BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13528_g1_i1 len=2566 path=[2616:0-2565]

Length=2566
                                                                      Score     E

ref|XP_009626278.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        933   0.0      
ref|XP_009759689.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        920   0.0      
ref|XP_004246021.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    910   0.0      
ref|XP_004244440.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    900   0.0      
gb|AGK82806.1|  alcohol oxidase                                         899   0.0      
gb|AGK82821.1|  alcohol oxidase                                         897   0.0      
emb|CDP07225.1|  unnamed protein product                                895   0.0      
gb|AGK82832.1|  alcohol oxidase                                         895   0.0      
ref|XP_006361221.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    893   0.0      
gb|AGK82825.1|  alcohol oxidase                                         892   0.0      
ref|XP_006359947.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    890   0.0      
ref|XP_006359948.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    883   0.0      
ref|XP_007210564.1|  hypothetical protein PRUPE_ppa014756mg             869   0.0      
ref|XP_010054021.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        869   0.0      
ref|XP_011072398.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    864   0.0      
ref|XP_008237995.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        864   0.0      
ref|XP_006482469.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    863   0.0      
ref|XP_006430998.1|  hypothetical protein CICLE_v10011111mg             863   0.0      
ref|XP_010054015.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    860   0.0      
ref|XP_007158083.1|  hypothetical protein PHAVU_002G122600g             859   0.0      
gb|EYU29124.1|  hypothetical protein MIMGU_mgv1a001761mg                857   0.0      
ref|XP_003629014.1|  GMC-type oxidoreductase, putative                  852   0.0      
gb|AES95453.2|  long-chain-alcohol oxidase FAO1-like protein            852   0.0      
ref|XP_011078909.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    848   0.0      
ref|XP_003517097.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    850   0.0      
gb|KHN41766.1|  Long-chain-alcohol oxidase FAO4A                        849   0.0      
ref|XP_011028488.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        843   0.0      
ref|XP_003534338.2|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    843   0.0      
ref|XP_003547818.2|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    842   0.0      
ref|XP_007156339.1|  hypothetical protein PHAVU_003G278200g             841   0.0      
ref|XP_006385149.1|  alcohol oxidase-related family protein             836   0.0      
ref|XP_003612495.1|  GMC-type oxidoreductase, putative                  839   0.0      
ref|XP_010275157.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    831   0.0      
ref|XP_010111511.1|  Long-chain-alcohol oxidase FAO4A                   830   0.0      
ref|XP_003547733.2|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    829   0.0      
gb|KDP37816.1|  hypothetical protein JCGZ_06718                         826   0.0      
ref|XP_007040880.1|  Long-chain fatty alcohol dehydrogenase famil...    840   0.0      
ref|XP_002269629.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        826   0.0      Vitis vinifera
ref|XP_004509495.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    824   0.0      
gb|KDO72345.1|  hypothetical protein CISIN_1g0039902mg                  815   0.0      
gb|EYU37432.1|  hypothetical protein MIMGU_mgv1a022390mg                808   0.0      
ref|XP_004512334.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    811   0.0      
ref|XP_002519938.1|  electron carrier, putative                         805   0.0      Ricinus communis
ref|XP_010676697.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    802   0.0      
ref|XP_004512333.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    799   0.0      
ref|XP_008444238.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...    792   0.0      
ref|XP_010274418.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    774   0.0      
ref|XP_011072475.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    755   0.0      
gb|EPS61567.1|  hypothetical protein M569_13229                         756   0.0      
gb|KCW78402.1|  hypothetical protein EUGRSUZ_D02568                     751   0.0      
gb|KHN27504.1|  Long-chain-alcohol oxidase FAO4A                        744   0.0      
ref|XP_010676700.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    749   0.0      
ref|XP_002867943.1|  hypothetical protein ARALYDRAFT_914728             744   0.0      
gb|KCW78401.1|  hypothetical protein EUGRSUZ_D02566                     742   0.0      
ref|XP_010538590.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...    738   0.0      
gb|KHN11789.1|  Long-chain-alcohol oxidase FAO4A                        729   0.0      
ref|XP_010439724.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    729   0.0      
ref|XP_010449364.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        726   0.0      
gb|KDP37817.1|  hypothetical protein JCGZ_06719                         718   0.0      
ref|NP_193673.2|  Long-chain-alcohol oxidase FAO4A                      722   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010434428.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    722   0.0      
gb|EPS64229.1|  hypothetical protein M569_10552                         719   0.0      
ref|XP_006283177.1|  hypothetical protein CARUB_v10004208mg             721   0.0      
ref|XP_010274420.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    717   0.0      
ref|XP_010538591.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...    718   0.0      
ref|XP_010942998.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        710   0.0      
ref|XP_009132755.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        708   0.0      
gb|KFK28594.1|  hypothetical protein AALP_AA7G017800                    707   0.0      
ref|XP_008776965.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    706   0.0      
ref|XP_009384756.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    706   0.0      
emb|CDY01593.1|  BnaC07g35830D                                          703   0.0      
ref|XP_009137007.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    699   0.0      
ref|XP_006413983.1|  hypothetical protein EUTSA_v10024528mg             694   0.0      
ref|XP_008805948.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    695   0.0      
ref|XP_006878629.1|  hypothetical protein AMTR_s00011p00262370          693   0.0      
ref|XP_004150760.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    675   0.0      
ref|XP_004167305.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    672   0.0      
ref|XP_008444239.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...    670   0.0      
ref|XP_009396212.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        666   0.0      
emb|CAA18625.1|  putative protein                                       628   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283178.1|  hypothetical protein CARUB_v10004208mg             620   0.0      
ref|XP_008382148.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    620   0.0      
emb|CBI29206.3|  unnamed protein product                                611   0.0      
gb|ABR17814.1|  unknown                                                 597   0.0      Picea sitchensis
ref|XP_006368110.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    583   0.0      
emb|CDY66156.1|  BnaA01g34950D                                          578   0.0      
emb|CDX99382.1|  BnaC01g11700D                                          571   0.0      
emb|CDX98615.1|  BnaA03g44000D                                          565   0.0      
emb|CAN71289.1|  hypothetical protein VITISV_019349                     543   6e-178   Vitis vinifera
ref|XP_002285334.1|  PREDICTED: long-chain-alcohol oxidase FAO1         541   8e-177   Vitis vinifera
ref|XP_009384649.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    536   4e-175   
ref|XP_002314488.2|  alcohol oxidase-related family protein             535   2e-174   Populus trichocarpa [western balsam poplar]
ref|XP_010920358.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    534   4e-174   
ref|XP_009376994.1|  PREDICTED: long-chain-alcohol oxidase FAO1         533   1e-173   
ref|XP_011030464.1|  PREDICTED: long-chain-alcohol oxidase FAO1         531   5e-173   
ref|XP_010262397.1|  PREDICTED: long-chain-alcohol oxidase FAO2-l...    530   1e-172   
ref|XP_010934290.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    530   2e-172   
ref|XP_010684652.1|  PREDICTED: long-chain-alcohol oxidase FAO2         528   9e-172   
ref|XP_004134405.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    527   2e-171   
ref|XP_009594479.1|  PREDICTED: long-chain-alcohol oxidase FAO2         526   3e-171   
ref|XP_006489686.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    526   5e-171   
gb|KCW60303.1|  hypothetical protein EUGRSUZ_H03017                     527   6e-171   
ref|XP_010036770.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    526   6e-171   
ref|XP_010023906.1|  PREDICTED: long-chain-alcohol oxidase FAO1         526   6e-171   
ref|XP_010264984.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    525   1e-170   
ref|XP_006489687.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    524   2e-170   
ref|XP_010262396.1|  PREDICTED: long-chain-alcohol oxidase FAO2-l...    524   3e-170   
ref|XP_009790215.1|  PREDICTED: long-chain-alcohol oxidase FAO1         523   4e-170   
ref|XP_010069617.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    522   2e-169   
ref|XP_006420282.1|  hypothetical protein CICLE_v10004403mg             521   3e-169   
gb|KDP40361.1|  hypothetical protein JCGZ_02359                         520   8e-169   
ref|XP_008438494.1|  PREDICTED: long-chain-alcohol oxidase FAO1         520   9e-169   
ref|XP_011029789.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    520   9e-169   
ref|XP_001763007.1|  predicted protein                                  520   2e-168   
ref|XP_004152057.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    518   3e-168   
gb|KHN02487.1|  Long-chain-alcohol oxidase FAO2                         518   5e-168   
gb|AGC65582.1|  fatty alcohol oxidase                                   517   6e-168   
ref|XP_006420281.1|  hypothetical protein CICLE_v10004405mg             516   2e-167   
ref|XP_004495357.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    516   2e-167   
gb|KHG17178.1|  Long-chain-alcohol oxidase FAO1                         516   2e-167   
ref|XP_009764096.1|  PREDICTED: long-chain-alcohol oxidase FAO2         515   4e-167   
ref|XP_002311685.2|  alcohol oxidase-related family protein             515   5e-167   Populus trichocarpa [western balsam poplar]
gb|ACF22878.1|  alcohol oxidase                                         514   5e-167   Glycine max [soybeans]
ref|XP_003554295.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    514   2e-166   
sp|B5WWZ8.1|FAO1_LOTJA  RecName: Full=Long-chain-alcohol oxidase ...    513   5e-166   Lotus japonicus
ref|XP_008804287.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    513   6e-166   
ref|XP_010093072.1|  Long-chain-alcohol oxidase FAO2                    512   9e-166   
gb|KGN56837.1|  hypothetical protein Csa_3G134850                       509   2e-165   
ref|XP_007224435.1|  hypothetical protein PRUPE_ppa021498mg             509   6e-165   
ref|XP_008447391.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    510   6e-165   
ref|NP_566729.1|  long-chain-alcohol oxidase FAO3                       510   7e-165   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003540021.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    510   9e-165   
ref|XP_004289970.1|  PREDICTED: long-chain-alcohol oxidase FAO2-l...    509   1e-164   
ref|XP_004289971.1|  PREDICTED: long-chain-alcohol oxidase FAO2-l...    509   1e-164   
ref|XP_010670985.1|  PREDICTED: long-chain-alcohol oxidase FAO1         509   2e-164   
gb|EPS58840.1|  hypothetical protein M569_15969                         506   2e-164   
ref|XP_007200494.1|  hypothetical protein PRUPE_ppa018458mg             509   3e-164   
ref|XP_008785203.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    508   4e-164   
ref|XP_006354463.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    508   4e-164   
gb|EYU46421.1|  hypothetical protein MIMGU_mgv1a001868mg                508   4e-164   
ref|XP_008224323.1|  PREDICTED: long-chain-alcohol oxidase FAO1         508   5e-164   
gb|KDO60414.1|  hypothetical protein CISIN_1g004496mg                   507   1e-163   
ref|XP_009610950.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    506   1e-163   
emb|CDX85097.1|  BnaC07g08090D                                          506   1e-163   
gb|AES89853.2|  long-chain-alcohol oxidase FAO2-like protein            507   1e-163   
ref|XP_009102621.1|  PREDICTED: long-chain-alcohol oxidase FAO3         506   1e-163   
ref|XP_006367233.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    506   2e-163   
ref|XP_004247745.1|  PREDICTED: long-chain-alcohol oxidase FAO1         505   4e-163   
ref|XP_008364320.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    505   6e-163   
ref|XP_006582261.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    504   1e-162   
ref|XP_007132926.1|  hypothetical protein PHAVU_011G136600g             504   1e-162   
ref|XP_011080081.1|  PREDICTED: long-chain-alcohol oxidase FAO2         504   1e-162   
ref|XP_002883430.1|  hypothetical protein ARALYDRAFT_479855             503   2e-162   
gb|EYU46424.1|  hypothetical protein MIMGU_mgv1a001883mg                503   2e-162   
emb|CAC87643.1|  alcohol oxidase                                        501   2e-162   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007035183.1|  Fatty alcohol oxidase 3 isoform 1                  503   2e-162   
ref|XP_006296686.1|  hypothetical protein CARUB_v10013046mg             503   3e-162   
emb|CDP11641.1|  unnamed protein product                                503   4e-162   
ref|XP_006443786.1|  hypothetical protein CICLE_v10018992mg             503   4e-162   
gb|KEH30749.1|  long-chain-alcohol oxidase FAO2-like protein            503   4e-162   
gb|KHN28101.1|  Long-chain-alcohol oxidase FAO1-like protein            503   6e-162   
emb|CDX94858.1|  BnaC03g43300D                                          502   6e-162   
ref|XP_010466677.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    502   7e-162   
ref|XP_008235630.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    502   8e-162   
gb|KEH23950.1|  long-chain-alcohol oxidase FAO1                         501   8e-162   
gb|KDP26499.1|  hypothetical protein JCGZ_17657                         499   9e-162   
ref|XP_011091281.1|  PREDICTED: long-chain-alcohol oxidase FAO1         502   1e-161   
ref|XP_002966834.1|  hypothetical protein SELMODRAFT_87621              501   1e-161   
ref|XP_002961172.1|  hypothetical protein SELMODRAFT_73531              501   2e-161   
ref|XP_009336115.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    501   2e-161   
ref|XP_007050220.1|  Alcohol oxidase                                    498   2e-160   
ref|XP_006857358.1|  hypothetical protein AMTR_s00067p00112750          500   2e-160   
ref|XP_004247518.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    497   5e-160   
ref|XP_006354464.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    494   5e-160   
ref|XP_002529832.1|  electron carrier, putative                         496   1e-159   Ricinus communis
ref|XP_010488398.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    496   1e-159   
emb|CDX92985.1|  BnaA03g37070D                                          495   1e-159   
ref|XP_010512451.1|  PREDICTED: long-chain-alcohol oxidase FAO3         495   4e-159   
ref|XP_009136067.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    494   4e-159   
dbj|BAJ86655.1|  predicted protein                                      495   6e-159   
ref|XP_004982881.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    494   1e-158   
ref|XP_006406028.1|  hypothetical protein EUTSA_v10020141mg             493   2e-158   
gb|EYU18303.1|  hypothetical protein MIMGU_mgv1a001896mg                493   2e-158   
ref|XP_002528823.1|  disulfide oxidoreductase, putative                 493   2e-158   Ricinus communis
ref|XP_006589281.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    493   3e-158   
gb|KFK39637.1|  hypothetical protein AALP_AA3G269600                    492   4e-158   
ref|XP_004505474.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    493   4e-158   
ref|XP_004493801.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    491   6e-158   
ref|XP_008382898.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    489   8e-158   
ref|XP_002272123.2|  PREDICTED: long-chain-alcohol oxidase FAO2-like    491   1e-157   Vitis vinifera
ref|XP_007144044.1|  hypothetical protein PHAVU_007G124200g             491   1e-157   
ref|XP_007035188.1|  Fatty alcohol oxidase 3 isoform 6                  487   3e-157   
ref|XP_007162567.1|  hypothetical protein PHAVU_001G162800g             489   3e-157   
ref|XP_009369442.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    490   3e-157   
ref|XP_002967201.1|  hypothetical protein SELMODRAFT_87684              489   4e-157   
ref|XP_002960521.1|  hypothetical protein SELMODRAFT_74601              488   7e-157   
ref|XP_004296386.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    489   2e-156   
ref|XP_009369441.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    488   2e-156   
gb|EPS66779.1|  hypothetical protein M569_07992                         487   3e-156   
gb|KHG12235.1|  Long-chain-alcohol oxidase FAO1                         487   4e-156   
ref|XP_006283182.1|  hypothetical protein CARUB_v10004212mg             488   4e-156   
sp|B5WWZ9.1|FAO2_LOTJA  RecName: Full=Long-chain-alcohol oxidase ...    487   4e-156   Lotus japonicus
ref|XP_003571871.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    488   6e-156   
gb|AAM63097.1|  unknown                                                 485   2e-155   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010532671.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    485   2e-155   
ref|NP_194586.1|  Long-chain-alcohol oxidase FAO4B                      485   3e-155   Arabidopsis thaliana [mouse-ear cress]
gb|AAK64154.1|  unknown protein                                         485   3e-155   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011080082.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    484   8e-155   
ref|XP_002464496.1|  hypothetical protein SORBIDRAFT_01g019480          481   4e-154   Sorghum bicolor [broomcorn]
ref|XP_004982884.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    482   6e-154   
ref|XP_010532672.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    481   7e-154   
ref|XP_008668721.1|  PREDICTED: uncharacterized protein LOC100274...    482   9e-154   
ref|XP_008664883.1|  PREDICTED: long-chain-alcohol oxidase FAO1         479   8e-153   
ref|XP_002869492.1|  hypothetical protein ARALYDRAFT_491906             477   3e-152   
emb|CDO99261.1|  unnamed protein product                                477   4e-152   
emb|CDX92884.1|  BnaC07g41420D                                          476   5e-152   
emb|CDP03771.1|  unnamed protein product                                477   6e-152   
ref|XP_006412936.1|  hypothetical protein EUTSA_v10024496mg             476   1e-151   
ref|XP_010532673.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    476   2e-151   
ref|XP_003574052.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    474   6e-151   
ref|NP_001142399.1|  uncharacterized protein LOC100274574               469   3e-150   Zea mays [maize]
ref|XP_009137800.1|  PREDICTED: long-chain-alcohol oxidase FAO4B        471   4e-150   
gb|KFK29401.1|  hypothetical protein AALP_AA7G128800                    471   4e-150   
ref|XP_010457422.1|  PREDICTED: long-chain-alcohol oxidase FAO1         471   1e-149   
ref|XP_002464495.1|  hypothetical protein SORBIDRAFT_01g019470          471   2e-149   Sorghum bicolor [broomcorn]
ref|NP_001176205.1|  Os10g0474966                                       470   3e-149   
ref|XP_004982882.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    470   3e-149   
ref|XP_010433200.1|  PREDICTED: long-chain-alcohol oxidase FAO4B        469   4e-149   
emb|CDY51703.1|  BnaA03g58930D                                          469   4e-149   
ref|XP_010102592.1|  Long-chain-alcohol oxidase FAO1                    467   2e-148   
gb|EEC73620.1|  hypothetical protein OsI_08118                          468   3e-148   Oryza sativa Indica Group [Indian rice]
ref|XP_001753124.1|  predicted protein                                  464   6e-148   
ref|XP_002454188.1|  hypothetical protein SORBIDRAFT_04g026370          466   1e-147   Sorghum bicolor [broomcorn]
dbj|BAK02336.1|  predicted protein                                      464   3e-147   
ref|XP_007035186.1|  Alcohol oxidase, putative isoform 4                461   4e-147   
ref|XP_010548742.1|  PREDICTED: long-chain-alcohol oxidase FAO4B-...    462   1e-146   
ref|NP_001047464.1|  Os02g0621800                                       463   2e-146   Oryza sativa Japonica Group [Japonica rice]
gb|KEH23951.1|  long-chain-alcohol oxidase FAO1                         456   3e-146   
gb|AAP54248.2|  GMC oxidoreductase family protein, expressed            462   5e-146   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010438427.1|  PREDICTED: long-chain-alcohol oxidase FAO4B-...    461   5e-146   
ref|XP_010526493.1|  PREDICTED: long-chain-alcohol oxidase FAO4B-...    460   2e-145   
ref|XP_010447958.1|  PREDICTED: long-chain-alcohol oxidase FAO4B-...    459   2e-145   
ref|XP_004982883.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    457   3e-145   
ref|XP_004953134.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    459   7e-145   
gb|ACN27562.1|  unknown                                                 457   3e-144   Zea mays [maize]
ref|XP_006418179.1|  hypothetical protein EUTSA_v10006882mg             456   4e-144   
ref|XP_006306477.1|  hypothetical protein CARUB_v10012453mg             456   6e-144   
ref|NP_001148058.1|  oxidoreductase                                     455   2e-143   Zea mays [maize]
ref|XP_010475034.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    454   3e-143   
ref|XP_003575383.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    454   4e-143   
ref|XP_002454190.1|  hypothetical protein SORBIDRAFT_04g026390          454   7e-143   Sorghum bicolor [broomcorn]
ref|XP_003607676.1|  Annotation was added to scaffolds in Novembe...    446   3e-142   
gb|KHN30591.1|  Long-chain-alcohol oxidase FAO1                         447   5e-142   
gb|AAL31024.1|AC078948_8  putative alcohol oxidase                      451   6e-142   Oryza sativa [red rice]
ref|XP_006589282.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    447   6e-142   
ref|XP_004982885.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    449   9e-142   
gb|AAL31021.1|AC078948_5  putative alcohol oxidase                      444   1e-141   Oryza sativa [red rice]
emb|CDX89850.1|  BnaA10g02320D                                          449   1e-141   
ref|XP_009119340.1|  PREDICTED: long-chain-alcohol oxidase FAO1         449   2e-141   
gb|AAL31049.1|AC078893_12  putative oxidase                             443   3e-141   Oryza sativa [red rice]
ref|XP_002982582.1|  hypothetical protein SELMODRAFT_116855             445   4e-141   
ref|XP_002889487.1|  hypothetical protein ARALYDRAFT_470376             448   5e-141   
ref|XP_002994642.1|  hypothetical protein SELMODRAFT_138935             444   2e-140   
ref|XP_002981110.1|  hypothetical protein SELMODRAFT_114089             443   3e-140   
emb|CDY18199.1|  BnaC05g02220D                                          443   3e-139   
ref|XP_006412937.1|  hypothetical protein EUTSA_v10024496mg             435   7e-138   
ref|NP_171895.2|  long-chain-alcohol oxidase FAO1                       439   2e-137   Arabidopsis thaliana [mouse-ear cress]
gb|EEC67160.1|  hypothetical protein OsI_34014                          434   2e-136   Oryza sativa Indica Group [Indian rice]
ref|NP_001064839.2|  Os10g0474800                                       430   9e-136   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001761391.1|  predicted protein                                  431   4e-135   
gb|AAL31027.1|AC078948_11  putative alcohol oxidase                     427   3e-134   Oryza sativa [red rice]
tpg|DAA49654.1|  TPA: hypothetical protein ZEAMMB73_468308              425   3e-134   
ref|XP_002464494.1|  hypothetical protein SORBIDRAFT_01g019460          423   2e-133   Sorghum bicolor [broomcorn]
gb|EAY78905.1|  hypothetical protein OsI_34008                          422   3e-133   Oryza sativa Indica Group [Indian rice]
gb|KEH15695.1|  long-chain-alcohol oxidase FAO1                         421   8e-132   
gb|EMT04470.1|  Putative GMC-type oxidoreductase                        427   8e-132   
gb|KHG08529.1|  Long-chain-alcohol oxidase FAO2                         421   1e-131   
dbj|BAK00483.1|  predicted protein                                      412   4e-129   
gb|AAD10696.1|  Unknown protein                                         415   1e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010529119.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    412   2e-128   
ref|XP_006489751.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    406   4e-127   
ref|XP_003590828.1|  Annotation was added to scaffolds in Novembe...    402   1e-125   
gb|AES61079.2|  long-chain-alcohol oxidase FAO1-like protein            400   2e-125   
gb|KGN53994.1|  hypothetical protein Csa_4G246400                       393   1e-124   
ref|XP_010523169.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    402   2e-123   
ref|XP_003607656.1|  Annotation was added to scaffolds in Novembe...    395   7e-123   
gb|ACF88407.1|  unknown                                                 390   2e-122   
gb|ACF87929.1|  unknown                                                 386   4e-121   
tpg|DAA49655.1|  TPA: hypothetical protein ZEAMMB73_468308              383   4e-120   
gb|KFK42743.1|  hypothetical protein AALP_AA1G034000                    388   4e-119   
gb|EEE51130.1|  hypothetical protein OsJ_31873                          379   2e-116   
gb|ACR36076.1|  unknown                                                 370   7e-114   
gb|EEE51131.1|  hypothetical protein OsJ_31875                          372   1e-113   
ref|XP_010501308.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    374   6e-113   
ref|XP_006379996.1|  hypothetical protein POPTR_0008s18750g             350   2e-108   
gb|EEC67159.1|  hypothetical protein OsI_34012                          347   5e-103   
ref|XP_006662437.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    327   1e-97    
ref|XP_009831227.1|  hypothetical protein, variant 5                    326   1e-96    
ref|XP_009831229.1|  hypothetical protein, variant 1                    327   4e-95    
gb|EEE57396.1|  hypothetical protein OsJ_07570                          328   3e-93    
emb|CBI23676.3|  unnamed protein product                                314   2e-92    
ref|XP_009831226.1|  hypothetical protein, variant 4                    315   6e-92    
emb|CDX77517.1|  BnaA07g06550D                                          311   7e-92    
ref|XP_009831225.1|  hypothetical protein H257_07411                    315   1e-90    
ref|XP_004157702.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    300   1e-89    
ref|XP_005644346.1|  FAD/NAD(P)-binding domain-containing protein       305   1e-89    
gb|KFH71384.1|  hypothetical protein MVEG_01683                         310   2e-89    
ref|XP_005650828.1|  FAD/NAD(P)-binding domain-containing protein       305   2e-89    
ref|XP_008871235.1|  hypothetical protein H310_07607                    309   4e-89    
ref|XP_009831228.1|  hypothetical protein, variant 3                    308   1e-88    
ref|XP_009831231.1|  hypothetical protein H257_07412                    301   5e-86    
gb|EXX66452.1|  hypothetical protein RirG_123640                        301   1e-85    
ref|WP_007907865.1|  glucose-methanol-choline oxidoreductase            297   6e-85    
gb|EPB86823.1|  hypothetical protein HMPREF1544_06348                   296   1e-84    
gb|ESA06032.1|  hypothetical protein GLOINDRAFT_82554                   295   1e-84    
ref|XP_009831230.1|  hypothetical protein, variant 2                    295   4e-84    
emb|CDS08066.1|  hypothetical protein LRAMOSA02015                      291   8e-83    
emb|CEI89775.1|  hypothetical protein RMCBS344292_04123                 290   3e-82    
gb|EHA26798.1|  long chain fatty alcohol oxidase                        291   4e-82    
ref|XP_001389382.1|  long chain fatty alcohol oxidase                   291   4e-82    
ref|XP_001214264.1|  conserved hypothetical protein                     291   5e-82    
ref|XP_001268562.1|  long chain fatty alcohol oxidase, putative         291   5e-82    
emb|CEG67601.1|  hypothetical protein RMATCC62417_04004                 288   1e-81    
dbj|GAA82032.1|  long chain fatty alcohol oxidase                       289   2e-81    
gb|KDO33323.1|  hypothetical protein SPRG_02132                         288   4e-81    
emb|CEG74394.1|  hypothetical protein RMATCC62417_09621                 286   7e-81    
emb|CEJ01770.1|  hypothetical protein RMCBS344292_15791                 286   8e-81    
ref|XP_007680563.1|  hypothetical protein BAUCODRAFT_274597             286   1e-80    
ref|XP_008615139.1|  hypothetical protein SDRG_10901                    285   5e-80    
emb|CCD42906.1|  similar to long chain fatty alcohol oxidase            284   1e-79    
ref|XP_001554225.1|  hypothetical protein BC1G_07362                    283   3e-79    
gb|EMR84578.1|  putative long chain fatty alcohol protein               282   6e-79    
gb|KFZ00641.1|  hypothetical protein V501_10589                         285   1e-78    
ref|XP_753079.1|  long chain fatty alcohol oxidase                      281   2e-78    
gb|KEY78297.1|  long chain fatty alcohol oxidase                        280   3e-78    
gb|KFY64266.1|  hypothetical protein V496_03367                         278   8e-78    
gb|ELR10689.1|  hypothetical protein GMDG_04950                         277   2e-77    
gb|KGO74925.1|  Alcohol dehydrogenase, long-chain fatty                 278   2e-77    
gb|KGO40669.1|  Alcohol dehydrogenase, long-chain fatty                 277   3e-77    
ref|XP_001591990.1|  hypothetical protein SS1G_07437                    277   4e-77    
ref|XP_001264046.1|  long chain fatty alcohol oxidase, putative         276   6e-77    
gb|KFY48297.1|  hypothetical protein V495_01464                         276   6e-77    
gb|KFY79221.1|  hypothetical protein V499_01756                         279   8e-77    
ref|XP_001243546.1|  hypothetical protein CIMG_02987                    276   1e-76    
ref|XP_002569337.1|  Pc21g23700                                         275   1e-76    
emb|CDM31622.1|  Alcohol dehydrogenase, long-chain fatty                275   2e-76    
emb|CCT75976.1|  related to long chain fatty alcohol oxidase            274   3e-76    
gb|AHH21230.1|  glucose-methanol-choline (GMC) oxidoreductase fam...    272   3e-76    
gb|EKG12277.1|  Glucose-methanol-choline oxidoreductase                 274   6e-76    
ref|XP_007697741.1|  hypothetical protein COCSADRAFT_295770             273   1e-75    
ref|WP_029214956.1|  hypothetical protein                               270   2e-75    
gb|EFW14100.1|  long chain fatty alcohol oxidase                        272   3e-75    
ref|XP_003071927.1|  GMC oxidoreductase family protein                  271   4e-75    
ref|XP_004157399.1|  PREDICTED: LOW QUALITY PROTEIN: puromycin-se...    273   1e-74    
gb|EIE83566.1|  hypothetical protein RO3G_08271                         268   1e-74    
ref|XP_001821106.1|  long chain fatty alcohol oxidase                   270   2e-74    
ref|XP_007684042.1|  GMC oxidoreductase                                 270   2e-74    
gb|EWZ83069.1|  hypothetical protein FOWG_13006                         269   2e-74    
gb|ENH62892.1|  Long-chain-alcohol oxidase FAO2                         267   2e-74    
gb|EEH19591.1|  hypothetical protein PABG_07795                         270   2e-74    
gb|EGU81929.1|  hypothetical protein FOXB_07532                         268   3e-74    
ref|XP_658227.1|  hypothetical protein AN0623.2                         269   3e-74    
gb|EPB87889.1|  hypothetical protein HMPREF1544_05296                   268   4e-74    
gb|EIT74840.1|  choline dehydrogenase                                   269   4e-74    
gb|KFY98584.1|  hypothetical protein V500_01604                         272   4e-74    
ref|XP_010762144.1|  hypothetical protein PADG_06552                    268   5e-74    
dbj|GAM35263.1|  hypothetical protein TCE0_017r03459                    268   5e-74    
gb|EPB87888.1|  hypothetical protein HMPREF1544_05295                   267   5e-74    
gb|KFZ24759.1|  hypothetical protein V502_00763                         261   6e-74    
gb|KFY36052.1|  hypothetical protein V494_05366                         268   6e-74    
gb|EXA34422.1|  hypothetical protein FOVG_14401                         267   8e-74    
gb|KFY10153.1|  hypothetical protein V492_05166                         267   8e-74    
gb|EGD99881.1|  long chain fatty alcohol oxidase                        268   8e-74    
gb|EXK85609.1|  hypothetical protein FOQG_10402                         267   9e-74    
gb|EXM19432.1|  hypothetical protein FOTG_12485                         267   1e-73    
ref|XP_001940486.1|  long chain fatty alcohol oxidase                   267   1e-73    
ref|XP_003328562.1|  hypothetical protein PGTG_10521                    268   1e-73    
gb|EPS25096.1|  hypothetical protein PDE_00027                          267   1e-73    
gb|EXK25528.1|  hypothetical protein FOMG_17829                         266   1e-73    
ref|XP_002618046.1|  hypothetical protein CLUG_01505                    266   2e-73    
ref|XP_003231449.1|  long chain fatty alcohol oxidase                   263   2e-73    
ref|XP_002788971.1|  long chain fatty acid oxidase                      267   2e-73    
ref|XP_007373525.1|  fatty alcohol oxidase                              266   2e-73    
gb|EWZ33891.1|  hypothetical protein FOZG_13577                         266   2e-73    
ref|WP_039798089.1|  oxidoreductase                                     264   4e-73    
gb|EZF29717.1|  hypothetical protein H101_06625                         266   4e-73    
gb|EUN25552.1|  hypothetical protein COCVIDRAFT_39053                   265   6e-73    
gb|EMT74381.1|  Long-chain-alcohol oxidase FAO2                         264   6e-73    
ref|XP_008026917.1|  hypothetical protein SETTUDRAFT_20639              265   6e-73    
ref|XP_003011696.1|  hypothetical protein ARB_02250                     265   8e-73    
gb|EWY81831.1|  hypothetical protein FOYG_16040                         264   8e-73    
gb|EXL94556.1|  hypothetical protein FOIG_12751                         264   9e-73    
gb|KFY41130.1|  hypothetical protein V494_03193                         264   1e-72    
ref|XP_003298648.1|  hypothetical protein PTT_09421                     264   1e-72    
gb|EXL42725.1|  hypothetical protein FOCG_15170                         264   2e-72    
gb|EZF78359.1|  hypothetical protein H105_00612                         264   2e-72    
ref|XP_007706606.1|  hypothetical protein COCCADRAFT_81154              263   3e-72    
ref|WP_019946571.1|  hypothetical protein                               262   3e-72    
gb|EZF27387.1|  hypothetical protein H100_00625                         263   4e-72    
gb|EER37923.1|  long chain fatty acid oxidase                           261   4e-72    
ref|XP_002147053.1|  long chain fatty alcohol oxidase, putative         263   4e-72    
gb|EZG10707.1|  long chain fatty alcohol oxidase                        263   4e-72    
ref|WP_018162755.1|  hypothetical protein                               261   4e-72    
gb|KFY15271.1|  hypothetical protein V492_02111                         262   5e-72    
ref|XP_003869427.1|  hypothetical protein CORT_0D04520                  262   5e-72    
ref|XP_002543430.1|  conserved hypothetical protein                     256   6e-72    
gb|KFX48806.1|  Long-chain-alcohol oxidase FAO2                         263   6e-72    
gb|ENH81120.1|  long chain fatty alcohol oxidase                        263   6e-72    
emb|CDR40807.1|  RHTO0S05e07470g1_1                                     262   7e-72    
gb|EMS23820.1|  long chain fatty alcohol oxidase                        261   8e-72    
gb|EGU13115.1|  Long chain fatty alcohol oxidase                        261   8e-72    
ref|XP_003018036.1|  hypothetical protein TRV_07960                     262   1e-71    
ref|XP_004361070.1|  glucose-methanol-choline oxidoreductase            264   1e-71    
gb|KFY27803.1|  hypothetical protein V493_03299                         261   1e-71    
gb|EMD94921.1|  hypothetical protein COCHEDRAFT_1201414                 261   1e-71    
ref|XP_003654573.1|  hypothetical protein THITE_2117674                 262   1e-71    
ref|XP_007837981.1|  hypothetical protein PFICI_11209                   261   1e-71    
gb|EWG51602.1|  hypothetical protein FVEG_10526                         261   2e-71    
ref|XP_002479333.1|  long chain fatty alcohol oxidase, putative         266   2e-71    
gb|EFQ33355.1|  GMC oxidoreductase                                      261   3e-71    
ref|XP_006648845.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    258   4e-71    
ref|XP_007375878.1|  fatty alcohol oxidase                              259   5e-71    
ref|XP_007922551.1|  hypothetical protein MYCFIDRAFT_52380              260   7e-71    
ref|XP_008084965.1|  FAD/NAD(P)-binding protein                         259   7e-71    
gb|KFH47883.1|  Long-chain-alcohol oxidase-like protein                 259   9e-71    
gb|EMS51759.1|  Long-chain-alcohol oxidase FAO2                         253   9e-71    
gb|EEQ89581.1|  long chain fatty alcohol oxidase                        259   1e-70    
gb|KDN64457.1|  putative GMC oxidoreductase                             259   1e-70    
gb|EQB53611.1|  GMC oxidoreductase                                      259   2e-70    
gb|KFY31288.1|  hypothetical protein V493_01243                         258   2e-70    
gb|EME47783.1|  hypothetical protein DOTSEDRAFT_69651                   258   2e-70    
ref|XP_010038987.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    250   3e-70    
ref|XP_002842592.1|  long chain fatty acid oxidase                      258   3e-70    
ref|XP_001792978.1|  hypothetical protein SNOG_02371                    257   4e-70    
dbj|GAA98883.1|  hypothetical protein E5Q_05571                         258   4e-70    
ref|XP_007595248.1|  GMC oxidoreductase                                 258   4e-70    
ref|XP_006687527.1|  hypothetical protein CANTEDRAFT_108652             256   7e-70    
emb|CCE42800.1|  hypothetical protein CPAR2_204430                      255   1e-69    
ref|WP_027004897.1|  hypothetical protein                               254   1e-69    
gb|KFY68894.1|  hypothetical protein V496_00717                         256   1e-69    
ref|XP_001386087.1|  long chain fatty acid oxidase                      254   2e-69    
gb|KFY76557.1|  hypothetical protein V499_03848                         255   2e-69    
dbj|GAD98322.1|  hypothetical protein PVAR5_7014                        255   2e-69    
gb|KFY96639.1|  hypothetical protein V500_02373                         255   3e-69    
ref|WP_033245952.1|  oxidoreductase                                     252   4e-69    
emb|CCF43856.1|  GMC oxidoreductase                                     250   5e-69    
ref|XP_002622231.1|  long chain fatty alcohol oxidase                   254   6e-69    
ref|XP_006692351.1|  hypothetical protein CTHT_0018560                  254   1e-68    
gb|KFZ16786.1|  hypothetical protein V502_04902                         253   1e-68    
ref|WP_007506841.1|  oxidoreductase                                     251   1e-68    
gb|ESZ93853.1|  hypothetical protein SBOR_5750                          253   2e-68    
gb|EYE98796.1|  putative long chain fatty alcohol oxidase               253   2e-68    
gb|EGC44059.1|  long chain fatty acid oxidase                           252   2e-68    
gb|ELR05461.1|  hypothetical protein GMDG_01756                         252   2e-68    
ref|XP_003869426.1|  hypothetical protein CORT_0D04510                  251   2e-68    
gb|KFZ10506.1|  hypothetical protein V501_05178                         251   3e-68    
ref|XP_011124651.1|  hypothetical protein AOL_s00097g516                252   4e-68    
ref|XP_003171263.1|  fatty alcohol oxidase                              251   5e-68    
ref|XP_712386.1|  potential long chain fatty acid alcohol oxidase       251   5e-68    
ref|XP_712350.1|  potential long chain fatty acid alcohol oxidase       250   7e-68    
gb|KHC28526.1|  hypothetical protein MGQ_06035                          250   9e-68    
gb|AIZ62505.1|  hypothetical protein PK28_00185                         249   9e-68    
emb|CAB75353.1|  long chain fatty alcohol oxidase                       249   1e-67    
gb|EMS48507.1|  Long-chain-alcohol oxidase FAO1                         246   2e-67    
gb|KFY02756.1|  hypothetical protein O988_01934                         249   2e-67    
gb|KGU18308.1|  hypothetical protein MG7_05986                          248   3e-67    
gb|KGQ82028.1|  hypothetical protein MEO_06026                          248   3e-67    
gb|KGU00959.1|  hypothetical protein MEQ_06042                          248   3e-67    
ref|WP_036542894.1|  oxidoreductase                                     247   3e-67    
gb|AAS46880.1|  fatty alcohol oxidase                                   248   4e-67    
gb|KHC59946.1|  hypothetical protein MGI_06027                          248   5e-67    
ref|WP_032385620.1|  hypothetical protein                               247   5e-67    
ref|WP_035567966.1|  hypothetical protein                               247   7e-67    
gb|AAS46878.1|  fatty alcohol oxidase                                   247   7e-67    
gb|KGQ81126.1|  hypothetical protein MEU_06065                          247   7e-67    
ref|XP_002182547.1|  predicted protein                                  249   7e-67    
emb|CCE42799.1|  hypothetical protein CPAR2_204420                      247   8e-67    
ref|WP_039822949.1|  oxidoreductase                                     246   8e-67    
gb|KGT63535.1|  hypothetical protein MEK_06076                          247   9e-67    
ref|WP_033369528.1|  hypothetical protein                               246   1e-66    
dbj|GAM23381.1|  hypothetical protein SAMD00019534_065560               247   1e-66    
gb|KGU21594.1|  hypothetical protein MGM_06048                          246   1e-66    
ref|WP_011207508.1|  oxidoreductase                                     245   2e-66    
gb|EDK39369.2|  hypothetical protein PGUG_03467                         246   2e-66    
gb|EEQ43775.1|  hypothetical protein CAWG_02023                         246   2e-66    
gb|KFY45551.1|  hypothetical protein V495_02926                         246   2e-66    
gb|KGQ81329.1|  hypothetical protein MG1_06098                          246   2e-66    
gb|KGR00851.1|  hypothetical protein MG5_06042                          246   3e-66    
gb|KGR05615.1|  hypothetical protein MG9_06083                          245   3e-66    
gb|KGU01103.1|  hypothetical protein MEM_06199                          245   3e-66    
ref|WP_030525445.1|  oxidoreductase                                     244   3e-66    
gb|KHC28037.1|  hypothetical protein MGO_06014                          245   3e-66    
ref|WP_014985326.1|  oxidoreductase                                     244   3e-66    
ref|XP_002422236.1|  fatty alcohol oxidase, putative                    245   3e-66    
emb|CCX32413.1|  Similar to Long-chain-alcohol oxidase FAO1; acc....    245   4e-66    
ref|XP_001484086.1|  hypothetical protein PGUG_03467                    245   4e-66    
gb|EHL01767.1|  putative Long-chain-alcohol oxidase FAO2                245   5e-66    
gb|KGR01100.1|  hypothetical protein MG3_06097                          245   5e-66    
gb|KEQ64225.1|  long-chain fatty alcohol dehydrogenase                  246   6e-66    
ref|XP_001904377.1|  hypothetical protein                               245   6e-66    



>ref|XP_009626278.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Nicotiana tomentosiformis]
Length=773

 Score =   933 bits (2412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/766 (65%), Positives = 592/766 (77%), Gaps = 36/766 (5%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQ--HAAVDDDSVKLFFQTSASIAGTPQRVAWMISERL  294
             LS   M ++T+I DT LP++D     H    DD    F QTSAS+ GTPQ +AWMIS RL
Sbjct  29    LSSNQMDSLTAICDTILPSIDANSFYHQEAIDDPFTNFLQTSASMTGTPQHIAWMISNRL  88

Query  295   QHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYI  474
             QHPK+ L ++ALWLLSTRIGTL+LCGKASLSSQFPYLQSF  ISP+KR EIV SWS    
Sbjct  89    QHPKLNLCKIALWLLSTRIGTLILCGKASLSSQFPYLQSFSRISPNKREEIVLSWSTSCF  148

Query  475   KILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQH  654
             K+L+  +  +K++VLL FF+QVNE ++N SWKA+ Y GPDPD  K+  G           
Sbjct  149   KLLRILFSAIKILVLLVFFTQVNEKSQNPSWKALGYSGPDPDFKKQNQG-----------  197

Query  655   MTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQ---  825
                 ++Q++ EE         L GPL++G+I+L Q  +++ F+RLQK+GF VS       
Sbjct  198   ---PQDQEEEEE---------LFGPLYQGIISLKQS-QKKTFERLQKIGFSVSKPHNFNN  244

Query  826   -QKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegss  1002
              ++ +  P F IECDAVVVGSGSGGGVIAG+LA AGHKVLVLEKG Y AR++LSLLEG S
Sbjct  245   TRRSTECPDFTIECDAVVVGSGSGGGVIAGILAKAGHKVLVLEKGSYLARTNLSLLEGPS  304

Query  1003  lDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSK  1182
             +D+MYLG GL+ SKDMD++LLAGS VGGGSTINWSASIQTP HVLKEW E +KL+LF S+
Sbjct  305   MDQMYLGNGLLTSKDMDVMLLAGSTVGGGSTINWSASIQTPQHVLKEWSERYKLDLFQSE  364

Query  1183  EYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGC  1362
              Y+ A++ VC +MGVQSE+EDEGFQNM+LRKGC ELGY VETIPRNA  DHYCGWCS GC
Sbjct  365   FYKGALKVVCEKMGVQSEIEDEGFQNMILRKGCQELGYQVETIPRNAQSDHYCGWCSMGC  424

Query  1363  KDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKK---TGREQAAGVMFVYQN-NGA  1530
             KDGKKKGT+ETWL DLV SGNG IFPECEA++V+H KK   +G+ +A GV F +QN  G 
Sbjct  425   KDGKKKGTAETWLVDLVKSGNGAIFPECEALEVIHVKKNDNSGKSKAIGVAFAFQNGKGV  484

Query  1531  KEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSK--A  1704
             +E C VKS+VT++ACGAL TPSLLK SGL+NPNIGRNLHLHPVV AWGYFPD P      
Sbjct  485   REICMVKSKVTIVACGALSTPSLLKRSGLKNPNIGRNLHLHPVVIAWGYFPDTPSDSNVL  544

Query  1705  WPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQ  1884
             WPE +KKSY+GGIMTAMSKVVANFE SGYGA+IQTP LHPGMFSA+MPW+SG DIK RM 
Sbjct  545   WPEADKKSYEGGIMTAMSKVVANFEGSGYGAIIQTPGLHPGMFSALMPWVSGLDIKMRMC  604

Query  1885  RFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTC  2064
             ++SRTA + ALARDK SGEA SP+S++Y M + D+ +LK GLEK+LRILAAAGAEEIGT 
Sbjct  605   KYSRTAYILALARDKGSGEAFSPYSVTYKMDQIDEENLKLGLEKMLRILAAAGAEEIGTQ  664

Query  2065  HRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMG  2244
             H  G+ LK K AS  E + FV++ESS ++GN S  I SAHQMGSCRMGVDP +SVVN  G
Sbjct  665   HGKGRSLKVKDASLKEFERFVKEESSIEIGNHSVPICSAHQMGSCRMGVDPTTSVVNSKG  724

Query  2245  ETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTH  2382
             E WEVEGLFL DSSVFPTA+GVNPMVT+QAI+YCTAQSV++ LK  
Sbjct  725   ELWEVEGLFLGDSSVFPTAIGVNPMVTIQAISYCTAQSVVQLLKNQ  770



>ref|XP_009759689.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Nicotiana sylvestris]
Length=772

 Score =   920 bits (2377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/767 (65%), Positives = 585/767 (76%), Gaps = 39/767 (5%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVP---QHAAVDDDSVKLFFQTSASIAGTPQRVAWMISER  291
             LS   M ++T++ DT LP++D     Q+ A+DD     F QTSAS+ GTPQ +AWMIS R
Sbjct  29    LSSNQMDSLTALCDTILPSIDANSFYQNEAIDDPFTN-FLQTSASMTGTPQHIAWMISNR  87

Query  292   LQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCY  471
             L HPK+ L +LALWLLSTRIGTL+LCGKASLSSQFPYLQSF  ISP++R EIV SWS   
Sbjct  88    LHHPKLNLCKLALWLLSTRIGTLILCGKASLSSQFPYLQSFSRISPNQREEIVLSWSTSC  147

Query  472   IKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQ  651
              K+L+  +  +K++VLL FF+QVNE ++N SWKA+ Y GPDPD  K              
Sbjct  148   FKLLRILFSAIKILVLLVFFTQVNEKSQNPSWKALGYSGPDPDFKK--------------  193

Query  652   HMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSP----C  819
                    Q +G +D      E L GPL++G+I+L Q  +++ F+RLQKLGF VS      
Sbjct  194   -------QNQGVQD---QEEEQLFGPLYQGIISLKQS-QKKAFERLQKLGFSVSKPHNFN  242

Query  820   IQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegs  999
               ++ +  P+F IECDAVVVGSGSGGGVIAG+LA AGHKVLVLEKG Y AR++LSLLEG 
Sbjct  243   DTRRSTECPNFTIECDAVVVGSGSGGGVIAGILAKAGHKVLVLEKGSYLARTNLSLLEGP  302

Query  1000  slDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGS  1179
             S+D+MYLG GL+ SKDMDI+LLAGS VGGGSTINWSASIQTP HVLKEW E +KLELF S
Sbjct  303   SMDQMYLGNGLLTSKDMDIMLLAGSTVGGGSTINWSASIQTPQHVLKEWSEKYKLELFQS  362

Query  1180  KEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFG  1359
             + Y  A++ VC +MGVQSE+EDEGFQNM+LRKGC ELGY VETIPRNA  DHYCGWCS G
Sbjct  363   EFYEGALKVVCEKMGVQSEIEDEGFQNMILRKGCQELGYQVETIPRNAQSDHYCGWCSMG  422

Query  1360  CKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKK---TGREQAAGVMFVYQN-NG  1527
             CKDGKKKGT+ETWL DLV SGNG I PECEA++V+H KK   +G+ +A GV F +QN  G
Sbjct  423   CKDGKKKGTAETWLVDLVKSGNGAILPECEALEVIHVKKNDNSGKSKAIGVAFAFQNGKG  482

Query  1528  AKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPG--SK  1701
              +E C VKS+VT++ACGAL TPSLLK SGL+NPNIGRNLHLHPVV AWGYFPD P   + 
Sbjct  483   VREICMVKSKVTIVACGALSTPSLLKKSGLKNPNIGRNLHLHPVVIAWGYFPDTPSDCNV  542

Query  1702  AWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRM  1881
              WPE  KKSY+GGIMTAMSKVVANFE SGYGA+IQTP LHPGMFSA+MPW+SG DIK RM
Sbjct  543   LWPEANKKSYEGGIMTAMSKVVANFEGSGYGAIIQTPGLHPGMFSALMPWVSGLDIKMRM  602

Query  1882  QRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGT  2061
              ++SRTA L ALARD  SGEA SP+S++Y M + D+ +LK GLEK+LRILAAAGAE IGT
Sbjct  603   CKYSRTAYLLALARDMGSGEAFSPYSVTYKMDRIDEENLKLGLEKMLRILAAAGAEAIGT  662

Query  2062  CHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPM  2241
              H  G+ L  K  S  E + FV++ESS  +GN S  I SAHQMGSCRMG DP +SVVN  
Sbjct  663   QHGKGRSLNVKDESLKEFERFVKEESSIKIGNHSVPICSAHQMGSCRMGEDPTTSVVNSK  722

Query  2242  GETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTH  2382
             GETWEVEGLFL DSSVFPTA+GVNPMVT+QAI+YCTAQSVL+ LK  
Sbjct  723   GETWEVEGLFLGDSSVFPTAIGVNPMVTIQAISYCTAQSVLQLLKNQ  769



>ref|XP_004246021.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum lycopersicum]
Length=776

 Score =   910 bits (2351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/771 (63%), Positives = 589/771 (76%), Gaps = 40/771 (5%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVD-------VPQHAAVDDDSVKLFFQTSASIAGTPQRVAWM  279
             LS   + ++T++ DTF+P++          Q    DDDS   F QTSAS+ GTPQ +AWM
Sbjct  26    LSSNQLDSLTTLCDTFVPSIHDANSYGHQDQGNIDDDDSYAKFLQTSASMNGTPQHIAWM  85

Query  280   ISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW  459
             I+ RLQHPK+ L RLALWLLSTRIGT +LCGKASLS+QFPYLQ+F  ISP KR E V+SW
Sbjct  86    INNRLQHPKMNLCRLALWLLSTRIGTFILCGKASLSTQFPYLQTFSNISPKKREESVKSW  145

Query  460   SCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWI  639
             +    K+L+  +   K++VLL F++QVN+ N+N SWKA+ Y GPDPD  K+         
Sbjct  146   ATSCFKLLRILFFAAKILVLLVFYTQVNDENKNSSWKALGYSGPDPDFKKQ---------  196

Query  640   TREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPC  819
              ++++M     +KK ++           GPLH+G+I+L +  ++ +F RLQ+LGF VS  
Sbjct  197   -KQENMN---SKKKDDQP---------FGPLHEGIISL-KNSQKIIFHRLQELGFSVSKP  242

Query  820   IQ----QKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsl  987
                   ++ +  P+F+IECDAVVVGSGSGGGVIAG+LANAGHKV+VLEKG Y ARS+LSL
Sbjct  243   HNFNNARRSTECPAFIIECDAVVVGSGSGGGVIAGILANAGHKVIVLEKGSYLARSNLSL  302

Query  988   legsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLE  1167
             LEG S+D+MYLG GL+ ++DMD++LLAGS VGGGST+NWSASIQTP HVLKEW E++ L 
Sbjct  303   LEGPSMDQMYLGSGLLITQDMDVMLLAGSTVGGGSTVNWSASIQTPRHVLKEWSESYNLR  362

Query  1168  LFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGW  1347
             LF S+ Y+ AME VC +MGVQSE+EDEGFQNM+LRKGC ELGYPVETIP NA  DHYCGW
Sbjct  363   LFESELYKEAMEIVCEKMGVQSEIEDEGFQNMILRKGCQELGYPVETIPTNAPSDHYCGW  422

Query  1348  CSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKK---TGREQAAGVMFVYQ  1518
             CS GCKDGKKKGTSETWL DLV SGNG I PECEA++V+H +K   +G+ +A GV F +Q
Sbjct  423   CSMGCKDGKKKGTSETWLVDLVKSGNGAILPECEALEVIHEEKNGNSGKSKAIGVAFAFQ  482

Query  1519  N-NGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPG  1695
             N  G +E C VKS VT+IACGAL TPSLL  SGL+NPNIGRNLHLHPVV AWGYFPD+P 
Sbjct  483   NIEGMREICMVKSTVTIIACGALSTPSLLIKSGLKNPNIGRNLHLHPVVIAWGYFPDSPS  542

Query  1696  S--KAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDI  1869
             +  + WP+ EKKSY+GGIMTAMSKVVANFE SGYGA+IQTP LHPGMFSA+MPW+SG D 
Sbjct  543   NSNETWPKAEKKSYEGGIMTAMSKVVANFEGSGYGAVIQTPGLHPGMFSALMPWVSGLDF  602

