS  KMG + NSI I  V+WI+G  I+GINIYYL T+FV  L+
Sbjct  401   ILSFELPFALIPLLKFTSSKIKMGEHVNSITISAVTWIIGSLIMGINIYYLVTSFVKLLL  460

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQ--PNDDDSKMDNNVNNNV  1603
             H  L     V +GI+ F  +A+Y+  + YL+FRK+   T+I      +D  M N    +V
Sbjct  461   HAELRIVTTVFLGILGFSGVALYMGGIAYLVFRKNTKTTYILTFSTSEDQNMANE-QGDV  519

Query  1604  CMTPIDHNDF-SHTLP  1648
              M  +   D  S  LP
Sbjct  520   SMYCLPREDIVSMQLP  535



>ref|XP_010265997.1| PREDICTED: metal transporter Nramp6-like isoform X2 [Nelumbo 
nucifera]
Length=406

 Score =   520 bits (1338),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 284/392 (72%), Positives = 337/392 (86%), Gaps = 0/392 (0%)
 Frame = +2

Query  164   NKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSL  343
              + P W+K L +VGPGF+VS AYLDPGNLETDLQAGADH++ELLWVVL+G+ FALIIQS 
Sbjct  8     QETPRWKKILGFVGPGFLVSAAYLDPGNLETDLQAGADHKHELLWVVLVGVSFALIIQSR  67

Query  344   AANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLW  523
             +ANLGV+TGKHLSE CKAEYP+ V YCLW+LAE+AVIAADIPEVIGTAFALNIL +IP+W
Sbjct  68    SANLGVATGKHLSEHCKAEYPRPVNYCLWVLAEIAVIAADIPEVIGTAFALNILLNIPIW  127

Query  524   vgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIP  703
              GVL  GL+TLLLL LQR+G+RKLE+ I VL+ +M  CFFG MA+ KP   ++ KGMF+P
Sbjct  128   SGVLLAGLNTLLLLGLQRFGIRKLEIAIGVLLLMMGGCFFGVMAHAKPDPREIVKGMFVP  187

Query  704   KLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFV  883
             KL G GAT DA+ALLGAL+MPHNLFLHSALV +RK+P S  G+N ACR+FLIE G AL V
Sbjct  188   KLKGDGATRDAVALLGALIMPHNLFLHSALVTSRKIPRSFNGINSACRHFLIEGGIALLV  247

Query  884   AFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLAS  1063
             AFLINV+VVSVS +VC +  LS ++  HC D++LNSA+FLLKN LGK SS +YA++LLAS
Sbjct  248   AFLINVSVVSVSSSVCYSPGLSLENKTHCEDITLNSAAFLLKNALGKWSSRLYALSLLAS  307

Query  1064  GQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiia  1243
             GQSST+TGTYAGQYIMQGFLDLKM+ W RNL+TRCIAI PSL+ SI+GGSSGAG+LIIIA
Sbjct  308   GQSSTVTGTYAGQYIMQGFLDLKMELWIRNLLTRCIAIAPSLVASIVGGSSGAGKLIIIA  367

Query  1244  sMILSFELPFALIPLLKFSSSSTKMGPYKNSI  1339
             SMILSFELPFAL+PLL+F+SS TKMG +KNS+
Sbjct  368   SMILSFELPFALVPLLRFTSSKTKMGHHKNSL  399



>ref|XP_002273263.1| PREDICTED: metal transporter Nramp6 [Vitis vinifera]
 ref|XP_010655022.1| PREDICTED: metal transporter Nramp6 [Vitis vinifera]
 emb|CBI38940.3| unnamed protein product [Vitis vinifera]
Length=541

 Score =   525 bits (1351),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 301/478 (63%), Positives = 383/478 (80%), Gaps = 2/478 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             +  W+   +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    ALIIQSLAA
Sbjct  38    RKSWKNLFAYMGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALIIQSLAA  97

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E C+ EYPK   + LW+LAE+AV+A DIPEVIGTAFALN+LF+IP+W G
Sbjct  98    NLGVVTGKHLAEHCRIEYPKVPNFILWVLAEIAVVACDIPEVIGTAFALNMLFNIPVWCG  157

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLSTL+LL+LQ+YGVRKLE  IA LV  +AACFF E+ Y KP + +V +G+F+P+L
Sbjct  158   VLLTGLSTLVLLALQQYGVRKLEFFIAFLVLTIAACFFVELGYAKPNSSEVLRGLFVPQL  217

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SVRG+ +ACR+++IESGFAL VAF
Sbjct  218   KGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVRGIKEACRFYMIESGFALMVAF  277

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LINV+V+ VSG VCS+  L+ DD + C DL LN ASFLL+NVLGK SS ++AIALLASGQ
Sbjct  278   LINVSVICVSGAVCSSSNLNLDDQESCKDLDLNKASFLLRNVLGKWSSKLFAIALLASGQ  337

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDL+++ W RN +TRC+AI PSLIV+IIGGSSGAG+LIIIASM
Sbjct  338   SSTITGTYAGQYVMQGFLDLRLQPWIRNFLTRCLAIIPSLIVAIIGGSSGAGKLIIIASM  397

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFALIPLLKF+S  TKMG Y NS  I  ++WI+G  ++ INIYYL+++F+  L+
Sbjct  398   ILSFELPFALIPLLKFTSCKTKMGAYVNSTMITAITWIIGSLLMAINIYYLASSFIKLLL  457

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFI--QPNDDDSKMDNNVNN  1597
             H++L     V  GI+ F  M +YV  + YL+FRK+K  T +      ++ ++ N+V  
Sbjct  458   HSHLKLVAAVFAGIIGFSGMIVYVCGIGYLVFRKNKKATHLLALATAENGELTNDVGG  515



>gb|KGN58625.1| hypothetical protein Csa_3G702630 [Cucumis sativus]
Length=521

 Score =   523 bits (1348),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 301/459 (66%), Positives = 378/459 (82%), Gaps = 0/459 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             K  W+   +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++Y LLWV+L+    ALIIQSLAA
Sbjct  41    KESWKNLFAYMGPGFLVSIAYIDPGNFETDLQSGAKYKYGLLWVILVASFAALIIQSLAA  100

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E CKAEYPK   + LW+LAE+A++A DIPEVIGTAFALN+LF IP+W G
Sbjct  101   NLGVVTGKHLAEHCKAEYPKVQNFILWVLAEIAIVACDIPEVIGTAFALNMLFSIPVWCG  160

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLSTLLLL+LQ+YG+RKLE LIA LV  +A CFF E+ Y KP A ++F G+F+P+L
Sbjct  161   VLLTGLSTLLLLALQQYGIRKLEFLIAFLVLTIAVCFFLELGYAKPDAGEIFYGLFVPQL  220

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P S+ G+ +ACR+++IESGFAL VAF
Sbjct  221   KGSGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSLSGIKEACRFYMIESGFALMVAF  280

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LINV+V+SVSG VCS+  L+K+D   C+DL LN ASFLL+NVLGK SS ++AIALLASGQ
Sbjct  281   LINVSVISVSGAVCSSPDLNKEDQMSCNDLDLNKASFLLRNVLGKWSSKLFAIALLASGQ  340

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDLK+  W RN++TR +AI PSLIV++IGGSSGAG+LIIIASM
Sbjct  341   SSTITGTYAGQYVMQGFLDLKLTPWIRNILTRSLAIIPSLIVALIGGSSGAGKLIIIASM  400

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFAL+PLLKF+SS  KMGP+ NS  I V++WI+GL I+ INIYYL   F+D L+
Sbjct  401   ILSFELPFALVPLLKFTSSKAKMGPHVNSTAITVLTWIIGLLIMAINIYYLMGRFIDVLL  460

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVT  1546
             HN+L  A  VL+G++ F  +A+Y+  + YL+ +K K ++
Sbjct  461   HNDLHLAAVVLIGVLGFSGVALYLAGIAYLVLKKTKKIS  499



>ref|XP_010926919.1| PREDICTED: metal transporter Nramp3-like isoform X1 [Elaeis guineensis]
Length=550

 Score =   525 bits (1351),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 307/494 (62%), Positives = 385/494 (78%), Gaps = 7/494 (1%)
 Frame = +2

Query  122   DSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWV  301
             D+I+  Q+ + E    +  W+   +Y+GPGF+VS+AY+DPGN ETDLQAGA ++YELLW+
Sbjct  32    DNIDAEQIIVPE----RKSWKNLFAYIGPGFLVSIAYIDPGNFETDLQAGAQYKYELLWI  87

Query  302   VLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIG  481
             +L+    ALIIQSLAA LGV TGKHL+E C+AEYPK   + LW+LAELAV+A DIPEVIG
Sbjct  88    ILVASCAALIIQSLAAKLGVVTGKHLAEHCRAEYPKVPNFILWILAELAVVACDIPEVIG  147

Query  482   TAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYV  661
             TAFALN+LF IP+W GVL TGLSTL+LL LQ+YGVRKLE LIA LVF MA+CFF E+ Y 
Sbjct  148   TAFALNMLFRIPVWCGVLITGLSTLMLLLLQQYGVRKLEFLIAFLVFTMASCFFVELGYA  207

Query  662   KPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDA  841
             KP + +V KG+F+P+L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P S+ G+ +A
Sbjct  208   KPNSSEVLKGLFVPQLKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSIHGIKEA  267

Query  842   CRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLG  1021
              R++ IES  ALFVAFLINV+V+SVSG VCS+  LS +D  +C DL LN ASFLL+NVLG
Sbjct  268   YRFYTIESALALFVAFLINVSVISVSGAVCSSDNLSPEDQRNCEDLDLNKASFLLRNVLG  327

Query  1022  KSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsi  1201
             K SS ++A ALLASGQSSTITGTYAGQY+MQGFLDL++  W RN++TR +AI PSLIV++
Sbjct  328   KWSSKLFAFALLASGQSSTITGTYAGQYVMQGFLDLRITPWIRNMLTRSLAIVPSLIVAL  387

Query  1202  iggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgii  1381
             IGGSS AG+LIIIASMILSFELPFAL+PLLKF+SS TKMG Y NSI I  ++WI+   I+
Sbjct  388   IGGSSAAGKLIIIASMILSFELPFALVPLLKFTSSKTKMGSYSNSIIISSITWIISSSIV  447

Query  1382  giniyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPN  1561
              IN YYL T F++ L+HN L     V  GIV F  M +Y  A++YL+ RK+   T  QP 
Sbjct  448   AINSYYLITGFINLLLHNGLKTVSIVFAGIVGFSGMLVYAAAILYLVIRKNSKST--QPL  505

Query  1562  -DDDSKMDNNVNNN  1600
               D++++  + NN+
Sbjct  506   WLDEAELGQSCNNS  519



>ref|XP_010910516.1| PREDICTED: metal transporter Nramp5-like, partial [Elaeis guineensis]
Length=385

 Score =   518 bits (1335),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 283/364 (78%), Positives = 328/364 (90%), Gaps = 0/364 (0%)
 Frame = +2

Query  251   ETDLQAGADHRYELLWVVLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLW  430
             ETDLQAGA+HRYELLWV+LI LVFALIIQSLAANLGV+TGKHL+ELCKAEYPKY+K+CLW
Sbjct  1     ETDLQAGANHRYELLWVLLIALVFALIIQSLAANLGVTTGKHLAELCKAEYPKYIKFCLW  60

Query  431   LLAELAVIAADIPEVIGTAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIA  610
             LLAE+AVIAADIPEVIGTAFALNILFHIP+W GVL TGL+TLLLL LQRYGVRKLE+LI+
Sbjct  61    LLAEVAVIAADIPEVIGTAFALNILFHIPVWTGVLITGLNTLLLLGLQRYGVRKLEILIS  120

Query  611   VLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSA  790
             +LV ++AAC+F E+ YVKPPA +V KG+F+P+L G GA AD+IA+LG  V PHNLFLHSA
Sbjct  121   MLVSVLAACYFAELGYVKPPASEVLKGLFVPRLKGSGALADSIAMLGQNVPPHNLFLHSA  180

Query  791   LVLTRKVPNSVRGVNDACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHC  970
             LVL+RK P S +G+N+ACRYFL+E+ FA+FVA LIN+AVVSVSGTVC+   LS+++ + C
Sbjct  181   LVLSRKTPPSAKGINNACRYFLLETAFAMFVALLINIAVVSVSGTVCAADSLSQENSNRC  240

Query  971   SDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSR  1150
             +DL+LNSASFL KNVLGKSS  VYAIALLASGQSS I+ T AGQYIMQGFLD++ +KW R
Sbjct  241   NDLNLNSASFLFKNVLGKSSFVVYAIALLASGQSSAISCTCAGQYIMQGFLDIEARKWLR  300

Query  1151  NLMTRCIAITPslivsiiggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYK  1330
             NL+TRCIAI PSLIV+IIGGSSGAGRLIIIASMILSFELPFALIPLLKFSS  TKMGP+K
Sbjct  301   NLVTRCIAIVPSLIVAIIGGSSGAGRLIIIASMILSFELPFALIPLLKFSSGGTKMGPHK  360

Query  1331  NSIY  1342
             NSI+
Sbjct  361   NSIF  364



>ref|XP_002978108.1| hypothetical protein SELMODRAFT_418073 [Selaginella moellendorffii]
 gb|EFJ20765.1| hypothetical protein SELMODRAFT_418073 [Selaginella moellendorffii]
Length=555

 Score =   525 bits (1351),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 292/483 (60%), Positives = 376/483 (78%), Gaps = 4/483 (1%)
 Frame = +2

Query  122   DSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWV  301
             D   K Q+++ E    K GWRK L+++GPGF+V +AY+DPGN E+DLQ+GA+++YELLW+
Sbjct  28    DEPTKYQIEVGE----KKGWRKALAFLGPGFLVCIAYIDPGNFESDLQSGAEYKYELLWI  83

Query  302   VLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIG  481
             +L+  V ALIIQSLAANLGV TGKHL+E C+ EYPK V Y LWLLAE++VIAADIPEVIG
Sbjct  84    ILVASVSALIIQSLAANLGVVTGKHLAEHCRTEYPKAVNYVLWLLAEVSVIAADIPEVIG  143

Query  482   TAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYV  661
             TAFALNIL  IP+W+GV+ TG STLLLL+LQ YGVRKLE +I  LV  M  CFF E+ Y 
Sbjct  144   TAFALNILVKIPIWIGVILTGFSTLLLLALQTYGVRKLEFVITGLVMTMTVCFFAELGYA  203

Query  662   KPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDA  841
             KP ++++ +GMF+P+L G GATA AI+LLGA++MPHNL+LHSA+VLTRK+  + RG+ +A
Sbjct  204   KPDSKELLRGMFVPQLRGNGATALAISLLGAMIMPHNLYLHSAIVLTRKISRTPRGLKEA  263

Query  842   CRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLG  1021
             CR+ L ESGFALF AFLINV V+SVSG +CSN  +S+++ D C +L LN ASFLL+NVLG
Sbjct  264   CRFCLFESGFALFFAFLINVCVISVSGAICSNPGISQENKDKCDNLDLNEASFLLQNVLG  323

Query  1022  KSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsi  1201
             + S  ++ IALLASGQSSTITGTYAGQY+MQGFL L+ K W RNLMTR +AI PSLIV++
Sbjct  324   RFSKILFGIALLASGQSSTITGTYAGQYVMQGFLHLRFKPWIRNLMTRAVAIVPSLIVAL  383

Query  1202  iggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgii  1381
             IGGS  AG LII+ SMILSF LPF LIP+LKF+ S  KMGPY NS  I V++W +G G++
Sbjct  384   IGGSRAAGNLIIVCSMILSFVLPFVLIPMLKFTGSKVKMGPYANSWIITVITWGIGGGVM  443

Query  1382  giniyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPN  1561
              IN++YLS++F  WLIH ++   G V++GI V+  + +Y+  V YL  R D+  T+   +
Sbjct  444   AINVWYLSSSFTKWLIHGSMVMGGKVVLGICVYATILLYMALVAYLTLRIDRENTYCAED  503

Query  1562  DDD  1570
             D +
Sbjct  504   DKE  506



>gb|EMS65084.1| Metal transporter Nramp3 [Triticum urartu]
Length=565

 Score =   525 bits (1351),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 298/493 (60%), Positives = 372/493 (75%), Gaps = 21/493 (4%)
 Frame = +2

Query  122   DSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWV  301
             DSI+  Q+ + E+++    W+   SY+GPGF+VS+AY+DPGN ETDLQAGA ++YELLW+
Sbjct  33    DSIDVDQIVIPEKNS----WKNLFSYIGPGFLVSIAYIDPGNFETDLQAGAQYKYELLWI  88

Query  302   VLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIG  481
             +LI    AL+IQSLAA+LGV TGKHL+E C+ EYPK   + LW+LAELAV+A DIPEVIG
Sbjct  89    ILIASCAALVIQSLAASLGVVTGKHLAEHCRDEYPKVTNFILWILAELAVVACDIPEVIG  148

Query  482   TAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYV  661
             TAFALN+LF IP+W GVL TGLSTL+LL LQ+YGVRKLE LIA LVFL+A CF  E+ Y 
Sbjct  149   TAFALNMLFKIPIWCGVLITGLSTLMLLFLQQYGVRKLEFLIAFLVFLIATCFLVELGYS  208

Query  662   KPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDA  841
             KP + +V +G+F+P++ G GAT  AI+LLGA+VMPHNLFLHSALVL+RKVP SV G+ +A
Sbjct  209   KPNSSEVVRGLFVPEIKGDGATGLAISLLGAMVMPHNLFLHSALVLSRKVPRSVHGIKEA  268

Query  842   CRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLG  1021
             CR+++IES FAL VAFLIN++++SVSG VCS   L+ +D  +C+DL LN ASFLLKNVLG
Sbjct  269   CRFYMIESAFALTVAFLINISIISVSGAVCSADNLNPEDRMNCNDLDLNKASFLLKNVLG  328

Query  1022  KSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsi  1201
               SS V+AIALLASGQSSTITGTYAGQY+MQGFLDL+M  W RNL+TR +AI PSLIVS+
Sbjct  329   NWSSKVFAIALLASGQSSTITGTYAGQYVMQGFLDLRMTPWLRNLLTRSLAIVPSLIVSL  388

Query  1202  iggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgii  1381
             IGGSS AG+LIIIASMILSFELPFAL+PLLKF+SS TKMGP+ NS +    + I+   I 
Sbjct  389   IGGSSAAGKLIIIASMILSFELPFALVPLLKFTSSKTKMGPHTNSRFQSNYTHIIARPIS  448

Query  1382  giniyyl-----------------sTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAV  1510
                   +                  T+FV  L+H+ L     V  GI  F  M IY+ A+
Sbjct  449   IPMQISVLTWAIGSFIMVINIYFLITSFVRLLLHSGLSTVSQVFSGIFGFLGMLIYIAAI  508

Query  1511  IYLMFRKDKVVTF  1549
             +YL+FRK++  T 
Sbjct  509   LYLVFRKNRKCTL  521



>ref|XP_008652227.1| PREDICTED: metal transporter Nramp5 [Zea mays]
 tpg|DAA60202.1| TPA: hypothetical protein ZEAMMB73_089397 [Zea mays]
Length=449

 Score =   520 bits (1339),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 317/395 (80%), Positives = 363/395 (92%), Gaps = 0/395 (0%)
 Frame = +2

Query  368   GKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvgvlctgl  547
             G+HL+E+CK+EYPK+V+ CLW+LAE+AVIAADIPEVIGTAFA N+LFHIP+WVGVL TG 
Sbjct  12    GRHLAEICKSEYPKFVRICLWILAEVAVIAADIPEVIGTAFAFNLLFHIPVWVGVLITGS  71

Query  548   stllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSGQGAT  727
             STLLLL LQRYGVRKLE LI++LVF+MAACFFGE+++VKPPA DV KG+FIP+L G GAT
Sbjct  72    STLLLLGLQRYGVRKLEFLISMLVFVMAACFFGELSFVKPPAVDVVKGLFIPRLKGDGAT  131

Query  728   ADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAFLINVAV  907
             ADAIALLGALVMPHNLFLHSALVL+RK P+SVRG+ DACR+FL ESGFALFVA LIN+AV
Sbjct  132   ADAIALLGALVMPHNLFLHSALVLSRKTPSSVRGIKDACRFFLYESGFALFVALLINIAV  191

Query  908   VSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITG  1087
             +SVSGTVC +G LS +D   CSDLSL+S+SFLLKNVLG+SSS VY +ALLASGQSSTITG
Sbjct  192   ISVSGTVCFSGNLSPEDAGKCSDLSLDSSSFLLKNVLGRSSSIVYGVALLASGQSSTITG  251

Query  1088  TYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasMILSFEL  1267
             TY+GQYIMQGFLD++MKKW RNLMTRCIAI PSL+VSIIGGSSGAGRLIIIASMILSFEL
Sbjct  252   TYSGQYIMQGFLDIRMKKWLRNLMTRCIAIAPSLVVSIIGGSSGAGRLIIIASMILSFEL  311

Query  1268  PFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLIHNNLPK  1447
             PFALIPLLKFSSSS+KMGP+KNSIYIIV SW+LGL IIGIN+Y+LST+FV WL+HN+LPK
Sbjct  312   PFALIPLLKFSSSSSKMGPHKNSIYIIVFSWLLGLMIIGINMYFLSTSFVGWLVHNSLPK  371

Query  1448  AGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFI  1552
               NVLVG++VFPLM +YVVAVIYL FRKD VVTF+
Sbjct  372   YANVLVGLLVFPLMLVYVVAVIYLTFRKDTVVTFV  406



>gb|KFK43835.1| hypothetical protein AALP_AA1G179700 [Arabis alpina]
Length=511

 Score =   521 bits (1343),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 295/457 (65%), Positives = 377/457 (82%), Gaps = 0/457 (0%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             +K  W+ F SY+GPGF+VS+AY+DPGN ETDLQAGA ++YELLW++L+    AL+IQSLA
Sbjct  32    EKKSWKNFFSYLGPGFLVSIAYIDPGNFETDLQAGAQYKYELLWIILVASCAALVIQSLA  91

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGV TGKHL+E C+AEY K   + LW++AE+AV+A DIPEVIGTAFALN+LF+IP+W+
Sbjct  92    ANLGVVTGKHLAEHCRAEYSKVPNFMLWVVAEIAVVACDIPEVIGTAFALNMLFNIPVWI  151

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL TGLSTL+LL+LQ+YG+RKLE LI  LV  +A CFF E+ Y KP  ++V  G+F+P+
Sbjct  152   GVLLTGLSTLILLALQQYGIRKLEFLIVFLVLTIALCFFVELHYSKPDPKEVLYGLFVPQ  211

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SV G+ +ACRY+LIESG AL VA
Sbjct  212   LKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVTGIKEACRYYLIESGLALMVA  271

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
             FLINV+V+SVSG VC+   LS +D   C DL LN ASFLL+NV+GK SS ++AIALLASG
Sbjct  272   FLINVSVISVSGAVCNASDLSPEDKASCEDLDLNKASFLLRNVVGKWSSKIFAIALLASG  331

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiias  1246
             QSSTITGTYAGQY+MQGFLDLK+K W RN +TRC+AI PSLIVS+IGGS+GAG+LIIIAS
Sbjct  332   QSSTITGTYAGQYVMQGFLDLKLKPWLRNFLTRCLAIIPSLIVSLIGGSAGAGKLIIIAS  391

Query  1247  MILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWL  1426
             MILSFELPF+L+PLLKF+SS+TKMG + NS+ I  V+W++G  I+GINIYYL ++F+  L
Sbjct  392   MILSFELPFSLVPLLKFTSSNTKMGTHANSLLISSVTWLIGGLIMGINIYYLVSSFIKLL  451

Query  1427  IHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDK  1537
             +H+++     V +G++ F  +AIY+ A+ YL+ RK++
Sbjct  452   LHSHMKLVAIVFLGLLGFSGIAIYLAAIAYLVLRKNR  488



>ref|XP_010537873.1| PREDICTED: metal transporter Nramp6 [Tarenaya hassleriana]
Length=535

 Score =   522 bits (1345),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 295/460 (64%), Positives = 376/460 (82%), Gaps = 0/460 (0%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             +K  W+ F +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    ALIIQSLA
Sbjct  38    EKKSWKNFFAYLGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALIIQSLA  97

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGV TGKHL+E C+AEY K   + LW++AE+A++A DIPEVIGTAFALN+LF+IP+W+
Sbjct  98    ANLGVVTGKHLAEHCRAEYSKVPNFILWVIAEIAIVACDIPEVIGTAFALNMLFNIPVWI  157

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL TGLSTL+LL+LQ+YG+RKLE  IA LVF +A CFF E+ Y +P A +V  G+F+P+
Sbjct  158   GVLLTGLSTLVLLALQQYGIRKLEFFIAFLVFTIAICFFIELHYSRPDAGEVLHGLFVPQ  217

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SV G+ +ACR++LIESG AL VA
Sbjct  218   LKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVTGIKEACRFYLIESGLALMVA  277

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
             FLINV+V+SVSG VC    LS +D   C DL LN ASFLL+NVLGK SS  +AIALLASG
Sbjct  278   FLINVSVISVSGAVCKAPDLSPEDRASCEDLDLNKASFLLRNVLGKWSSKFFAIALLASG  337

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiias  1246
             QSSTITGTYAGQY+MQGFLDL++K W RNL+TRC+AI PSLIV++IGGSSGAGRLIIIAS
Sbjct  338   QSSTITGTYAGQYVMQGFLDLRLKPWIRNLLTRCLAIIPSLIVALIGGSSGAGRLIIIAS  397

Query  1247  MILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWL  1426
             MILSFELPFAL+PLLKF+SS TKMG + N++ I  ++WI+G  I+GINIYY+ ++F+  L
Sbjct  398   MILSFELPFALVPLLKFTSSKTKMGSHANTLLISSLTWIIGALIMGINIYYIVSSFIKVL  457

Query  1427  IHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVT  1546
             +H+++     V  GI+ F  +A+Y+ A+ YL+ RK++  T
Sbjct  458   LHSHMKLVAVVFCGILGFSAIAVYLAAIAYLVLRKNRKST  497



>gb|AAM63430.1| metal ion transporter [Arabidopsis thaliana]
Length=532

 Score =   522 bits (1345),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 296/474 (62%), Positives = 383/474 (81%), Gaps = 0/474 (0%)
 Frame = +2

Query  164   NKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSL  343
             ++K  W+ F +Y+GPGF+VS+AY+DPGN ETDLQAGA ++YELLW++L+    AL+IQSL
Sbjct  38    SEKKSWKNFFAYLGPGFLVSIAYIDPGNFETDLQAGAHYKYELLWIILVASCAALVIQSL  97

Query  344   AANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLW  523
             AANLGV TGKHL+E C+AEY K   + LW++AE+AV+A DIPEVIGTAFALN+LF IP+W
Sbjct  98    AANLGVVTGKHLAEQCRAEYSKVPNFMLWVVAEIAVVACDIPEVIGTAFALNMLFSIPVW  157

Query  524   vgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIP  703
             +GVL TGLSTL+LL+LQ+YGVRKLE LIA LVF +A CFF E+ Y KP   +V  G+F+P
Sbjct  158   IGVLLTGLSTLILLALQKYGVRKLEFLIAFLVFTIAICFFVELHYSKPDPGEVLHGLFVP  217

Query  704   KLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFV  883
             +L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P S  G+ +ACR++LIESG AL V
Sbjct  218   QLKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSASGIKEACRFYLIESGLALMV  277

Query  884   AFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLAS  1063
             AFLINV+V+SVSG VC+   LS +D  +C DL LN ASFLL+NV+GK SS ++AIALLAS
Sbjct  278   AFLINVSVISVSGAVCNAPNLSPEDRANCEDLDLNKASFLLRNVVGKWSSKLFAIALLAS  337

Query  1064  GQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiia  1243
             GQSSTITGTYAGQY+MQGFLDL+++ W RNL+TRC+AI PSLIV++IGGS+GAG+LIIIA
Sbjct  338   GQSSTITGTYAGQYVMQGFLDLRLEPWLRNLLTRCLAIIPSLIVALIGGSAGAGKLIIIA  397

Query  1244  sMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDW  1423
             SMILSFELPFAL+PLLKF+S  TKMG + N + I  ++W++G  I+GINIYYL ++F+  
Sbjct  398   SMILSFELPFALVPLLKFTSCKTKMGSHVNPMAITALTWVIGGLIMGINIYYLVSSFIKL  457

Query  1424  LIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMDN  1585
             LIH+++     V  GI+ F  +A+Y+ A+ YL+FRK++V T +  + D   ++ 
Sbjct  458   LIHSHMKLILVVFCGILGFAGIALYLAAIAYLVFRKNRVATSLLISRDSQNVET  511



>ref|NP_178198.1| metal transporter Nramp1 [Arabidopsis thaliana]
 sp|Q9SAH8.1|NRAM1_ARATH RecName: Full=Metal transporter Nramp1; Short=AtNramp1 [Arabidopsis 
thaliana]
 gb|AAF14670.1|AC011713_18 Identical to gb|AF181687 metal ion transporter from Arabidopsis 
thaliana. ESTs gb|Z30530, gb|AA585940, gb|AI998720 and gb|Z33946 
come from this gene [Arabidopsis thaliana]
 gb|AAF36535.1|AF165125_1 NRAMP1 protein [Arabidopsis thaliana]
 gb|ABK32114.1| At1g80830 [Arabidopsis thaliana]
 gb|AEE36455.1| metal transporter Nramp1 [Arabidopsis thaliana]
Length=532

 Score =   522 bits (1344),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 296/474 (62%), Positives = 383/474 (81%), Gaps = 0/474 (0%)
 Frame = +2

Query  164   NKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSL  343
             ++K  W+ F +Y+GPGF+VS+AY+DPGN ETDLQAGA ++YELLW++L+    AL+IQSL
Sbjct  38    SEKKSWKNFFAYLGPGFLVSIAYIDPGNFETDLQAGAHYKYELLWIILVASCAALVIQSL  97

Query  344   AANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLW  523
             AANLGV TGKHL+E C+AEY K   + LW++AE+AV+A DIPEVIGTAFALN+LF IP+W
Sbjct  98    AANLGVVTGKHLAEQCRAEYSKVPNFMLWVVAEIAVVACDIPEVIGTAFALNMLFSIPVW  157

Query  524   vgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIP  703
             +GVL TGLSTL+LL+LQ+YGVRKLE LIA LVF +A CFF E+ Y KP   +V  G+F+P
Sbjct  158   IGVLLTGLSTLILLALQKYGVRKLEFLIAFLVFTIAICFFVELHYSKPDPGEVLHGLFVP  217