Query  1870  KTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAE  2049
             K RM ++SRTA +FALARDK SGEA SP+S+SY + +TD+ +LK GLEK LRILAAAGAE
Sbjct  603   KMRMSKYSRTAYIFALARDKGSGEAFSPYSVSYKLDQTDEENLKAGLEKTLRILAAAGAE  662

Query  2050  EIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSV  2229
             EIGT    G+ LK   AS  E + FV +ESS ++G  S  I SAHQMGSCRMG DP++SV
Sbjct  663   EIGTQQEKGRSLKVNEASTKEFERFVREESSIEIGKHSVPICSAHQMGSCRMGTDPKTSV  722

Query  2230  VNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTH  2382
             VN  GETWEVEGLFL DSSV PTA+GVNPMVT+QAI+YCTAQSVL+ LK  
Sbjct  723   VNSKGETWEVEGLFLGDSSVCPTAIGVNPMVTIQAISYCTAQSVLQLLKNQ  773



>ref|XP_004244440.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum lycopersicum]
Length=774

 Score =   900 bits (2327),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 482/779 (62%), Positives = 593/779 (76%), Gaps = 27/779 (3%)
 Frame = +1

Query  73    GKAERGNDGVYSGGC-PLSPAVMATVTSISDTFLPAVDVPQ-HAAVDDDSVKLFFQTSAS  246
             G  E+  D    G    LS + M ++++I DTFLP++D    H    DDS+  F  TSAS
Sbjct  7     GNMEKVKDDAKKGHFGSLSFSQMDSLSAICDTFLPSIDTNSLHQENMDDSLIKFLHTSAS  66

Query  247   IAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEIS  426
             + GTPQ +AWM+SER+QHPK+ L +LALWLLSTRIGT +LCGKASLSSQFPYLQ+F  +S
Sbjct  67    MNGTPQHLAWMVSERIQHPKLNLCKLALWLLSTRIGTFILCGKASLSSQFPYLQNFSRVS  126

Query  427   PHKRAEIVRSWSCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSN  606
             P+KR EIV+SWSC   K++K  ++ +KV+ LL FF+QV+E  +N SWKA+ YCG DPD  
Sbjct  127   PNKREEIVQSWSCSNFKLIKLLFVALKVLTLLVFFTQVDEKGQNPSWKALGYCGQDPDFK  186

Query  607   KKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDR  786
             K+   K            ++ +Q K EE +     E L GPL+KG++ L Q P+  +F++
Sbjct  187   KQKQEK------------MNSKQSKHEE-LSDKRDEHLYGPLYKGILTLKQ-PQNALFNK  232

Query  787   LQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYF  966
             LQKLGF VS       S  PSF+IECDAVVVGSGSGGGVIAGVLANAGHKVLVLEKG Y 
Sbjct  233   LQKLGFHVSK--PNSSSNCPSFIIECDAVVVGSGSGGGVIAGVLANAGHKVLVLEKGSYL  290

Query  967   ARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEW  1146
             AR++LSLLEG S+D+M+LG GL+ +KDMD+ LLAGS VGGGSTINWSASI TP HVLKEW
Sbjct  291   ARTNLSLLEGPSMDQMFLGNGLMMTKDMDVFLLAGSTVGGGSTINWSASIDTPSHVLKEW  350

Query  1147  DETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNAS  1326
              + ++LELF S+ Y+ A+ET+  +MGVQ ++++EGFQNM+LRKGC ELGY VE IPRNA 
Sbjct  351   CDIYELELFQSEFYKEALETIREKMGVQDKIDEEGFQNMILRKGCEELGYNVENIPRNAH  410

Query  1327  RDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTG--REQAAG  1500
              +HYCGWCS GCKDG KKGT+ETWL DLV SGNG I  ECEA++V+H  K    + +A G
Sbjct  411   SNHYCGWCSMGCKDGSKKGTNETWLVDLVKSGNGAIIQECEALEVIHEHKNNYNKSKAIG  470

Query  1501  VMFVYQ-NNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGY  1677
             V   +Q +NG KE   VKS+VT++ACGAL TPSLLK SGL+NPNIG+NLH+HPVVFAWG+
Sbjct  471   VACEFQHDNGVKEIFMVKSKVTIVACGALSTPSLLKRSGLKNPNIGKNLHVHPVVFAWGH  530

Query  1678  FPDA------PGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSA  1839
             FPD         S+ WPE +KKSY+GGIM+ MSKVVAN EE GYG +IQTP+LHPGMFS 
Sbjct  531   FPDTNSTDNVKNSEVWPESDKKSYEGGIMSVMSKVVANTEEPGYGVVIQTPALHPGMFSV  590

Query  1840  IMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKV  2019
             +MPW+SG DIK RM ++SRTA +FALARDK SGE  SP+SISY + + D+ +LK G+EK+
Sbjct  591   VMPWISGLDIKMRMCKYSRTAHIFALARDKGSGETVSPYSISYKLDQIDEQNLKVGIEKL  650

Query  2020  LRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSC  2199
             LRILAAAGAEEIGT H  G+  K K +S DE + FV++ESSR L NLST I SAHQMGSC
Sbjct  651   LRILAAAGAEEIGTHHVKGRKFKVKESSVDEFESFVKEESSRGLKNLSTPICSAHQMGSC  710

Query  2200  RMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             RMG+DP+ SVVNP GETWEVE LF+ D+SVFPTALGVNPM+TVQAI+YCTAQ+VL+ LK
Sbjct  711   RMGIDPKISVVNPKGETWEVEDLFIGDTSVFPTALGVNPMLTVQAISYCTAQNVLQLLK  769



>gb|AGK82806.1| alcohol oxidase [Solanum lycopersicum]
Length=746

 Score =   899 bits (2322),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 476/757 (63%), Positives = 585/757 (77%), Gaps = 26/757 (3%)
 Frame = +1

Query  136   MATVTSISDTFLPAVDVPQ-HAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVI  312
             M ++++I DTFLP++D    H    DDS+  F  TSAS+ GTPQ +AWM+SER+QHPK+ 
Sbjct  1     MDSLSAICDTFLPSIDTNSLHQENMDDSLIKFLHTSASMNGTPQHLAWMVSERIQHPKLN  60

Query  313   llrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTF  492
             L +LALWLLSTRIGT +LCGKASLSSQFPYLQ+F  +SP+KR EIV+SWSC   K++K  
Sbjct  61    LCKLALWLLSTRIGTFILCGKASLSSQFPYLQNFSRVSPNKREEIVQSWSCSNFKLIKLL  120

Query  493   YLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEE  672
             ++ +KV+ LL FF+QV+E  +N SWKA+ YCG DPD  K+   K            ++ +
Sbjct  121   FVALKVLTLLVFFTQVDEKGQNPSWKALGYCGQDPDFKKQKQEK------------MNSK  168

Query  673   QKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSF  852
             Q K EE +     E L GPL+KG++ L Q P+  +F++LQKLGF VS       S  PSF
Sbjct  169   QSKHEE-LSDKRDEHLYGPLYKGILTLKQ-PQNALFNKLQKLGFHVSK--PNSSSNCPSF  224

Query  853   VIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGL  1032
             +IECDAVVVGSGSGGGVIAGVLANAGHKVLVLEKG Y AR++LSLLEG S+D+M+LG GL
Sbjct  225   IIECDAVVVGSGSGGGVIAGVLANAGHKVLVLEKGSYLARTNLSLLEGPSMDQMFLGNGL  284

Query  1033  VASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVC  1212
             + +KDMD+ LLAGS VGGGSTINWSASI TP HVLKEW + ++LELF S+ Y+ A+ET+ 
Sbjct  285   MMTKDMDVFLLAGSTVGGGSTINWSASIDTPSHVLKEWCDIYELELFQSEFYKEALETIR  344

Query  1213  SRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSE  1392
              +MGVQ ++++EGFQNM+LRKGC ELGY VE IPRNA  +HYCGWCS GCKDG KKGT+E
Sbjct  345   EKMGVQDKIDEEGFQNMILRKGCEELGYNVENIPRNAHSNHYCGWCSMGCKDGSKKGTNE  404

Query  1393  TWLADLVDSGNGVIFPECEAVKVVHNKKTG--REQAAGVMFVYQ-NNGAKEFCFVKSRVT  1563
             TWL DLV SGNG I  ECEA++V+H  K    + +A GV   +Q +NG KE   VKS+VT
Sbjct  405   TWLVDLVKSGNGAIIQECEALEVIHEHKNNYNKSKAIGVACEFQHDNGVKEIFMVKSKVT  464

Query  1564  VIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDA------PGSKAWPEPEKK  1725
             ++ACGAL TPSLLK SGL+NPNIG+NLH+HPVVFAWG+FPD         S+ WPE +KK
Sbjct  465   IVACGALSTPSLLKRSGLKNPNIGKNLHVHPVVFAWGHFPDTNSTDNVKNSEVWPESDKK  524

Query  1726  SYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAI  1905
             SY+GGIM+ MSKVVAN EE GYG +IQTP+LHPGMFS +MPW+SG DIK RM ++SRTA 
Sbjct  525   SYEGGIMSVMSKVVANTEEPGYGVVIQTPALHPGMFSVVMPWISGLDIKMRMCKYSRTAH  584

Query  1906  LFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKIL  2085
             +FALARDK SGE  SP+SISY + + D+ +LK G+EK+LRILAAAGAEEIGT H  G+  
Sbjct  585   IFALARDKGSGETVSPYSISYKLDQIDEQNLKVGIEKLLRILAAAGAEEIGTHHVKGRKF  644

Query  2086  KPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEG  2265
             K K +S DE + FV++ESSR L NLST I SAHQMGSCRMG+DP+ SVVNP GETWEVE 
Sbjct  645   KVKESSVDEFESFVKEESSRGLKNLSTPICSAHQMGSCRMGIDPKISVVNPKGETWEVED  704

Query  2266  LFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             LF+ D+SVFPTALGVNPM+TVQAI+YCTAQ+VL+ LK
Sbjct  705   LFIGDTSVFPTALGVNPMLTVQAISYCTAQNVLQLLK  741



>gb|AGK82821.1| alcohol oxidase [Solanum pimpinellifolium]
Length=746

 Score =   897 bits (2319),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/757 (63%), Positives = 585/757 (77%), Gaps = 26/757 (3%)
 Frame = +1

Query  136   MATVTSISDTFLPAVDVPQ-HAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVI  312
             M ++T+I DTFLP++D    H    DDS+  F  TSAS+  TPQ +AWM+SER+QHPK+ 
Sbjct  1     MDSLTAICDTFLPSIDTNSLHQENMDDSLIKFLHTSASMNETPQHLAWMVSERIQHPKLN  60

Query  313   llrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTF  492
             L +LALWLLSTRIGT +LCGKASLSSQFPYLQ+F ++SP+KR EIV+SWSC   K++K  
Sbjct  61    LCKLALWLLSTRIGTFILCGKASLSSQFPYLQNFSKVSPNKREEIVQSWSCSNFKLIKLL  120

Query  493   YLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEE  672
             ++ +KV+ LL FF+QV+E  +N SWKA+ YCG DPD  K+   K            ++ +
Sbjct  121   FVALKVLTLLVFFTQVDEKGQNPSWKALGYCGQDPDFKKQKQEK------------MNSK  168

Query  673   QKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSF  852
             Q K EE +     E L GPL+KG++ L Q P+  +F++LQKLGF VS       S  PSF
Sbjct  169   QSKHEE-LSDKRDEHLYGPLYKGILTLKQ-PQNALFNKLQKLGFHVSK--PNSSSNCPSF  224

Query  853   VIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGL  1032
             +IECDAVVVGSGSGGGVIAGVLANAGHKVLVLEKG Y AR++LSLLEG S+D+M+LG GL
Sbjct  225   IIECDAVVVGSGSGGGVIAGVLANAGHKVLVLEKGSYLARTNLSLLEGPSMDQMFLGNGL  284

Query  1033  VASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVC  1212
             + +KDMD+ LLAGS VGGGSTINWSASI TP HVLKEW + + LELF S+ Y+ A+ET+ 
Sbjct  285   MMTKDMDVFLLAGSTVGGGSTINWSASIDTPSHVLKEWCDIYNLELFQSEFYKEALETIR  344

Query  1213  SRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSE  1392
              +MGVQ ++++EGFQNM+LRKGC ELGY VE IPRNA  +HYCGWCS GCKDG KKGT+E
Sbjct  345   EKMGVQDKIDEEGFQNMILRKGCEELGYNVENIPRNAHSNHYCGWCSMGCKDGSKKGTNE  404

Query  1393  TWLADLVDSGNGVIFPECEAVKVVHNKKTG--REQAAGVMFVYQ-NNGAKEFCFVKSRVT  1563
             TWL DLV SGNG I  ECEA++V+H  K    + +A GV   +Q ++G KE   VKS+VT
Sbjct  405   TWLVDLVKSGNGAIIQECEALEVIHEHKNNYNKSKAIGVACEFQHDDGVKEIFMVKSKVT  464

Query  1564  VIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDA------PGSKAWPEPEKK  1725
             ++ACGAL TPSLLK SGL+NPNIG+NLH+HPVVFAWG+FPD         S+ WPE +KK
Sbjct  465   IVACGALSTPSLLKRSGLKNPNIGKNLHVHPVVFAWGHFPDTNSTDNVKNSEVWPESDKK  524

Query  1726  SYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAI  1905
             SY+GGIM+AMSKVVAN EE GYG +IQTPSLHPGMFS +MPW+SG DIK RM ++SRTA 
Sbjct  525   SYEGGIMSAMSKVVANTEEPGYGVVIQTPSLHPGMFSVVMPWISGLDIKMRMCKYSRTAH  584

Query  1906  LFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKIL  2085
             +FALARDK SGE  SP+SISY + + D+ +LK G+EK+LRILAAAGAEEIGT H  G+  
Sbjct  585   IFALARDKGSGETVSPYSISYKLDQIDEQNLKVGIEKLLRILAAAGAEEIGTHHVKGRKF  644

Query  2086  KPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEG  2265
             K K +S DE + FV++ESSR L NLST I SAHQMGSCRMG+DP+ SVVNP GETWEVE 
Sbjct  645   KVKESSVDEFESFVKEESSRGLKNLSTPICSAHQMGSCRMGIDPKISVVNPKGETWEVED  704

Query  2266  LFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             LF+ D+SVFPTALGVNPM+TVQAI+YCTAQ+VL+ LK
Sbjct  705   LFIGDTSVFPTALGVNPMLTVQAISYCTAQNVLQLLK  741



>emb|CDP07225.1| unnamed protein product [Coffea canephora]
Length=829

 Score =   895 bits (2314),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/759 (62%), Positives = 586/759 (77%), Gaps = 21/759 (3%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
             LS   M ++ ++ DT+LP++D        D+S   F+QTSAS+AGTPQR+  +ISERLQH
Sbjct  47    LSSRQMESLKALCDTYLPSID--GFHTKHDESTARFYQTSASVAGTPQRLGGLISERLQH  104

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  480
             PK+ + RLALW LST IGT  +CG ASLS  FPYLQ F ++SP KR +IV SWS   I  
Sbjct  105   PKLFMARLALWFLSTSIGTFAMCGIASLSGNFPYLQKFSQVSPEKREQIVLSWSRSIIFP  164

Query  481   LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMT  660
             L+  +  +KV++LL FFSQV++  EN+SWKAI YCGPDPD  ++    +++  T +Q   
Sbjct  165   LRLLFTALKVLILLVFFSQVDDKEENLSWKAIGYCGPDPDFKRQ----TQRIKTLKQMFE  220

Query  661   LSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGS-  837
              +E+QK+ E      + E L GPL+KG++NL++ P++ VF++LQ  GF VS     K + 
Sbjct  221   SAEDQKQDE-----ASAEELFGPLYKGIVNLDR-PKQFVFEKLQNAGFSVSASSHLKNAK  274

Query  838   ---GNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslD  1008
                  PSF I+CDAVVVGSGSGGGV+AG+LA AG+K LVLEKG YFAR++LSLLEGS++D
Sbjct  275   SKYNRPSFRIKCDAVVVGSGSGGGVVAGILAKAGYKTLVLEKGNYFARTNLSLLEGSTMD  334

Query  1009  EMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEY  1188
             +MYLG G +A++ MD++ LAGS VGGGS +NWS+SI+TPPHV+KEW E+++LELF SK Y
Sbjct  335   QMYLGSGFMATEKMDVIFLAGSTVGGGSAVNWSSSIRTPPHVIKEWSESYELELFDSKLY  394

Query  1189  RHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKD  1368
               A++ VC +MGVQSE+E+EGF NMVLRKGC ELGYPV TIPRNA+ DHYCGWC FGCKD
Sbjct  395   EEALDAVCQKMGVQSEIENEGFNNMVLRKGCEELGYPVNTIPRNATADHYCGWCCFGCKD  454

Query  1369  GKKKGTSETWLADLVDSGNGVIFPECEAVKVVH---NKKTGREQAAGVMFVYQNNGAKEF  1539
             G+KKGT ETWL DL++SGNG+I PEC+A++V+H   NKK GR  A GV F +QN G +E 
Sbjct  455   GRKKGTLETWLVDLLNSGNGLILPECKAIRVLHKRKNKKKGR-HAVGVAFKFQNQGVEEI  513

Query  1540  CFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPE  1719
               V+S+VT++ACGAL TP LL  SGL+NPNIG++LH+HPV  AWGYFPD      WPE E
Sbjct  514   GIVESKVTIVACGALSTPELLIKSGLKNPNIGKHLHIHPVAMAWGYFPDTT-PDPWPEAE  572

Query  1720  KKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRT  1899
             KKSY+GGIMTAMS VVANFE SGYGA+IQTP+LHPGMFSA+MPW SG D K RM +FSRT
Sbjct  573   KKSYEGGIMTAMSTVVANFEGSGYGAVIQTPALHPGMFSALMPWTSGRDFKDRMCKFSRT  632

Query  1900  AILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGK  2079
             A +FALARDK SG+   P SI+YNM K D+ ++K GLEKVLRILA+AGAEEIGT H  G+
Sbjct  633   AHVFALARDKGSGKLLYPNSITYNMDKIDEENIKRGLEKVLRILASAGAEEIGTHHVKGR  692

Query  2080  ILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEV  2259
              +  K  S  E D+FV++ESSR L +L+T I SAHQMGSCRMGVDP+ SV NP+GETWE+
Sbjct  693   SINVKKVSYTEFDKFVKEESSRSLKDLATPICSAHQMGSCRMGVDPKISVANPIGETWEI  752

Query  2260  EGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             EGL+LADSSVFPTALGVNPMVTVQAIAYCTAQSVL+ L+
Sbjct  753   EGLYLADSSVFPTALGVNPMVTVQAIAYCTAQSVLESLR  791



>gb|AGK82832.1| alcohol oxidase [Solanum habrochaites]
Length=746

 Score =   895 bits (2313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/760 (63%), Positives = 585/760 (77%), Gaps = 26/760 (3%)
 Frame = +1

Query  136   MATVTSISDTFLPAVDVPQ-HAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVI  312
             M ++++I DTFLP++D    H    DDS+  F  TSAS+ GTPQ +AWM+SER+QHPK+ 
Sbjct  1     MDSLSAICDTFLPSIDTNSLHQENMDDSLIKFLHTSASMNGTPQHLAWMVSERIQHPKLN  60

Query  313   llrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTF  492
             L +LALWLLSTRIGT +LCGKASLSSQFPYLQ+F  +SP+KR EIV+SWSC   K++K  
Sbjct  61    LCKLALWLLSTRIGTFILCGKASLSSQFPYLQNFSRVSPNKREEIVQSWSCSNFKLIKLL  120

Query  493   YLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEE  672
             ++ +KV+ LL FF+QV+E  +N SWKA+ YCG DPD  K+   K            ++ +
Sbjct  121   FVALKVLTLLVFFTQVDEKGQNPSWKALGYCGQDPDFKKQKQEK------------MNSK  168

Query  673   QKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSF  852
             Q K EE       E L GPL+KG++ L Q P+  +F++LQKLGF VS       S  PSF
Sbjct  169   QSKHEE-FSDKRDEHLYGPLYKGILTLKQ-PQNALFNKLQKLGFHVSK--PNSSSNCPSF  224

Query  853   VIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGL  1032
             +IECDAVVVGSGSGGGVIAGVLANAGHKVLVLEKG Y AR++LSLLEG S+D+M+LG GL
Sbjct  225   IIECDAVVVGSGSGGGVIAGVLANAGHKVLVLEKGSYLARTNLSLLEGPSMDQMFLGNGL  284

Query  1033  VASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVC  1212
             + +KDMD+ LLAGS VGGGSTINWSASI TP HVLKEW + ++LELF S+ Y+ A+ET+ 
Sbjct  285   MMTKDMDVFLLAGSTVGGGSTINWSASIDTPSHVLKEWCDIYELELFQSEFYKEALETIR  344

Query  1213  SRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSE  1392
              +MGVQ ++++EGFQNM+LRKGC ELGY VE IPRNA  +HYCGWCS GCKDG KKGT+E
Sbjct  345   KKMGVQDKIDEEGFQNMILRKGCEELGYNVENIPRNAHSNHYCGWCSMGCKDGSKKGTNE  404

Query  1393  TWLADLVDSGNGVIFPECEAVKVVHNKKTG--REQAAGVMFVYQ-NNGAKEFCFVKSRVT  1563
             TWL DLV SGNG I  ECEA++V+H  K    + +A GV   +Q ++G KE   V+S+VT
Sbjct  405   TWLVDLVKSGNGAIIQECEALEVIHEHKNNYNKSKAIGVACEFQHDDGVKEIFMVRSKVT  464

Query  1564  VIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGS------KAWPEPEKK  1725
             ++ACGAL TPSLLK SGL+NPNIG+NLH+HPVVFAWG+FPD   +      + WPE EKK
Sbjct  465   IVACGALSTPSLLKRSGLKNPNIGKNLHVHPVVFAWGHFPDTDSTDNVKNFEVWPESEKK  524

Query  1726  SYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAI  1905
             SY+GGIM+ MSKVVAN EE GYG +IQTPSLHPGMFS +MPW+SG DIK RM ++SRTA 
Sbjct  525   SYEGGIMSVMSKVVANTEEPGYGVVIQTPSLHPGMFSVVMPWISGLDIKMRMCKYSRTAH  584

Query  1906  LFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKIL  2085
             +FALARDK SGE  SP+SISY + + D+ +LK G+EK+LRILAAAGAEEIGT H  G+  
Sbjct  585   IFALARDKGSGETVSPYSISYKLDQIDEQNLKVGIEKLLRILAAAGAEEIGTHHVKGRKF  644

Query  2086  KPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEG  2265
             K K +S DE + FV++ESSR L +LST I SAHQMGSCRMG+DP+ SVVNP GETWEVE 
Sbjct  645   KVKESSVDEFESFVKEESSRGLKDLSTPICSAHQMGSCRMGIDPKISVVNPKGETWEVED  704

Query  2266  LFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHN  2385
             LF+ D+SVFPTALGVNPM+TVQAI+YCTAQ+VL+ LK  N
Sbjct  705   LFIGDTSVFPTALGVNPMLTVQAISYCTAQNVLQLLKAKN  744



>ref|XP_006361221.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum tuberosum]
Length=745

 Score =   893 bits (2308),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/756 (63%), Positives = 582/756 (77%), Gaps = 25/756 (3%)
 Frame = +1

Query  136   MATVTSISDTFLPAVDVPQ-HAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVI  312
             M ++++I DTFLP++D    H    DDSV  F  TSAS+ GTPQ +AWM+SER+QHPK+ 
Sbjct  1     MDSLSAICDTFLPSIDTNSLHQENMDDSVIKFLHTSASMNGTPQHLAWMVSERIQHPKLN  60

Query  313   llrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTF  492
             L +LALWLLSTRIGT +LCGKASLSSQFPYLQ+F  +SP+KR EIV+SWSC   K++K  
Sbjct  61    LCKLALWLLSTRIGTFILCGKASLSSQFPYLQNFSRVSPNKREEIVQSWSCSNFKLIKLL  120

Query  493   YLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEE  672
             ++ +KV+ LL FF+QV+E  +N SWKA+ YCG DPD  KKP           +   ++ +
Sbjct  121   FVALKVLTLLVFFTQVDEKCQNPSWKALGYCGQDPDF-KKP-----------KQEKMNSK  168

Query  673   QKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSF  852
             Q K EE       E L GPL+KG+I L Q P+  +F++LQKLGF VS       S  PSF
Sbjct  169   QSKHEE-FSDKRDEHLYGPLYKGIITLKQ-PQNALFNKLQKLGFHVSK--PNSSSNCPSF  224

Query  853   VIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGL  1032
             +IECDAVVVGSGSGGGVIAGVLANAGHKVLVLEKG Y AR++LSLLEG SLD+M+LG GL
Sbjct  225   IIECDAVVVGSGSGGGVIAGVLANAGHKVLVLEKGSYLARTNLSLLEGPSLDQMFLGNGL  284

Query  1033  VASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVC  1212
             + +KDM++ LLAGS VGGGSTINWSASI TP HVLKEW   ++LE+F S+ Y+ A+E + 
Sbjct  285   MMTKDMEVFLLAGSTVGGGSTINWSASIDTPSHVLKEWCGIYELEMFQSESYKEALEAIR  344

Query  1213  SRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSE  1392
              +MGVQ ++++EGFQNM+LRKGC ELGY VE IPRNA  +H CGWCS GCKDG KKGT+E
Sbjct  345   EKMGVQDKIDEEGFQNMILRKGCEELGYHVENIPRNAPSNHNCGWCSMGCKDGSKKGTNE  404

Query  1393  TWLADLVDSGNGVIFPECEAVKVVHNKKTG--REQAAGVMFVYQNNGAKEFCFVKSRVTV  1566
             TWL DLV SGNG I  ECEA++V+H  K    + +A GV   +Q+ G KE   VKS+VT+
Sbjct  405   TWLVDLVKSGNGAIIQECEALEVIHEHKNNYNKSKAIGVACEFQHEGVKEIFMVKSKVTI  464

Query  1567  IACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGS------KAWPEPEKKS  1728
             +ACGAL TPSLLK SGL+NPNIG+NLH+HPVVFAWG+FPD   S      + WPE +KKS
Sbjct  465   VACGALSTPSLLKRSGLKNPNIGKNLHVHPVVFAWGHFPDTNSSDNVKNFEVWPESKKKS  524

Query  1729  YQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAIL  1908
             Y+GGIM+ MSKVVANFEESGYG +IQTP+LHPGMFS +MPW+SG DIK RM ++SRTA +
Sbjct  525   YEGGIMSVMSKVVANFEESGYGVVIQTPALHPGMFSVVMPWISGLDIKMRMCKYSRTAHI  584

Query  1909  FALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILK  2088
             FALARDK SGEA S  SISY + + D+ +LK G+EK+LRILAAAGAEEIGT H  GK LK
Sbjct  585   FALARDKGSGEAISSNSISYKLDQIDEQNLKVGIEKLLRILAAAGAEEIGTHHVKGKTLK  644

Query  2089  PKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  2268
              K +S DE + FV++ESSR   NLST I SAHQMGSCRMG+DP+ SVVNP GETWEVE L
Sbjct  645   VKESSVDEFESFVKEESSRGFKNLSTPICSAHQMGSCRMGIDPKISVVNPKGETWEVEDL  704

Query  2269  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             F+ D+SVFPTALGVNPMVTVQAI+YCTAQ+VL+ LK
Sbjct  705   FIGDTSVFPTALGVNPMVTVQAISYCTAQNVLQVLK  740



>gb|AGK82825.1| alcohol oxidase [Solanum pennellii]
Length=746

 Score =   892 bits (2306),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/757 (62%), Positives = 584/757 (77%), Gaps = 26/757 (3%)
 Frame = +1

Query  136   MATVTSISDTFLPAVDVPQ-HAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVI  312
             M ++++I DTFLP++D    H    DDS+  F  TSAS+ GTPQ +AWM+SER+QHPK+ 
Sbjct  1     MDSLSAICDTFLPSIDTNSLHQENMDDSLIKFLHTSASMNGTPQHLAWMLSERIQHPKLN  60

Query  313   llrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTF  492
             L +LALWLLSTRIGT +LCGKASLSSQFPYLQ+F  +SP+KR EIV+SWSC  +K +K  
Sbjct  61    LCKLALWLLSTRIGTFILCGKASLSSQFPYLQNFSRVSPNKREEIVQSWSCSNLKFIKLL  120

Query  493   YLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEE  672
             ++ +KV+ LL FF+QVNE  +N SWKA+ YCG DPD  K+   K            ++ +
Sbjct  121   FVALKVLTLLVFFTQVNEKGQNPSWKALGYCGQDPDFKKQKQEK------------MNSK  168

Query  673   QKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSF  852
             Q K EE       E L GPL+KG++ L Q P+  +F++LQKLGF VS       S  PSF
Sbjct  169   QSKHEE-FSDKRDEHLYGPLYKGILTLKQ-PQNALFNKLQKLGFHVSK--PNSSSNCPSF  224

Query  853   VIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGL  1032
             +IECDAVVVGSGSGGGVIAGVLANAGHKVLVLEKG Y AR++LSLLEG S+D+M+LG GL
Sbjct  225   IIECDAVVVGSGSGGGVIAGVLANAGHKVLVLEKGSYLARTNLSLLEGPSMDQMFLGNGL  284

Query  1033  VASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVC  1212
             + +KDMD+ LLAGS VGGGSTINWSASI TP HVLKEW + ++LELF S+ Y+ A+ET+ 
Sbjct  285   MMTKDMDVFLLAGSTVGGGSTINWSASIDTPSHVLKEWCDIYELELFQSEFYKEALETIR  344

Query  1213  SRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSE  1392
              +MGVQ ++++EGFQNM+LRKGC ELGY VE IPRNA  +HYCGWCS GCKDG KKGT+E
Sbjct  345   EKMGVQDKIDEEGFQNMILRKGCEELGYNVENIPRNAHSNHYCGWCSMGCKDGSKKGTNE  404

Query  1393  TWLADLVDSGNGVIFPECEAVKVVHNKKTG--REQAAGVMFVYQ-NNGAKEFCFVKSRVT  1563
             TWL DLV SGNG I  ECEA++V+H  K    + +A GV   +Q ++G KE   V+S+VT
Sbjct  405   TWLVDLVKSGNGAIIQECEALEVIHEHKNNYNKSKAIGVACEFQHDDGVKEIFMVRSKVT  464

Query  1564  VIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGS------KAWPEPEKK  1725
             ++ACGAL TPSLLK SGL+NPNIG+NLH+HPVVFAWG+FPD   +      + WPE +KK
Sbjct  465   IVACGALSTPSLLKRSGLKNPNIGKNLHVHPVVFAWGHFPDTDSTDNVKNFEVWPESDKK  524

Query  1726  SYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAI  1905
             SY+GGIM+ MSKVVAN EE GYG +IQTPSLHPGMFS +MPW+SG DIK RM ++SRTA 
Sbjct  525   SYEGGIMSVMSKVVANTEEPGYGVVIQTPSLHPGMFSVVMPWISGLDIKMRMCKYSRTAH  584

Query  1906  LFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKIL  2085
             +FALARDK SGE  SP+SISY + + D+ ++K G+EK+LRILAAAGAEEIGT H  G+  
Sbjct  585   IFALARDKGSGETVSPYSISYKLDQIDEQNIKVGIEKLLRILAAAGAEEIGTHHVKGRKF  644

Query  2086  KPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEG  2265
             K K +S DE + FV++ESSR L +LST I SAHQMGSCRMG+DP+ SVVNP GETWEVE 
Sbjct  645   KVKESSVDEFESFVKEESSRGLKDLSTPICSAHQMGSCRMGIDPKISVVNPKGETWEVED  704

Query  2266  LFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             LF+ D+SVFPTALGVNPM+TVQAI+YCTAQ+VL+ LK
Sbjct  705   LFIGDTSVFPTALGVNPMLTVQAISYCTAQNVLQLLK  741



>ref|XP_006359947.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum tuberosum]
Length=702

 Score =   890 bits (2299),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/720 (65%), Positives = 561/720 (78%), Gaps = 33/720 (5%)
 Frame = +1

Query  253   GTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPH  432
             GTPQ +AWMI+ RLQHPK+ L +LALWLLSTRIGT +LCGKASLS+QFPYLQ+F  ISP 
Sbjct  3     GTPQHIAWMINNRLQHPKMNLCKLALWLLSTRIGTFILCGKASLSTQFPYLQTFSNISPK  62

Query  433   KRAEIVRSWSCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKK  612
             KR E V+SW+    K+L+  +   K++VLL F++QVN+ ++N SWKA+ Y GPDPD  K+
Sbjct  63    KREESVKSWATSCFKLLRILFFAAKILVLLVFYTQVNDESQNSSWKALGYSGPDPDFKKQ  122

Query  613   PAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQ  792
                               E     E+D  P       GPL++G+I+L +  ++ +F RLQ
Sbjct  123   K----------------QENMNSNEKDDQP------FGPLYEGIISL-KNSQKIIFHRLQ  159

Query  793   KLGFPVSPCIQQKGSGN----PSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGK  960
             +LGF VS     K +      P+F+IECDAVVVGSGSGGGVIAG+LANAGHKVLVLEKG 
Sbjct  160   ELGFSVSKPHNFKNARRSTECPAFIIECDAVVVGSGSGGGVIAGILANAGHKVLVLEKGS  219

Query  961   YFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLK  1140
             Y AR++LSLLEG+S+D+MYLG GL+ ++DMDI+LLAGS VGGGSTINWSASIQTP HVLK
Sbjct  220   YLARTNLSLLEGTSMDQMYLGSGLLTTQDMDIMLLAGSTVGGGSTINWSASIQTPQHVLK  279

Query  1141  EWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRN  1320
             EW E++ LELF S+ Y+ AM+ VC +MGVQSE+EDEGFQNM+LRKGC ELGYPVETIP N
Sbjct  280   EWSESYNLELFESELYKEAMKIVCEKMGVQSEIEDEGFQNMILRKGCQELGYPVETIPTN  339

Query  1321  ASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVH---NKKTGREQ  1491
             A  DHYCGWCS GCKDGKKKGT+ETWL DLV SGNG I PECEA++V+H   N  +G+ +
Sbjct  340   APSDHYCGWCSMGCKDGKKKGTAETWLVDLVKSGNGAILPECEALEVIHEEKNDNSGKRK  399

Query  1492  AAGVMFVYQN-NGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFA  1668
             A GV F +QN  G +E C VKS+VT++ACGAL TPSLLK SGL+NPNIGRNLHLHPVV A
Sbjct  400   AIGVAFAFQNIEGMREICMVKSKVTIVACGALSTPSLLKRSGLKNPNIGRNLHLHPVVIA  459

Query  1669  WGYFPDAPGS--KAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAI  1842
             WGYFPD+P +  + WP+ EKKSY+GGIMTAMSKVVANFE SGYGA+IQTP LHPGMFSA+
Sbjct  460   WGYFPDSPSTSNEIWPKAEKKSYEGGIMTAMSKVVANFEGSGYGAVIQTPGLHPGMFSAL  519

Query  1843  MPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVL  2022
             MPW+SG D K RM ++SRTA +FALARDK SGEA SP+SISY + +TD+ +LK GLEK L
Sbjct  520   MPWVSGLDFKMRMSKYSRTAYIFALARDKGSGEALSPYSISYKLDQTDEENLKAGLEKTL  579

Query  2023  RILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCR  2202
             RILAAAGAEEIGT    G+ LK   AS  E + FV++ESS ++G  S  I SAHQMGSCR
Sbjct  580   RILAAAGAEEIGTQQEKGRSLKVNEASLKEFERFVKEESSIEIGKHSVPICSAHQMGSCR  639

Query  2203  MGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTH  2382
             MGVDP++SVVN  GETWEVEGLFL DSSV PTA+GVNPMVT+QAI+YCTAQSVL+ LK  
Sbjct  640   MGVDPKTSVVNSKGETWEVEGLFLGDSSVCPTAIGVNPMVTIQAISYCTAQSVLQLLKNQ  699



>ref|XP_006359948.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum tuberosum]
Length=707

 Score =   883 bits (2282),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/716 (65%), Positives = 561/716 (78%), Gaps = 33/716 (5%)
 Frame = +1

Query  265   RVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAE  444
             ++AWMIS RLQHP++ L +LALWLLSTRIGT +LCGKASLS+QFPYLQ+F  ISP KR E
Sbjct  12    QMAWMISNRLQHPRLNLCKLALWLLSTRIGTFILCGKASLSTQFPYLQNFSNISPKKREE  71

Query  445   IVRSWSCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGK  624
             IV+SW+    K+L+  Y  MKV+VLL FF+QVNE ++N SWKA+ Y GPD D  K+    
Sbjct  72    IVKSWATSCFKLLRILYFAMKVLVLLVFFTQVNEESQNPSWKALGYIGPDLDFKKQ----  127

Query  625   SKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGF  804
                   ++++M     +KK ++           GPL++G+I+L +  ++  FDRL+KLGF
Sbjct  128   ------KQENMN---SKKKDDQP---------FGPLYEGIISL-KNSQKITFDRLKKLGF  168

Query  805   PVSPCIQQKGSGN----PSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFAR  972
              VS     K +      P+F IE D VVVGSGSGGGVIAG+LANAGHKVLVLEKG Y AR
Sbjct  169   SVSKPHNFKNAKRSTECPAFTIESDVVVVGSGSGGGVIAGILANAGHKVLVLEKGSYLAR  228

Query  973   sslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDE  1152
             S+LSLLEG+S+D+MYLG G+VA+KDMDI+LLAGS VGGGSTINWSASIQTP HVLKEW E
Sbjct  229   SNLSLLEGTSMDQMYLGSGIVATKDMDIILLAGSTVGGGSTINWSASIQTPQHVLKEWSE  288

Query  1153  THKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRD  1332
             ++ L+LF S+ Y+ A+  VC +MGVQSE+EDEGFQNM+LRKGC ELGYPVETIP NA  D
Sbjct  289   SYNLKLFESELYKEALRIVCEKMGVQSEIEDEGFQNMILRKGCQELGYPVETIPTNAPSD  348

Query  1333  HYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVH---NKKTGREQAAGV  1503
             HYCGWCS GCKDGKKKGT+ETWL DLV SGNG I PECEA++V+H   N  +G+ +A GV
Sbjct  349   HYCGWCSMGCKDGKKKGTAETWLVDLVKSGNGAILPECEALEVIHEEKNDNSGKRKAIGV  408

Query  1504  MFVYQN-NGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYF  1680
              F +QN  G +E C VKS+VT++ACGAL TPSLLK SGL+NPNIGRNLHLHPVV AWGYF
Sbjct  409   AFAFQNIEGMREICMVKSKVTIVACGALSTPSLLKRSGLKNPNIGRNLHLHPVVIAWGYF  468

Query  1681  PDAPGS--KAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWL  1854
             PD+P +  + WP+ EKKSY+GGIMTAMSKVVANFE SGYGA+IQTP LHPGMFSA+MPW+
Sbjct  469   PDSPSTSNEIWPKAEKKSYEGGIMTAMSKVVANFEGSGYGAVIQTPGLHPGMFSALMPWV  528

Query  1855  SGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILA  2034
             SG D K RM ++SRTA +FALARDK SGEA SP+SISY + +TD+ +LK GLEK LRILA
Sbjct  529   SGLDFKMRMSKYSRTAYIFALARDKGSGEALSPYSISYKLDQTDEENLKAGLEKTLRILA  588

Query  2035  AAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVD  2214
             AAGAEEIGT    G+ LK   AS  E + FV++ESS ++G  S  I SAHQMGSCRMGVD
Sbjct  589   AAGAEEIGTQQEKGRSLKVNEASLKEFERFVKEESSIEIGKHSVPICSAHQMGSCRMGVD  648

Query  2215  PRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTH  2382
             P++SVVN  GETWEVEGLFL DSSV PTA+GVNPMVT+QAI+YCTAQSVL+ LK  
Sbjct  649   PKTSVVNSKGETWEVEGLFLGDSSVCPTAIGVNPMVTIQAISYCTAQSVLQLLKNQ  704



>ref|XP_007210564.1| hypothetical protein PRUPE_ppa014756mg [Prunus persica]
 gb|EMJ11763.1| hypothetical protein PRUPE_ppa014756mg [Prunus persica]
Length=808

 Score =   869 bits (2246),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/760 (61%), Positives = 575/760 (76%), Gaps = 19/760 (3%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
             LS   M ++T++ DTFLP++DV       + S+  F++TSAS+AGTPQRV  +ISER++H
Sbjct  52    LSSREMESLTALCDTFLPSIDVSD--TTTNASLVAFYRTSASMAGTPQRVGGLISERMKH  109

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  480
             PK+ L+RLALW LST IG+ +LCG+ASLSSQFPY QSFP++S  KR EI+ SWS  Y  +
Sbjct  110   PKLWLMRLALWFLSTWIGSFILCGRASLSSQFPYFQSFPQMSQQKREEILLSWSLSYFYL  169

Query  481   LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMT  660
             L+  +  MK++ LL FF+QVNE NEN+SWKAIDY GPDP+       K+KK+   +   T
Sbjct  170   LRMLFKSMKLLTLLVFFTQVNEKNENLSWKAIDYTGPDPEF----ITKTKKF---KASTT  222

Query  661   LSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKG--  834
             +  ++   EE     + E L GPL++G+INL++ P+  V D L   G P S    +K   
Sbjct  223   IGSQRPNNEEQNACPHKEELFGPLNRGIINLDK-PKDLVVDALSTFGIPASVLHSEKTVN  281

Query  835   -SGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDE  1011
              S NPS  I CDAVV+GSGSGGGV+AGVLA AG+KV+V+EKG Y AR +L+LLEG ++D+
Sbjct  282   CSSNPSLTIRCDAVVIGSGSGGGVVAGVLATAGYKVVVIEKGNYHARKNLTLLEGPAMDQ  341

Query  1012  MYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYR  1191
             MYL GGL+A+ DM + +LAGS VGGGS INWSASI+TP HV+KEW   H+LELF SK Y+
Sbjct  342   MYLSGGLIATDDMGVFVLAGSTVGGGSAINWSASIRTPQHVIKEWCNDHELELFDSKLYQ  401

Query  1192  HAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDG  1371
              A++ VC +MGVQS++++EGF N +LRKGC ELGYPV  IPRN+  +HYCGWC FGCKDG
Sbjct  402   EALDVVCEKMGVQSQIQEEGFNNAILRKGCQELGYPVNNIPRNSPPNHYCGWCCFGCKDG  461

Query  1372  KKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQ---AAGVMFVYQNNGAKEFC  1542
             +K GT+ETWL DLV+SGNG I   CEA+KV+H +K GR     A GV F +++ G KE  
Sbjct  462   RKGGTTETWLVDLVNSGNGAILTGCEAIKVLHKRKKGRRDRNTATGVAFEFEHGGGKEIG  521

Query  1543  FVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEK  1722
             FV+S+VT++ACGALCTP LLK SGL+N NIG NLHLHPV  AWGYFPD+      PE EK
Sbjct  522   FVESKVTIVACGALCTPKLLKRSGLKNVNIGENLHLHPVAMAWGYFPDSQVFDGRPEREK  581

Query  1723  KSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTA  1902
             KSY+GGIMTAMS VVA F +SGYGA+IQTP+LHPGMFS +MPW+SG DIK RM RFSRTA
Sbjct  582   KSYEGGIMTAMSTVVAEFNKSGYGAVIQTPALHPGMFSVVMPWVSGKDIKHRMSRFSRTA  641

Query  1903  ILFALARDKTSG--EAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAG  2076
              +FALARDK SG   AP P+SISY M+  D+ +LK GLEK LRILAAAGAE+IGT H  G
Sbjct  642   HVFALARDKGSGTVNAP-PYSISYEMEALDENNLKIGLEKSLRILAAAGAEDIGTHHFKG  700

Query  2077  KILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWE  2256
             K L  K ++ DE + FV++ESSR L  LS+ I SAHQMGSCRMGVD + SV+N MGETWE
Sbjct  701   KGLHVKKSNLDEFERFVKEESSRPLRELSSAICSAHQMGSCRMGVDSKQSVLNQMGETWE  760

Query  2257  VEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             VEGLF+AD+SVFPTALGVNPMVTVQAIAYCT+QS+L+ L+
Sbjct  761   VEGLFVADTSVFPTALGVNPMVTVQAIAYCTSQSILQVLR  800



>ref|XP_010054021.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Eucalyptus grandis]
Length=814

 Score =   869 bits (2245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/767 (60%), Positives = 567/767 (74%), Gaps = 22/767 (3%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDD--------DSVKLFFQTSASIAGTPQRVAW  276
             LSP  M T+T++ DTFLP++  P H +  D        + V  F++TSAS+AGTP+++  
Sbjct  49    LSPRQMDTLTALCDTFLPSIAHPHHPSYTDSGGDGDCDEEVAKFYRTSASMAGTPEKLGG  108

Query  277   MISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRS  456
             +ISER++HPK+ LLRL LW LST IGT +LCG+   SS FPY+Q FPEI   +R EIVR 
Sbjct  109   LISERIKHPKLWLLRLTLWFLSTCIGTFILCGQKCFSSHFPYVQRFPEIPQRRREEIVRR  168

Query  457   WSCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPD--SNKKPAGKSK  630
             WS     +L+ F   +K++  L FF+QV+E + N+SWKAI Y GPDP+  ++KK    S 
Sbjct  169   WSRSVFPLLRIFARTVKLLTFLVFFTQVDEKDHNVSWKAIGYAGPDPEFENSKKLKRTSC  228

Query  631   KWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPV  810
             +    EQ        K G ED      E   GPLH+G+I++   PR  V   L++ GFPV
Sbjct  229   QISADEQQGKEQATAKNGYED------EAFFGPLHQGLIHMVH-PRDIVTKSLRQFGFPV  281

Query  811   SPCIQQKGSGNPSF---VIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARssl  981
               C        P F    I+CDAVV+GSG+GGGV+AGVLA AG+KVLVLEKG Y ARS+L
Sbjct  282   LICPSNHNVRKPRFPSLSIQCDAVVIGSGAGGGVVAGVLAKAGYKVLVLEKGSYCARSNL  341

Query  982   sllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHK  1161
             SLLEG ++D+MYL GG+VA++DM  L+LAGS VGGGSTINWSAS++TP HV+ EW   + 
Sbjct  342   SLLEGPTMDQMYLSGGVVATEDMSTLVLAGSTVGGGSTINWSASLRTPQHVMNEWSNKYD  401

Query  1162  LELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYC  1341
             LELF SK YR A++ VC RMGVQS + +EGF N VLRKGC ELGYPV  IPRN+  DHYC
Sbjct  402   LELFDSKLYREALDVVCKRMGVQSAISEEGFNNAVLRKGCQELGYPVSNIPRNSPADHYC  461

Query  1342  GWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKT--GREQAAGVMFVY  1515
             GWC  GCKDGKKKGT+ETWL DLV+SGNG I P CEA++V+H++++  GR+ A GV F +
Sbjct  462   GWCCLGCKDGKKKGTAETWLVDLVESGNGAILPGCEAIEVLHSRQSRRGRDTATGVTFEF  521

Query  1516  QNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPG  1695
             ++NG KE C ++S+VT++ACGAL TP+LLK SGL+NPNIG+NLHLHPV  AWGYFPD   
Sbjct  522   EHNGVKEVCIIESKVTIVACGALSTPALLKRSGLKNPNIGKNLHLHPVTMAWGYFPDTEM  581

Query  1696  SKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKT  1875
             +  WPE EKKSY+GGIMTAMS VV NF +SGYGA+IQTP+LHPGMFSA+MPW SG D+K 
Sbjct  582   ADLWPEKEKKSYEGGIMTAMSTVVGNFNKSGYGAVIQTPALHPGMFSALMPWTSGLDMKE  641

Query  1876  RMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEI  2055
             RM +FSRTA LF LARDK SG   S  SISY M   D+ +L+ GLEKVLRILAAAGAEEI
Sbjct  642   RMTKFSRTAHLFTLARDKGSGTITSSTSISYKMDDADEQNLQKGLEKVLRILAAAGAEEI  701

Query  2056  GTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVN  2235
             G+ H  GK LK K  S  E ++FV++ES+R +  LST I SAHQMGSCRMG DPRSS VN
Sbjct  702   GSHHGEGKTLKVKQVSYHEFEQFVKEESARSIKGLSTPICSAHQMGSCRMGPDPRSSAVN  761

Query  2236  PMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             PMGETWEVEGL++AD+SVFPTALGVNPMVTVQAIAYCTAQSVL+ L+
Sbjct  762   PMGETWEVEGLYVADTSVFPTALGVNPMVTVQAIAYCTAQSVLEALR  808



>ref|XP_011072398.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Sesamum 
indicum]
Length=761

 Score =   864 bits (2233),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/752 (60%), Positives = 566/752 (75%), Gaps = 15/752 (2%)
 Frame = +1

Query  136   MATVTSISDTFLPAVDVPQHAA---VDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPK  306
             M  ++++ DTFLPA+DV  +     +     + F+QTSAS+AG P  V   +  +++HPK
Sbjct  13    MEALSALCDTFLPAIDVDNYDVGPQLHSSLHRQFYQTSASMAGIPHHVGEFLGGKVEHPK  72

Query  307   VIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILK  486
             + L RLA+ LLSTRIG+L+LCG+ SLS +FPY Q+F ++S  +R EI+ SWS     +L+
Sbjct  73    MCLARLAIMLLSTRIGSLILCGRKSLSPKFPYFQTFSKVSCERREEILLSWSTSSFLLLR  132

Query  487   TFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLS  666
               +  +K+  LL FF+QVNE  EN+SWKAI YCGPDP   K       + +  E      
Sbjct  133   ILFTALKIFTLLLFFTQVNEKGENLSWKAIGYCGPDPGCTKT------RRLNAENTQQPP  186

Query  667   EEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVS-PCIQQK--GS  837
             EE ++   D    + E L G L+KG+INL+Q PR     +LQ LGF VS P  + +   S
Sbjct  187   EECEEKLAD--GASKEELFGSLYKGIINLSQ-PREDPLSKLQNLGFSVSIPHSRNRRMKS  243

Query  838   GNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMY  1017
              NPSF+++CDAVVVGSGSGGGV+AGVLANAGHKVLVLEKG YFAR++LSLLEG ++D+MY
Sbjct  244   LNPSFIVKCDAVVVGSGSGGGVMAGVLANAGHKVLVLEKGSYFARANLSLLEGEAMDQMY  303

Query  1018  LGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHA  1197
             LG G+  + ++D+LLLAGS VGGGSTINWSASI TPPHV++EW E HKL+LF SK Y+ A
Sbjct  304   LGKGMATTDNLDVLLLAGSTVGGGSTINWSASIHTPPHVIREWSEKHKLKLFESKVYQQA  363

Query  1198  METVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKK  1377
             ++ VC +MGVQSEVE EGF NM+LRKGC +LGYPVET+PRNA  DHYCGWC FGCKDG+K
Sbjct  364   LDVVCQKMGVQSEVEHEGFNNMILRKGCEKLGYPVETVPRNAPSDHYCGWCCFGCKDGRK  423

Query  1378  KGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQAAGVMFVYQNNGAKEFCFVKSR  1557
             KGTSETWL DLV+SGNG I P CEA++V+  +  G+++A GV F +     +E   V+S 
Sbjct  424   KGTSETWLVDLVESGNGAILPACEALRVITEESNGKKRAIGVAFAFYTPFGREIGIVESD  483

Query  1558  VTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQG  1737
             VTV A GA+CTP LLK SGL+N NIG+NLH+HPVV AWGYFPD+    AWP  EK+SY+G
Sbjct  484   VTVAASGAICTPPLLKRSGLKNRNIGKNLHIHPVVMAWGYFPDSASPDAWPAAEKRSYEG  543

Query  1738  GIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFAL  1917
             GI+TAMS V+AN E SGYG +IQTP LHPGMFS +MPW+SGTD+K RM +FSRT  +FAL
Sbjct  544   GIITAMSTVIANTETSGYGTVIQTPILHPGMFSLLMPWISGTDMKNRMVKFSRTTHIFAL  603

Query  1918  ARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKG  2097
             ARDK SG+  S  ++SY ++ +D+ +L  GLEKV+RI+AAAGAEEIGT H  G++LK K 
Sbjct  604   ARDKGSGKITSETNVSYKLEYSDQENLSKGLEKVMRIMAAAGAEEIGTQHTTGRVLKVKQ  663

Query  2098  ASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLA  2277
             AS +E + FV++ES R L  LS+ IGSAHQMGSCRMGVDP+SS VNP GETWEVEGLF+A
Sbjct  664   ASEEEFERFVKEESLRPLQKLSSPIGSAHQMGSCRMGVDPKSSAVNPKGETWEVEGLFVA  723

Query  2278  DSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
             DSSVFPTALGVNPMVT+QAIAYCTAQSVL+ L
Sbjct  724   DSSVFPTALGVNPMVTIQAIAYCTAQSVLEVL  755



>ref|XP_008237995.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Prunus mume]
Length=752

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/755 (61%), Positives = 571/755 (76%), Gaps = 19/755 (3%)
 Frame = +1

Query  136   MATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIl  315
             M ++T++ DTFLP++DV    A  + S+  F++TSAS+AGTPQRV  +ISERL+HPK+ L
Sbjct  1     MESLTALCDTFLPSIDVSD--ATTNASLVAFYRTSASMAGTPQRVGGLISERLKHPKLWL  58