Query  704   KLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFV  883
             +L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P S  G+ +ACR++LIESG AL V
Sbjct  218   QLKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSASGIKEACRFYLIESGLALMV  277

Query  884   AFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLAS  1063
             AFLINV+V+SVSG VC+   LS +D  +C DL LN ASFLL+NV+GK SS ++AIALLAS
Sbjct  278   AFLINVSVISVSGAVCNAPNLSPEDRANCEDLDLNKASFLLRNVVGKWSSKLFAIALLAS  337

Query  1064  GQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiia  1243
             GQSSTITGTYAGQY+MQGFLDL+++ W RNL+TRC+AI PSLIV++IGGS+GAG+LIIIA
Sbjct  338   GQSSTITGTYAGQYVMQGFLDLRLEPWLRNLLTRCLAIIPSLIVALIGGSAGAGKLIIIA  397

Query  1244  sMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDW  1423
             SMILSFELPFAL+PLLKF+S  TKMG + N + I  ++W++G  I+GINIYYL ++F+  
Sbjct  398   SMILSFELPFALVPLLKFTSCKTKMGSHVNPMAITALTWVIGGLIMGINIYYLVSSFIKL  457

Query  1424  LIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMDN  1585
             LIH+++     V  GI+ F  +A+Y+ A+ YL+FRK++V T +  + D   ++ 
Sbjct  458   LIHSHMKLILVVFCGILGFAGIALYLAAIAYLVFRKNRVATSLLISRDSQNVET  511



>gb|AAD54417.1| metal ion transporter [Arabidopsis thaliana]
Length=532

 Score =   522 bits (1344),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 296/474 (62%), Positives = 382/474 (81%), Gaps = 0/474 (0%)
 Frame = +2

Query  164   NKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSL  343
             ++K  W+ F +Y+GPGF+VS+AY+DPGN ETDLQAGA ++YELLW++L+    AL+IQSL
Sbjct  38    SEKKSWKNFFAYLGPGFLVSIAYIDPGNFETDLQAGAHYKYELLWIILVASCAALVIQSL  97

Query  344   AANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLW  523
             AANLGV TGKHL+E C+AEY K   + LW++AE+AV+A DIPEVIGTAFALN+LF IP+W
Sbjct  98    AANLGVVTGKHLAEQCRAEYSKVPNFMLWVVAEIAVVACDIPEVIGTAFALNMLFSIPVW  157

Query  524   vgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIP  703
             +GVL TGLSTL+LL+LQ+YGVRKLE LIA LVF +A CFF E+ Y KP   +V  G+F+P
Sbjct  158   IGVLLTGLSTLILLALQKYGVRKLEFLIAFLVFTIAICFFVEIHYSKPDPGEVLHGLFVP  217

Query  704   KLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFV  883
             +L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P S  G+ +ACR++LIESG AL V
Sbjct  218   QLKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSASGIKEACRFYLIESGLALMV  277

Query  884   AFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLAS  1063
             AFLINV+V+SVSG VC+   LS +D  +C DL LN ASFLL+NV+GK SS ++AIALLAS
Sbjct  278   AFLINVSVISVSGAVCNAPNLSPEDRANCEDLDLNKASFLLRNVVGKWSSKLFAIALLAS  337

Query  1064  GQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiia  1243
             GQSSTITGTYAGQY+MQGFLDL+++ W RNL+TRC+AI PSLIV++IGGS+GAG+LIIIA
Sbjct  338   GQSSTITGTYAGQYVMQGFLDLRLEPWLRNLLTRCLAIIPSLIVALIGGSAGAGKLIIIA  397

Query  1244  sMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDW  1423
             SMILSFELPFAL+PLLKF+S  TKMG + N + I   +W++G  I+GINIYYL ++F+  
Sbjct  398   SMILSFELPFALVPLLKFTSCKTKMGSHVNPMAITAFTWVIGGLIMGINIYYLVSSFIKL  457

Query  1424  LIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMDN  1585
             LIH+++     V  GI+ F  +A+Y+ A+ YL+FRK++V T +  + D   ++ 
Sbjct  458   LIHSHMKLILVVFCGILGFAGIALYLAAIAYLVFRKNRVATSLLISRDSQNVET  511



>ref|NP_173048.3| metal transporter Nramp6 [Arabidopsis thaliana]
 sp|Q9S9N8.2|NRAM6_ARATH RecName: Full=Metal transporter Nramp6; Short=AtNramp6 [Arabidopsis 
thaliana]
 emb|CAC28123.1| putative metal transporter [Arabidopsis thaliana]
 gb|AEE29390.1| metal transporter Nramp6 [Arabidopsis thaliana]
Length=527

 Score =   520 bits (1340),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 294/457 (64%), Positives = 377/457 (82%), Gaps = 0/457 (0%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             +K  W+ F SY+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    AL+IQSLA
Sbjct  31    EKKSWKNFFSYLGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALVIQSLA  90

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGV TGKHL+E C+AEY K   + LW++AE+AV+A DIPEVIGTAFALN+LF+IP+W+
Sbjct  91    ANLGVVTGKHLAEHCRAEYSKVPNFMLWVVAEIAVVACDIPEVIGTAFALNMLFNIPVWI  150

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL TGLSTL+LL+LQ+YG+RKLE LIA LVF +A CFF E+ Y KP  ++V  G+F+P+
Sbjct  151   GVLLTGLSTLILLALQQYGIRKLEFLIAFLVFTIALCFFVELHYSKPDPKEVLYGLFVPQ  210

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SV G+ +ACRY+LIESG AL VA
Sbjct  211   LKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVTGIKEACRYYLIESGLALMVA  270

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
             FLINV+V+SVSG VC+   LS +D   C DL LN ASFLL+NV+GK SS ++AIALLASG
Sbjct  271   FLINVSVISVSGAVCNASDLSPEDRASCQDLDLNKASFLLRNVVGKWSSKLFAIALLASG  330

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiias  1246
             QSSTITGTYAGQY+MQGFLDL+++ W RN +TRC+AI PSLIV++IGGS+GAG+LIIIAS
Sbjct  331   QSSTITGTYAGQYVMQGFLDLRLEPWLRNFLTRCLAIIPSLIVALIGGSAGAGKLIIIAS  390

Query  1247  MILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWL  1426
             MILSFELPFAL+PLLKF+SS TKMG + NS+ I  V+WI+G  I+GINIYYL ++F+  L
Sbjct  391   MILSFELPFALVPLLKFTSSKTKMGSHANSLVISSVTWIIGGLIMGINIYYLVSSFIKLL  450

Query  1427  IHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDK  1537
             +H+++     V +G++ F  +A Y+ A+ YL+ RK++
Sbjct  451   LHSHMNLVAIVFLGVLGFSGIATYLAAISYLVLRKNR  487



>ref|XP_004486619.1| PREDICTED: metal transporter Nramp6-like isoform X4 [Cicer arietinum]
Length=494

 Score =   519 bits (1336),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 294/492 (60%), Positives = 388/492 (79%), Gaps = 6/492 (1%)
 Frame = +2

Query  200   VGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAANLGVSTGKHL  379
             +GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    AL+IQS+AANLGV TGKHL
Sbjct  1     MGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALVIQSMAANLGVVTGKHL  60

Query  380   SELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvgvlctglstll  559
             +E C+AEY +   + LW++AE+A++A DIPEVIGTAFALN+LF+IP+W+GVL TGLSTL+
Sbjct  61    AEHCRAEYSRVSNFILWIIAEIAIVACDIPEVIGTAFALNMLFNIPVWIGVLLTGLSTLM  120

Query  560   llslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADAI  739
             LL+LQ+YGVRKLE LIA LVF +AACF+ E+ Y KP A++V KG+F+P+L G GAT  AI
Sbjct  121   LLALQQYGVRKLEFLIAFLVFTIAACFWAELGYAKPDAKEVVKGLFVPQLKGSGATGLAI  180

Query  740   ALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAFLINVAVVSVS  919
             +LLGA+VMPHNLFLHSALVL+RK+P SVRG+ +ACR+++IES FAL VAFLINV+V+SVS
Sbjct  181   SLLGAMVMPHNLFLHSALVLSRKIPRSVRGIKEACRFYMIESAFALMVAFLINVSVISVS  240

Query  920   GTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAG  1099
             G +C++  L+++D   C DL LN ASFLL+NVLGK SS ++ +ALLASGQSSTITGTYAG
Sbjct  241   GAICNSSNLNEEDQMSCQDLDLNKASFLLRNVLGKWSSKLFGVALLASGQSSTITGTYAG  300

Query  1100  QYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasMILSFELPFAL  1279
             QY+MQGFLDL++  W RN++TRC+AI PSLIV++IGGS+GAG+LIIIASMILSFELPFAL
Sbjct  301   QYVMQGFLDLRLTPWIRNMLTRCLAIVPSLIVAVIGGSTGAGKLIIIASMILSFELPFAL  360

Query  1280  IPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLIHNNLPKAGNV  1459
             +PLLKF++S TKMG + NS  I  V+WI+G  I+ INIYYL T F+  L+H+++     V
Sbjct  361   VPLLKFTNSKTKMGAHVNSTMISTVTWIVGSLIMVINIYYLMTGFIKLLLHSDIEMVAKV  420

Query  1460  LVGIVVFPLMAIYVVAVIYLMFRKDK----VVTFIQPNDDDSKMDNNVNNNVCMTPIDHN  1627
              +GI+ F  MA+Y+  + YL+ RK+K    ++    P +     +  VN ++   P   +
Sbjct  421   FLGILGFSGMALYLAGIGYLVLRKNKEGAHLLALTAP-ESQQMANQQVNGSIYSLP-RED  478

Query  1628  DFSHTLP*LSRP  1663
               +  LP  S P
Sbjct  479   IVNMQLPQRSSP  490



>ref|XP_010459132.1| PREDICTED: metal transporter Nramp6-like isoform X2 [Camelina 
sativa]
Length=527

 Score =   520 bits (1340),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 297/474 (63%), Positives = 384/474 (81%), Gaps = 5/474 (1%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             +K  W+ F SY+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    AL+IQSLA
Sbjct  34    EKKSWKNFFSYLGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALVIQSLA  93

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGV TGKHL+E C+AEY K   + LW++AE+AV+A DIPEVIGTAFALN+LF+IP+W+
Sbjct  94    ANLGVVTGKHLAEHCRAEYSKVPNFMLWVVAEIAVVACDIPEVIGTAFALNMLFNIPVWI  153

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL TGLSTL+LL+LQRYG+RKLE LIA LVF +A CFF E+ Y KP  ++V  G+F+P+
Sbjct  154   GVLLTGLSTLILLALQRYGIRKLEFLIAFLVFTIALCFFVELHYSKPDPKEVLYGLFVPQ  213

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SV G+ +ACRY+LIESG AL VA
Sbjct  214   LKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVPGIKEACRYYLIESGLALSVA  273

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
             FLINV+V+SVSG VC+   LS +D   C DL LN ASFLL+NV+GK SS ++AIALLASG
Sbjct  274   FLINVSVISVSGAVCNAPDLSPEDRASCEDLDLNKASFLLRNVVGKWSSKIFAIALLASG  333

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiias  1246
             QSSTITGTYAGQY+MQGFL+L+++ W RN +TRC+AI PSLIV++IGGS+GAG+LIIIAS
Sbjct  334   QSSTITGTYAGQYVMQGFLNLRLQPWLRNFLTRCLAIIPSLIVALIGGSAGAGKLIIIAS  393

Query  1247  MILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWL  1426
             MILSFELPFAL+PLLKF+SS TKMG + NS+ I  V+WI+G  I+GINIYY+ ++F+  L
Sbjct  394   MILSFELPFALVPLLKFTSSRTKMGSHANSLLISAVTWIIGGLIMGINIYYIVSSFIKLL  453

Query  1427  IHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMDNN  1588
             +H+++     V +GI+ F  +A+Y+ A+ YL+ RK++     +P+      DN+
Sbjct  454   LHSHMKLVAIVFLGILGFSGIALYLAAIGYLVLRKNR-----EPSTQYLPSDNS  502



>ref|XP_010497540.1| PREDICTED: metal transporter Nramp6 [Camelina sativa]
 ref|XP_010497544.1| PREDICTED: metal transporter Nramp6 [Camelina sativa]
Length=524

 Score =   520 bits (1339),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 296/474 (62%), Positives = 384/474 (81%), Gaps = 1/474 (0%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             +K  W+ F SY+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    AL+IQSLA
Sbjct  31    EKKSWKNFFSYLGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALVIQSLA  90

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGV TGKHL+E C+AEY K   + LW++AE+AV+A DIPEVIGTAFALN+LF+IP+W+
Sbjct  91    ANLGVVTGKHLAEHCRAEYSKVPNFMLWVVAEIAVVACDIPEVIGTAFALNMLFNIPVWI  150

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL TGLSTL+LL+LQRYG+RKLE LIA LVF +A CFF E+ Y KP  ++V  G+F+P+
Sbjct  151   GVLLTGLSTLILLALQRYGIRKLEFLIAFLVFTIALCFFVEIHYSKPDPKEVLYGLFVPQ  210

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SV G+ +ACRY+LIESG AL VA
Sbjct  211   LKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVPGIKEACRYYLIESGLALSVA  270

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
             FLINV+V+SVSG VC+   LS +D   C DL LN ASFLL+NV+GK SS ++AIALLASG
Sbjct  271   FLINVSVISVSGAVCNASDLSPEDRASCEDLDLNKASFLLRNVVGKWSSKIFAIALLASG  330

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiias  1246
             QSSTITGTYAGQY+MQGFL+L+++ W RN +TRC+AI PSLIV++IGGS+GAG+LIIIAS
Sbjct  331   QSSTITGTYAGQYVMQGFLNLRLQPWLRNFLTRCLAIIPSLIVALIGGSAGAGKLIIIAS  390

Query  1247  MILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWL  1426
             MILSFELPFAL+PLLKF+SS TKMG + NS+ I  V+WI+G  I+GINIYY+ ++F+  L
Sbjct  391   MILSFELPFALVPLLKFTSSRTKMGSHANSLLISAVTWIIGGLIMGINIYYIVSSFIKLL  450

Query  1427  IHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDK-VVTFIQPNDDDSKMDN  1585
             +H+++     V +G++ F  +A+Y+ A+ YL+ RK++   T   P+D+    + 
Sbjct  451   LHSHMKLVAIVFLGLLGFSGIALYLAAIGYLVLRKNRESSTQYLPSDNSQTAET  504



>ref|XP_002887809.1| NRAMP1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64068.1| NRAMP1 [Arabidopsis lyrata subsp. lyrata]
Length=526

 Score =   520 bits (1338),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 294/474 (62%), Positives = 383/474 (81%), Gaps = 0/474 (0%)
 Frame = +2

Query  164   NKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSL  343
             ++K  W+ F +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    AL+IQSL
Sbjct  32    SEKKSWKNFFAYLGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALVIQSL  91

Query  344   AANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLW  523
             AANLGV TGKHL+E C+AEY K   + LW++AE+AV+A DIPEVIGTAFALN+LF IP+W
Sbjct  92    AANLGVVTGKHLAEQCRAEYSKVPNFMLWVVAEIAVVACDIPEVIGTAFALNMLFSIPVW  151

Query  524   vgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIP  703
             +GVL TGLSTL+LL+LQ+YGVRKLE LIA LVF +A CFF E+ Y KP   +V  G+F+P
Sbjct  152   IGVLLTGLSTLILLALQKYGVRKLEFLIAFLVFTIAICFFVELHYSKPDPGEVLHGLFVP  211

Query  704   KLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFV  883
             +L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P S  G+ +ACR++LIESG AL V
Sbjct  212   QLKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSASGIKEACRFYLIESGLALMV  271

Query  884   AFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLAS  1063
             AFLINV+V+SVSG VC+   LS +D  +C DL LN ASFLL+NV+GK SS ++AIALLAS
Sbjct  272   AFLINVSVISVSGAVCNAPNLSPEDRANCEDLDLNKASFLLRNVVGKWSSKLFAIALLAS  331

Query  1064  GQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiia  1243
             GQSSTITGTYAGQY+MQGFLDL+++ W RNL+TRC+AI PSLIV++IGGS+GAG+LIIIA
Sbjct  332   GQSSTITGTYAGQYVMQGFLDLRLEPWLRNLLTRCLAIIPSLIVALIGGSAGAGKLIIIA  391

Query  1244  sMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDW  1423
             SMILSFELPFAL+PLLKF+S  TKMG + N + I  ++W++G  I+GINIYYL ++F+  
Sbjct  392   SMILSFELPFALVPLLKFTSCKTKMGSHVNPMAISALTWVIGGLIMGINIYYLVSSFIKL  451

Query  1424  LIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMDN  1585
             LIH+++  A  V  GI+ F  +A+Y+ A+ YL+FRK++  T +  + +   ++ 
Sbjct  452   LIHSHMKLALVVFCGILGFAGIALYLAAIAYLVFRKNREATPLLASRNSQNVET  505



>ref|XP_010034028.1| PREDICTED: metal transporter Nramp6 isoform X1 [Eucalyptus grandis]
 ref|XP_010034029.1| PREDICTED: metal transporter Nramp6 isoform X1 [Eucalyptus grandis]
 gb|KCW53902.1| hypothetical protein EUGRSUZ_J03115 [Eucalyptus grandis]
Length=537

 Score =   520 bits (1339),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 294/481 (61%), Positives = 375/481 (78%), Gaps = 1/481 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             +  W+   +Y+GPGF+VS+AY+DPGN ETDLQAGA ++YELLW++L+    AL+IQSLAA
Sbjct  37    RKSWKNLFAYMGPGFLVSIAYIDPGNFETDLQAGAQYKYELLWIILVASCAALVIQSLAA  96

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
              LGV TGKHL+E  + EYPK   + LW+LAE++++A DIPEVIGTAFALN+LF IPLW G
Sbjct  97    KLGVVTGKHLAEHFRMEYPKVPNFILWVLAEISIVACDIPEVIGTAFALNMLFKIPLWCG  156

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLSTL+LL+LQ+YGVRKLE LIA LVF +AACFFGE+ Y KP A +V  G+F+P+L
Sbjct  157   VLLTGLSTLMLLALQQYGVRKLEFLIAFLVFTIAACFFGELGYAKPVASEVLNGLFVPQL  216

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SVRG+ +ACR++ IES FAL VAF
Sbjct  217   KGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVRGIKEACRFYTIESAFALMVAF  276

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LIN++V+SVSG VC++  L+  D   C DL LN ASFLL+NVLG  SS ++AIALLASGQ
Sbjct  277   LINISVISVSGAVCNSTSLNPQDKASCQDLDLNKASFLLRNVLGSWSSKLFAIALLASGQ  336

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDL++  W RN +TRC+AI PSLIV++IGGS+GAG+LIIIASM
Sbjct  337   SSTITGTYAGQYVMQGFLDLRLTPWVRNFLTRCLAIIPSLIVALIGGSAGAGKLIIIASM  396

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFAL+PLLKF+SS TKMG Y N   +  V+WI+G  I+GIN+YYL T F+  L+
Sbjct  397   ILSFELPFALVPLLKFTSSKTKMGQYANQTMVAAVTWIIGFLIMGINVYYLVTGFIKLLL  456

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVT-FIQPNDDDSKMDNNVNNNVC  1606
             ++ +     V+ GI+ F  MA+Y+  + YL+ RK+K  +  +     +S+   N   +  
Sbjct  457   NSPMKLGAKVVCGILGFSGMAVYLAGITYLVLRKNKEASHLLALTTAESQQSENGQGDAS  516

Query  1607  M  1609
             M
Sbjct  517   M  517



>ref|XP_004160334.1| PREDICTED: LOW QUALITY PROTEIN: metal transporter Nramp6-like 
[Cucumis sativus]
Length=544

 Score =   520 bits (1339),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 303/494 (61%), Positives = 388/494 (79%), Gaps = 1/494 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             K  W+   +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++Y LLW++L+    ALIIQSLAA
Sbjct  41    KKSWKNLFAYMGPGFLVSIAYIDPGNFETDLQSGAQYKYGLLWIILVASFAALIIQSLAA  100

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E CKAEYPK   + LW+LAE+A++A DIPEVIGTAFALN+LF IP+W G
Sbjct  101   NLGVVTGKHLAEHCKAEYPKAQNFILWVLAEIAIVACDIPEVIGTAFALNMLFSIPVWCG  160

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLSTLLLL+LQ+YG+RKLE LIA LV  +A CFF E+ Y KP   ++F G+F+P+L
Sbjct  161   VLLTGLSTLLLLALQQYGIRKLEFLIAFLVLTIAICFFLELGYAKPDVGEIFYGLFVPQL  220

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P S+ G+ +ACR+++IESGFAL VAF
Sbjct  221   KGSGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSLSGIKEACRFYMIESGFALMVAF  280

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LINV+V+SVSG VC++  L+K+D   C+DL LN ASFLL+NVLGK SS ++AIALLASGQ
Sbjct  281   LINVSVISVSGAVCNSPDLNKEDQMSCNDLDLNKASFLLRNVLGKWSSKLFAIALLASGQ  340

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDLK+  W RN +TR +AI PSLIV+IIGGSSGAG+LIIIASM
Sbjct  341   SSTITGTYAGQYVMQGFLDLKLTPWVRNFLTRSLAIVPSLIVAIIGGSSGAGKLIIIASM  400

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFAL+PLLKF+SS  KMGP+ NS  I V++WI+G  I+ INIYYL + F+  L+
Sbjct  401   ILSFELPFALVPLLKFTSSKAKMGPHVNSTAITVLTWIIGFLIMAINIYYLMSRFIHVLL  460

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVT-FIQPNDDDSKMDNNVNNNVC  1606
             HN+L  A  + +GI+ F  +A+Y+  + YL+ RK K ++  +    ++S+  +N  +   
Sbjct  461   HNDLHLAVVIFIGILGFSGVALYLAGIAYLVLRKTKEISHLLALTAEESRRLSNELSKTS  520

Query  1607  MTPIDHNDFSHTLP  1648
                + + D S  LP
Sbjct  521   GYDLPNEDVSMQLP  534



>ref|XP_010258654.1| PREDICTED: metal transporter Nramp6-like [Nelumbo nucifera]
 ref|XP_010258655.1| PREDICTED: metal transporter Nramp6-like [Nelumbo nucifera]
Length=545

 Score =   520 bits (1338),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 306/504 (61%), Positives = 390/504 (77%), Gaps = 13/504 (3%)
 Frame = +2

Query  152   QEEHNK-----KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGL  316
              EE N+     +  W+   SY+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+  
Sbjct  31    NEETNQIIVPDRKSWKNLFSYMGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVAS  90

Query  317   VFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFAL  496
               ALIIQSLAANLGV TGKHL+E C+AEYPK   + LWLLAE+A++A DIPEVIGTAFAL
Sbjct  91    CAALIIQSLAANLGVVTGKHLAEHCRAEYPKVPNFILWLLAEIAIVACDIPEVIGTAFAL  150

Query  497   NILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAE  676
             N+LF+IP+W GVL TG STL+LL+LQ+YGVRKLE LIA LV  +AACFF E+ Y KP + 
Sbjct  151   NMLFNIPVWCGVLLTGFSTLVLLALQQYGVRKLEFLIAFLVLTIAACFFAELGYAKPNSS  210

Query  677   DVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFL  856
             +V KG+FIP+L G GAT  AI+LLGA+VMPHNLFLHSALVL+R++P S+ G+ +ACR++ 
Sbjct  211   EVIKGLFIPQLKGNGATGLAISLLGAMVMPHNLFLHSALVLSRRIPRSIHGIKEACRFYT  270

Query  857   IESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSST  1036
             IES FAL VAFLINV+V+SVSG+VC++  LS +D   C+DL LN ASFLL+NVLG  SS 
Sbjct  271   IESAFALLVAFLINVSVISVSGSVCNSSNLSPEDQTSCNDLDLNKASFLLRNVLGSWSSK  330

Query  1037  VYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggss  1216
             ++AIALLASGQSSTITGTYAGQY+MQGFLDL++  W RN +TRC+AI PSL V+IIGGS+
Sbjct  331   LFAIALLASGQSSTITGTYAGQYVMQGFLDLRITPWIRNFLTRCLAIVPSLTVAIIGGSA  390

Query  1217  gagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiy  1396
             GAG+LIIIASMILSFELPFALIPLLKF+SS TKMG + NS  I V++WI+G  I+ INIY
Sbjct  391   GAGKLIIIASMILSFELPFALIPLLKFTSSKTKMGSHANSTMISVITWIIGSLIMAINIY  450

Query  1397  ylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSK  1576
             YL+T FV  L+++ L     V  G+  F  M +Y+  ++YL+ RK+K VT + P ++   
Sbjct  451   YLATGFVKLLLNSGLEVVAIVFAGLFGFSGMLVYLAGILYLVIRKNKEVTHLLPLEESVN  510

Query  1577  MDNNVNNNVCMTPIDHNDFSHTLP  1648
             +  N N +        N+  ++LP
Sbjct  511   LPRNSNCD--------NEILYSLP  526



>ref|XP_007023419.1| NRAMP metal ion transporter 6 isoform 1 [Theobroma cacao]
 ref|XP_007023420.1| NRAMP metal ion transporter 6 isoform 1 [Theobroma cacao]
 gb|EOY26041.1| NRAMP metal ion transporter 6 isoform 1 [Theobroma cacao]
 gb|EOY26042.1| NRAMP metal ion transporter 6 isoform 1 [Theobroma cacao]
Length=543

 Score =   519 bits (1337),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 300/503 (60%), Positives = 391/503 (78%), Gaps = 4/503 (1%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             ++  W+   +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    AL+IQSLA
Sbjct  38    ERKSWKNLFAYMGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALVIQSLA  97

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGV TGKHL+E C+AEYP+   + LW+LAE+AV+A DIPEVIGTAFALN+LF+IP+W+
Sbjct  98    ANLGVVTGKHLAEHCRAEYPRGPNFILWVLAEIAVVACDIPEVIGTAFALNMLFNIPVWI  157

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL TGLSTL+LL+LQ+YGVRKLE+ I+ LV  +A CF  E+ Y KP A +V KG+F+P+
Sbjct  158   GVLLTGLSTLVLLALQQYGVRKLEIFISFLVLTIAGCFLAELGYAKPVAGEVLKGLFVPQ  217

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             L G GAT  AI+LLGA+VMPHNLFLHSALVL+R++P SV+G+ +ACR+++IESGFAL VA
Sbjct  218   LKGNGATGLAISLLGAMVMPHNLFLHSALVLSRRIPRSVQGIKEACRFYMIESGFALMVA  277

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
             FLINV+++SVSG VC++  ++ +D   C DL LN ASFLL+NVLG  SS ++ IALLASG
Sbjct  278   FLINVSIISVSGAVCNSSNMNPEDQASCEDLDLNKASFLLRNVLGSWSSKLFGIALLASG  337

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiias  1246
             QSSTITGTYAGQY+MQGFLDL++K W RN +TRC+AI PSLIV+IIGGS+GAG+LIIIAS
Sbjct  338   QSSTITGTYAGQYVMQGFLDLRLKPWLRNFLTRCLAIVPSLIVAIIGGSAGAGKLIIIAS  397

Query  1247  MILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWL  1426
             MILSFELPFALIPLLKF+SS TKMG + NS  +  ++WI+G  I+GINIYYL T+F+ +L
Sbjct  398   MILSFELPFALIPLLKFTSSETKMGEHANSTAVSAIAWIIGSLIMGINIYYLVTSFIHFL  457

Query  1427  IHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVT-FIQPNDDDSKMDNNVNNNV  1603
             + ++      V +GI  F  +AIY+ AV YL+FR +K  T  +     DS+   N +   
Sbjct  458   LQSHWKLIAVVFLGIFGFVGVAIYLAAVAYLVFRPNKKATHLLALTTPDSRHMVNGSGRT  517

Query  1604  CMTPIDHNDF-SHTLP*LSRPDQ  1669
              +  +   D  S  LP   R +Q
Sbjct  518   SVDCLPREDIVSMQLP--QRREQ  538



>gb|KGN58662.1| hypothetical protein Csa_3G714870 [Cucumis sativus]
Length=574

 Score =   520 bits (1338),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 303/494 (61%), Positives = 388/494 (79%), Gaps = 1/494 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             K  W+   +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++Y LLW++L+    +LII SLAA
Sbjct  71    KKSWKNLFAYMGPGFLVSIAYIDPGNFETDLQSGAQYKYGLLWIILVASFSSLIIHSLAA  130

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E CKAEYPK   + LW+LAE+A++A DIPEVIGTAFALN+LF IP+W G
Sbjct  131   NLGVVTGKHLAEHCKAEYPKAQNFILWVLAEIAIVACDIPEVIGTAFALNMLFSIPVWCG  190

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLSTLLLL+LQ+YG+RKLE LIA LV  +A CFF E+ Y KP   ++F G+F+P+L
Sbjct  191   VLLTGLSTLLLLALQQYGIRKLEFLIAFLVLTIAICFFLELGYAKPDVGEIFYGLFVPQL  250

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P S+ G+ +ACR+++IESGFAL VAF
Sbjct  251   KGSGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSLSGIKEACRFYMIESGFALMVAF  310

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LINV+V+SVSG VCS+  L+K+D   C+DL LN ASFLL+NVLGK SS ++AIALLASGQ
Sbjct  311   LINVSVISVSGAVCSSPDLNKEDQMSCNDLDLNKASFLLRNVLGKWSSKLFAIALLASGQ  370

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDLK+  W RN +TR +AI PSLIV+IIGGSSGAG+LIIIASM
Sbjct  371   SSTITGTYAGQYVMQGFLDLKLTPWVRNFLTRSLAIVPSLIVAIIGGSSGAGKLIIIASM  430

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFAL+PLLKF+SS  KMGP+ NS  I V++WI+G  I+ INIYYL + F+  L+
Sbjct  431   ILSFELPFALVPLLKFTSSKAKMGPHVNSTAITVLTWIIGFLIMAINIYYLMSRFIHVLL  490

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVT-FIQPNDDDSKMDNNVNNNVC  1606
             HN+L  A  +L+GI+ F  +A+Y+  + YL+ RK K ++  +    ++S+  +N  +   
Sbjct  491   HNDLHLAVVILIGILGFSGVALYLAGIAYLVLRKTKEISHLLALTAEESRRLSNELSKTS  550

Query  1607  MTPIDHNDFSHTLP  1648
                + + D S  LP
Sbjct  551   GYDLPNEDVSMQLP  564



>ref|XP_011034541.1| PREDICTED: metal transporter Nramp6-like [Populus euphratica]
 ref|XP_011034542.1| PREDICTED: metal transporter Nramp6-like [Populus euphratica]
 ref|XP_011034543.1| PREDICTED: metal transporter Nramp6-like [Populus euphratica]
 ref|XP_011034544.1| PREDICTED: metal transporter Nramp6-like [Populus euphratica]
Length=541

 Score =   518 bits (1335),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 289/478 (60%), Positives = 380/478 (79%), Gaps = 1/478 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             +  W+   +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    ALIIQSLAA
Sbjct  39    RKSWKNLFAYMGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALIIQSLAA  98

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E C+ EYP+   + LW+LAE+A++A DIPEVIGTAFALN+LF IP+W+G
Sbjct  99    NLGVVTGKHLAEHCRNEYPRIPNFILWVLAEIAIVACDIPEVIGTAFALNMLFKIPVWIG  158

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLSTL+LL+LQ+YGVRKLE  IA LV  +A CFF E+ Y KP  ++V KG+F+P+L
Sbjct  159   VLLTGLSTLVLLALQQYGVRKLEFFIAFLVCTIAGCFFAELGYAKPDPKEVLKGLFVPQL  218

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GA   AI+LLGA+VMPHNLFLHSALVL+RK+P SV G+ +ACR+++IESGFAL +AF
Sbjct  219   KGNGAAGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVHGIKEACRFYMIESGFALVLAF  278

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LINV+V+SVSG VC++  ++  D ++C DL LN ASFLLKNVLG  SS ++AIALLASGQ
Sbjct  279   LINVSVISVSGAVCNSQNINAQDQENCKDLDLNKASFLLKNVLGSWSSKLFAIALLASGQ  338

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDL++  W RN +TR +AI PSLIV+IIGGS+GAG+LIIIASM
Sbjct  339   SSTITGTYAGQYVMQGFLDLRLTPWLRNFLTRSLAIVPSLIVAIIGGSAGAGKLIIIASM  398

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFALIPLLKF+SS TKMG Y NS  I  ++W++G  ++ INIYYL+++F+  ++
Sbjct  399   ILSFELPFALIPLLKFTSSKTKMGIYANSTTISCITWVIGFLMMAINIYYLASSFIKIIV  458

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVT-FIQPNDDDSKMDNNVNNN  1600
             H +L     + +G+  F  MA+Y+  V+YL+FR++K  T  +    ++ ++ N   N+
Sbjct  459   HGHLKLVAAIFLGMFGFLGMAVYLAGVVYLVFRRNKEATHLVALTSENPRIANESGNS  516



>ref|XP_009354189.1| PREDICTED: metal transporter Nramp1-like [Pyrus x bretschneideri]
Length=545

 Score =   518 bits (1333),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 285/459 (62%), Positives = 372/459 (81%), Gaps = 0/459 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             K  W+   +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++Y LLW++L+    AL+IQSLAA
Sbjct  41    KTSWKNLFAYMGPGFLVSIAYIDPGNFETDLQSGAQYKYGLLWIILVASCAALVIQSLAA  100

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E C+AEYP+   + LW+LAE++V+A DIPEVIGTAFALN+LF+IP+W+G
Sbjct  101   NLGVVTGKHLAEHCRAEYPRVTNFILWVLAEISVVACDIPEVIGTAFALNMLFNIPIWIG  160

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLSTL+LL+LQ+YGVRKLE LIA LV  +A CF  E+ Y KP A ++  G+F+P+L
Sbjct  161   VLLTGLSTLILLALQQYGVRKLEFLIAFLVLTIAGCFLAELGYAKPDATEILDGLFVPQL  220

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SV G+ +ACR+++IESGFAL VAF
Sbjct  221   KGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVCGIKEACRFYMIESGFALMVAF  280

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LINV+++SVSG VC++  L+ ++  +C DL LN ASFLL+NVLG+ SS ++A+ALLASGQ
Sbjct  281   LINVSIISVSGAVCNSPDLNAENKMNCQDLDLNKASFLLRNVLGRWSSKLFAVALLASGQ  340

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDL++K W RN +TRC+AI PSLIV++IGGS+GAG+LIIIASM
Sbjct  341   SSTITGTYAGQYVMQGFLDLRLKPWLRNFLTRCLAIVPSLIVAVIGGSAGAGQLIIIASM  400

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSF LPFALIPLLKF+S  TKMG + NS  I  ++WI+G  ++ IN+YYL + F+  L+
Sbjct  401   ILSFALPFALIPLLKFTSCKTKMGTHANSTAISALTWIIGSLMMAINLYYLMSRFIKLLL  460

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVT  1546
             H++    G V +GI+ F  M +Y+  + YL+FRK+K  T
Sbjct  461   HSHFKVVGIVFLGILGFSGMGLYLAGIAYLVFRKNKEAT  499



>ref|XP_011082346.1| PREDICTED: metal transporter Nramp6-like isoform X2 [Sesamum 
indicum]
 ref|XP_011082355.1| PREDICTED: metal transporter Nramp6-like isoform X2 [Sesamum 
indicum]
Length=542

 Score =   518 bits (1333),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 291/456 (64%), Positives = 368/456 (81%), Gaps = 0/456 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             K  W+   +Y+GPGF+VS+AY+DPGN +TDLQ+GA ++Y LLW++L+    ALIIQSLAA
Sbjct  39    KTSWKNLFAYMGPGFLVSIAYIDPGNFQTDLQSGAQYKYGLLWIILLASFAALIIQSLAA  98

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E C+ EYPK   + LW+LAE+A++A DIPEVIGTAFAL++LF +PLW+G
Sbjct  99    NLGVVTGKHLAEHCRQEYPKIPNFILWILAEIAIVACDIPEVIGTAFALDMLFGVPLWIG  158

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLST++LL LQ+YGVRKLE+LIA LVF +A CF  E+ Y KP + +V +G+FIP+L
Sbjct  159   VLITGLSTMVLLLLQQYGVRKLEILIAFLVFTIAGCFLAELKYAKPNSSEVLRGLFIPQL  218

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SV G+ +ACR++LIESG AL VAF
Sbjct  219   KGSGATKLAISLLGAMVMPHNLFLHSALVLSRKIPRSVNGIKEACRFYLIESGLALMVAF  278

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LIN++V+SVSG VC++  L+ DDL  C +L LN ASFLLK+VLG  SS ++AIALLASGQ
Sbjct  279   LINISVISVSGAVCNSPNLNSDDLQSCQNLDLNEASFLLKHVLGSWSSKLFAIALLASGQ  338

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDL++K W RN +TRC+AI PSLIV+IIGGS+GAG LIIIASM
Sbjct  339   SSTITGTYAGQYVMQGFLDLRLKPWIRNFLTRCLAIVPSLIVAIIGGSTGAGNLIIIASM  398

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFALIPLLKF+SS TKMG Y N++ +   +WI+G  I+GIN+YYL+   V  L 
Sbjct  399   ILSFELPFALIPLLKFTSSKTKMGSYANTVAVSTTTWIIGSLIMGINVYYLADKLVSSLR  458

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDK  1537
             H++L   G V  G++ F  M IY+  + YL+ RK+K
Sbjct  459   HSHLNIVGTVFCGLLGFLAMLIYLAGIGYLVIRKNK  494



>ref|XP_011082336.1| PREDICTED: metal transporter Nramp6-like isoform X1 [Sesamum 
indicum]
Length=547

 Score =   517 bits (1332),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 291/456 (64%), Positives = 368/456 (81%), Gaps = 0/456 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             K  W+   +Y+GPGF+VS+AY+DPGN +TDLQ+GA ++Y LLW++L+    ALIIQSLAA
Sbjct  44    KTSWKNLFAYMGPGFLVSIAYIDPGNFQTDLQSGAQYKYGLLWIILLASFAALIIQSLAA  103

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E C+ EYPK   + LW+LAE+A++A DIPEVIGTAFAL++LF +PLW+G
Sbjct  104   NLGVVTGKHLAEHCRQEYPKIPNFILWILAEIAIVACDIPEVIGTAFALDMLFGVPLWIG  163

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLST++LL LQ+YGVRKLE+LIA LVF +A CF  E+ Y KP + +V +G+FIP+L
Sbjct  164   VLITGLSTMVLLLLQQYGVRKLEILIAFLVFTIAGCFLAELKYAKPNSSEVLRGLFIPQL  223

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SV G+ +ACR++LIESG AL VAF
Sbjct  224   KGSGATKLAISLLGAMVMPHNLFLHSALVLSRKIPRSVNGIKEACRFYLIESGLALMVAF  283

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LIN++V+SVSG VC++  L+ DDL  C +L LN ASFLLK+VLG  SS ++AIALLASGQ
Sbjct  284   LINISVISVSGAVCNSPNLNSDDLQSCQNLDLNEASFLLKHVLGSWSSKLFAIALLASGQ  343

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDL++K W RN +TRC+AI PSLIV+IIGGS+GAG LIIIASM
Sbjct  344   SSTITGTYAGQYVMQGFLDLRLKPWIRNFLTRCLAIVPSLIVAIIGGSTGAGNLIIIASM  403

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFALIPLLKF+SS TKMG Y N++ +   +WI+G  I+GIN+YYL+   V  L 
Sbjct  404   ILSFELPFALIPLLKFTSSKTKMGSYANTVAVSTTTWIIGSLIMGINVYYLADKLVSSLR  463

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDK  1537
             H++L   G V  G++ F  M IY+  + YL+ RK+K
Sbjct  464   HSHLNIVGTVFCGLLGFLAMLIYLAGIGYLVIRKNK  499



>ref|XP_006368514.1| Metal transporter Nramp1 family protein [Populus trichocarpa]
 gb|ERP65083.1| Metal transporter Nramp1 family protein [Populus trichocarpa]
Length=541

 Score =   517 bits (1331),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 291/478 (61%), Positives = 379/478 (79%), Gaps = 1/478 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             +  W+   +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    ALIIQSLAA
Sbjct  39    RKSWKNLFAYMGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALIIQSLAA  98

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E C+ EYP+   + LW+LAE+A++A DIPEVIGTAFALN+LF IP+W+G
Sbjct  99    NLGVVTGKHLAEHCRNEYPRIPNFILWVLAEIAIVACDIPEVIGTAFALNMLFKIPVWIG  158

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLSTL+LL+LQ+YGVRKLEL IA LV  +A CFF E+ Y KP A++V KG+F+P+L
Sbjct  159   VLLTGLSTLVLLALQQYGVRKLELFIAFLVCTIAGCFFAELGYAKPDAKEVLKGLFVPQL  218

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GA   AI+LLGA+VMPHNLFLHSALVL+RK+P S+ G+ DACR+++IESGFAL +AF
Sbjct  219   KGNGAAGLAISLLGAMVMPHNLFLHSALVLSRKIPRSMHGIKDACRFYMIESGFALVLAF  278

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LINV+++SVSG VC++  ++  D ++C DL LN ASFLL+NVLG  SS ++AIALLASGQ
Sbjct  279   LINVSIISVSGAVCNSPNINAQDQENCKDLDLNKASFLLENVLGSWSSKLFAIALLASGQ  338

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDL++  W RN +TR +AI PSLIV+IIGGSSGAG+LIIIASM
Sbjct  339   SSTITGTYAGQYVMQGFLDLRLTPWLRNFLTRSLAIVPSLIVAIIGGSSGAGKLIIIASM  398

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFAL+PLLKF+SS TKMG Y NS  I  ++W++G  I+ INIYYL+++F+  L+
Sbjct  399   ILSFELPFALVPLLKFTSSKTKMGIYANSTTISSITWVIGFLIMAINIYYLASSFIKILL  458

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVT-FIQPNDDDSKMDNNVNNN  1600
             H +L     + +GI  F  MA+Y+  V YL+ R++K  T  +    ++ ++ N   N 
Sbjct  459   HGHLKLVAAIFLGIFGFLGMAVYLAGVAYLVLRRNKEATHLVALTSENPQIANESGNE  516



>ref|XP_006301485.1| hypothetical protein CARUB_v10021908mg [Capsella rubella]
 gb|EOA34383.1| hypothetical protein CARUB_v10021908mg [Capsella rubella]
Length=533

 Score =   516 bits (1330),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 290/458 (63%), Positives = 375/458 (82%), Gaps = 0/458 (0%)
 Frame = +2

Query  164   NKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSL  343
             ++K  W+ F +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    AL+IQSL
Sbjct  39    SEKKSWKNFFAYLGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALVIQSL  98

Query  344   AANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLW  523
             AANLGV TGKHL+E C+AEY K   + LW++AE+AV+A DIPEVIGTAFALN+LF IP+W
Sbjct  99    AANLGVVTGKHLAEQCRAEYSKVPNFLLWVVAEIAVVACDIPEVIGTAFALNMLFSIPVW  158

Query  524   vgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIP  703
             +GVL TGLSTL+LL+LQ+YGVRKLE LIA LVF +A CFF E+ Y KP   +V  G+F+P
Sbjct  159   IGVLLTGLSTLILLALQKYGVRKLEFLIAFLVFTIAICFFVELHYSKPDPGEVLHGLFVP  218

Query  704   KLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFV  883
             +L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P S  G+ +ACR++LIESG AL V
Sbjct  219   QLKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSASGIKEACRFYLIESGLALMV  278

Query  884   AFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLAS  1063
             AFLINV+V+SVSG VC+   LS +D  +C +L LN ASFLL+NV+GK SS ++AIALLAS
Sbjct  279   AFLINVSVISVSGAVCNAPNLSSEDRANCEELDLNKASFLLRNVVGKWSSKLFAIALLAS  338

Query  1064  GQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiia  1243
             GQSSTITGTYAGQY+MQGFLDL+++ W RNL+TRC+AI PSLIV++IGGS+GAG+LIIIA
Sbjct  339   GQSSTITGTYAGQYVMQGFLDLRLEPWLRNLLTRCLAIIPSLIVALIGGSAGAGKLIIIA  398

Query  1244  sMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDW  1423
             SMILSFELPFAL+PLLKF+S  TKMG + N   +  ++W++G  I+GINIYYL ++F+  
Sbjct  399   SMILSFELPFALVPLLKFTSCKTKMGSHVNPKAVSALTWVIGSLIMGINIYYLVSSFIKL  458

Query  1424  LIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDK  1537
             LIH+++     +  GI+ F  +AIY+ ++ YL+FRK+K
Sbjct  459   LIHSHMKLVAVIFCGILGFAGIAIYLASIAYLVFRKNK  496



>ref|XP_009104491.1| PREDICTED: metal transporter Nramp1-like [Brassica rapa]
Length=532

 Score =   515 bits (1327),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 291/457 (64%), Positives = 373/457 (82%), Gaps = 0/457 (0%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             +K  W+ F +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    AL+IQSLA
Sbjct  39    EKKSWKNFFAYLGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALVIQSLA  98

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGV TGKHL+E C+AEY K   + LW++AE+AV+A DIPEVIGTAFALN+LFHIP+W+
Sbjct  99    ANLGVVTGKHLAEHCRAEYSKVPNFLLWVVAEIAVVACDIPEVIGTAFALNMLFHIPVWI  158

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL TGLSTL+LL+LQ+YGVRKLE LIA LVF +A CFF E+ Y KP   +V  G+F+P+
Sbjct  159   GVLLTGLSTLMLLALQQYGVRKLEFLIAFLVFTIAICFFVELHYSKPDPREVLHGLFVPQ  218

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P S  G+ +ACR++LIESG AL VA
Sbjct  219   LKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSATGIKEACRFYLIESGLALTVA  278

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
             FLINV+V+SVSG VC+   LS +D   C DL LN ASFLL+NV+GK SS ++AIALLASG
Sbjct  279   FLINVSVISVSGAVCNAPDLSPEDRAKCEDLDLNKASFLLRNVVGKWSSKLFAIALLASG  338

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiias  1246
             QSSTITGTYAGQY+MQGFLDL+++ W RN +TRC+AI PSLIV+IIGGS+GAG+LIIIAS
Sbjct  339   QSSTITGTYAGQYVMQGFLDLRLEPWLRNFLTRCLAIIPSLIVAIIGGSAGAGKLIIIAS  398

Query  1247  MILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWL  1426
             MILSFELPFAL+PLLKF+S   KMG Y N I +  ++W++G  I+GINIYYL ++F+  L
Sbjct  399   MILSFELPFALVPLLKFTSCKMKMGSYVNPIAVSALTWVIGGLIMGINIYYLVSSFIKLL  458

Query  1427  IHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDK  1537
             +H+++     V  GI+ F  +AIY+ ++ YL+FR+++
Sbjct  459   VHSHMKLGLVVFCGILGFSGIAIYLASIAYLVFRRNR  495



>ref|XP_006389836.1| hypothetical protein EUTSA_v10018389mg [Eutrema salsugineum]
 gb|ESQ27122.1| hypothetical protein EUTSA_v10018389mg [Eutrema salsugineum]
Length=532

 Score =   515 bits (1327),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 295/473 (62%), Positives = 376/473 (79%), Gaps = 0/473 (0%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             +K  W+ F +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    AL+IQSLA
Sbjct  39    EKKSWKNFFAYLGPGFLVSIAYIDPGNFETDLQSGARYKYELLWIILVASCAALLIQSLA  98

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGV TGKHL+E C+AEY K   + LWL+AE+AV+A DIPEVIGTAFALN+LF IP+W+
Sbjct  99    ANLGVVTGKHLAEHCRAEYSKVPNFMLWLVAEIAVVACDIPEVIGTAFALNMLFSIPVWI  158

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL TGLSTL+LL+LQ+YGVRKLE LIA LVF +A CFF E+ Y KP   +V  G+F+P+
Sbjct  159   GVLLTGLSTLMLLALQKYGVRKLEFLIAFLVFTIAICFFIELHYSKPDPGEVLHGLFVPQ  218

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P S  G+ +ACR++LIESG AL VA
Sbjct  219   LKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSATGIKEACRFYLIESGLALMVA  278

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
             FLINV+V+SVSG VC+   LS  D   C DL LN ASFLL+NV+GK SS ++AIALLASG
Sbjct  279   FLINVSVISVSGAVCNAPDLSPTDRASCEDLDLNKASFLLRNVVGKWSSKLFAIALLASG  338

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiias  1246
             QSSTITGTYAGQY+MQGFLDL+++ W RN +TRC+AI PSLIV++IGGS+GAG+LIIIAS
Sbjct  339   QSSTITGTYAGQYVMQGFLDLRLEPWLRNFLTRCLAIIPSLIVALIGGSAGAGKLIIIAS  398

Query  1247  MILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWL  1426
             MILSFELPFAL+PLLKF+S  TKMG Y N   I  ++W++G  I+GINIYYL ++F+  L
Sbjct  399   MILSFELPFALVPLLKFTSCKTKMGSYVNPKAISALTWVIGGLIMGINIYYLVSSFIKLL  458

Query  1427  IHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMDN  1585
             I++++     V  GI+ F  +AIY+ A+ YL+FRK+K  T +    +   ++ 
Sbjct  459   INSHMKLVAVVFCGILGFTGIAIYLAAIAYLVFRKNKEATHLLATTNSQTVET  511



>ref|XP_010472867.1| PREDICTED: metal transporter Nramp1 [Camelina sativa]
Length=532

 Score =   514 bits (1325),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 292/474 (62%), Positives = 381/474 (80%), Gaps = 0/474 (0%)
 Frame = +2

Query  164   NKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSL  343
             ++K  W+ F +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    AL+IQSL
Sbjct  38    SEKKSWKNFFAYLGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALVIQSL  97

Query  344   AANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLW  523
             AANLGV TGKHL+E C+AEY K   + LW++AE+AV+A DIPEVIGTAFALN+LF IP+W
Sbjct  98    AANLGVVTGKHLAEQCRAEYSKVPNFLLWVVAEIAVVACDIPEVIGTAFALNMLFSIPVW  157

Query  524   vgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIP  703
             +GVL TGLSTL+LL+LQ+YGVRKLE LIA LVF +A CFF E+ Y KP   +V  G+F+P
Sbjct  158   IGVLLTGLSTLILLALQKYGVRKLEFLIAFLVFTIAICFFVELHYSKPDPGEVLHGLFVP  217

Query  704   KLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFV  883
             +L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P S  G+ +ACR++LIESG AL V
Sbjct  218   QLKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSASGIKEACRFYLIESGLALMV  277

Query  884   AFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLAS  1063
             AFLINV+V+SVSG VC+   LS +D  +C +L LN ASFLL+NV+GK SS ++AIALLAS
Sbjct  278   AFLINVSVISVSGAVCNAPNLSSEDRANCEELDLNKASFLLRNVVGKWSSKLFAIALLAS  337

Query  1064  GQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiia  1243
             GQSSTITGTYAGQY+MQGFLDL+++ W RNL+TRC+AI PSLIV++IGGS+GAG+LIIIA
Sbjct  338   GQSSTITGTYAGQYVMQGFLDLRLEPWLRNLLTRCLAIIPSLIVALIGGSAGAGKLIIIA  397

Query  1244  sMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDW  1423
             SMILSFELPFAL+PLLKF+S  TKMG + N   I  ++W++G  I+GINIYYL ++F+  
Sbjct  398   SMILSFELPFALVPLLKFTSCKTKMGSHVNPKAITALTWVIGGLIMGINIYYLVSSFIKL  457

Query  1424  LIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMDN  1585
             LIH+++     +  GI+ F  +AIY+ ++ YL+FRK+K  T +  + +   ++ 
Sbjct  458   LIHSHMKLGLVIFCGILGFAGIAIYLASIGYLVFRKNKEATPLLSSRNSQNVET  511



>gb|KFK42462.1| hypothetical protein AALP_AA2G260000 [Arabis alpina]
Length=531

 Score =   514 bits (1324),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 292/457 (64%), Positives = 372/457 (81%), Gaps = 0/457 (0%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             +K  W+ F SY+GPGF+VS+AY+DPGN ETDLQAGA ++YELLW++L+     LIIQSLA
Sbjct  36    EKKSWKNFFSYLGPGFLVSIAYIDPGNFETDLQAGAQYKYELLWIILVASCAGLIIQSLA  95

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGV TGKHL+E C+AEYPK   + LW++AE+AV+A DIPEVIGTAFALN+LF IP+W+
Sbjct  96    ANLGVVTGKHLAEHCRAEYPKVPNFMLWVVAEIAVVACDIPEVIGTAFALNMLFSIPVWI  155

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL TGLSTL+LL+LQ+YGVRKLE LIA LVF +A CF  E+ Y KP A +V  G+F+P+
Sbjct  156   GVLLTGLSTLILLALQKYGVRKLEFLIAFLVFTIAICFLIELHYSKPDAGEVLHGLFVPQ  215

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             L G GA   AI+LLGA+VMPHNLFLHSALVL+RK+P S  G+ +ACR++LIESG AL VA
Sbjct  216   LKGNGAAGLAISLLGAMVMPHNLFLHSALVLSRKIPRSASGIKEACRFYLIESGLALTVA  275

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
             FLINV+V+SVSG VC+   LS +D   C DL+LN ASFLL+NVLGK SS ++AIALLASG
Sbjct  276   FLINVSVISVSGAVCNASDLSPEDRVSCEDLNLNKASFLLRNVLGKWSSKIFAIALLASG  335

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiias  1246
             QSSTITGTYAGQY+MQGFL+L+++ W RNL+TRC+AI PSLIV++IGGS+GAG+LIIIAS
Sbjct  336   QSSTITGTYAGQYVMQGFLNLRLEPWLRNLLTRCLAIIPSLIVALIGGSAGAGKLIIIAS  395

Query  1247  MILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWL  1426
             MILSFELPFAL+PLLKF+S  TKM  + N I I V++W++G  ++GINIY++ ++F+  L
Sbjct  396   MILSFELPFALVPLLKFTSCKTKMASHVNPIAISVLTWVIGGFMMGINIYFIVSSFIKLL  455

Query  1427  IHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDK  1537
              H+++     V  GI  F  +AIY+ ++ YL+FRK+K
Sbjct  456   FHSHMKLLAVVFSGIFGFSGIAIYLASIAYLVFRKNK  492



>ref|XP_009149038.1| PREDICTED: metal transporter Nramp6 [Brassica rapa]
Length=484

 Score =   512 bits (1319),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 288/469 (61%), Positives = 376/469 (80%), Gaps = 0/469 (0%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             +K  W+ F SY+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    AL+IQSLA
Sbjct  2     QKESWKNFFSYLGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALVIQSLA  61

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGV TGKHL+E C+AEY K   + LW++AE+AV+A DIPEVIGTAFALN+LF+IP+W+
Sbjct  62    ANLGVVTGKHLAEHCRAEYSKVPNFMLWVVAEIAVVACDIPEVIGTAFALNMLFNIPVWI  121

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL TG STL+LL+LQ+YG+RKLE LIA LV  +A CF  E+ Y KP  ++V  G+F+P+
Sbjct  122   GVLLTGFSTLILLALQKYGIRKLEFLIAFLVLTIAVCFLIELHYSKPDPKEVLYGLFVPQ  181

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SV G+ +ACRY++IESG AL VA
Sbjct  182   LKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVTGIKEACRYYMIESGLALTVA  241

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
             FLINV+V+SVSG VC+   LS +D   C DL LN ASFLL+NV+GK SS ++AIALLASG
Sbjct  242   FLINVSVISVSGAVCNASDLSPEDQASCEDLDLNKASFLLRNVVGKWSSKLFAIALLASG  301

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiias  1246
             QSSTITGTYAGQY+MQGFL+L ++ W RN +TRC+AI P LIV++IGGS+GAG+LIIIAS
Sbjct  302   QSSTITGTYAGQYVMQGFLNLTIRPWLRNFLTRCLAIIPRLIVALIGGSAGAGKLIIIAS  361

Query  1247  MILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWL  1426
             M+LSFELPFAL+PLLKF+ S TKMG + NS+ I  V+WI+G  I+GINIYYL ++F+  +
Sbjct  362   MVLSFELPFALVPLLKFTCSKTKMGSHANSLLISSVTWIIGGLIMGINIYYLLSSFIKLI  421

Query  1427  IHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDS  1573
             +H ++     V +GI+ F  +AIY+ A+ YL+FRK +  + +  ++  +
Sbjct  422   LHGHMKLVAVVFLGILGFSGIAIYLAAIGYLVFRKSRESSTLASSNSQT  470



>ref|XP_010429896.1| PREDICTED: metal transporter Nramp1-like [Camelina sativa]
Length=532

 Score =   514 bits (1323),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 291/474 (61%), Positives = 381/474 (80%), Gaps = 0/474 (0%)
 Frame = +2

Query  164   NKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSL  343
             ++K  W+ F +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    AL+IQSL
Sbjct  38    SEKKSWKNFFAYLGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALVIQSL  97

Query  344   AANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLW  523
             AANLGV TGKHL+E C+AEY K   + LW++AE+AV+A DIPEVIGTAFALN+LF IP+W
Sbjct  98    AANLGVVTGKHLAEQCRAEYSKVPNFLLWVVAEIAVVACDIPEVIGTAFALNMLFSIPVW  157

Query  524   vgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIP  703
             +GVL TGLSTL+LL+LQ+YGVRKLE LIA LVF +A CFF E+ Y KP   +V  G+F+P
Sbjct  158   IGVLLTGLSTLILLALQKYGVRKLEFLIAFLVFTIAICFFVELHYSKPDPGEVLHGLFVP  217

Query  704   KLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFV  883
             +L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P S  G+ +ACR++LIESG AL V
Sbjct  218   QLKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSASGIKEACRFYLIESGLALMV  277

Query  884   AFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLAS  1063
             AFLINV+V+SVSG VC+   LS +D  +C +L LN ASFLL+NV+GK SS ++AIALLAS
Sbjct  278   AFLINVSVISVSGAVCNAPNLSSEDRANCEELDLNKASFLLRNVVGKWSSKLFAIALLAS  337

Query  1064  GQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiia  1243
             GQSSTITGTYAGQY+MQGFLDL+++ W RNL+TRC+AI PSLIV++IGGS+GAG+LIIIA
Sbjct  338   GQSSTITGTYAGQYVMQGFLDLRLEPWLRNLLTRCLAIIPSLIVALIGGSAGAGKLIIIA  397

Query  1244  sMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDW  1423
             SMILSFELPFAL+PLLKF+S  TKMG + N   I  ++W++G  I+GINIYYL ++F+  
Sbjct  398   SMILSFELPFALVPLLKFTSCKTKMGSHVNPKAITALTWVIGGLIMGINIYYLVSSFIKL  457

Query  1424  LIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMDN  1585
             L+H+++     +  GI+ F  +AIY+ ++ YL+FRK+K  T +  + +   ++ 
Sbjct  458   LVHSHMKLGLVIFCGILGFAGIAIYLASIGYLVFRKNKEATPLLSSRNSQNVET  511



>gb|KFK42470.1| hypothetical protein AALP_AA2G261200 [Arabis alpina]
Length=531

 Score =   514 bits (1323),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 292/457 (64%), Positives = 375/457 (82%), Gaps = 0/457 (0%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             +K  W+ F +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    AL+IQSLA
Sbjct  39    EKKSWKNFFAYLGPGFLVSIAYIDPGNFETDLQSGARYKYELLWIILVASCAALVIQSLA  98

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGV TGKHL+E C+AEY K   + LW+LAE+AV+A DIPEVIGTAFALN+LF IP+W+
Sbjct  99    ANLGVVTGKHLAEHCRAEYSKVPNFMLWVLAEIAVVACDIPEVIGTAFALNMLFSIPVWI  158

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL TGLSTL+LL+LQ+YGVRKLE LIA LVF +A CFF E+ Y KP   +V  G+F+P+
Sbjct  159   GVLLTGLSTLMLLALQQYGVRKLEFLIAFLVFTIAICFFIELHYSKPDPGEVLHGLFVPQ  218

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P S  G+ +ACR++LIESG AL VA
Sbjct  219   LKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSASGIKEACRFYLIESGLALMVA  278

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
             FLINV+V+SVSG VC+   LS +D  +C DL LN ASFLL+NV+GK SS ++AIALLASG
Sbjct  279   FLINVSVISVSGAVCNAPDLSPEDRANCEDLDLNKASFLLRNVVGKWSSKLFAIALLASG  338