Query  316   lrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTFY  495
             +RLALW LST IG+ +LCG+ASLSSQFPY QSFP++S  KR EI+ SWS  Y  +L+  +
Sbjct  59    MRLALWFLSTWIGSFILCGRASLSSQFPYFQSFPQMSQQKREEILLSWSLSYFYLLRMLF  118

Query  496   LGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQ  675
               MK++  L FF+QVNE NEN+SWKAIDY GPDP+       K+KK+   +   T+  ++
Sbjct  119   KTMKLLTFLVFFTQVNEKNENLSWKAIDYTGPDPEF----ITKTKKF---KASTTIGNQR  171

Query  676   KKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKG---SGNP  846
                EE     + E L GPL++ +INL++ P+  V D L   G P S    +K      NP
Sbjct  172   PNNEEQNACPHEEELFGPLNRCIINLDK-PKDLVVDALSTFGIPASVLHSEKTVNCPSNP  230

Query  847   SFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGG  1026
             S  I CDAVV+GSGSGGGV+AGVLA AG+KV+V+EKG Y AR +L+LLEG ++D+MYL G
Sbjct  231   SLTIRCDAVVIGSGSGGGVVAGVLAKAGYKVVVIEKGNYHARKNLTLLEGPAMDQMYLSG  290

Query  1027  GLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMET  1206
             GL+A+ DM + +LAGS VGGGS INWSASI+TP HV+KEW   H+LELF SK Y+ A++ 
Sbjct  291   GLIATDDMGVFVLAGSTVGGGSAINWSASIRTPQHVIKEWCNDHELELFDSKLYQEALDV  350

Query  1207  VCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGT  1386
             V  +MGVQS+V++EGF N +LRKGC ELGYPV  IPRN+  +HYCGWC FGCKDG+K+GT
Sbjct  351   VSEKMGVQSQVQEEGFNNEILRKGCQELGYPVNNIPRNSPPNHYCGWCCFGCKDGRKRGT  410

Query  1387  SETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQ---AAGVMFVYQNNGAKEFCFVKSR  1557
             +ETWL DLV+SGNG I   CEA+KV+H +K GR     A GV F +++ G KE  FV+S+
Sbjct  411   TETWLVDLVNSGNGAILTGCEAIKVLHKRKKGRRDRNTATGVAFKFEHGGGKEIGFVESK  470

Query  1558  VTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQG  1737
             VT++ACGALCTP LLK SGL+N NIG NLHLHPV  AWGYFPD+     WPE EKKSY+G
Sbjct  471   VTIVACGALCTPKLLKRSGLKNVNIGENLHLHPVAMAWGYFPDSQVFDGWPEREKKSYEG  530

Query  1738  GIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFAL  1917
             GIMTAMS VVA F +SGYGA+IQTP+LHPGMFS +MPW+SG DIK RM RFSRTA +FAL
Sbjct  531   GIMTAMSTVVAEFNKSGYGAVIQTPALHPGMFSVVMPWVSGKDIKHRMSRFSRTAHVFAL  590

Query  1918  ARDKTSG--EAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKP  2091
             ARDK SG   AP P SISY M+  D+ +LK GLEK LRILAAAGAE+IGT H  GK L  
Sbjct  591   ARDKGSGTVNAP-PDSISYEMEALDENNLKIGLEKSLRILAAAGAEDIGTHHFKGKGLHV  649

Query  2092  KGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLF  2271
             K A+ DE + FV++ESSR L  +S+ I SAHQMGSCRMGVD + SVVN MGETWEVEGLF
Sbjct  650   KKANLDEFERFVKEESSRPLREISSAICSAHQMGSCRMGVDSKQSVVNQMGETWEVEGLF  709

Query  2272  LADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             +AD+SVFPTALGVNPMVTVQAIAYCT+QS+L+ L+
Sbjct  710   VADTSVFPTALGVNPMVTVQAIAYCTSQSILQVLR  744



>ref|XP_006482469.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Citrus sinensis]
Length=788

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/756 (61%), Positives = 574/756 (76%), Gaps = 10/756 (1%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
             LS   M +++++ DTFLPAVDV   A++D D +  FF+ SAS AGTP+R+  ++SERL+H
Sbjct  34    LSSQEMESLSALCDTFLPAVDVKTAASIDKD-IADFFRASASAAGTPERLGGLMSERLKH  92

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  480
             PK  L+RL LWLLST IG+L+LCG+   SS+FPY+ SF ++   KR  ++ SWS  Y   
Sbjct  93    PKKWLVRLCLWLLSTCIGSLVLCGRYCFSSKFPYMHSFTQLPQKKRDAVLVSWSLSYFYH  152

Query  481   LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMT  660
             L+  Y  MK+++LL FF+QVNE NEN+SWKAI Y GPDP+   K     ++   R + + 
Sbjct  153   LRMLYKAMKLLILLVFFTQVNEKNENLSWKAIGYKGPDPEFKTKSM---QRKTLRNEGLN  209

Query  661   LSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGS-  837
               ++ +   +D      EL  GPL+KG+IN+ Q PR  V D L+++GFPVS   ++  + 
Sbjct  210   DDDDDEGQNDDGHEEEAELY-GPLYKGLINM-QLPRNIVADSLRQVGFPVSVRNKRNAAP  267

Query  838   ---GNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslD  1008
                 +PS VI+CDAVVVGSGSGGG+IAGVLA AG+KVLVLEKG Y ARS+LSLLEG ++D
Sbjct  268   SSIASPSLVIKCDAVVVGSGSGGGLIAGVLAKAGYKVLVLEKGSYCARSNLSLLEGKTMD  327

Query  1009  EMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEY  1188
             +MYL GG++A+ DM ++LLAGS VGGGSTINWSASI+TP HV  EW + ++L+LF S  Y
Sbjct  328   QMYLAGGVLATDDMGVILLAGSTVGGGSTINWSASIKTPKHVANEWCDEYELKLFESDLY  387

Query  1189  RHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKD  1368
             + AME VC RMGVQSEVE+EGF N VLR+GC ELGYPV  IPRN+  DHYCGWC  GCKD
Sbjct  388   KEAMEVVCERMGVQSEVEEEGFNNAVLRRGCKELGYPVNNIPRNSPPDHYCGWCCLGCKD  447

Query  1369  GKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQAAGVMFVYQNNGAKEFCFV  1548
             G KKGTSETWL DLV+SGN  I P CEA++V+H K+  R  A GV F +Q  GAK+ C V
Sbjct  448   GSKKGTSETWLVDLVNSGNSAILPGCEAIEVLHKKRRDRNVATGVAFEFQYMGAKDICVV  507

Query  1549  KSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKS  1728
             +S+VT++ACGAL TP+LLK SGL+N NIG+NLHLHPV  AWGYFP    S  WPE +K S
Sbjct  508   ESKVTIVACGALSTPNLLKRSGLKNANIGKNLHLHPVTMAWGYFPKTSSSGEWPEEKKTS  567

Query  1729  YQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAIL  1908
             Y+GGIMTAMS  V NF +SGYGA+IQTP+LHPGMFS++MPW+SG DIK RM +FSRTA +
Sbjct  568   YEGGIMTAMSTTVGNFGKSGYGAVIQTPALHPGMFSSLMPWVSGADIKLRMCKFSRTAHI  627

Query  1909  FALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILK  2088
             FALARD+ SG   SP+SISY M+  D+ +LK G+EK+LR+LAAAGAEEIGT H  GK + 
Sbjct  628   FALARDQGSGTVNSPYSISYQMEAMDEENLKKGIEKILRMLAAAGAEEIGTHHCKGKTIN  687

Query  2089  PKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  2268
              K AS +E + FV++ESSR L +LST + SAHQMGSCRMG+DP++SVVN MGETW+VEGL
Sbjct  688   VKKASSEEFERFVKEESSRPLRDLSTPLSSAHQMGSCRMGIDPKTSVVNQMGETWDVEGL  747

Query  2269  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             +LAD+SVFPTALGVNPMVTVQAIAYCTAQSVL  L+
Sbjct  748   YLADTSVFPTALGVNPMVTVQAIAYCTAQSVLDVLR  783



>ref|XP_006430998.1| hypothetical protein CICLE_v10011111mg [Citrus clementina]
 gb|ESR44238.1| hypothetical protein CICLE_v10011111mg [Citrus clementina]
Length=780

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/756 (61%), Positives = 574/756 (76%), Gaps = 11/756 (1%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
             LS   M +++++ DTFLPAVDV Q AA+D D +  FF+ SAS AGTP+R+  ++SERL+H
Sbjct  27    LSSQEMESLSALCDTFLPAVDVKQAAAIDTD-IADFFRASASAAGTPERLGGLMSERLKH  85

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  480
             PK  L+RL LWLLST IG+L+LCG+   SS+FPY+ SF ++  +KR  ++ SWS  Y   
Sbjct  86    PKKWLVRLCLWLLSTCIGSLILCGRYCFSSKFPYMHSFTQLPQNKREAVLVSWSLSYFYH  145

Query  481   LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMT  660
             L+  Y  MK+++ L FF+QVNE NEN+SWKAI Y GPDP+   K     +K +  E    
Sbjct  146   LRMLYKAMKLLIFLVFFTQVNEKNENLSWKAIGYKGPDPEFKTKSM--QRKTLRNE---G  200

Query  661   LSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGS-  837
             L+++  +G+ D        L GPL+KG+IN+ Q PR  V D L+++GFPVS   ++  + 
Sbjct  201   LNDDDDEGQNDDGHEEEAELYGPLYKGLINM-QLPRNIVADSLRQVGFPVSVRNKRNAAP  259

Query  838   ---GNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslD  1008
                 +PS VI+CDAVVVGSGSGGGVIAGVLA AG+KVLVLEKG Y ARS+LSLLEG ++D
Sbjct  260   ISIASPSLVIKCDAVVVGSGSGGGVIAGVLAKAGYKVLVLEKGSYCARSNLSLLEGKTMD  319

Query  1009  EMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEY  1188
             +MYL GG++A+ DM ++LLAGS VGGGSTINWSASI+TP HV  EW + ++L+LF S  Y
Sbjct  320   QMYLAGGMLATDDMGVILLAGSTVGGGSTINWSASIKTPKHVANEWCDEYELKLFESDLY  379

Query  1189  RHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKD  1368
             + AME VC R+GVQSEVEDEGF N VLR+GC ELGYPV  IPRN+  DHYCGWC  GCKD
Sbjct  380   KEAMEVVCERIGVQSEVEDEGFNNAVLRRGCKELGYPVNNIPRNSPPDHYCGWCCLGCKD  439

Query  1369  GKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQAAGVMFVYQNNGAKEFCFV  1548
             G KKGTSETWL DLV+SGN  I P CEA++V+H K+  R  A GV F +Q  GAK+ C V
Sbjct  440   GSKKGTSETWLVDLVNSGNSAILPGCEAIEVLHKKRRDRNVATGVAFEFQYMGAKDICVV  499

Query  1549  KSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKS  1728
             +S+VT++ACGAL TP+LLK SGL+N NIG+NLHLHPV  AWGYFP    S  WPE +K S
Sbjct  500   ESKVTIVACGALSTPNLLKRSGLKNANIGKNLHLHPVTMAWGYFPKTSSSGEWPEEKKTS  559

Query  1729  YQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAIL  1908
             Y+GGIMTAMS  V NF +SGYGA+IQTP+LHPGMFS++MPW+SG DIK RM +FSRTA +
Sbjct  560   YEGGIMTAMSTTVGNFGKSGYGAVIQTPALHPGMFSSLMPWVSGADIKLRMCKFSRTAHI  619

Query  1909  FALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILK  2088
             F LARD+ SG   SP+SISY M+  D+ +LK G+EK+LRILAAAGAEEIGT H  GK + 
Sbjct  620   FVLARDQGSGTVNSPYSISYQMEAMDEENLKKGIEKILRILAAAGAEEIGTHHCKGKTIN  679

Query  2089  PKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  2268
              K AS +E + FV++ESSR L +LST + SAHQMGSCRMG+DP++SVVN MGETW VEGL
Sbjct  680   VKKASSEEFERFVKEESSRPLRDLSTPLSSAHQMGSCRMGIDPKTSVVNQMGETWGVEGL  739

Query  2269  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             +LAD+SVFPTALGVNPMVTVQAIAYCTAQSVL  L+
Sbjct  740   YLADTSVFPTALGVNPMVTVQAIAYCTAQSVLDVLR  775



>ref|XP_010054015.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Eucalyptus 
grandis]
Length=804

 Score =   860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/764 (60%), Positives = 563/764 (74%), Gaps = 20/764 (3%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAA----VDDDSVKLFFQTSASIAGTPQRVAWMISE  288
             LSP  M T+TS+ DTFLP++  P H +      D+ V  F+QTSAS+AGTP+++  ++SE
Sbjct  43    LSPRQMETLTSLCDTFLPSIAHPHHPSDTEGEGDEEVAKFYQTSASMAGTPEKIGGLVSE  102

Query  289   RLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCC  468
             R++HPK+ LL L LWLLST IGT +LCG+   SS FPY+Q F EI   +R EI R W   
Sbjct  103   RMKHPKLWLLPLTLWLLSTCIGTFILCGRKCFSSHFPYVQRFSEIPQRRREEIARRWFRS  162

Query  469   YIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITRE  648
                +L+ F   +K++  L FF+Q++E + N+SWKAI Y GPDPD        SKK   + 
Sbjct  163   VFPVLRMFARTIKLLTFLVFFTQLDEKDRNLSWKAIGYAGPDPDFEN-----SKK--LKR  215

Query  649   QHMTLSEEQKKGEEDVIPMN---PELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPC  819
                 +S ++++G+E     N    E + GPLH+G+I +   P+  V   L++ GFPV  C
Sbjct  216   MSCQVSADEQQGQEQAKAKNCYEDEAISGPLHQGLIQMVH-PQDIVTKSLRQFGFPVLIC  274

Query  820   IQQKGSGNPSF---VIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsll  990
                     P F    I+CDAVV+GSG+GGGV+AGVLA AGHKVLVLEKG Y ARS+LSLL
Sbjct  275   PSNHNVRKPRFPSLSIQCDAVVIGSGAGGGVVAGVLAKAGHKVLVLEKGSYCARSNLSLL  334

Query  991   egsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLEL  1170
             EG ++D+MYL GGLVA++DM  L+LAGS VGGGSTINWSAS++TP HV+ EW   + LEL
Sbjct  335   EGPTMDQMYLSGGLVATEDMSTLVLAGSTVGGGSTINWSASLRTPQHVMNEWSNKYDLEL  394

Query  1171  FGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWC  1350
             F SK Y+ A++ VC RMGVQS + +EGF N VLRKGC ELGYPV  IPRN+  DHYCGWC
Sbjct  395   FDSKLYQEALDVVCKRMGVQSAISEEGFNNAVLRKGCQELGYPVSNIPRNSPADHYCGWC  454

Query  1351  SFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGR--EQAAGVMFVYQNN  1524
               GCKDGKKKGT+ETWL DLV+SGNG I P CEA++V+H +++GR  +   GV F +++N
Sbjct  455   CLGCKDGKKKGTAETWLVDLVESGNGAILPGCEAIEVLHTRRSGRGRDTVTGVAFEFEHN  514

Query  1525  GAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKA  1704
             G KE C V+S VT++ACGAL TP+LLK SGL+NPNIG+NLHLHPV  AWGYFPD      
Sbjct  515   GFKEVCIVESNVTIVACGALGTPALLKRSGLKNPNIGKNLHLHPVAMAWGYFPDTKTVDL  574

Query  1705  WPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQ  1884
             WPE EKKSY+GGIMTAMS VV NF++SGYGA+IQTP+LHPGMFS +MPW SG D+K RM 
Sbjct  575   WPEKEKKSYEGGIMTAMSPVVGNFDKSGYGAVIQTPALHPGMFSVLMPWTSGLDMKERMT  634

Query  1885  RFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTC  2064
             +FSRTA LFALARDK SG   S  SISY M  TD+ +L+ GLEKVLRILAAAGAEEIGT 
Sbjct  635   KFSRTAHLFALARDKGSGTIASSTSISYKMDDTDEHNLQKGLEKVLRILAAAGAEEIGTH  694

Query  2065  HRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMG  2244
             H  GK LK K  S  E + FV++ES+R +   ST I SAHQMGSCRMG +PRSSVVNPMG
Sbjct  695   HNEGKTLKVKQVSYHEFERFVKEESARPIKGQSTPICSAHQMGSCRMGPNPRSSVVNPMG  754

Query  2245  ETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             ETWEVEGL++AD+SVFPTALGVNPMVTVQAIAYCTAQSVL+ L+
Sbjct  755   ETWEVEGLYVADTSVFPTALGVNPMVTVQAIAYCTAQSVLEALR  798



>ref|XP_007158083.1| hypothetical protein PHAVU_002G122600g [Phaseolus vulgaris]
 gb|ESW30077.1| hypothetical protein PHAVU_002G122600g [Phaseolus vulgaris]
Length=807

 Score =   859 bits (2220),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/758 (60%), Positives = 577/758 (76%), Gaps = 20/758 (3%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
             LS   M +++++ DT LP++D   H++  D+SV  F++ SAS+AGTPQ    MI E+L+H
Sbjct  60    LSSRQMKSLSALCDTILPSLDHFPHSS--DESVNRFYRISASMAGTPQLFGGMICEKLKH  117

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  480
             P   LL+L LW LST  GTL+LCG   +S++FP++ S+P++S  KR +I+RSWS  YI+ 
Sbjct  118   PMTGLLKLVLWALSTWFGTLILCGMGCVSTKFPFIHSYPDLSVEKRQQIMRSWSLSYIRH  177

Query  481   LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMT  660
             L+  +  +K++ LL FF+Q++E+ +N+SWKAI YCGPDP+           +  + ++  
Sbjct  178   LRQLFRTIKLLTLLIFFTQLDESEDNLSWKAIGYCGPDPE-----------FKAQLKNHF  226

Query  661   LSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQ-KGS  837
             L  + K+GEED    + E ++GPL+KG+++LN  PR    D L+++GFPVS   ++ K +
Sbjct  227   LEGKSKRGEEDKEDEDVEEVIGPLYKGLVHLNN-PRDITADALRRIGFPVSVIRRKHKAA  285

Query  838   GN---PSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslD  1008
              N   PS VI+CDAVVVGSGSGGGVIAGVLA AG+KVLVLEKG YFAR++LSLLEG ++D
Sbjct  286   ANLSSPSLVIQCDAVVVGSGSGGGVIAGVLAKAGYKVLVLEKGGYFARNNLSLLEGQTMD  345

Query  1009  EMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEY  1188
             +MYL GGLVAS DM + +L+GS VGGGS INWSASI+TP HV KEW E H LELFGS+ Y
Sbjct  346   QMYLNGGLVASDDMGMFILSGSTVGGGSAINWSASIKTPQHVRKEWCEKHGLELFGSELY  405

Query  1189  RHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKD  1368
             R A++ VC +MGVQSE+ DEGF N VLRKGC E+GYPV TIPRN+S DHYCGWC  GCKD
Sbjct  406   REALDAVCEKMGVQSEIGDEGFNNAVLRKGCQEMGYPVNTIPRNSSSDHYCGWCCLGCKD  465

Query  1369  GKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQ--AAGVMFVYQNNGAKEFC  1542
             GKKKGT ETWL DLV SGNG I P CEA+KV+H KK G+++  A GV F ++  G K+ C
Sbjct  466   GKKKGTLETWLVDLVKSGNGAILPGCEAIKVLHKKKEGKDRKVARGVAFEFEYKGIKDIC  525

Query  1543  FVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEK  1722
              V+S+VT++ACGALCTP+LLK SGLRN NIGR+LHLHPV  AWGYFPD P S+ WPE  K
Sbjct  526   VVESKVTIVACGALCTPALLKRSGLRNQNIGRHLHLHPVTMAWGYFPDEPASEVWPEAYK  585

Query  1723  KSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTA  1902
             KSY+GGIMTAMS VVA FE+SGYGA+IQTPSLHPGMFS + PW SG DI+ RM++FSRTA
Sbjct  586   KSYEGGIMTAMSSVVAEFEQSGYGAVIQTPSLHPGMFSIVTPWTSGIDIRDRMRKFSRTA  645

Query  1903  ILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKI  2082
              +FALARDK SG   SP  ISY +   D+ +L+ G+EKVLRILAAAGAEEIGT H  G+ 
Sbjct  646   HIFALARDKGSGTVESPKHISYRLAGVDEENLQKGIEKVLRILAAAGAEEIGTHHNKGRT  705

Query  2083  LKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVE  2262
             L  K  S  E ++FV++ESSR L +LST + SAHQMGSCRMG +P+ SVVN  GETWE+E
Sbjct  706   LNVKQVSYHEFEKFVKEESSRPLADLSTPLCSAHQMGSCRMGSNPKQSVVNQTGETWEME  765

Query  2263  GLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             GL+LAD+SVFPTALGVNPMVTVQA AYC AQSV++ L+
Sbjct  766   GLYLADTSVFPTALGVNPMVTVQATAYCIAQSVVEVLR  803



>gb|EYU29124.1| hypothetical protein MIMGU_mgv1a001761mg [Erythranthe guttata]
Length=763

 Score =   857 bits (2214),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/758 (60%), Positives = 560/758 (74%), Gaps = 30/758 (4%)
 Frame = +1

Query  136   MATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIl  315
             M  +T++ DTFLPA+DV  H      SV  F+QTSAS++ TP  VA  I+E+++HPK++L
Sbjct  18    MEALTALCDTFLPAIDVSDHDPHLPQSVANFYQTSASMSETPPLVAEFIAEKVKHPKILL  77

Query  316   lrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTFY  495
              ++A+ +LST IGT +LCG+ SLS  FPYLQ F  +   KR EI+ SWS     +L+  +
Sbjct  78    AKVAVKMLSTWIGTFILCGRKSLSDDFPYLQRFSRVESLKREEILLSWSNSCFSLLRILF  137

Query  496   LGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQ  675
               +K+ +L +FF+QV+E  +NISWKAI YCGPDPD       K++K   +E       + 
Sbjct  138   SALKIFILFTFFTQVDEKEDNISWKAIGYCGPDPDF------KTRKPQYQECEQKEENDH  191

Query  676   KKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFP---VSPCIQQKGSG--  840
             K  EED        L GPLHKG+IN + +P  +   +L+  GF    VS    +K +   
Sbjct  192   KSIEED--------LFGPLHKGIINFSHQPIEKSLRKLRDSGFTTAVVSKPYSEKNTSVG  243

Query  841   ---NPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDE  1011
                NPSFV++CDAV+VGSGSGGGV+AGVLA AGHKV+VLEKG Y ARS+LSLLEG +LD+
Sbjct  244   SLLNPSFVLKCDAVIVGSGSGGGVVAGVLAKAGHKVVVLEKGSYLARSNLSLLEGEALDQ  303

Query  1012  MYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYR  1191
             MYLG G+VAS +MD+L LAGS VGGGS +NWSAS +TP HV KEW E H LELFGSK Y 
Sbjct  304   MYLGNGIVASDNMDVLFLAGSTVGGGSAVNWSASFRTPSHVTKEWSEKHGLELFGSKNYE  363

Query  1192  HAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDG  1371
             +A++ VC +MGVQSE +DEGF NMVLRKGC  LGY V  IPRNA  DHYCGWC  GCKDG
Sbjct  364   NALDVVCEKMGVQSEFDDEGFNNMVLRKGCEGLGYQVGNIPRNAPSDHYCGWCCMGCKDG  423

Query  1372  KKKGTSETWLADLVDSGNGVIFPECEAVKVVHNK-KT--GREQAAGVMFVYQNN-GAKEF  1539
             +KKGT ETWL DLV+S NG I  ECEA+KV+  + KT  GR+ A GV F ++N  G +E 
Sbjct  424   RKKGTLETWLVDLVESKNGAILSECEALKVITTEGKTVNGRKMATGVAFAFRNEEGGQEI  483

Query  1540  CFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPE  1719
               V+++VTV ACGA+CTP LLK SGL+N NIG+NLH+HPVV AWGYFP+     +WPE E
Sbjct  484   GIVEAKVTVTACGAMCTPQLLKKSGLKNKNIGKNLHVHPVVMAWGYFPE----DSWPETE  539

Query  1720  KKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRT  1899
             K+S++GGIMTAMSKVV+NFE SGYGA+IQTPSLHPG+FSA+MPW+SG D K RM ++SRT
Sbjct  540   KRSHKGGIMTAMSKVVSNFETSGYGAVIQTPSLHPGLFSAVMPWVSGKDFKDRMVKYSRT  599

Query  1900  AILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGK  2079
             A +FALARDK  G   SP  ISY +   D+ +L+ G+E+VLRILAAAGAEEIGT HR G 
Sbjct  600   AHVFALARDKGRGTIASPSDISYKLDDLDRENLREGIERVLRILAAAGAEEIGTHHRDGG  659

Query  2080  ILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEV  2259
             +LK KGASR+E + FVE+ES R L NLST I SAHQMGSCRMGVD   S V+P GETWEV
Sbjct  660   VLKVKGASREEFEGFVERESMRPLRNLSTPIASAHQMGSCRMGVDSGGSGVDPRGETWEV  719

Query  2260  EGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
             EGLF+ADSSVFPTALGVNPMVTVQAIAYCTAQSVL+ L
Sbjct  720   EGLFVADSSVFPTALGVNPMVTVQAIAYCTAQSVLEIL  757



>ref|XP_003629014.1| GMC-type oxidoreductase, putative [Medicago truncatula]
 gb|AET03490.1| long-chain-alcohol oxidase FAO1-like protein [Medicago truncatula]
Length=810

 Score =   852 bits (2201),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/758 (60%), Positives = 573/758 (76%), Gaps = 16/758 (2%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
             LSP  M ++ ++ DT LP++     AA  D+ +  F++TSAS+AGTP+ VA ++SE+L+H
Sbjct  60    LSPTQMKSLVALCDTMLPSIKDNNVAASSDEFLNNFYRTSASMAGTPELVANLVSEKLKH  119

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  480
             P   LL+L LWLLST  GTL+LCG AS+S++FP+  S+P++SP KR +++ SWS  Y++ 
Sbjct  120   PSTWLLKLTLWLLSTWFGTLILCGIASISTKFPFFHSYPKLSPEKRQKVMLSWSVSYLRP  179

Query  481   LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMT  660
             L+  +  +K++ LL FF+QV+E   N SWKAI Y GPD +     A +  K +    H T
Sbjct  180   LRMLFRTIKLLTLLVFFTQVDEEKNNPSWKAIGYSGPDQEFK---AQRKNKIL----HKT  232

Query  661   LSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVS---PCIQQK  831
              S+E ++ +ED    + E ++GPL++G++NLN  PR  + D L++ GFPVS   P  +  
Sbjct  233   -SKEGRQEKEDC-DHDDEEVIGPLYEGLVNLNY-PRDIISDSLRRFGFPVSVTPPTNKAS  289

Query  832   GSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDE  1011
                +PS VI+CDAVVVGSGSGGGV+AGVLA +G+KVLVLEKG YFAR++LSLLEG +LD+
Sbjct  290   TISSPSLVIQCDAVVVGSGSGGGVVAGVLAKSGYKVLVLEKGSYFARNNLSLLEGPTLDQ  349

Query  1012  MYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYR  1191
             MYL  GL+A+ DM +L+LAGS VGGGS INWSASI+TP HV KEW + H+LELF S+ Y+
Sbjct  350   MYLANGLIATDDMSVLVLAGSTVGGGSAINWSASIKTPSHVCKEWCDRHELELFESELYK  409

Query  1192  HAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDG  1371
              AM+ VC +MGVQSE E+EGF N +LRKGC E+GYPV  IPRNA  DHYCGWC  GCKDG
Sbjct  410   EAMDAVCEKMGVQSEFEEEGFNNAILRKGCQEMGYPVSNIPRNAPPDHYCGWCCLGCKDG  469

Query  1372  KKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTG--REQAAGVMFVYQNNGAKEFCF  1545
             KKKGTSETWL DLV SGNG I P CEA++V++ +K G  R+ A GV F    NG K+ C 
Sbjct  470   KKKGTSETWLVDLVKSGNGAILPNCEAIQVLYREKKGTDRKIAKGVAFEIDYNGKKDICV  529

Query  1546  VKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGS-KAWPEPEK  1722
             V+S+VT++ACGALCTPSLLK SGL+N NIGRNLHLHPV  AWGYFPDAP S + WPE  K
Sbjct  530   VESKVTIVACGALCTPSLLKRSGLKNENIGRNLHLHPVTMAWGYFPDAPSSPELWPEGHK  589

Query  1723  KSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTA  1902
             KSY+GGIMTAMS VVA+F  +GYGA+IQTPSLHPG+FS +MPW SG DIK RM++FSRTA
Sbjct  590   KSYEGGIMTAMSTVVADFNATGYGAVIQTPSLHPGLFSVLMPWSSGMDIKDRMRKFSRTA  649

Query  1903  ILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKI  2082
              +FALARD+ SG   SP  ISY M+  DK +L  G+EKVLRILAAAGAEEIGT +  G+ 
Sbjct  650   HVFALARDQGSGTVDSPTRISYQMKNVDKENLHKGIEKVLRILAAAGAEEIGTHNNKGRS  709

Query  2083  LKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVE  2262
             L  K  S  E ++FV++ESS  L +LST + SAHQMGSCRMG +P+ SVVN  GETWEVE
Sbjct  710   LNVKEVSYHEFEKFVKEESSMPLTDLSTPVCSAHQMGSCRMGTNPKESVVNQTGETWEVE  769

Query  2263  GLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             GL+LAD+SVFPTALGVNPMVTVQAIAYCTAQ VL+ LK
Sbjct  770   GLYLADTSVFPTALGVNPMVTVQAIAYCTAQHVLEVLK  807



>gb|AES95453.2| long-chain-alcohol oxidase FAO1-like protein [Medicago truncatula]
Length=831

 Score =   852 bits (2202),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/763 (58%), Positives = 576/763 (75%), Gaps = 22/763 (3%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
             LS   M ++T++ DT LP+++     + DD+S   F++ SAS+AGTP+R+  +ISERL H
Sbjct  75    LSIKQMKSLTALCDTILPSINDFVPVSDDDESAATFYRISASMAGTPERLGGIISERLIH  134

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  480
             P  ++L+L LW LST +GT++LCG   LS++FP++ +FP++  HKR +I++SWS  + + 
Sbjct  135   PMTMVLKLVLWFLSTWLGTIILCGMGCLSTKFPFIHTFPDLPLHKRQQIMQSWSLSFFRH  194

Query  481   LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMT  660
             L+ F+  +K++ LL FF+QV+E+ +N SWKAI YCGPDP+   +          +E+   
Sbjct  195   LRMFFRTIKLLTLLIFFTQVDESEDNCSWKAIGYCGPDPEFKAQLKNHFLHGACKEK---  251

Query  661   LSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSG  840
               ++ ++G+ D      EL +GPL+KG+++LN  PR  + D L++ GFPVS   +++ + 
Sbjct  252   --QDSEEGDNDA-----ELAIGPLYKGLVHLNY-PRDIIVDTLRRFGFPVSVSRRKQKTA  303

Query  841   ----NPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslD  1008
                 +PS V++CDAVVVGSGSGGGV+AG+LANAG+KVLVLEKG Y AR++LSLLEG ++D
Sbjct  304   PSLSSPSLVVQCDAVVVGSGSGGGVVAGILANAGYKVLVLEKGGYSARNNLSLLEGPTMD  363

Query  1009  EMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEY  1188
             +MY  GGLVA+ DM+I +L+GS VGGGS INWSA I+TP HV KEW E H LELF S+ Y
Sbjct  364   QMYQAGGLVATDDMNIFILSGSTVGGGSAINWSACIKTPQHVCKEWCEKHGLELFESELY  423

Query  1189  RHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKD  1368
             + AME VC +MGVQSE+E+EGF N +LRKGC E+GYPV  IPRNAS DHYCGWC  GCKD
Sbjct  424   QEAMEAVCEKMGVQSEIEEEGFNNAILRKGCQEMGYPVNNIPRNASPDHYCGWCCLGCKD  483

Query  1369  GKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKK--TGREQAAGVMFVYQNNGAKEFC  1542
             GKKKGTSETWL DLV SGNG I P C A+KV+H KK  +G + A GV F ++  G+K+ C
Sbjct  484   GKKKGTSETWLVDLVKSGNGAILPGCTAMKVLHKKKKGSGEKTARGVAFEFEYRGSKDIC  543

Query  1543  FVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAP-----GSKAW  1707
              V+S+VT++ACG L TPSLLK SGL+N NIGRNLHLHPVV AWGYFPD P      S+ W
Sbjct  544   VVESKVTIVACGTLNTPSLLKRSGLKNNNIGRNLHLHPVVMAWGYFPDTPVEPTGASEVW  603

Query  1708  PEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQR  1887
             PE  KKSY+GGIMTAMS VVA FE+SGYGA+IQTP+LHPG FS +MPW+SG+DIK RM++
Sbjct  604   PETWKKSYEGGIMTAMSPVVAEFEKSGYGAVIQTPALHPGTFSIVMPWVSGSDIKDRMRK  663

Query  1888  FSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCH  2067
             FSRTA +FALARD+ SG   SP  ISY M+  D+ +L+ G++KVLRILAAAGAEEIGT H
Sbjct  664   FSRTAHIFALARDQGSGNVHSPSRISYEMEDVDEENLQKGIDKVLRILAAAGAEEIGTHH  723

Query  2068  RAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGE  2247
               G  L  K AS  E ++FV+KESSR L +LST + SAHQMGSCRMG +P+ SVV   GE
Sbjct  724   NKGNTLNVKNASYHEFEQFVKKESSRSLTDLSTPLCSAHQMGSCRMGSNPKESVVKETGE  783

Query  2248  TWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             TWEVE LF+AD+SVFPTALG+NPM+TVQ+IAYCTAQSVL+ LK
Sbjct  784   TWEVEDLFVADASVFPTALGMNPMITVQSIAYCTAQSVLQVLK  826



>ref|XP_011078909.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Sesamum indicum]
Length=755

 Score =   848 bits (2190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/750 (60%), Positives = 563/750 (75%), Gaps = 20/750 (3%)
 Frame = +1

Query  136   MATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIl  315
             M  ++++ DT LP+VDV     +     + F+QTSAS+  TP  VA ++  +++HPK+ L
Sbjct  18    MEALSALCDTLLPSVDV--DGQLHPSFHRQFYQTSASMTATPHHVAELLGGKIEHPKIYL  75

Query  316   lrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTFY  495
              RLA+ LLSTRIGT +LCG+ SL  +FPY Q+F E+   +R +I+RSWS     +L+  +
Sbjct  76    GRLAVGLLSTRIGTFVLCGRKSLCPKFPYFQTFSEVPYEEREQILRSWSTSNFLLLRILF  135

Query  496   LGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQ  675
               +K   LL FF+QVNE  EN+SWKAI YCGPDP       G +K  I +       EE+
Sbjct  136   TALKFFTLLLFFTQVNEKGENLSWKAIGYCGPDP-------GCAKTRILKTSGPQECEEK  188

Query  676   KKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVS-PCIQQKG--SGNP  846
             + G         + L GPL+KG+INL+Q  R +   +LQ LGFPVS P  + +   S NP
Sbjct  189   EDGASQ------DELFGPLYKGIINLDQS-REEALHKLQSLGFPVSTPHSRNRRLMSLNP  241

Query  847   SFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGG  1026
             SF+++CDAVVVGSGSGGGV+AGVLANAGHKVLVLEKG YFAR++LSLLEG ++D+MYLG 
Sbjct  242   SFIVKCDAVVVGSGSGGGVVAGVLANAGHKVLVLEKGSYFARTNLSLLEGEAMDQMYLGN  301

Query  1027  GLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMET  1206
             G++ + ++D+L++AGS VGGGSTINWSASI+TP HV++EW E H+LELFGS+ Y+ A++ 
Sbjct  302   GMLVTDNLDVLIVAGSTVGGGSTINWSASIRTPSHVMREWSEKHELELFGSEVYQQALDV  361

Query  1207  VCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGT  1386
             VC +MGVQSEVE EGF NM+LRKGC  LGYPVET+P NA  DHYCGWC FGCKDG+KKGT
Sbjct  362   VCQKMGVQSEVEHEGFNNMILRKGCENLGYPVETVPCNAPSDHYCGWCCFGCKDGRKKGT  421

Query  1387  SETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQAAGVMFVYQNNGAKEFCFVKSRVTV  1566
             SETWL DLV+SGNG I P CEA+KV+ +   G+++A GV F +     +E   V+S VTV
Sbjct  422   SETWLVDLVESGNGAILPTCEAIKVITDDINGKKRAIGVAFAFDTPFGREIGIVESDVTV  481

Query  1567  IACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIM  1746
             +A GA+CTP+LLK SGL+NPN+G+N H+HPVV AWGYFPD P   AWP PEK+SY+GGI+
Sbjct  482   VASGAICTPALLKRSGLKNPNVGKNFHIHPVVMAWGYFPD-PSPDAWPAPEKRSYEGGII  540

Query  1747  TAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARD  1926
             TAMSKVVANFE SGYGA+IQTPSLHPG+FS +MPW+SG D+K RM +FSRTA +FALARD
Sbjct  541   TAMSKVVANFETSGYGAIIQTPSLHPGIFSLLMPWISGIDMKNRMVKFSRTAHVFALARD  600

Query  1927  KTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASR  2106
             K SG   S   ISY ++  D+ +L  GLEK +RILAAAGAEEIGT H  G++LK K AS 
Sbjct  601   KGSGVITSETDISYKLEDFDQENLSKGLEKCMRILAAAGAEEIGTHHSTGRVLKVKQASE  660

Query  2107  DEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSS  2286
              E + FV++ES R L  LS  I SAHQMGSCRMGVDP+ SVVNP GETWEVEGLF+ADSS
Sbjct  661   KEFERFVKEESLRPLQKLSAPIASAHQMGSCRMGVDPKGSVVNPKGETWEVEGLFVADSS  720

Query  2287  VFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             VFPTALGVNPMVTVQA AYC AQSVL+ L+
Sbjct  721   VFPTALGVNPMVTVQATAYCIAQSVLQILE  750



>ref|XP_003517097.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
Length=809

 Score =   850 bits (2195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/778 (58%), Positives = 572/778 (74%), Gaps = 23/778 (3%)
 Frame = +1

Query  61    LFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTS  240
             L SNG+ E+    + +    LSP  M ++ ++ DT LP+VD        D+SV  F+Q S
Sbjct  44    LLSNGEREKKLQPLTN---TLSPRQMKSLYALCDTILPSVD--HFVDTSDESVTKFYQIS  98

Query  241   ASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPE  420
             AS+ GTP+R   MISE+L+HP   LL+  LWLLST  GTL+ CG    S+QFP++ ++P+
Sbjct  99    ASMTGTPERFGCMISEKLKHPLTGLLKFVLWLLSTWFGTLIFCGMGCFSTQFPFIHTYPD  158

Query  421   ISPHKRAEIVRSWSCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPD  600
             +   KR +I+RSWS  Y++  +  +  +K++ LL FF+Q++E+ +N++WKAI YCGPDP+
Sbjct  159   LPLQKRQQIMRSWSLSYLRHFRMLFRTIKLLTLLIFFTQIDESEDNVAWKAIGYCGPDPE  218

Query  601   SNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVF  780
                        +  R +   L    K G+ED    + E ++GPL+KG+++LN  PR    
Sbjct  219   -----------FKARLKSHFLDGTSKGGQEDKEDEDAEEVIGPLYKGLVHLNY-PRDITA  266

Query  781   DRLQKLGFPVSPCIQQ-KGSGN---PSFVIECDavvvgsgsgggviagvLANAGHKVLVL  948
             D L++LGFPVS   Q+ K + N   PS VI+CDAVVVGSGSGGGVIAGVLA AG+KVLVL
Sbjct  267   DALKRLGFPVSVIRQKHKAAANLSSPSLVIQCDAVVVGSGSGGGVIAGVLAKAGYKVLVL  326

Query  949   EKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPP  1128
             EKG Y AR++LSLLEG ++D+MYL GGLVAS DM + +L+GS VGGGS INWSA I+TP 
Sbjct  327   EKGGYSARNNLSLLEGPTMDQMYLNGGLVASDDMGVFILSGSTVGGGSAINWSACIKTPQ  386

Query  1129  HVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVET  1308
             HV KEW + H LELF S+ YR A+  VC +M VQSE+EDEGF N +LRKGC E+GYPV  
Sbjct  387   HVCKEWSDKHGLELFESELYREALNAVCEKMEVQSEIEDEGFNNAILRKGCQEMGYPVSN  446

Query  1309  IPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGRE  1488
             IPRN++ DHYCGWC  GCKDG+KKGTSETWL DLV SGNG I P CEA+KV+H KK GR+
Sbjct  447   IPRNSASDHYCGWCCMGCKDGRKKGTSETWLVDLVKSGNGAILPGCEAIKVLHKKKEGRD  506

Query  1489  Q--AAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVV  1662
             +  A GV F ++  G K+ C V+S+VT++ACGAL TP+LLK SGLRN NIGRNLHLHPV 
Sbjct  507   RKIARGVAFEFEYKGTKDICVVESKVTIVACGALSTPALLKKSGLRNQNIGRNLHLHPVA  566

Query  1663  FAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAI  1842
              AWGYFPDAP S+ WPE  KKSY+GGIMTAMS VVA FE+SGYGA+IQTPSLHPGMFS +
Sbjct  567   MAWGYFPDAPESEVWPEAYKKSYEGGIMTAMSTVVAEFEQSGYGAVIQTPSLHPGMFSIV  626

Query  1843  MPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVL  2022
              PW SG DI+ RM++FSRTA +FALARD+ SG   +P  ISY     D+ +LK G+EKVL
Sbjct  627   TPWTSGIDIRDRMRKFSRTAHIFALARDQGSGTVKAPDRISYKPAGVDEENLKKGIEKVL  686

Query  2023  RILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCR  2202
             RILAAAGAEEIGT H  G+ L  K     E ++FV++ESSR L +L+T + SAHQMGSCR
Sbjct  687   RILAAAGAEEIGTHHNKGRTLNVKQVRYHEFEKFVKEESSRSLTDLTTPLCSAHQMGSCR  746

Query  2203  MGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             MG +P+ S VN  GETWEVEGL++AD+SVFPTALGVNPMVTVQAIAYCTAQSV++ L+
Sbjct  747   MGSNPKQSAVNQTGETWEVEGLYVADTSVFPTALGVNPMVTVQAIAYCTAQSVVEVLR  804



>gb|KHN41766.1| Long-chain-alcohol oxidase FAO4A [Glycine soja]
Length=809

 Score =   849 bits (2194),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/778 (58%), Positives = 572/778 (74%), Gaps = 23/778 (3%)
 Frame = +1

Query  61    LFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTS  240
             L SNG+ E+    + +    LSP  M ++ ++ DT LP+VD        D+SV  F+Q S
Sbjct  44    LLSNGEREKKLQPLTN---TLSPRQMKSLYALCDTILPSVD--HFVDTSDESVTKFYQIS  98

Query  241   ASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPE  420
             AS+ GTP+R   MISE+L+HP   LL+  LWLLST  GTL+ CG    S+QFP++ ++P+
Sbjct  99    ASMTGTPERFGCMISEKLKHPLTGLLKFVLWLLSTWFGTLIFCGMGCFSTQFPFIHTYPD  158

Query  421   ISPHKRAEIVRSWSCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPD  600
             +   KR +I+RSWS  Y++  +  +  +K++ LL FF+Q++E+ +N++WKAI YCGPDP+
Sbjct  159   LPLQKRQQIMRSWSLSYLRHFRMLFRTIKLLTLLIFFTQIDESEDNVAWKAIGYCGPDPE  218

Query  601   SNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVF  780
                        +  R +   L    K G+ED    + E ++GPL+KG+++LN  PR    
Sbjct  219   -----------FKARLKSHFLDGTSKGGQEDKEDEDAEEVIGPLYKGLVHLNY-PRDITA  266

Query  781   DRLQKLGFPVSPCIQQ-KGSGN---PSFVIECDavvvgsgsgggviagvLANAGHKVLVL  948
             D L++LGFPVS   Q+ K + N   PS VI+CDAVVVGSGSGGGVIAGVLA AG+KVLVL
Sbjct  267   DALKRLGFPVSVIRQKHKAAANLSSPSLVIQCDAVVVGSGSGGGVIAGVLAKAGYKVLVL  326

Query  949   EKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPP  1128
             EKG Y AR++LSLLEG ++D+MYL GGLVAS DM + +L+GS VGGGS INWSA I+TP 
Sbjct  327   EKGGYSARNNLSLLEGPTMDQMYLNGGLVASDDMGVFILSGSTVGGGSAINWSACIKTPQ  386

Query  1129  HVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVET  1308
             HV KEW + H LELF S+ YR A+  VC +M VQSE+EDEGF N +LRKGC E+GYPV  
Sbjct  387   HVCKEWSDKHGLELFESELYREALNAVCEKMEVQSEIEDEGFNNAILRKGCQEMGYPVSN  446

Query  1309  IPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGRE  1488
             IPRN++ DHYCGWC  GCKDG+KKGTSETWL DLV SGNG I P CEA+KV+H KK GR+
Sbjct  447   IPRNSAADHYCGWCCMGCKDGRKKGTSETWLVDLVKSGNGAILPGCEAIKVLHKKKEGRD  506

Query  1489  Q--AAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVV  1662
             +  A GV F ++  G K+ C V+S+VT++ACGAL TP+LLK SGLRN NIGRNLHLHPV 
Sbjct  507   RKIARGVAFEFEYKGTKDICVVESKVTIVACGALSTPALLKKSGLRNQNIGRNLHLHPVA  566

Query  1663  FAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAI  1842
              AWGYFPDAP S+ WPE  KKSY+GGIMTAMS VVA FE+SGYGA+IQTPSLHPGMFS +
Sbjct  567   MAWGYFPDAPESEVWPEAYKKSYEGGIMTAMSTVVAEFEQSGYGAVIQTPSLHPGMFSIV  626

Query  1843  MPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVL  2022
              PW SG DI+ RM++FSRTA +FALARD+ SG   +P  ISY     D+ +LK G+EKVL
Sbjct  627   TPWTSGIDIRDRMRKFSRTAHIFALARDQGSGTVKAPDRISYKPAGVDEENLKKGIEKVL  686

Query  2023  RILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCR  2202
             RILAAAGAEEIGT H  G+ L  K     E ++FV++ESSR L +L+T + SAHQMGSCR
Sbjct  687   RILAAAGAEEIGTHHNKGRTLNVKQVRYHEFEKFVKEESSRSLTDLTTPLCSAHQMGSCR  746

Query  2203  MGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             MG +P+ S VN  GETWEVEGL++AD+SVFPTALGVNPMVTVQAIAYCTAQSV++ L+
Sbjct  747   MGSNPKQSAVNQTGETWEVEGLYVADTSVFPTALGVNPMVTVQAIAYCTAQSVVEVLR  804



>ref|XP_011028488.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Populus euphratica]
Length=806

 Score =   843 bits (2178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/772 (59%), Positives = 578/772 (75%), Gaps = 25/772 (3%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAV-DVPQHAAVDDD----SVKLFFQTSASIAGTPQRVAWMIS  285
             LS   M ++T++ DT  P+V +    AA  DD    S+  F+Q+SAS+AGTPQRV  +  
Sbjct  41    LSSREMESLTALCDTLFPSVYNSSMIAASADDGSTNSISTFYQSSASMAGTPQRVGELFC  100

Query  286   ERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSC  465
             ER+QHPK  L+RL L+LLST IGT +LCG  S+S  FPY Q F +IS  KR +IV SW+ 
Sbjct  101   ERVQHPKKWLIRLTLYLLSTWIGTFILCGLPSISPSFPYFQRFSQISQSKREQIVFSWAT  160

Query  466   CYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITR  645
              +  +L+  +  +K+++ L FFSQV+E NEN++WKAI Y GPDP + K+         T 
Sbjct  161   SFFYLLRMLFKSIKLVIPLVFFSQVDEKNENLTWKAIGYPGPDPAALKRQTQ------TC  214

Query  646   EQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVS----  813
              Q  TL    K  ++D      E L GPL++G+++LN  PR +V D L+++GFPVS    
Sbjct  215   GQPETLYASLKDDDDDEHDCKEEHLFGPLYRGLVDLNL-PRDRVADSLRQIGFPVSILRG  273

Query  814   ---PCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARssls  984
                   +   + NPS VI+CDAVVVGSGSGGGV+AGVLA AG+KVLVLEKG YFAR++LS
Sbjct  274   KNIDSSRDFSTSNPSLVIKCDAVVVGSGSGGGVVAGVLAKAGYKVLVLEKGNYFARNNLS  333

Query  985   llegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKL  1164
             LLEG S+D+MYLGGG++AS DM +++LAGS VGGGSTINWSASI+TP HV+ EW E++ L
Sbjct  334   LLEGPSMDQMYLGGGMLASDDMGVVILAGSTVGGGSTINWSASIKTPQHVINEWSESYDL  393

Query  1165  ELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCG  1344
             ELF SK Y+ A++ VC +MGVQS++++EGF + VLR+GC ELGYPV TIPRN+  DHYCG
Sbjct  394   ELFDSKLYKEALDAVCEKMGVQSDIDEEGFNSAVLRRGCEELGYPVNTIPRNSVPDHYCG  453

Query  1345  WCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQ--AAGVMFVYQ  1518
             WC FGC+DG+KK T ETWL D+V+SGNG I P C+A+KV+H +K G+++  A+GV F ++
Sbjct  454   WCCFGCRDGRKKDTCETWLKDMVNSGNGAILPGCKAIKVLHERKKGKDRSTASGVAFGFE  513

Query  1519  NNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGS  1698
              NG K+ C V+S+VTV+A GAL TP+LLK SGL+N NIG++LHLHPV  AWGYFP+AP S
Sbjct  514   YNGMKDLCVVESKVTVVAGGALSTPALLKASGLKNANIGKHLHLHPVTMAWGYFPEAPNS  573

Query  1699  KA-WPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKT  1875
              A WPE +KKSY+GGIMTAMS VVAN  +SGYGA+IQTPSLHPGMFS ++PW+SG D+K 
Sbjct  574   TAAWPEEQKKSYEGGIMTAMSTVVANVNKSGYGAVIQTPSLHPGMFSGLIPWISGADMKR  633

Query  1876  RMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEI  2055
             RM RFSRTA +FALARD+ SG   SP SI+Y M   D+ +L+ GLEK LRILAAAGAEEI
Sbjct  634   RMFRFSRTAHVFALARDRGSGTVNSPSSINYRMDAEDEKNLQEGLEKTLRILAAAGAEEI  693

Query  2056  GTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVN  2235
             GT H  GKIL  K  S  E + FV++ES+R L +L+  I SAHQMGSCRMGV+P+ S VN
Sbjct  694   GTHHSTGKILNVKKVSYREFERFVKEESARPLRDLTGQICSAHQMGSCRMGVNPKESAVN  753

Query  2236  PMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL---KTH  2382
              MGE WEVEGLF+AD+SVFPTALGVNPMVTVQAIAYCTAQSV++ L   +TH
Sbjct  754   QMGEAWEVEGLFVADTSVFPTALGVNPMVTVQAIAYCTAQSVVQLLSRKRTH  805



>ref|XP_003534338.2| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
Length=807

 Score =   843 bits (2177),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/781 (58%), Positives = 575/781 (74%), Gaps = 25/781 (3%)
 Frame = +1

Query  61    LFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTS  240
             L SNG+ E+    + +    LSP  M ++T++ DT LP+V         D+SV  F+Q S
Sbjct  38    LLSNGEREKKLQPLTNS---LSPRQMKSLTALCDTILPSV-ADHFVDSSDESVTKFYQIS  93

Query  241   ASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPE  420
             AS+ GTP+R   MISERL+HP   LL+  LWLLST  GTL+ CG   LS+QFP++ ++P 
Sbjct  94    ASMTGTPERFGGMISERLKHPLTGLLKFVLWLLSTWYGTLIFCGIGCLSTQFPFIHAYPH  153

Query  421   ISPHKRAEIVRSWSCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPD  600
             +S  KR +I+RSWS  Y++  +  +  +K++ LL FF+Q++E+ +N++WKAI YCGPDP+
Sbjct  154   LSLQKRQKIMRSWSLSYLRHFRMLFRTIKLLTLLIFFTQIDESEDNVAWKAIGYCGPDPE  213

Query  601   SNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPEL-LLGPLHKGVINLNQEPRRQV  777
                +           + H      +  G+ED         ++GPL+KG+++LN  P+   
Sbjct  214   FKAQ----------LKNHFLDGTSKGGGQEDKEEDEDAEEMIGPLYKGLVHLNY-PQDIT  262

Query  778   FDRLQKLGFPVSPCIQQK---GSGN---PSFVIECDavvvgsgsgggviagvLANAGHKV  939
              D L++ GFPVS  I++K    + N   PS VI+CDAVVVGSGSGGGVIAGVLA AG+KV
Sbjct  263   ADALRRFGFPVS-VIRRKHKAAAANLSCPSLVIQCDAVVVGSGSGGGVIAGVLAKAGYKV  321

Query  940   LVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQ  1119
             LVLEKG Y A+++LSLLEG ++D+MYL GGLVAS DM + +L+GS VGGGS INWSA I+
Sbjct  322   LVLEKGGYSAKNNLSLLEGPTMDQMYLNGGLVASDDMGVFILSGSTVGGGSAINWSACIK  381