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiias  1246
             QSSTITGTYAGQY+MQGFL+L ++ W RNL+TRC+AI PSLIV++IGGS+GAG+LIIIAS
Sbjct  339   QSSTITGTYAGQYVMQGFLNLTLEPWLRNLLTRCLAIIPSLIVALIGGSAGAGKLIIIAS  398

Query  1247  MILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWL  1426
             MILSFELPFAL+PLLKF+S  TKM  + NS+ I V++W++G  ++GINIYYL ++F+  L
Sbjct  399   MILSFELPFALVPLLKFTSCKTKMAAHVNSMAITVITWVIGGFMMGINIYYLVSSFIKLL  458

Query  1427  IHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDK  1537
             IH+++     V  GI+ F  +AIY+ ++ YL+FRK++
Sbjct  459   IHSHMKLVAVVFCGILGFSGIAIYLASIAYLVFRKNR  495



>ref|XP_010034031.1| PREDICTED: metal transporter Nramp6 isoform X3 [Eucalyptus grandis]
Length=491

 Score =   512 bits (1318),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 292/471 (62%), Positives = 370/471 (79%), Gaps = 1/471 (0%)
 Frame = +2

Query  200   VGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAANLGVSTGKHL  379
             +GPGF+VS+AY+DPGN ETDLQAGA ++YELLW++L+    AL+IQSLAA LGV TGKHL
Sbjct  1     MGPGFLVSIAYIDPGNFETDLQAGAQYKYELLWIILVASCAALVIQSLAAKLGVVTGKHL  60

Query  380   SELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvgvlctglstll  559
             +E  + EYPK   + LW+LAE++++A DIPEVIGTAFALN+LF IPLW GVL TGLSTL+
Sbjct  61    AEHFRMEYPKVPNFILWVLAEISIVACDIPEVIGTAFALNMLFKIPLWCGVLLTGLSTLM  120

Query  560   llslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADAI  739
             LL+LQ+YGVRKLE LIA LVF +AACFFGE+ Y KP A +V  G+F+P+L G GAT  AI
Sbjct  121   LLALQQYGVRKLEFLIAFLVFTIAACFFGELGYAKPVASEVLNGLFVPQLKGNGATGLAI  180

Query  740   ALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAFLINVAVVSVS  919
             +LLGA+VMPHNLFLHSALVL+RK+P SVRG+ +ACR++ IES FAL VAFLIN++V+SVS
Sbjct  181   SLLGAMVMPHNLFLHSALVLSRKIPRSVRGIKEACRFYTIESAFALMVAFLINISVISVS  240

Query  920   GTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAG  1099
             G VC++  L+  D   C DL LN ASFLL+NVLG  SS ++AIALLASGQSSTITGTYAG
Sbjct  241   GAVCNSTSLNPQDKASCQDLDLNKASFLLRNVLGSWSSKLFAIALLASGQSSTITGTYAG  300

Query  1100  QYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasMILSFELPFAL  1279
             QY+MQGFLDL++  W RN +TRC+AI PSLIV++IGGS+GAG+LIIIASMILSFELPFAL
Sbjct  301   QYVMQGFLDLRLTPWVRNFLTRCLAIIPSLIVALIGGSAGAGKLIIIASMILSFELPFAL  360

Query  1280  IPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLIHNNLPKAGNV  1459
             +PLLKF+SS TKMG Y N   +  V+WI+G  I+GIN+YYL T F+  L+++ +     V
Sbjct  361   VPLLKFTSSKTKMGQYANQTMVAAVTWIIGFLIMGINVYYLVTGFIKLLLNSPMKLGAKV  420

Query  1460  LVGIVVFPLMAIYVVAVIYLMFRKDKVVT-FIQPNDDDSKMDNNVNNNVCM  1609
             + GI+ F  MA+Y+  + YL+ RK+K  +  +     +S+   N   +  M
Sbjct  421   VCGILGFSGMAVYLAGITYLVLRKNKEASHLLALTTAESQQSENGQGDASM  471



>emb|CDY63970.1| BnaC02g46600D [Brassica napus]
Length=532

 Score =   511 bits (1317),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 289/457 (63%), Positives = 373/457 (82%), Gaps = 0/457 (0%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             +K  W+ F +Y+GPGF+VS+AY+DPGN ETDLQAGA ++YELLW++L+    AL+IQSLA
Sbjct  39    EKKSWKNFFAYLGPGFLVSIAYIDPGNFETDLQAGAQYKYELLWIILVASCAALVIQSLA  98

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGV TGKHL+E C+AEY K   + LW++AE+AV+A DIPEVIGTAFALN+LF IP+W+
Sbjct  99    ANLGVVTGKHLAEHCRAEYSKVPNFLLWVVAEIAVVACDIPEVIGTAFALNMLFRIPVWI  158

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL TGLSTL+LL+LQ+YGVRKLE LIA LVF +A CF  E+ Y KP   +V  G+F+P+
Sbjct  159   GVLLTGLSTLMLLALQQYGVRKLEFLIAFLVFTIALCFVIELHYSKPDPGEVLHGLFVPQ  218

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P S  G+ +ACR++LIESG AL +A
Sbjct  219   LKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSSTGIKEACRFYLIESGLALMIA  278

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
             FLINV+V+SVSG VC+   L+ +D   C DL LN ASFLL+NV+GK SS ++AIALLASG
Sbjct  279   FLINVSVISVSGAVCNAPDLTPEDRAKCEDLDLNKASFLLRNVVGKWSSKLFAIALLASG  338

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiias  1246
             QSSTITGTYAGQY+MQGFLDL+++ W RNL+TRC+AI PSLIV++IGGS+GAG+LIIIAS
Sbjct  339   QSSTITGTYAGQYVMQGFLDLRLEPWLRNLLTRCLAIIPSLIVALIGGSAGAGKLIIIAS  398

Query  1247  MILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWL  1426
             MILSFELPFAL+PLLKF+S  TKMG + N + I  ++W++G  I+GINIYY+ ++F   L
Sbjct  399   MILSFELPFALVPLLKFTSCKTKMGSHVNHMAITTLTWVIGALIMGINIYYIVSSFTKLL  458

Query  1427  IHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDK  1537
             IH+++  A  +  GI+ F  +AIY+ ++ YL+FRK++
Sbjct  459   IHSHMKLALVIFCGILGFSGIAIYLASIAYLVFRKNR  495



>gb|KDO41580.1| hypothetical protein CISIN_1g008955mg [Citrus sinensis]
Length=437

 Score =   507 bits (1306),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 268/390 (69%), Positives = 329/390 (84%), Gaps = 0/390 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             K  W+   +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    ALIIQSLAA
Sbjct  40    KTSWKNLFAYIGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALIIQSLAA  99

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E C+ EYPK   + LW+LAE+A++A DIPEVIGTAFALN+LF IP+W+G
Sbjct  100   NLGVVTGKHLAEHCRNEYPKVPNFILWVLAEIAIVACDIPEVIGTAFALNMLFKIPVWIG  159

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TG STL+LL+LQ+YGVRKLE LIA LVF MA CFF E+ Y KP A++V  G+F+P+L
Sbjct  160   VLLTGFSTLILLALQQYGVRKLEFLIAFLVFTMAGCFFAELGYAKPEAKEVLHGLFVPQL  219

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SVR + +ACR+++IESGFAL VAF
Sbjct  220   KGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVRSIKEACRFYMIESGFALAVAF  279

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LINV+V+SVSG VCS+  ++ +D   C DL LN ASFLL+NVLG  SS ++AIALLASGQ
Sbjct  280   LINVSVISVSGAVCSSSNINPEDQASCKDLDLNKASFLLRNVLGSWSSKLFAIALLASGQ  339

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDL++K W RN +TRC+AI PSLIV++IGGS+GAG+LIIIASM
Sbjct  340   SSTITGTYAGQYVMQGFLDLRLKPWLRNFLTRCLAIVPSLIVALIGGSAGAGQLIIIASM  399

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSI  1339
             ILSFELPFAL+PLLKF+SS  KMG + NSI
Sbjct  400   ILSFELPFALVPLLKFTSSKVKMGMHANSI  429



>ref|XP_010691589.1| PREDICTED: metal transporter Nramp6-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010691590.1| PREDICTED: metal transporter Nramp6-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010691592.1| PREDICTED: metal transporter Nramp6-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010691593.1| PREDICTED: metal transporter Nramp6-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010691594.1| PREDICTED: metal transporter Nramp6-like [Beta vulgaris subsp. 
vulgaris]
Length=537

 Score =   510 bits (1313),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 290/461 (63%), Positives = 370/461 (80%), Gaps = 0/461 (0%)
 Frame = +2

Query  164   NKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSL  343
             ++K  W+ F SY+GPGF+VS+AY+DPGN ETDLQAGA  +YELLW++L+    ALIIQS+
Sbjct  43    SEKKSWKNFFSYMGPGFLVSIAYIDPGNFETDLQAGAQFKYELLWIILVASCAALIIQSM  102

Query  344   AANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLW  523
             AANLGV TGKHL+E C+ EY K   + LW+LAE+A++A DIPEVIGTAFALN+LF+IP+W
Sbjct  103   AANLGVVTGKHLAEHCRFEYSKVPNFILWILAEIAIVACDIPEVIGTAFALNMLFNIPVW  162

Query  524   vgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIP  703
              GVL TGLSTL+LL+LQ+YGVRKLE LI  LV  +AACF  E+ Y KP A +V  G+F+P
Sbjct  163   AGVLLTGLSTLVLLALQQYGVRKLEFLITFLVLTIAACFLAELGYAKPDASEVMHGLFVP  222

Query  704   KLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFV  883
             +L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P S  G+ +ACRY++IESG AL V
Sbjct  223   QLKGDGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSASGIKEACRYYMIESGIALAV  282

Query  884   AFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLAS  1063
             AFLIN++V++VSG VC++  L+ +D   C DL LN ASFLLKNVLG  SS ++ IALLAS
Sbjct  283   AFLINISVIAVSGAVCNSSNLNPEDQKSCRDLDLNEASFLLKNVLGNWSSKLFGIALLAS  342

Query  1064  GQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiia  1243
             GQSSTITGTYAGQY+MQGFLDL+M+ W RNL+TRC+AI PSL+V++IGGS+GAGRLIIIA
Sbjct  343   GQSSTITGTYAGQYVMQGFLDLRMEPWIRNLLTRCLAIVPSLVVALIGGSAGAGRLIIIA  402

Query  1244  sMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDW  1423
             SMILSFELPFALIPLLKF+SS  KMG + NS+ +  V+W++G  I+ INIY++S++F+  
Sbjct  403   SMILSFELPFALIPLLKFTSSKAKMGVHANSLMLSAVTWMIGSMIMVINIYFISSSFIKL  462

Query  1424  LIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVT  1546
             L+H+ L     +  GI+ F  + IY+ A+ YL+ RK+K  T
Sbjct  463   LLHSKLKLVYAIFAGILGFSGLLIYLAAIAYLIIRKNKEST  503



>ref|XP_006416859.1| hypothetical protein EUTSA_v10009815mg [Eutrema salsugineum]
 gb|ESQ35212.1| hypothetical protein EUTSA_v10009815mg [Eutrema salsugineum]
Length=526

 Score =   509 bits (1310),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 288/457 (63%), Positives = 370/457 (81%), Gaps = 0/457 (0%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             +K  W+ F SY+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    AL+IQSLA
Sbjct  31    EKKSWKNFFSYLGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALVIQSLA  90

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGV TGKHL+E C+AEY K   + LW++AE+AV+A DIPEVIGTAFALN+LF+IP+W+
Sbjct  91    ANLGVVTGKHLAEHCRAEYSKVPNFMLWVVAEIAVVACDIPEVIGTAFALNMLFNIPVWI  150

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL TG STL+LL+LQ+YG+RKLE LIA LV  +A CFF E+ Y KP  ++V  G+F+P+
Sbjct  151   GVLLTGFSTLILLALQQYGIRKLEFLIAFLVLTIALCFFVELHYSKPDPKEVLYGLFVPQ  210

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SV G+ +ACRY+LIESG AL VA
Sbjct  211   LKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVTGIKEACRYYLIESGLALTVA  270

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
             FLINV+V+SVSG VC+   LS +D   C DL LN ASFLL+NV+G  SS ++AIALLASG
Sbjct  271   FLINVSVISVSGAVCNASDLSPEDQASCEDLDLNKASFLLRNVVGTWSSKLFAIALLASG  330

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiias  1246
             QSSTITGTYAGQY+MQGFLDL ++ W RN +TRC+AI PSLIV++IGGS+GAG+LIIIAS
Sbjct  331   QSSTITGTYAGQYVMQGFLDLTLRPWLRNFLTRCLAIIPSLIVALIGGSAGAGKLIIIAS  390

Query  1247  MILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWL  1426
             MILSFELPFAL+PLLKF+SS TKMG + NS+ +  V+W++G  I+GINIYYL ++F+  L
Sbjct  391   MILSFELPFALVPLLKFTSSKTKMGSHANSLLVSSVTWLIGGLIMGINIYYLVSSFIKLL  450

Query  1427  IHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDK  1537
             +  ++     V +GI+    + IY+ A+ YL+ RK++
Sbjct  451   LQGHMKLVAIVFLGILGSSGITIYLAAIGYLVLRKNR  487



>dbj|BAE48710.1| NRAMP family metal transporter [Chengiopanax sciadophylloides]
Length=537

 Score =   509 bits (1311),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 295/500 (59%), Positives = 378/500 (76%), Gaps = 2/500 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             K  W+   +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    ALIIQSLAA
Sbjct  37    KTSWKNLSAYMGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALIIQSLAA  96

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV +GKHL+E C+ EY K   + LW+LAE++++A DIPEVIGTAFALN+LF IP W+G
Sbjct  97    NLGVVSGKHLAEHCRTEYEKVPNFILWILAEISIVACDIPEVIGTAFALNMLFDIPEWIG  156

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TG STL+LL+LQ+YGVRKLE LIA LVF +AACF  E+ Y KP A +V  G+F+P+L
Sbjct  157   VLLTGFSTLVLLALQQYGVRKLEFLIAFLVFTIAACFLVELGYAKPNASEVLYGLFVPQL  216

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G G+T  AI+LLGA+VMPHNLFLHSALVL+RK+P SV G+ +ACR++++ESGFAL +A 
Sbjct  217   QGSGSTLLAISLLGAMVMPHNLFLHSALVLSRKIPRSVNGIKEACRFYMVESGFALVLAL  276

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LINV+V++VSG+VCS+  L+ DD   C +L LN ASFLLKNVLG  SS ++AIALLASGQ
Sbjct  277   LINVSVIAVSGSVCSSSNLNPDDQKSCQNLDLNKASFLLKNVLGSWSSKLFAIALLASGQ  336

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDL++K W RN +TRC+AI PSLIV++IGGS+GAG+LIIIASM
Sbjct  337   SSTITGTYAGQYVMQGFLDLRLKPWIRNFLTRCLAIVPSLIVALIGGSAGAGKLIIIASM  396

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFALIPLLK +SS TKMG Y NS  I   +W +G  I+GINIY+L    ++ LI
Sbjct  397   ILSFELPFALIPLLKSTSSKTKMGAYANSTMISATTWTIGSLIMGINIYFLVDHLIELLI  456

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVT-FIQPNDDDSKMDNNVNNNVC  1606
             H+ L     VL GI+ F    +Y+  + YL+ RK++  +  +     +S+     N +V 
Sbjct  457   HSQLKLVDKVLCGILGFLGTLVYLAGIGYLVLRKNRESSHLLALTTPESRQSEAGNTSVY  516

Query  1607  MTPIDHNDFSHTLP*LSRPD  1666
               P   +  S  LP   R D
Sbjct  517   SLP-REDIVSMQLPQRGRAD  535



>ref|XP_008360386.1| PREDICTED: metal transporter Nramp5-like [Malus domestica]
Length=442

 Score =   505 bits (1301),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 301/377 (80%), Positives = 337/377 (89%), Gaps = 0/377 (0%)
 Frame = +2

Query  473   VIGTAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEM  652
             VIGTAFALNILF+IP+W GVL TG STLLLL LQ+YGVRKLE+LIAVLVF+MAACFFGEM
Sbjct  45    VIGTAFALNILFNIPVWTGVLLTGFSTLLLLGLQKYGVRKLEMLIAVLVFVMAACFFGEM  104

Query  653   AYVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGV  832
             +YVKPPA  V KGMFIPKLSGQGAT DAIALLGAL MPHNLFLHSALVL+RK+P SVRG 
Sbjct  105   SYVKPPASGVLKGMFIPKLSGQGATGDAIALLGALXMPHNLFLHSALVLSRKIPKSVRGX  164

Query  833   NDACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKN  1012
             NDACRYFLIESGFALFVAFLINVA+VSVSGTVC +  LS  D D CSDL+LNSASFLL+N
Sbjct  165   NDACRYFLIESGFALFVAFLINVAIVSVSGTVCHHSNLSDKDNDTCSDLTLNSASFLLQN  224

Query  1013  VLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPsli  1192
             VLG+SS  +YAIALLASGQSSTITGTYAGQ++MQGFL++KMKKW+RNLMTRCIAITPSLI
Sbjct  225   VLGRSSKILYAIALLASGQSSTITGTYAGQFVMQGFLNIKMKKWARNLMTRCIAITPSLI  284

Query  1193  vsiiggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilgl  1372
             VSIIGGSSGAGRLIIIASMILSFELPFALIPLLKFSSS+TKMGP+KNSIYIIV+SW LG+
Sbjct  285   VSIIGGSSGAGRLIIIASMILSFELPFALIPLLKFSSSATKMGPHKNSIYIIVISWTLGM  344

Query  1373  giiginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFI  1552
             GIIGINIYYLST FV W+IH++LPK   V +GI+VFP MAIY++AV+YL  RKD VVTF+
Sbjct  345   GIIGINIYYLSTGFVGWIIHSSLPKVATVFIGILVFPFMAIYILAVLYLTLRKDSVVTFV  404

Query  1553  QPNDDDSKMDNNVNNNV  1603
             +P  +D    N + N +
Sbjct  405   EPTKNDPAAQNQMENGL  421



>gb|EYU24597.1| hypothetical protein MIMGU_mgv1a004193mg [Erythranthe guttata]
Length=540

 Score =   509 bits (1311),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 291/456 (64%), Positives = 361/456 (79%), Gaps = 0/456 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             K  W+   +Y+GPGF+VS+AY+DPGN +TDLQAGA ++Y LLW++L+    AL+IQSLAA
Sbjct  39    KKSWKNLFAYMGPGFLVSIAYIDPGNFQTDLQAGAQYKYGLLWIILLASCAALVIQSLAA  98

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E C+ EYPK   + LW++AE+A++A DIPEVIGTAFALN+LF IPLW+G
Sbjct  99    NLGVVTGKHLAEHCRLEYPKVPNFILWIIAEIAIVACDIPEVIGTAFALNMLFKIPLWLG  158

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLSTL+LL LQ+YGVRKLE+LI  LV  +A CFF E+AY KP A +V +G+F+P+L
Sbjct  159   VLITGLSTLVLLLLQQYGVRKLEILITFLVLTIAGCFFAELAYAKPVASEVLQGLFVPQL  218

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SV G+ +AC ++LIESGFAL VAF
Sbjct  219   KGSGATKLAISLLGAMVMPHNLFLHSALVLSRKIPRSVSGIREACAFYLIESGFALLVAF  278

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LIN++V+SVSG VC++  L   DL  C +L LN ASFLL+NVLG  SS ++AIALLASGQ
Sbjct  279   LINISVISVSGAVCNSSNLDPKDLQSCKNLDLNEASFLLRNVLGNWSSKLFAIALLASGQ  338

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDL++K W RN +TRC+AI PSL V+IIGGSSGAG LIIIASM
Sbjct  339   SSTITGTYAGQYVMQGFLDLRLKPWVRNFVTRCLAIVPSLAVAIIGGSSGAGNLIIIASM  398

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFALIPLLKF+S  TKMG Y NSI I   +WI+   I+ INIYYL+   V  L 
Sbjct  399   ILSFELPFALIPLLKFTSCKTKMGIYVNSIAISATTWIISSLIMAINIYYLAETLVTSLR  458

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDK  1537
              ++L   G V +G +    M IY+ ++ YL+ RK+K
Sbjct  459   ESHLKIVGIVFLGFLGVLAMLIYLASIAYLVIRKNK  494



>ref|XP_009594426.1| PREDICTED: LOW QUALITY PROTEIN: metal transporter Nramp6-like 
[Nicotiana tomentosiformis]
Length=533

 Score =   509 bits (1310),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 293/459 (64%), Positives = 363/459 (79%), Gaps = 0/459 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             K  W+   SYVGPGF+V +AY+DPGN +TDLQAGA ++Y LLW++L+    AL+IQSLAA
Sbjct  39    KKSWKNIFSYVGPGFLVCIAYIDPGNFQTDLQAGAQYKYGLLWIILLASFAALVIQSLAA  98

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E C+ EYPK   + LW++AE+A++A DIPEVIGTAFALN+LF IP+W G
Sbjct  99    NLGVVTGKHLAEHCRKEYPKVPNFILWIIAEIAIVACDIPEVIGTAFALNMLFKIPIWCG  158

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLSTL LL LQ+YGVRKLE LIA LV  +A CFF E+ Y KP + +V  G+F+P+L
Sbjct  159   VLITGLSTLSLLLLQQYGVRKLEFLIAFLVLTIAVCFFVELGYAKPESSEVLHGLFVPQL  218

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SV G+ DACRY+LIESG AL VAF
Sbjct  219   KGSGATKLAISLLGAMVMPHNLFLHSALVLSRKIPRSVNGIRDACRYYLIESGLALMVAF  278

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LIN++V+SVSG VC++  ++ DD + C DL LN ASFLLKNVLG  SS ++AIALLASGQ
Sbjct  279   LINISVISVSGAVCNSATMTPDDREKCEDLDLNKASFLLKNVLGNWSSKLFAIALLASGQ  338

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDL++K W RN +TR +AI PSLIVS+IGGS+GAG LIIIASM
Sbjct  339   SSTITGTYAGQYVMQGFLDLRLKPWIRNFLTRSLAIVPSLIVSLIGGSAGAGDLIIIASM  398

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFALIPLLKF+SS TKMG + N I +   +W++G  I+GINIYYL+   V  L 
Sbjct  399   ILSFELPFALIPLLKFTSSKTKMGSHVNPIAVSGATWLIGTLIMGINIYYLAEKLVTSLK  458

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVT  1546
              ++L KA  VL GI+    + +Y+ +++YL  RK+K  T
Sbjct  459   DSHLGKAVKVLCGILGALCLLVYLCSILYLAIRKNKEST  497



>ref|XP_009774026.1| PREDICTED: LOW QUALITY PROTEIN: metal transporter Nramp6-like 
[Nicotiana sylvestris]
Length=533

 Score =   508 bits (1309),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 291/459 (63%), Positives = 363/459 (79%), Gaps = 0/459 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             K  W+   SYVGPGF+V +AY+DPGN +TDLQAGA ++Y LLW++L+    AL+IQSLAA
Sbjct  39    KKSWKNIFSYVGPGFLVCIAYIDPGNFQTDLQAGAQYKYGLLWIILLASFAALVIQSLAA  98

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E C+ EYPK   + LW++AE+A++A DIPEVIGTAFALN+LF IP+W G
Sbjct  99    NLGVVTGKHLAEHCRKEYPKVPNFILWIIAEIAIVACDIPEVIGTAFALNMLFRIPIWCG  158

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLSTL LL LQ+YGVRKLE LIA LV  +A CFF E+ Y KP + +V  G+F+P+L
Sbjct  159   VLITGLSTLGLLLLQQYGVRKLEFLIAFLVLTIAVCFFVELGYAKPESSEVLHGLFVPQL  218

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SV G+ DACRY+LIESG AL VAF
Sbjct  219   KGSGATKLAISLLGAMVMPHNLFLHSALVLSRKIPRSVNGIRDACRYYLIESGLALMVAF  278

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LIN++V+SVSG VC++  ++ DD + C DL LN ASFLL+NVLG  SS ++AIALLASGQ
Sbjct  279   LINISVISVSGAVCNSSTMTADDREKCEDLDLNKASFLLQNVLGNWSSKLFAIALLASGQ  338

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDL++K W RN +TR +AI PSLIVS+IGGS+GAG LIIIASM
Sbjct  339   SSTITGTYAGQYVMQGFLDLRLKPWIRNFLTRSLAIVPSLIVSLIGGSAGAGDLIIIASM  398

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFALIPLLKF+SS TKMG + N + +   +W++G  I+GINIYYL+   V  L 
Sbjct  399   ILSFELPFALIPLLKFTSSKTKMGSHVNPVAVSAATWVIGTLIMGINIYYLAEKLVTSLK  458

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVT  1546
              ++L KA  VL GI+    + +Y+ +++YL  RK+K  T
Sbjct  459   DSHLGKAVKVLCGILGTLCLLVYLCSILYLAIRKNKEST  497



>dbj|BAH66919.1| metal transporter [Nicotiana tabacum]
Length=533

 Score =   507 bits (1306),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 291/459 (63%), Positives = 362/459 (79%), Gaps = 0/459 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             K  W+   SYVGPGF+V +AY+DPGN +TDLQAGA ++Y LLW++L+    AL+IQSLAA
Sbjct  39    KKSWKNIFSYVGPGFLVCIAYIDPGNFQTDLQAGAQYKYGLLWIILLASFAALVIQSLAA  98

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E C+ EYPK   + LW++AE+A++A DIPEVIGTAFALN+LF IP+W G
Sbjct  99    NLGVVTGKHLAEHCRKEYPKVPNFILWIIAEIAIVACDIPEVIGTAFALNMLFRIPIWCG  158

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLSTL LL LQ+YGVRKLE LIA LV  +A CFF E+ Y KP + +V  G+F+P+L
Sbjct  159   VLITGLSTLGLLLLQQYGVRKLEFLIAFLVLTIAVCFFVELGYAKPESSEVLHGLFVPQL  218

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI LLGA+VMPHNLFLHSALVL+RK+P SV G+ DACRY+LIESG AL VAF
Sbjct  219   KGSGATKLAIPLLGAIVMPHNLFLHSALVLSRKIPRSVNGIRDACRYYLIESGLALMVAF  278

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LIN++V+SVSG VC++  ++ DD + C DL LN ASFLL+NVLG  SS ++AIALLASGQ
Sbjct  279   LINISVISVSGAVCNSSTMTADDREKCEDLDLNKASFLLQNVLGNWSSKLFAIALLASGQ  338

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDL++K W RN +TR +AI PSLIVS+IGGS+GAG LIIIASM
Sbjct  339   SSTITGTYAGQYVMQGFLDLRLKPWIRNFLTRSLAIVPSLIVSLIGGSAGAGDLIIIASM  398

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFALIPLLKF+SS TKMG + N + +   +W++G  I+GINIYYL+   V  L 
Sbjct  399   ILSFELPFALIPLLKFTSSKTKMGSHVNPVAVSAATWVIGTLIMGINIYYLAEKLVTSLK  458

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVT  1546
              ++L KA  VL GI+    + +Y+ +++YL  RK+K  T
Sbjct  459   DSHLGKAVKVLCGILGTLCLLVYLCSILYLAIRKNKEST  497



>ref|XP_009128390.1| PREDICTED: metal transporter Nramp1 [Brassica rapa]
Length=532

 Score =   507 bits (1305),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 287/457 (63%), Positives = 371/457 (81%), Gaps = 0/457 (0%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             +K  W+ F +Y+GPGF+V +AY+DPGN ETDLQAGA ++YELLW++L+    AL+IQSLA
Sbjct  39    EKKSWKNFFAYLGPGFLVLIAYIDPGNFETDLQAGAQYKYELLWIILVASCAALVIQSLA  98

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGV TGKHL+E C+AEY K   + LW++AE+AV+A DIPEVIGTAFALN+LF IP+W+
Sbjct  99    ANLGVVTGKHLAEHCRAEYSKVPNFLLWVVAEIAVVACDIPEVIGTAFALNMLFSIPVWI  158

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL TGLSTL+LL+LQ+YGVRKLE LIA LVF +A CF  E+ Y KP   +V  G+F+P+
Sbjct  159   GVLLTGLSTLMLLALQQYGVRKLEFLIAFLVFTIALCFVIELHYSKPDPGEVLHGLFVPQ  218

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P S  G+ +ACR++LIESG AL +A
Sbjct  219   LKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSSTGIKEACRFYLIESGLALMIA  278

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
             FLINV+V+SVSG VC+   L+ +D   C DL LN ASFLL+NV+GK SS ++AIALLASG
Sbjct  279   FLINVSVISVSGAVCNAPDLTPEDRAKCEDLDLNKASFLLRNVVGKWSSKLFAIALLASG  338

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiias  1246
             QSSTITGTYAGQY+MQGFLDL+++ W RN +TRC+AI PSLIV++IGGS+GAG+LIIIAS
Sbjct  339   QSSTITGTYAGQYVMQGFLDLRLEPWLRNFLTRCLAIIPSLIVALIGGSAGAGKLIIIAS  398

Query  1247  MILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWL  1426
             MILSFELPFAL+PLLKF+S  TKMG + N + I  ++W++G  I+GINIYY+ ++F   L
Sbjct  399   MILSFELPFALVPLLKFTSCKTKMGSHVNHMAITTLTWVIGALIMGINIYYIISSFTKLL  458

Query  1427  IHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDK  1537
             IH+++  A  +  GI+ F  +AIY+ ++ YL+FRK++
Sbjct  459   IHSHMKLALVIFCGILGFSGIAIYLASIAYLVFRKNR  495



>ref|XP_006341345.1| PREDICTED: LOW QUALITY PROTEIN: metal transporter Nramp1-like 
[Solanum tuberosum]
Length=533

 Score =   506 bits (1302),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 288/456 (63%), Positives = 360/456 (79%), Gaps = 0/456 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             K  W+   SY+GPGF+VS+AY+DPGN +TDLQAGA ++Y LLW++L+    AL+IQSLAA
Sbjct  39    KKSWKNIFSYIGPGFLVSIAYIDPGNFQTDLQAGAQYKYGLLWIILLASFAALVIQSLAA  98

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E C+ EY K   + LW++AE+A++A DIPEVIGTAFALN+LF IPLW G
Sbjct  99    NLGVVTGKHLAEHCRKEYAKVPNFILWVIAEIAIVACDIPEVIGTAFALNMLFKIPLWCG  158

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLSTL LL LQ+YGVR LE  IA LV  +A CFF E+ Y KP + +V  G+F+P+L
Sbjct  159   VLITGLSTLTLLLLQQYGVRTLEFFIAFLVLTVAICFFVELGYAKPDSSEVLHGLFVPQL  218

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SV G+ +ACRY+LIESG AL +AF
Sbjct  219   KGTGATKLAISLLGAMVMPHNLFLHSALVLSRKIPRSVNGIKEACRYYLIESGLALMLAF  278

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LINV+V+SV+G VC++  +S DD + C DL LN ASFLLKNVLG  SS ++AIALLASGQ
Sbjct  279   LINVSVISVTGAVCNSPSMSPDDQEKCQDLDLNKASFLLKNVLGNWSSKLFAIALLASGQ  338

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDL++K W RN +TRC+AI PSL+VS+IGGS GAG LIIIASM
Sbjct  339   SSTITGTYAGQYVMQGFLDLRLKPWIRNFLTRCLAIVPSLVVSLIGGSGGAGNLIIIASM  398

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFALIPLLKF+SS TKMG + N + +   +W++G  I+GINIYYL+   V  L 
Sbjct  399   ILSFELPFALIPLLKFTSSKTKMGSHANPVAVSAATWVIGTLIMGINIYYLAEKLVTSLK  458

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDK  1537
              ++L  A  VL GI+    + +Y+ +++YL FRK+K
Sbjct  459   DSHLGNAAKVLCGILGASCLLVYLSSILYLAFRKNK  494



>emb|CDY39940.1| BnaC06g40180D [Brassica napus]
Length=519

 Score =   505 bits (1301),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 286/456 (63%), Positives = 367/456 (80%), Gaps = 0/456 (0%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             +   W+ F +Y+GPGF+VS+AY+DPGN ETDLQAGA ++YELLW++L+     L+IQSLA
Sbjct  27    ENKSWKNFFAYLGPGFLVSIAYIDPGNFETDLQAGAQYKYELLWIILVASCAGLVIQSLA  86

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGV TGKHL+E C+AEY K   + LW++AE+A++A DIPEVIGTAFALN+LF IP+W+
Sbjct  87    ANLGVVTGKHLAEHCRAEYSKVPNFLLWVVAEIAIVACDIPEVIGTAFALNMLFSIPIWI  146

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL TGLSTL+LL+LQ+YGVRKLE L+A LVF +A CF  E+ Y KP A +V  G+F+P+
Sbjct  147   GVLLTGLSTLMLLALQQYGVRKLEFLVAFLVFTIAICFVIELHYSKPDAGEVLHGLFVPQ  206

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P S  G+ +ACR++LIESG AL VA
Sbjct  207   LKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSSTGIKEACRFYLIESGLALMVA  266

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
             FLINV+V+SVSG VC+   L+ +D   C DL LN ASFLL+NV+GK SS ++AIALLASG
Sbjct  267   FLINVSVISVSGAVCNASDLTPEDRAKCEDLDLNKASFLLRNVVGKWSSKLFAIALLASG  326

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiias  1246
             QSSTITGTYAGQYIMQGFLDL++  W RN +TRC+AI PSLIV++IGGS+GAG+LIIIAS
Sbjct  327   QSSTITGTYAGQYIMQGFLDLRLVPWLRNFLTRCLAIIPSLIVALIGGSAGAGKLIIIAS  386

Query  1247  MILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWL  1426
             MILSFELPFAL+PLLKF+S   KMG + N + I  ++W++G  I+GINIYY+ ++F   L
Sbjct  387   MILSFELPFALVPLLKFTSCKIKMGSHVNHMAISALTWVIGGLIMGINIYYIVSSFTKLL  446

Query  1427  IHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKD  1534
             IH+++     V  GI+ F  +AIY+ ++ YL+FRK+
Sbjct  447   IHSHMKHVLVVFCGIIGFSGIAIYLASIAYLVFRKN  482



>ref|XP_009106714.1| PREDICTED: metal transporter Nramp1-like [Brassica rapa]
 emb|CDX87346.1| BnaA07g35270D [Brassica napus]
Length=519

 Score =   504 bits (1299),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 286/456 (63%), Positives = 367/456 (80%), Gaps = 0/456 (0%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             +   W+ F +Y+GPGF+VS+AY+DPGN ETDLQAGA ++YELLW++L+     L+IQSLA
Sbjct  27    ENKSWKNFFAYLGPGFLVSIAYIDPGNFETDLQAGAQYKYELLWIILVASCAGLVIQSLA  86

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGV TGKHL+E C+AEY K   + LW++AE+A++A DIPEVIGTAFALN+LF IP+W+
Sbjct  87    ANLGVVTGKHLAEHCRAEYSKVPNFLLWVVAEIAIVACDIPEVIGTAFALNMLFSIPIWI  146

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL TGLSTL+LL+LQ+YGVRKLE L+A LVF +A CF  E+ Y KP A +V  G+F+P+
Sbjct  147   GVLLTGLSTLMLLALQQYGVRKLEFLVAFLVFTIAICFVIELHYSKPDAGEVLHGLFVPQ  206

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P S  G+ +ACR++LIESG AL VA
Sbjct  207   LKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSSTGIKEACRFYLIESGLALMVA  266

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
             FLINV+V+SVSG VC+   L+ +D   C DL LN ASFLL+NV+GK SS ++AIALLASG
Sbjct  267   FLINVSVISVSGAVCNASDLTPEDRAKCEDLDLNKASFLLRNVVGKWSSKLFAIALLASG  326

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiias  1246
             QSSTITGTYAGQYIMQGFLDL++  W RN +TRC+AI PSLIV++IGGS+GAG+LIIIAS
Sbjct  327   QSSTITGTYAGQYIMQGFLDLRLVPWLRNFLTRCLAIIPSLIVALIGGSAGAGKLIIIAS  386

Query  1247  MILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWL  1426
             MILSFELPFAL+PLLKF+S   KMG + N + I  ++W++G  I+GINIYY+ ++F   L
Sbjct  387   MILSFELPFALVPLLKFTSCKIKMGSHVNHMAISALTWVIGGLIMGINIYYIVSSFTKLL  446

Query  1427  IHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKD  1534
             IH+++     V  GI+ F  +AIY+ ++ YL+FRK+
Sbjct  447   IHSHMKHVLVVFCGILGFTGIAIYLASIAYLVFRKN  482



>ref|XP_008392949.1| PREDICTED: metal transporter Nramp5-like [Malus domestica]
Length=412

 Score =   500 bits (1288),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 297/376 (79%), Positives = 337/376 (90%), Gaps = 0/376 (0%)
 Frame = +2

Query  473   VIGTAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEM  652
             VIGTAFALNILF+IP+W GVL TG STLLLL LQ+YGVRKLE+LIAVLVF+MAACFFGEM
Sbjct  15    VIGTAFALNILFNIPVWTGVLLTGFSTLLLLGLQKYGVRKLEMLIAVLVFVMAACFFGEM  74

Query  653   AYVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGV  832
             +YVKPPA  V KGMFIPKLSGQGAT DAIALLGAL+MPHNLFLHSALVL+RK+P SVRG+
Sbjct  75    SYVKPPASGVLKGMFIPKLSGQGATGDAIALLGALIMPHNLFLHSALVLSRKIPKSVRGM  134

Query  833   NDACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKN  1012
             NDACRYFLIESGFALFVAFLINVA++SVSGTVC    LS  + D CSDL+LNSASFLL+N
Sbjct  135   NDACRYFLIESGFALFVAFLINVAIISVSGTVCHQSNLSDKNNDTCSDLTLNSASFLLQN  194

Query  1013  VLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPsli  1192
             VLG+SS  +YAIALLASGQSSTITGTYAGQ++MQGFL++KMKKW+RNLMTRCIAITPSLI
Sbjct  195   VLGRSSKILYAIALLASGQSSTITGTYAGQFVMQGFLBIKMKKWARNLMTRCIAITPSLI  254

Query  1193  vsiiggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilgl  1372
             VSIIGGSSGAGRLIIIASMILSFELPFALIPLLKFS S+TKMGP+KNSIYIIV+SWI+G+
Sbjct  255   VSIIGGSSGAGRLIIIASMILSFELPFALIPLLKFSXSATKMGPHKNSIYIIVISWIIGM  314

Query  1373  giiginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFI  1552
              IIGINIYYLST FV W+IH++LPK   V +GI+VFP+MAIY++AV+YL  RKD VVTF+
Sbjct  315   AIIGINIYYLSTGFVGWIIHSSLPKVATVFIGILVFPIMAIYILAVLYLALRKDSVVTFV  374

Query  1553  QPNDDDSKMDNNVNNN  1600
             +P  +D    N + N 
Sbjct  375   EPTKNDPAAQNQMENG  390



>ref|XP_010926920.1| PREDICTED: metal transporter Nramp3-like isoform X2 [Elaeis guineensis]
Length=499

 Score =   503 bits (1296),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 274/406 (67%), Positives = 334/406 (82%), Gaps = 4/406 (1%)
 Frame = +2

Query  122   DSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWV  301
             D+I+  Q+ + E    +  W+   +Y+GPGF+VS+AY+DPGN ETDLQAGA ++YELLW+
Sbjct  32    DNIDAEQIIVPE----RKSWKNLFAYIGPGFLVSIAYIDPGNFETDLQAGAQYKYELLWI  87

Query  302   VLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIG  481
             +L+    ALIIQSLAA LGV TGKHL+E C+AEYPK   + LW+LAELAV+A DIPEVIG
Sbjct  88    ILVASCAALIIQSLAAKLGVVTGKHLAEHCRAEYPKVPNFILWILAELAVVACDIPEVIG  147

Query  482   TAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYV  661
             TAFALN+LF IP+W GVL TGLSTL+LL LQ+YGVRKLE LIA LVF MA+CFF E+ Y 
Sbjct  148   TAFALNMLFRIPVWCGVLITGLSTLMLLLLQQYGVRKLEFLIAFLVFTMASCFFVELGYA  207

Query  662   KPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDA  841
             KP + +V KG+F+P+L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P S+ G+ +A
Sbjct  208   KPNSSEVLKGLFVPQLKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSIHGIKEA  267

Query  842   CRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLG  1021
              R++ IES  ALFVAFLINV+V+SVSG VCS+  LS +D  +C DL LN ASFLL+NVLG
Sbjct  268   YRFYTIESALALFVAFLINVSVISVSGAVCSSDNLSPEDQRNCEDLDLNKASFLLRNVLG  327

Query  1022  KSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsi  1201
             K SS ++A ALLASGQSSTITGTYAGQY+MQGFLDL++  W RN++TR +AI PSLIV++
Sbjct  328   KWSSKLFAFALLASGQSSTITGTYAGQYVMQGFLDLRITPWIRNMLTRSLAIVPSLIVAL  387

Query  1202  iggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSI  1339
             IGGSS AG+LIIIASMILSFELPFAL+PLLKF+SS TKMG Y NSI
Sbjct  388   IGGSSAAGKLIIIASMILSFELPFALVPLLKFTSSKTKMGSYSNSI  433



>emb|CCM80484.1| Nramp1.1 [Psychotria gabriellae]
Length=508

 Score =   504 bits (1297),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 299/484 (62%), Positives = 370/484 (76%), Gaps = 7/484 (1%)
 Frame = +2

Query  149   LQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFAL  328
             +Q +    P WRKFL ++GPG ++S+AYLDPGNLETDLQAGADH+YELLW+VLIGL FA 
Sbjct  5     VQIQETPSP-WRKFLGFIGPGILISVAYLDPGNLETDLQAGADHKYELLWIVLIGLTFAH  63

Query  329   IIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILF  508
             +IQS +ANLGV+TGKHLSE C  EYPK V   LW+ AE+AV+AADIPEV+GTAFALN+LF
Sbjct  64    LIQSRSANLGVATGKHLSEQCSKEYPKVVTVFLWMFAEVAVVAADIPEVLGTAFALNLLF  123

Query  509   HIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFK  688
              +P+W GVL  GLSTLLLL LQRYG+R LE++I  LV ++  CF   M + +P  ++V  
Sbjct  124   KVPIWAGVLLAGLSTLLLLGLQRYGIRTLEIVITTLVLIVGGCFLTVMVHARPDVKEVAM  183

Query  689   GMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESG  868
             GMFIPKLS   A  DA+ALLGAL+MPHNLFLHSALVL+RK+P +V GV  A RYF +ESG
Sbjct  184   GMFIPKLSHGSAVRDAVALLGALIMPHNLFLHSALVLSRKIPPTVEGVRSASRYFFVESG  243

Query  869   FALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAI  1048
              AL +AFLIN+AVVSVSG+VCSN  +S +   HC  ++LNSA+FLLK+ LGK SS VYAI
Sbjct  244   LALLIAFLINLAVVSVSGSVCSNPSISSESKKHCKSITLNSAAFLLKDSLGKWSSIVYAI  303

Query  1049  ALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagr  1228
             +LLASGQSST+TGTYAGQYIMQGF D +M  W RNL+TR I+I PSL+V IIGG SGA R
Sbjct  304   SLLASGQSSTVTGTYAGQYIMQGFFDFRMSLWLRNLVTRSISIIPSLVVCIIGGPSGAAR  363

Query  1229  liiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsT  1408
             LII+ASMILSF LPFALIPLLKF+SS  KMG +KNS+   +VSW+LG   I IN+Y+LST
Sbjct  364   LIIVASMILSFVLPFALIPLLKFTSSEAKMGQHKNSLIATLVSWLLGFCSISINLYFLST  423

Query  1409  AFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMDNN  1588
             + + W+I N +P A  +L GI + PLM +Y+  V YL  + +       P+ D + +D +
Sbjct  424   SLLGWIISNKMPMATRILAGIFIVPLMMLYMGMVAYLTLKPET------PSPDPTFLDVD  477

Query  1589  VNNN  1600
              NN 
Sbjct  478   SNNE  481



>gb|AAF18493.1|AC010924_6 Strong similarity to gi|2130080 Nramp1 protein from Oryza sativa 
and contains a PF|01566 Nramp domain [Arabidopsis thaliana]
Length=522

 Score =   504 bits (1298),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 289/457 (63%), Positives = 373/457 (82%), Gaps = 5/457 (1%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             +K  W+ F SY+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    AL+IQSLA
Sbjct  31    EKKSWKNFFSYLGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALVIQSLA  90

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGV TGKHL+E C+AEY K   + LW++AE+AV+A     +IGTAFALN+LF+IP+W+
Sbjct  91    ANLGVVTGKHLAEHCRAEYSKVPNFMLWVVAEIAVVA-----LIGTAFALNMLFNIPVWI  145

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL TGLSTL+LL+LQ+YG+RKLE LIA LVF +A CFF E+ Y KP  ++V  G+F+P+
Sbjct  146   GVLLTGLSTLILLALQQYGIRKLEFLIAFLVFTIALCFFVELHYSKPDPKEVLYGLFVPQ  205

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SV G+ +ACRY+LIESG AL VA
Sbjct  206   LKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVTGIKEACRYYLIESGLALMVA  265

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
             FLINV+V+SVSG VC+   LS +D   C DL LN ASFLL+NV+GK SS ++AIALLASG
Sbjct  266   FLINVSVISVSGAVCNASDLSPEDRASCQDLDLNKASFLLRNVVGKWSSKLFAIALLASG  325

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiias  1246
             QSSTITGTYAGQY+MQGFLDL+++ W RN +TRC+AI PSLIV++IGGS+GAG+LIIIAS
Sbjct  326   QSSTITGTYAGQYVMQGFLDLRLEPWLRNFLTRCLAIIPSLIVALIGGSAGAGKLIIIAS  385

Query  1247  MILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWL  1426
             MILSFELPFAL+PLLKF+SS TKMG + NS+ I  V+WI+G  I+GINIYYL ++F+  L
Sbjct  386   MILSFELPFALVPLLKFTSSKTKMGSHANSLVISSVTWIIGGLIMGINIYYLVSSFIKLL  445

Query  1427  IHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDK  1537
             +H+++     V +G++ F  +A Y+ A+ YL+ RK++
Sbjct  446   LHSHMNLVAIVFLGVLGFSGIATYLAAISYLVLRKNR  482



>ref|XP_008645206.1| PREDICTED: metal transporter NRAT1-like [Zea mays]
 ref|XP_008645207.1| PREDICTED: metal transporter NRAT1-like [Zea mays]
 gb|AFW69998.1| hypothetical protein ZEAMMB73_660809 [Zea mays]
Length=551

 Score =   504 bits (1298),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 284/481 (59%), Positives = 375/481 (78%), Gaps = 4/481 (1%)
 Frame = +2

Query  122   DSINKLQLDLQEEHNKK--PGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELL  295
             + ++K  +D  E+   +    WR+FL++VGPG +V++ +LDP NLETD+QAGAD +Y+LL
Sbjct  32    ERVDKAVVDGGEDERFRVQRKWRRFLAHVGPGALVAIGFLDPSNLETDMQAGADFKYQLL  91

Query  296   WVVLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEV  475
             WV+L+G+VFAL+IQ+LAANLGV TGKHL+ELC+ EYP+ V  CLW++AELAVI+ DIPEV
Sbjct  92    WVILVGMVFALLIQTLAANLGVKTGKHLAELCREEYPRSVNICLWIIAELAVISDDIPEV  151

Query  476   IGTAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMA  655
             +GTAFA NIL  IP+W GV+ T LSTLLLL ++R+G RKLE ++A  +F MAACFFGE++
Sbjct  152   LGTAFAFNILLGIPVWAGVVLTVLSTLLLLGVERFGARKLEFVVAAFMFAMAACFFGELS  211

Query  656   YVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVN  835
             Y++P A +V +GMF+P+L G+GA A+AIAL GA++ P+NLFLHSALVL+RK P SV+ + 
Sbjct  212   YLRPSAGEVVEGMFVPRLRGKGAAANAIALFGAIITPYNLFLHSALVLSRKTPRSVKSIR  271

Query  836   DACRYFLIESGFALFVAFLINVAVVSVSGTVC--SNGKLSKDDLDHCSDLSLNSASFLLK  1009
              ACRYFL+E   A  VAFLINVAVV V+G++C  + G LS  D   C DL+L S   LL+
Sbjct  272   AACRYFLVECSLAFVVAFLINVAVVVVAGSICNAAGGNLSPADAAACGDLTLQSTPLLLR  331

Query  1010  NVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPsl  1189
             +VLG+SSS VYA+ALLASGQS+TI+ T+AGQ IMQGFLD++MK W RNL TR IAI PSL
Sbjct  332   DVLGRSSSVVYAVALLASGQSTTISCTFAGQVIMQGFLDMRMKSWVRNLTTRAIAIAPSL  391

Query  1190  ivsiiggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilg  1369
             +VSI+ G SGAG+LI+ +SM+LSFELPFALIPLLKF +SS K+GP K SIY +V++W L 
Sbjct  392   VVSIVSGPSGAGKLIVFSSMVLSFELPFALIPLLKFCNSSNKVGPLKESIYTVVIAWALS  451

Query  1370  lgiiginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTF  1549
               +I +N Y+L   +VDWL+H+ LPK    L+ + V  LMA Y+  V+YL FR+D V T+
Sbjct  452   FALIVVNTYFLVWTYVDWLVHSRLPKYATALLSVAVLALMAAYLAFVVYLAFRRDAVRTY  511

Query  1550  I  1552
             +
Sbjct  512   V  512



>ref|XP_004235940.1| PREDICTED: LOW QUALITY PROTEIN: metal transporter Nramp6 [Solanum 
lycopersicum]
Length=533

 Score =   503 bits (1294),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 285/456 (63%), Positives = 360/456 (79%), Gaps = 0/456 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             K  W+   SY+GPGF+VS+AY+DPGN +TDLQAGA ++Y LLW++L+    AL+IQSLAA
Sbjct  39    KKSWKNIFSYIGPGFLVSIAYIDPGNFQTDLQAGAQYKYGLLWIILLASFAALVIQSLAA  98

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E C+ EY K   + LW++AE+A++A DIPEVIGTAFALN+LF IP+W G
Sbjct  99    NLGVVTGKHLAEHCRKEYAKVPNFILWVIAEIAIVACDIPEVIGTAFALNMLFKIPIWCG  158

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLSTL LL LQ+YGVR LE  IA LV  +A CFF E+ Y KP + +V +G+F+P+L
Sbjct  159   VLITGLSTLTLLLLQQYGVRTLEFFIAFLVLTVAVCFFVELGYAKPDSSEVLQGLFVPQL  218

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SV G+ +ACRY+LIESG AL VAF
Sbjct  219   KGTGATKLAISLLGAMVMPHNLFLHSALVLSRKIPRSVNGIKEACRYYLIESGLALMVAF  278

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LINV+V+SV+G VC++  +S DD + C DL LN ASFLLKNVLG  SS ++AIALLASGQ
Sbjct  279   LINVSVISVTGAVCNSPSMSPDDQEKCQDLDLNKASFLLKNVLGNWSSKLFAIALLASGQ  338

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDL++K W RN +TRC+AI PSL+VS+IGGS GAG LIIIASM
Sbjct  339   SSTITGTYAGQYVMQGFLDLRLKPWIRNFLTRCLAIVPSLVVSLIGGSGGAGNLIIIASM  398

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFALIPLLKF+SS TKMG + N + +   +W++G  I+GINIYYL+   +  + 
Sbjct  399   ILSFELPFALIPLLKFTSSKTKMGSHANPVAVSAATWVIGTLIMGINIYYLAEKLITSIK  458

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDK  1537
               +L KA  VL G++    +  Y+ +++YL FR++K
Sbjct  459   DGHLGKASKVLCGLLGASCLLGYLSSILYLAFRRNK  494



>ref|XP_010459131.1| PREDICTED: metal transporter Nramp6-like isoform X1 [Camelina 
sativa]
Length=561

 Score =   503 bits (1296),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 298/508 (59%), Positives = 384/508 (76%), Gaps = 39/508 (8%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             +K  W+ F SY+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    AL+IQSLA
Sbjct  34    EKKSWKNFFSYLGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALVIQSLA  93

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGV TGKHL+E C+AEY K   + LW++AE+AV+A DIPEVIGTAFALN+LF+IP+W+
Sbjct  94    ANLGVVTGKHLAEHCRAEYSKVPNFMLWVVAEIAVVACDIPEVIGTAFALNMLFNIPVWI  153

Query  527   gvlctglstllllslQRYGV----------------------------------RKLELL  604
             GVL TGLSTL+LL+LQRYGV                                  RKLE L
Sbjct  154   GVLLTGLSTLILLALQRYGVSTFTFVMFFYSFSVSCGFQVSKSVSWLFFISLQIRKLEFL  213

Query  605   IAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLH  784
             IA LVF +A CFF E+ Y KP  ++V  G+F+P+L G GAT  AI+LLGA+VMPHNLFLH
Sbjct  214   IAFLVFTIALCFFVELHYSKPDPKEVLYGLFVPQLKGNGATGLAISLLGAMVMPHNLFLH  273

Query  785   SALVLTRKVPNSVRGVNDACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLD  964
             SALVL+RK+P SV G+ +ACRY+LIESG AL VAFLINV+V+SVSG VC+   LS +D  
Sbjct  274   SALVLSRKIPRSVPGIKEACRYYLIESGLALSVAFLINVSVISVSGAVCNAPDLSPEDRA  333

Query  965   HCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKW  1144
              C DL LN ASFLL+NV+GK SS ++AIALLASGQSSTITGTYAGQY+MQGFL+L+++ W
Sbjct  334   SCEDLDLNKASFLLRNVVGKWSSKIFAIALLASGQSSTITGTYAGQYVMQGFLNLRLQPW  393

Query  1145  SRNLMTRCIAITPslivsiiggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGP  1324
              RN +TRC+AI PSLIV++IGGS+GAG+LIIIASMILSFELPFAL+PLLKF+SS TKMG 
Sbjct  394   LRNFLTRCLAIIPSLIVALIGGSAGAGKLIIIASMILSFELPFALVPLLKFTSSRTKMGS  453

Query  1325  YKNSIYiivvswilglgiiginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVV  1504
             + NS+ I  V+WI+G  I+GINIYY+ ++F+  L+H+++     V +GI+ F  +A+Y+ 
Sbjct  454   HANSLLISAVTWIIGGLIMGINIYYIVSSFIKLLLHSHMKLVAIVFLGILGFSGIALYLA  513

Query  1505  AVIYLMFRKDKVVTFIQPNDDDSKMDNN  1588
             A+ YL+ RK++     +P+      DN+
Sbjct  514   AIGYLVLRKNR-----EPSTQYLPSDNS  536



>ref|XP_011082369.1| PREDICTED: metal transporter Nramp6-like isoform X4 [Sesamum 
indicum]
Length=473

 Score =   499 bits (1286),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 265/390 (68%), Positives = 328/390 (84%), Gaps = 0/390 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             K  W+   +Y+GPGF+VS+AY+DPGN +TDLQ+GA ++Y LLW++L+    ALIIQSLAA
Sbjct  44    KTSWKNLFAYMGPGFLVSIAYIDPGNFQTDLQSGAQYKYGLLWIILLASFAALIIQSLAA  103

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E C+ EYPK   + LW+LAE+A++A DIPEVIGTAFAL++LF +PLW+G
Sbjct  104   NLGVVTGKHLAEHCRQEYPKIPNFILWILAEIAIVACDIPEVIGTAFALDMLFGVPLWIG  163

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLST++LL LQ+YGVRKLE+LIA LVF +A CF  E+ Y KP + +V +G+FIP+L
Sbjct  164   VLITGLSTMVLLLLQQYGVRKLEILIAFLVFTIAGCFLAELKYAKPNSSEVLRGLFIPQL  223

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SV G+ +ACR++LIESG AL VAF
Sbjct  224   KGSGATKLAISLLGAMVMPHNLFLHSALVLSRKIPRSVNGIKEACRFYLIESGLALMVAF  283

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LIN++V+SVSG VC++  L+ DDL  C +L LN ASFLLK+VLG  SS ++AIALLASGQ
Sbjct  284   LINISVISVSGAVCNSPNLNSDDLQSCQNLDLNEASFLLKHVLGSWSSKLFAIALLASGQ  343

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDL++K W RN +TRC+AI PSLIV+IIGGS+GAG LIIIASM
Sbjct  344   SSTITGTYAGQYVMQGFLDLRLKPWIRNFLTRCLAIVPSLIVAIIGGSTGAGNLIIIASM  403

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSI  1339
             ILSFELPFALIPLLKF+SS TKMG Y N++
Sbjct  404   ILSFELPFALIPLLKFTSSKTKMGSYANTV  433



>gb|EYU24596.1| hypothetical protein MIMGU_mgv1a004193mg [Erythranthe guttata]
Length=433

 Score =   497 bits (1279),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 267/390 (68%), Positives = 324/390 (83%), Gaps = 0/390 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             K  W+   +Y+GPGF+VS+AY+DPGN +TDLQAGA ++Y LLW++L+    AL+IQSLAA
Sbjct  39    KKSWKNLFAYMGPGFLVSIAYIDPGNFQTDLQAGAQYKYGLLWIILLASCAALVIQSLAA  98

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E C+ EYPK   + LW++AE+A++A DIPEVIGTAFALN+LF IPLW+G
Sbjct  99    NLGVVTGKHLAEHCRLEYPKVPNFILWIIAEIAIVACDIPEVIGTAFALNMLFKIPLWLG  158

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLSTL+LL LQ+YGVRKLE+LI  LV  +A CFF E+AY KP A +V +G+F+P+L
Sbjct  159   VLITGLSTLVLLLLQQYGVRKLEILITFLVLTIAGCFFAELAYAKPVASEVLQGLFVPQL  218

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SV G+ +AC ++LIESGFAL VAF
Sbjct  219   KGSGATKLAISLLGAMVMPHNLFLHSALVLSRKIPRSVSGIREACAFYLIESGFALLVAF  278

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LIN++V+SVSG VC++  L   DL  C +L LN ASFLL+NVLG  SS ++AIALLASGQ
Sbjct  279   LINISVISVSGAVCNSSNLDPKDLQSCKNLDLNEASFLLRNVLGNWSSKLFAIALLASGQ  338

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDL++K W RN +TRC+AI PSL V+IIGGSSGAG LIIIASM
Sbjct  339   SSTITGTYAGQYVMQGFLDLRLKPWVRNFVTRCLAIVPSLAVAIIGGSSGAGNLIIIASM  398

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSI  1339
             ILSFELPFALIPLLKF+S  TKMG Y NSI
Sbjct  399   ILSFELPFALIPLLKFTSCKTKMGIYVNSI  428



>gb|EMT07132.1| Metal transporter Nramp6 [Aegilops tauschii]
Length=549

 Score =   499 bits (1286),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 265/466 (57%), Positives = 334/466 (72%), Gaps = 23/466 (5%)
 Frame = +2

Query  158   EHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQ  337
             E   +P WRKFL++VG G +V++ +LDP NLETD+QAGAD +YELLWVVL+G++F L IQ
Sbjct  38    EFQVQPRWRKFLAHVGSGALVAIGFLDPSNLETDMQAGADFKYELLWVVLVGMIFVLFIQ  97

Query  338   SLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIP  517
             +L+ANLGV TG+HL+ELC+ EYP +V  CLW++AELAVI+ DIPEV+GTAFA NILF IP
Sbjct  98    TLSANLGVKTGRHLAELCREEYPPFVNICLWIIAELAVISDDIPEVLGTAFAFNILFKIP  157

Query  518   LWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMF  697
             +W GV+ T  STLLLL +QR+G RKLE +IA  +F MA CFFGE++Y+ P A DV KGMF
Sbjct  158   VWAGVILTVFSTLLLLGVQRFGARKLEFIIAAFMFTMAGCFFGELSYLSPSARDVTKGMF  217

Query  698   IPKLSGQGATADAIALLGALVMP--HNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGF  871
             +P L G+GA A+A+AL GA++ P     F+   LVL       +     ACRY LIE   
Sbjct  218   VPSLRGKGAAANAMALFGAIIHPSLSVTFMQVQLVLALCPGPLMEDPTAACRYVLIECSL  277

Query  872   ALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIA  1051
             A  VAFLINVAVV V+G++CS   LS  D   C DL+L SA  L++NVLG+SSS VYA+A
Sbjct  278   AFVVAFLINVAVVIVAGSICSANNLSPADAGACGDLTLQSAPLLIRNVLGRSSSVVYAVA  337

Query  1052  LLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrl  1231
             LLASGQS+TI+ T+AGQ IMQGFLD+KMK W RNL+TR IAI P                
Sbjct  338   LLASGQSTTISCTFAGQVIMQGFLDMKMKNWVRNLITRVIAIAP---------------S  382