Query  1120  TPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYP  1299
             TP HV KEW + H LELF S+ YR A++ VC +MGVQSE+EDEGF N +LRKGC E+GYP
Sbjct  382   TPQHVCKEWCDKHGLELFESELYREALDAVCGKMGVQSEIEDEGFNNAILRKGCQEMGYP  441

Query  1300  VETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKT  1479
             V  IPRN+  +HYCGWC  GCKDG+KKGTSETWL DLV SGNG I P CEA+KV+H KK 
Sbjct  442   VNNIPRNSPSNHYCGWCCMGCKDGRKKGTSETWLVDLVKSGNGAILPGCEAIKVLHKKKE  501

Query  1480  GREQ--AAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLH  1653
             G+++  A GV F ++  G K+ C V+S+VT++ACGAL TP+LLK SGLRN NIG+NLHLH
Sbjct  502   GKDRKIARGVAFEFEYKGTKDVCVVESKVTIVACGALSTPALLKRSGLRNQNIGKNLHLH  561

Query  1654  PVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMF  1833
             PVV AWGYFPDAP S+ WPE  KKSY+GGIMTAMS VVA FE+SGYGA+IQTPSLHPGMF
Sbjct  562   PVVMAWGYFPDAPESEVWPEAYKKSYEGGIMTAMSTVVAEFEQSGYGAVIQTPSLHPGMF  621

Query  1834  SAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLE  2013
             S + PW SG DI+ RM++FSRTA +FALARD+ SG   +P  ISY     D+ +LK G+E
Sbjct  622   SIVTPWTSGIDIRDRMRKFSRTAHIFALARDQGSGTVKAPDRISYKPADVDEENLKKGIE  681

Query  2014  KVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMG  2193
             KVLRILAAAGAEEIGT H  G+ L  K  S  E ++FV++ESSR L +L+T + SAHQMG
Sbjct  682   KVLRILAAAGAEEIGTHHNKGRTLNVKQVSYHEFEKFVKEESSRSLTDLTTPLCSAHQMG  741

Query  2194  SCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
             SCRMG +P+ SVVNP GETWEVEGL++AD+SVFPTALGVNPMVTVQAIAYCTAQSV++ L
Sbjct  742   SCRMGSNPKQSVVNPTGETWEVEGLYVADASVFPTALGVNPMVTVQAIAYCTAQSVVEVL  801

Query  2374  K  2376
             K
Sbjct  802   K  802



>ref|XP_003547818.2| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
 gb|KHN35528.1| Long-chain-alcohol oxidase FAO4A [Glycine soja]
Length=828

 Score =   842 bits (2174),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/762 (59%), Positives = 575/762 (75%), Gaps = 22/762 (3%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQH---AAVDDDSVKLFFQTSASIAGTPQRVAWMISER  291
             LSP  M ++ ++ DT LP+++   +    + DD+SV  F++TSAS+AGTP+ +  +ISE+
Sbjct  75    LSPRQMKSLVALCDTLLPSINNNSNNVCGSDDDESVANFYKTSASMAGTPEHLGILISEK  134

Query  292   LQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCY  471
             L+HP   LL L+LWLLST  GT +LCG  SLS++FP+  S+PE+S  K+ ++++SWS  Y
Sbjct  135   LRHPSTWLLLLSLWLLSTWFGTFILCGMLSLSTKFPFFHSYPELSLLKQQKVMQSWSLSY  194

Query  472   IKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITRE-  648
             ++ L+  +  +K++ LL FF+Q++E  +N SWKAI+YCGPDP+   +       + T+E 
Sbjct  195   LRPLRMLFRTIKLLTLLVFFTQLDEAEDNPSWKAINYCGPDPEFKSQ---LKNHFFTKER  251

Query  649   -QHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQ  825
              Q     E+   G EDV         GPL+KG+I +N  PR  + D L+++GF VS   +
Sbjct  252   GQEEKEDEDYDDGTEDV--------RGPLYKGLIYINY-PRDIITDSLRRVGFSVSATPK  302

Query  826   QKGSGN---PSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslslleg  996
             +  + +   PS VI+CDAVVVGSGSGGGV+AGVLANAG+KVLVLEKG Y AR++LSLLEG
Sbjct  303   KTKASSLSSPSLVIQCDAVVVGSGSGGGVVAGVLANAGYKVLVLEKGSYSARNNLSLLEG  362

Query  997   sslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFG  1176
              S+D+MYL  GLVA+KDM +L+LAGS VGGGS INWSASI+TP HV KEW + H+LELF 
Sbjct  363   PSMDQMYLSNGLVATKDMSVLILAGSTVGGGSAINWSASIRTPQHVCKEWCDGHELELFE  422

Query  1177  SKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSF  1356
             SK Y+ A++ VC +MGVQSE++DEGF N VLR+GCLE+GYPV  IPRNAS DHYCGWC  
Sbjct  423   SKLYKEALDVVCEKMGVQSEIDDEGFNNAVLRRGCLEMGYPVCDIPRNASSDHYCGWCCM  482

Query  1357  GCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQ--AAGVMFVYQNNGA  1530
             GCKDG+KKGT ETWL DLV SGNG I P CEA++V+H KK GR++  A GV F  +  G 
Sbjct  483   GCKDGRKKGTLETWLVDLVKSGNGAIIPSCEAIQVLHKKKKGRDRKIARGVAFAIEYKGK  542

Query  1531  KEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWP  1710
             ++ C V+S+VTV+ACGAL TP+LLK SGL+N NIGRNLHLHPV  AWGYFPD+   + WP
Sbjct  543   RDICVVESKVTVVACGALSTPALLKRSGLKNENIGRNLHLHPVAMAWGYFPDSLSPELWP  602

Query  1711  EPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRF  1890
             E  KKSY+GGIMTAMS VVA F++SGYGA+IQTP+LHPGMFS +MPW SG DIK RM++F
Sbjct  603   EKHKKSYEGGIMTAMSTVVAQFDKSGYGAVIQTPALHPGMFSILMPWTSGKDIKDRMRKF  662

Query  1891  SRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHR  2070
             SRTA +FALARD+ SG   SP  ISY ++  DK +LK GLEKVLRILAAAGAEEIGT + 
Sbjct  663   SRTAHVFALARDQGSGTVNSPSHISYQLKDVDKENLKIGLEKVLRILAAAGAEEIGTHNN  722

Query  2071  AGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGET  2250
              G+ +  K  S  E ++FV++ESS  L ++ST + SAHQMGSC+MG +PR SVVN MGET
Sbjct  723   KGRSINVKQVSYHEFEKFVKEESSMSLTDISTPLCSAHQMGSCKMGTNPRESVVNQMGET  782

Query  2251  WEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             WEVEGL+LAD+SVFPTALGVNPMVTVQAI+YCTAQ VL+ L+
Sbjct  783   WEVEGLYLADTSVFPTALGVNPMVTVQAISYCTAQYVLEVLR  824



>ref|XP_007156339.1| hypothetical protein PHAVU_003G278200g [Phaseolus vulgaris]
 gb|ESW28333.1| hypothetical protein PHAVU_003G278200g [Phaseolus vulgaris]
Length=814

 Score =   841 bits (2172),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/781 (59%), Positives = 579/781 (74%), Gaps = 18/781 (2%)
 Frame = +1

Query  61    LFSNGKAERGNDGVYSGGCPL----SPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLF  228
             L ++G A+ G++       PL    SP  M ++ ++ DT +P++D     + DD+SV  F
Sbjct  39    LHAHGDADVGDEERDKHQKPLTNSLSPRQMKSLVALCDTIIPSIDNNVVRSSDDESVANF  98

Query  229   FQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQ  408
             ++TSAS+AGTPQ +  +ISE+++HP   LL L LWLLST  GTL+LCG AS+SS+FP+  
Sbjct  99    YKTSASMAGTPQHLGKLISEKVKHPSTWLLLLTLWLLSTWFGTLILCGMASVSSRFPFFH  158

Query  409   SFPEISPHKRAEIVRSWSCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCG  588
             S+PE+S  KR  +++SWS  Y++ L+ F+  +K++ LL+FF+QV+E  EN SWKAI YCG
Sbjct  159   SYPEMSLLKRQRVMQSWSLSYLRPLRMFFRTIKLLTLLTFFTQVDEAEENPSWKAIGYCG  218

Query  589   PDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPR  768
             PDP+     A     ++ R      S+E++  ++D      E   GPLHKG+++LN  PR
Sbjct  219   PDPEFK---AQLKNNFLHRT-----SKEEQHQKKDDDDDEEEEFRGPLHKGLVHLNY-PR  269

Query  769   RQVFDRLQKLGFPVSPCIQQKGSGN---PSFVIECDavvvgsgsgggviagvLANAGHKV  939
               + + L++ GF VS   ++  + N   PS VI+CDAVVVGSGSGGGV AGVLANAG+KV
Sbjct  270   DMIKNSLRRFGFSVSTISKKHEASNLSSPSLVIQCDAVVVGSGSGGGVAAGVLANAGYKV  329

Query  940   LVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQ  1119
             LVLEKG Y AR++LSLLEG S+D+MYL  GLVA+KDM +L+LAGS VGGGS +NWSASI+
Sbjct  330   LVLEKGSYCARNNLSLLEGPSMDQMYLSNGLVATKDMSVLILAGSTVGGGSAVNWSASIK  389

Query  1120  TPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYP  1299
             TP HV KEW + H+LELF SK YR AM+ VC +MGVQSEVE+EGF N VLR+GCLE+GY 
Sbjct  390   TPQHVCKEWCDLHELELFESKLYREAMDAVCGKMGVQSEVEEEGFNNEVLRRGCLEMGYH  449

Query  1300  VETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKT  1479
             V  IPRNAS DHYCGWC  GCKDG KK TSETWL DLV SGNG I P CEA++V+H KK 
Sbjct  450   VCNIPRNASSDHYCGWCCMGCKDGNKKSTSETWLVDLVKSGNGAIIPSCEAIQVLHKKKK  509

Query  1480  GREQ--AAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLH  1653
             G E+  A GV F  +  G K+ C V+S+VT++ACGAL TP+LLK SGL+N NIG+NLHLH
Sbjct  510   GSEKKTARGVAFAIEYKGKKDICVVESKVTIVACGALSTPALLKKSGLKNENIGKNLHLH  569

Query  1654  PVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMF  1833
             PV  AWGYFPD+   K WPE  KKSY+GGIMTAMS VVA F+++GYGA+IQTPSLHPGMF
Sbjct  570   PVAMAWGYFPDSSSPKMWPEKHKKSYEGGIMTAMSTVVAQFDKTGYGAVIQTPSLHPGMF  629

Query  1834  SAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLE  2013
             S +MPW SG D+K RM +FSRTA +FALARD+ SG   SP  ISY ++  DK +L+ G+E
Sbjct  630   SILMPWTSGKDMKDRMHKFSRTAHVFALARDQGSGTVNSPSLISYELKDVDKENLETGIE  689

Query  2014  KVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMG  2193
             KVLRILAAAGAEEIGT +  G+ +  K  S  E ++FV++ESS  L +L+T + SAHQMG
Sbjct  690   KVLRILAAAGAEEIGTHNNKGRSINVKQVSYHEFEKFVKEESSMSLTDLTTPLCSAHQMG  749

Query  2194  SCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
             SC+MG +P  SVVN MGETWEVEGL+LAD+SVFPTALGVNPMVTVQAIAYCTAQ V + L
Sbjct  750   SCKMGTNPSDSVVNQMGETWEVEGLYLADTSVFPTALGVNPMVTVQAIAYCTAQYVAEVL  809

Query  2374  K  2376
             +
Sbjct  810   R  810



>ref|XP_006385149.1| alcohol oxidase-related family protein [Populus trichocarpa]
 gb|ERP62946.1| alcohol oxidase-related family protein [Populus trichocarpa]
Length=748

 Score =   836 bits (2159),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/767 (59%), Positives = 571/767 (74%), Gaps = 38/767 (5%)
 Frame = +1

Query  136   MATVTSISDTFLPAV-DVPQHAAVDDD----SVKLFFQTSASIAGTPQRVAWMISERLQH  300
             M ++T+I DT  P+V +    AA  DD    S+  F+Q+SAS+AGTPQRV  +  +R+QH
Sbjct  1     MESLTAICDTLFPSVYNSSMMAASADDGSTNSISTFYQSSASMAGTPQRVGELFCDRVQH  60

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  480
             PK  L+RL L+LLST IGT +LCG  S+S  FPY   F +IS  KR +IV SW+  +  +
Sbjct  61    PKKWLIRLTLYLLSTWIGTFILCGLPSISPSFPYFLRFSQISQSKREQIVFSWATSFFYL  120

Query  481   LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMT  660
             L+  +  +K+++ L FFSQV+E NEN++WKAI Y GPDP + K+          + Q   
Sbjct  121   LRMLFKSIKLVIPLVFFSQVDEKNENLTWKAIGYPGPDPAALKR----------QTQTCG  170

Query  661   LSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVS-------PC  819
             L E     E          L GPL++G+++LN  PR +V D L+++GFPVS         
Sbjct  171   LPETLYAKEH---------LFGPLYRGLVDLNL-PRDRVADSLRQIGFPVSIRRGKDIDS  220

Query  820   IQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegs  999
              +   + NPS VI+CDAVVVGSGSGGGV+AGVLA AG+KVLVLEKG YFAR++LSLLEG 
Sbjct  221   SRDFSTSNPSLVIKCDAVVVGSGSGGGVVAGVLAKAGYKVLVLEKGNYFARNNLSLLEGP  280

Query  1000  slDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGS  1179
             S+D+MYLG G++AS DM +++LAGS VGGGSTINWSASI+TP HV+ EW ET+ LELF S
Sbjct  281   SMDQMYLGAGMLASDDMGVVVLAGSTVGGGSTINWSASIKTPQHVINEWSETYDLELFDS  340

Query  1180  KEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFG  1359
             K Y+ A++ VC +MGVQS++++EGF + VLR+GC ELGYPV TIPRN+  DHYCGWC FG
Sbjct  341   KLYKEALDAVCEKMGVQSDIDEEGFNSAVLRRGCEELGYPVNTIPRNSVPDHYCGWCCFG  400

Query  1360  CKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQ--AAGVMFVYQNNGAK  1533
             CKDG+KKGT ETWL D+V+SGNG I P CEA+KV+H +K G+++  A+GV F +++NG K
Sbjct  401   CKDGRKKGTCETWLKDMVNSGNGAILPGCEAIKVLHERKKGKDRSTASGVAFGFEHNGMK  460

Query  1534  EFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAP-GSKAWP  1710
             + C V+S+VT++A GAL TP+LLK SGL+N NIG++LHLHPV  AWGYFP+AP  + AWP
Sbjct  461   DLCVVESKVTIVAGGALSTPALLKASGLKNANIGKHLHLHPVTMAWGYFPEAPISTTAWP  520

Query  1711  EPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRF  1890
             E +KKSY+GGIMTAMS VVAN  +SGYGA+IQTPSLHPGMFS ++PW+SG D+K RM RF
Sbjct  521   EEQKKSYEGGIMTAMSTVVANVNKSGYGAVIQTPSLHPGMFSGLIPWISGADMKRRMCRF  580

Query  1891  SRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHR  2070
             SRTA +FALARD+ SG   SP SI+Y M   D+ +L+ GLEK LRILAAAGAEEIGT H 
Sbjct  581   SRTAHVFALARDRGSGTVNSPSSINYRMDAEDEKNLQEGLEKTLRILAAAGAEEIGTHHS  640

Query  2071  AGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGET  2250
              GK L  K  S  E + FV++ES+R L +L+  I SAHQMGSCRMGV+P+ S VN MGE 
Sbjct  641   TGKSLNVKKVSYREFERFVKEESARPLRDLTGQICSAHQMGSCRMGVNPKESAVNQMGEA  700

Query  2251  WEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL---KTH  2382
             WEVEGLF+AD+SVFPTALGVNPMVTVQAIAYCTAQSV++ L   +TH
Sbjct  701   WEVEGLFVADTSVFPTALGVNPMVTVQAIAYCTAQSVVQLLSRKRTH  747



>ref|XP_003612495.1| GMC-type oxidoreductase, putative [Medicago truncatula]
Length=853

 Score =   839 bits (2168),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/785 (57%), Positives = 576/785 (73%), Gaps = 44/785 (6%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
             LS   M ++T++ DT LP+++     + DD+S   F++ SAS+AGTP+R+  +ISERL H
Sbjct  75    LSIKQMKSLTALCDTILPSINDFVPVSDDDESAATFYRISASMAGTPERLGGIISERLIH  134

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  480
             P  ++L+L LW LST +GT++LCG   LS++FP++ +FP++  HKR +I++SWS  + + 
Sbjct  135   PMTMVLKLVLWFLSTWLGTIILCGMGCLSTKFPFIHTFPDLPLHKRQQIMQSWSLSFFRH  194

Query  481   LKTFYLGMKVMVLLSFFSQ----------------------VNENNENISWKAIDYCGPD  594
             L+ F+  +K++ LL FF+Q                      V+E+ +N SWKAI YCGPD
Sbjct  195   LRMFFRTIKLLTLLIFFTQYKILFLLGNDLLYSSLHYTYFQVDESEDNCSWKAIGYCGPD  254

Query  595   PDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQ  774
             P+   +          +E+     ++ ++G+ D      EL +GPL+KG+++LN  PR  
Sbjct  255   PEFKAQLKNHFLHGACKEK-----QDSEEGDNDA-----ELAIGPLYKGLVHLNY-PRDI  303

Query  775   VFDRLQKLGFPVSPCIQQKGSG----NPSFVIECDavvvgsgsgggviagvLANAGHKVL  942
             + D L++ GFPVS   +++ +     +PS V++CDAVVVGSGSGGGV+AG+LANAG+KVL
Sbjct  304   IVDTLRRFGFPVSVSRRKQKTAPSLSSPSLVVQCDAVVVGSGSGGGVVAGILANAGYKVL  363

Query  943   VLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQT  1122
             VLEKG Y AR++LSLLEG ++D+MY  GGLVA+ DM+I +L+GS VGGGS INWSA I+T
Sbjct  364   VLEKGGYSARNNLSLLEGPTMDQMYQAGGLVATDDMNIFILSGSTVGGGSAINWSACIKT  423

Query  1123  PPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPV  1302
             P HV KEW E H LELF S+ Y+ AME VC +MGVQSE+E+EGF N +LRKGC E+GYPV
Sbjct  424   PQHVCKEWCEKHGLELFESELYQEAMEAVCEKMGVQSEIEEEGFNNAILRKGCQEMGYPV  483

Query  1303  ETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKK--  1476
               IPRNAS DHYCGWC  GCKDGKKKGTSETWL DLV SGNG I P C A+KV+H KK  
Sbjct  484   NNIPRNASPDHYCGWCCLGCKDGKKKGTSETWLVDLVKSGNGAILPGCTAMKVLHKKKKG  543

Query  1477  TGREQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHP  1656
             +G + A GV F ++  G+K+ C V+S+VT++ACG L TPSLLK SGL+N NIGRNLHLHP
Sbjct  544   SGEKTARGVAFEFEYRGSKDICVVESKVTIVACGTLNTPSLLKRSGLKNNNIGRNLHLHP  603

Query  1657  VVFAWGYFPDAP-----GSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLH  1821
             VV AWGYFPD P      S+ WPE  KKSY+GGIMTAMS VVA FE+SGYGA+IQTP+LH
Sbjct  604   VVMAWGYFPDTPVEPTGASEVWPETWKKSYEGGIMTAMSPVVAEFEKSGYGAVIQTPALH  663

Query  1822  PGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLK  2001
             PG FS +MPW+SG+DIK RM++FSRTA +FALARD+ SG   SP  ISY M+  D+ +L+
Sbjct  664   PGTFSIVMPWVSGSDIKDRMRKFSRTAHIFALARDQGSGNVHSPSRISYEMEDVDEENLQ  723

Query  2002  NGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSA  2181
              G++KVLRILAAAGAEEIGT H  G  L  K AS  E ++FV+KESSR L +LST + SA
Sbjct  724   KGIDKVLRILAAAGAEEIGTHHNKGNTLNVKNASYHEFEQFVKKESSRSLTDLSTPLCSA  783

Query  2182  HQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSV  2361
             HQMGSCRMG +P+ SVV   GETWEVE LF+AD+SVFPTALG+NPM+TVQ+IAYCTAQSV
Sbjct  784   HQMGSCRMGSNPKESVVKETGETWEVEDLFVADASVFPTALGMNPMITVQSIAYCTAQSV  843

Query  2362  LKFLK  2376
             L+ LK
Sbjct  844   LQVLK  848



>ref|XP_010275157.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Nelumbo nucifera]
Length=807

 Score =   831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/759 (59%), Positives = 553/759 (73%), Gaps = 29/759 (4%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAV--DVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERL  294
             LSP  M  +T+ SDT LP+V  D+     ++D   K F++TSAS+AGTP+ V   +S ++
Sbjct  60    LSPRQMEVLTAFSDTLLPSVFPDINCSGQLEDSLFK-FYRTSASMAGTPELVGGFLSGKI  118

Query  295   QHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYI  474
             +HP + +L LALWLLST  GT +LCG  SLS+QFPY Q F ++S  KR +I+ SWS    
Sbjct  119   EHPMLGVLLLALWLLSTWFGTFILCGIPSLSTQFPYFQRFSQVSQKKREKILLSWSSSSF  178

Query  475   KILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQH  654
              I +  +  +K +V   FF+QV+ENNEN +W+ IDYCGPDPD           +I     
Sbjct  179   NIYRMLFKTLKYLVFFIFFTQVDENNENPTWRGIDYCGPDPD-----------FINNRTR  227

Query  655   MTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQK-  831
              T + +  + EE         L  PL++G++N+ Q PR  + + L++ GF V     ++ 
Sbjct  228   ETKTPQGHEHEE---------LFEPLYRGIVNMRQ-PREALAETLRQSGFHVRLHPHRRY  277

Query  832   --GSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegssl  1005
                  +PS  I CDAVVVGSGSGGGV AG+LA AG+KV VLEKG YF R +LSLLEG S+
Sbjct  278   NPSPSHPSLTIRCDAVVVGSGSGGGVAAGILAKAGYKVAVLEKGNYFGRKNLSLLEGPSM  337

Query  1006  DEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKE  1185
             DEMYL GGL+ + DM +++LAGS VGGGSTINWSASI+TP HV++EW   ++LELFGSK 
Sbjct  338   DEMYLSGGLMVTDDMGVIMLAGSTVGGGSTINWSASIRTPQHVIREWCNEYELELFGSKL  397

Query  1186  YRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCK  1365
             Y+ AM+ VC RMGVQ +VE+E   N VLRKGC ELGYPV T PRN+  +HYCGWC FGCK
Sbjct  398   YKEAMDVVCKRMGVQPDVEEESLSNTVLRKGCSELGYPVITAPRNSPPNHYCGWCCFGCK  457

Query  1366  DGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQ--AAGVMFVYQNNGAKEF  1539
             DG+KKGTSETWL DLVDSGNGVI P CEA+K++H +K GR++  A GV+F + N   K+F
Sbjct  458   DGRKKGTSETWLVDLVDSGNGVILPGCEALKILHERKKGRKRNTATGVVFEFNNGWGKDF  517

Query  1540  CFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPE  1719
             C ++S+VT++A GALCTP+LLK SGLRN NIG+NLHLHPVV AWG+FP  P    WPE +
Sbjct  518   CVLESKVTIVAGGALCTPTLLKRSGLRNSNIGKNLHLHPVVMAWGHFPSRPADSGWPEKD  577

Query  1720  KKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRT  1899
             KKSY+GGI+TAMS VVAN E SGYGA+IQTP LHPGMFS I PW+S  D++ RM +FSRT
Sbjct  578   KKSYKGGIITAMSTVVANSEGSGYGAVIQTPMLHPGMFSVITPWISSVDMRERMSKFSRT  637

Query  1900  AILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGK  2079
             A +FALARDK SG+  SP SISY M   D+  LK GLEK+LRILAAAGAEEIGT H  G+
Sbjct  638   AYIFALARDKGSGQVNSPSSISYRMDAMDEEHLKQGLEKILRILAAAGAEEIGTSHCLGR  697

Query  2080  ILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEV  2259
              +  K  S +E + FV+KES R L +L T I SAHQMGSCRMGVDP+SSVVN  GETWEV
Sbjct  698   KVNVKKVSSNEFERFVKKESRRALRDLRTPIPSAHQMGSCRMGVDPKSSVVNHRGETWEV  757

Query  2260  EGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             EGLFLADSSVFPTALGVNPMVT+Q+IAYCTAQSVL+ L+
Sbjct  758   EGLFLADSSVFPTALGVNPMVTIQSIAYCTAQSVLEVLR  796



>ref|XP_010111511.1| Long-chain-alcohol oxidase FAO4A [Morus notabilis]
 gb|EXC31034.1| Long-chain-alcohol oxidase FAO4A [Morus notabilis]
Length=838

 Score =   830 bits (2145),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/808 (57%), Positives = 570/808 (71%), Gaps = 41/808 (5%)
 Frame = +1

Query  43    SDDGDSLFSNGKAERGNDGVYS-GGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSV  219
             S   D      K+   N+ V++     LS   M T+ ++SD FLP+VDV    A  D+S+
Sbjct  51    SSTADQAMKEEKSRNDNNNVFNIYESSLSRRQMDTLIAVSDAFLPSVDVSDLTA--DESL  108

Query  220   KLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFP  399
               F+ TSAS+A TPQR+  MISERL+HPK  LL++ALW LST  GT ++CG AS+S+ FP
Sbjct  109   LKFYATSASMAATPQRLGGMISERLKHPKKWLLKVALWALSTWFGTFVMCGIASVSTTFP  168

Query  400   YLQSFPEISPHKRAEIVRSWSCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAID  579
             Y  SFP +S  +R EI+ SWS  Y  +L+  Y  +K++  L FF+QV+  + N+SWKAI 
Sbjct  169   YFHSFPNLSHQRRQEILNSWSQSYFFLLRLLYWSLKLLTFLVFFTQVDSKDHNVSWKAIG  228

Query  580   YCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQ  759
             Y GPDPD              + Q+ T +   K  E+       E+L GPL  G+++   
Sbjct  229   YTGPDPD-------------FKVQNTTTAATTKLDEQQQ--QQQEILFGPLSSGIVDFKT  273

Query  760   EPRR-QVFDRLQKLGFPVS---PCI----QQKGSGN---------PSFVIECDavvvgsg  888
              P    + + L++ GFPV    PC     Q++ + N         P   I CDAVVVGSG
Sbjct  274   LPHDLTLINTLKRHGFPVKRRRPCTSILPQERSTHNNKVPSSIFDPFLKIRCDAVVVGSG  333

Query  889   sgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLA  1068
             SGGGV+AG+LA AG+KVLVLEKG Y+AR++L+LLEG +LD+MYL  GL+A+ DMD+LLLA
Sbjct  334   SGGGVVAGLLARAGYKVLVLEKGNYYARNNLTLLEGPTLDQMYLSNGLMATADMDVLLLA  393

Query  1069  GSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDE  1248
             GS VGGGSTINWSASI TP HV KEW + ++LELFGSK Y  A++ VC RM VQSE+E+E
Sbjct  394   GSTVGGGSTINWSASIPTPQHVRKEWCDEYELELFGSKLYEEALDVVCKRMQVQSEIEEE  453

Query  1249  GFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNG  1428
             GF N VLRKGC ELGYPV+ IPRNA  DHYCGWC  GCKDG+KKGTSETWL DLV+SGNG
Sbjct  454   GFNNAVLRKGCEELGYPVDNIPRNAPSDHYCGWCCLGCKDGRKKGTSETWLLDLVESGNG  513

Query  1429  VIFPECEAVKVVHNKKTGREQ--AAGVMFVYQNN-GAKEFCFVKSRVTVIACGALCTPSL  1599
             VI P  EAVKV+H +K+GRE+  A GV F ++N+ G KE C V+SRVTV+ACGAL TP+L
Sbjct  514   VILPGSEAVKVLHQRKSGRERNTATGVAFEFENSKGDKEICVVESRVTVVACGALRTPTL  573

Query  1600  LKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFE  1779
             LK SGLRNPNIG+NLHLHPV  AWGYFPD   S      EKKSY+GGIMTAMS V A+ +
Sbjct  574   LKRSGLRNPNIGKNLHLHPVAMAWGYFPDNSSSFL---AEKKSYEGGIMTAMSTVAADLK  630

Query  1780  ESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFS  1959
             +SGYG +IQTP+LHPGMFS +MPW+SG D+K RM+RFSRTA +FALARD+ SG   S   
Sbjct  631   KSGYGTVIQTPALHPGMFSILMPWVSGKDMKDRMRRFSRTAHVFALARDQGSGTVNSDSE  690

Query  1960  ISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKES  2139
             I Y+++  D+  L+ G+EKVLRILAAAGAEEIGT H  GK +  K AS  E++ FV++ES
Sbjct  691   IRYSVEARDEEKLRAGVEKVLRILAAAGAEEIGTHHGKGKSINVKSASYHELERFVKEES  750

Query  2140  SRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPM  2319
              R++  L   I SAHQMGSCRMGV   +S VNPMGETWEVEGLF+AD+SVFPTALGVNPM
Sbjct  751   GREMRGLRWPICSAHQMGSCRMGVAAATSAVNPMGETWEVEGLFVADTSVFPTALGVNPM  810

Query  2320  VTVQAIAYCTAQSVLKFLKTHNHMQGYI  2403
             VTVQAIAYCTA SVL+ LK       YI
Sbjct  811   VTVQAIAYCTALSVLQLLKRKKIKTTYI  838



>ref|XP_003547733.2| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
Length=825

 Score =   829 bits (2142),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/758 (59%), Positives = 570/758 (75%), Gaps = 20/758 (3%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHA-AVDDDSVKLFFQTSASIAGTPQRVAWMISERLQ  297
             LSP  M ++ ++ DT LP+++        DD+SV  F++TSAS+AGTP+ +  +ISE+L+
Sbjct  78    LSPRQMKSLVALCDTLLPSINNNNVVWGSDDESVANFYKTSASMAGTPEHLGILISEKLK  137

Query  298   HPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIK  477
             HP   LL L LWLLST  GT +LCG  SLS++FP+  S+PE+S  KR ++++SWS  Y++
Sbjct  138   HPSTWLLLLTLWLLSTWFGTFILCGTLSLSTKFPFFHSYPELSLLKRQKVMQSWSLSYLR  197

Query  478   ILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHM  657
              L+ F+  +K++ LL FF+Q++E  +N SWKAI YCGPDP+   +       + T+++  
Sbjct  198   PLRMFFRTIKLLTLLVFFTQLDEAEDNPSWKAIGYCGPDPEFKSQ---LKNHFFTKQRGQ  254

Query  658   TLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGS  837
                E++  G EDV         GPL+KG+I +N  PR  + D L+++GF VS   ++  +
Sbjct  255   --EEKEDDGTEDV--------RGPLYKGLIRINN-PRDIITDSLRRVGFSVSATPKKTKA  303

Query  838   G---NPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslD  1008
                 +PS VI+CDAVVVGSGSGGGV+AGVLANAG+KVLVLEKG Y AR++LSLLEG S+D
Sbjct  304   STLSSPSLVIKCDAVVVGSGSGGGVVAGVLANAGYKVLVLEKGSYSARNNLSLLEGPSMD  363

Query  1009  EMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEY  1188
             +MYL  GLVA+ DM +L+LAGS VGGGS INWSASI+TP HV KEW + H+LELF S  Y
Sbjct  364   QMYLSNGLVATNDMSVLILAGSTVGGGSAINWSASIRTPQHVCKEWCDRHELELFESMLY  423

Query  1189  RHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKD  1368
             + A++ VC +MGVQSE++DEGF N VLR+GC+E+GYPV  IPRNA+ DHYCGWC  GCKD
Sbjct  424   KEALDVVCEKMGVQSEIDDEGFNNAVLRRGCVEMGYPVCNIPRNATSDHYCGWCCLGCKD  483

Query  1369  GKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQ--AAGVMFVYQNNGAKEFC  1542
             G+KKGT ETWL DLV SGNG I P CEA++V+H KK GR +  A GV F  +  G K+ C
Sbjct  484   GRKKGTLETWLVDLVKSGNGAIIPSCEAIQVLHKKKKGRHRKIARGVAFAIEYKGKKDIC  543

Query  1543  FVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEK  1722
              V+S+VT++ACGAL TP+LLK SGL+N NIGRNLHLHPV  AWGYFPD+P  + WPE  K
Sbjct  544   VVESKVTIVACGALSTPALLKRSGLKNENIGRNLHLHPVAMAWGYFPDSPSPELWPEKHK  603

Query  1723  KSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTA  1902
             KSY+GGIMTAMS VVA F++SGYG +IQTP+LHPGMFS +MPW SG DIK RM++FSRTA
Sbjct  604   KSYEGGIMTAMSTVVAQFDKSGYGTVIQTPALHPGMFSILMPWTSGADIKDRMRKFSRTA  663

Query  1903  ILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKI  2082
              +FALARD+ SG   SP  ISY ++  DK +LK GLEKVLRILAAAGAEEIGT +  G+ 
Sbjct  664   HVFALARDQGSGTVNSPSCISYQLKDIDKENLKVGLEKVLRILAAAGAEEIGTHNNKGRR  723

Query  2083  LKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVE  2262
             +  K  S  E ++FV++ESS  L ++ST + SAHQMGSC+MG +PR SVVN MGETWEVE
Sbjct  724   INVKQVSYHEFEKFVKEESSMSLTDISTPLCSAHQMGSCKMGTNPRESVVNQMGETWEVE  783

Query  2263  GLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             GL+LADSSVFPTALGVNPMVTVQAI+YCTAQ VL+ L+
Sbjct  784   GLYLADSSVFPTALGVNPMVTVQAISYCTAQYVLEVLR  821



>gb|KDP37816.1| hypothetical protein JCGZ_06718 [Jatropha curcas]
Length=760

 Score =   826 bits (2134),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/754 (60%), Positives = 559/754 (74%), Gaps = 31/754 (4%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
             LS   M +++++ DTFLP+ DV   +A  DDS+  FF +SAS+AGTPQR+  +IS+RL+H
Sbjct  31    LSFPEMESLSALCDTFLPSNDVVSSSAAADDSIAKFFLSSASMAGTPQRIGGLISQRLKH  90

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  480
             PK  L+R+ LW+LSTR+GT +LCG  S+S+ FP+   F +I  HKR +I+ SWS  +  +
Sbjct  91    PKKWLIRVVLWMLSTRVGTFILCGLLSISTHFPFFLKFSQIHLHKREKILHSWSLSFFSL  150

Query  481   LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMT  660
             L+  +  +K++ LL FFSQV+E  EN++WKA+DY GPDP+  K            EQ   
Sbjct  151   LRMLFKTVKLLCLLVFFSQVDEKGENLAWKAMDYPGPDPEFKK------------EQEAA  198

Query  661   LSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSG  840
             L   +   EE       E L GPL+KG+I++N  PR    + L+  GFPV     +    
Sbjct  199   LKLVKNNEEEK------EKLFGPLYKGLIDMNL-PRDITANSLRLSGFPV--FTYRPKIN  249

Query  841   NPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYL  1020
             NPS VI+CDAVVVGSGSGGGV+AGVLA AG+KV+V+EKG YFARS+LSLLEG S+D+MYL
Sbjct  250   NPSLVIKCDAVVVGSGSGGGVVAGVLAKAGYKVVVIEKGNYFARSNLSLLEGPSMDQMYL  309

Query  1021  GGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAM  1200
               GL+A+ DM +++LAGS VGGGSTINWSASI+TP HV  EW   + LE+F SK Y+ A+
Sbjct  310   SAGLMATDDMGVVVLAGSTVGGGSTINWSASIRTPQHVTDEWSNAYGLEIFDSKLYKEAL  369

Query  1201  ETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKK  1380
             + VC +MGVQSE+ +EGF N +LRKGC ELGY V TIPRN+S DHYCGWC  GCKDGKKK
Sbjct  370   DVVCEKMGVQSEINEEGFNNAILRKGCEELGYNVNTIPRNSSSDHYCGWCCLGCKDGKKK  429

Query  1381  GTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQ--AAGVMFVYQNNGAKEFCFVKS  1554
             GT ETWL DLV+SGNG+I P CEA+KV+H ++    +  A+GV F +     KE C V+S
Sbjct  430   GTCETWLLDLVNSGNGLILPNCEAIKVLHKRRRRGNRRVASGVAFAF----GKEVCVVQS  485

Query  1555  RVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQ  1734
             +VT++ACGAL TP LLK SGL+N NIG++LHLHPV  AWGYFPD     AWPE  KKSYQ
Sbjct  486   KVTIVACGALSTPPLLKRSGLKNSNIGKHLHLHPVTMAWGYFPDDQ-PLAWPEKHKKSYQ  544

Query  1735  GGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFA  1914
             GGIMTAMS V +   +  YGA+IQTPSLHPGMF+++MPW+S  D+K +  RFSRTA +FA
Sbjct  545   GGIMTAMSLVNS---DKSYGAVIQTPSLHPGMFASLMPWVSCVDMKMKRGRFSRTAHIFA  601

Query  1915  LARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPK  2094
             LARDK SG+  SP SISY M+  D+ +L+ GLEKVLRILAAAGAEEIGT H  G+ L  K
Sbjct  602   LARDKGSGKVNSPNSISYQMEAPDEENLQKGLEKVLRILAAAGAEEIGTHHSKGRSLNVK  661

Query  2095  GASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFL  2274
              AS  E D+FV++ESSR L +LST I SAHQMGSCRMG+DPR+SVVN MGETWEVEGLF+
Sbjct  662   KASYKEFDKFVKRESSRSLRDLSTQICSAHQMGSCRMGIDPRNSVVNEMGETWEVEGLFI  721

Query  2275  ADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             AD+SVFPTALGVNPMVTVQAIAYCTAQSVL+ LK
Sbjct  722   ADTSVFPTALGVNPMVTVQAIAYCTAQSVLQLLK  755



>ref|XP_007040880.1| Long-chain fatty alcohol dehydrogenase family protein [Theobroma 
cacao]
 gb|EOY25381.1| Long-chain fatty alcohol dehydrogenase family protein [Theobroma 
cacao]
Length=1140

 Score =   840 bits (2170),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/757 (61%), Positives = 570/757 (75%), Gaps = 14/757 (2%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
             +S   M ++T+I D FLP++ V    A    +   F+Q+SAS+A TP+RV  ++SER++H
Sbjct  387   ISSREMESLTAICDAFLPSLHVSAADADAVAT---FYQSSASMAATPERVGGLLSERMEH  443

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  480
             PK  ++RLALWLLST +GT +LCG  SLS+ FP+  +F ++S  KR EI+ SWS  +   
Sbjct  444   PKKWMIRLALWLLSTWLGTFVLCGPRSLSTNFPFFHTFSQLSQQKREEILLSWSLSFFYH  503

Query  481   LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMT  660
             L+  +   K++ LL FFSQV+E N+N+SWKAI YCGPDP+   +P     K   +  +  
Sbjct  504   LRMLFKSTKLLTLLVFFSQVDEKNQNLSWKAIGYCGPDPEF--QPQASRLKTSKQNGYGN  561

Query  661   LSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVS---PCIQQK  831
                ++++ +ED      E   GPL +G+INL + PR  V D L + G PVS     I   
Sbjct  562   FICKEQECKED---GEKEERYGPLCRGLINL-KHPRDVVADNLLRFGLPVSVRPKKINPP  617

Query  832   GSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDE  1011
                +PS  I+CDAV+VGSGSGGGV+AGVLA AG+KVLVLEKG YFARS+LSLLEG S+D+
Sbjct  618   NLSHPSLTIKCDAVIVGSGSGGGVVAGVLAKAGYKVLVLEKGNYFARSNLSLLEGPSMDQ  677

Query  1012  MYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYR  1191
             MY+ GG++A+ DM +++LAGS VGGGSTINWSASI+TP HV+ EW +  KLELF SK Y+
Sbjct  678   MYMSGGMLATDDMGVVILAGSTVGGGSTINWSASIKTPQHVINEWCDRCKLELFDSKLYK  737

Query  1192  HAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDG  1371
              AM+ VC +MGVQSE+ +EGF N VLRKGC ELGYPV  IPRN+  DHYCGWC  GCKDG
Sbjct  738   EAMDVVCEKMGVQSEIVEEGFNNAVLRKGCEELGYPVNDIPRNSPPDHYCGWCCMGCKDG  797

Query  1372  KKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQ--AAGVMFVYQNNGAKEFCF  1545
             +KKGTSETWL DLV+SGNGVI P CEA+KV+H ++ GR +  A G+ F  +  GAK+ C 
Sbjct  798   RKKGTSETWLVDLVNSGNGVILPGCEAIKVLHKRRKGRGRNRATGIAFQLEYVGAKDICI  857

Query  1546  VKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKK  1725
             V+S+VT++ACGAL TP LLK SGL+N NIG+NLHLHPV  AWGYFPDAP S  WPE EKK
Sbjct  858   VESKVTIVACGALSTPPLLKRSGLKNANIGKNLHLHPVAMAWGYFPDAPLSSGWPEKEKK  917

Query  1726  SYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAI  1905
             SY+GGIMTAMS VVAN ++SGYGA++QTP+LHPGMFSA+MPWLSG D+K RM RFSRTA 
Sbjct  918   SYEGGIMTAMSTVVANMDKSGYGAVLQTPALHPGMFSALMPWLSGADMKRRMLRFSRTAH  977

Query  1906  LFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKIL  2085
             +FALARDK SG+  SP SI Y M+ TD+ +LK GL+K+LRILAAAGAEEIGT H  GK +
Sbjct  978   IFALARDKGSGDVYSPDSIGYKMEATDEENLKKGLDKILRILAAAGAEEIGTHHCKGKSI  1037

Query  2086  KPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEG  2265
               K AS  E + FV++ESSR L +L+T I SAHQMGSCRMG+DP+ SVVN MGETWEVEG
Sbjct  1038  NVKQASSHEFERFVKEESSRPLRDLNTQICSAHQMGSCRMGIDPKQSVVNQMGETWEVEG  1097

Query  2266  LFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             LF+ADSSVFPTALGVNPMVT+QAIAYCTAQSVL  LK
Sbjct  1098  LFVADSSVFPTALGVNPMVTIQAIAYCTAQSVLDVLK  1134



>ref|XP_002269629.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Vitis vinifera]
Length=793

 Score =   826 bits (2133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/770 (59%), Positives = 576/770 (75%), Gaps = 38/770 (5%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
             LS   M ++ +ISDTFLP+V+ P +AA     V  F++TSAS+AGTP  V  +ISERL+H
Sbjct  35    LSSREMESLIAISDTFLPSVEAPHNAA--HAYVDKFYRTSASMAGTPHIVGGLISERLEH  92

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  480
             PK+ L R+ LWLLST  GT ++CG AS+SS FPY QSFP++SPHKR EIV SWS  Y  +
Sbjct  93    PKLWLSRVVLWLLSTWFGTFIICGLASMSSHFPYFQSFPQVSPHKRHEIVLSWSLSYFSL  152

Query  481   LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPD------SNK--KPAGKSKKW  636
             ++  +  +K++ LL FF+QV+E NEN++WKAI YCGPDPD      +NK  +P G  +  
Sbjct  153   IRMLFRSLKLVTLLVFFTQVDEKNENLTWKAIGYCGPDPDFKTLYRANKTAQPNGYGR--  210

Query  637   ITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSP  816
                    ++ + +++ E+D    N     GPL++G+IN+ + PR  V + L+  GF +S 
Sbjct  211   -------SIYQREQEEEDDREDFN-----GPLYRGLINV-KRPREVVAEALRLSGFSISI  257

Query  817   CIQQKGSGNPS--FVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsll  990
               ++  + N S   +I CDAVV+GSGSGGGV AGVLA AG+KVLVLEKG Y ARS+LSLL
Sbjct  258   HSRKHETPNSSSPLIIRCDAVVIGSGSGGGVAAGVLAKAGYKVLVLEKGNYCARSNLSLL  317

Query  991   egsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLEL  1170
             EG +LD+MYL GG++A+ D  +++LAGS VGGGSTINWSASI+TP HV KEW + H+LEL
Sbjct  318   EGPTLDQMYLYGGMLATDDTGVIILAGSTVGGGSTINWSASIRTPQHVRKEWCDQHELEL  377

Query  1171  FGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWC  1350
             F S+ Y+ AM+ VC +MGVQSE+ +EG  N VLR+GC ELGYPV  IPRN+   HYCGWC
Sbjct  378   FDSQLYKEAMDVVCEKMGVQSEIYEEGLNNAVLRRGCQELGYPVTDIPRNSQPKHYCGWC  437

Query  1351  SFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQ--AAGVMFVYQNN  1524
              FGCKDG+KKGT+ETWL D+++SGNGVI P CEA+KV+HN+K GR +  A GV F ++  
Sbjct  438   CFGCKDGRKKGTAETWLVDMMNSGNGVILPGCEAIKVLHNRKKGRARSTATGVAFEFEYK  497

Query  1525  GAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPD------  1686
             G KE   V+S+VT++ACGA+ TP LLK SGL+NPNIG+NLHLHPV  AWG+FP+      
Sbjct  498   GVKEVFMVESKVTIVACGAISTPGLLKRSGLKNPNIGKNLHLHPVAMAWGHFPEPTPLSP  557

Query  1687  APGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTD  1866
             +PG    P  EK+SY+G IMT MS VVA+FE SGYGA+IQTPSLHPGMFS +MPW+SG D
Sbjct  558   SPGC---PGLEKRSYEGEIMTVMSTVVADFEGSGYGAVIQTPSLHPGMFSVLMPWISGPD  614

Query  1867  IKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGA  2046
             +K RM R+SRTA +FALARDK SG   SP +ISY M +TD+ +LK G+EK+LRILAAAGA
Sbjct  615   MKDRMIRYSRTAHIFALARDKGSGTISSPSTISYQMDETDEENLKRGMEKLLRILAAAGA  674

Query  2047  EEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSS  2226
             EEIGT +  G+ +  K  S    ++FV++ESSR L +LST + SAHQMGSCRMGVDPRSS
Sbjct  675   EEIGTHNCNGRSINVKKVSSHAFEKFVKEESSRALRDLSTPVCSAHQMGSCRMGVDPRSS  734

Query  2227  VVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
              VN MGETWEVEGL++AD+SVFPTALGVNPMVTVQAIAY TA+SV++ L+
Sbjct  735   AVNQMGETWEVEGLYVADTSVFPTALGVNPMVTVQAIAYSTAKSVVEVLR  784



>ref|XP_004509495.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Cicer arietinum]
Length=824

 Score =   824 bits (2129),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/758 (58%), Positives = 563/758 (74%), Gaps = 11/758 (1%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
             LSP  M ++ ++ DT +P+++         +SV  F++TSAS+AGTPQR+  +I E+L+H
Sbjct  69    LSPRQMKSLVALCDTIIPSIEGNNVVHSSHESVNNFYRTSASMAGTPQRLGILI-EKLKH  127

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  480
             P   LL + LWLLST  GTL+LCGKASLS+ FP+ +SFP++S   R  +++ WS  Y   
Sbjct  128   PSTRLLMVTLWLLSTWFGTLILCGKASLSTNFPFFRSFPDLSSETRQNVMKCWSQSYFHH  187

Query  481   LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMT  660
             L+ F+  +K++ LL FF+Q++E   N SWKAI Y GP  +  ++   +    + +     
Sbjct  188   LRMFFRTIKLLTLLVFFTQLDEEENNPSWKAIGYSGPHEEFKRQ---QKNHILQKSSKEG  244

Query  661   LSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVS---PCIQQK  831
             L +E+++   D    N E +LGPL++G+++LN  P   + D L++  F VS   P  +  
Sbjct  245   LQKEKQEDNNDDDNDNNEEILGPLYRGLVHLNH-PCDIIADSLRRFKFHVSVTPPNNKPS  303

Query  832   GSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDE  1011
                +PS VI+CD VVVGSGSGGGV+AGVLA +G+KVLVLEKG YFAR+++SLLEG ++D+
Sbjct  304   TISSPSLVIQCDVVVVGSGSGGGVVAGVLAKSGYKVLVLEKGSYFARNNVSLLEGPTMDQ  363

Query  1012  MYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYR  1191
             MYL  GL+A+ DM +L+LAGS VGGGSTINWSASI+TP HV KEW + H+LELF S  Y+
Sbjct  364   MYLSNGLIATTDMSVLILAGSTVGGGSTINWSASIKTPHHVCKEWCDIHELELFESTLYK  423

Query  1192  HAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDG  1371
              AM+ VC +MGVQS+ E+EGF N VLRKGC E+GYPV  IPRNA  +HYCGWC  GCKDG
Sbjct  424   EAMDVVCKKMGVQSDFEEEGFNNAVLRKGCHEMGYPVNNIPRNAPPNHYCGWCCMGCKDG  483

Query  1372  KKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTG--REQAAGVMFVYQNNGAKEFCF  1545
              KKGTSETWL DLV SGNG I P+CEA++++H +K G  R+ A+GV F  + NG K+ C 
Sbjct  484   TKKGTSETWLVDLVKSGNGAILPKCEAIQILHREKKGSDRKTASGVAFAIEYNGNKDICV  543

Query  1546  VKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGS-KAWPEPEK  1722
             V+S+VT+IACGAL TPSLLK SGL+N NIGRNLHLHPV  AWGYFP++P S K WPE  K
Sbjct  544   VESKVTIIACGALSTPSLLKRSGLKNENIGRNLHLHPVTMAWGYFPNSPSSSKLWPEEHK  603

Query  1723  KSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTA  1902
             KSY+GGIMTAMS VVA F +SGYGA+IQTPSLHPG+FS +MPW SG DIK RM++FSRTA
Sbjct  604   KSYEGGIMTAMSTVVAEFNKSGYGAVIQTPSLHPGLFSILMPWNSGMDIKDRMRKFSRTA  663

Query  1903  ILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKI  2082
              +FALARD+ SG   SP  ISY+M+  DK +LK G+EKVLRILAAAGAEEIGT +  G  
Sbjct  664   HVFALARDQGSGTVDSPSCISYHMKDADKENLKKGIEKVLRILAAAGAEEIGTHNNKGNR  723

Query  2083  LKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVE  2262
             L  K  S  E ++FV++ESS +L +LST I SAHQMGSCRMG +P+ SVVN MGETWEVE
Sbjct  724   LNVKKVSYHEFEKFVKEESSMELTDLSTPICSAHQMGSCRMGNNPKDSVVNQMGETWEVE  783

Query  2263  GLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
              L++AD+SVFPTALGVNPMVT+QAIAYCTAQ VL+ L+
Sbjct  784   DLYIADASVFPTALGVNPMVTIQAIAYCTAQHVLEVLR  821



>gb|KDO72345.1| hypothetical protein CISIN_1g0039902mg, partial [Citrus sinensis]
Length=707

 Score =   815 bits (2104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/704 (62%), Positives = 537/704 (76%), Gaps = 9/704 (1%)
 Frame = +1

Query  277   MISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRS  456
             ++SERL+HPK  L+RL LWLLST IG+L+LCG+   SS+FPY+ SF ++   KR  ++ S
Sbjct  4     LMSERLKHPKKWLVRLCLWLLSTCIGSLVLCGRYCFSSKFPYMHSFTQLPQKKRDAVLVS  63

Query  457   WSCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKW  636
             WS  Y   L+  Y  MK+++LL FF+QVNE NEN+SWKAI Y GPDP+   K     ++ 
Sbjct  64    WSLSYFYHLRMLYKAMKLLILLVFFTQVNEKNENLSWKAIGYKGPDPEFKTKSM---QRK  120

Query  637   ITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSP  816
               R + +   ++ +   +D      EL  GPL+KG+IN+ Q PR  V D L+++GFPVS 
Sbjct  121   TLRNEGLNDDDDDEGQNDDGHEEEAELY-GPLYKGLINM-QLPRNIVADSLRQVGFPVSV  178

Query  817   CIQQKGS----GNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARssls  984
               ++  +     +PS VI+CDAVVVGSGSGGG+IAGVLA AG+KVLVLEKG Y ARS+LS
Sbjct  179   RNKRNAAPSSIASPSLVIKCDAVVVGSGSGGGLIAGVLAKAGYKVLVLEKGSYCARSNLS  238

Query  985   llegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKL  1164
             LLEG ++D+MYL GG++A+ DM ++LLAGS VGGGSTINWSASI+TP HV  EW + ++L
Sbjct  239   LLEGKTMDQMYLAGGMLATDDMGVILLAGSTVGGGSTINWSASIKTPKHVANEWCDEYEL  298

Query  1165  ELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCG  1344
             +LF S  Y+ AME VC RMGVQSEVE+EGF N VLR+GC ELGYPV  IPRN+  DHYCG
Sbjct  299   KLFESDLYKEAMEVVCERMGVQSEVEEEGFNNAVLRRGCKELGYPVNNIPRNSPPDHYCG  358

Query  1345  WCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQAAGVMFVYQNN  1524
             WC  GCKDG KKGTSETWL DLV+SGN  I P CEA++V+H K+  R  A GV F +Q  
Sbjct  359   WCCLGCKDGSKKGTSETWLVDLVNSGNSAILPGCEAIEVLHKKRRDRNVATGVAFEFQYM  418

Query  1525  GAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKA  1704
             GAK+ C V+S+VT++ACGAL TP+LLK SGL+N NIG+NLHLHPV  AWGYFP    S  
Sbjct  419   GAKDICVVESKVTIVACGALSTPNLLKRSGLKNANIGKNLHLHPVTMAWGYFPKTSSSGE  478