Query  1232  iiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTA  1411
             +I++ MILSFELPFALIPLLKF +SS K+GP K SIY + V+ I+      +        
Sbjct  383   LIVSIMILSFELPFALIPLLKFCNSSKKVGPLKESIYALSVALIIVNTYFLVW------T  436

Query  1412  FVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTF  1549
             ++DWL HN+LP+  N LV +VVF LMA Y+VAV+YL FRKD VVT+
Sbjct  437   YIDWLAHNHLPRYTNTLVSVVVFALMAAYLVAVVYLTFRKDMVVTY  482



>emb|CDX79348.1| BnaC06g19550D [Brassica napus]
Length=526

 Score =   499 bits (1284),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 284/457 (62%), Positives = 369/457 (81%), Gaps = 5/457 (1%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             +K  W+ F +Y+GPGF+VS+AY+DPGN ETDLQAGA ++YELLW++L+    AL+IQSLA
Sbjct  38    EKKSWKNFFAYLGPGFLVSIAYIDPGNFETDLQAGAQYKYELLWIILVASCAALVIQSLA  97

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGV TGKHL+E C+AEY K   + LW++AE+AV+A     +IGTAFALN+LFHIP+W+
Sbjct  98    ANLGVVTGKHLAEHCRAEYSKVPNFLLWVVAEIAVVA-----LIGTAFALNMLFHIPVWI  152

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL TGLSTL+LL+LQ+YGVRKLE LIA LVF +A CFF E+ Y KP   +V  G+F+P+
Sbjct  153   GVLLTGLSTLMLLALQQYGVRKLEFLIAFLVFTIAICFFVELHYSKPDPREVLHGLFVPQ  212

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P S  G+ +ACR++LIESG AL VA
Sbjct  213   LKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSATGIKEACRFYLIESGLALTVA  272

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
             FLINV+V+SVSG VC+   LS +D   C DL LN ASFLL+N +GK SS ++AIALLASG
Sbjct  273   FLINVSVISVSGAVCNAPDLSPEDRAKCEDLDLNKASFLLRNAVGKWSSKLFAIALLASG  332

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiias  1246
             QSSTITGTYAGQY+MQGFLDL+++ W RN +TRC+AI PSL+V+IIGGS+GAG+LIIIAS
Sbjct  333   QSSTITGTYAGQYVMQGFLDLRLEPWLRNFLTRCLAIIPSLVVAIIGGSAGAGKLIIIAS  392

Query  1247  MILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWL  1426
             MILSFELPFAL+PLLKF+S   KMG Y N + +  ++W++G  I+GINIYYL ++F+  L
Sbjct  393   MILSFELPFALVPLLKFTSCKIKMGSYVNPMAVSALTWVIGGLIMGINIYYLVSSFIKLL  452

Query  1427  IHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDK  1537
             +H+++     V  GI+ F  +AIY+ +++YL+FR+++
Sbjct  453   VHSHMKLGLVVFCGILGFSGIAIYLASIVYLVFRRNR  489



>emb|CDY33364.1| BnaC05g12190D [Brassica napus]
Length=492

 Score =   497 bits (1279),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 285/458 (62%), Positives = 369/458 (81%), Gaps = 5/458 (1%)
 Frame = +2

Query  164   NKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSL  343
             ++K  W+ F SY+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    AL+IQSL
Sbjct  24    SEKKSWKNFFSYLGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALVIQSL  83

Query  344   AANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLW  523
             AANLGV TGKHL+E C+AEY K   + LW++AE+AV+A     +IGTAFALN+LF+IP+W
Sbjct  84    AANLGVVTGKHLAEHCRAEYSKVPNFMLWVVAEIAVVA-----LIGTAFALNMLFNIPVW  138

Query  524   vgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIP  703
             +GVL TG STL+LL+LQ+YG+RKLE LIA LV  +A CF  E+ Y KP  ++V  G+F+P
Sbjct  139   IGVLLTGFSTLILLALQKYGIRKLEFLIAFLVLTIALCFLIELHYSKPDPKEVLYGLFVP  198

Query  704   KLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFV  883
             +L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SV G+ +ACRY+LIESG AL V
Sbjct  199   QLKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVTGIKEACRYYLIESGLALTV  258

Query  884   AFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLAS  1063
             AFLINV+V+SVSG VC+   LS +D   C DL LN ASFLL+NV+GK SS ++AIALLAS
Sbjct  259   AFLINVSVISVSGAVCNASDLSPEDQASCEDLDLNKASFLLRNVVGKWSSKLFAIALLAS  318

Query  1064  GQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiia  1243
             GQSSTITGTYAGQY+MQGFLDL ++ W RN +TRC+AI PSLIV++IGGS+GAG+LIIIA
Sbjct  319   GQSSTITGTYAGQYVMQGFLDLTIRPWLRNFLTRCLAIIPSLIVALIGGSAGAGKLIIIA  378

Query  1244  sMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDW  1423
             SMILSFELPFAL+PLLKF+ S TKMG + NS+ I  V+W++G  I+GINIYYL ++F+  
Sbjct  379   SMILSFELPFALVPLLKFTCSKTKMGSHANSLLISSVTWVIGGLIMGINIYYLVSSFIKL  438

Query  1424  LIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDK  1537
             ++H ++     V +GI+ F  +AIY+ A+ YL+ RK++
Sbjct  439   ILHGHMKLVAVVFLGILGFSGIAIYLAAIGYLVLRKNR  476



>ref|XP_004303243.1| PREDICTED: LOW QUALITY PROTEIN: metal transporter Nramp6-like 
[Fragaria vesca subsp. vesca]
Length=547

 Score =   487 bits (1253),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 277/466 (59%), Positives = 364/466 (78%), Gaps = 10/466 (2%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             K  W+   +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++Y LLW++L+    AL+IQSLAA
Sbjct  39    KTSWKNLFAYMGPGFLVSIAYIDPGNFETDLQSGAQYKYGLLWIILVASCAALVIQSLAA  98

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E C+AEYPK   + LW+LAE++++A DIPEVIGTAFALN+LF+IP+W+G
Sbjct  99    NLGVVTGKHLAEHCRAEYPKKTNFILWVLAEISIVACDIPEVIGTAFALNMLFNIPIWIG  158

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLSTL+LL+LQ+YGVRKLE LIA LV  +A CFF E+ Y KP A +V  G+F+P+L
Sbjct  159   VLLTGLSTLMLLALQQYGVRKLEFLIAFLVLTIAGCFFAELGYAKPAASEVLDGLFVPQL  218

Query  710   SGQGATADAIALLGALVMPHNLFLHSA----LVLTRKVPNSV------RGVNDACRYFLI  859
              G GAT  AI+LLGA+VMP +  L       L++  K+  S         V +ACR++++
Sbjct  219   KGNGATGLAISLLGAMVMPEDFNLSHTPTYILLVELKILRSYIXQKKKSXVQEACRFYMV  278

Query  860   ESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTV  1039
             ESGFAL VAFLINV+V+SVSG +C++  LS +D  +C DL LN ASFLL+NVLG  SS +
Sbjct  279   ESGFALMVAFLINVSVISVSGAICNSSSLSAEDQKNCQDLDLNKASFLLRNVLGSWSSKL  338

Query  1040  YAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssg  1219
             +A+ALLASGQSSTITGTYAGQY+MQGFLDL+++ W RN +TRC+AI PSLIV++IGGS+G
Sbjct  339   FAVALLASGQSSTITGTYAGQYVMQGFLDLRLRPWIRNFLTRCLAIVPSLIVAVIGGSAG  398

Query  1220  agrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyy  1399
             AG+LII+ASMILSFELPFALIPLLKF+SS+TKMG Y NS  I  ++WI+G  ++ INIYY
Sbjct  399   AGKLIIVASMILSFELPFALIPLLKFTSSNTKMGVYANSTAISAITWIIGSLLMAINIYY  458

Query  1400  lsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDK  1537
             L + F+  L+H++    G V +GI+ F  M +Y+  ++YL+FRK+K
Sbjct  459   LMSGFIKILLHSHFELVGIVFLGILGFSGMTMYLAGIVYLVFRKNK  504



>ref|XP_002985555.1| hypothetical protein SELMODRAFT_122391, partial [Selaginella 
moellendorffii]
 gb|EFJ13429.1| hypothetical protein SELMODRAFT_122391, partial [Selaginella 
moellendorffii]
Length=484

 Score =   484 bits (1246),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 277/478 (58%), Positives = 367/478 (77%), Gaps = 0/478 (0%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             K  GW+K ++YVGPGF+V++AY+DPGN E+DLQAGA  +YELLWV+L+  V   +IQSLA
Sbjct  2     KARGWKKLMAYVGPGFLVAIAYMDPGNFESDLQAGAQFKYELLWVLLLATVSGALIQSLA  61

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGV T KHL++ C+ EYP  V   LW LAE+A++A+DIPEVIGTA+ALN+LF + LW+
Sbjct  62    ANLGVVTEKHLAQHCRLEYPPKVNLVLWFLAEIAIVASDIPEVIGTAYALNMLFGLQLWI  121

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GV+ TGLSTLL L+LQ+YG+RKLE+ I++LVF +A+CFF EM   +P   ++ KG+FIP+
Sbjct  122   GVVLTGLSTLLFLALQQYGIRKLEIFISILVFTIASCFFVEMFNARPSPVELMKGLFIPR  181

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             LSG GA   AI+L GA+VMPHNLFLHSALVLTR  P ++ G+ D CRY LIE  FAL V+
Sbjct  182   LSGNGAAGIAISLFGAMVMPHNLFLHSALVLTRSTPQTMEGIRDGCRYNLIECCFALLVS  241

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
             F IN+AVV+VSG VCS+ +LS DD D CS+L LN ASFLLK+VLG  S  ++ IALLASG
Sbjct  242   FAINLAVVAVSGAVCSDSQLSVDDADRCSNLDLNRASFLLKHVLGSWSGVLFGIALLASG  301

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiias  1246
             QSSTITGT+AGQY+MQGFL+L+ ++W RNL+TRC+AI PSL+V+++GGSSGAG+LIII+S
Sbjct  302   QSSTITGTFAGQYVMQGFLELRFEQWIRNLLTRCVAIVPSLVVALLGGSSGAGQLIIISS  361

Query  1247  MILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWL  1426
             MILSFELPFALIPLLKF+S+  KMGP+ N   + +++W++G  II +N++YL++ F+ WL
Sbjct  362   MILSFELPFALIPLLKFTSNPGKMGPHVNHRKVTILTWVIGSSIILVNLFYLASNFIKWL  421

Query  1427  IHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMDNNVNNN  1600
               + L +    L+GI  F  +  Y +   YL FRKD   T+   +  + + D  V+  
Sbjct  422   QRSRLRRLHIALLGIAGFLALLAYALLAAYLAFRKDNEGTYRLSSSVEEEQDGFVDKE  479



>ref|XP_010230920.1| PREDICTED: metal transporter Nramp4-like isoform X1 [Brachypodium 
distachyon]
Length=545

 Score =   484 bits (1246),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 274/455 (60%), Positives = 349/455 (77%), Gaps = 3/455 (1%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             + P W++FL++VGPGF+VS+AYLDP NL+TDLQAG  HRYELLWV+L G +F LIIQSLA
Sbjct  57    QGPMWKRFLAHVGPGFLVSMAYLDPSNLQTDLQAGYSHRYELLWVLLFGFIFVLIIQSLA  116

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             A LG+ TG+HL+ELC +EYPKYVKYCLW LAEL VIAA IP V+GTA A N+L HIP W 
Sbjct  117   AKLGIITGRHLAELCTSEYPKYVKYCLWFLAELGVIAATIPGVLGTALAYNMLLHIPFWA  176

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL  G ST+LLL LQ YG RK+E  IAV +  MA+CFF E+++V PP ++  +G+FIP+
Sbjct  177   GVLICGASTVLLLGLQGYGARKMEFTIAVAMLFMASCFFIELSHVNPPIKEQLEGLFIPR  236

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             L G+ A +DA+AL   LV+PHNLFLHS+LVL+RK+P+  +GV DA  +FL+E+  ALF+A
Sbjct  237   LKGRYAVSDAVALFSVLVVPHNLFLHSSLVLSRKIPSCSKGVKDASTFFLVENALALFLA  296

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
              L+NVAVVS+SGT+C+N  LS DD + CS LSLNSA+ L KNVLGKS STVY +ALLASG
Sbjct  297   LLVNVAVVSLSGTICAN-NLSLDDNNRCSSLSLNSAAVLFKNVLGKSRSTVYGLALLASG  355

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiias  1246
             QS T+  TY+GQYIMQGF    M+K    L+  C+ + P+L+V  IGG+S   +LI IA+
Sbjct  356   QSCTVVTTYSGQYIMQGFSG--MRKCIIFLIAPCLTVVPTLVVCSIGGASRVRQLINIAA  413

Query  1247  MILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWL  1426
             +ILSF LPFAL+PLLKFSS  T +GP+KNS  I  +S IL + IIGIN Y+  T+FV WL
Sbjct  414   IILSFVLPFALVPLLKFSSCRTMIGPHKNSTCITRISGILSVVIIGINTYFFCTSFVSWL  473

Query  1427  IHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRK  1531
             + ++LP+  N ++  +VFP MA Y+ AVIYL FRK
Sbjct  474   VDSDLPRFANAIISTLVFPFMAAYIAAVIYLTFRK  508



>ref|XP_010230921.1| PREDICTED: metal transporter Nramp4-like isoform X2 [Brachypodium 
distachyon]
Length=486

 Score =   482 bits (1240),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 273/454 (60%), Positives = 348/454 (77%), Gaps = 3/454 (1%)
 Frame = +2

Query  179   WRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAANLG  358
             W++FL++VGPGF+VS+AYLDP NL+TDLQAG  HRYELLWV+L G +F LIIQSLAA LG
Sbjct  2     WKRFLAHVGPGFLVSMAYLDPSNLQTDLQAGYSHRYELLWVLLFGFIFVLIIQSLAAKLG  61

Query  359   VSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvgvlc  538
             + TG+HL+ELC +EYPKYVKYCLW LAEL VIAA IP V+GTA A N+L HIP W GVL 
Sbjct  62    IITGRHLAELCTSEYPKYVKYCLWFLAELGVIAATIPGVLGTALAYNMLLHIPFWAGVLI  121

Query  539   tglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSGQ  718
              G ST+LLL LQ YG RK+E  IAV +  MA+CFF E+++V PP ++  +G+FIP+L G+
Sbjct  122   CGASTVLLLGLQGYGARKMEFTIAVAMLFMASCFFIELSHVNPPIKEQLEGLFIPRLKGR  181

Query  719   GATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAFLIN  898
              A +DA+AL   LV+PHNLFLHS+LVL+RK+P+  +GV DA  +FL+E+  ALF+A L+N
Sbjct  182   YAVSDAVALFSVLVVPHNLFLHSSLVLSRKIPSCSKGVKDASTFFLVENALALFLALLVN  241

Query  899   VAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSST  1078
             VAVVS+SGT+C+N  LS DD + CS LSLNSA+ L KNVLGKS STVY +ALLASGQS T
Sbjct  242   VAVVSLSGTICAN-NLSLDDNNRCSSLSLNSAAVLFKNVLGKSRSTVYGLALLASGQSCT  300

Query  1079  ITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasMILS  1258
             +  TY+GQYIMQGF    M+K    L+  C+ + P+L+V  IGG+S   +LI IA++ILS
Sbjct  301   VVTTYSGQYIMQGFSG--MRKCIIFLIAPCLTVVPTLVVCSIGGASRVRQLINIAAIILS  358

Query  1259  FELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLIHNN  1438
             F LPFAL+PLLKFSS  T +GP+KNS  I  +S IL + IIGIN Y+  T+FV WL+ ++
Sbjct  359   FVLPFALVPLLKFSSCRTMIGPHKNSTCITRISGILSVVIIGINTYFFCTSFVSWLVDSD  418

Query  1439  LPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKV  1540
             LP+  N ++  +VFP MA Y+ AVIYL FRK  +
Sbjct  419   LPRFANAIISTLVFPFMAAYIAAVIYLTFRKVSI  452



>gb|EEC70718.1| hypothetical protein OsI_02097 [Oryza sativa Indica Group]
Length=550

 Score =   484 bits (1246),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 269/455 (59%), Positives = 344/455 (76%), Gaps = 3/455 (1%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             + P W++FL++VGPGF++S+AYLDP NL+TDL AG+ HRY LLWV+L G +F L +QSLA
Sbjct  65    QAPTWKRFLAHVGPGFVISIAYLDPSNLQTDLVAGSSHRYSLLWVLLFGFIFVLTVQSLA  124

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLG+ TG+HL+ELC  EYPKYVKYCLWLLAEL VIAA IP V+GTA A N+L HIP W 
Sbjct  125   ANLGIITGRHLAELCMGEYPKYVKYCLWLLAELGVIAATIPGVLGTALAYNMLLHIPFWA  184

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL  G  T L+L LQ YG RK+E  I+VL+ +MA CFF E+  V PPA  V KG+FIP+
Sbjct  185   GVLACGACTFLILGLQGYGARKMEFTISVLMLVMATCFFMELGKVNPPAGGVIKGLFIPR  244

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
               G  +T+DA+A+ G+LV+PHNLFLHS+LVLTRK+P + +G  DA  +FL+E+  ALF+A
Sbjct  245   PKGDYSTSDAVAMFGSLVVPHNLFLHSSLVLTRKMPYTSKGRKDASTFFLLENALALFIA  304

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
              L+NVA+VS+SGT+C+N  LS  D   CS L+LNS   LLKN+LGKSSSTVY +ALL SG
Sbjct  305   LLVNVAIVSISGTICAN-NLSFADTSTCSSLTLNSTYVLLKNILGKSSSTVYGVALLVSG  363

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiias  1246
             QS  +  +YAGQYIMQGF    M+K    L+  C  + PSLI+  IGG+    R+I IA+
Sbjct  364   QSCMVATSYAGQYIMQGFSG--MRKCIIYLVAPCFTLLPSLIICSIGGTLRVHRIINIAA  421

Query  1247  MILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWL  1426
             ++LSF LPFALIPL+KFSSS T +GPYKN+  II ++WIL L IIGINIY+  T+FV WL
Sbjct  422   IVLSFVLPFALIPLIKFSSSCTNIGPYKNATSIIRIAWILSLVIIGINIYFFCTSFVAWL  481

Query  1427  IHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRK  1531
             +H++LP+  N ++  +VFP MA Y+ A+IYL FRK
Sbjct  482   VHSDLPRVVNAIISSLVFPFMAAYIAALIYLAFRK  516



>ref|XP_006645926.1| PREDICTED: metal transporter Nramp4-like [Oryza brachyantha]
Length=534

 Score =   482 bits (1241),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 270/467 (58%), Positives = 351/467 (75%), Gaps = 3/467 (1%)
 Frame = +2

Query  146   DLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFA  325
              L +   + PGW++FL++VGPGF++S+AYLDP NL+TDL AG+ HRY LLWV+L G +F 
Sbjct  42    GLDDNGVQVPGWKRFLAHVGPGFVISIAYLDPSNLQTDLLAGSSHRYSLLWVLLFGFIFV  101

Query  326   LIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNIL  505
             LI+QSLAANLG+ TG+HL+ELC  EYPKYVKY LWLLAEL VIAA IP V+GTA A N+L
Sbjct  102   LIVQSLAANLGIITGRHLAELCMGEYPKYVKYSLWLLAELGVIAATIPGVLGTALAYNML  161

Query  506   FHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVF  685
              HIP W GVL  G ST+L+L LQ  G RKLE +++VL+ +MA CFF E++ V PP   V 
Sbjct  162   LHIPFWAGVLVCGASTILILGLQSCGARKLEFIVSVLMLVMATCFFIELSKVNPPVGGVI  221

Query  686   KGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIES  865
             +G+FIP+  G+ +T+D +A+ G+L++PHNLFLHS+LVLTR +P++ +G  D   +FL+E+
Sbjct  222   EGLFIPRPKGEYSTSDMVAMFGSLIVPHNLFLHSSLVLTRIMPDTPKGRKDTSTFFLLEN  281

Query  866   GFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYA  1045
               ALF+A LINVA+VSVSGTVC+   LS  D   CS L+LNS S LLKN+LGKSSSTVY 
Sbjct  282   ALALFIALLINVAIVSVSGTVCAK-NLSSADTSTCSSLTLNSTSVLLKNILGKSSSTVYG  340

Query  1046  IALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgag  1225
             +ALLASGQS T+  +YAGQYIMQGF    M+K    L+  C  + PSLI+  IGG+    
Sbjct  341   LALLASGQSCTVATSYAGQYIMQGFSG--MRKCIIYLVAPCFTLLPSLIICSIGGTLHVH  398

Query  1226  rliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyyls  1405
              +I IA++ILS  LPFALIPL+KF+SS T +GPYKNS  II ++WIL L IIGINIY+  
Sbjct  399   GVINIAAIILSVVLPFALIPLIKFNSSCTNIGPYKNSTSIIRIAWILSLVIIGINIYFFC  458

Query  1406  TAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVT  1546
             T+FV+WL+H++LP+A N ++  +VFP MA Y+  +IYL FRK  + T
Sbjct  459   TSFVNWLVHSDLPRAVNAVISTLVFPFMAAYIAGLIYLAFRKVNIST  505



>ref|NP_001043139.1| Os01g0503400 [Oryza sativa Japonica Group]
 sp|Q5QN13.1|NRAM4_ORYSJ RecName: Full=Metal transporter Nramp4 [Oryza sativa Japonica 
Group]
 dbj|BAD73194.1| putative root-specific metal transporter [Oryza sativa Japonica 
Group]
 dbj|BAF05053.1| Os01g0503400 [Oryza sativa Japonica Group]
 dbj|BAG90764.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE54653.1| hypothetical protein OsJ_01931 [Oryza sativa Japonica Group]
Length=550

 Score =   483 bits (1242),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 268/455 (59%), Positives = 344/455 (76%), Gaps = 3/455 (1%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             + P W++FL++VGPGF++S+AYLDP NL+TDL AG+ HRY LLWV+L G +F L +QSLA
Sbjct  65    QAPTWKRFLAHVGPGFVISIAYLDPSNLQTDLVAGSSHRYSLLWVLLFGFIFVLTVQSLA  124

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLG+ TG+HL+ELC  EYPKYVKYCLWLLAEL VIAA IP V+GTA A N+L HIP W 
Sbjct  125   ANLGIITGRHLAELCMGEYPKYVKYCLWLLAELGVIAATIPGVLGTALAYNMLLHIPFWA  184

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL  G  T L+L LQ YG RK+E  I+VL+ +MA CFF E+  V PPA  V +G+FIP+
Sbjct  185   GVLACGACTFLILGLQGYGARKMEFTISVLMLVMATCFFMELGKVNPPAGGVIEGLFIPR  244

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
               G  +T+DA+A+ G+LV+PHNLFLHS+LVLTRK+P + +G  DA  +FL+E+  ALF+A
Sbjct  245   PKGDYSTSDAVAMFGSLVVPHNLFLHSSLVLTRKMPYTSKGRKDASTFFLLENALALFIA  304

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
              L+NVA+VS+SGT+C+N  LS  D   CS L+LNS   LLKN+LGKSSSTVY +ALL SG
Sbjct  305   LLVNVAIVSISGTICAN-NLSFADTSTCSSLTLNSTYVLLKNILGKSSSTVYGVALLVSG  363

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiias  1246
             QS  +  +YAGQYIMQGF    M+K    L+  C  + PSLI+  IGG+    R+I IA+
Sbjct  364   QSCMVATSYAGQYIMQGFSG--MRKCIIYLVAPCFTLLPSLIICSIGGTLRVHRIINIAA  421

Query  1247  MILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWL  1426
             ++LSF LPFALIPL+KFSSS T +GPYKN+  II ++WIL L IIGINIY+  T+FV WL
Sbjct  422   IVLSFVLPFALIPLIKFSSSCTNIGPYKNATSIIRIAWILSLVIIGINIYFFCTSFVAWL  481

Query  1427  IHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRK  1531
             +H++LP+  N ++  +VFP MA Y+ A+IYL FRK
Sbjct  482   VHSDLPRVVNAIISSLVFPFMAAYIAALIYLAFRK  516



>ref|XP_004486618.1| PREDICTED: metal transporter Nramp6-like isoform X3 [Cicer arietinum]
Length=508

 Score =   479 bits (1233),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 258/456 (57%), Positives = 338/456 (74%), Gaps = 44/456 (10%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             +  W+ F +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    AL+IQS+AA
Sbjct  49    RSSWKNFFAYMGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALVIQSMAA  108

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E C+AEY +   + LW++AE+A++A DIPEVIGTAFALN+LF+IP+W+G
Sbjct  109   NLGVVTGKHLAEHCRAEYSRVSNFILWIIAEIAIVACDIPEVIGTAFALNMLFNIPVWIG  168

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLSTL+LL+LQ+YGVRKLE LIA LVF +AACF+ E+ Y KP A++V KG+F+P+L
Sbjct  169   VLLTGLSTLMLLALQQYGVRKLEFLIAFLVFTIAACFWAELGYAKPDAKEVVKGLFVPQL  228

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SVRG+ +ACR+++IES FAL VAF
Sbjct  229   KGSGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVRGIKEACRFYMIESAFALMVAF  288

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LINV+V+SVSG +C++  L+++D   C DL LN ASFLL+NVLGK SS ++ +ALLASGQ
Sbjct  289   LINVSVISVSGAICNSSNLNEEDQMSCQDLDLNKASFLLRNVLGKWSSKLFGVALLASGQ  348

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQ                                            M
Sbjct  349   SSTITGTYAGQYVMQ--------------------------------------------M  364

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFAL+PLLKF++S TKMG + NS  I  V+WI+G  I+ INIYYL T F+  L+
Sbjct  365   ILSFELPFALVPLLKFTNSKTKMGAHVNSTMISTVTWIVGSLIMVINIYYLMTGFIKLLL  424

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDK  1537
             H+++     V +GI+ F  MA+Y+  + YL+ RK+K
Sbjct  425   HSDIEMVAKVFLGILGFSGMALYLAGIGYLVLRKNK  460



>emb|CAN78852.1| hypothetical protein VITISV_034005 [Vitis vinifera]
Length=595

 Score =   481 bits (1239),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 298/532 (56%), Positives = 379/532 (71%), Gaps = 56/532 (11%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYE-------------LLWVVLI  310
             +  W+   +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++YE             LLW++L+
Sbjct  38    RKSWKNLFAYMGPGFLVSIAYIDPGNFETDLQSGAQYKYEFEKFDLWVQMVRLLLWIILV  97

Query  311   GLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAF  490
                 ALIIQSLAANLGV TGKHL+E C+ EYPK   + LW+LAE+AV+A DIPEVIGTAF
Sbjct  98    ASCAALIIQSLAANLGVVTGKHLAEHCRIEYPKVPNFILWVLAEIAVVACDIPEVIGTAF  157

Query  491   ALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPP  670
             ALN+LF+IP+W GVL TGLSTL+LL+LQ+YGVRKLE  IA LV  +AACFF E+ Y KP 
Sbjct  158   ALNMLFNIPVWCGVLLTGLSTLVLLALQQYGVRKLEFFIAFLVLTIAACFFVELGYAKPN  217

Query  671   AEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRY  850
             + +V +G+F+P+L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P  VRG+ +ACR+
Sbjct  218   SSEVLRGLFVPQLKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRXVRGIKEACRF  277

Query  851   FLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLK-------  1009
             ++IESGFAL VAFLINV+V+ VSG VCS+  L+ DD + C DL LN ASF  +       
Sbjct  278   YMIESGFALMVAFLINVSVICVSGAVCSSSNLNPDDQESCKDLDLNKASFYSEYVSVVVA  337

Query  1010  -----NVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIA  1174
                  NVLGK SS ++AIALLASGQSSTITGTYAGQY+MQGFLDL+++ W RN +TRC+A
Sbjct  338   TWAFINVLGKWSSKLFAIALLASGQSSTITGTYAGQYVMQGFLDLRLQPWIRNFLTRCLA  397

Query  1175  ITPslivsiiggssgagrliiias-----------------------------MILSFEL  1267
             I PSLIV+IIGGSSGAG+LIIIAS                             MILSFEL
Sbjct  398   IIPSLIVAIIGGSSGAGKLIIIASVQYPYLQTSKLFLLPKYHALFVISPCCFKMILSFEL  457

Query  1268  PFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLIHNNLPK  1447
             PFALIPLLKF+S  TKMG Y NS  I  ++WI+G  ++ INIYYL+++F+  L+H++L  
Sbjct  458   PFALIPLLKFTSCKTKMGAYVNSTMITAITWIIGSLLMAINIYYLASSFIKLLLHSHLKL  517

Query  1448  AGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFI--QPNDDDSKMDNNVNN  1597
                V  GI  F  M +YV  + YL+FRK+K  T +      ++ ++ N+V  
Sbjct  518   VXAVFAGIFGFSGMIVYVCGIGYLVFRKNKKATHLLALATAENGELTNDVGG  569



>ref|XP_002987015.1| hypothetical protein SELMODRAFT_125213, partial [Selaginella 
moellendorffii]
 gb|EFJ11858.1| hypothetical protein SELMODRAFT_125213, partial [Selaginella 
moellendorffii]
Length=484

 Score =   477 bits (1227),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 275/478 (58%), Positives = 365/478 (76%), Gaps = 0/478 (0%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             K  GW+K ++YVGPGF+V++AY+DPGN E+DLQAGA  +YELLWV+L+  V   +IQSLA
Sbjct  2     KARGWKKLMAYVGPGFLVAIAYMDPGNFESDLQAGAQFKYELLWVLLLATVSGALIQSLA  61

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGV T KHL++ C+ EYP  V   LW LAE+A++A+DIPEVIGTA+ALN+LF + LW+
Sbjct  62    ANLGVVTEKHLAQHCRLEYPPKVNLVLWFLAEIAIVASDIPEVIGTAYALNMLFGLQLWI  121

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GV+ TGLSTLL L+LQ+YG+RKLE+ I++LVF +A+CFF EM   +P   ++ KG+FIP+
Sbjct  122   GVVLTGLSTLLFLALQQYGIRKLEIFISILVFTIASCFFVEMFNARPSPVELMKGLFIPR  181