Query  1705  WPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQ  1884
             WPE +K SY+GGIMTAMS  V NF +SGYGA+IQTP+LHPGMFS++MPW+SG DIK RM 
Sbjct  479   WPEEKKTSYEGGIMTAMSTTVGNFGKSGYGAVIQTPALHPGMFSSLMPWVSGADIKLRMC  538

Query  1885  RFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTC  2064
             +FSRTA +F LARD+ SG   SP+SISY M+  D+ +LK G+EK+LRILAAAGAEEIGT 
Sbjct  539   KFSRTAHIFVLARDQGSGTVNSPYSISYQMEAMDEENLKKGIEKILRILAAAGAEEIGTH  598

Query  2065  HRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMG  2244
             H  GKI+  K AS +E + FV++ESSR L +LST + SAHQMGSCRMG+DP++SVVN MG
Sbjct  599   HCKGKIINVKKASSEEFERFVKEESSRPLRDLSTPLSSAHQMGSCRMGIDPKTSVVNQMG  658

Query  2245  ETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             ETW VEGL+LAD+SVFPTALGVNPMVTVQAIAYCTAQSVL  L+
Sbjct  659   ETWGVEGLYLADTSVFPTALGVNPMVTVQAIAYCTAQSVLDVLR  702



>gb|EYU37432.1| hypothetical protein MIMGU_mgv1a022390mg [Erythranthe guttata]
Length=740

 Score =   808 bits (2088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/755 (57%), Positives = 551/755 (73%), Gaps = 30/755 (4%)
 Frame = +1

Query  136   MATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIl  315
             M  +T++ DTFLP++ +  H          F+QTSAS+  TP  +A ++ E+++HPK+ L
Sbjct  1     MEELTAVCDTFLPSIHLSDHHRHHQ-----FYQTSASMTQTPHHLAELLGEKIKHPKIYL  55

Query  316   lrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTFY  495
              RLAL+ LSTR+GT +LCG+ SLS +FPYLQ F  + PHKR +I+ SWS     +L+  Y
Sbjct  56    SRLALFSLSTRLGTFILCGRKSLSEKFPYLQRFSRVLPHKREQILLSWSESCFSLLRILY  115

Query  496   LGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQ  675
              G+K+  LL FF+ VN+ +EN+SWKAI Y  PD  + K     +     RE         
Sbjct  116   AGLKIFTLLVFFTLVNDKDENVSWKAIGYTRPDHKARKPVVHNTPHEKARE---------  166

Query  676   KKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKG---SGNP  846
              KGEE +   + +   GPL+ G++NLNQ  R     +L+K GFPVS          S +P
Sbjct  167   -KGEECI---SEKERFGPLYNGIVNLNQS-REIALCKLEKSGFPVSIPHSNGAKIKSSDP  221

Query  847   SFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGG  1026
             SF+++CD VVVGSGSGGGV+AGVLA AG+KVLVLEKG Y ARS+LSLLEG ++D+MYLG 
Sbjct  222   SFIVKCDVVVVGSGSGGGVVAGVLAEAGYKVLVLEKGCYIARSNLSLLEGQTIDQMYLGN  281

Query  1027  GLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMET  1206
             G++ + +MD+LLLAGS VGGGSTINWSASI+TPPHV K+W E HKLE+F  + Y +A++ 
Sbjct  282   GVLGTDNMDVLLLAGSTVGGGSTINWSASIRTPPHVRKDWSENHKLEMFDGEIYENALDV  341

Query  1207  VCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGT  1386
             VC +MGVQSE + EGF + +LRKGC +LGYPVE+IPRNA  DH+CGWC+ GC+DGKKKG 
Sbjct  342   VCEKMGVQSEFKQEGFNSTILRKGCEKLGYPVESIPRNAGPDHHCGWCNLGCRDGKKKGV  401

Query  1387  SETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQAAGVMFVYQNNGAKEFCFVKSRVTV  1566
             SETWL DLV+SGNG I  ECEA+KV+ ++K  +++A GV F++ ++  KE   ++S++TV
Sbjct  402   SETWLVDLVESGNGAILTECEALKVIVDQKDRKKRACGVSFMFGSDEVKEIAVIESKITV  461

Query  1567  IACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSK----AWPEPEKKSYQ  1734
             +ACGA+CTP LLK SGL+N NIGRNLHLHPVV AWGYFPD+P S      WPE EK+SY+
Sbjct  462   VACGAICTPPLLKRSGLKNRNIGRNLHLHPVVNAWGYFPDSPSSSNCNYVWPEAEKRSYE  521

Query  1735  GGIMTAMSKVVANFEESGY-GALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILF  1911
             G IMTAMSKVV   E SGY  A+IQTP+LHPGMFSA+MPWLSG DIK RM ++SRTA LF
Sbjct  522   GAIMTAMSKVVE--EHSGYSAAIIQTPALHPGMFSALMPWLSGRDIKDRMVKYSRTAHLF  579

Query  1912  ALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKP  2091
             AL RD+ SG   SP  + Y M   D+ +L+ G+E+VLR+LAAAGAEEIGT HR G++LK 
Sbjct  580   ALVRDRGSGFVASPDHVGYKMDGADRENLRKGIERVLRVLAAAGAEEIGTHHRNGRVLKV  639

Query  2092  KGASRDEIDEFVEKESSRDL-GNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  2268
             K A  +E++ FV +ESSR L  NLS  I SAHQMGSCRMGV PR S V P GE+WEV  L
Sbjct  640   KEAGEEELERFVVEESSRVLEENLSWPISSAHQMGSCRMGVGPRGSAVGPTGESWEVGAL  699

Query  2269  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
             F+AD+SVFPTALGVNPMVTVQAIAYC AQ V++ L
Sbjct  700   FVADASVFPTALGVNPMVTVQAIAYCVAQCVVQSL  734



>ref|XP_004512334.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Cicer 
arietinum]
Length=816

 Score =   811 bits (2095),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/759 (58%), Positives = 568/759 (75%), Gaps = 23/759 (3%)
 Frame = +1

Query  136   MATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQ-HPKVI  312
             M +++ ++DT LP+++    A  DD+S   F+  SAS+AGTP+ V  +ISERL  HP   
Sbjct  64    MKSLSVLADTILPSIN-DFVAIKDDESAATFYHISASMAGTPELVGGVISERLNYHPMTW  122

Query  313   llrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTF  492
             LL+  LWLLST +GT++LCG    S++FP++ +FP +  HKR  I++SWS  + + L+ F
Sbjct  123   LLKFVLWLLSTLVGTIILCGMDCFSTKFPFIHTFPNLPLHKRQRIMQSWSLSFFRHLRMF  182

Query  493   YLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEE  672
             +  +K++ LL FF+Q++E+ +N SWKAI YCGPDP+     A     ++ R       +E
Sbjct  183   FKTIKLLTLLVFFTQIDESEDNCSWKAIGYCGPDPEFK---AQLRNHFLHRT--CKGGQE  237

Query  673   QKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQ-KGSGN--  843
              ++G+ED    + E ++GPL+KG+++LN  PR    D L++ GFPVS   ++ K + N  
Sbjct  238   SEEGDED----DAEQVIGPLYKGLVHLNC-PRDITADALRRFGFPVSVTRRKPKAAANLS  292

Query  844   -PSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYL  1020
              PS VI+CDAVVVGSGSGGG++AG+LA AG+KVLVLEKG Y ARS+LSLLEG +LD+MY 
Sbjct  293   SPSLVIQCDAVVVGSGSGGGLVAGILAKAGYKVLVLEKGGYSARSNLSLLEGPTLDQMYQ  352

Query  1021  GGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAM  1200
              GG++A+ DM + +L+GS VGGGS INWSASI+TP HV KEW E H LELF S+ YR AM
Sbjct  353   SGGMLATDDMSVFVLSGSTVGGGSAINWSASIKTPQHVCKEWCEKHGLELFESELYREAM  412

Query  1201  ETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKK  1380
             + VC +MGVQSE+E+EGF N +LR+GC ELGYPV TIPRN+  DHYCGWC  GCKDG+KK
Sbjct  413   DVVCEKMGVQSEIEEEGFNNTILRRGCQELGYPVSTIPRNSPSDHYCGWCFMGCKDGRKK  472

Query  1381  GTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQ--AAGVMFVYQNNGAKEFCFVKS  1554
             GTSETWL DLV SGNG I P CE +KV++ KK G +Q  A GV F ++  G+K+ C V+S
Sbjct  473   GTSETWLVDLVKSGNGAILPGCEVLKVLYKKKKGSDQKTARGVAFEFEYKGSKDICVVES  532

Query  1555  RVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPG-----SKAWPEPE  1719
             +VT++ACGAL TP+LLK SGL+N NIGRNLHLHPVV AWGYFPD+       ++ WPE  
Sbjct  533   KVTIVACGALNTPALLKRSGLKNNNIGRNLHLHPVVMAWGYFPDSSAESTGETEVWPEAW  592

Query  1720  KKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRT  1899
             KKSY+GGIMTAMS VVA FE SGYGA+IQTP+LHPG FS +MPW+SG DIK RM++FSRT
Sbjct  593   KKSYEGGIMTAMSPVVAEFENSGYGAVIQTPALHPGTFSIVMPWISGKDIKDRMRKFSRT  652

Query  1900  AILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGK  2079
             A +FALARDK SG+  SP  I+Y M+  D+ +L+ G+EKVLRILAAAGAEEIGT H  G+
Sbjct  653   AHIFALARDKGSGKVDSPNRINYQMEDVDEENLQKGIEKVLRILAAAGAEEIGTHHNKGR  712

Query  2080  ILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEV  2259
              L  K AS+ E+++FV++ESSR L  LST + SAHQMGSCRMG +P+ S V   GETWEV
Sbjct  713   TLNVKQASKLELEKFVKEESSRPLTKLSTPLCSAHQMGSCRMGSNPKESAVKQTGETWEV  772

Query  2260  EGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             E L++ADSSVFPTALG+NPM+T+Q+IAYCTAQSVL  LK
Sbjct  773   EDLYVADSSVFPTALGLNPMITIQSIAYCTAQSVLHALK  811



>ref|XP_002519938.1| electron carrier, putative [Ricinus communis]
 gb|EEF42542.1| electron carrier, putative [Ricinus communis]
Length=710

 Score =   805 bits (2080),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/710 (61%), Positives = 538/710 (76%), Gaps = 24/710 (3%)
 Frame = +1

Query  277   MISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRS  456
             +ISERL+HPK  L+RLALW+LST IGT +LCG AS+S+ FPY QSF +++ HKR +I+ S
Sbjct  11    LISERLKHPKKWLIRLALWMLSTWIGTFILCGVASISTHFPYFQSFSQLTLHKREKILHS  70

Query  457   WSCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKW  636
             WS  ++  L+  +  MK+++LL FFSQV+E NEN++WKAI Y GPDP        K  KW
Sbjct  71    WSLSFLYPLRMLFKAMKLLILLVFFSQVDEKNENLTWKAIGYPGPDPQF------KVDKW  124

Query  637   ----ITREQHMTLSEEQKKGEEDVIPMNPEL------LLGPLHKGVINLNQEPRRQVFDR  786
                 ++     T  + ++K EE+      E       L GPLH+G++++N  PR  V + 
Sbjct  125   EALKLSPYARFTDKQLERKEEEEEEEEEEEEGEDELKLFGPLHRGIVDMNL-PRDAVANS  183

Query  787   LQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYF  966
             LQ+LGF +     +K       VI CDAVVVGSGSGG V+AG LA AG+KVLVLEKG YF
Sbjct  184   LQRLGFSILANRPKKYYS--PLVIRCDAVVVGSGSGGSVVAGALAKAGYKVLVLEKGNYF  241

Query  967   ARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEW  1146
             ARS+LSLLEG ++D+MYL GGL+A+ DM ++LLAGS VGGGSTINWSASI+TP HV+ EW
Sbjct  242   ARSNLSLLEGPTMDQMYLSGGLMATDDMGVVLLAGSTVGGGSTINWSASIKTPQHVISEW  301

Query  1147  DETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNAS  1326
                + LE+FGSK Y+ A++ VC +MGVQSE+  EGF N +LRKGC ELGYPV  IPRN++
Sbjct  302   TNCYDLEIFGSKLYKEALDVVCEKMGVQSEIHVEGFNNEILRKGCEELGYPVSNIPRNSA  361

Query  1327  RDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQAAGVM  1506
              DHYCGWC  GCKDGKKKGT ETWL DLV+SGNG I P CE +K++H +K+ R+ A GV+
Sbjct  362   PDHYCGWCCLGCKDGKKKGTCETWLLDLVNSGNGAILPRCEVIKILHKRKSNRKAATGVV  421

Query  1507  FVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPD  1686
             F ++  G KE   V+S+VT+IACGAL +P LL+ SGL+NPNIGRNLHLHPV  AWGYFP+
Sbjct  422   FGFEYKGKKELYVVESKVTIIACGALSSPPLLRRSGLKNPNIGRNLHLHPVTMAWGYFPE  481

Query  1687  APGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTD  1866
                  AWPE EKKSY+GGIMTAMS VVANF++SGYGA+IQTPSLHPGMFS++MPW+SG D
Sbjct  482   -----AWPEVEKKSYEGGIMTAMSTVVANFDKSGYGAVIQTPSLHPGMFSSLMPWVSGAD  536

Query  1867  IKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGA  2046
             IK +M R+SRTA +FAL RDK SG   SP SI+Y M+  D+ +L+NG+EK+LRILAAAGA
Sbjct  537   IKMQMCRYSRTAHIFALGRDKGSGTVNSPSSITYQMKAADEKNLQNGIEKILRILAAAGA  596

Query  2047  EEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSS  2226
             EEIGT H  G+ L  K AS  E ++FV++E +R + +LS  I SAHQMGSCRMGV+P+ S
Sbjct  597   EEIGTHHCIGRRLNVKTASYHEFEKFVKEERARPMRDLSNQICSAHQMGSCRMGVNPKHS  656

Query  2227  VVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             VVN  GETWE+EGL+LAD+SVFPTALGVNPMVTVQAIAYCTAQSVL+ L+
Sbjct  657   VVNQTGETWEIEGLYLADASVFPTALGVNPMVTVQAIAYCTAQSVLEVLR  706



>ref|XP_010676697.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Beta vulgaris 
subsp. vulgaris]
Length=816

 Score =   802 bits (2071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/769 (56%), Positives = 570/769 (74%), Gaps = 23/769 (3%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
             LS   M ++T++ DT LPAVD P++ A  D+S+  F++TSAS+AGTP+ +  MIS RL+H
Sbjct  50    LSAREMDSLTALCDTILPAVDPPENTA--DESLVRFYKTSASMAGTPEHLGRMISHRLRH  107

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  480
               V L+R  L++LSTR+GT +  G  SLS  FP+   F E+S  KR  I+ S S     +
Sbjct  108   -HVFLIRFLLFMLSTRLGTFVFGGIHSLSICFPFFLKFSELSLEKRQHILLSLSTSCFIL  166

Query  481   LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPD---SNKKPAGKSKKWITREQ  651
              +  ++G+K++VLL+FF+QV+E+ EN SW+AI YCGPDPD     +  + +S  +IT + 
Sbjct  167   FRMAFVGIKLLVLLAFFTQVDESEENPSWEAIGYCGPDPDFVSKKRNESSQSLGYITPKS  226

Query  652   HMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQK  831
             + +    + + +      +   L GPL+KG+I++ + P+  + + L++ G  VS   ++K
Sbjct  227   YHSSPTTEVQAQAQA--QSKYDLYGPLYKGIISV-KYPQEILTESLKRCGIHVSVNRKKK  283

Query  832   GSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDE  1011
              S  P   I+CD VVVGSGSGGGV+AGVLA+AG+KV+V+EKG Y+AR++LSLLEG +LD 
Sbjct  284   NSEKPKITIQCDVVVVGSGSGGGVVAGVLASAGYKVVVIEKGDYYARTNLSLLEGHTLDH  343

Query  1012  MYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYR  1191
             MY G G+++++D+ + +LAGS VGGGSTINWSASI+TPPHV+KEW   H+LE+F S  Y+
Sbjct  344   MYEGAGMISTRDLGVNILAGSTVGGGSTINWSASIRTPPHVIKEWANVHELEIFDSPLYK  403

Query  1192  HAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDG  1371
              A+E VC +M VQS+V DEGF N VLRKGCLELGYP+  IPRNA  DHYCGWC  GCKDG
Sbjct  404   EALEVVCEKMEVQSDVSDEGFNNAVLRKGCLELGYPLVDIPRNAPPDHYCGWCCLGCKDG  463

Query  1372  KKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTG--REQAAGVMFVYQNNGAKEFC-  1542
             +KKGT ETWL D+V+SGNGVI   CE  KV++ ++ G  R+ A GVMF   +N  +  C 
Sbjct  464   RKKGTCETWLKDVVNSGNGVILTGCEVAKVLYGRQKGRNRDTAKGVMFDITSNDHQSSCV  523

Query  1543  FVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAP----------  1692
              V+++ T+IACGAL TP+LL+ SGL N NIG+NLHLHPVV AWGYFPD+           
Sbjct  524   IVEAKATIIACGALNTPALLRRSGLNNKNIGKNLHLHPVVMAWGYFPDSEPLSSLLSDNQ  583

Query  1693  GSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIK  1872
             G + WP+ +KKSY+GGIMT MS VVA+F +SGYGA+IQTPSLHPG+FSA+MPW SG++IK
Sbjct  584   GDQVWPQKQKKSYEGGIMTTMSTVVADFNDSGYGAVIQTPSLHPGLFSALMPWTSGSNIK  643

Query  1873  TRMQRFSRTAILFALARDKTSG-EAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAE  2049
              RM +FSRTA +FAL+RD  SG  + SPF ISY M   D+ +LK G+EK+LRILAAAGAE
Sbjct  644   HRMTKFSRTAHIFALSRDVGSGIISTSPFDISYMMDPIDEANLKKGVEKMLRILAAAGAE  703

Query  2050  EIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSV  2229
             EIGT H +G+ +  K A+  E ++FV++ESS+++  LST + SAHQMGSC+MGVDPR+SV
Sbjct  704   EIGTHHNSGESINVKKATYHEFEKFVKRESSKEIQGLSTPVASAHQMGSCKMGVDPRTSV  763

Query  2230  VNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             VN MGE+W+VEGL++ADSSVFPTALGVNPMVTVQAI+YCTAQSVL++LK
Sbjct  764   VNQMGESWDVEGLYIADSSVFPTALGVNPMVTVQAISYCTAQSVLEYLK  812



>ref|XP_004512333.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Cicer 
arietinum]
Length=834

 Score =   799 bits (2064),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/777 (57%), Positives = 568/777 (73%), Gaps = 41/777 (5%)
 Frame = +1

Query  136   MATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQ-HPKVI  312
             M +++ ++DT LP+++    A  DD+S   F+  SAS+AGTP+ V  +ISERL  HP   
Sbjct  64    MKSLSVLADTILPSIN-DFVAIKDDESAATFYHISASMAGTPELVGGVISERLNYHPMTW  122

Query  313   llrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTF  492
             LL+  LWLLST +GT++LCG    S++FP++ +FP +  HKR  I++SWS  + + L+ F
Sbjct  123   LLKFVLWLLSTLVGTIILCGMDCFSTKFPFIHTFPNLPLHKRQRIMQSWSLSFFRHLRMF  182

Query  493   YLGMKVMVLLSFFSQV------------------NENNENISWKAIDYCGPDPDSNKKPA  618
             +  +K++ LL FF+Q+                  +E+ +N SWKAI YCGPDP+     A
Sbjct  183   FKTIKLLTLLVFFTQIFLLFGTLYSSWHGTYFQIDESEDNCSWKAIGYCGPDPEFK---A  239

Query  619   GKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKL  798
                  ++ R       +E ++G+ED    + E ++GPL+KG+++LN  PR    D L++ 
Sbjct  240   QLRNHFLHRT--CKGGQESEEGDED----DAEQVIGPLYKGLVHLNC-PRDITADALRRF  292

Query  799   GFPVSPCIQQ-KGSGN---PSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYF  966
             GFPVS   ++ K + N   PS VI+CDAVVVGSGSGGG++AG+LA AG+KVLVLEKG Y 
Sbjct  293   GFPVSVTRRKPKAAANLSSPSLVIQCDAVVVGSGSGGGLVAGILAKAGYKVLVLEKGGYS  352

Query  967   ARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEW  1146
             ARS+LSLLEG +LD+MY  GG++A+ DM + +L+GS VGGGS INWSASI+TP HV KEW
Sbjct  353   ARSNLSLLEGPTLDQMYQSGGMLATDDMSVFVLSGSTVGGGSAINWSASIKTPQHVCKEW  412

Query  1147  DETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNAS  1326
              E H LELF S+ YR AM+ VC +MGVQSE+E+EGF N +LR+GC ELGYPV TIPRN+ 
Sbjct  413   CEKHGLELFESELYREAMDVVCEKMGVQSEIEEEGFNNTILRRGCQELGYPVSTIPRNSP  472

Query  1327  RDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQ--AAG  1500
              DHYCGWC  GCKDG+KKGTSETWL DLV SGNG I P CE +KV++ KK G +Q  A G
Sbjct  473   SDHYCGWCFMGCKDGRKKGTSETWLVDLVKSGNGAILPGCEVLKVLYKKKKGSDQKTARG  532

Query  1501  VMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYF  1680
             V F ++  G+K+ C V+S+VT++ACGAL TP+LLK SGL+N NIGRNLHLHPVV AWGYF
Sbjct  533   VAFEFEYKGSKDICVVESKVTIVACGALNTPALLKRSGLKNNNIGRNLHLHPVVMAWGYF  592

Query  1681  PDAPG-----SKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIM  1845
             PD+       ++ WPE  KKSY+GGIMTAMS VVA FE SGYGA+IQTP+LHPG FS +M
Sbjct  593   PDSSAESTGETEVWPEAWKKSYEGGIMTAMSPVVAEFENSGYGAVIQTPALHPGTFSIVM  652

Query  1846  PWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLR  2025
             PW+SG DIK RM++FSRTA +FALARDK SG+  SP  I+Y M+  D+ +L+ G+EKVLR
Sbjct  653   PWISGKDIKDRMRKFSRTAHIFALARDKGSGKVDSPNRINYQMEDVDEENLQKGIEKVLR  712

Query  2026  ILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRM  2205
             ILAAAGAEEIGT H  G+ L  K AS+ E+++FV++ESSR L  LST + SAHQMGSCRM
Sbjct  713   ILAAAGAEEIGTHHNKGRTLNVKQASKLELEKFVKEESSRPLTKLSTPLCSAHQMGSCRM  772

Query  2206  GVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             G +P+ S V   GETWEVE L++ADSSVFPTALG+NPM+T+Q+IAYCTAQSVL  LK
Sbjct  773   GSNPKESAVKQTGETWEVEDLYVADSSVFPTALGLNPMITIQSIAYCTAQSVLHALK  829



>ref|XP_008444238.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X1 [Cucumis 
melo]
Length=821

 Score =   792 bits (2045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/782 (58%), Positives = 563/782 (72%), Gaps = 20/782 (3%)
 Frame = +1

Query  49    DGDSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLF  228
             DG S+  +  A   ND  YS    LS A M ++ ++ DTFLP+V  P  AA  D S  +F
Sbjct  50    DGASVEISQHANSNND-YYSSAGHLSAAEMESLAALCDTFLPSV-APATAA--DRSTAVF  105

Query  229   FQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQ  408
             F+TSAS  GTP+RV  MI ER++HPK  L+R++LW+LST  GT +LCG  SLS+ FPY +
Sbjct  106   FETSASAVGTPERVGEMIMERVRHPKKWLVRVSLWMLSTWYGTYILCGNESLSNHFPYFK  165

Query  409   SFPEISPHKRAEIVRSWSCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCG  588
              F ++S  KR +I  SWS  Y  +L+ F+  +K++ LL+FF+QV+E   NISWKAIDY G
Sbjct  166   RFSKVSQKKREQIALSWSLSYFFLLRMFFRTIKILCLLAFFTQVDEEMNNISWKAIDYPG  225

Query  589   PDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPR  768
              DP        K K   +RE      EE+++ EE         L GPL KG++NL  + +
Sbjct  226   SDPQFKPPSNLKEKDSKSREVDEEGDEEEEEAEE---------LYGPLFKGIVNLQHQQQ  276

Query  769   RQV-FDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLV  945
              QV    L+K GFPV+         NPS +I+CDAVVVGSGSGGGV+AGVLANAG+KVLV
Sbjct  277   IQVAVGALRKFGFPVTLLSPTTKPPNPSMIIKCDAVVVGSGSGGGVVAGVLANAGYKVLV  336

Query  946   LEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTP  1125
             LEKG Y AR++LSLLEG +++EMY   GLVA+ +M++L+LAGS VGGGST+NWSASI+TP
Sbjct  337   LEKGSYCARTNLSLLEGPAMEEMYQSSGLVATDNMNVLILAGSTVGGGSTVNWSASIKTP  396

Query  1126  PHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVE  1305
              HV KEW + ++LELF S  Y+ A++ VC +MGVQS++++EGF N VLRKGC ELG    
Sbjct  397   SHVTKEWSDEYELELFRSNLYKEAIDVVCKKMGVQSKIDNEGFNNAVLRKGCEELGGHAI  456

Query  1306  TIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGR  1485
              IPRN++ DHYCGWC  GC+DG+KKGT+ETWL DLV SGNGVI P CEA+K+   KK GR
Sbjct  457   NIPRNSTSDHYCGWCCLGCRDGRKKGTAETWLVDLVRSGNGVILPGCEAIKIRQEKKQGR  516

Query  1486  EQ--AAGVMF-VYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHP  1656
             E+  A GV F  +  + AK+ C V+S+VT++ACGAL TP LLK SGLRNPNIG+NLHLHP
Sbjct  517   ERKMAKGVAFEFWCGSAAKQMCLVESKVTIVACGALNTPPLLKRSGLRNPNIGKNLHLHP  576

Query  1657  VVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVAN-FEESGYG-ALIQTPSLHPGM  1830
             V  AWGYFP A   K+WPE +KKSY+GGIMTAM  +     +E GYG A+IQTP+LHPG+
Sbjct  577   VTMAWGYFP-AETDKSWPEKDKKSYEGGIMTAMCNIGPEPNQEPGYGGAVIQTPALHPGL  635

Query  1831  FSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGL  2010
             FS +MPW+SGT+IK RM +FSRTA +F LARDK SG   SP S+SY M   D+ +L+ GL
Sbjct  636   FSILMPWVSGTNIKQRMCKFSRTAHVFVLARDKGSGTVKSPSSLSYKMDNVDEQNLQKGL  695

Query  2011  EKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQM  2190
             EK L+ILAAAGA EIGT H  G+ +  K  S  E ++FV++ESSR L +L T I SAHQM
Sbjct  696   EKALKILAAAGAVEIGTHHNKGRSINVKKVSYREYEKFVKEESSRPLKDLLTPICSAHQM  755

Query  2191  GSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKF  2370
             GSCRMG   + SVVN  GETWEVEGLF+ADSSVFPTALGVNPMVTVQAIAYCTAQSVL+ 
Sbjct  756   GSCRMGSGAKDSVVNQRGETWEVEGLFIADSSVFPTALGVNPMVTVQAIAYCTAQSVLET  815

Query  2371  LK  2376
             LK
Sbjct  816   LK  817



>ref|XP_010274418.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010274419.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Nelumbo 
nucifera]
Length=775

 Score =   774 bits (1999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/773 (57%), Positives = 551/773 (71%), Gaps = 44/773 (6%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVD-DDSVKLFFQTSASIAGTPQRVAWMISERLQ  297
             LS   M ++ ++ DT LP+++   H+A D DDS+  F+  SAS   TPQ VA +I+E+L 
Sbjct  21    LSSREMHSLCTLCDTLLPSIN---HSATDEDDSLSNFYWASASTTATPQLVAGIITEKLP  77

Query  298   HPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIK  477
              PK  +LRL LWLLST  GT +L GK+SLS++FPY Q F ++S  KR EI+ SWS     
Sbjct  78    LPKAGILRLTLWLLSTWFGTFILTGKSSLSTKFPYFQKFSQVSQKKREEILLSWSTSSFS  137

Query  478   ILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHM  657
             +L+  +   K+++L  FF+QV+E NEN SWKA+ YCGPDPD                +H 
Sbjct  138   LLRMLFKIFKLLLLFVFFTQVDEKNENPSWKALGYCGPDPDF---------------KHQ  182

Query  658   TLSEEQKKGEEDVIPMNPEL---LLGPLHKGVINLNQEPRRQVFDRLQKLGFPVS-----  813
             T  +  K  ++D+     E    L GPL++ +IN  + PR+ + + L++ GFPV+     
Sbjct  183   T--QASKTDQDDLTSEEEEKKEELFGPLYRRLIN-PRHPRQSIAEYLEQSGFPVTINHFH  239

Query  814   ----PCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARssl  981
                 P I      +PS  I CDAVVVGSGSGG V A VLA AG+KVLVLEKGKYFAR++L
Sbjct  240   GNKTPSIS-----SPSLTIRCDAVVVGSGSGGSVAAAVLAKAGYKVLVLEKGKYFARNNL  294

Query  982   sllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHK  1161
             SLLEG SL++MYL GGL A+ D+ + L AG+ VGGGST+NWSASI+TP HV++EW  +HK
Sbjct  295   SLLEGPSLEQMYLDGGLTATDDLGVFLFAGATVGGGSTVNWSASIRTPGHVMEEWCYSHK  354

Query  1162  LELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYC  1341
             LELF  K Y  AM+ VC+RMGVQ +  +E F N VLR+GCLELGYPV  + +NA  DHYC
Sbjct  355   LELFDRKPYNRAMDVVCNRMGVQVDTREESFNNAVLRRGCLELGYPVSRVSQNAPMDHYC  414

Query  1342  GWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKK--TGREQAAGVMFVY  1515
             GWC FGCKDGKK+GT+ETWL DLVDSGNGVI P CEA+KV+H +K    R  A GV F  
Sbjct  415   GWCGFGCKDGKKQGTAETWLVDLVDSGNGVILPGCEALKVLHERKRRNDRSTAIGVAFRL  474

Query  1516  QN-NGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAP  1692
              N +G  + C V+S+VTV+ACGAL TP LLK SGL+N NIG++L +HPVV AWGYF D P
Sbjct  475   DNGSGGHDICVVESKVTVVACGALRTPVLLKRSGLKNTNIGKHLRVHPVVLAWGYFADEP  534

Query  1693  GSKAWPE--PEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTD  1866
              S    E   +K+SY+GGI+T+MS VVA FE SGYGA++QTPSLHPG+FS +MPW+SG D
Sbjct  535   ASSNGDEWVKDKRSYEGGILTSMSTVVAGFEGSGYGAILQTPSLHPGLFSVLMPWVSGAD  594

Query  1867  IKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGA  2046
              K RM RFSRTA +FALARDK SG+  S  S+SY +   D+ +L  G+EK+LRILAAAGA
Sbjct  595   FKERMSRFSRTAHVFALARDKGSGQVNSESSLSYRLDAIDEENLSKGVEKMLRILAAAGA  654

Query  2047  EEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSS  2226
             EEIGT H  G+ L  K AS+DE ++FV++ES R LG LST + SAHQMGSCRMGVD   S
Sbjct  655   EEIGTHHCEGRKLNVKRASKDEFEKFVKEESGRKLGGLSTPVASAHQMGSCRMGVDRDKS  714

Query  2227  VVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHN  2385
             VV P GETWEVEGLF+AD+SVFPTALGVNPMVTVQAI+YCTA SV++FL+ ++
Sbjct  715   VVCPRGETWEVEGLFVADTSVFPTALGVNPMVTVQAISYCTAHSVIEFLERND  767



>ref|XP_011072475.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Sesamum 
indicum]
Length=671

 Score =   755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/616 (64%), Positives = 476/616 (77%), Gaps = 12/616 (2%)
 Frame = +1

Query  535   QVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPE  714
              VNE  EN+SWKAI YCGPDP   K       + +  E      EE ++   D    + E
Sbjct  59    HVNEKGENLSWKAIGYCGPDPGCTKT------RRLNAENTQQPPEECEEKLAD--GASKE  110

Query  715   LLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVS-PCIQQK--GSGNPSFVIECDavvvgs  885
              L G L+KG+INL+Q PR     +LQ LGF VS P  + +   S NPSF+++CDAVVVGS
Sbjct  111   ELFGSLYKGIINLSQ-PREDPLSKLQNLGFSVSIPHSRNRRMKSLNPSFIVKCDAVVVGS  169

Query  886   gsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLL  1065
             GSGGGV+AGVLANAGHKVLVLEKG YFAR++LSLLEG ++D+MYLG G+  + ++D+LLL
Sbjct  170   GSGGGVMAGVLANAGHKVLVLEKGSYFARANLSLLEGEAMDQMYLGKGMATTDNLDVLLL  229

Query  1066  AGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVED  1245
             AGS VGGGSTINWSASI TPPHV++EW E HKL+LF SK Y+ A++ VC +MGVQSEVE 
Sbjct  230   AGSTVGGGSTINWSASIHTPPHVIREWSEKHKLKLFESKVYQQALDVVCQKMGVQSEVEH  289

Query  1246  EGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGN  1425
             EGF NM+LRKGC +LGYPVET+PRNA  DHYCGWC FGCKDG+KKGTSETWL DLV+SGN
Sbjct  290   EGFNNMILRKGCEKLGYPVETVPRNAPSDHYCGWCCFGCKDGRKKGTSETWLVDLVESGN  349

Query  1426  GVIFPECEAVKVVHNKKTGREQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLK  1605
             G I P CEA++V+  +  G+++A GV F +     +E   V+S VTV A GA+CTP LLK
Sbjct  350   GAILPACEALRVITEESNGKKRAIGVAFAFYTPFGREIGIVESDVTVAASGAICTPPLLK  409

Query  1606  NSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEES  1785
              SGL+N NIG+NLH+HPVV AWGYFPD+    AWP  EK+SY+GGI+TAMS V+AN E S
Sbjct  410   RSGLKNRNIGKNLHIHPVVMAWGYFPDSASPDAWPAAEKRSYEGGIITAMSTVIANTETS  469

Query  1786  GYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSIS  1965
             GYG +IQTP LHPGMFS +MPW+SGTD+K RM +FSRT  +FALARDK SG+  S  ++S
Sbjct  470   GYGTVIQTPILHPGMFSLLMPWISGTDMKNRMVKFSRTTHIFALARDKGSGKITSETNVS  529

Query  1966  YNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSR  2145
             Y ++ +D+ +L  GLEKV+RI+AAAGAEEIGT H  G++LK K AS +E + FV++ES R
Sbjct  530   YKLEYSDQENLSKGLEKVMRIMAAAGAEEIGTQHTTGRVLKVKQASEEEFERFVKEESLR  589

Query  2146  DLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVT  2325
              L  LS+ IGSAHQMGSCRMGVDP+SS VNP GETWEVEGLF+ADSSVFPTALGVNPMVT
Sbjct  590   PLQKLSSPIGSAHQMGSCRMGVDPKSSAVNPKGETWEVEGLFVADSSVFPTALGVNPMVT  649

Query  2326  VQAIAYCTAQSVLKFL  2373
             +QAIAYCTAQSVL+ L
Sbjct  650   IQAIAYCTAQSVLEVL  665



>gb|EPS61567.1| hypothetical protein M569_13229, partial [Genlisea aurea]
Length=735

 Score =   756 bits (1953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/764 (54%), Positives = 537/764 (70%), Gaps = 37/764 (5%)
 Frame = +1

Query  97    GVYSGG-CPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVA  273
             G  SGG CP S   M ++ ++ DTFLP ++ P   A DD  +  FF+TSAS A TP +VA
Sbjct  4     GAESGGKCPYSRRQMESLAALCDTFLPEME-PPSGADDDKDISRFFRTSASTANTPHQVA  62

Query  274   WMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVR  453
              ++  +++H ++ L  LALW+LST IGT +LCG+ SLS +FPYLQ F  +S   R EI+ 
Sbjct  63    ILMGHKIRHRRLFLAPLALWVLSTAIGTWVLCGRKSLSRRFPYLQKFSRVSTENRKEIMH  122

Query  454   SWSCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKK  633
             SW+  +  +L+  +  +K+ + L FFSQV+E  +N+SW+AI Y        +   G +  
Sbjct  123   SWANSHFFVLRLLFNALKIFITLIFFSQVDEKGDNVSWQAIRY--------RSKTGGAAM  174

Query  634   WITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVS  813
              + +  +M  ++E           NPEL  GPL +G+I+L  + + +   +L  LGFPVS
Sbjct  175   NVQQLGNMITAQENS---------NPEL--GPLREGIIDL--KSKEESLQKLSDLGFPVS  221

Query  814   PCIQQ-KGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsll  990
                 + +  G  S+ +E D VV+GSG GGGV+AGVLA  G+K +VLEKGKYF  + L LL
Sbjct  222   LNPNRIRRRGGASYAVESDVVVIGSGCGGGVVAGVLAQQGYKTIVLEKGKYFPTARLPLL  281

Query  991   egsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLEL  1170
             EG ++D+MYLG G++ + +MDIL+LAGS VGGGSTINWSASI+TPPHV KEW E H+L+L
Sbjct  282   EGQAMDQMYLGNGIIGTDNMDILILAGSTVGGGSTINWSASIRTPPHVRKEWSENHELKL  341

Query  1171  FGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWC  1350
             F S  Y  AM+ VC ++GVQ+ V +EGF NMVLRKGC EL  P ETIPRNAS DHYCG C
Sbjct  342   FESSAYDDAMDAVCGKIGVQANVAEEGFNNMVLRKGCDELRIPAETIPRNASSDHYCGSC  401

Query  1351  SFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQAAGVMFVYQNNGA  1530
              FGC++G K+G +ETWL DLV SGNG I PECEAVK++ +K+ GR+ A GV F  +N   
Sbjct  402   CFGCENGGKRGVAETWLMDLVSSGNGAILPECEAVKIITSKRGGRKHAGGVSFRLKNG--  459

Query  1531  KEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWP  1710
              EF  V+S++TV++CGA+ TP+LLK S L+N +IGRNLHLHPVV  WGYFPD P  ++WP
Sbjct  460   -EFAVVESKITVVSCGAIGTPALLKKSRLKNRHIGRNLHLHPVVMGWGYFPDGP--ESWP  516

Query  1711  EPEKKSYQGGIMTAMSK--VVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQ  1884
             E EK SY+G IMTAMSK  +++N       A+IQTP+LHPGMFSA+MPW+SG   K +M 
Sbjct  517   ETEKVSYEGAIMTAMSKSLMISNR------AIIQTPALHPGMFSALMPWISGDAHKKKML  570

Query  1885  RFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTC  2064
             +F RTA LF L RD  +GE  SP  ISY +   D+ +L+ G+E VLRILAAAGAEEIGT 
Sbjct  571   KFPRTANLFTLVRDLGTGEVNSPTDISYRVDDRDEENLRRGMEMVLRILAAAGAEEIGTQ  630

Query  2065  HRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMG  2244
             H+ G++L  K A+ +E+++FV++ES R   NLS+ + SAHQMGSCRMG  P  S V P G
Sbjct  631   HKQGRVLNVKRATEEELEKFVKEESERGFRNLSSPMCSAHQMGSCRMGASPAESAVAPDG  690

Query  2245  ETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             E+WEVEGL++ADSSVFPTALGVNPMVT+QAIAYCTAQS+L  L+
Sbjct  691   ESWEVEGLYVADSSVFPTALGVNPMVTIQAIAYCTAQSILTRLR  734



>gb|KCW78402.1| hypothetical protein EUGRSUZ_D02568 [Eucalyptus grandis]
Length=758

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/767 (54%), Positives = 520/767 (68%), Gaps = 78/767 (10%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDD--------DSVKLFFQTSASIAGTPQRVAW  276
             LSP  M T+T++ DTFLP++  P H +  D        + V  F++TSAS+AGTP+++  
Sbjct  49    LSPRQMDTLTALCDTFLPSIAHPHHPSYTDSGGDGDCDEEVAKFYRTSASMAGTPEKLGG  108

Query  277   MISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRS  456
             +ISER++HPK+ LLRL LW LST IGT +LCG+   SS FPY+Q FPEI   +R EIVR 
Sbjct  109   LISERIKHPKLWLLRLTLWFLSTCIGTFILCGQKCFSSHFPYVQRFPEIPQRRREEIVRR  168

Query  457   WSCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPD--SNKKPAGKSK  630
             WS     +L+ F   +K++  L FF+QV+E + N+SWKAI Y GPDP+  ++KK    S 
Sbjct  169   WSRSVFPLLRIFARTVKLLTFLVFFTQVDEKDHNVSWKAIGYAGPDPEFENSKKLKRTSC  228

Query  631   KWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPV  810
             +    EQ        K G ED      E   GPLH+G+I++   PR  V   L++ GFPV
Sbjct  229   QISADEQQGKEQATAKNGYED------EAFFGPLHQGLIHMVH-PRDIVTKSLRQFGFPV  281

Query  811   SPCIQQKGSGNPSF---VIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARssl  981
               C        P F    I+CDAVV+GSG+GGGV+AGVLA AG+KVLVLEKG Y ARS+L
Sbjct  282   LICPSNHNVRKPRFPSLSIQCDAVVIGSGAGGGVVAGVLAKAGYKVLVLEKGSYCARSNL  341

Query  982   sllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHK  1161
             SLLEG ++D+MYL GG+VA++DM  L+LAGS VGGGSTINWSAS++TP HV+ EW   + 
Sbjct  342   SLLEGPTMDQMYLSGGVVATEDMSTLVLAGSTVGGGSTINWSASLRTPQHVMNEWSNKYD  401

Query  1162  LELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYC  1341
             LELF SK YR A++ VC RMGVQS + +EGF N VLRKGC ELGYPV  IPRN+  DHYC
Sbjct  402   LELFDSKLYREALDVVCKRMGVQSAISEEGFNNAVLRKGCQELGYPVSNIPRNSPADHYC  461

Query  1342  GWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKT--GREQAAGVMFVY  1515
             GWC  GCKDGKKKGT+ETWL DLV+SGNG I P CEA++V+H++++  GR+ A GV F +
Sbjct  462   GWCCLGCKDGKKKGTAETWLVDLVESGNGAILPGCEAIEVLHSRQSRRGRDTATGVTFEF  521

Query  1516  QNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPG  1695
             ++NG KE C ++S+VT++ACGAL TP+LLK SGL+NPNIG+NLHLHPV  AWGYFPD   
Sbjct  522   EHNGVKEVCIIESKVTIVACGALSTPALLKRSGLKNPNIGKNLHLHPVTMAWGYFPDTEM  581

Query  1696  SKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKT  1875
             +  WPE EKKSY+GGIMTAM K        G G +  + S                    
Sbjct  582   ADLWPEKEKKSYEGGIMTAMDK--------GSGTITSSTS--------------------  613

Query  1876  RMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEI  2055
                                         ISY M   D+ +L+ GLEKVLRILAAAGAEEI
Sbjct  614   ----------------------------ISYKMDDADEQNLQKGLEKVLRILAAAGAEEI  645

Query  2056  GTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVN  2235
             G+ H  GK LK K  S  E ++FV++ES+R +  LST I SAHQMGSCRMG DPRSS VN
Sbjct  646   GSHHGEGKTLKVKQVSYHEFEQFVKEESARSIKGLSTPICSAHQMGSCRMGPDPRSSAVN  705

Query  2236  PMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             PMGETWEVEGL++AD+SVFPTALGVNPMVTVQAIAYCTAQSVL+ L+
Sbjct  706   PMGETWEVEGLYVADTSVFPTALGVNPMVTVQAIAYCTAQSVLEALR  752



>gb|KHN27504.1| Long-chain-alcohol oxidase FAO4A [Glycine soja]
Length=638

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/648 (61%), Positives = 494/648 (76%), Gaps = 19/648 (3%)
 Frame = +1

Query  448   VRSWSCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKS  627
             ++SWS  Y++ L+ F+  +K++ LL FF+Q++E  +N SWKAI YCGPDP+   +     
Sbjct  1     MQSWSLSYLRPLRMFFRTIKLLTLLVFFTQLDEAEDNPSWKAIGYCGPDPEFKSQ---LK  57

Query  628   KKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFP  807
               + T+++     E++  G EDV         GPL+KG+I +N  PR  + D L+++GF 
Sbjct  58    NHFFTKQRGQ--EEKEDDGTEDV--------RGPLYKGLIRINN-PRDIITDSLRRVGFS  106

Query  808   VSPCIQQKGSG---NPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARss  978
             VS   ++  +    +PS VI+CDAVVVGSGSGGGV+AGVLANAG+KVLVLEKG Y AR++
Sbjct  107   VSATPKKTKASTLSSPSLVIKCDAVVVGSGSGGGVVAGVLANAGYKVLVLEKGSYSARNN  166

Query  979   lsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETH  1158
             LSLLEG S+D+MYL  GLVA+ DM +L+LAGS VGGGS INWSASI+TP HV KEW + H
Sbjct  167   LSLLEGPSMDQMYLSNGLVATNDMSVLILAGSTVGGGSAINWSASIRTPQHVCKEWCDRH  226

Query  1159  KLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHY  1338
             +LELF S  Y+ A++ VC +MGVQSE++DEGF N VLR+GC+E+GYPV  IPRNA+ DHY
Sbjct  227   ELELFESMLYKEALDVVCEKMGVQSEIDDEGFNNAVLRRGCVEMGYPVCNIPRNATSDHY  286

Query  1339  CGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQ--AAGVMFV  1512
             CGWC  GCKDG+KKGT ETWL DLV SGNG I P CEA++V+H KK GR +  A GV F 
Sbjct  287   CGWCCLGCKDGRKKGTLETWLVDLVKSGNGAIIPSCEAIQVLHKKKKGRHRKIARGVAFA  346

Query  1513  YQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAP  1692
              +  G K+ C V+S+VT++ACGAL TP+LLK SGL+N NIGRNLHLHPV  AWGYFPD+P
Sbjct  347   IEYKGKKDICVVESKVTIVACGALSTPALLKRSGLKNENIGRNLHLHPVAMAWGYFPDSP  406

Query  1693  GSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIK  1872
               + WPE  KKSY+GGIMTAMS VVA F++SGYG +IQTP+LHPGMFS +MPW SG DIK
Sbjct  407   SPELWPEKHKKSYEGGIMTAMSTVVAQFDKSGYGTVIQTPALHPGMFSILMPWTSGADIK  466

Query  1873  TRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEE  2052
              RM++FSRTA +FALARD+ SG   SP  ISY ++  DK +LK GLEKVLRILAAAGAEE
Sbjct  467   DRMRKFSRTAHVFALARDQGSGTVNSPSCISYQLKDIDKENLKVGLEKVLRILAAAGAEE  526

Query  2053  IGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVV  2232
             IGT +  G+ +  K  S  E ++FV++ESS  L ++ST + SAHQMGSC+MG +PR SVV
Sbjct  527   IGTHNNKGRRINVKQVSYHEFEKFVKEESSMSLTDISTPLCSAHQMGSCKMGTNPRESVV  586

Query  2233  NPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             N MGETWEVEGL+LADSSVFPTALGVNPMVTVQAI+YCTAQ VL+ L+
Sbjct  587   NQMGETWEVEGLYLADSSVFPTALGVNPMVTVQAISYCTAQYVLEVLR  634



>ref|XP_010676700.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Beta vulgaris 
subsp. vulgaris]
Length=808

 Score =   749 bits (1933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/774 (54%), Positives = 553/774 (71%), Gaps = 37/774 (5%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
             LS   M ++T++ DT LPAVD P+  +  D+SV  F++TSAS+ GTP+ V  MIS+RL+ 
Sbjct  45    LSSWEMESLTALCDTLLPAVDPPE--STTDESVVRFYRTSASMNGTPEHVGRMISQRLRQ  102

Query  301   PKVIllrlalwllSTRIGTLMLCGKA----SLSSQFPYLQSFPEISPHKRAEIVRSWSCC  468
               V+L R+ L LL+TR+GT +L        +LS ++P+L    E+S  KR ++V SW   
Sbjct  103   -HVLLGRIILVLLATRLGTFVLGLLGGGLPNLSPRYPFLLKCSEMSLEKRQQLVLSWRTS  161

Query  469   YIKILKTFYLGMKVMVLLSFFSQVNENNE-NISWKAIDYCGPDPDSNKKPAGKSKKWITR  645
             +  +++  + GMK ++ + +F+QV++N + N  W+AI YCGPDP    K A +S K   +
Sbjct  162   WFYLVRMIFFGMKRLISVVYFTQVDDNEDYNPIWEAIGYCGPDPYFISKKASESNK---Q  218

Query  646   EQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQ  825
               ++T      + +ED        L GPL+KG+IN+ +  +  + + L+   F VS   +
Sbjct  219   SAYLTPKSLHNQPKED--------LCGPLYKGIINV-KCTQEILIESLKHSNFQVSINRK  269

Query  826   QKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegssl  1005
             +K        I+CD VVVGSGSGGGV AGVLA+ G+KVLV++KG Y+AR++LSLLEG +L
Sbjct  270   KKDCQMQVITIKCDVVVVGSGSGGGVAAGVLASLGYKVLVIDKGDYYARTNLSLLEGPTL  329

Query  1006  DEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKE  1185
             D+MY G GL+++KD+ + +LAGS VGGGSTINWSASI+TPPHV+KEW + H+LE+F S  
Sbjct  330   DQMYEGAGLLSTKDLGVNILAGSTVGGGSTINWSASIRTPPHVIKEWADVHELEIFDSPL  389

Query  1186  YRHAMETVCSRMGVQSEVE--DEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFG  1359
             Y+ A++ VC +M VQS+++  DEGF N VLRKGCLELGYPV  IP+NA ++H CGWC  G
Sbjct  390   YKEALDVVCEKMEVQSDIDVSDEGFNNAVLRKGCLELGYPVVNIPQNAPKNHNCGWCCLG  449

Query  1360  CKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGR--EQAAGVMF-VYQNNGA  1530
             CKDGKKK T ETWL D+V+SGNG I   CE  KV++ ++ GR  + A GVMF +  +N  
Sbjct  450   CKDGKKKSTCETWLKDVVNSGNGAILTGCEVAKVLYGRQKGRNRDTAKGVMFDITSSNDR  509

Query  1531  KEFC-FVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAP-----  1692
             +  C  V+++ T+IACGAL TP+LL+ SGL N NIG+NLHLHPVV AWGYFPD+      
Sbjct  510   QSSCVIVEAKATIIACGALNTPALLRRSGLNNKNIGKNLHLHPVVMAWGYFPDSEPLSSL  569

Query  1693  -----GSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLS  1857
                  G + WPE +KKSY+GGIMT MS VVA+F +SGYG +IQTPSLHPG+FSA+MPW S
Sbjct  570   LSDNQGDQVWPEKQKKSYEGGIMTTMSTVVADFNDSGYGTVIQTPSLHPGLFSAMMPWTS  629

Query  1858  GTDIKTRMQRFSRTAILFALARDKTSGE-APSPFSISYNMQKTDKVSLKNGLEKVLRILA  2034
             G +IK RM +FSRT+ +FALARD  SG  + SPF I Y M   D+ +L+ G+EK+LRILA
Sbjct  630   GLNIKHRMTKFSRTSHMFALARDMGSGVISTSPFDIKYKMHPIDEANLQKGIEKMLRILA  689

Query  2035  AAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVD  2214
             AAGAEEIGT H +G  +  K AS  E ++FV+KESS+ +  LS  I SAHQMGSCRMG++
Sbjct  690   AAGAEEIGTHHYSGSSINVKKASFHEFEKFVKKESSKAIQGLSMPIASAHQMGSCRMGIN  749

Query  2215  PRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             PR+SVVN  GE+WEVEGL+LADSSVFPTALGVNPMVTVQAI+YCT QSVL+FL+
Sbjct  750   PRTSVVNQRGESWEVEGLYLADSSVFPTALGVNPMVTVQAISYCTTQSVLEFLR  803



>ref|XP_002867943.1| hypothetical protein ARALYDRAFT_914728 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44202.1| hypothetical protein ARALYDRAFT_914728 [Arabidopsis lyrata subsp. 
lyrata]
Length=725

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/755 (55%), Positives = 525/755 (70%), Gaps = 41/755 (5%)
 Frame = +1

Query  136   MATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIl  315
             M ++ +I DTF+ ++D      VDD  V  +F  SAS  GTP R A ++SERL HPK  +
Sbjct  1     MESLVAICDTFISSIDGSGVGHVDD-CVAGYFSASASQTGTPDRAARLMSERLHHPKKWI  59

Query  316   lrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTFY  495
             LR  LWLLST IGTL+LCG+ S + QFPY + F  +   +R EI+ +WS  Y  +L+ F+
Sbjct  60    LRAGLWLLSTWIGTLILCGRRSFTGQFPYFRRFCRLPEKQREEILLNWSSSYFSLLRMFF  119

Query  496   LGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQ  675
               +K++    FF+QV+EN  N++WKAI Y GP  D +             +  + L+E+ 
Sbjct  120   RSIKLITAFVFFTQVDENGRNLAWKAIGYDGPSSDHS-------------DHEVELNEKM  166

Query  676   KKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFV  855
             +K         PE + GPL+ G+I+L Q PR  V  +L   GF VS    QK + N S +
Sbjct  167   QK--------KPEEIFGPLYNGIIDL-QSPREAVAKKLTGHGFTVS---TQKRNTNGSSI  214