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             LSG GA   AI+L GA+VMPHNLFLHSALVLTR  P ++ G+ D CRY LIE  FAL V+
Sbjct  182   LSGNGAAGIAISLFGAMVMPHNLFLHSALVLTRSTPPTMEGIRDGCRYNLIECCFALLVS  241

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
             F IN+AVV+VSG VCS+ +LS  D D CS+L LN ASFLLK+VLG  S  ++ IALLASG
Sbjct  242   FAINLAVVAVSGAVCSDSQLSVADADRCSNLDLNRASFLLKHVLGSWSGVLFGIALLASG  301

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiias  1246
             QSSTITGT+AGQY+MQGFL+L+ ++W RNL+TRC+AI PSL+V+++GGSSGAG+LIII+S
Sbjct  302   QSSTITGTFAGQYVMQGFLELRFEQWIRNLLTRCVAIVPSLVVALLGGSSGAGQLIIISS  361

Query  1247  MILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWL  1426
             MILSFELPFALIPLLKF+S+  KMGP+ N   + +++W++G  II +N++YL++ F+ WL
Sbjct  362   MILSFELPFALIPLLKFTSNPGKMGPHVNHRKVTILTWVIGSSIILVNLFYLASNFIKWL  421

Query  1427  IHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTFIQPNDDDSKMDNNVNNN  1600
               + L +    L+GI  F  +  Y +   YL  RKD   T+   +  + + D  V+  
Sbjct  422   QRSRLRRLHIALLGIAGFLALLAYALLAAYLALRKDNEGTYRLSSSVEEEQDGFVDKE  479



>ref|XP_002966281.1| hypothetical protein SELMODRAFT_407690 [Selaginella moellendorffii]
 gb|EFJ32308.1| hypothetical protein SELMODRAFT_407690 [Selaginella moellendorffii]
Length=516

 Score =   478 bits (1229),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 270/455 (59%), Positives = 353/455 (78%), Gaps = 20/455 (4%)
 Frame = +2

Query  164   NKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSL  343
              +K  +RK L+++GPGF+V +AY+DP N E+DLQ+GA +RYELLWVVL   V  LIIQSL
Sbjct  30    RQKGAFRKLLAFLGPGFLVCIAYIDPANFESDLQSGAQYRYELLWVVLFASVAGLIIQSL  89

Query  344   AANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLW  523
             AANLGV TG+HL+E C+ EYP+ VKY LW+LAE+ +IA+DIPEVIGTAFALN+LF IPLW
Sbjct  90    AANLGVVTGRHLAEHCRTEYPRLVKYVLWILAEVTIIASDIPEVIGTAFALNMLFSIPLW  149

Query  524   vgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIP  703
             +GVL TG+STLLLL+LQ+YGVRKLE ++A+ VF+M  CFF E+ Y KP A +V KG FIP
Sbjct  150   IGVLLTGVSTLLLLALQQYGVRKLEFVVALFVFVMVGCFFAELGYAKPEASEVLKG-FIP  208

Query  704   KLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFV  883
             +LSG GAT  AI+LLGA++MPHNL+LHSAL              + CRY+L+E GFA+F+
Sbjct  209   RLSGHGATGIAISLLGAMIMPHNLYLHSAL--------------EGCRYYLLECGFAIFL  254

Query  884   AFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLAS  1063
             +FLINV V+SVS TVC    LS +D D CSDL LN ASFLL+NVLG+ S  ++A+ALLAS
Sbjct  255   SFLINVCVISVSATVCFRPDLSPEDRDKCSDLDLNQASFLLRNVLGQWSKVIFAVALLAS  314

Query  1064  GQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiia  1243
             G+SSTITGTYAGQY+MQGFL+L++K W RNL+TR +AI PSL+V++IGGS  AG+LII+ 
Sbjct  315   GESSTITGTYAGQYVMQGFLNLRLKPWMRNLLTRSVAIVPSLVVALIGGSRSAGQLIIVC  374

Query  1244  sMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDW  1423
             SMILSF LPF LIPLL+F+ S  KMG      +I++V+  +G  ++ +N+Y+L +AFV W
Sbjct  375   SMILSFVLPFVLIPLLRFTGSKLKMGA-----HIMIVTGFIGGCVMTVNVYFLVSAFVKW  429

Query  1424  LIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFR  1528
             LI ++   AG V++G++VF L  +Y++ + YL  R
Sbjct  430   LISSHTLLAGRVILGMIVFSLTLLYLLFIAYLSLR  464



>ref|XP_002978291.1| hypothetical protein SELMODRAFT_418064 [Selaginella moellendorffii]
 gb|EFJ20948.1| hypothetical protein SELMODRAFT_418064 [Selaginella moellendorffii]
Length=516

 Score =   477 bits (1227),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 270/455 (59%), Positives = 353/455 (78%), Gaps = 20/455 (4%)
 Frame = +2

Query  164   NKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSL  343
              +K  +RK L+++GPGF+V +AY+DP N E+DLQ+GA +RYELLWVVL   V  LIIQSL
Sbjct  30    RQKGAFRKLLAFLGPGFLVCIAYIDPANFESDLQSGAQYRYELLWVVLFASVAGLIIQSL  89

Query  344   AANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLW  523
             AANLGV TG+HL+E C+ EYP+ VKY LW+LAE+ +IA+DIPEVIGTAFALN+LF IPLW
Sbjct  90    AANLGVVTGRHLAEHCRTEYPRLVKYVLWILAEVTIIASDIPEVIGTAFALNMLFSIPLW  149

Query  524   vgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIP  703
             +GVL TG+STLLLL+LQ+YGVRKLE ++A+ VF+M  CFF E+ Y KP A +V KG FIP
Sbjct  150   IGVLLTGVSTLLLLALQQYGVRKLEFVVALFVFVMVGCFFAELGYAKPEASEVLKG-FIP  208

Query  704   KLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFV  883
             +LSG GAT  AI+LLGA++MPHNL+LHSAL              + CRY+L+E GFA+F+
Sbjct  209   RLSGHGATGIAISLLGAMIMPHNLYLHSAL--------------EGCRYYLLECGFAIFL  254

Query  884   AFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLAS  1063
             +FLINV V+SVS TVC    LS +D D CSDL LN ASFLL+NVLG+ S  ++A+ALLAS
Sbjct  255   SFLINVCVISVSATVCFRPDLSPEDRDKCSDLDLNQASFLLRNVLGQWSKVIFAVALLAS  314

Query  1064  GQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiia  1243
             G+SSTITGTYAGQY+MQGFL+L++K W RNL+TR +AI PSL+V++IGGS  AG+LII+ 
Sbjct  315   GESSTITGTYAGQYVMQGFLNLRLKPWMRNLLTRSVAIVPSLVVALIGGSRSAGQLIIVC  374

Query  1244  sMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDW  1423
             SMILSF LPF LIPLL+F+ S  KMG      +I++V+  +G  ++ +N+Y+L +AFV W
Sbjct  375   SMILSFVLPFVLIPLLRFTGSKLKMGA-----HIMIVTGFIGGCVMTVNVYFLVSAFVKW  429

Query  1424  LIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFR  1528
             LI ++   AG V++G++VF L  +Y++ + YL  R
Sbjct  430   LISSHTLLAGRVILGMIVFSLTLLYLLFIAYLSLR  464



>ref|XP_008681155.1| PREDICTED: uncharacterized protein LOC100193537 isoform X3 [Zea 
mays]
Length=471

 Score =   474 bits (1220),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 279/423 (66%), Positives = 342/423 (81%), Gaps = 2/423 (0%)
 Frame = +2

Query  290   LLWVVLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIP  469
             LLW++L+    ALIIQSLAA LGV TGKHL+E C+AEYPK   + LW+LAELAV+A DIP
Sbjct  5     LLWIILVASCAALIIQSLAARLGVVTGKHLAEHCRAEYPKVTNFVLWILAELAVVACDIP  64

Query  470   EVIGTAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGE  649
             EVIGTAFALN+LF IP+W GVL TGLSTL+LL LQ+YGVRKLE LIA LVFL+A CF  E
Sbjct  65    EVIGTAFALNMLFRIPVWCGVLITGLSTLMLLLLQQYGVRKLEFLIAFLVFLIATCFLVE  124

Query  650   MAYVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRG  829
             + Y KP A +V +G+F+P+L G GAT  AI+LLGA+VMPHNLFLHSALVL+RKVP SV G
Sbjct  125   LGYSKPNAPEVVRGLFVPELKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKVPRSVHG  184

Query  830   VNDACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLK  1009
             + +ACR++ IES FAL VAFLIN++++SVSG+VC +G L+ +D  +CSDL LN ASFLLK
Sbjct  185   IKEACRFYTIESAFALTVAFLINISIISVSGSVCGSGNLNPEDQANCSDLDLNKASFLLK  244

Query  1010  NVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPsl  1189
             NVLG  SS ++A+ALLASGQSSTITGTYAGQY+MQGFLDL+MK W RNL+TR +AI PSL
Sbjct  245   NVLGNWSSKLFAVALLASGQSSTITGTYAGQYVMQGFLDLRMKPWIRNLVTRSLAILPSL  304

Query  1190  ivsiiggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilg  1369
             IVSIIGGSS AG+LIIIASMILSFELPFAL+PLLKF+SS TKMG + NSI+  V++W++G
Sbjct  305   IVSIIGGSSAAGQLIIIASMILSFELPFALVPLLKFTSSKTKMGQHTNSIFTAVLTWMIG  364

Query  1370  lgiiginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVTF  1549
               I+ IN Y+L T+FV  L+ + L     V  GI  F  M IY+VA++YL+FR+++  T 
Sbjct  365   SFIVVINTYFLITSFVKLLVQSGLTTISQVFSGIFGFLGMLIYIVAILYLVFRRNRKST-  423

Query  1550  IQP  1558
              QP
Sbjct  424   -QP  425



>ref|XP_010034030.1| PREDICTED: metal transporter Nramp6 isoform X2 [Eucalyptus grandis]
Length=493

 Score =   471 bits (1212),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 263/481 (55%), Positives = 336/481 (70%), Gaps = 45/481 (9%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             +  W+   +Y+GPGF+VS+AY+DPGN ETDLQAGA ++YELLW++L+    AL+IQSLAA
Sbjct  37    RKSWKNLFAYMGPGFLVSIAYIDPGNFETDLQAGAQYKYELLWIILVASCAALVIQSLAA  96

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
              LGV TGKHL+E  + EYPK   + LW+LAE++++A DIPEVIGTAFALN+LF IPLW G
Sbjct  97    KLGVVTGKHLAEHFRMEYPKVPNFILWVLAEISIVACDIPEVIGTAFALNMLFKIPLWCG  156

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLSTL+LL+LQ+YGVRKLE LIA LVF +AACFFGE+ Y KP A +V  G+F+P+L
Sbjct  157   VLLTGLSTLMLLALQQYGVRKLEFLIAFLVFTIAACFFGELGYAKPVASEVLNGLFVPQL  216

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SVRG+ +ACR++ IES FAL VAF
Sbjct  217   KGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVRGIKEACRFYTIESAFALMVAF  276

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LIN++V+SVSG VC++  L+  D   C DL LN ASFLL+NVLG  SS ++AIALLASGQ
Sbjct  277   LINISVISVSGAVCNSTSLNPQDKASCQDLDLNKASFLLRNVLGSWSSKLFAIALLASGQ  336

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQ                                            M
Sbjct  337   SSTITGTYAGQYVMQ--------------------------------------------M  352

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFAL+PLLKF+SS TKMG Y N   +  V+WI+G  I+GIN+YYL T F+  L+
Sbjct  353   ILSFELPFALVPLLKFTSSKTKMGQYANQTMVAAVTWIIGFLIMGINVYYLVTGFIKLLL  412

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVT-FIQPNDDDSKMDNNVNNNVC  1606
             ++ +     V+ GI+ F  MA+Y+  + YL+ RK+K  +  +     +S+   N   +  
Sbjct  413   NSPMKLGAKVVCGILGFSGMAVYLAGITYLVLRKNKEASHLLALTTAESQQSENGQGDAS  472

Query  1607  M  1609
             M
Sbjct  473   M  473



>ref|XP_009127640.1| PREDICTED: metal transporter Nramp6-like [Brassica rapa]
Length=448

 Score =   469 bits (1206),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 252/376 (67%), Positives = 315/376 (84%), Gaps = 0/376 (0%)
 Frame = +2

Query  212   FMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAANLGVSTGKHLSELC  391
             F+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    AL+IQSLAANLGV TGKHL+E C
Sbjct  25    FLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALVIQSLAANLGVVTGKHLAEHC  84

Query  392   KAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvgvlctglstllllsl  571
             +AEY K   + LW++AE+AV+A DIPEVIGTAFALN+LF+IP+W+GVL TG STL+LL+L
Sbjct  85    RAEYSKVPNFMLWVVAEIAVVACDIPEVIGTAFALNMLFNIPVWIGVLLTGFSTLILLAL  144

Query  572   QRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADAIALLG  751
             Q+YG+RKLE LIA LV  +A CF  E+ Y KP  ++V  G+F+P+L G GAT  AI+LLG
Sbjct  145   QKYGIRKLEFLIAFLVLTIAVCFLIELHYSKPDPKEVLYGLFVPQLKGNGATGLAISLLG  204

Query  752   ALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAFLINVAVVSVSGTVC  931
             A+VMPHNLFLHSALVL+RK+P SV G+ +ACRY++IESG AL VAFLINV+V+SVSG VC
Sbjct  205   AMVMPHNLFLHSALVLSRKIPRSVTGIKEACRYYMIESGLALTVAFLINVSVISVSGAVC  264

Query  932   SNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQYIM  1111
             +   LS +D   C DL LN ASFLL+NV+GK SS ++AIALLASGQSSTITGTYAGQY+M
Sbjct  265   NASDLSPEDQASCEDLDLNKASFLLRNVVGKWSSKLFAIALLASGQSSTITGTYAGQYVM  324

Query  1112  QGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasMILSFELPFALIPLL  1291
             QGFL+L ++ W RN +TRC+AI P LIV++IGGS+GAG+LIIIASM+LSFELPFAL+PLL
Sbjct  325   QGFLNLTIRPWLRNFLTRCLAIIPRLIVALIGGSAGAGKLIIIASMVLSFELPFALVPLL  384

Query  1292  KFSSSSTKMGPYKNSI  1339
             KF+ S TKMG + NS+
Sbjct  385   KFTCSKTKMGSHANSL  400



>ref|XP_004975312.1| PREDICTED: metal transporter Nramp4-like [Setaria italica]
Length=581

 Score =   473 bits (1216),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 257/459 (56%), Positives = 346/459 (75%), Gaps = 5/459 (1%)
 Frame = +2

Query  164   NKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSL  343
              +K  W++FL++ GPGF++SLAYLDP N++TDLQAG+ HRYELLWV+  G +F LIIQSL
Sbjct  97    RQKSTWKRFLAHAGPGFLISLAYLDPSNVQTDLQAGSSHRYELLWVLFFGFIFVLIIQSL  156

Query  344   AANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLW  523
             AA LG+ TGKHL+ELC  EYPKYVKY LWLL E+ VIAA +P V+GTA A  IL HIP W
Sbjct  157   AAKLGIITGKHLAELCMREYPKYVKYGLWLLIEVGVIAATVPGVLGTALAYKILLHIPFW  216

Query  524   vgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIP  703
              GVL  G ST L+L+LQ  GVRK+E +  + + +MAACFF E+    PP  +V +G+FIP
Sbjct  217   AGVLICGASTFLILALQSCGVRKMEFIGVIFILIMAACFFVEVNSANPPMGEVIQGLFIP  276

Query  704   KLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFV  883
             +L G  AT+DAIAL  AL++PHNLFLHS+LVL+RK+P+S +GV D   +FLIE+ FALF+
Sbjct  277   RLRGAYATSDAIALFSALIVPHNLFLHSSLVLSRKIPSSPKGVKDTSTFFLIENAFALFL  336

Query  884   AFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLAS  1063
               L+NVA+VS++GT+C++ ++  D+   CS L+LNS S LLKN+ GKSSS +Y +ALLAS
Sbjct  337   VLLVNVAIVSITGTICADSQMVDDN---CSGLTLNSTSVLLKNIFGKSSSKIYGLALLAS  393

Query  1064  GQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiia  1243
             GQS T+  +Y+GQYIMQGF    M+K+   ++  C  I PSLI+  IGG++   +LI I+
Sbjct  394   GQSCTVATSYSGQYIMQGFSG--MRKFIIYIIAPCFTIIPSLIICSIGGAAHVRQLIYIS  451

Query  1244  sMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDW  1423
             ++IL+F LPFAL+PLLKFSSS   +GPYKNS  I+ V+WIL + I+G+NIY+  T+F+ W
Sbjct  452   AIILAFVLPFALVPLLKFSSSCAMIGPYKNSTCIVRVAWILSMVIMGVNIYFFCTSFLSW  511

Query  1424  LIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKV  1540
             L+H+ LP+  N ++  +VFP MA Y+ A+IYL+F+K  V
Sbjct  512   LVHSELPRIANAVISTLVFPFMAAYIAALIYLVFKKVSV  550



>gb|KDO41579.1| hypothetical protein CISIN_1g008955mg [Citrus sinensis]
Length=511

 Score =   468 bits (1204),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 227/338 (67%), Positives = 281/338 (83%), Gaps = 0/338 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             K  W+   +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    ALIIQSLAA
Sbjct  40    KTSWKNLFAYIGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALIIQSLAA  99

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E C+ EYPK   + LW+LAE+A++A DIPEVIGTAFALN+LF IP+W+G
Sbjct  100   NLGVVTGKHLAEHCRNEYPKVPNFILWVLAEIAIVACDIPEVIGTAFALNMLFKIPVWIG  159

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TG STL+LL+LQ+YGVRKLE LIA LVF MA CFF E+ Y KP A++V  G+F+P+L
Sbjct  160   VLLTGFSTLILLALQQYGVRKLEFLIAFLVFTMAGCFFAELGYAKPEAKEVLHGLFVPQL  219

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SVR + +ACR+++IESGFAL VAF
Sbjct  220   KGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVRSIKEACRFYMIESGFALAVAF  279

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LINV+V+SVSG VCS+  ++ +D   C DL LN ASFLL+NVLG  SS ++AIALLASGQ
Sbjct  280   LINVSVISVSGAVCSSSNINPEDQASCKDLDLNKASFLLRNVLGSWSSKLFAIALLASGQ  339

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITP  1183
             SSTITGTYAGQY+MQGFLDL++K W RN +TRC+AI P
Sbjct  340   SSTITGTYAGQYVMQGFLDLRLKPWLRNFLTRCLAIVP  377



>ref|XP_004486620.1| PREDICTED: metal transporter Nramp6-like isoform X5 [Cicer arietinum]
Length=418

 Score =   464 bits (1194),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 221/338 (65%), Positives = 287/338 (85%), Gaps = 0/338 (0%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             +  W+ F +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    AL+IQS+AA
Sbjct  49    RSSWKNFFAYMGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALVIQSMAA  108

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TGKHL+E C+AEY +   + LW++AE+A++A DIPEVIGTAFALN+LF+IP+W+G
Sbjct  109   NLGVVTGKHLAEHCRAEYSRVSNFILWIIAEIAIVACDIPEVIGTAFALNMLFNIPVWIG  168

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLSTL+LL+LQ+YGVRKLE LIA LVF +AACF+ E+ Y KP A++V KG+F+P+L
Sbjct  169   VLLTGLSTLMLLALQQYGVRKLEFLIAFLVFTIAACFWAELGYAKPDAKEVVKGLFVPQL  228

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SVRG+ +ACR+++IES FAL VAF
Sbjct  229   KGSGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVRGIKEACRFYMIESAFALMVAF  288

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LINV+V+SVSG +C++  L+++D   C DL LN ASFLL+NVLGK SS ++ +ALLASGQ
Sbjct  289   LINVSVISVSGAICNSSNLNEEDQMSCQDLDLNKASFLLRNVLGKWSSKLFGVALLASGQ  348

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITP  1183
             SSTITGTYAGQY+MQGFLDL++  W RN++TRC+AI P
Sbjct  349   SSTITGTYAGQYVMQGFLDLRLTPWIRNMLTRCLAIVP  386



>ref|XP_006836387.1| hypothetical protein AMTR_s00092p00132440 [Amborella trichopoda]
 gb|ERM99240.1| hypothetical protein AMTR_s00092p00132440 [Amborella trichopoda]
Length=482

 Score =   464 bits (1194),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 225/339 (66%), Positives = 282/339 (83%), Gaps = 0/339 (0%)
 Frame = +2

Query  167   KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
             ++  W+   SYVGPGF+VS+AY+DPGN +TDLQAGA ++YELLW++L+    AL+IQ+LA
Sbjct  9     RRKSWKNLFSYVGPGFLVSIAYIDPGNFQTDLQAGASYKYELLWIILVASCAALVIQTLA  68

Query  347   ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
             ANLGV TGKHL+E C+AEYP+   + LW+LAE+A++A DIPEVIGTAFALN+LF IP+W 
Sbjct  69    ANLGVVTGKHLAEHCRAEYPRTPNFILWILAEIAIVACDIPEVIGTAFALNMLFRIPVWC  128

Query  527   gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
             GVL TGLSTL+LL+LQ+YGVRKLE LIA LVF +AACFFGE+AY KP   +V KG+F+P+
Sbjct  129   GVLLTGLSTLMLLALQQYGVRKLEFLIAFLVFTIAACFFGELAYAKPIPSEVLKGLFVPQ  188

Query  707   LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
             L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P S+  + +ACR++ IES FAL VA
Sbjct  189   LKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSINRIKEACRFYTIESAFALAVA  248

Query  887   FLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASG  1066
             FLINV+V+SVSG VC++  LS +D  +C DL LN ASFLL+NV+G  SS ++AIALLASG
Sbjct  249   FLINVSVISVSGAVCNSSNLSPEDQKNCEDLDLNRASFLLRNVVGSWSSKLFAIALLASG  308

Query  1067  QSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITP  1183
             QSSTITGTYAGQY+MQGFLDL++  W RN +TRC+AI P
Sbjct  309   QSSTITGTYAGQYVMQGFLDLRLTPWIRNFLTRCLAIIP  347



>ref|XP_002889256.1| hypothetical protein ARALYDRAFT_895871 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65515.1| hypothetical protein ARALYDRAFT_895871 [Arabidopsis lyrata subsp. 
lyrata]
Length=459

 Score =   462 bits (1189),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 274/458 (60%), Positives = 355/458 (78%), Gaps = 13/458 (3%)
 Frame = +2

Query  260   LQAGADHRYELLWVVLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLA  439
             +QAGA ++YELLW++L+    + +IQSLAANLGV TGKHL+E C++EYPK   + LW++A
Sbjct  1     MQAGAQYKYELLWIILLASCASFVIQSLAANLGVVTGKHLAEQCRSEYPKVPNFMLWIIA  60

Query  440   ELAVIAADIPE----------VIGTAFALNILFHIPLWvgvlctglstllllslQRYGVR  589
             E+AV+A DIPE          +IGTAFALN+LF +P+W+GV  TGLST++LL +Q+YGVR
Sbjct  61    EIAVVACDIPEGINTSLLFCYLIGTAFALNMLFSMPVWIGVPLTGLSTMVLLKIQKYGVR  120

Query  590   KLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPH  769
             KLE LIA+LVF MA  FF E+ Y KP   ++  G+F+P+L G GAT  AI+LLGA+VMPH
Sbjct  121   KLEFLIAILVFTMAISFFVELHYSKPDPGEILHGLFVPQLKGNGATGLAISLLGAMVMPH  180

Query  770   NLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLS  949
             NLFLHSALVL+R +P S  G+  ACR++LIESG AL VAFLINV+V+SVSG VC+   LS
Sbjct  181   NLFLHSALVLSRNIPRSTTGIKKACRFYLIESGLALMVAFLINVSVISVSGAVCNAPNLS  240

Query  950   KDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDL  1129
              +D  +C +L LN ASFLL+NVLGK SS ++AIALLASGQSSTITGTYAGQYIMQGFLDL
Sbjct  241   PEDRANCENLDLNKASFLLRNVLGKWSSKLFAIALLASGQSSTITGTYAGQYIMQGFLDL  300

Query  1130  KMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasMILSFELPFALIPLLKFSSSS  1309
             K+K W RNL+TRC+AI PSLIVS+IGGS+GAG+LIIIASMILSFELPFAL+PLLKF+S  
Sbjct  301   KLKPWLRNLLTRCLAIIPSLIVSLIGGSAGAGKLIIIASMILSFELPFALVPLLKFTSCK  360

Query  1310  TKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLM  1489
             TKMG + NSI+I  ++WI+GL I+GINIYY+ T+F+  L+H+++     +  GI+ F  +
Sbjct  361   TKMGSHVNSIWITALTWIIGLLIMGINIYYIVTSFIKLLLHSHMKLVAVIFCGIIGFAGI  420

Query  1490  AIYVVAVIYLMFRKDKVVTFIQ---PNDDDSKMDNNVN  1594
             AIY+ ++ YL+ RK++  T +    P  D   M ++V 
Sbjct  421   AIYLASIAYLVLRKNREATPLVETLPRQDIVNMQSDVT  458



>ref|XP_011082362.1| PREDICTED: metal transporter Nramp1-like isoform X3 [Sesamum 
indicum]
Length=507

 Score =   462 bits (1188),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 269/417 (65%), Positives = 337/417 (81%), Gaps = 0/417 (0%)
 Frame = +2

Query  287   ELLWVVLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADI  466
             +LLW++L+    ALIIQSLAANLGV TGKHL+E C+ EYPK   + LW+LAE+A++A DI
Sbjct  43    DLLWIILLASFAALIIQSLAANLGVVTGKHLAEHCRQEYPKIPNFILWILAEIAIVACDI  102

Query  467   PEVIGTAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFG  646
             PEVIGTAFAL++LF +PLW+GVL TGLST++LL LQ+YGVRKLE+LIA LVF +A CF  
Sbjct  103   PEVIGTAFALDMLFGVPLWIGVLITGLSTMVLLLLQQYGVRKLEILIAFLVFTIAGCFLA  162

Query  647   EMAYVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVR  826
             E+ Y KP + +V +G+FIP+L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P SV 
Sbjct  163   ELKYAKPNSSEVLRGLFIPQLKGSGATKLAISLLGAMVMPHNLFLHSALVLSRKIPRSVN  222

Query  827   GVNDACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLL  1006
             G+ +ACR++LIESG AL VAFLIN++V+SVSG VC++  L+ DDL  C +L LN ASFLL
Sbjct  223   GIKEACRFYLIESGLALMVAFLINISVISVSGAVCNSPNLNSDDLQSCQNLDLNEASFLL  282

Query  1007  KNVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPs  1186
             K+VLG  SS ++AIALLASGQSSTITGTYAGQY+MQGFLDL++K W RN +TRC+AI PS
Sbjct  283   KHVLGSWSSKLFAIALLASGQSSTITGTYAGQYVMQGFLDLRLKPWIRNFLTRCLAIVPS  342

Query  1187  livsiiggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswil  1366
             LIV+IIGGS+GAG LIIIASMILSFELPFALIPLLKF+SS TKMG Y N++ +   +WI+
Sbjct  343   LIVAIIGGSTGAGNLIIIASMILSFELPFALIPLLKFTSSKTKMGSYANTVAVSTTTWII  402

Query  1367  glgiiginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDK  1537
             G  I+GIN+YYL+   V  L H++L   G V  G++ F  M IY+  + YL+ RK+K
Sbjct  403   GSLIMGINVYYLADKLVSSLRHSHLNIVGTVFCGLLGFLAMLIYLAGIGYLVIRKNK  459



>ref|XP_010092194.1| Metal transporter Nramp6 [Morus notabilis]
 gb|EXB50420.1| Metal transporter Nramp6 [Morus notabilis]
Length=509

 Score =   447 bits (1150),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 277/498 (56%), Positives = 354/498 (71%), Gaps = 42/498 (8%)
 Frame = +2

Query  170   KPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAA  349
             +  W+ F +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW++L+    AL+IQSLAA
Sbjct  40    RKSWKNFFAYMGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALVIQSLAA  99

Query  350   NLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvg  529
             NLGV TG         EYP+   + LW+LAE+A++A DIPEVIGTAFALN+LF++P+W G
Sbjct  100   NLGVVTGIM-------EYPRVPNFILWVLAEIAIVACDIPEVIGTAFALNMLFNVPIWCG  152

Query  530   vlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKL  709
             VL TGLSTL+LL+LQ+YGVRKLE LIA LV  +AACFF E+ Y  P  ++V KG+F+P+L
Sbjct  153   VLLTGLSTLVLLALQQYGVRKLEFLIAFLVLTIAACFFVELHYANPDPKEVLKGLFVPQL  212

Query  710   SGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVAF  889
              G GAT  AI+LLGA+                          +ACR+++ ES FAL VAF
Sbjct  213   KGSGATGLAISLLGAM--------------------------EACRFYMFESAFALMVAF  246

Query  890   LINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQ  1069
             LIN++V+SVSG VC +  L+ +D   C DL LN ASFLL+NVLG  SS ++AIALLASGQ
Sbjct  247   LINISVISVSGAVCGSSSLNAEDQKSCQDLDLNKASFLLRNVLGSWSSKLFAIALLASGQ  306

Query  1070  SSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasM  1249
             SSTITGTYAGQY+MQGFLDL++K W RN +TRC+AI PSLIV+IIGGS+GAG+LIIIASM
Sbjct  307   SSTITGTYAGQYVMQGFLDLRLKPWIRNFLTRCLAIVPSLIVAIIGGSAGAGKLIIIASM  366

Query  1250  ILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDWLI  1429
             ILSFELPFAL+PLLKF+SS TKMG   NS+ I  ++WI+G  I+ INIYYL T F+  L+
Sbjct  367   ILSFELPFALVPLLKFTSSETKMGACVNSVAISAITWIIGSLIMAINIYYLMTGFIKLLL  426

Query  1430  HNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVT----FIQPNDDDSKMDNNVNN  1597
             H  +  A  V +GI  F  MA+Y+  + YL+FRK+K  T    F  P  +  +M  N  +
Sbjct  427   HLQIVAA--VFLGIFGFSGMAVYLAGIAYLVFRKNKEATHLLAFTMP--ESRQMTANEQS  482

Query  1598  NVCMTPIDHNDF-SHTLP  1648
             N  M  +   D  S  LP
Sbjct  483   NASMYCLPREDIVSMQLP  500



>ref|XP_010419378.1| PREDICTED: metal transporter Nramp1-like [Camelina sativa]
Length=496

 Score =   443 bits (1139),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 268/461 (58%), Positives = 347/461 (75%), Gaps = 36/461 (8%)
 Frame = +2

Query  164   NKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSL  343
             ++K  W+ F +Y+GPGF+VS+AY+DPGN            Y+L+                
Sbjct  38    SEKKSWKNFFAYLGPGFLVSIAYIDPGN------------YDLI----------------  69

Query  344   AANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLW  523
                     GKHL+E C+AEY K   + LW++AE+AV+A DIPEVIGTAFALN+LF IP+W
Sbjct  70    --------GKHLAEQCRAEYSKVPNFLLWVVAEIAVVACDIPEVIGTAFALNMLFSIPVW  121

Query  524   vgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIP  703
             +GVL TGLSTL+LL+LQ+YGVRKLE LIA LVF +A CFF E+ Y KP   +V  G+F+P
Sbjct  122   IGVLLTGLSTLILLALQKYGVRKLEFLIAFLVFTIAICFFVELHYSKPDPGEVLHGLFVP  181

Query  704   KLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFV  883
             +L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P S  G+ +ACR++LIESG AL V
Sbjct  182   QLKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSASGIKEACRFYLIESGLALMV  241

Query  884   AFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLAS  1063
             AFLINV+V+SVSG VC+   LS +D  +C +L LN ASFLL+NV+GK SS ++AIALLAS
Sbjct  242   AFLINVSVISVSGAVCNAPNLSSEDRANCEELDLNKASFLLRNVVGKWSSKLFAIALLAS  301

Query  1064  GQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiia  1243
             GQSSTITGTYAGQY+MQGFLDL+++ W RNL+TRC+AI PSLIV++IGGS+GAG+LIIIA
Sbjct  302   GQSSTITGTYAGQYVMQGFLDLRLEPWLRNLLTRCLAIIPSLIVALIGGSAGAGKLIIIA  361

Query  1244  sMILSFELPFALIPLLKFSSSSTKMGPYKNSIYiivvswilglgiiginiyylsTAFVDW  1423
             SMILSFELPFAL+PLLKF+S  TKMG + N   I  ++W++G  I+GINIYYL ++F+  
Sbjct  362   SMILSFELPFALVPLLKFTSCKTKMGSHVNPKAITALTWVIGGLIMGINIYYLVSSFIKL  421

Query  1424  LIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMFRKDKVVT  1546
             LIH+++     +  GI+ F  +AIY+ ++ YL+FRK+K  T
Sbjct  422   LIHSHMKLGLVIFCGILGFAGIAIYLASIGYLVFRKNKEAT  462



>emb|CDP10960.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   435 bits (1118),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 259/315 (82%), Positives = 285/315 (90%), Gaps = 0/315 (0%)
 Frame = +2

Query  626   MAACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTR  805
             MAACF GE++YVKPPA DV KGMF+PKL+G  AT DAIALLGALVMPHNLFLHSALVL+R
Sbjct  1     MAACFLGELSYVKPPARDVLKGMFVPKLNGNSATGDAIALLGALVMPHNLFLHSALVLSR  60

Query  806   KVPNSVRGVNDACRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSL  985
             K+P S RG+NDACR FLIESGFALFVAFLINVAV+SVSG VCS   LS++ ++ C+DL+L
Sbjct  61    KIPKSERGINDACRCFLIESGFALFVAFLINVAVISVSGAVCSGEILSQERIESCNDLTL  120

Query  986   NSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTR  1165
             NSASFLLKNVLG+SSST+YAIALLASGQSSTITGTYAGQ+IMQGFLDLKMKKW RNLMTR
Sbjct  121   NSASFLLKNVLGRSSSTIYAIALLASGQSSTITGTYAGQFIMQGFLDLKMKKWLRNLMTR  180

Query  1166  CIAITPslivsiiggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNSIYi  1345
             CIAITPSLIVSIIGGSSGAGRLIIIASMILSFE PFALIPLLKFSSS+TKMGPYKNSI I
Sbjct  181   CIAITPSLIVSIIGGSSGAGRLIIIASMILSFEPPFALIPLLKFSSSTTKMGPYKNSINI  240

Query  1346  ivvswilglgiiginiyylsTAFVDWLIHNNLPKAGNVLVGIVVFPLMAIYVVAVIYLMF  1525
             IV+SWILGLGIIGINIYYLST FV WLIHN+L K GNV +GI+VFPLMA+Y+VAV YLMF
Sbjct  241   IVISWILGLGIIGINIYYLSTDFVGWLIHNSLSKVGNVFIGILVFPLMAVYIVAVFYLMF  300

Query  1526  RKDKVVTFIQPNDDD  1570
             RKD + TF +P   D
Sbjct  301   RKDTIDTFKEPAKYD  315



>gb|AFW69006.1| hypothetical protein ZEAMMB73_198457 [Zea mays]
Length=368

 Score =   432 bits (1110),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 220/333 (66%), Positives = 273/333 (82%), Gaps = 4/333 (1%)
 Frame = +2

Query  122   DSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWV  301
             +SI+  Q+ + E+++    W+   SY+GPGF+VS+AY+DPGN ETDLQAGA ++YELLW+
Sbjct  32    ESIDVDQIVIPEKNS----WKNLFSYIGPGFLVSIAYIDPGNFETDLQAGAQYKYELLWI  87

Query  302   VLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIG  481
             +L+    ALIIQSLAA LGV TGKHL+E C+AEYPK   + LW+LAELAV+A DIPEVIG
Sbjct  88    ILVASCAALIIQSLAARLGVVTGKHLAEHCRAEYPKVTNFVLWILAELAVVACDIPEVIG  147

Query  482   TAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYV  661
             TAFALN+LF IP+W GVL TGLSTL+LL LQ+YGVRKLE LIA LVFL+A CF  E+ Y 
Sbjct  148   TAFALNMLFRIPVWCGVLITGLSTLMLLLLQQYGVRKLEFLIAFLVFLIATCFLVELGYS  207

Query  662   KPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDA  841
             KP A +V +G+F+P+L G GAT  AI+LLGA+VMPHNLFLHSALVL+RKVP SV G+ +A
Sbjct  208   KPNAPEVVRGLFVPELKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKVPRSVHGIKEA  267

Query  842   CRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLG  1021
             CR++ IES FAL VAFLIN++++SVSG+VC +G L+ +D  +CSDL LN ASFLLKNVLG
Sbjct  268   CRFYTIESAFALTVAFLINISIISVSGSVCGSGNLNPEDQANCSDLDLNKASFLLKNVLG  327

Query  1022  KSSSTVYAIALLASGQSSTITGTYAGQYIMQGF  1120
               SS ++A+ALLASGQSSTITGTYAGQY+MQ F
Sbjct  328   NWSSKLFAVALLASGQSSTITGTYAGQYVMQVF  360



>ref|XP_010926921.1| PREDICTED: metal transporter Nramp3-like isoform X3 [Elaeis guineensis]
Length=374

 Score =   428 bits (1100),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 219/332 (66%), Positives = 269/332 (81%), Gaps = 4/332 (1%)
 Frame = +2

Query  122   DSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWV  301
             D+I+  Q+ + E    +  W+   +Y+GPGF+VS+AY+DPGN ETDLQAGA ++YELLW+
Sbjct  32    DNIDAEQIIVPE----RKSWKNLFAYIGPGFLVSIAYIDPGNFETDLQAGAQYKYELLWI  87

Query  302   VLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIG  481
             +L+    ALIIQSLAA LGV TGKHL+E C+AEYPK   + LW+LAELAV+A DIPEVIG
Sbjct  88    ILVASCAALIIQSLAAKLGVVTGKHLAEHCRAEYPKVPNFILWILAELAVVACDIPEVIG  147

Query  482   TAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYV  661
             TAFALN+LF IP+W GVL TGLSTL+LL LQ+YGVRKLE LIA LVF MA+CFF E+ Y 
Sbjct  148   TAFALNMLFRIPVWCGVLITGLSTLMLLLLQQYGVRKLEFLIAFLVFTMASCFFVELGYA  207

Query  662   KPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDA  841
             KP + +V KG+F+P+L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P S+ G+ +A
Sbjct  208   KPNSSEVLKGLFVPQLKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSIHGIKEA  267

Query  842   CRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLG  1021
              R++ IES  ALFVAFLINV+V+SVSG VCS+  LS +D  +C DL LN ASFLL+NVLG
Sbjct  268   YRFYTIESALALFVAFLINVSVISVSGAVCSSDNLSPEDQRNCEDLDLNKASFLLRNVLG  327

Query  1022  KSSSTVYAIALLASGQSSTITGTYAGQYIMQG  1117
             K SS ++A ALLASGQSSTITGTYAGQY+MQG
Sbjct  328   KWSSKLFAFALLASGQSSTITGTYAGQYVMQG  359



>ref|XP_008681156.1| PREDICTED: uncharacterized protein LOC100193537 isoform X4 [Zea 
mays]
Length=466

 Score =   431 bits (1109),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 219/331 (66%), Positives = 272/331 (82%), Gaps = 4/331 (1%)
 Frame = +2

Query  122   DSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWV  301
             +SI+  Q+ + E+++    W+   SY+GPGF+VS+AY+DPGN ETDLQAGA ++YELLW+
Sbjct  106   ESIDVDQIVIPEKNS----WKNLFSYIGPGFLVSIAYIDPGNFETDLQAGAQYKYELLWI  161

Query  302   VLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIG  481
             +L+    ALIIQSLAA LGV TGKHL+E C+AEYPK   + LW+LAELAV+A DIPEVIG
Sbjct  162   ILVASCAALIIQSLAARLGVVTGKHLAEHCRAEYPKVTNFVLWILAELAVVACDIPEVIG  221

Query  482   TAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYV  661
             TAFALN+LF IP+W GVL TGLSTL+LL LQ+YGVRKLE LIA LVFL+A CF  E+ Y 
Sbjct  222   TAFALNMLFRIPVWCGVLITGLSTLMLLLLQQYGVRKLEFLIAFLVFLIATCFLVELGYS  281

Query  662   KPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDA  841
             KP A +V +G+F+P+L G GAT  AI+LLGA+VMPHNLFLHSALVL+RKVP SV G+ +A
Sbjct  282   KPNAPEVVRGLFVPELKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKVPRSVHGIKEA  341

Query  842   CRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLG  1021
             CR++ IES FAL VAFLIN++++SVSG+VC +G L+ +D  +CSDL LN ASFLLKNVLG
Sbjct  342   CRFYTIESAFALTVAFLINISIISVSGSVCGSGNLNPEDQANCSDLDLNKASFLLKNVLG  401

Query  1022  KSSSTVYAIALLASGQSSTITGTYAGQYIMQ  1114
               SS ++A+ALLASGQSSTITGTYAGQY+MQ
Sbjct  402   NWSSKLFAVALLASGQSSTITGTYAGQYVMQ  432



>dbj|BAM45316.1| Nramp metal transporter [Oryza sativa Japonica Group]
Length=358

 Score =   425 bits (1093),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 213/269 (79%), Positives = 246/269 (91%), Gaps = 0/269 (0%)
 Frame = +2

Query  167  KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLA  346
            K+P W++FL++VGPGFMVSLAYLDPGNLETDLQAGA+HRYELLWV+LIGL+FALIIQSLA
Sbjct  37   KEPAWKRFLAHVGPGFMVSLAYLDPGNLETDLQAGANHRYELLWVILIGLIFALIIQSLA  96

Query  347  ANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWv  526
            ANLGV TG+HL+E+CK+EYPK+VK  LWLLAELAVIAADIPEVIGTAFA NILFHIP+WV
Sbjct  97   ANLGVVTGRHLAEICKSEYPKFVKIFLWLLAELAVIAADIPEVIGTAFAFNILFHIPVWV  156

Query  527  gvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPK  706
            GVL TG STLLLL LQ+YGVRKLE LI++LVF+MAACFFGE++ VKPPA++V KG+FIP+
Sbjct  157  GVLITGTSTLLLLGLQKYGVRKLEFLISMLVFVMAACFFGELSIVKPPAKEVMKGLFIPR  216

Query  707  LSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGFALFVA  886
            L+G GATADAIALLGALVMPHNLFLHSALVL+RK P SVRG+ D CR+FL ESGFALFVA
Sbjct  217  LNGDGATADAIALLGALVMPHNLFLHSALVLSRKTPASVRGIKDGCRFFLYESGFALFVA  276

Query  887  FLINVAVVSVSGTVCSNGKLSKDDLDHCS  973
             LIN+AVVSVSGT CS+  LS++D D C+
Sbjct  277  LLINIAVVSVSGTACSSANLSQEDADKCA  305



>ref|XP_008806828.1| PREDICTED: metal transporter Nramp3-like isoform X2 [Phoenix 
dactylifera]
Length=379

 Score =   423 bits (1087),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 216/332 (65%), Positives = 270/332 (81%), Gaps = 4/332 (1%)
 Frame = +2

Query  122   DSINKLQLDLQEEHNKKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELLWV  301
             D+I+  Q+ + E    +  W+   +Y+GPGF+VS+AY+DPGN ETDLQ+GA ++YELLW+
Sbjct  32    DNIDAEQIIVPE----RKSWKNLFAYIGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWI  87

Query  302   VLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIG  481
             +L+    ALIIQSLAA LGV TGKHL+E C+AEYPK   + LW+LAELAV+A DIPEVIG
Sbjct  88    ILVASCAALIIQSLAAKLGVVTGKHLAEHCRAEYPKVPNFILWILAELAVVACDIPEVIG  147

Query  482   TAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYV  661
             TAFALN+LF IP+W GVL TGLSTL+LL LQ+YG+RKLELLIA LVF MA+CFF E+ Y 
Sbjct  148   TAFALNMLFRIPIWCGVLITGLSTLMLLLLQQYGIRKLELLIAFLVFTMASCFFVELGYA  207

Query  662   KPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDA  841
             KP + +V KG+FIP+L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P S+ G+ +A
Sbjct  208   KPSSSEVLKGLFIPQLKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSIHGLKEA  267

Query  842   CRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLG  1021
               ++ +ES FAL VAFLIN++V+SVSG VCS+  LS +D  +C DL LN ASFLL++VLG
Sbjct  268   YWFYTVESAFALSVAFLINISVISVSGAVCSSENLSPEDQRNCEDLDLNKASFLLRHVLG  327

Query  1022  KSSSTVYAIALLASGQSSTITGTYAGQYIMQG  1117
             K SS ++AIALLASGQSSTITGTYAGQY+MQG
Sbjct  328   KWSSKLFAIALLASGQSSTITGTYAGQYVMQG  359



>gb|ACR16683.1| natural resistance-associated macrophage protein 1.4 [Brassica 
juncea]
Length=345

 Score =   421 bits (1083),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 235/345 (68%), Positives = 288/345 (83%), Gaps = 0/345 (0%)
 Frame = +2

Query  302   VLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIG  481
             +L+    AL+IQSLAANLGV TGKHL+E C+AEY K   + LW++AE+AV+A DIPEVIG
Sbjct  1     ILVASCAALVIQSLAANLGVVTGKHLAEHCRAEYSKVPNFLLWIVAEIAVVACDIPEVIG  60

Query  482   TAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYV  661
             TAFALN+LFHIP+W+GVL TGLSTL+LL++Q+YGVRKLE LIA LVF +A CFF E+ Y 
Sbjct  61    TAFALNMLFHIPVWIGVLLTGLSTLMLLAIQQYGVRKLEFLIAFLVFTIAICFFVELHYS  120

Query  662   KPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDA  841
             KP  ++V  G+F+P+L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P S  G+ +A
Sbjct  121   KPDPKEVLHGLFVPQLKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSATGIKEA  180

Query  842   CRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLG  1021
             CR++LIESG AL VAFLINV+V+SVSG VC+   LS +D   C DL LN A FLL+NV+G
Sbjct  181   CRFYLIESGLALTVAFLINVSVISVSGAVCNASDLSPEDRAKCEDLDLNKAPFLLRNVVG  240

Query  1022  KSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsi  1201
             K SS ++AIALLASGQSSTITGTYAGQY+MQGFLDL+++ W RN +TRC+AI PSLIV++
Sbjct  241   KWSSKLFAIALLASGQSSTITGTYAGQYVMQGFLDLRLEPWLRNFLTRCLAIIPSLIVAL  300

Query  1202  iggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNS  1336
             IGGS+GAG+LIIIASMILSFELPFAL+PLLKF+S   KMG + NS
Sbjct  301   IGGSAGAGKLIIIASMILSFELPFALVPLLKFTSCKMKMGSHANS  345



>gb|ACL83360.1| natural resistance associated macrophage protein 1.1 [Brassica 
juncea]
Length=345

 Score =   421 bits (1081),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 235/344 (68%), Positives = 287/344 (83%), Gaps = 0/344 (0%)
 Frame = +2

Query  302   VLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIG  481
             +L+    AL+IQSLAANLGV TGKHL+E C+AEY K   + LW++AE+AV+A DIPEVIG
Sbjct  1     ILVASCAALVIQSLAANLGVVTGKHLAEHCRAEYSKVPNFLLWVVAEIAVVACDIPEVIG  60

Query  482   TAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYV  661
             TAFALN+LFHIP+W+GVL TGLSTL+LL++Q+YGVRKLE LIA LVF +A CFF E+ Y 
Sbjct  61    TAFALNMLFHIPVWIGVLLTGLSTLMLLAIQQYGVRKLEFLIAFLVFTIAICFFVELHYS  120

Query  662   KPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDA  841
             KP  ++V  G+F+P+L G GAT  AI+LLGA+VMPHNLFLHSALVL RK+P S  G+ +A
Sbjct  121   KPDPKEVLHGLFVPQLKGNGATGLAISLLGAMVMPHNLFLHSALVLPRKIPRSATGIKEA  180

Query  842   CRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLG  1021
             CR++LIESG AL VAFLINV+V+SVSG VC+   LS +D   C DL LN ASFLL+NV+G
Sbjct  181   CRFYLIESGLALTVAFLINVSVISVSGAVCNASDLSPEDRAKCEDLDLNKASFLLRNVVG  240

Query  1022  KSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsi  1201
             K SS ++AIALLASGQSSTITGTYAGQY+MQGFLDL+++ W RN +TRC+AI PSLIV++
Sbjct  241   KWSSKLFAIALLASGQSSTITGTYAGQYVMQGFLDLRLEPWLRNFLTRCLAIIPSLIVAL  300

Query  1202  iggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKN  1333
             IGGS+GAG+LIIIASMILSFELPFAL+PLLKF+S   KMG + N
Sbjct  301   IGGSAGAGKLIIIASMILSFELPFALVPLLKFTSCKMKMGSHAN  344



>gb|ACR16686.1| natural resistance-associated macrophage protein 1.2 [Brassica 
juncea]
Length=345

 Score =   419 bits (1077),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 233/344 (68%), Positives = 285/344 (83%), Gaps = 0/344 (0%)
 Frame = +2

Query  302   VLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIG  481
             +L+    AL+IQSLAANLGV TGKHL+E C+AEY K   + LW++AE+AV+A DIPEVIG
Sbjct  1     ILVASCAALVIQSLAANLGVVTGKHLAEHCRAEYSKVPNFLLWVVAEIAVVACDIPEVIG  60

Query  482   TAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYV  661
             TAFALN+LFHIP+W+GVL TG STL+LL++Q+YGVRKLE LIA LVF +A CFF E  Y 
Sbjct  61    TAFALNMLFHIPVWIGVLLTGSSTLMLLAIQQYGVRKLEFLIAFLVFTIAICFFVEHHYS  120

Query  662   KPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDA  841
             KP  ++V  G+F+P+L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P S  G+ +A
Sbjct  121   KPDPKEVLHGLFVPQLKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSATGIKEA  180

Query  842   CRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLG  1021
             CR++LIESG AL VAFLINV+V+SVSG VC+   LS +D   C DL LN ASFLL+NV+G
Sbjct  181   CRFYLIESGLALTVAFLINVSVISVSGAVCNASDLSPEDRAKCEDLDLNKASFLLRNVVG  240

Query  1022  KSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsi  1201
             K SS ++AIALLASGQSSTITGTYAGQY+MQGFLDL+++ W RN +TRC+AI PSLIV++
Sbjct  241   KWSSKLFAIALLASGQSSTITGTYAGQYVMQGFLDLRLEPWLRNFLTRCLAIIPSLIVAL  300

Query  1202  iggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKN  1333
             IGGS+GAG+LIIIASMILSFELPFAL+P LKF+S   KMG + N
Sbjct  301   IGGSAGAGKLIIIASMILSFELPFALVPFLKFTSCKMKMGSHAN  344



>gb|AFW69999.1| hypothetical protein ZEAMMB73_660809 [Zea mays]
Length=413

 Score =   422 bits (1084),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 217/358 (61%), Positives = 284/358 (79%), Gaps = 4/358 (1%)
 Frame = +2

Query  122   DSINKLQLDLQEEHN--KKPGWRKFLSYVGPGFMVSLAYLDPGNLETDLQAGADHRYELL  295
             + ++K  +D  E+     +  WR+FL++VGPG +V++ +LDP NLETD+QAGAD +Y+LL
Sbjct  32    ERVDKAVVDGGEDERFRVQRKWRRFLAHVGPGALVAIGFLDPSNLETDMQAGADFKYQLL  91

Query  296   WVVLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEV  475
             WV+L+G+VFAL+IQ+LAANLGV TGKHL+ELC+ EYP+ V  CLW++AELAVI+ DIPEV
Sbjct  92    WVILVGMVFALLIQTLAANLGVKTGKHLAELCREEYPRSVNICLWIIAELAVISDDIPEV  151

Query  476   IGTAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMA  655
             +GTAFA NIL  IP+W GV+ T LSTLLLL ++R+G RKLE ++A  +F MAACFFGE++
Sbjct  152   LGTAFAFNILLGIPVWAGVVLTVLSTLLLLGVERFGARKLEFVVAAFMFAMAACFFGELS  211

Query  656   YVKPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVN  835
             Y++P A +V +GMF+P+L G+GA A+AIAL GA++ P+NLFLHSALVL+RK P SV+ + 
Sbjct  212   YLRPSAGEVVEGMFVPRLRGKGAAANAIALFGAIITPYNLFLHSALVLSRKTPRSVKSIR  271

Query  836   DACRYFLIESGFALFVAFLINVAVVSVSGTVC--SNGKLSKDDLDHCSDLSLNSASFLLK  1009
              ACRYFL+E   A  VAFLINVAVV V+G++C  + G LS  D   C DL+L S   LL+
Sbjct  272   AACRYFLVECSLAFVVAFLINVAVVVVAGSICNAAGGNLSPADAAACGDLTLQSTPLLLR  331

Query  1010  NVLGKSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITP  1183
             +VLG+SSS VYA+ALLASGQS+TI+ T+AGQ IMQGFLD++MK W RNL TR IAI P
Sbjct  332   DVLGRSSSVVYAVALLASGQSTTISCTFAGQVIMQGFLDMRMKSWVRNLTTRAIAIAP  389



>gb|ACR16687.1| natural resistance-associated macrophage protein 1.3 [Brassica 
juncea]
Length=345

 Score =   416 bits (1069),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 234/345 (68%), Positives = 286/345 (83%), Gaps = 0/345 (0%)
 Frame = +2

Query  302   VLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIG  481
             +L+    AL+IQSLAANLGV TGKHL+E C+AEY K   + LW++AE+AVIA DIPEVIG
Sbjct  1     ILVASCAALVIQSLAANLGVVTGKHLAEHCRAEYSKVPNFLLWVVAEIAVIACDIPEVIG  60

Query  482   TAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYV  661
             TAFALN+LFHIP+W+GVL TGLSTL+LL++Q+YGVRKLE LIA LVF +A C F E+ Y 
Sbjct  61    TAFALNMLFHIPVWIGVLLTGLSTLMLLAIQQYGVRKLESLIAFLVFTIAICLFVELHYS  120

Query  662   KPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDA  841
             KP  ++V  G+F+P+L G GAT  AI+LLGA+VMPHNLFLHSALVL+RK+P S  G+ +A
Sbjct  121   KPDPKEVLHGLFVPQLKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSATGIKEA  180

Query  842   CRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLG  1021
             C ++LIESG AL VAFLINV+V+SVSG VC+   LS +D   C DL LN  SFLL+NV+G
Sbjct  181   CGFYLIESGLALTVAFLINVSVISVSGAVCNASDLSPEDRAKCEDLDLNKTSFLLRNVVG  240

Query  1022  KSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsi  1201
             K SS ++AIALLASGQSSTITGTYAGQY+MQGFLDL+++ W RN +TRC+AI PSLIV++
Sbjct  241   KWSSKLFAIALLASGQSSTITGTYAGQYVMQGFLDLRLEPWLRNFLTRCLAIIPSLIVAL  300

Query  1202  iggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKNS  1336
             IGGS+GAG+LIIIASMILSFELPFAL+PLLKF+S   KMG + NS
Sbjct  301   IGGSAGAGKLIIIASMILSFELPFALVPLLKFTSCKMKMGSHANS  345



>gb|ACO24484.1| natural resistance associated macrophage protein 6.2 [Brassica 
juncea]
Length=345

 Score =   406 bits (1044),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 229/344 (67%), Positives = 283/344 (82%), Gaps = 0/344 (0%)
 Frame = +2

Query  302   VLIGLVFALIIQSLAANLGVSTGKHLSELCKAEYPKYVKYCLWLLAELAVIAADIPEVIG  481
             +L+    AL+IQSLAANLGV TGKHL+E C+AEY +   + LW++AE+AV+A DIPEVIG
Sbjct  1     ILVASCAALVIQSLAANLGVVTGKHLAEHCRAEYSRVPNFLLWVVAEIAVVACDIPEVIG  60

Query  482   TAFALNILFHIPLWvgvlctglstllllslQRYGVRKLELLIAVLVFLMAACFFGEMAYV  661
             TAFALN+LFHIP+W+GV  TGLSTL+LL++Q+YGVRKLE LIA L   MA CFF E+ Y 
Sbjct  61    TAFALNMLFHIPVWIGVPLTGLSTLMLLAIQQYGVRKLEFLIAFLGDTMAICFFVELHYS  120

Query  662   KPPAEDVFKGMFIPKLSGQGATADAIALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDA  841
             KP  ++V  G+F+P+L G GAT  AI+LLGA+VMPHNLFLHSALVL+ K+P S  G+ +A
Sbjct  121   KPDPKEVLHGLFVPQLKGNGATGLAISLLGAMVMPHNLFLHSALVLSGKIPRSATGIKEA  180

Query  842   CRYFLIESGFALFVAFLINVAVVSVSGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLG  1021
             CR++LIESG AL VAF INV+V+SVSG VC+   L+ +D   C DL LN ASFLL+NV+G
Sbjct  181   CRFYLIESGLALTVAFPINVSVISVSGAVCNAPDLTPEDRAKCEDLDLNKASFLLRNVVG  240

Query  1022  KSSSTVYAIALLASGQSSTITGTYAGQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsi  1201
             K SS ++AIALLASGQSSTITGTYAGQY+MQGF DL+++ W RN +TRC+AI PSLIV++
Sbjct  241   KWSSKLFAIALLASGQSSTITGTYAGQYVMQGFPDLRLEPWLRNFLTRCLAIIPSLIVAL  300

Query  1202  iggssgagrliiiasMILSFELPFALIPLLKFSSSSTKMGPYKN  1333
             IGGS+GAG+LIIIASMILSFELPFAL+PLLKF+S  TKMG + N
Sbjct  301   IGGSAGAGKLIIIASMILSFELPFALVPLLKFTSCKTKMGSHVN  344



>gb|AAC49720.1| integral membrane protein OsNramp3 [Oryza sativa]
Length=385

 Score =   406 bits (1044),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 241/374 (64%), Positives = 294/374 (79%), Gaps = 9/374 (2%)
 Frame = +2

Query  203   GPGFMVSLAYLDPGNLETDLQAGADHRYELLWVVLIGLVFALIIQSLAANLGVSTGKHLS  382
             GPGF++S+AY+DPGN ETDLQAGA ++YELLW++LI    ALIIQSLAA LGV TGK   
Sbjct  3     GPGFLISIAYIDPGNFETDLQAGAQYKYELLWIILIASCAALIIQSLAARLGVVTGKPPG  62

Query  383   -ELCKAEYPKYVKYCLWLLAELAVIAADIPEVIGTAFALNILFHIPLWvgvlctglstll  559
               + + EYPK   + LW+LAELAV+A DIPEVIGTAFALN+LF     V +L TGLSTL+
Sbjct  63    PSIAEVEYPKATNFILWILAELAVVACDIPEVIGTAFALNMLFKSLCGVVILITGLSTLM  122

Query  560   llslQRYGVRKLELLIAVLVFLMAACFFGEMAYVKPPAEDVFKGMFIPKLSGQGATADAI  739
             LL LQ+YGVRKLE LIA+LV L+A CF  E+ Y KP +  V +G+F+P+L G GAT  AI
Sbjct  123   LLLLQQYGVRKLEFLIAILVSLIATCFLVELGYSKPNSSVVVRGLFVPELKGNGATGLAI  182

Query  740   ALLGALVMPHNLFLHSALVLTRKVPNSVRGVNDACRYFLIESGF-ALFVAFLINVAVVSV  916
             +LLGA+VMPHNLFLHS LVL+RK   SV G+ +ACR+++IES F AL +AFLIN++++SV
Sbjct  183   SLLGAMVMPHNLFLHSELVLSRKEKRSVHGIKEACRFYMIESAFLALTIAFLINISIISV  242

Query  917   SGTVCSNGKLSKDDLDHCSDLSLNSASFLLKNVLGKSSSTVYAIALLASGQSSTITGTYA  1096
             + TVC +  LS +D  +CSDL LN ASFLLKNVLG  SS ++A+ALLASGQSSTITGTYA
Sbjct  243   NNTVCGSDNLSPEDQMNCSDLDLNKASFLLKNVLGNWSSKLFAVALLASGQSSTITGTYA  302

Query  1097  GQYIMQGFLDLKMKKWSRNLMTRCIAITPslivsiiggssgagrliiiasMILSFELPFA  1276
             GQY+MQGFLDL+M  W RNL+TR +AI PSLIVSIIGGSS AG+LIIIASMIL+FE  FA
Sbjct  303   GQYVMQGFLDLRMTPWIRNLLTRSLAILPSLIVSIIGGSSAAGQLIIIASMILTFEPSFA  362

Query  1277  LIPLLKFSSSSTKM  1318
                    SSS+ K+
Sbjct  363   -------SSSTPKI  369



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4885834314610