Query  856   ------IECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMY  1017
                   I CDAVVVGSGSGGGV+AGVLA AG+KVLV+E G Y+ARS LSLLEG ++D+MY
Sbjct  215   SDLVMTIRCDAVVVGSGSGGGVVAGVLAKAGYKVLVVESGTYYARSKLSLLEGQAMDDMY  274

Query  1018  LGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHA  1197
             L GGL+A+ D ++++LAGS VGGGSTINWSASI+TP HV+KEW E  KLE+FGS  YR A
Sbjct  275   LSGGLLATSDTNVVILAGSTVGGGSTINWSASIKTPEHVIKEWAEKSKLEMFGSDLYREA  334

Query  1198  METVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKK  1377
             M+ VC RMGVQ    +EGF N +LRKGC ELG PV+ IPRNA+ DHYCG+C  GCK G+K
Sbjct  335   MDVVCERMGVQCGFVEEGFNNEILRKGCEELGLPVKNIPRNAASDHYCGFCCLGCKKGQK  394

Query  1378  KGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTG-REQAAGVMFVYQNNGAKEFCFVKS  1554
             +GTSETWL DLV+SGNG+I P CEA++V+++   G +++A GV F Y     +E   V+S
Sbjct  395   QGTSETWLVDLVESGNGLILPGCEAMEVLYDCGRGKKKKATGVAFAY----GEEIYVVES  450

Query  1555  RVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQ  1734
             + TV+ACGAL TP LLK SGLRN NIGRNL LHPVV AWG+FPD      WPE +KKSY+
Sbjct  451   KTTVVACGALRTPHLLKRSGLRNGNIGRNLCLHPVVMAWGWFPD---EDKWPEKKKKSYE  507

Query  1735  GGIMTAMSKVVANFEESGYGAL-IQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILF  1911
             GGIMTAMS VV     S YG + IQTP+LHPGMFS I+PW S  D KTRM +FSRTA +F
Sbjct  508   GGIMTAMSSVVNAETHSSYGEMVIQTPALHPGMFSGIIPWTSSKDFKTRMLKFSRTAHIF  567

Query  1912  ALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKP  2091
             AL RDK +G   S   I YN+   D+ SLK+GL++VL+ILAAAGAEEIGT H  G+ L  
Sbjct  568   ALLRDKGTGTINSKSYIDYNLNDEDEESLKSGLDRVLKILAAAGAEEIGTHHSEGRSLNV  627

Query  2092  KGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLF  2271
             + AS  EI+ FV +ESS+ L +LS  I SAHQMGSCRMG+ P  S V P GETWEVEGLF
Sbjct  628   RTASTLEIERFVREESSKPLKDLSGQICSAHQMGSCRMGIRPEESAVRPTGETWEVEGLF  687

Query  2272  LADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             +AD+SVFPTALGVNPMVTVQ+IAYC   +V+  LK
Sbjct  688   VADTSVFPTALGVNPMVTVQSIAYCIGLNVVDVLK  722



>gb|KCW78401.1| hypothetical protein EUGRSUZ_D02566 [Eucalyptus grandis]
Length=748

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/764 (54%), Positives = 515/764 (67%), Gaps = 76/764 (10%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAA----VDDDSVKLFFQTSASIAGTPQRVAWMISE  288
             LSP  M T+TS+ DTFLP++  P H +      D+ V  F+QTSAS+AGTP+++  ++SE
Sbjct  43    LSPRQMETLTSLCDTFLPSIAHPHHPSDTEGEGDEEVAKFYQTSASMAGTPEKIGGLVSE  102

Query  289   RLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCC  468
             R++HPK+ LL L LWLLST IGT +LCG+   SS FPY+Q F EI   +R EI R W   
Sbjct  103   RMKHPKLWLLPLTLWLLSTCIGTFILCGRKCFSSHFPYVQRFSEIPQRRREEIARRWFRS  162

Query  469   YIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITRE  648
                +L+ F   +K++  L FF+Q++E + N+SWKAI Y GPDPD        SKK   + 
Sbjct  163   VFPVLRMFARTIKLLTFLVFFTQLDEKDRNLSWKAIGYAGPDPDFEN-----SKKL--KR  215

Query  649   QHMTLSEEQKKGEEDVIPMN---PELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPC  819
                 +S ++++G+E     N    E + GPLH+G+I +   P+  V   L++ GFPV  C
Sbjct  216   MSCQVSADEQQGQEQAKAKNCYEDEAISGPLHQGLIQMVH-PQDIVTKSLRQFGFPVLIC  274

Query  820   IQQKGSGNPSF---VIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsll  990
                     P F    I+CDAVV+GSG+GGGV+AGVLA AGHKVLVLEKG Y ARS+LSLL
Sbjct  275   PSNHNVRKPRFPSLSIQCDAVVIGSGAGGGVVAGVLAKAGHKVLVLEKGSYCARSNLSLL  334

Query  991   egsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLEL  1170
             EG ++D+MYL GGLVA++DM  L+LAGS VGGGSTINWSAS++TP HV+ EW   + LEL
Sbjct  335   EGPTMDQMYLSGGLVATEDMSTLVLAGSTVGGGSTINWSASLRTPQHVMNEWSNKYDLEL  394

Query  1171  FGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWC  1350
             F SK Y+ A++ VC RMGVQS + +EGF N VLRKGC ELGYPV  IPRN+  DHYCGWC
Sbjct  395   FDSKLYQEALDVVCKRMGVQSAISEEGFNNAVLRKGCQELGYPVSNIPRNSPADHYCGWC  454

Query  1351  SFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKT--GREQAAGVMFVYQNN  1524
               GCKDGKKKGT+ETWL DLV+SGNG I P CEA++V+H +++  GR+   GV F +++N
Sbjct  455   CLGCKDGKKKGTAETWLVDLVESGNGAILPGCEAIEVLHTRRSGRGRDTVTGVAFEFEHN  514

Query  1525  GAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKA  1704
             G KE C V+S VT++ACGAL TP+LLK SGL+NPNIG+NLHLHPV  AWGYFPD      
Sbjct  515   GFKEVCIVESNVTIVACGALGTPALLKRSGLKNPNIGKNLHLHPVAMAWGYFPDTKTVDL  574

Query  1705  WPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQ  1884
             WPE EKKSY+GGIMTAM K        G G +  + S                       
Sbjct  575   WPEKEKKSYEGGIMTAMDK--------GSGTIASSTS-----------------------  603

Query  1885  RFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTC  2064
                                      ISY M  TD+ +L+ GLEKVLRILAAAGAEEIGT 
Sbjct  604   -------------------------ISYKMDDTDEHNLQKGLEKVLRILAAAGAEEIGTH  638

Query  2065  HRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMG  2244
             H  GK LK K  S  E + FV++ES+R +   ST I SAHQMGSCRMG +PRSSVVNPMG
Sbjct  639   HNEGKTLKVKQVSYHEFERFVKEESARPIKGQSTPICSAHQMGSCRMGPNPRSSVVNPMG  698

Query  2245  ETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             ETWEVEGL++AD+SVFPTALGVNPMVTVQAIAYCTAQSVL+ L+
Sbjct  699   ETWEVEGLYVADTSVFPTALGVNPMVTVQAIAYCTAQSVLEALR  742



>ref|XP_010538590.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X1 [Tarenaya 
hassleriana]
Length=782

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/768 (54%), Positives = 535/768 (70%), Gaps = 36/768 (5%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
             L+   M ++ +I DT +P+++  +   VDD  V  FF  SAS  GTP RVA  IS  L H
Sbjct  33    LTAREMESLWAICDTLIPSINGSEVCHVDDH-VAGFFAASASQMGTPDRVARKISGTLDH  91

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  480
             PK  LLR ALWLLST IG+L+LCG+ S S +FPY + F  +   +R EI+ SW+  +  +
Sbjct  92    PKKWLLRAALWLLSTHIGSLVLCGRKSFSGEFPYCRRFCRLPQKQREEIMLSWASSFFSL  151

Query  481   LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMT  660
             L+ F+  MK++  L FF+QV+E  +N++W+AI Y GP  DS  + + +  + I RE    
Sbjct  152   LRMFFKAMKLITALVFFTQVDEKGKNLAWEAIRYTGPISDS--EDSDQEDQTIHREH---  206

Query  661   LSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSG  840
               +E+ K E       PE + GP++ G+++L   PR  V + L + GF VS    +   G
Sbjct  207   --QEKTKKE-------PEQIFGPIYNGIVDL-MNPREVVIETLNRHGFQVSTRTGKNSHG  256

Query  841   ----------NPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsll  990
                       +P   I CDAVVVGSGSGGGV+AGVLA AG+KVLVLEKG Y+AR++LSLL
Sbjct  257   RDRRPGSSISDPVMKIRCDAVVVGSGSGGGVVAGVLAKAGYKVLVLEKGNYYARNNLSLL  316

Query  991   egsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLEL  1170
             EG ++++MYL  GLVA+ DM+ ++LAGS+VGGGST+NWSASI+TP +V+KEW E   L+L
Sbjct  317   EGQAMEQMYLSSGLVATADMNTVILAGSSVGGGSTVNWSASIRTPENVIKEWSEKCGLKL  376

Query  1171  FGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWC  1350
             F S  YR AM+ VC RMGVQS   +EGF N +LRKGC  LG+PV++IPRN+  DHYCG+C
Sbjct  377   FESGFYREAMDVVCERMGVQSGFVEEGFNNEILRKGCEALGFPVKSIPRNSLADHYCGFC  436

Query  1351  SFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQAAGVMFVYQN--N  1524
              FGCK G+KKGT+ETWL DLVDSGNGVI P CEA++V+  ++ G++ AAGV F+++N   
Sbjct  437   CFGCKKGRKKGTAETWLVDLVDSGNGVILPGCEALQVLQRRERGKKTAAGVAFLFENIDE  496

Query  1525  GAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKA  1704
               KE   V+S+VT++ACGAL TP LL+NSGL+NPNIGRNL LHPV  AWG+FP+    + 
Sbjct  497   ARKEIYVVESKVTIVACGALRTPILLRNSGLKNPNIGRNLCLHPVAMAWGWFPE----EK  552

Query  1705  WPEPEKKSYQGGIMTAMSKVVANFE---ESGYG-ALIQTPSLHPGMFSAIMPWLSGTDIK  1872
             WP   KKSY+GGIMT MS V A+ E    + YG  +IQTP+LHPGMFS I+PW SG D K
Sbjct  553   WPGKGKKSYEGGIMTTMSTVSADAEVESPNSYGTTIIQTPALHPGMFSGIIPWTSGKDYK  612

Query  1873  TRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEE  2052
              RM +FSRTA +FAL RDK SGE  S  SI+Y +  TD+ +LK G+E++LRIL AAGAEE
Sbjct  613   NRMLKFSRTAHVFALTRDKGSGEIRSLNSITYTLNGTDEENLKKGIERILRILTAAGAEE  672

Query  2053  IGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVV  2232
             IGT +  GK L  K AS +E + FV +ESS+ L  LS  I SAHQMGSCRMGV    S V
Sbjct  673   IGTHNLEGKSLNVKAASSEEYERFVREESSKPLKGLSGQICSAHQMGSCRMGVAAEKSAV  732

Query  2233  NPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
              P GETWEVEGLF+AD+SVFPTALGVNPMVTVQAIAYC    V+  LK
Sbjct  733   RPTGETWEVEGLFVADTSVFPTALGVNPMVTVQAIAYCVGSYVIDVLK  780



>gb|KHN11789.1| Long-chain-alcohol oxidase FAO4A [Glycine soja]
Length=622

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/625 (62%), Positives = 476/625 (76%), Gaps = 21/625 (3%)
 Frame = +1

Query  529   FSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMN  708
             + Q++E+ +N++WKAI YCGPDP+   +           + H      +  G+ED     
Sbjct  5     YFQIDESEDNVAWKAIGYCGPDPEFKAQ----------LKNHFLDGTSKGGGQEDKEEDE  54

Query  709   PEL-LLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQK---GSGN---PSFVIECD  867
                 ++GPL+KG+++LN  P+    D L++ GFPVS  I++K    + N   PS VI+CD
Sbjct  55    DAEEMIGPLYKGLVHLNY-PQDITADALRRFGFPVS-VIRRKHKAAAANLSCPSLVIQCD  112

Query  868   avvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKD  1047
             AVVVGSGSGGGVIAGVLA AG+KVLVLEKG Y A+++LSLLEG ++D+MYL GGLVAS D
Sbjct  113   AVVVGSGSGGGVIAGVLAKAGYKVLVLEKGGYSAKNNLSLLEGPTMDQMYLNGGLVASDD  172

Query  1048  MDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGV  1227
             M + +L+GS VGGGS INWSA I+TP HV KEW + H LELF S+ YR A++ VC +MGV
Sbjct  173   MGVFILSGSTVGGGSAINWSACIKTPQHVCKEWCDKHGLELFESELYREALDAVCGKMGV  232

Query  1228  QSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLAD  1407
             QSE+EDEGF N +LRKGC E+GYPV  IPRN+  +HYCGWC  GCKDG+KKGTSETWL D
Sbjct  233   QSEIEDEGFNNAILRKGCQEMGYPVNNIPRNSPSNHYCGWCCMGCKDGRKKGTSETWLVD  292

Query  1408  LVDSGNGVIFPECEAVKVVHNKKTGREQ--AAGVMFVYQNNGAKEFCFVKSRVTVIACGA  1581
             LV SGNG I P CEA+KV+H KK G+++  A GV F ++  G K+ C V+S+VT++ACGA
Sbjct  293   LVKSGNGAILPGCEAIKVLHKKKEGKDRKIARGVAFEFEYKGTKDVCVVESKVTIVACGA  352

Query  1582  LCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSK  1761
             L TP+LLK SGLRN NIG+NLHLHPVV AWGYFPDAP S+ WPE  KKSY+GGIMTAMS 
Sbjct  353   LSTPALLKRSGLRNQNIGKNLHLHPVVMAWGYFPDAPESEVWPEAYKKSYEGGIMTAMST  412

Query  1762  VVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGE  1941
             VVA FE+SGYGA+IQTPSLHPGMFS + PW SG DI+ RM++FSRTA +FALARD+ SG 
Sbjct  413   VVAEFEQSGYGAVIQTPSLHPGMFSIVTPWTSGIDIRDRMRKFSRTAHIFALARDQGSGT  472

Query  1942  APSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDE  2121
               +P  ISY     D+ +LK G+EKVLRILAAAGAEEIGT H  G+ L  K  S  E ++
Sbjct  473   VKAPDRISYKPADVDEENLKKGIEKVLRILAAAGAEEIGTHHNKGRTLNVKQVSYHEFEK  532

Query  2122  FVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTA  2301
             FV++ESSR L +L+T + SAHQMGSCRMG +P+ SVVNP GETWEVEGL++AD+SVFPTA
Sbjct  533   FVKEESSRSLTDLTTPLCSAHQMGSCRMGSNPKQSVVNPTGETWEVEGLYVADASVFPTA  592

Query  2302  LGVNPMVTVQAIAYCTAQSVLKFLK  2376
             LGVNPMVTVQAIAYCTAQSV++ LK
Sbjct  593   LGVNPMVTVQAIAYCTAQSVVEVLK  617



>ref|XP_010439724.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Camelina 
sativa]
 ref|XP_010439725.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Camelina 
sativa]
Length=771

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/764 (54%), Positives = 525/764 (69%), Gaps = 36/764 (5%)
 Frame = +1

Query  103   YSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMI  282
             +     L+   M ++ +I DT +P++D      VDDDSV  +F  SAS  GTP RVA ++
Sbjct  36    FCANSSLTQREMESLVAICDTLIPSIDGSGVGHVDDDSVAEYFSASASQTGTPDRVAKLM  95

Query  283   SERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  462
             SERL HPK  +LR+ALW LST IG+ +LCG+ S + +FPY + F  +   +R +++ +WS
Sbjct  96    SERLDHPKKWILRVALWFLSTWIGSFILCGRRSFTGEFPYFRIFCRLPAKQREDVLLNWS  155

Query  463   CCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWIT  642
               Y  +L+ F+  +K++  L FF+QV+    N+SWKAI Y GP  D +            
Sbjct  156   ASYFSLLRMFFKSIKLITALVFFTQVDGKGRNLSWKAIGYNGPSLDDS------------  203

Query  643   REQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVS-PC  819
              +    L+E++KK         PE + GPL+ G+++L + PR  V  +L   GF VS P 
Sbjct  204   -DLQEELNEKKKK---------PEEIFGPLYNGIVDL-KSPREVVTKKLTDRGFTVSTPK  252

Query  820   IQQKGSG--NPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslslle  993
                KGS   N    I CDAVVVGSGSGGGV+AGVLA AG+KVLV+E G Y+ARS+LSLLE
Sbjct  253   KNPKGSSLSNRVMTIRCDAVVVGSGSGGGVVAGVLAKAGYKVLVVESGNYYARSTLSLLE  312

Query  994   gsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELF  1173
             G +++EMYL GGL+A+ DM++++LAGS VGGGSTINWSASI+TP HV+ EW E  KL++F
Sbjct  313   GQAMEEMYLSGGLLATSDMNVVVLAGSTVGGGSTINWSASIKTPEHVMNEWAEKSKLKMF  372

Query  1174  GSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCS  1353
              S  YR AM+ VC RMGVQ    +EGF N +LRKGC ELG PV+ IPRNA  DHYCG+C 
Sbjct  373   RSDSYREAMDVVCKRMGVQCGFVEEGFNNEILRKGCEELGLPVKNIPRNAPSDHYCGFCC  432

Query  1354  FGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTG--REQAAGVMFVYQNNG  1527
              GCK G+K+GTSETWL DLV+SGNG+I P CE ++V+++ + G  +++A+GV F +    
Sbjct  433   LGCKKGQKQGTSETWLVDLVESGNGLILPGCEVMEVLYDCEQGKKKKKASGVSFAF----  488

Query  1528  AKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAW  1707
              +E   V+SR TV+ACGAL TP LLK SGL N NIGRNL LHPVV AWG+FP+      W
Sbjct  489   GEEIYVVESRSTVVACGALRTPHLLKRSGLTNANIGRNLSLHPVVMAWGWFPE---EDKW  545

Query  1708  PEPEKKSYQGGIMTAMSKVVANFEESGYG-ALIQTPSLHPGMFSAIMPWLSGTDIKTRMQ  1884
             PE +K SY+GGIMTAMS +V    +  YG  +IQTP+LHPGMFS I PW S  D KTRM 
Sbjct  546   PEKKKMSYEGGIMTAMSSLVNAQTQRSYGETVIQTPALHPGMFSGITPWTSSNDFKTRML  605

Query  1885  RFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTC  2064
             +FSRTA +FAL RDK +G   S   I YN+   D+ SLK GLE+VL+ILAA+GAEEIGT 
Sbjct  606   KFSRTAHIFALLRDKGTGTVNSTSCIDYNLNDEDEESLKKGLERVLKILAASGAEEIGTH  665

Query  2065  HRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMG  2244
             +  GK L  + AS  EI+ FV +ESS+ L +LS  + SAHQMGSCRMG+ P  S V P G
Sbjct  666   NLEGKSLNLRTASAVEIERFVREESSKPLKDLSGQLCSAHQMGSCRMGIRPEESAVRPTG  725

Query  2245  ETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             ETWEVEGLF+AD+SVFPTALGVNPMVTVQ+IAYC   +V+  LK
Sbjct  726   ETWEVEGLFVADTSVFPTALGVNPMVTVQSIAYCIGLNVVDVLK  769



>ref|XP_010449364.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Camelina sativa]
Length=768

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/758 (54%), Positives = 525/758 (69%), Gaps = 37/758 (5%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
             L+   M ++ +I DT +P++D      VDD SV  +F  SAS  GTP RVA +ISERL H
Sbjct  40    LTQREMESLVAICDTLIPSIDGSGVGHVDD-SVAEYFSASASQTGTPDRVAKLISERLDH  98

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  480
             PK  +LR+ALW LST IG+ +LCG+ S + +FPY + F  +   +R +++ +WS  Y  +
Sbjct  99    PKKWILRVALWFLSTWIGSFILCGRRSFTGEFPYFRIFCRLPAKQREDVLLNWSASYFSL  158

Query  481   LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMT  660
             L+ F+  +K++  L FF+QV+    N++WKAI Y GP  D +             +    
Sbjct  159   LRMFFKCIKLITGLVFFTQVDGKGRNLAWKAIGYNGPSLDDS-------------DLQEE  205

Query  661   LSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVS-PCIQQKGS  837
             L+E++KK         P+ + GPL+ G+++L + PR  V  +L   GF VS P   QKGS
Sbjct  206   LNEKKKK---------PDEIFGPLYNGIVDL-KSPREVVTKKLTDRGFTVSTPKKIQKGS  255

Query  838   G--NPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDE  1011
                N    I CDAVVVGSGSGGGV+AGVLA AG+KVLV+E G Y+ARS+LSLLEG +++E
Sbjct  256   SLSNRVMTIRCDAVVVGSGSGGGVVAGVLAKAGYKVLVVESGNYYARSTLSLLEGQAMEE  315

Query  1012  MYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYR  1191
             MYL GGL+A+ DM++++LAGS VGGGSTINWSASI+TP HV+ EW E  KLE+FGS  YR
Sbjct  316   MYLSGGLLATSDMNVVVLAGSTVGGGSTINWSASIKTPEHVMNEWAEKSKLEMFGSDSYR  375

Query  1192  HAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDG  1371
              AM+ VC RMGVQ    +EGF N +LRKGC ELG PV+ IPRNA  DHYCG+C  GCK G
Sbjct  376   EAMDVVCKRMGVQCGFVEEGFNNEILRKGCEELGLPVKNIPRNAPSDHYCGFCCLGCKKG  435

Query  1372  KKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTG--REQAAGVMFVYQNNGAKEFCF  1545
             +K+GTSETWL DLV+SGNG+I P CE ++V++  + G  +++A+GV F +     +E   
Sbjct  436   QKQGTSETWLVDLVESGNGLILPGCEVMEVLYECEQGKKKKKASGVSFAF----GEEIYV  491

Query  1546  VKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKK  1725
             V+SR TV+ACGAL TP LLK SGL+N NIGRNL LHPVV AWG+FP       WPE +K 
Sbjct  492   VESRATVVACGALKTPHLLKRSGLKNGNIGRNLCLHPVVMAWGWFPK---EDKWPEKKKM  548

Query  1726  SYQGGIMTAMSKVVANFEESGYG-ALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTA  1902
             SY+GGIMTAMS VV    +S YG  +IQTP+LHPGMFS + PW S  D KTRM +FSRTA
Sbjct  549   SYEGGIMTAMSSVVNAKTQSSYGETVIQTPALHPGMFSGVTPWTSSNDFKTRMLKFSRTA  608

Query  1903  ILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKI  2082
              +FAL RDK +G   S   I YN+   D+ SL+ GLE+VL+ILAA+GAEEIGT +  GK 
Sbjct  609   HIFALLRDKGTGTVNSTSCIDYNLNDEDEESLQKGLERVLKILAASGAEEIGTHNLEGKS  668

Query  2083  LKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVE  2262
             L  + AS  EI+ FV +ESS+ L +LS  + SAHQMGSCRMG+ P  S V P GETWEVE
Sbjct  669   LNLRTASAVEIERFVREESSKPLKDLSGQLCSAHQMGSCRMGIRPEESAVRPTGETWEVE  728

Query  2263  GLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             GLF+AD+SVFPTALGVNPMVTVQ+IAYC   +V+  LK
Sbjct  729   GLFVADTSVFPTALGVNPMVTVQSIAYCIGLNVVDVLK  766



>gb|KDP37817.1| hypothetical protein JCGZ_06719 [Jatropha curcas]
Length=608

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/630 (62%), Positives = 471/630 (75%), Gaps = 37/630 (6%)
 Frame = +1

Query  502   MKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKK  681
             +K++ LL FFSQV+E  EN++WKA+DY GPDP+              +EQ   L   +  
Sbjct  6     VKLLCLLVFFSQVDEKGENLAWKAMDYPGPDPE------------FKKEQEAALKLVKNN  53

Query  682   GEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPV---SPCIQQKGSGNPSF  852
              EE       E L GPL+KG+I++N  PR    + L+  GFPV    P I      NPS 
Sbjct  54    EEEK------EKLFGPLYKGLIDMNL-PRDITANSLRLSGFPVFTYRPKIN-----NPSL  101

Query  853   VIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGL  1032
             VI+CDAVVVGSGSGG V+AGVLA AG+KV+V+EKG YFARS+LSLLEG S+D+MYL  GL
Sbjct  102   VIKCDAVVVGSGSGGSVVAGVLAKAGYKVVVIEKGNYFARSNLSLLEGPSMDQMYLSAGL  161

Query  1033  VASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVC  1212
             +A+ DM +++LAGS VGGGSTINWSASI+TP HV  EW   + LE+F SK Y+ A++ VC
Sbjct  162   MATDDMGVVVLAGSTVGGGSTINWSASIRTPQHVTDEWSNAYGLEIFDSKLYKEALDVVC  221

Query  1213  SRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSE  1392
              +MGVQSE+ +EGF N +LRKGC ELGY V TIPRN+S DHYCGWC  GCKDGKKKGT E
Sbjct  222   EKMGVQSEINEEGFNNAILRKGCEELGYNVNTIPRNSSSDHYCGWCCLGCKDGKKKGTCE  281

Query  1393  TWLADLVDSGNGVIFPECEAVKVVHNKKTGREQ--AAGVMFVYQNNGAKEFCFVKSRVTV  1566
             TWL DLV+SGNG+I P CEA+KV+H ++    +  A+GV F +     KE C V+S+VT+
Sbjct  282   TWLLDLVNSGNGLILPNCEAIKVLHKRRRRGNRRVASGVAFAF----GKEVCVVQSKVTI  337

Query  1567  IACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIM  1746
             +ACGAL TP LLK SGL+NPNIG++LHLHPV  AWGYFPD     AWPE  KKSYQGGIM
Sbjct  338   VACGALSTPPLLKRSGLKNPNIGKHLHLHPVTMAWGYFPDDQ-PLAWPEKHKKSYQGGIM  396

Query  1747  TAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARD  1926
             TAMS V +   +  YGA+IQTPSLHPGMF+++MPW SG D+K +M RFSRTA +FALARD
Sbjct  397   TAMSLVTS---DKLYGAVIQTPSLHPGMFASLMPWGSGVDMKRKMGRFSRTAHIFALARD  453

Query  1927  KTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASR  2106
             K SG+  SP SISY M+  D+ +L+ GLEK LRILAAAGAEEIGT H  G+ L  K AS 
Sbjct  454   KGSGKVNSPNSISYQMEAADEENLQKGLEKGLRILAAAGAEEIGTHHSKGRSLNVKKASY  513

Query  2107  DEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSS  2286
              E D+FV++ESSR L +LST I SAHQMGSCRMG+DPR+SVVN MGETWEVEGLF+AD+S
Sbjct  514   KEFDKFVKRESSRSLRDLSTQICSAHQMGSCRMGIDPRNSVVNEMGETWEVEGLFIADTS  573

Query  2287  VFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             VFP ALGVNPMVTVQAIAYCTAQSVL+ LK
Sbjct  574   VFPAALGVNPMVTVQAIAYCTAQSVLQLLK  603



>ref|NP_193673.2| Long-chain-alcohol oxidase FAO4A [Arabidopsis thaliana]
 sp|O65709.2|FAO4A_ARATH RecName: Full=Long-chain-alcohol oxidase FAO4A; AltName: Full=Long-chain 
fatty alcohol oxidase 4A [Arabidopsis thaliana]
 gb|AEE84174.1| Long-chain-alcohol oxidase FAO4A [Arabidopsis thaliana]
Length=726

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/755 (55%), Positives = 519/755 (69%), Gaps = 40/755 (5%)
 Frame = +1

Query  136   MATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIl  315
             M ++ +I DTF+ ++D      VDD  V  +F  SAS  GTP RVA ++SERL HPK  +
Sbjct  1     MESLVAICDTFISSIDDSGVGHVDD-CVAGYFSASASQTGTPDRVARLMSERLHHPKKWI  59

Query  316   lrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTFY  495
             LR  LWLLST IG+L+LCG  S + +FPY + F  +   +R EI+ +WS  Y  +L+  +
Sbjct  60    LRAGLWLLSTWIGSLVLCGWRSFTGEFPYFRRFCRLPEKRREEILLNWSSSYFSLLRMLF  119

Query  496   LGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQ  675
               +K++  L FF+QV+E   N++WKAI Y GP PD                     S+ +
Sbjct  120   RTIKLISALVFFTQVDEKGRNLAWKAIGYNGPSPDH--------------------SDHE  159

Query  676   KKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGN----  843
              +  E+     PE + GPL+ G+++L + PR  V  +L   GF VS    QK + N    
Sbjct  160   VELNEEKKKKKPEEIFGPLYNGIVDL-KSPREAVEKKLAGRGFAVS---NQKRNTNGSSI  215

Query  844   --PSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMY  1017
               P   I+CDAVVVGSGSGGGV AGVLA AG+KVLV+E G Y+ARS LSLLEG ++D+MY
Sbjct  216   SDPVMKIQCDAVVVGSGSGGGVAAGVLAKAGYKVLVIESGNYYARSKLSLLEGQAMDDMY  275

Query  1018  LGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHA  1197
             L GGL+A+ D ++++LAGS VGGGSTINWSASI+TP HV+KEW E  KLE+FGS  YR A
Sbjct  276   LSGGLLATSDTNVVILAGSTVGGGSTINWSASIKTPEHVMKEWAEKSKLEMFGSDLYREA  335

Query  1198  METVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKK  1377
             M+ VC RMGVQ    +EGF N VLRKGC +LG PV+ IPRNA  DHYCG+C  GCK G+K
Sbjct  336   MDVVCKRMGVQCGFVEEGFNNEVLRKGCEKLGLPVKNIPRNAPSDHYCGFCCLGCKKGQK  395

Query  1378  KGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTG-REQAAGVMFVYQNNGAKEFCFVKS  1554
             +GTSETWL DLV+S NG+I P C+A +V+++ + G +++A GV F +     +E   V+S
Sbjct  396   QGTSETWLVDLVESDNGLILPGCQATEVMYDCEQGKKKKATGVAFAF----GEEIYVVES  451

Query  1555  RVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQ  1734
             RVT++ACGAL TP LLK SGL+N NIGRNL LHPVV AWG+FP+      WPE +KKSY+
Sbjct  452   RVTIVACGALRTPHLLKRSGLKNSNIGRNLCLHPVVMAWGWFPE---EDKWPEKKKKSYE  508

Query  1735  GGIMTAMSKVVANFEESGYGAL-IQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILF  1911
             GGIMTAMS VV     S YG + IQTP+LHPGMFS I+PW S  D KTRM +FSRTA +F
Sbjct  509   GGIMTAMSSVVIEETHSSYGEMVIQTPALHPGMFSGIIPWTSSKDFKTRMLKFSRTAHIF  568

Query  1912  ALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKP  2091
             AL RDK +G   S   I YN+   D+ SLKNGLE+VL+ILAAAGAEEIGT H  G+ L  
Sbjct  569   ALLRDKGTGTIDSKTYIDYNLNDEDEESLKNGLERVLKILAAAGAEEIGTHHSEGRSLNV  628

Query  2092  KGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLF  2271
             + AS  EI+ FV +ESS+ L +LS  I SAHQMGSCRMG+ P  S V P GETWEVE LF
Sbjct  629   RTASSLEIERFVREESSKPLKDLSGQICSAHQMGSCRMGIRPEESAVRPTGETWEVERLF  688

Query  2272  LADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             +AD+SVFPTALGVNPMVTVQ+IAYC   +V+  LK
Sbjct  689   VADTSVFPTALGVNPMVTVQSIAYCIGLNVVDVLK  723



>ref|XP_010434428.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Camelina sativa]
Length=771

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/764 (53%), Positives = 523/764 (68%), Gaps = 36/764 (5%)
 Frame = +1

Query  103   YSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMI  282
             +     L+   M ++ +I DT +P++D      VDDDSV  +F  SAS  GTP RVA ++
Sbjct  36    FCANSSLTQREMESLVAICDTLIPSIDGSGVGHVDDDSVAEYFSASASQTGTPDRVAKLM  95

Query  283   SERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  462
             SERL HPK  +LR+ALW LST IG+ +LCG+ S + +FPY + F  +   +R +++ +WS
Sbjct  96    SERLDHPKKWILRVALWFLSTWIGSFILCGRRSFTGEFPYFRIFCRLPAKQREDVLLNWS  155

Query  463   CCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWIT  642
               Y  +L+ F+  +K++  L FF+QV+    N+SWKAI Y GP+ D++            
Sbjct  156   ASYFSLLRMFFRCIKLISALVFFTQVDGKGRNLSWKAIGYNGPNLDNS------------  203

Query  643   REQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVS-PC  819
              +    L+E++KK         PE + GPL+ G+++L + PR  V  +L   GF VS P 
Sbjct  204   -DLQEELNEKKKK---------PEEIFGPLYNGIVDL-KSPREVVTKKLTDRGFTVSTPK  252

Query  820   IQQKGSG--NPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslslle  993
                KGS   N    I CDAVVVGSGSGGGV+AGVLANAGHKVLV+E G Y+ARS+LSLLE
Sbjct  253   KNPKGSSLSNRVMTIRCDAVVVGSGSGGGVVAGVLANAGHKVLVVESGNYYARSTLSLLE  312

Query  994   gsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELF  1173
             G +++EMYL GGL+A+ DM++++LAGS VGGGSTINWSASI+TP HV+ EW E  KLE+F
Sbjct  313   GQAMEEMYLSGGLLATSDMNVVVLAGSTVGGGSTINWSASIKTPEHVMNEWAEKSKLEMF  372

Query  1174  GSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCS  1353
             GS  YR AM+ VC RMGV             LRKGC ELG PV+ IPRNA  DHYCG+C 
Sbjct  373   GSDSYREAMDVVCKRMGVXXXXXXXXXXXXXLRKGCEELGLPVKNIPRNAPSDHYCGFCC  432

Query  1354  FGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTG--REQAAGVMFVYQNNG  1527
              GCK G+K+GTSETWL DLV+SGNG+I P CE ++V+++ + G  +++A+GV F +    
Sbjct  433   LGCKKGQKQGTSETWLVDLVESGNGLILPGCEVMEVLYDCEQGKKKKKASGVSFAF----  488

Query  1528  AKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAW  1707
              +E   V+SR TV+ACGAL TP LLK SGL N NIGRNL LHPVV AWG+FP+      W
Sbjct  489   GEEIYVVESRATVVACGALRTPHLLKRSGLTNGNIGRNLCLHPVVMAWGWFPE---EDRW  545

Query  1708  PEPEKKSYQGGIMTAMSKVVANFEESGYG-ALIQTPSLHPGMFSAIMPWLSGTDIKTRMQ  1884
             PE +K SY+GGIMT MS V+ +  +S YG  +IQTP+LHPGMFS + PW S  D KTRM 
Sbjct  546   PEKKKMSYEGGIMTVMSSVINSETQSSYGETVIQTPALHPGMFSGVTPWTSSNDFKTRML  605

Query  1885  RFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTC  2064
             +FSRTA +FAL RDK +G   S   I YN+   D+ SL+ GLE+VL+ILAA+GAEEIGT 
Sbjct  606   KFSRTAHIFALLRDKGTGTVNSTSCIDYNLNDEDEESLQKGLERVLKILAASGAEEIGTH  665

Query  2065  HRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMG  2244
             +  GK L  + AS  EI+ FV +ESS+ L +LS  + SAHQMGSCRMG+ P  S V P G
Sbjct  666   NLEGKSLNLRTASAVEIERFVREESSKPLKDLSGQLCSAHQMGSCRMGIRPEESAVRPTG  725

Query  2245  ETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             ETWEVEGLF+AD+SVFPTALGVNPMVTVQ+IAYC   +V+  LK
Sbjct  726   ETWEVEGLFVADTSVFPTALGVNPMVTVQSIAYCIGLNVVDVLK  769



>gb|EPS64229.1| hypothetical protein M569_10552, partial [Genlisea aurea]
Length=725

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/767 (53%), Positives = 523/767 (68%), Gaps = 63/767 (8%)
 Frame = +1

Query  130   AVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKV  309
              V+ T++++ D FLP++D      +D  +   F++TSAS++ TP+ V  M++ + +HPK+
Sbjct  7     GVLETLSAVCDAFLPSIDDGGGIDIDPSAAD-FYRTSASMSETPRGVMEMLA-KARHPKI  64

Query  310   IllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKT  489
              L   ALW LSTRIG+++LCG+  +      ++ F E+   +R EI+  WS  ++  L+ 
Sbjct  65    SLAVPALWFLSTRIGSVVLCGRRCVGGG-KLVKRFSELPVEEREEILAYWSRHFLPHLRI  123

Query  490   FYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSE  669
             FY  +K   LL FF+ V+EN EN+SWKAI YCGPDP  N  P                  
Sbjct  124   FYHSLKFFTLLRFFTHVDENGENVSWKAIGYCGPDPTRNGGP------------------  165

Query  670   EQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPS  849
                              +GPLH+G+INL++E        L   GFPVS    + G G  S
Sbjct  166   ---------------FEVGPLHRGIINLDREREPPPSRALSLYGFPVS----KGGEGGVS  206

Query  850   FVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGG  1029
             F IECDAVVVGSGSGGGV+AGVLA +GHKVLV+EKG Y ARS L+LLEG S++ MYL  G
Sbjct  207   FTIECDAVVVGSGSGGGVVAGVLAKSGHKVLVIEKGSYSARSDLTLLEGQSMERMYLEKG  266

Query  1030  LVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETV  1209
             L+AS DM +L +AGS VGGGSTINWSASI+TPPHV +EW +   L LF S++Y  A++ V
Sbjct  267   LLASDDMSVLFVAGSTVGGGSTINWSASIRTPPHVRREWSDECGLRLFQSEDYDDALDVV  326

Query  1210  CSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTS  1389
               RM VQ EVEDEG  NMVLR+GC  LGY VE IPRNA  DHYCGWCSFGC+DG+K GTS
Sbjct  327   SERMSVQKEVEDEGLANMVLRRGCETLGYAVENIPRNAPSDHYCGWCSFGCRDGRKHGTS  386

Query  1390  ETWLADLVDSGNGVIFPECEAVKVVHN-KKT-----GR-EQAAGVMFVYQN-NGAKEFCF  1545
             ETWL DLV+SGNG I P CEA+KV+   KKT     GR ++A G+ F ++N NG +E   
Sbjct  387   ETWLVDLVESGNGAILPNCEAIKVITQMKKTTTINDGRSKKAVGITFRFRNPNGDEEIAA  446

Query  1546  VKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKK  1725
             V++R  V +CGA+CTP LLK SGL+NPNIGRNLH+HPVV AWGYF   P +  WPE +K+
Sbjct  447   VRARAVVSSCGAICTPPLLKRSGLKNPNIGRNLHIHPVVMAWGYF---PATNPWPEADKR  503

Query  1726  SYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAI  1905
             SY+GGIMTAM+K            +IQTPSLHPGMFSA+ PW+SG DIK RM +FSRTA 
Sbjct  504   SYEGGIMTAMAKSRTG------DTIIQTPSLHPGMFSALTPWISGRDIKNRMLKFSRTAH  557

Query  1906  LFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKIL  2085
             +F+LARD  SG   S  +ISY +   D+ +L +GLE+VLR+LAAAGAEEIGT HR G+ L
Sbjct  558   IFSLARDAGSGTVTSESNISYRLDDADRENLGSGLEEVLRVLAAAGAEEIGTHHRDGRSL  617

Query  2086  KPKGASRDE----IDEFVEKESSRDL--GNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGE  2247
             K K   RD+    ++ F+++ES + L   +LS+ I SAHQMGSCRMG DP  S V+P GE
Sbjct  618   KVKKKDRDDQAALLERFIKEESRKPLEKESLSSPICSAHQMGSCRMGTDPLRSAVDPNGE  677

Query  2248  TWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHNH  2388
             TWEV GLF+AD+SVFPTALGVNPM+TVQAI+YC ++SVL  LK + +
Sbjct  678   TWEVGGLFVADTSVFPTALGVNPMLTVQAISYCISKSVLNHLKCNKY  724



>ref|XP_006283177.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
 gb|EOA16075.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
Length=761

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/762 (54%), Positives = 521/762 (68%), Gaps = 35/762 (5%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
             L+   M T+ +  DT +P++D        DDSV  +F  SAS  GTP RVA ++SERL H
Sbjct  28    LTQREMETLVAFCDTLIPSIDGSGVGGHVDDSVAEYFAASASQTGTPDRVARLMSERLDH  87

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  480
             PK  +LR+ALWLLST IG+L+LCG+ S + +FPY + F  +   +R  I+ +WS  Y  +
Sbjct  88    PKKWILRVALWLLSTWIGSLVLCGRRSFTGEFPYFRRFCRLPTKQREAILLNWSESYFSL  147

Query  481   LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMT  660
             L+ F+  +K++    FF+QV+E   N++WKAI Y GP  D                    
Sbjct  148   LRMFFRCIKLITAFVFFTQVDEKGRNLAWKAIGYNGPSLDD-------------------  188

Query  661   LSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQ-KGS  837
              S+   + E +     PE + GPL+ G+++LN  PR  V  +L   GF VS    + KGS
Sbjct  189   -SDHDLEEELNEKKKKPEEIFGPLYNGIVDLNC-PREAVTKKLTGRGFTVSSQKNKSKGS  246

Query  838   G--NPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDE  1011
                NP   I CDAVVVGSGSGGGV+AGVLA AG+KVLV+E G Y+ARS+LSLLEG ++++
Sbjct  247   SLSNPVMTIRCDAVVVGSGSGGGVVAGVLAKAGYKVLVVESGNYYARSNLSLLEGQAMED  306

Query  1012  MYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYR  1191
             MYL GGL+A+ D ++++LAGS VGGGSTINWSASI+TP HV+KEW E  KLE+FGS  YR
Sbjct  307   MYLSGGLLATSDTNVVILAGSTVGGGSTINWSASIKTPEHVMKEWTEKSKLEMFGSDLYR  366

Query  1192  HAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDG  1371
              AM+ VC RMGVQ    +EGF N +LRKGC ELG PV+ IPRNA  DHYCG C  GCK G
Sbjct  367   EAMDVVCERMGVQCGFVEEGFNNEILRKGCEELGLPVKNIPRNAPSDHYCGHCCLGCKKG  426

Query  1372  KKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTG---REQAAGVMFVYQNNGAKEFC  1542
             +K+GTSETWL DLV SGNG+I P C+A++V++  + G   +++A GV F +     +E  
Sbjct  427   QKQGTSETWLVDLVQSGNGLILPGCKAMEVLYECEQGKKNKKKATGVAFAF----GEEIY  482

Query  1543  FVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEK  1722
              V+SR TV+ACGAL TP LLK SGL+N NIGRNL LHPVV AWG+FP+    + WPE +K
Sbjct  483   VVESRATVVACGALRTPHLLKRSGLKNGNIGRNLCLHPVVMAWGWFPEG---EKWPEKKK  539

Query  1723  KSYQGGIMTAMSKVVANFEESGYG-ALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRT  1899
              SY+GGIMTAMS VV    +S YG  +IQTP+LHPGMFS + PW S  D KTRM +FSRT
Sbjct  540   MSYEGGIMTAMSSVVNAETQSSYGETVIQTPALHPGMFSGVTPWASSKDFKTRMLKFSRT  599

Query  1900  AILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGK  2079
             A +FAL RDK +G   S   I YN+   D+ SLK GLE+VL+I+AAAGAEEIGT +  GK
Sbjct  600   AHIFALLRDKGTGTINSKSYIDYNLNDEDEESLKKGLEEVLKIMAAAGAEEIGTHNSEGK  659

Query  2080  ILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEV  2259
              L  + AS  E + FV +ESS+ L NLS  I SAHQMGSCRMG+ P  S V P GETWEV
Sbjct  660   SLNVRRASAVEFERFVREESSKPLKNLSGQICSAHQMGSCRMGIRPEESAVRPTGETWEV  719

Query  2260  EGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHN  2385
             EGLF+AD+SVFPTALGVNPMVTVQ+IAYC   +V+  LK +N
Sbjct  720   EGLFVADTSVFPTALGVNPMVTVQSIAYCIGLNVVDVLKRNN  761



>ref|XP_010274420.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Nelumbo 
nucifera]
Length=728

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/773 (53%), Positives = 515/773 (67%), Gaps = 91/773 (12%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVD-DDSVKLFFQTSASIAGTPQRVAWMISERLQ  297
             LS   M ++ ++ DT LP+++   H+A D DDS+  F+  SAS   TPQ           
Sbjct  21    LSSREMHSLCTLCDTLLPSIN---HSATDEDDSLSNFYWASASTTATPQ-----------  66

Query  298   HPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIK  477
                                                   F ++S  KR EI+ SWS     
Sbjct  67    ------------------------------------LKFSQVSQKKREEILLSWSTSSFS  90

Query  478   ILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHM  657
             +L+  +   K+++L  FF+QV+E NEN SWKA+ YCGPDPD                +H 
Sbjct  91    LLRMLFKIFKLLLLFVFFTQVDEKNENPSWKALGYCGPDPDF---------------KHQ  135

Query  658   TLSEEQKKGEEDVIPMNPEL---LLGPLHKGVINLNQEPRRQVFDRLQKLGFPVS-----  813
             T  +  K  ++D+     E    L GPL++ +IN  + PR+ + + L++ GFPV+     
Sbjct  136   T--QASKTDQDDLTSEEEEKKEELFGPLYRRLIN-PRHPRQSIAEYLEQSGFPVTINHFH  192

Query  814   ----PCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARssl  981
                 P I      +PS  I CDAVVVGSGSGG V A VLA AG+KVLVLEKGKYFAR++L
Sbjct  193   GNKTPSIS-----SPSLTIRCDAVVVGSGSGGSVAAAVLAKAGYKVLVLEKGKYFARNNL  247

Query  982   sllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHK  1161
             SLLEG SL++MYL GGL A+ D+ + L AG+ VGGGST+NWSASI+TP HV++EW  +HK
Sbjct  248   SLLEGPSLEQMYLDGGLTATDDLGVFLFAGATVGGGSTVNWSASIRTPGHVMEEWCYSHK  307

Query  1162  LELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYC  1341
             LELF  K Y  AM+ VC+RMGVQ +  +E F N VLR+GCLELGYPV  + +NA  DHYC
Sbjct  308   LELFDRKPYNRAMDVVCNRMGVQVDTREESFNNAVLRRGCLELGYPVSRVSQNAPMDHYC  367

Query  1342  GWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKK--TGREQAAGVMFVY  1515
             GWC FGCKDGKK+GT+ETWL DLVDSGNGVI P CEA+KV+H +K    R  A GV F  
Sbjct  368   GWCGFGCKDGKKQGTAETWLVDLVDSGNGVILPGCEALKVLHERKRRNDRSTAIGVAFRL  427

Query  1516  QN-NGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAP  1692
              N +G  + C V+S+VTV+ACGAL TP LLK SGL+N NIG++L +HPVV AWGYF D P
Sbjct  428   DNGSGGHDICVVESKVTVVACGALRTPVLLKRSGLKNTNIGKHLRVHPVVLAWGYFADEP  487

Query  1693  GSKAWPE--PEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTD  1866
              S    E   +K+SY+GGI+T+MS VVA FE SGYGA++QTPSLHPG+FS +MPW+SG D
Sbjct  488   ASSNGDEWVKDKRSYEGGILTSMSTVVAGFEGSGYGAILQTPSLHPGLFSVLMPWVSGAD  547

Query  1867  IKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGA  2046
              K RM RFSRTA +FALARDK SG+  S  S+SY +   D+ +L  G+EK+LRILAAAGA
Sbjct  548   FKERMSRFSRTAHVFALARDKGSGQVNSESSLSYRLDAIDEENLSKGVEKMLRILAAAGA  607

Query  2047  EEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSS  2226
             EEIGT H  G+ L  K AS+DE ++FV++ES R LG LST + SAHQMGSCRMGVD   S
Sbjct  608   EEIGTHHCEGRKLNVKRASKDEFEKFVKEESGRKLGGLSTPVASAHQMGSCRMGVDRDKS  667

Query  2227  VVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHN  2385
             VV P GETWEVEGLF+AD+SVFPTALGVNPMVTVQAI+YCTA SV++FL+ ++
Sbjct  668   VVCPRGETWEVEGLFVADTSVFPTALGVNPMVTVQAISYCTAHSVIEFLERND  720



>ref|XP_010538591.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X2 [Tarenaya 
hassleriana]
Length=765

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/751 (54%), Positives = 524/751 (70%), Gaps = 36/751 (5%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
             L+   M ++ +I DT +P+++  +   VDD  V  FF  SAS  GTP RVA  IS  L H
Sbjct  33    LTAREMESLWAICDTLIPSINGSEVCHVDDH-VAGFFAASASQMGTPDRVARKISGTLDH  91

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  480
             PK  LLR ALWLLST IG+L+LCG+ S S +FPY + F  +   +R EI+ SW+  +  +
Sbjct  92    PKKWLLRAALWLLSTHIGSLVLCGRKSFSGEFPYCRRFCRLPQKQREEIMLSWASSFFSL  151

Query  481   LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMT  660
             L+ F+  MK++  L FF+QV+E  +N++W+AI Y GP  DS  + + +  + I RE    
Sbjct  152   LRMFFKAMKLITALVFFTQVDEKGKNLAWEAIRYTGPISDS--EDSDQEDQTIHREH---  206

Query  661   LSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSG  840
               +E+ K E       PE + GP++ G+++L   PR  V + L + GF VS    +   G
Sbjct  207   --QEKTKKE-------PEQIFGPIYNGIVDL-MNPREVVIETLNRHGFQVSTRTGKNSHG  256

Query  841   ----------NPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsll  990
                       +P   I CDAVVVGSGSGGGV+AGVLA AG+KVLVLEKG Y+AR++LSLL
Sbjct  257   RDRRPGSSISDPVMKIRCDAVVVGSGSGGGVVAGVLAKAGYKVLVLEKGNYYARNNLSLL  316

Query  991   egsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLEL  1170
             EG ++++MYL  GLVA+ DM+ ++LAGS+VGGGST+NWSASI+TP +V+KEW E   L+L
Sbjct  317   EGQAMEQMYLSSGLVATADMNTVILAGSSVGGGSTVNWSASIRTPENVIKEWSEKCGLKL  376

Query  1171  FGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWC  1350
             F S  YR AM+ VC RMGVQS   +EGF N +LRKGC  LG+PV++IPRN+  DHYCG+C
Sbjct  377   FESGFYREAMDVVCERMGVQSGFVEEGFNNEILRKGCEALGFPVKSIPRNSLADHYCGFC  436

Query  1351  SFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQAAGVMFVYQN--N  1524
              FGCK G+KKGT+ETWL DLVDSGNGVI P CEA++V+  ++ G++ AAGV F+++N   
Sbjct  437   CFGCKKGRKKGTAETWLVDLVDSGNGVILPGCEALQVLQRRERGKKTAAGVAFLFENIDE  496

Query  1525  GAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKA  1704
               KE   V+S+VT++ACGAL TP LL+NSGL+NPNIGRNL LHPV  AWG+FP+    + 
Sbjct  497   ARKEIYVVESKVTIVACGALRTPILLRNSGLKNPNIGRNLCLHPVAMAWGWFPE----EK  552

Query  1705  WPEPEKKSYQGGIMTAMSKVVANFE---ESGYG-ALIQTPSLHPGMFSAIMPWLSGTDIK  1872
             WP   KKSY+GGIMT MS V A+ E    + YG  +IQTP+LHPGMFS I+PW SG D K
Sbjct  553   WPGKGKKSYEGGIMTTMSTVSADAEVESPNSYGTTIIQTPALHPGMFSGIIPWTSGKDYK  612

Query  1873  TRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEE  2052
              RM +FSRTA +FAL RDK SGE  S  SI+Y +  TD+ +LK G+E++LRIL AAGAEE
Sbjct  613   NRMLKFSRTAHVFALTRDKGSGEIRSLNSITYTLNGTDEENLKKGIERILRILTAAGAEE  672

Query  2053  IGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVV  2232
             IGT +  GK L  K AS +E + FV +ESS+ L  LS  I SAHQMGSCRMGV    S V
Sbjct  673   IGTHNLEGKSLNVKAASSEEYERFVREESSKPLKGLSGQICSAHQMGSCRMGVAAEKSAV  732

Query  2233  NPMGETWEVEGLFLADSSVFPTALGVNPMVT  2325
              P GETWEVEGLF+AD+SVFPTALGVNPMVT
Sbjct  733   RPTGETWEVEGLFVADTSVFPTALGVNPMVT  763



>ref|XP_010942998.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Elaeis guineensis]
Length=787

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/763 (52%), Positives = 527/763 (69%), Gaps = 46/763 (6%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
             L+   M ++T+ISDTFLP++D+P      ++S++ F+ TSAS+ GTP+ V   +S RL+H
Sbjct  51    LTAREMDSLTAISDTFLPSIDLP---GARNESIRAFYLTSASMIGTPEIVGGYMSGRLRH  107

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  480
               + LLRL+LWLLST  GT + CG   +S +FP+   F +I P +R +I+ SWS   I +
Sbjct  108   ASLWLLRLSLWLLSTWYGTFIFCGTRCMSCRFPFFHKFSDIDPKRREQILSSWSSSPIYL  167

Query  481   LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMT  660
              +  +  +K +++L +F+QVNE NEN +W A+DYCGP+P+                    
Sbjct  168   YRQLFRALKFLIMLFYFTQVNEKNENPAWTALDYCGPEPE--------------------  207

Query  661   LSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGF-----PVSPCIQ  825
             L+++ K     V   + +   GPLH  ++++ + P   +   L + G      P S   +
Sbjct  208   LADQVKA---SVDQSSEDDRFGPLHCAMVHM-ESPGDDLAAALSRAGLYLATRPFSGDRR  263

Query  826   QKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegssl  1005
             +K    P   I CDAVVVGSGSGGGV+AGVLA AG+KV+VLEKG Y ARS+LSL EG ++
Sbjct  264   KK----PLRTIHCDAVVVGSGSGGGVVAGVLAQAGYKVVVLEKGGYHARSNLSLHEGPAM  319

Query  1006  DEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKE  1185
             D MY GGGL+A+ D  +++L+G+ VGGGS INW+A+++TP HV  EW   H LELFGS  
Sbjct  320   DLMYEGGGLLATTDTGVVVLSGATVGGGSAINWAAALRTPDHVAAEWRRDHGLELFGSDA  379

Query  1186  YRHAMETVCSRMGVQSEVE--DEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFG  1359
             Y  A++ VC RMGVQS+V+  +E   N  LR+GCLELGYPV  I RNA  DH+CGWC FG
Sbjct  380   YAEALDAVCERMGVQSDVDKMEENLNNAALRRGCLELGYPVANISRNAPPDHHCGWCCFG  439

Query  1360  CKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQ--AAGVMFVYQNNGAK  1533
             CKDG+KK TSETWL D+ +S NGVI P C AV+V+H  + GR +  A GV+F  ++    
Sbjct  440   CKDGRKKATSETWLVDMAESRNGVILPGCRAVRVLHRNRGGRRRKVATGVLFESESG---  496

Query  1534  EFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKA--W  1707
             E C V+S+VTV+ACGAL TP LLK SGLRNPNIG++LHLHPVV  WGYFP++ GS+   +
Sbjct  497   EACIVESKVTVVACGALNTPVLLKRSGLRNPNIGKHLHLHPVVMVWGYFPES-GSRRPDY  555

Query  1708  PEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQR  1887
              E EK+SY+GGIMTAMS V AN+  +GYG +IQTP+LHPGMFS + PW SG D K RM R
Sbjct  556   REEEKRSYEGGIMTAMSTVTANWGTTGYGTVIQTPALHPGMFSVVTPWTSGADFKDRMTR  615

Query  1888  FSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCH  2067
             F+RTA +FALARD+ SG      +ISY M++ D+ SLK G+EK+L I+A AGAEE+GT H
Sbjct  616   FARTAHVFALARDRGSGTVDGEGNISYRMERGDEESLKKGVEKMLWIMAGAGAEEVGTQH  675

Query  2068  RAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGE  2247
               G+  + K AS  E + FV K S R +G L+T + SAHQMGSCRMGV+  +S V+  GE
Sbjct  676   CKGERFEVKRASAREWERFVIKASRRVVGWLTTPVCSAHQMGSCRMGVEDTTSAVDERGE  735

Query  2248  TWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             TWEVEGLF+AD+SVFPTALGVNPMVTVQAIAYCTA S+++ L+
Sbjct  736   TWEVEGLFVADASVFPTALGVNPMVTVQAIAYCTAHSIVQVLR  778



>ref|XP_009132755.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Brassica rapa]
Length=771

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/780 (51%), Positives = 524/780 (67%), Gaps = 36/780 (5%)
 Frame = +1

Query  55    DSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQ  234
             D  F   + E     VY+    ++   M ++ +I DT +P+ D  +   +DD  V  ++ 
Sbjct  19    DVEFGGLRQEDETKTVYAN--SMTAREMESLVAICDTLIPSRDASEVGHLDD-GVAGYYS  75

Query  235   TSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSF  414
              SAS  GTP RVA ++SERL HPK  +LR+ LW LST IG+L++CG+ S + ++PY + F
Sbjct  76    ASASHTGTPDRVARLMSERLHHPKKWILRVGLWSLSTWIGSLVMCGRRSFTGEYPYFRRF  135

Query  415   PEISPHKRAEIVRSWSCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPD  594
               +   +R EI+ +W+  Y  +L+ F+  +K++    FF+QV+E   N++WKAI Y GP 
Sbjct  136   CWLPETQREEILLNWASSYFILLRMFFRSIKLITAFVFFTQVDEKGNNVAWKAIGYNGPS  195

Query  595   PDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQ  774
              D +      ++K   + +H                   + + GPL+ G+I+L + PR  
Sbjct  196   SDHSDHEEEINEKTTKKNKH-------------------DEIFGPLYNGIIDL-KNPREA  235

Query  775   VFDRLQKLGFPVSPCIQQKGSG---NPSFVIECDavvvgsgsgggviagvLANAGHKVLV  945
             V  +L   GF VS   + K      +P   I+CDAVVVGSGSGGGV+AG+LA AG+KVLV
Sbjct  236   VTKKLTGHGFTVSTHKRTKNGSSISDPVMTIQCDAVVVGSGSGGGVVAGMLAKAGYKVLV  295

Query  946   LEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTP  1125
             +EKG Y+ARS+LSL EG +LDEMYL GGL+A+ DMD+++LAGS VGGGSTINWSASI+TP
Sbjct  296   VEKGNYYARSNLSLHEGQALDEMYLSGGLLATTDMDVVILAGSTVGGGSTINWSASIKTP  355

Query  1126  PHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVE  1305
              HV+KEW E  +LE+FGS  YR AM+ VC RMGVQ E  +EGF N +LRKGC  LG PV+
Sbjct  356   EHVMKEWSEKSELEMFGSHLYREAMDVVCERMGVQCEFLEEGFNNEILRKGCENLGLPVK  415

Query  1306  TIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGR  1485
              IPRNA  DHYCG+C  GCK G+K+GTSETWL DLV+SGNG+I P CEA++V++  K G+
Sbjct  416   NIPRNAPSDHYCGFCCLGCKKGQKQGTSETWLVDLVESGNGLILPGCEAMEVLYECKGGK  475

Query  1486  --EQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPV  1659
               + + G+ F +     K+   V+SR T++ACGAL TP LLK+SGL+N +IGRNL LHPV
Sbjct  476   KTKTSTGIAFAF----GKDIYMVESRATIVACGALRTPHLLKHSGLKNGSIGRNLCLHPV  531

Query  1660  VFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYG-ALIQTPSLHPGMFS  1836
             V AWG+FP+          +K+SYQGGIMTAMS VV    ++ YG  +IQTPSLHPG+FS
Sbjct  532   VMAWGWFPEEEEWPE---KKKRSYQGGIMTAMSSVVNEETKNSYGETVIQTPSLHPGLFS  588

Query  1837  AIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEK  2016
              ++PW S  + K+RM +FSRTA +F L RDK +G   S  SI YN+   D+ SLK GLE+
Sbjct  589   GVIPWTSSKEFKSRMLKFSRTAHVFTLLRDKGTGTINSKSSIEYNLNNEDEESLKKGLER  648

Query  2017  VLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGS  2196
             VL IL AAGAEEIGT +  GK L  K  S  EI+ FV +ESS+ L +LS  I SAHQMGS
Sbjct  649   VLNILTAAGAEEIGTHNSEGKSLNVKTTSAVEIERFVREESSKSLKDLSGQICSAHQMGS  708

Query  2197  CRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             CRMG  P  S V P GETWEVEGLF+AD+SVFPTALGVNPMVTVQ+IAYC   +V+  LK
Sbjct  709   CRMGTSPEVSAVKPTGETWEVEGLFVADTSVFPTALGVNPMVTVQSIAYCIGLNVVDALK  768



>gb|KFK28594.1| hypothetical protein AALP_AA7G017800 [Arabis alpina]
Length=752

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/758 (54%), Positives = 522/758 (69%), Gaps = 34/758 (4%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
             L+   M ++ +I DT +P++D  +   V+DD V  ++  SAS  GTP RVA ++SERL H
Sbjct  20    LTAREMESLVAICDTLIPSIDGSKLGHVEDDGVARYYSASASQTGTPDRVARLMSERLDH  79

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  480
             PK  +LR+ LW LST IG+L+LCG+ S S +FPY + F ++   +R EI+ +WS  YI +
Sbjct  80    PKKWILRVGLWFLSTWIGSLILCGRKSFSGEFPYFRRFCKLPEKQREEILLNWSSSYIVL  139

Query  481   LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMT  660
             ++  +  +K++  L FF+Q++E  +N++WKAI Y GP  D                    
Sbjct  140   IRMLFRSLKLITALVFFTQLDEQGQNLAWKAIGYNGPTSDD-------------------  180

Query  661   LSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVS-PCIQQKGS  837
              S+ +++  E      PE + GPL+ G+I+L   PR  V  +L   GF VS P   + GS
Sbjct  181   -SDHEEELNEKKKKKKPEEIFGPLYNGIIDLTN-PRDAVAKKLTGRGFTVSTPKSNKNGS  238

Query  838   --GNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDE  1011
                +P   I CDAVVVGSGSGGGV+AGVLA AG+KVLV+EKG Y+ARS+LSLLEG +LDE
Sbjct  239   FISDPVMTIRCDAVVVGSGSGGGVVAGVLAKAGYKVLVVEKGNYYARSNLSLLEGQALDE  298

Query  1012  MYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYR  1191
             MYL  GL+A+ DM++++LAGS VGGGSTINWSASI+TP HV+KEW +  KLE+FGS  YR
Sbjct  299   MYLSAGLLATSDMNVVILAGSTVGGGSTINWSASIKTPEHVMKEWADKSKLEMFGSDLYR  358

Query  1192  HAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDG  1371
              AM+ VC RMGVQ    +EGF N +LRKGC ELG  V+ IPRN+  DHYCG+C  GCK G
Sbjct  359   EAMDVVCERMGVQCGFVEEGFNNEILRKGCEELGLQVKNIPRNSPSDHYCGFCCLGCKKG  418

Query  1372  KKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQ--AAGVMFVYQNNGAKEFCF  1545
             +K+GTSETWL DLV+SGNG+I P CEA++V++ ++ G+++  A GV F +     +E   
Sbjct  419   QKQGTSETWLVDLVESGNGLILPGCEAMEVLYEREPGKKKKIATGVAFAF----GEEVYV  474

Query  1546  VKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKK  1725
             V+S+  ++ACGAL TP LLK SGL+N NIGRNL LHPVV AWG+FP+          +KK
Sbjct  475   VESKAAIVACGALRTPDLLKRSGLKNGNIGRNLCLHPVVMAWGWFPEEEKWPE---KKKK  531

Query  1726  SYQGGIMTAMSKVVANFEESGYG-ALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTA  1902
             SY+GGIMTAMS VV     S YG  +IQTPSLHPGMFS I+PW S  D KTRM +FSRTA
Sbjct  532   SYEGGIMTAMSSVVNAETRSSYGETVIQTPSLHPGMFSGIIPWTSSKDFKTRMLKFSRTA  591

Query  1903  ILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKI  2082
              +FAL RD+ +G   S   I YN+Q  D+ SLK GLE+VL IL AAGAEEIGT +  GK 
Sbjct  592   HVFALLRDRGTGTISSKSCIDYNLQDEDEESLKKGLERVLEILIAAGAEEIGTHNSEGKS  651

Query  2083  LKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVE  2262
             L    A+  +I  FV +ESS+ L +LS  I SAHQMGSCRMG+ P  S V P GETWEVE
Sbjct  652   LNITTANALQIARFVREESSKGLKDLSGQICSAHQMGSCRMGIRPEESAVRPTGETWEVE  711

Query  2263  GLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             GLF+AD+SVFPTALGVNPMVTVQ+IAYC   +VL+ LK
Sbjct  712   GLFVADTSVFPTALGVNPMVTVQSIAYCIGLNVLEVLK  749



>ref|XP_008776965.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Phoenix dactylifera]
Length=766

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/771 (51%), Positives = 517/771 (67%), Gaps = 47/771 (6%)
 Frame = +1

Query  109   GGCPLSPAV-----MATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVA  273
             GG P  P +     M ++T+  D FLP+VDV   +   D+ +  F+ TSAS+AGTP+R+ 
Sbjct  33    GGRPTHPNLLSKREMDSLTAACDAFLPSVDV---SDTGDEGLIAFYGTSASMAGTPERIG  89

Query  274   WMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVR  453
              ++S  +QHP + LLRLALWLLST  GT +LCG+ASLS+QFPYLQ FP++   K+ EI+ 
Sbjct  90    GLLSGGMQHPAIGLLRLALWLLSTWYGTFILCGRASLSNQFPYLQKFPQVRREKQEEILL  149

Query  454   SWSCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKK  633
             SWS   +  LK  Y  +K + +  +FSQ+N+   N SW A+ YCGPDP+     A +S+ 
Sbjct  150   SWSRSSLCPLKMLYKCLKYLTMKEYFSQINDKETNPSWDALGYCGPDPEL----ADQSQH  205

Query  634   WITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVS  813
             + T      L E+    E D  P       GPL   ++ ++  PR  +  +LQ  GFP  
Sbjct  206   FRTP----PLEEDSVSQEADSCP-------GPLDSALLYMDS-PRDVITRKLQIAGFPTP  253

Query  814   PCIQQKGSGNPS--FVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsl  987
                   G+ +PS    + CD VVVGSGSGG V+AGVLA AGH+V+V+EKG Y+ RS LSL
Sbjct  254   ----TSGTNSPSSPLTLHCDVVVVGSGSGGSVVAGVLAKAGHRVIVVEKGHYYHRSELSL  309

Query  988   legsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLE  1167
             LEG ++ EMY GGG++++ D+ ++LLAGS VGGGST+NWSA I+TP HV  EW     L 
Sbjct  310   LEGPTIAEMYEGGGIISTDDIGVILLAGSTVGGGSTVNWSACIRTPDHVRNEWCNKLGLR  369

Query  1168  LFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGW  1347
             LFGS+ Y HA++ VC RMGVQS+VE+EGF N +LRKGC+ELGYPV  +PRNA  DH CGW
Sbjct  370   LFGSEAYDHALDVVCGRMGVQSDVEEEGFNNAILRKGCVELGYPVSNVPRNAPPDHCCGW  429

Query  1348  CSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKK---TGREQAAGVMFVYQ  1518
             C  GCK  +KK T ETWL DL  SGNG+I P C+A+KV+H KK     R  A GV+  + 
Sbjct  430   CHLGCKSARKKSTQETWLVDLAGSGNGLILPRCKALKVLHRKKKKGVDRSTANGVIVRF-  488

Query  1519  NNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGS  1698
               G++E   ++S+VTV+ACGAL TP LLK SGLRN N+G+NLHLHP V AWGYFP A   
Sbjct  489   --GSREDFIIESKVTVVACGALNTPGLLKRSGLRNANVGKNLHLHPAVLAWGYFPPA---  543

Query  1699  KAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTR  1878
               WPE  KKSY+GGI+TAMS  +A+     Y  L++TP+LHPGMF+   PW+S  D + R
Sbjct  544   -RWPEEPKKSYEGGILTAMSTALAS-----YDILLETPALHPGMFAVATPWISAADFRER  597

Query  1879  MQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIG  2058
             M RFSRTA +FAL RDK SG    P S++Y M   D+  LK G+E ++RILAAAGAEE+G
Sbjct  598   MTRFSRTAHVFALVRDKGSGTTDYPHSLTYGMDAEDEEKLKKGVEAMVRILAAAGAEEVG  657

Query  2059  TCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNP  2238
             T H  G+  + +      ++  V++   R L +  T + +AHQMGSCRMG D R+  V+P
Sbjct  658   TLHCKGE--RVRVGEEGGVEWLVKEVRRRGLRDGGTPVSTAHQMGSCRMGTDARAGAVSP  715

Query  2239  MGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHNHM  2391
              GE WEVEGLF+AD+SVFPTALGVNPMVT QAIAYCTAQS+L+FL+    +
Sbjct  716   TGEVWEVEGLFVADTSVFPTALGVNPMVTAQAIAYCTAQSILEFLEQERKL  766



>ref|XP_009384756.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Musa acuminata 
subsp. malaccensis]
Length=787

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/755 (53%), Positives = 515/755 (68%), Gaps = 42/755 (6%)
 Frame = +1

Query  142   TVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllr  321
             ++ ++ D FLP++ VP HA     S++ ++  SAS+ GTP+ V   +SER+QHP++  LR
Sbjct  54    SLAAVCDAFLPSIHVP-HAP--HQSLRTYYANSASMIGTPEVVGGYLSERIQHPRLWQLR  110

Query  322   lalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTFYLG  501
             LALWLLST  GT +LCG  SLS +FP+ +SFPE+    R +I+RSWS   I +L+  Y G
Sbjct  111   LALWLLSTWFGTFILCGTNSLSCRFPFFRSFPEVEAAGREDIIRSWSMSCIFLLRVLYKG  170

Query  502   MKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKK  681
              K +V+L +F+Q+NE NEN +W+AI Y GPDP    + A KS            S E+++
Sbjct  171   FKALVVLFYFTQLNEKNENPAWEAIGYVGPDP----RRAIKS------------SSEEEE  214

Query  682   GEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGS--GNPSFV  855
             G  D          GPL+K ++++   P   +   L + G  +     Q       P   
Sbjct  215   GARD----------GPLYKALVHM-AGPMDVLCTSLSRAGLSLVTSQSQPDGLKSKPLPT  263

Query  856   IECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLV  1035
             I CDAVVVGSGSGGGV+AGVLA AG KV+VLEKG Y AR++L+LLE  +LD MY G G++
Sbjct  264   IYCDAVVVGSGSGGGVVAGVLAKAGFKVVVLEKGGYHARNNLTLLERHTLDHMYEGCGVL  323

Query  1036  ASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCS  1215
              ++D+ + +L+GS VGGGS +NWSASI+TP HV+ EW   H LELF S  Y  A++ V  
Sbjct  324   TTEDLGVFVLSGSTVGGGSAVNWSASIRTPDHVISEWRHEHGLELFDSDVYAEALDAVSG  383

Query  1216  RMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSET  1395
             RMGVQ EV  E   N VLR+GC ELGYPV+T+ +NA  DH CGWC FGC+DG KKGTSET
Sbjct  384   RMGVQCEVRHESLANAVLRRGCAELGYPVQTVGQNAPPDHDCGWCCFGCRDGSKKGTSET  443

Query  1396  WLADLVDSGNGVIFPECEAVKVVHNKKTGREQ--AAGVMFVYQN--NGAKEFCFVKSRVT  1563
             WL D+ +SGNGVI P   A++V+H    GR +  AAGV+F +++   G KE C ++S+VT
Sbjct  444   WLVDMAESGNGVIIPGSRALRVLH-ADAGRNKNVAAGVVFEFRDGWRGKKERCIIRSKVT  502

Query  1564  VIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKK----SY  1731
             V+ACGAL TP LLK SGLRN NIGR+LHLHPVV +WGYFP++  S+  P  E +    SY
Sbjct  503   VVACGALNTPVLLKKSGLRNANIGRHLHLHPVVMSWGYFPESD-SRWQPSKENQEKITSY  561

Query  1732  QGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILF  1911
             +G I+T MS VV+NF  SGYGA+IQTP+LHPG+FS   PWLSG D K RM RFSRT  +F
Sbjct  562   EGAILTTMSTVVSNFATSGYGAVIQTPALHPGLFSVATPWLSGADYKDRMARFSRTTHIF  621

Query  1912  ALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKP  2091
             ALARD+ SG   +   I Y M   D+ +L+ GLEK+LRI+AAAGAEEIGT H  G  L  
Sbjct  622   ALARDRGSGTVDASGCIRYRMGAADEKNLQRGLEKILRIMAAAGAEEIGTQHCHGDRLNV  681

Query  2092  KGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLF  2271
             + AS  + + FV+  S + L +L T + SAHQMGSCRMG+ PR+S VN  GETWEVEGLF
Sbjct  682   RSASSHQFERFVKATSGKGLMDLLTPVYSAHQMGSCRMGIHPRTSAVNSRGETWEVEGLF  741

Query  2272  LADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             +AD+SV PTALGVNPMVTVQAIAYCTA SVL+ L+
Sbjct  742   VADASVLPTALGVNPMVTVQAIAYCTAHSVLEELR  776



>emb|CDY01593.1| BnaC07g35830D [Brassica napus]
Length=770

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/758 (53%), Positives = 513/758 (68%), Gaps = 34/758 (4%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
             L+   M ++ +I DT +P++D  +   +DD  V  ++  SAS  GTP RVA ++S+RL H
Sbjct  39    LTAREMESLVAICDTLIPSLDGAEVGHLDD-GVAGYYSASASHTGTPDRVARLMSQRLHH  97

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  480
             PK  +LR+ LW LST IG+L+LCG+ S    FPY Q F  +   +R E + +W+  Y  +
Sbjct  98    PKKWILRVGLWSLSTWIGSLVLCGQRSFIGGFPYFQRFCRLPKKQREETLLNWASSYFLL  157

Query  481   LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMT  660
             L+ F+  +K++  L FF+QV+E  +N++WKAI Y GP  D +                  
Sbjct  158   LRMFFRSIKLITALVFFTQVDEKGKNLAWKAIGYNGPSSDHS------------------  199

Query  661   LSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSG  840
                E++  E       P+ + GPL+ G+INL ++PR  V  +L   GF +S     K   
Sbjct  200   -DHEEELNETKTNKNMPKEIFGPLYNGIINL-KKPREAVTKKLTGHGFTISTQKSNKKRS  257

Query  841   ---NPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDE  1011
                NP   I CDAVVVGSGSGGGV+AG+LA AG+KVLV+EKG Y+ARS+LS LEG ++DE
Sbjct  258   SISNPVMTIRCDAVVVGSGSGGGVVAGLLAKAGYKVLVVEKGNYYARSNLSQLEGQAMDE  317

Query  1012  MYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYR  1191
             MYL GGL+A+ DM++++LAGS VGGGSTINWSASI+TP HV+KEW E  +LELF S  YR
Sbjct  318   MYLSGGLLATSDMNVVILAGSTVGGGSTINWSASIKTPEHVMKEWAEKSELELFESNLYR  377

Query  1192  HAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDG  1371
              AM+ VC RMGVQ    +EGF N VLRKGC ELG  V+ IPRNAS+DHYCG+CS GCK G
Sbjct  378   EAMDVVCERMGVQCGFVEEGFNNEVLRKGCEELGLQVKNIPRNASKDHYCGFCSLGCKKG  437

Query  1372  KKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTG--REQAAGVMFVYQNNGAKEFCF  1545
             +K+GTSETWL DLV+SGNG+I P C+A++V++  + G  ++ + G+ F +     ++   
Sbjct  438   QKQGTSETWLVDLVESGNGLILPGCKAMEVLYESEGGNKKKTSTGIAFAF----GEDIYV  493

Query  1546  VKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKK  1725
             V+SR TV+ACGAL TP LLK SGL+N NIGRNL LHPVV AWG+FP+          +KK
Sbjct  494   VESRATVVACGALRTPHLLKRSGLKNGNIGRNLCLHPVVMAWGWFPEEEKWPE---KKKK  550

Query  1726  SYQGGIMTAMSKVVANFEESGYG-ALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTA  1902
             SY+GGIMTAMS VV    ++ YG  +IQTPSLHPGMFS ++PW S  D KTRM +FSRTA
Sbjct  551   SYEGGIMTAMSSVVNAEAKTTYGETVIQTPSLHPGMFSGVIPWTSSNDFKTRMLKFSRTA  610

Query  1903  ILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKI  2082
              +F L RDK +G   S   I YN+   D+ SLK GL  VL IL AAGAEEIGT +  GK 
Sbjct  611   HVFTLLRDKGTGTINSKSYIDYNLNDEDEESLKKGLGSVLNILIAAGAEEIGTHNSEGKS  670

Query  2083  LKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVE  2262
             L  + AS  EI  FV +ESS+ L +LS  I SAHQMGSCRMG+ P  S V P GETWEVE
Sbjct  671   LNVRTASAVEIKRFVREESSKSLKDLSGQICSAHQMGSCRMGIRPEESAVKPTGETWEVE  730

Query  2263  GLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             GLF+AD+SVFPTALGVNPMVTVQ+IAYC   +V+  LK
Sbjct  731   GLFVADTSVFPTALGVNPMVTVQSIAYCIGLNVVGALK  768



>ref|XP_009137007.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Brassica rapa]
Length=770

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/758 (53%), Positives = 514/758 (68%), Gaps = 34/758 (4%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
             L+   M ++ +I DT +P++D  +   +DD  V  ++  SAS  GTP RVA ++S+RL H
Sbjct  39    LTAREMESLVAICDTLIPSIDGAEVGHLDD-GVAGYYSASASHTGTPDRVARLMSQRLHH  97

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  480
             P+  +LR+ LW LST IG+L+LCG+ S    FP+ Q F  +   +R E + +W+  Y  +
Sbjct  98    PRKWILRVGLWSLSTWIGSLVLCGRRSFIGGFPFFQRFCRLPKKQREETLLNWASSYFLL  157

Query  481   LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMT  660
             L+ F+  +K++  L FF+QV+E  +N++WKAI Y GP  D +                  
Sbjct  158   LRMFFRSIKLITALVFFTQVDEKGKNLAWKAIGYNGPSSDHS------------------  199

Query  661   LSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSP---CIQQK  831
                E++  E       P+ + GPL+ G+INL ++PR  V  +L   GF VS       + 
Sbjct  200   -DHEEELNETKTNKEMPKEIFGPLYNGIINL-KKPREAVTKKLTDHGFTVSTQKSNNNRS  257

Query  832   GSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDE  1011
                NP   I CDAVVVGSGSGGGV+AG+LA AG KVLV+EKG Y+ARS+LS LEG ++DE
Sbjct  258   SISNPVMTIRCDAVVVGSGSGGGVVAGLLAKAGFKVLVVEKGNYYARSNLSQLEGQAMDE  317

Query  1012  MYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYR  1191
             MYL GGL+A+ DM++++LAGS VGGGSTINWSASI+TP HV+KEW E  +LELF S  YR
Sbjct  318   MYLSGGLLATSDMNVVILAGSTVGGGSTINWSASIKTPEHVMKEWAEKSELELFESDLYR  377

Query  1192  HAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDG  1371
              AM+ VC RMGVQ    +EGF N VLRKGC ELG  V+ IPRNAS+DHYCG+CS GCK G
Sbjct  378   EAMDVVCERMGVQCGFVEEGFNNEVLRKGCEELGLKVKNIPRNASKDHYCGFCSLGCKKG  437

Query  1372  KKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTG--REQAAGVMFVYQNNGAKEFCF  1545
             +K+GTSETWL DLV+SGNG I P C+A++V++  + G  ++ + G+ F +     ++   
Sbjct  438   QKQGTSETWLVDLVESGNGSILPGCKAMEVLYECEGGNKKKTSTGIAFAF----GEDIYV  493

Query  1546  VKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKK  1725
             V+SR TV+ACGAL TP LLK SGL+N NIGRNL LHPVV AWG+FP+          +KK
Sbjct  494   VESRATVVACGALRTPHLLKRSGLKNGNIGRNLCLHPVVMAWGWFPEEEKWPE---KKKK  550

Query  1726  SYQGGIMTAMSKVVANFEESGYG-ALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTA  1902
             SY+GGIMTAMS V+    ++ YG  +IQTPSLHPGMFS ++PW S  D KTRM +FSRTA
Sbjct  551   SYEGGIMTAMSSVLNAEAKTTYGETVIQTPSLHPGMFSGVIPWTSSNDFKTRMLKFSRTA  610

Query  1903  ILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKI  2082
              +F L RDK +G   S   I YN+   D+ SLK GLE VL IL AAGAEEIGT +  GK 
Sbjct  611   HVFTLLRDKGTGTINSKSYIDYNLNDEDEESLKKGLESVLNILIAAGAEEIGTHNSKGKS  670

Query  2083  LKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVE  2262
             L  + AS  EI+ FV +ESS+ L +LS  I SAHQMGSCRMG+ P  S V PMGETWEVE
Sbjct  671   LNVRTASAVEIERFVREESSKSLKDLSGQICSAHQMGSCRMGIRPEESAVRPMGETWEVE  730

Query  2263  GLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             GLF+AD+SVFPTALGVNPMVTVQ+IAYC   +V+  LK
Sbjct  731   GLFVADTSVFPTALGVNPMVTVQSIAYCIGLNVVGALK  768



>ref|XP_006413983.1| hypothetical protein EUTSA_v10024528mg [Eutrema salsugineum]
 gb|ESQ55436.1| hypothetical protein EUTSA_v10024528mg [Eutrema salsugineum]
Length=728

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/756 (52%), Positives = 518/756 (69%), Gaps = 40/756 (5%)
 Frame = +1

Query  136   MATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIl  315
             M ++ +I DT +P++D  +   VDD  V  ++  SAS  G P RVA +ISERL HPK  +
Sbjct  1     MESLVAICDTLIPSIDGSEVGHVDD-GVAGYYSASASQTGAPDRVARLISERLDHPKKWI  59

Query  316   lrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTFY  495
             LR A+W LST IG+L+LCG+ S +S+FPY Q F  +   +R EI+ +W+  Y  +L+  +
Sbjct  60    LRAAMWSLSTWIGSLVLCGRRSFTSEFPYFQRFCRLPEKQREEILLNWASSYFLLLRMLF  119

Query  496   LGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQ  675
               +K++  L FF+QV+E  +N++WKAI Y GP  D +                     ++
Sbjct  120   RSIKLITSLVFFTQVDEKGKNLAWKAIGYNGPSSDHS-------------------DHDE  160

Query  676   KKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGN----  843
             +  E+      PE + GPL+ G+I+L + PR  V  +L   GF V   + QK + N    
Sbjct  161   ELNEKKTKKKKPEEIFGPLYNGIIDL-KNPREAVVKKLTGHGFRV---LTQKRNKNGSSI  216

Query  844   --PSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMY  1017
               P   I+CDAVVVGSGSGGGV+AGVLA AG+KVLV+EKG Y+AR+ LSLLEG ++DEMY
Sbjct  217   SDPVMTIQCDAVVVGSGSGGGVVAGVLAKAGYKVLVVEKGNYYARNKLSLLEGQAMDEMY  276

Query  1018  LGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHA  1197
             L GGL+A+ DM++++LAGS VGGGSTINWSASI+TP HV+KEW E  +LE+FGS  YR A
Sbjct  277   LSGGLLATSDMNVVILAGSTVGGGSTINWSASIKTPEHVMKEWSENSELEMFGSDLYRKA  336

Query  1198  METVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKK  1377
             M+ VC RMGVQ    +EGF N +LRKGC ELG  V+ IPRN+  DHYCG+C  GCK G+K
Sbjct  337   MDVVCERMGVQCGFVEEGFNNEILRKGCEELGLTVKNIPRNSPSDHYCGFCCLGCKKGQK  396

Query  1378  KGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQ--AAGVMFVYQNNGAKEFCFVK  1551
             +GTSETWL DLV SGNG+I P CEA++V++  + G+++  A G+ F ++    +E   V+
Sbjct  397   QGTSETWLVDLVKSGNGLILPGCEAMEVLYECQNGKKKKTATGLAFAFE----EEVYVVE  452

Query  1552  SRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSY  1731
             S+ T++ACGAL TP LLK SGL+N NIGRNL LHPVV AWG+FP+          +KKSY
Sbjct  453   SKATIVACGALRTPHLLKRSGLKNRNIGRNLCLHPVVMAWGWFPEEEKWPE---KKKKSY  509

Query  1732  QGGIMTAMSKVVANFEESGYG-ALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAIL  1908
             +GGIMTAMS VV    ++ YG  +IQTP+LHPGMFS I+PW SG + K+RM +FSRTA +
Sbjct  510   EGGIMTAMSGVVNTETKTSYGETVIQTPALHPGMFSGIIPWTSGEEFKSRMLKFSRTAHV  569

Query  1909  FALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILK  2088
             F L RDK +G   S   I YN+   D+ SLK GLE+VL IL AAGAEEIGT +  GK L 
Sbjct  570   FTLLRDKGTGTVNSKSCIDYNLNDEDEESLKKGLERVLNILIAAGAEEIGTHNSEGKSLN  629

Query  2089  PKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  2268
              + AS  EI+ FV +ESS+ L +L+  I SAHQMGSCRMG+ P  S V P GETWEV GL
Sbjct  630   VRTASEAEIERFVREESSKGLKDLAGQICSAHQMGSCRMGIRPEESAVRPTGETWEVGGL  689

Query  2269  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             ++AD+SVFPTALGVNPMVTVQ+IAYC   +V+  L+
Sbjct  690   YVADTSVFPTALGVNPMVTVQSIAYCIGLNVVDVLR  725



>ref|XP_008805948.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Phoenix dactylifera]
Length=793

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/761 (52%), Positives = 518/761 (68%), Gaps = 40/761 (5%)
 Frame = +1

Query  112   GCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISER  291
             G  L+   M ++T+ISDTFLP++D+P      ++S++ F+  SAS+ GTP+ V   +S R
Sbjct  48    GNGLTAREMDSLTAISDTFLPSIDLP---GARNESIRAFYLASASMIGTPEIVGGYVSRR  104

Query  292   LQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCY  471
             L+H  + LLRL+LWLLST  GT + CG   +S +FP+   F +I P +R EI+ SWS   
Sbjct  105   LRHALLGLLRLSLWLLSTWYGTFIFCGTRCVSCRFPFFHKFSDIDPTRREEILSSWSSSP  164

Query  472   IKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQ  651
             I + +  +  MK ++   +F+QVN+  EN +W+A++YCGPDP                  
Sbjct  165   IYLYRKLFRAMKFLIPFFYFTQVNDKYENPTWRALEYCGPDP------------------  206

Query  652   HMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQK  831
                   +Q K   D    +     GPLH+ ++++   P   +      L     P  ++K
Sbjct  207   ---AFADQVKASVDQCSEDDRF--GPLHRALVHMGS-PGAALSRAGLSLATRPFPGGRRK  260

Query  832   GSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDE  1011
                 P   I CDAVVVGSGSGGGV+AG LA AG+KV+VLEKG Y ARS+LSL EG +LD 
Sbjct  261   ---KPLRTILCDAVVVGSGSGGGVVAGFLARAGYKVVVLEKGGYHARSNLSLCEGPTLDL  317

Query  1012  MYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYR  1191
             MY GGGL+++ D  +++L+G+ VGGGS INW+A+++TP HV  EW   H L+LFGS  Y 
Sbjct  318   MYEGGGLLSTTDTGVVVLSGATVGGGSAINWAAALRTPDHVAAEWRRDHGLQLFGSDAYA  377

Query  1192  HAMETVCSRMGVQSEVED--EGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCK  1365
              A++ VC RMGVQS+V +  E   N  LR+GC ELGYPV  I RNA  DH+CGWC FGCK
Sbjct  378   EALDAVCERMGVQSDVHEMKESLNNAALRRGCHELGYPVSNISRNAPPDHHCGWCCFGCK  437

Query  1366  DGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGR--EQAAGVMFVYQNNGAKEF  1539
             DG+KK TSETWL D+ +S NGVI P C AV+V+H  +  R  + A GV+F  ++    E 
Sbjct  438   DGRKKATSETWLVDMAESRNGVILPGCRAVRVLHRDRGRRRRKVATGVLFETESG---ET  494

Query  1540  CFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKA--WPE  1713
             C V+S+VTV+ACGAL TP LLK SGLRNPNIG++LHLHPVV  WG+FP++ GS+   + E
Sbjct  495   CIVESKVTVVACGALNTPVLLKRSGLRNPNIGKHLHLHPVVMVWGHFPES-GSRRPDYKE  553

Query  1714  PEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFS  1893
              EK+SY+G IMTAMS V AN+  +GYG +IQTP+LHPGMFS + PW SG D K RM RF+
Sbjct  554   EEKRSYEGDIMTAMSTVAANWGTTGYGVVIQTPALHPGMFSVVTPWTSGADFKDRMTRFA  613

Query  1894  RTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRA  2073
             RTA +FAL RD+ SG      +ISY M+K D+ SLKNG+EK+LRI+AAAGAEE+GT H  
Sbjct  614   RTAHVFALVRDRGSGTVDGEGNISYRMEKGDEESLKNGVEKMLRIMAAAGAEEVGTQHCK  673

Query  2074  GKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETW  2253
             G+  + K AS  E D FV++ S R +G+L+T + SAHQMGSCRMGV+  +S V+  GETW
Sbjct  674   GERFEVKRASAREWDSFVKEASRRGVGSLTTPVCSAHQMGSCRMGVEASTSAVDEGGETW  733

Query  2254  EVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             EVEGLF+AD+SVFPTALGVNPMVTVQAIAYCTA+S+++ L+
Sbjct  734   EVEGLFVADTSVFPTALGVNPMVTVQAIAYCTARSIVQVLR  774



>ref|XP_006878629.1| hypothetical protein AMTR_s00011p00262370 [Amborella trichopoda]
 gb|ERM94774.1| hypothetical protein AMTR_s00011p00262370 [Amborella trichopoda]
Length=814

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/793 (51%), Positives = 507/793 (64%), Gaps = 77/793 (10%)
 Frame = +1

Query  109   GGCP-----LSPAVMATVTSISDTFLPAVDV------PQHAAVD----------------  207
             GG P     LSP  M ++T++ DT +P++DV      P++A  D                
Sbjct  48    GGLPPSPNHLSPRQMESLTALCDTLIPSIDVDFHGQQPRNAGDDAIRSFATSAFMSDFHG  107

Query  208   -------DDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLML  366
                    DD+++ FF TSAS++GTP  VA ++S +++H    +LRL LWLLST  GT ++
Sbjct  108   QQQQNAGDDAIRSFFATSASMSGTPDHVAGLVSGKVKHALSGVLRLCLWLLSTWYGTFII  167

Query  367   CGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTFYLGMKVMVLLSFFSQVNE  546
             CG  SLSS FPY QSFP+I   KR EI+ SWS   I +L+  +  +K  V L F+S+V+E
Sbjct  168   CGTLSLSSHFPYFQSFPQIIQPKREEIMLSWSTSSIYLLRALFQCIKFFVHLIFYSKVDE  227

Query  547   NNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLG  726
             NN N +W+AI YCGPDP                             +E   P   +   G
Sbjct  228   NNHNSTWQAIGYCGPDPQ----------------------------KESGCPHGQQESKG  259

Query  727   PLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggvi  906
             PL  GVI+L+          L+  GF VS    Q      +F I+CDAVVVGSGSGGGV 
Sbjct  260   PLQHGVIDLDSMDHHTFAHVLRASGFTVS----QPKEKFSNFTIKCDAVVVGSGSGGGVA  315

Query  907   agvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGG  1086
             AGVLA AGHKV+VLEKG YFARS LSLLEG ++D+MY   GL+A+ D+  ++LAGS VGG
Sbjct  316   AGVLAVAGHKVVVLEKGHYFARSQLSLLEGPTMDQMYDRHGLIATDDLSAIILAGSTVGG  375

Query  1087  GSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMV  1266
             GS INWSA+I+TP HVL EW++ H LELF SK Y  AM+ V   MGVQ++V DEG     
Sbjct  376   GSAINWSAAIRTPDHVLNEWNQVHGLELFESKAYHQAMDVVARDMGVQTQVSDEGLACSA  435

Query  1267  LRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPEC  1446
             LRKGC ELG+PV  +PRN+  DHYCGWC FGCKDGKKKGT ETWL D+V+SGNGV+    
Sbjct  436   LRKGCQELGFPVVNVPRNSPDDHYCGWCCFGCKDGKKKGTGETWLLDMVNSGNGVVVSGA  495

Query  1447  EAVKVVHNKKTG-REQAAGVMFVYQNN--GAKEFCFVKSRVTVIACGALCTPSLLKNSGL  1617
               V+VV  K+ G R  A GV+F  +N   G +E   + S+VTV+ACGAL TP LLK SGL
Sbjct  496   RVVEVVQRKRKGMRNLAVGVVFERENKRLGCRERFMIVSKVTVVACGALGTPVLLKKSGL  555

Query  1618  RNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGA  1797
             R+  IGRNLH+HP   AWGYFP+        E EK+SY+GGI+TAM  V    ++SGYG 
Sbjct  556   RSQEIGRNLHIHPTNMAWGYFPENRDF----EKEKRSYEGGILTAMLPVPGKSKDSGYGG  611

Query  1798  LIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQ  1977
             LIQ P+LHPGMFS +MPW+S  D+K RM RFSRT  LFAL RDK SG   SP  +SY M 
Sbjct  612   LIQNPALHPGMFSVVMPWMSSLDMKERMTRFSRTVHLFALVRDKGSGVVSSPPYLSYKMS  671

Query  1978  KTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGN  2157
              +DK ++ N +EK+LRILAAAGAEEIGT    G+ +  K AS  E + FV + S + L  
Sbjct  672   HSDKETMSNCMEKMLRILAAAGAEEIGTHGSNGERINVKVASSHEFERFVREVSRKPLQR  731

Query  2158  LST----LIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVT  2325
              S      I SAHQMG+CRMG  P  SVV+  GE WEVEGL++ADSSVFPTALGVNPM+T
Sbjct  732   FSNGYWRPICSAHQMGTCRMGAHPNDSVVDQKGECWEVEGLYIADSSVFPTALGVNPMLT  791

Query  2326  VQAIAYCTAQSVL  2364
             VQAIAYCTA + L
Sbjct  792   VQAIAYCTAHAAL  804



>ref|XP_004150760.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Cucumis sativus]
Length=617

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/628 (60%), Positives = 463/628 (74%), Gaps = 21/628 (3%)
 Frame = +1

Query  511   MVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEE  690
             M+L+  +  V+E   NISWKAIDY G DP   K P+              L E+  K +E
Sbjct  1     MLLVLSYVWVDEELNNISWKAIDYPGSDPQF-KPPS-------------NLKEKDSKSKE  46

Query  691   DVIPMNPELLLGPLHKGVINLNQEPRRQV-FDRLQKLGFPVSPCIQQKGSGNPSFVIECD  867
                    E L GPL KG++NL  + + QV    L+K GFPV+         NPS +I+CD
Sbjct  47    VDEGEEAEELYGPLFKGIVNLQHQQQIQVAVGALRKFGFPVTLLSPTTKPPNPSMIIKCD  106

Query  868   avvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKD  1047
             AVVVGSGSGGGVIAGVLANAG+KVLVLEKG Y AR++LSLLEG +++EMY   GLVA+ +
Sbjct  107   AVVVGSGSGGGVIAGVLANAGYKVLVLEKGSYCARTNLSLLEGPAMEEMYQSSGLVATDN  166

Query  1048  MDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGV  1227
             M++L+LAGS VGGGST+NWSASI+TP H+ +EW + ++LELF S  Y+ A++ VC +MGV
Sbjct  167   MNVLILAGSTVGGGSTVNWSASIETPSHITREWSDEYELELFRSNLYKEAIDVVCKKMGV  226

Query  1228  QSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLAD  1407
             QS++++EGF N VLRKGC ELG    TIPRN++ DHYCGWC  GC+DG+KKGT+ETWL D
Sbjct  227   QSKIDNEGFNNAVLRKGCEELGGHAITIPRNSTSDHYCGWCCLGCRDGRKKGTAETWLVD  286

Query  1408  LVDSGNGVIFPECEAVKVVHNKKTGREQ--AAGVMF-VYQNNGAKEFCFVKSRVTVIACG  1578
             LV SGNGVI P CEA+K+   K+ GRE+  A GV F  +  + AK+ C V+S+VT++ACG
Sbjct  287   LVRSGNGVILPGCEAIKIRQEKEHGRERKRAKGVAFEFWCGSAAKQMCLVESKVTIVACG  346

Query  1579  ALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMS  1758
             AL TP LLK SGLRNPNIG+NLHLHPV  AWGYFP A   K+WPE +KKSY+GGIMTAM 
Sbjct  347   ALNTPPLLKRSGLRNPNIGKNLHLHPVTMAWGYFP-AETDKSWPEKDKKSYEGGIMTAMC  405

Query  1759  KVVAN-FEESGYG-ALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKT  1932
              + +   +E GYG A+IQTP+LHPG+FS +MPW+SGT+IK RM +FSRTA +F LARDK 
Sbjct  406   NIGSEPNQEPGYGGAVIQTPALHPGLFSILMPWISGTNIKQRMCKFSRTAHVFVLARDKG  465

Query  1933  SGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDE  2112
             SG   SP S+SY M   D+ +L+ GLEK L+ILAAAGA EIGT H  G+ +  K  S  E
Sbjct  466   SGIVKSPSSLSYKMDDVDEHNLQKGLEKALKILAAAGAVEIGTHHNKGRSINVKKVSFRE  525

Query  2113  IDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVF  2292
              ++FV++ESSR L +L T I SAHQMGSCRMG+  + SVVN  GETWEVEGLF+ADSSVF
Sbjct  526   YEKFVKEESSRPLKDLLTPICSAHQMGSCRMGIGAKDSVVNQRGETWEVEGLFIADSSVF  585

Query  2293  PTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             PTALGVNPMVTVQAIAYCTAQSVL+ LK
Sbjct  586   PTALGVNPMVTVQAIAYCTAQSVLETLK  613



>ref|XP_004167305.1| PREDICTED: LOW QUALITY PROTEIN: long-chain-alcohol oxidase FAO4A-like, 
partial [Cucumis sativus]
Length=608

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/619 (60%), Positives = 457/619 (74%), Gaps = 21/619 (3%)
 Frame = +1

Query  538   VNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPEL  717
             V+E   NISWKAIDY G DP   K P+              L E+  K +E       E 
Sbjct  1     VDEELNNISWKAIDYPGSDPQF-KPPS-------------NLKEKDSKSKEVDEGEEAEE  46

Query  718   LLGPLHKGVINLNQEPRRQV-FDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsg  894
             L GPL KG++NL  + + QV    L+K GFPV+         NPS +I+CDAVVVGSGSG
Sbjct  47    LYGPLFKGIVNLQHQQQIQVAVGALRKFGFPVTLLSPTTKPPNPSMIIKCDAVVVGSGSG  106

Query  895   ggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGS  1074
             GGVIAGVLANAG+KVLVLEKG Y AR +LSLLEG +++EMY   GLVA+ +M++L+LAGS
Sbjct  107   GGVIAGVLANAGYKVLVLEKGSYCARXNLSLLEGPAMEEMYQSSGLVATDNMNVLILAGS  166

Query  1075  NVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGF  1254
              VGGGST+NWSASI+TP H+ +EW + ++LELF S  Y+ A++ VC +MGVQS++++EGF
Sbjct  167   TVGGGSTVNWSASIETPSHITREWSDEYELELFRSNLYKEAIDVVCKKMGVQSKIDNEGF  226

Query  1255  QNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVI  1434
              N VLRKGC ELG    TIPRN++ DHYCGWC  GC+DG+KKGT+ETWL DLV SGNGVI
Sbjct  227   NNAVLRKGCEELGGHAITIPRNSTSDHYCGWCCLGCRDGRKKGTAETWLVDLVRSGNGVI  286

Query  1435  FPECEAVKVVHNKKTGREQ--AAGVMF-VYQNNGAKEFCFVKSRVTVIACGALCTPSLLK  1605
              P CEA+K+   K+ GRE+  A GV F  +  + AK+ C V+S+VT++ACGAL TP LLK
Sbjct  287   LPGCEAIKIRQEKEHGRERKRAKGVAFEFWCGSAAKQMCLVESKVTIVACGALNTPPLLK  346

Query  1606  NSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVAN-FEE  1782
              SGLRNPNIG+NLHLHPV  AWGYFP A   K+WPE +KKSY+GGIMTAM  + +   +E
Sbjct  347   RSGLRNPNIGKNLHLHPVTMAWGYFP-AETDKSWPEKDKKSYEGGIMTAMCNIGSEPNQE  405

Query  1783  SGYG-ALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFS  1959
              GYG A+IQTP+LHPG+FS +MPW+SGT+IK RM +FSRTA +F LARDK SG   SP S
Sbjct  406   PGYGGAVIQTPALHPGLFSILMPWISGTNIKQRMCKFSRTAHVFVLARDKGSGIVKSPSS  465

Query  1960  ISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKES  2139
             +SY M   D+ +L+ GLEK L+ILAAAGA EIGT H  G+ +  K  S  E ++FV++ES
Sbjct  466   LSYKMDDVDEHNLQKGLEKALKILAAAGAVEIGTHHNKGRSINVKKVSFREYEKFVKEES  525

Query  2140  SRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPM  2319
             SR L +L T I SAHQMGSCRMG+  + SVVN  GETWEVEGLF+ADSSVFPTALGVNPM
Sbjct  526   SRPLKDLLTPICSAHQMGSCRMGIGAKDSVVNQRGETWEVEGLFIADSSVFPTALGVNPM  585

Query  2320  VTVQAIAYCTAQSVLKFLK  2376
             VTVQAIAYCTAQSVL+ LK
Sbjct  586   VTVQAIAYCTAQSVLETLK  604



>ref|XP_008444239.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X2 [Cucumis 
melo]
Length=731

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/620 (60%), Positives = 458/620 (74%), Gaps = 16/620 (3%)
 Frame = +1

Query  535   QVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPE  714
             +V+E   NISWKAIDY G DP        K K   +RE      EE+++ EE        
Sbjct  118   RVDEEMNNISWKAIDYPGSDPQFKPPSNLKEKDSKSREVDEEGDEEEEEAEE--------  169

Query  715   LLLGPLHKGVINLNQEPRRQV-FDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgs  891
              L GPL KG++NL  + + QV    L+K GFPV+         NPS +I+CDAVVVGSGS
Sbjct  170   -LYGPLFKGIVNLQHQQQIQVAVGALRKFGFPVTLLSPTTKPPNPSMIIKCDAVVVGSGS  228

Query  892   gggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAG  1071
             GGGV+AGVLANAG+KVLVLEKG Y AR++LSLLEG +++EMY   GLVA+ +M++L+LAG
Sbjct  229   GGGVVAGVLANAGYKVLVLEKGSYCARTNLSLLEGPAMEEMYQSSGLVATDNMNVLILAG  288

Query  1072  SNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEG  1251
             S VGGGST+NWSASI+TP HV KEW + ++LELF S  Y+ A++ VC +MGVQS++++EG
Sbjct  289   STVGGGSTVNWSASIKTPSHVTKEWSDEYELELFRSNLYKEAIDVVCKKMGVQSKIDNEG  348

Query  1252  FQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGV  1431
             F N VLRKGC ELG     IPRN++ DHYCGWC  GC+DG+KKGT+ETWL DLV SGNGV
Sbjct  349   FNNAVLRKGCEELGGHAINIPRNSTSDHYCGWCCLGCRDGRKKGTAETWLVDLVRSGNGV  408

Query  1432  IFPECEAVKVVHNKKTGREQ--AAGVMF-VYQNNGAKEFCFVKSRVTVIACGALCTPSLL  1602
             I P CEA+K+   KK GRE+  A GV F  +  + AK+ C V+S+VT++ACGAL TP LL
Sbjct  409   ILPGCEAIKIRQEKKQGRERKMAKGVAFEFWCGSAAKQMCLVESKVTIVACGALNTPPLL  468

Query  1603  KNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVAN-FE  1779
             K SGLRNPNIG+NLHLHPV  AWGYFP A   K+WPE +KKSY+GGIMTAM  +     +
Sbjct  469   KRSGLRNPNIGKNLHLHPVTMAWGYFP-AETDKSWPEKDKKSYEGGIMTAMCNIGPEPNQ  527

Query  1780  ESGYG-ALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPF  1956
             E GYG A+IQTP+LHPG+FS +MPW+SGT+IK RM +FSRTA +F LARDK SG   SP 
Sbjct  528   EPGYGGAVIQTPALHPGLFSILMPWVSGTNIKQRMCKFSRTAHVFVLARDKGSGTVKSPS  587

Query  1957  SISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKE  2136
             S+SY M   D+ +L+ GLEK L+ILAAAGA EIGT H  G+ +  K  S  E ++FV++E
Sbjct  588   SLSYKMDNVDEQNLQKGLEKALKILAAAGAVEIGTHHNKGRSINVKKVSYREYEKFVKEE  647

Query  2137  SSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNP  2316
             SSR L +L T I SAHQMGSCRMG   + SVVN  GETWEVEGLF+ADSSVFPTALGVNP
Sbjct  648   SSRPLKDLLTPICSAHQMGSCRMGSGAKDSVVNQRGETWEVEGLFIADSSVFPTALGVNP  707

Query  2317  MVTVQAIAYCTAQSVLKFLK  2376
             MVTVQAIAYCTAQSVL+ LK
Sbjct  708   MVTVQAIAYCTAQSVLETLK  727



>ref|XP_009396212.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Musa acuminata subsp. 
malaccensis]
Length=745

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/752 (50%), Positives = 498/752 (66%), Gaps = 41/752 (5%)
 Frame = +1

Query  142   TVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllr  321
             ++ ++ DT LP VDV   ++V D+ +  F+ TSAS+ GT + +  ++S  L+HP   LL 
Sbjct  29    SLAAVCDTLLPQVDV---SSVGDEGLVEFYGTSASMVGTSEHIGGLLSGGLKHPAAGLLY  85

Query  322   lalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTFYLG  501
             LALWLLST  GT  +CG  SLS QFPY   F ++   KR +I+ SWS     +    +  
Sbjct  86    LALWLLSTWYGTFAMCGTRSLSKQFPYFHRFAKVERTKREQILLSWSLGSFPLYAMLFRC  145

Query  502   MKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKK  681
             +K + +  +F+Q+N++  N +WKA+ YCGPDPD            + + QH+   + Q+K
Sbjct  146   LKYLTMRLYFTQLNDDRTNPAWKAMGYCGPDPD-----------LVDQSQHLGTPQHQEK  194

Query  682   GEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIE  861
                D      + + GPLH  ++++ ++PR  +   L K GFP                + 
Sbjct  195   DPVD----QEDDVFGPLHSALLHM-EKPRDVITRMLHKAGFPAPATFPSS-----PLTLS  244

Query  862   CDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVAS  1041
             CDA V+GSGSGG V+AGVLA AG+KV+V+EKG Y+  S LSLLEG +L  MY GGGLVA+
Sbjct  245   CDAAVIGSGSGGSVVAGVLAKAGYKVIVIEKGDYYPSSRLSLLEGPALGAMYEGGGLVAT  304

Query  1042  KDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRM  1221
              D+  LLLAGS VGGGST+NWSASI+TP HV +EW + H LELF SK Y  A++ VC RM
Sbjct  305   DDVGALLLAGSTVGGGSTVNWSASIRTPGHVRREWCDEHGLELFSSKAYDEALDVVCERM  364

Query  1222  GVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWL  1401
             GVQS+V++EGF NM+LR+GC +LGYPV  +P NA  DHYCGWC  GCK+GKK+ T ETWL
Sbjct  365   GVQSDVKEEGFNNMILRRGCEKLGYPVANVPCNAPPDHYCGWCHLGCKNGKKQSTKETWL  424

Query  1402  ADLVDSGNGVIFPECEAVKVVHNK--KTGREQAAGVMFVYQNNGAKEFCFVKSRVTVIAC  1575
             ADL DSGNG I P C+AV++++ K    GR  A GV+  + N   +EF  V+S+VTV+A 
Sbjct  425   ADLADSGNGFILPCCKAVRILYRKGRGIGRSVANGVVVAFGN---EEFT-VESKVTVVAS  480

Query  1576  GALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAM  1755
             GAL TPSLLK SGL+N +IG++LH+HP V AWG+FP    S  WPE  +KSY+GGI+T+M
Sbjct  481   GALNTPSLLKRSGLKNVHIGKHLHIHPAVMAWGFFP----STRWPEECRKSYEGGILTSM  536

Query  1756  SKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTS  1935
               +      S Y  L+QTP+LHPGMF+ + PWLS  D + RM RFSRTA +FAL RDK S
Sbjct  537   CPL------SSYCTLLQTPALHPGMFATVTPWLSAADFRERMTRFSRTAHIFALVRDKGS  590

Query  1936  GEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGK-ILKPKGASRDE  2112
             G A  P S+ Y M + D+  LK  LE  +RILAAAGAEE+GT H  G+ +        + 
Sbjct  591   GTADYPESVVYRMDEEDEEKLKRSLEAAVRILAAAGAEEVGTHHGKGERVKVGGRGGGEG  650

Query  2113  IDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVF  2292
             ++E V +   R L +  T I +AHQMGSCRM  D +   V+P GETWEVEGL++AD+SVF
Sbjct  651   VEELVTEVVRRGLRDGKTPISTAHQMGSCRMAADAKEGAVSPRGETWEVEGLYVADTSVF  710

Query  2293  PTALGVNPMVTVQAIAYCTAQSVLKFLKTHNH  2388
             PTALGVNPMVTVQAIAYCTAQS+L+ L+  N+
Sbjct  711   PTALGVNPMVTVQAIAYCTAQSILQVLQGSNN  742



>emb|CAA18625.1| putative protein [Arabidopsis thaliana]
 emb|CAB78940.1| putative protein [Arabidopsis thaliana]
Length=678

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/622 (57%), Positives = 436/622 (70%), Gaps = 39/622 (6%)
 Frame = +1

Query  535   QVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPE  714
             +V+E   N++WKAI Y GP PD                     S+ + +  E+     PE
Sbjct  85    RVDEKGRNLAWKAIGYNGPSPDH--------------------SDHEVELNEEKKKKKPE  124

Query  715   LLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGN------PSFVIECDavv  876
              + GPL+ G+++L + PR  V  +L   GF VS    QK + N      P   I+CDAVV
Sbjct  125   EIFGPLYNGIVDL-KSPREAVEKKLAGRGFAVS---NQKRNTNGSSISDPVMKIQCDAVV  180

Query  877   vgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDI  1056
             VGSGSGGGV AGVLA AG+KVLV+E G Y+ARS LSLLEG ++D+MYL GGL+A+ D ++
Sbjct  181   VGSGSGGGVAAGVLAKAGYKVLVIESGNYYARSKLSLLEGQAMDDMYLSGGLLATSDTNV  240

Query  1057  LLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSE  1236
             ++LAGS VGGGSTINWSASI+TP HV+KEW E  KLE+FGS  YR AM+ VC RMGVQ  
Sbjct  241   VILAGSTVGGGSTINWSASIKTPEHVMKEWAEKSKLEMFGSDLYREAMDVVCKRMGVQCG  300

Query  1237  VEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVD  1416
               +EGF N VLRKGC +LG PV+ IPRNA  DHYCG+C  GCK G+K+GTSETWL DLV+
Sbjct  301   FVEEGFNNEVLRKGCEKLGLPVKNIPRNAPSDHYCGFCCLGCKKGQKQGTSETWLVDLVE  360

Query  1417  SGNGVIFPECEAVKVVHNKKTG-REQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTP  1593
             S NG+I P C+A +V+++ + G +++A GV F +     +E   V+SRVT++ACGAL TP
Sbjct  361   SDNGLILPGCQATEVMYDCEQGKKKKATGVAFAF----GEEIYVVESRVTIVACGALRTP  416

Query  1594  SLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVAN  1773
              LLK SGL+N NIGRNL LHPVV AWG+FP+      WPE +KKSY+GGIMTAMS VV  
Sbjct  417   HLLKRSGLKNSNIGRNLCLHPVVMAWGWFPE---EDKWPEKKKKSYEGGIMTAMSSVVIE  473

Query  1774  FEESGYGAL-IQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPS  1950
                S YG + IQTP+LHPGMFS I+PW S  D KTRM +FSRTA +FAL RDK +G   S
Sbjct  474   ETHSSYGEMVIQTPALHPGMFSGIIPWTSSKDFKTRMLKFSRTAHIFALLRDKGTGTIDS  533

Query  1951  PFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVE  2130
                I YN+   D+ SLKNGLE+VL+ILAAAGAEEIGT H  G+ L  + AS  EI+ FV 
Sbjct  534   KTYIDYNLNDEDEESLKNGLERVLKILAAAGAEEIGTHHSEGRSLNVRTASSLEIERFVR  593

Query  2131  KESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGV  2310
             +ESS+ L +LS  I SAHQMGSCRMG+ P  S V P GETWEVE LF+AD+SVFPTALGV
Sbjct  594   EESSKPLKDLSGQICSAHQMGSCRMGIRPEESAVRPTGETWEVERLFVADTSVFPTALGV  653

Query  2311  NPMVTVQAIAYCTAQSVLKFLK  2376
             NPMVTVQ+IAYC   +V+  LK
Sbjct  654   NPMVTVQSIAYCIGLNVVDVLK  675



>ref|XP_006283178.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
 gb|EOA16076.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
Length=598

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/626 (56%), Positives = 435/626 (69%), Gaps = 35/626 (6%)
 Frame = +1

Query  529   FSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMN  708
              + V+E   N++WKAI Y GP  D                     S+   + E +     
Sbjct  1     MNSVDEKGRNLAWKAIGYNGPSLDD--------------------SDHDLEEELNEKKKK  40

Query  709   PELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQ-KGSG--NPSFVIECDavvv  879
             PE + GPL+ G+++LN  PR  V  +L   GF VS    + KGS   NP   I CDAVVV
Sbjct  41    PEEIFGPLYNGIVDLNC-PREAVTKKLTGRGFTVSSQKNKSKGSSLSNPVMTIRCDAVVV  99

Query  880   gsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDIL  1059
             GSGSGGGV+AGVLA AG+KVLV+E G Y+ARS+LSLLEG ++++MYL GGL+A+ D +++
Sbjct  100   GSGSGGGVVAGVLAKAGYKVLVVESGNYYARSNLSLLEGQAMEDMYLSGGLLATSDTNVV  159

Query  1060  LLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEV  1239
             +LAGS VGGGSTINWSASI+TP HV+KEW E  KLE+FGS  YR AM+ VC RMGVQ   
Sbjct  160   ILAGSTVGGGSTINWSASIKTPEHVMKEWTEKSKLEMFGSDLYREAMDVVCERMGVQCGF  219

Query  1240  EDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDS  1419
              +EGF N +LRKGC ELG PV+ IPRNA  DHYCG C  GCK G+K+GTSETWL DLV S
Sbjct  220   VEEGFNNEILRKGCEELGLPVKNIPRNAPSDHYCGHCCLGCKKGQKQGTSETWLVDLVQS  279

Query  1420  GNGVIFPECEAVKVVHNKKTG---REQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCT  1590
             GNG+I P C+A++V++  + G   +++A GV F +     +E   V+SR TV+ACGAL T
Sbjct  280   GNGLILPGCKAMEVLYECEQGKKNKKKATGVAFAF----GEEIYVVESRATVVACGALRT  335

Query  1591  PSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVA  1770
             P LLK SGL+N NIGRNL LHPVV AWG+FP+    + WPE +K SY+GGIMTAMS VV 
Sbjct  336   PHLLKRSGLKNGNIGRNLCLHPVVMAWGWFPEG---EKWPEKKKMSYEGGIMTAMSSVVN  392

Query  1771  NFEESGYG-ALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAP  1947
                +S YG  +IQTP+LHPGMFS + PW S  D KTRM +FSRTA +FAL RDK +G   
Sbjct  393   AETQSSYGETVIQTPALHPGMFSGVTPWASSKDFKTRMLKFSRTAHIFALLRDKGTGTIN  452

Query  1948  SPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFV  2127
             S   I YN+   D+ SLK GLE+VL+I+AAAGAEEIGT +  GK L  + AS  E + FV
Sbjct  453   SKSYIDYNLNDEDEESLKKGLEEVLKIMAAAGAEEIGTHNSEGKSLNVRRASAVEFERFV  512

Query  2128  EKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALG  2307
              +ESS+ L NLS  I SAHQMGSCRMG+ P  S V P GETWEVEGLF+AD+SVFPTALG
Sbjct  513   REESSKPLKNLSGQICSAHQMGSCRMGIRPEESAVRPTGETWEVEGLFVADTSVFPTALG  572

Query  2308  VNPMVTVQAIAYCTAQSVLKFLKTHN  2385
             VNPMVTVQ+IAYC   +V+  LK +N
Sbjct  573   VNPMVTVQSIAYCIGLNVVDVLKRNN  598



>ref|XP_008382148.1| PREDICTED: LOW QUALITY PROTEIN: long-chain-alcohol oxidase FAO4A 
[Malus domestica]
Length=768

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/575 (59%), Positives = 420/575 (73%), Gaps = 16/575 (3%)
 Frame = +1

Query  667   EEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNP  846
              EQ+  E++  P N E L GPL +G+IN+  +    +   + + G P           + 
Sbjct  198   REQEIREQNQFPDNKEELFGPLFRGIINM--KXTNDLVADISRFGVPAFV--------HH  247

Query  847   SFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGG  1026
             S  I CDAVV+G+G GGGV+AGVLA  G+KV+VLEKG Y AR +L+LLEG ++D+MYL G
Sbjct  248   SLTIRCDAVVIGTGLGGGVVAGVLAKDGYKVVVLEKGHYHARHNLTLLEGPTMDQMYLSG  307

Query  1027  GLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMET  1206
             GL+A+ D  + +LAGS VGGGST+N SAS++TP HVLKEW   HKLELF SK Y+ A++ 
Sbjct  308   GLIATDDTXVFVLAGSTVGGGSTVNRSASVRTPVHVLKEWCNAHKLELFDSKLYQLALDV  367

Query  1207  VCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGT  1386
             VC RMGVQSE+++EGF N VLRKGC EL YP+E IPRN++  HYCGWC  G KDG+K+G 
Sbjct  368   VCERMGVQSEIQEEGFNNAVLRKGCQELRYPMENIPRNSTPGHYCGWCCLGYKDGRKRGA  427

Query  1387  SETWLADLVDSGNGVIFPECEAVKVVHNKKTG---REQAAGVMFVYQNNGAKEFCFVKSR  1557
             +ETW  DLV+SGNG IF  CEAVK +H +  G   R  A GV F +++ G +   FV+S+
Sbjct  428   TETWFVDLVNSGNGAIFSGCEAVKALHKRNKGRGHRNTATGVAFKFEHEGGRNIGFVESK  487

Query  1558  VTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQG  1737
             VT++ACGAL TP LLK S L+N NIG+NLHLH V   WG+FPD+         EKKS++G
Sbjct  488   VTIVACGALSTPKLLKRSELKNGNIGKNLHLHSVAMTWGHFPDSXVFDGRLPREKKSFEG  547

Query  1738  GIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFAL  1917
             GI+TAMS VVA+F+ SGYGA+IQTP+LHPGM S ++PW+SG D K RM  FSRTA +FAL
Sbjct  548   GILTAMSTVVADFDGSGYGAVIQTPTLHPGMLSIVIPWVSGKDTKRRMSMFSRTAHVFAL  607

Query  1918  ARDKTSG--EAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKP  2091
              RDK SG   AP P S+SY M+  D+ +L  GLEK LRILAAAGAEEIGT H  GK L  
Sbjct  608   VRDKGSGTVNAP-PNSVSYEMEAIDEHNLNTGLEKSLRILAAAGAEEIGTHHFKGKSLAV  666

Query  2092  KGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLF  2271
             K AS DE + FV++ESSR L +LS+ I  A+QMGSCRMGVD + SVVN MGETWEVE LF
Sbjct  667   KKASLDEFERFVKEESSRSLRDLSSAICLAYQMGSCRMGVDAKGSVVNQMGETWEVERLF  726

Query  2272  LADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             LAD+SVFPTALGVNPMVTVQAIAYCTAQSVL+ L+
Sbjct  727   LADTSVFPTALGVNPMVTVQAIAYCTAQSVLEVLR  761



>emb|CBI29206.3| unnamed protein product [Vitis vinifera]
Length=658

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/753 (49%), Positives = 473/753 (63%), Gaps = 145/753 (19%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
             LS   M ++ +ISDTFLP+V+ P +AA     V  F++TSAS+AGTP  V  +ISERL+H
Sbjct  35    LSSREMESLIAISDTFLPSVEAPHNAA--HAYVDKFYRTSASMAGTPHIVGGLISERLEH  92

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  480
             PK+ L R+ LWLLST  GT ++CG AS+SS FPY QSFP++SPHKR EIV SWS  Y  +
Sbjct  93    PKLWLSRVVLWLLSTWFGTFIICGLASMSSHFPYFQSFPQVSPHKRHEIVLSWSLSYFSL  152

Query  481   LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMT  660
             ++  +  +K++ LL FF+QV+E NEN++WKAI YCGPDPD                   T
Sbjct  153   IRMLFRSLKLVTLLVFFTQVDEKNENLTWKAIGYCGPDPDFK-----------------T  195

Query  661   LSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSG  840
             L    K  + +              +G+IN+ + PR  V + L+  GF +S   ++  + 
Sbjct  196   LYRANKTAQPN-----------GYGRGLINV-KRPREVVAEALRLSGFSISIHSRKHETP  243

Query  841   NPS--FVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEM  1014
             N S   +I CDAVV+GSGSGGGV AGVLA AG+KVLVLEKG Y ARS+LSLLEG +LD+M
Sbjct  244   NSSSPLIIRCDAVVIGSGSGGGVAAGVLAKAGYKVLVLEKGNYCARSNLSLLEGPTLDQM  303

Query  1015  YLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRH  1194
             YL GG++A+ D  +++LAGS VGGGSTINWSASI+TP HV KEW + H+LELF S+ Y+ 
Sbjct  304   YLYGGMLATDDTGVIILAGSTVGGGSTINWSASIRTPQHVRKEWCDQHELELFDSQLYKE  363

Query  1195  AMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGK  1374
             AM+ VC +MGVQSE+ +EG  N VLR+GC ELGYP                         
Sbjct  364   AMDVVCEKMGVQSEIYEEGLNNAVLRRGCQELGYP-------------------------  398

Query  1375  KKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQAAGVMFVYQNNGAKEFCFVKS  1554
                   TWL D+++SGN  +F                                    V+S
Sbjct  399   ------TWLVDMMNSGN--VF-----------------------------------MVES  415

Query  1555  RVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQ  1734
             +VT++ACGA+ TP LLK SGL+NPNIG+NLHLHPV  AWG+FP+       P P      
Sbjct  416   KVTIVACGAISTPGLLKRSGLKNPNIGKNLHLHPVAMAWGHFPE-------PTP------  462

Query  1735  GGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFA  1914
                                        L P     +MPW+SG D+K RM R+SRTA +FA
Sbjct  463   ---------------------------LSP----ILMPWISGPDMKDRMIRYSRTAHIFA  491

Query  1915  LARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPK  2094
             LARDK SG   SP +ISY M +TD+ +LK G+EK+LRILAAAGAEEIGT +  G+ +  K
Sbjct  492   LARDKGSGTISSPSTISYQMDETDEENLKRGMEKLLRILAAAGAEEIGTHNCNGRSINVK  551

Query  2095  GASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFL  2274
               S    ++FV++ESSR L +LST + SAHQMGSCRMGVDPRSS VN MGETWEVEGL++
Sbjct  552   KVSSHAFEKFVKEESSRALRDLSTPVCSAHQMGSCRMGVDPRSSAVNQMGETWEVEGLYV  611

Query  2275  ADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
             AD+SVFPTALGVNPMVTVQAIAY TA+SV++ L
Sbjct  612   ADTSVFPTALGVNPMVTVQAIAYSTAKSVVEML  644



>gb|ABR17814.1| unknown [Picea sitchensis]
Length=743

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/759 (45%), Positives = 486/759 (64%), Gaps = 52/759 (7%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
             LS + + ++ +I D F+P++  P    + D  V+ F++ S S  G P++VA +I+ R++ 
Sbjct  25    LSASQIKSLAAICDAFIPSI--PPTNDLQDPEVESFYRLSGSQNGIPEQVAELIARRVKP  82

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCY-IK  477
                ++ R  LWLLSTR+GT +LCG ASL  +FPYLQ F ++    R +I+  WS    I 
Sbjct  83    IAFLMARWLLWLLSTRLGTWLLCGSASLKKEFPYLQPFSDVQQVSREQILLDWSRGRRIT  142

Query  478   ILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHM  657
              LK  +   K+  L +F++  +EN EN +WK I Y  P P++++  +G+           
Sbjct  143   FLKFAFKLFKICCLFTFYTVADENAENPAWKGIGYSPPKPETDRVASGR-----------  191

Query  658   TLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGS  837
                                    PL KGVI+L+    + +    Q  GF V+   ++  S
Sbjct  192   -----------------------PLEKGVIDLSSASEQDLPKLFQDRGFTVTE--EENLS  226

Query  838   GN-PSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEM  1014
             G   ++ +ECDAVVVGSGSGGGV AGVLA AG++V+VLEKGKY+AR  L+LLEG S D+M
Sbjct  227   GKEKAWKVECDAVVVGSGSGGGVAAGVLAKAGYRVIVLEKGKYYARDDLTLLEGPSFDQM  286

Query  1015  YLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRH  1194
             Y  GG++ + D  +L++AG+ VGGGS INWSASI+TPPHVLKEW + H L LF S +Y+ 
Sbjct  287   YESGGILPTNDGKVLVMAGATVGGGSAINWSASIRTPPHVLKEWSKQHGLPLFESHDYQD  346

Query  1195  AMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGK  1374
             AM  VC R+GVQ     E FQN VL  GC +LG+  E +PRN++ DH+CG C FGC+ G 
Sbjct  347   AMNAVCGRLGVQDGCSKESFQNSVLSTGCAKLGFRFEKVPRNSTEDHFCGSCCFGCRKGN  406

Query  1375  KKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTG--REQAAGVMFVYQNNGAKEFCFV  1548
             KKG  ETWL D ++SG+ +I   C+A KV+  +  G  +++AAGV+  +     +   FV
Sbjct  407   KKGADETWLVDAMNSGS-LILAGCKAEKVLCQEIPGSWKQRAAGVVAAF--GPKRRSIFV  463

Query  1549  KSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKS  1728
             +++VTV ACG+L TP LL++SGLRNPNIGRNLHLHPV  AWG+FP+        EP  K 
Sbjct  464   QAKVTVAACGSLLTPLLLRSSGLRNPNIGRNLHLHPVQMAWGFFPEN------KEPAGKP  517

Query  1729  YQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAIL  1908
             ++GGI+T + K  A +E+SGYG +IQTP++ PG F++++PW SG D+K RMQ++ RTA +
Sbjct  518   HEGGIITTICKEGAKWEQSGYGTIIQTPAIAPGSFASMIPWTSGLDMKERMQKYHRTAHV  577

Query  1909  FALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILK  2088
             F LARD+ SG       + Y   ++DK +LK GL + ++IL AAGA E+GT    G+ L 
Sbjct  578   FCLARDRGSGSVGGEKDLDYRFAESDKDNLKEGLRRCVQILIAAGATEVGTHRSDGERLA  637

Query  2089  PKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGL  2268
              KGA+ DEI+EF+  +     G   T   SAHQMGSCRMG D  S  V+  GE+WEVEGL
Sbjct  638   VKGATDDEIEEFLNNKGKGRRGVWPTFF-SAHQMGSCRMGKDEESGGVDWKGESWEVEGL  696

Query  2269  FLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHN  2385
             F+ D S+ PT++GVNPM+T+Q++A+C A  +L+FL+T++
Sbjct  697   FVCDGSLLPTSVGVNPMITIQSLAFCVANYILQFLRTNS  735



>ref|XP_006368110.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like, partial [Solanum 
tuberosum]
Length=389

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/389 (72%), Positives = 322/389 (83%), Gaps = 6/389 (2%)
 Frame = +1

Query  1216  RMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSET  1395
             +MGVQSE+EDEGFQNM+LRKGC ELGYPVETIP NA  DHYCGWCS GCKDGKKKGT+ET
Sbjct  1     KMGVQSEIEDEGFQNMILRKGCQELGYPVETIPTNAPSDHYCGWCSMGCKDGKKKGTAET  60

Query  1396  WLADLVDSGNGVIFPECEAVKVVH---NKKTGREQAAGVMFVYQN-NGAKEFCFVKSRVT  1563
             WL DLV SGNG I PECEA++V+H   N  +G+ +A GV F +QN  G +E C VKS+VT
Sbjct  61    WLVDLVKSGNGAILPECEALEVIHEEKNDNSGKRKAIGVAFAFQNIEGMREICMVKSKVT  120

Query  1564  VIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGS--KAWPEPEKKSYQG  1737
             ++ACGAL TPSLLK SGL+NPNIGRNLHLHPVV AWGYFPD+P +  + WP+ EKKSY+G
Sbjct  121   IVACGALSTPSLLKRSGLKNPNIGRNLHLHPVVIAWGYFPDSPSTSNEIWPKAEKKSYEG  180

Query  1738  GIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFAL  1917
             GIMTAMSKVVANFE SGYGA+IQTP LHPGMFSA+MPW+SG D K RM ++SRTA +FAL
Sbjct  181   GIMTAMSKVVANFEGSGYGAVIQTPGLHPGMFSALMPWVSGLDFKMRMSKYSRTAYIFAL  240

Query  1918  ARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKG  2097
             ARDK SGEA SP+SISY + +TD+ +LK GLEK LRILAAAGAEEIGT    G+ LK   
Sbjct  241   ARDKGSGEALSPYSISYKLDQTDEENLKAGLEKTLRILAAAGAEEIGTQQEKGRSLKVNE  300

Query  2098  ASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLA  2277
             AS  E + FV++ESS ++G  S  I SAHQMGSCRMGVDP++SVVN  GETWEVEGLFL 
Sbjct  301   ASLKEFERFVKEESSIEIGKHSVPICSAHQMGSCRMGVDPKTSVVNSKGETWEVEGLFLG  360

Query  2278  DSSVFPTALGVNPMVTVQAIAYCTAQSVL  2364
             DSSV PTA+GVNPMVT+QAI+YCTAQSVL
Sbjct  361   DSSVCPTAIGVNPMVTIQAISYCTAQSVL  389



>emb|CDY66156.1| BnaA01g34950D [Brassica napus]
Length=508

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/512 (61%), Positives = 385/512 (75%), Gaps = 10/512 (2%)
 Frame = +1

Query  850   FVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGG  1029
               I+CDAVVVGSGSGGGV+AG+LA AG+KVLV+EKG Y+ARS+LSL EG +LDEMYL GG
Sbjct  1     MTIQCDAVVVGSGSGGGVVAGMLAKAGYKVLVVEKGNYYARSNLSLHEGQALDEMYLSGG  60

Query  1030  LVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETV  1209
             L+A+ DMD+++LAGS VGGGSTINWSASI+TP HV+KEW E  +LE+FGS  YR AM+ V
Sbjct  61    LLATTDMDVVILAGSTVGGGSTINWSASIKTPEHVMKEWSEKSELEMFGSHLYREAMDVV  120

Query  1210  CSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTS  1389
             C RMGVQ E  +EGF N +LRKGC  LG PV+ IPRNA  DHYCG+C  GCK G+K+GTS
Sbjct  121   CERMGVQCEFLEEGFNNEILRKGCENLGLPVKNIPRNAPSDHYCGFCCLGCKKGQKQGTS  180

Query  1390  ETWLADLVDSGNGVIFPECEAVKVVHNKKTGR--EQAAGVMFVYQNNGAKEFCFVKSRVT  1563
             ETWL DLV+SGNG+I P CEA++V++  K G+  + + G+ F +     K+   V+SR T
Sbjct  181   ETWLVDLVESGNGLILPGCEAMEVLYECKGGKKTKTSTGIAFAF----GKDIYMVESRAT  236

Query  1564  VIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGI  1743
             ++ACGAL TP LLK+SGL+N +IGRNL LHPVV AWG+FP+          +K+SYQGGI
Sbjct  237   IVACGALRTPHLLKHSGLKNGSIGRNLCLHPVVMAWGWFPEEEEWPE---KKKRSYQGGI  293

Query  1744  MTAMSKVVANFEESGYG-ALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALA  1920
             MTAMS VV    ++ YG  +IQTPSLHPG+FS ++PW S  + K+RM +FSRTA +F L 
Sbjct  294   MTAMSSVVNEETKNSYGETVIQTPSLHPGLFSGVIPWTSSKEFKSRMLKFSRTAHVFTLL  353

Query  1921  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  2100
             RDK +G   S  SI YN+   D+ SLK GLE+VL IL AAGAEEIGT +  GK L  K A
Sbjct  354   RDKGTGTINSKSSIEYNLNNEDEESLKKGLERVLNILTAAGAEEIGTHNSEGKSLNVKTA  413

Query  2101  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  2280
             S  EI+ FV +ESS+ L +LS  I SAHQMGSCRMG  P  S V P GETWEVEGLF+AD
Sbjct  414   SAVEIERFVREESSKSLKDLSGQICSAHQMGSCRMGTSPEVSAVKPTGETWEVEGLFVAD  473

Query  2281  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             +SVFPTALGVNPMVT+Q+IAYC   +V+  LK
Sbjct  474   TSVFPTALGVNPMVTIQSIAYCIGLNVVDALK  505



>emb|CDX99382.1| BnaC01g11700D [Brassica napus]
Length=508

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/512 (61%), Positives = 381/512 (74%), Gaps = 10/512 (2%)
 Frame = +1

Query  850   FVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGG  1029
               I+CDAVVVGSGSGGGV+AG+LA AG+KVLV+EKG Y+ARS+LSL EG + DEMYL GG
Sbjct  1     MTIQCDAVVVGSGSGGGVVAGMLAKAGYKVLVVEKGNYYARSNLSLHEGQAFDEMYLSGG  60

Query  1030  LVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETV  1209
             L+A+ DM++++LAGS VGGGSTINWSASI+TP HV+KEW E  +LE+FGS  YR AM+ V
Sbjct  61    LLATTDMNVVILAGSTVGGGSTINWSASIKTPEHVMKEWSEKSELEMFGSHLYREAMDVV  120

Query  1210  CSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTS  1389
             C RMGVQ E  +EGF N +LRKGC  LG PV+ IPRNA  DHYCG+C  GCK G+K+GTS
Sbjct  121   CERMGVQCEFLEEGFNNEILRKGCENLGLPVKNIPRNAPSDHYCGFCCLGCKKGQKQGTS  180

Query  1390  ETWLADLVDSGNGVIFPECEAVKVVHNKKTGR--EQAAGVMFVYQNNGAKEFCFVKSRVT  1563
             ETWL DLV+SGNG+I P CEA++V++  K G+  + + GV F + +    +   V+++ T
Sbjct  181   ETWLVDLVESGNGLILPGCEAMEVLYECKGGKKTKTSTGVAFAFGD----DIYVVEAKTT  236

Query  1564  VIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGI  1743
             ++ACGAL TP LLK SGL+N NIGRNL LHPVV AWG+FP           +KKSY+GGI
Sbjct  237   IVACGALRTPHLLKRSGLKNGNIGRNLCLHPVVMAWGWFPQEEEWPE---KKKKSYEGGI  293

Query  1744  MTAMSKVVANFEESGYG-ALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALA  1920
             MTAMS VV    +  YG  +IQTPSLHPG+FS ++PW S  + KTRM +FSRTA +F L 
Sbjct  294   MTAMSSVVNAETKRSYGETVIQTPSLHPGLFSGVIPWTSSKEFKTRMLKFSRTAHVFTLL  353

Query  1921  RDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGA  2100
             RDK +G   S  SI YN+   D+ SLK GLE+VL IL AAGAEEIGT +  GK L  + A
Sbjct  354   RDKGTGTINSKSSIEYNLNNEDEESLKKGLERVLNILTAAGAEEIGTHNSEGKSLNVRTA  413

Query  2101  SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  2280
             S  EI+ FV +ESS+ L +LS  I SAHQMGSCRMG  P  S V P GETWEVEGLF+AD
Sbjct  414   SAVEIERFVREESSKGLKDLSGQICSAHQMGSCRMGTRPEVSAVKPTGETWEVEGLFVAD  473

Query  2281  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             +SVFPTALGVNPMV+VQ+IAYC   +V+  LK
Sbjct  474   TSVFPTALGVNPMVSVQSIAYCIGLNVVDALK  505



>emb|CDX98615.1| BnaA03g44000D [Brassica napus]
Length=663

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/653 (51%), Positives = 437/653 (67%), Gaps = 34/653 (5%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
             L+   M ++ +I DT +P++D  +   +DD  V  ++  SAS  GTP RVA ++S+RL H
Sbjct  39    LTAREMESLVAICDTLIPSLDGAEVGHLDD-GVAGYYSASASHTGTPDRVARLMSQRLHH  97

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  480
             PK  +LR+ LW LST IG+L+LCG+ S    FP+ Q F  +   +R E + +W+  Y  +
Sbjct  98    PKKWILRVGLWSLSTWIGSLVLCGRRSFIGGFPFFQRFCRLPKKQREETLLNWASSYFLL  157

Query  481   LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMT  660
             L+ F+  +K++  L FF+QV+E  +N++WKAI Y GP  D +             E+ + 
Sbjct  158   LRMFFRSIKLITALVFFTQVDEKGKNLAWKAIGYNGPSSDHSD-----------HEEELN  206

Query  661   LSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSP---CIQQK  831
              ++  KK         P+ + GPL+ G+INL ++PR  V  +L   GF VS       + 
Sbjct  207   ETKTNKK--------MPKEIFGPLYNGIINL-KKPREAVTKKLTDHGFTVSTQKSNNNRS  257

Query  832   GSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDE  1011
                NP   I CDAVVVGSGSGGGV+AG+LA AG+KVLV+EKG Y+ARS+LS LEG ++DE
Sbjct  258   SISNPVMTIRCDAVVVGSGSGGGVVAGLLAKAGYKVLVVEKGNYYARSNLSQLEGQAMDE  317

Query  1012  MYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYR  1191
             MYL GGL+A+ DM++++LAGS VGGGSTINWSASI+TP HV+KEW E  +LELF S  YR
Sbjct  318   MYLSGGLLATSDMNVVILAGSTVGGGSTINWSASIKTPEHVMKEWAEKSELELFESDLYR  377

Query  1192  HAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDG  1371
              AM+ VC RMGVQ    +EGF N VLRKGC ELG  V+ IPRNAS+DHYCG+CS GCK G
Sbjct  378   EAMDVVCERMGVQCGFVEEGFNNEVLRKGCEELGLKVKNIPRNASKDHYCGFCSLGCKKG  437

Query  1372  KKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTG--REQAAGVMFVYQNNGAKEFCF  1545
             +K+GTSETWL DLV+SGNG+I P C A++V++  ++G  ++ + G+ F +     ++   
Sbjct  438   QKQGTSETWLVDLVESGNGLILPGCRAMEVLYECESGNKKKTSTGIAFAF----GEDIYV  493

Query  1546  VKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKK  1725
             V+SR TV+ACGAL TP LLK SGL+N NIGRNL LHPVV AWG+FP+          +KK
Sbjct  494   VESRATVVACGALRTPHLLKRSGLKNGNIGRNLCLHPVVMAWGWFPEEEKWPE---KKKK  550

Query  1726  SYQGGIMTAMSKVVANFEESGYG-ALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTA  1902
             SY+GGIMTAMS V+    ++ YG  +IQTPSLHPGMFS ++PW S  D KTRM +FSRTA
Sbjct  551   SYEGGIMTAMSSVLNAEAKTTYGETVIQTPSLHPGMFSGVIPWTSSNDFKTRMLKFSRTA  610

Query  1903  ILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGT  2061
              +F L RDK +G   S   I YN+   D+ SLK GLE VL IL AAGA+   T
Sbjct  611   HVFTLLRDKGTGTINSKSYIDYNLNDEDEESLKKGLESVLNILIAAGADHRDT  663



>emb|CAN71289.1| hypothetical protein VITISV_019349 [Vitis vinifera]
Length=741

 Score =   543 bits (1400),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 327/783 (42%), Positives = 463/783 (59%), Gaps = 61/783 (8%)
 Frame = +1

Query  55    DSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQ  234
             D L   G+ E    G Y+ G   S A M ++ SI +  LP + +          V+ F+Q
Sbjct  6     DPLLRGGRRE----GKYTHG--FSSAEMQSLASICEVLLPPLPLNSIEGQPSKGVQSFYQ  59

Query  235   TSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSF  414
              S S    P   A +  +R     VIL+R+ L +LSTR+GTL+LCG  S S ++P++ +F
Sbjct  60    ASGSQHPIPDEGAELFVKRALIEAVILVRVVLIILSTRLGTLLLCGSLSFSDKWPFINNF  119

Query  415   PEISPHKRAEIVRSW-SCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGP  591
               IS  KR +I++ W     +  ++  ++ +K + L +FF+  +EN+EN +W+AI Y   
Sbjct  120   SSISLEKREKILQRWFRHRLLTPIRLAFVYIKFLCLYAFFTLADENSENAAWEAIGY-HT  178

Query  592   DPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRR  771
             D D N+    K +                                PL KG++   QE   
Sbjct  179   DTDGNRSKVPKER--------------------------------PLQKGMVETMQETES  206

Query  772   QVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLE  951
              +   L + G  V    +QK      + I+CD VVVGSG GGGV A VLA++GHKV+VLE
Sbjct  207   TLVQSLNQKGLKVVKDPEQK-----LYKIKCDVVVVGSGCGGGVAAAVLASSGHKVVVLE  261

Query  952   KGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPH  1131
             KG YF  +  S LEG S+++++  GG++ + D  +++LAGS VGGGS INWSASI+TP  
Sbjct  262   KGNYFTATDYSSLEGPSMNQLFESGGILPTVDGKMMILAGSTVGGGSAINWSASIKTPKS  321

Query  1132  VLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETI  1311
             VL+EW E HKL LFGS +Y  AM+ VC R+GV     +EGFQN VLRKGC  LG  V+ +
Sbjct  322   VLQEWAEDHKLPLFGSSQYFSAMDAVCERIGVTETCAEEGFQNQVLRKGCENLGLKVDLV  381

Query  1312  PRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNK----KT  1479
             PRN+S  HYCG CS+GC+ G KKGT  TWL D V  G  VI   C+A + +       + 
Sbjct  382   PRNSSEKHYCGSCSYGCRSGDKKGTDSTWLVDAVACG-AVIITGCKAERFILETNEYGRV  440

Query  1480  GREQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPV  1659
              R++  GV+    NN  K    ++++VT+ ACG+L TP L+ +SGL+N +IG+NLHLHPV
Sbjct  441   KRKKCLGVIAKTLNNNIKNRIQIEAKVTISACGSLLTPPLMISSGLKNQHIGQNLHLHPV  500

Query  1660  VFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSA  1839
                WGYFPD+       E E K+Y+GGI+T+M KVV+  E+    A+I+TP+L PG F+A
Sbjct  501   AMIWGYFPDSN-----SEFEGKAYEGGIITSMHKVVS--EDCQVRAIIETPALGPGSFAA  553

Query  1840  IMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKV  2019
             + PW SG D+K RM R+ RT  LFA+ RD+ +G+      ISYN+   DK +L+ G+ + 
Sbjct  554   LCPWESGLDMKKRMVRYGRTVHLFAMVRDEGTGKVKVEGRISYNLSAIDKENLRAGVRQG  613

Query  2020  LRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLIGSAHQ  2187
             LRIL AAGA E+GT    G+ LK KG +  E++EF++     E  +   +  T+ G+AHQ
Sbjct  614   LRILIAAGAVEVGTYRSDGQRLKSKGINEKELEEFLDSVSAVEGPQSFVDKWTITGTAHQ  673

Query  2188  MGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLK  2367
             MGSCRMG   +   V+  GE+WE  GLF+ D SV PTA+GVNPM+T+Q+ AYC ++ +  
Sbjct  674   MGSCRMGQSEKEGAVDENGESWEAAGLFVCDGSVLPTAVGVNPMITIQSTAYCLSKKIAD  733

Query  2368  FLK  2376
              L+
Sbjct  734   SLE  736



>ref|XP_002285334.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Vitis vinifera]
Length=741

 Score =   541 bits (1393),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 326/783 (42%), Positives = 463/783 (59%), Gaps = 61/783 (8%)
 Frame = +1

Query  55    DSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQ  234
             D L   G+ E    G Y+ G   S A M ++ SI +  LP + +         +V+ F+Q
Sbjct  6     DPLLRGGRRE----GKYTHG--FSSAEMQSLASICEVLLPPLPLNSIEGQPSKAVQSFYQ  59

Query  235   TSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSF  414
              S S    P   A +  +R     VIL+R+ L +LSTR+GTL+LCG  S S ++P++ +F
Sbjct  60    ASGSQHPIPDEGAELFVKRALIEAVILVRVVLIILSTRLGTLLLCGSLSFSDKWPFINNF  119

Query  415   PEISPHKRAEIVRSW-SCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGP  591
               IS  KR +I++ W     +  ++  ++ +K + L +FF+  +EN+EN +W+AI Y   
Sbjct  120   SSISLEKREKILQRWFKHRLLTPIRLAFVYIKFLCLYAFFTLADENSENAAWEAIGY-HT  178

Query  592   DPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRR  771
             D D N+    K +                                PL KG++   QE   
Sbjct  179   DTDGNRSKVPKER--------------------------------PLQKGMVETMQETES  206

Query  772   QVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLE  951
              +   L + G  V    +QK      + I+CD VVVGSG GGGV A VLA++GHKV+VLE
Sbjct  207   TLVQSLNQKGLKVVKDPEQK-----LYKIKCDVVVVGSGCGGGVAAAVLASSGHKVVVLE  261

Query  952   KGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPH  1131
             KG YF  +  S LEG S+++++  GG++ + D  +++LAGS VGGGS INWSASI+TP  
Sbjct  262   KGTYFTATDYSSLEGPSMNQLFESGGILPTVDGKMMILAGSTVGGGSAINWSASIKTPKS  321

Query  1132  VLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETI  1311
             VL EW E HKL LFGS +Y  AM+ VC R+GV     +EGFQN VL+KGC  LG  V+ +
Sbjct  322   VLHEWAEEHKLPLFGSSQYFSAMDAVCERIGVTETCVEEGFQNQVLQKGCENLGLKVDLV  381

Query  1312  PRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNK----KT  1479
             PRN+S  HYCG CS+GC+ G KKGT  TWL D V  G  VI   C+A + +       + 
Sbjct  382   PRNSSEKHYCGSCSYGCRSGDKKGTDSTWLVDAVACG-AVIITGCKAERFILETNEYGRV  440

Query  1480  GREQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPV  1659
              R++  GV+    NN  K    ++++VT+ ACG+L TP L+ +SGL+N +IG+NLHLHPV
Sbjct  441   KRKKCLGVIAKTLNNNIKNRIQIEAKVTISACGSLLTPPLMISSGLKNQHIGQNLHLHPV  500

Query  1660  VFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSA  1839
                WGYFPD+       E E K+Y+GGI+T+M KVV+  E+    A+I+TP+L PG F+A
Sbjct  501   AMVWGYFPDSN-----SEFEGKAYEGGIITSMHKVVS--EDCQVRAIIETPALGPGSFAA  553

Query  1840  IMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKV  2019
             + PW SG D+K RM R+ RT  LFA+ RD+ +G+      ISYN+   DK +L+ G+ + 
Sbjct  554   LCPWESGLDMKKRMVRYGRTVHLFAMVRDEGTGKVKVEGRISYNLSAIDKENLRAGVRQG  613

Query  2020  LRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLIGSAHQ  2187
             LRIL AAGA E+GT    G+ LK KG +  E++EF++     E  +   +  T+ G+AHQ
Sbjct  614   LRILIAAGAVEVGTYRSDGQRLKSKGINEKELEEFLDSVSAAEGPQSFVDKWTITGTAHQ  673

Query  2188  MGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLK  2367
             MGSCRMG   +   V+  GE+WE  GLF+ D SV PTA+GVNPM+T+Q+ AYC ++ +  
Sbjct  674   MGSCRMGKSEKEGAVDENGESWEAAGLFVCDGSVLPTAVGVNPMITIQSTAYCLSKKIAD  733

Query  2368  FLK  2376
              L+
Sbjct  734   SLE  736



>ref|XP_009384649.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Musa acuminata 
subsp. malaccensis]
Length=752

 Score =   536 bits (1382),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 322/798 (40%), Positives = 467/798 (59%), Gaps = 77/798 (10%)
 Frame = +1

Query  52    GDSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAA--------VD  207
             G  L   G+  R   G Y  G  LS A M T++++  TF+P V  P  AA          
Sbjct  6     GHPLLRGGR--RAEKGGYRHG--LSAAQMRTLSAMCGTFVPTV--PIEAACLGGGKDEAP  59

Query  208   DDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLS  387
             D++V+ FF  S S +  P  VA ++  R Q   V L++L LW+L+TR+GTL+LCG  SLS
Sbjct  60    DEAVEAFFLASGSDSPVPDEVAELLVRRGQKEAVALVKLVLWVLATRLGTLVLCGSLSLS  119

Query  388   SQFPYLQSFPEISPHKRAEIVRSWSC--CYIKILKTFYLGMKVMVLLSFFSQVNENNENI  561
              +FP++  F ++   KR  I+  W+    +I  L+  ++ +KV  L  F+S  NE  EN 
Sbjct  120   WRFPFINKFSDMPVEKREHILMKWNREKSFI-FLRLVFVIVKVFCLYVFYSMTNEEEENR  178

Query  562   SWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKG  741
             +WKAI Y  P   S +KP                   + +GE             PL KG
Sbjct  179   AWKAIGYNTP---SEEKP------------------HKSRGER------------PLEKG  205

Query  742   VINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNP---SFVIECDavvvgsgsgggviag  912
             +I    +    +   L + G  V+         NP   ++ I CD V+ GSG GGGV A 
Sbjct  206   IIETMDKTDSSLRQSLIEKGLAVTD--------NPREHTYTINCDVVIAGSGCGGGVAAA  257

Query  913   vLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGS  1092
             VLA++GHKV+V+EKG YF     + LE  S+D++Y  GG+++S D+ ++L+AGS VGGGS
Sbjct  258   VLASSGHKVVVVEKGNYFTAEDYTALEAPSMDQLYEAGGILSSLDVKMMLMAGSTVGGGS  317

Query  1093  TINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLR  1272
              +NW+A ++TP  VL+EW E H L LF S  Y  AM++VC+R+GV  +   EGFQN VLR
Sbjct  318   AVNWAACVRTPDFVLREWAEEHHLRLFDSPTYTSAMDSVCARLGVTEKCTKEGFQNQVLR  377

Query  1273  KGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEA  1452
             +GC  LG  VE++PRN+S DHYCG C +GC+ G K+GT  TWL D VD G  VI   C+A
Sbjct  378   RGCQNLGLEVESVPRNSSEDHYCGTCCYGCRSGDKRGTDTTWLVDAVDRG-AVIITACKA  436

Query  1453  VKVVHNKK------TGREQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSG  1614
              + +  +         +++  G++    NN   +   ++++ T+ ACG+L TP L+  SG
Sbjct  437   ERFIIEEDRQDSSSKKKKKCLGLIARTLNNAITKTLRIEAKATISACGSLLTPPLMVASG  496

Query  1615  LRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYG  1794
             LRNPNIG+NL LHPV+ AWGYFP++       + +   ++GGI+T++ KV A+   +   
Sbjct  497   LRNPNIGKNLRLHPVLLAWGYFPESV-----SDLKGNIFEGGIITSLHKVKASENSNATR  551

Query  1795  ALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNM  1974
             ++I+T  L P  F+ + PW+SG D+K +M R+SRTA +FAL RD+ +G       + Y +
Sbjct  552   SIIETAVLGPASFATLFPWVSGKDMKEKMFRYSRTAHVFALVRDRGAGTIEGEGRLKYRL  611

Query  1975  QKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESS----  2142
              ++DK +L+ GL + LRIL AAGA E+GT    G+ +K KG   +E++EF++   S    
Sbjct  612   DRSDKENLREGLRRALRILVAAGAAEVGTHRSDGQTIKCKGMKEEELEEFLDGIDSVGGP  671

Query  2143  RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMV  2322
             R   ++ TL  SAHQMGSCRMG       V+  GE+WE  GLF+ D SV PTA+GVNPM+
Sbjct  672   RSRSDVWTLHCSAHQMGSCRMGASEEEGGVDERGESWEAGGLFVCDGSVVPTAVGVNPMI  731

Query  2323  TVQAIAYCTAQSVLKFLK  2376
             T+QAIAYC ++ + ++LK
Sbjct  732   TIQAIAYCLSEGIAEYLK  749



>ref|XP_002314488.2| alcohol oxidase-related family protein [Populus trichocarpa]
 gb|EEF00659.2| alcohol oxidase-related family protein [Populus trichocarpa]
Length=743

 Score =   535 bits (1377),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 326/778 (42%), Positives = 477/778 (61%), Gaps = 65/778 (8%)
 Frame = +1

Query  85    RGNDGVYSGGCPLSPAVMATVTSISDTFLPAVD-VPQHAAVDDD---SVKLFFQTSASIA  252
             R  +  Y+ G  LS A M +++S+ +T LP++  +P+     +    +V+ F++ SAS  
Sbjct  13    RNRESKYNHG--LSSAEMESLSSLCETILPSLSPIPKFDGKQNQPTKAVQAFYRASASQT  70

Query  253   GTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPH  432
               P  +A ++++R     V ++RL LWLLSTR+GT +LCG      ++PY ++F  I   
Sbjct  71    PMPDEMAELLTKRGLPEAVFMVRLVLWLLSTRLGTFLLCGSLCFGEKWPYFKNFSSIPLD  130

Query  433   KRAEIVRSW-SCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDY-CGPDPDSN  606
             KR  +++ W    +   ++T ++ +K++VL  FFS+V+E  +N +W+AI+Y  G D + +
Sbjct  131   KRERVLQKWFKHRFFTPIRTAFVYVKILVLYVFFSRVDEKGDNPAWEAIEYNAGTDENPD  190

Query  607   KKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDR  786
             + P  +                                  PL KG+I+ NQE    +   
Sbjct  191   QVPKER----------------------------------PLQKGLIDTNQETDSTLLHS  216

Query  787   LQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYF  966
             L++ G  V+    Q    N  + I+CD V+VGSG GGGV A VLA +G KV VLEKG YF
Sbjct  217   LKEKGLRVT----QDPRKN-LYKIKCDVVIVGSGCGGGVAAAVLAASGQKVFVLEKGNYF  271

Query  967   ARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEW  1146
               +  S LEG S+D++Y  GG +A+ D ++L++AGS VGGGS +NWSASI+TP  VL+EW
Sbjct  272   TATDYSGLEGPSMDQLYESGGKLATTDAEMLIMAGSAVGGGSAVNWSASIKTPNSVLQEW  331

Query  1147  DETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNAS  1326
               T K+ LFGS EY  AM+ VC+R+GV     +EGFQN VLRKGC  LG PV+T+PRN+S
Sbjct  332   TGTQKIPLFGSSEYFSAMDAVCTRIGVTESCGEEGFQNQVLRKGCESLGIPVKTVPRNSS  391

Query  1327  RDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTG----REQA  1494
               HYCG C +GC  G+KKGT  TWL D VD G  VI   C+A + +  K  G    +++ 
Sbjct  392   ERHYCGSCGYGCLKGEKKGTDRTWLVDAVDHG-AVILTGCKAERFMLEKNEGGSKRKKKC  450

Query  1495  AGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWG  1674
              GV     NN  +    ++++VT+ ACGAL TP L+ +SGL+N NIGRNLHLHPV+ AWG
Sbjct  451   VGVTAKIVNNNIRTRLQIEAKVTISACGALLTPPLMISSGLKNQNIGRNLHLHPVLMAWG  510

Query  1675  YFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWL  1854
             YFP++       E + K Y+GGI+TA+ +V+    +S   A+I+TP+L P  F A+ PW+
Sbjct  511   YFPESNS-----EFKGKVYEGGIITAVHEVLTG--DSNARAIIETPALGPSSFVALCPWV  563

Query  1855  SGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILA  2034
             SG D+K RM +++RTA L A+ RD  SG+  +   ISYN+   DK +LK GL + LRIL 
Sbjct  564   SGHDMKDRMAKYARTAHLIAIIRDSGSGKVTTEGRISYNLDAMDKENLKAGLRQALRILV  623

Query  2035  AAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLS-----TLIGSAHQMGSC  2199
             AAGA E+GT    G+ +K +G  +++++EF++   +   G LS      L  SAHQMGSC
Sbjct  624   AAGAVEVGTHRSDGQRIKCRGIKKEDLEEFLDTVYA-TAGPLSPVEDWMLYTSAHQMGSC  682

Query  2200  RMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
             RMG++ +   V+  GE+WE EGLF+ D+SV P+A+GVNPM+T+Q+ AYC ++ + + L
Sbjct  683   RMGINKKEGAVDENGESWEAEGLFVCDASVLPSAVGVNPMITIQSTAYCLSKKIAESL  740



>ref|XP_010920358.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Elaeis guineensis]
Length=756

 Score =   534 bits (1376),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 318/781 (41%), Positives = 473/781 (61%), Gaps = 64/781 (8%)
 Frame = +1

Query  85    RGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVD------DDSVKLFFQTSAS  246
             R   G YS G   SP+ + ++ ++ + F+P++ + +             S++ F++ S S
Sbjct  19    RREKGDYSHG--FSPSQIQSLAAMCEAFVPSLPMEEFHVTSGKEDPPTKSLQAFYRASGS  76

Query  247   IAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEIS  426
                 P  VA ++ +R     ++L++L LWLL+T++GTL+LC   SL  +FP++  F ++ 
Sbjct  77    EFPMPDEVAELMVKRGLKEALLLVKLVLWLLATKLGTLVLCRSLSLCGRFPFINKFSDMP  136

Query  427   PHKRAEIVRSWSC-CYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDS  603
               KR E  + W+   +   L+  ++ +KV  L  F+S  NEN+EN SW AI Y  P  + 
Sbjct  137   IEKREEAFKRWNKENFFTPLRLVFVMVKVFCLYIFYSMTNENSENQSWNAIGYSLPIVE-  195

Query  604   NKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFD  783
               KP               L  + ++               PL KGVI    +    +  
Sbjct  196   --KP---------------LKSQTER---------------PLEKGVIETMDQTDSSLLQ  223

Query  784   RLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKY  963
              L K G  VS    Q       + I+CD  +VGSG GGGV A VLA+AGHKV+V+EKG Y
Sbjct  224   SLSKKGLAVSQDPIQN-----LYDIKCDVAIVGSGCGGGVAAAVLASAGHKVVVIEKGNY  278

Query  964   FARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKE  1143
             F     + +E  S++EMY  GG++++ D  +LL+AGS VGGGS +NWSA I+TP +VLKE
Sbjct  279   FTSEDYTSIEAPSMNEMYECGGILSTTDGKMLLMAGSTVGGGSAVNWSACIKTPDYVLKE  338

Query  1144  WDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNA  1323
             W E H+L LFGS +Y  AM+TVC R+GV     +EGFQN VLRKGC  LG  V+++PRNA
Sbjct  339   WAEEHQLPLFGSTDYLSAMDTVCKRLGVTENCTEEGFQNKVLRKGCRNLGLQVDSVPRNA  398

Query  1324  SRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVK-VVHNKKTGREQAAG  1500
             S  H+CG CS+GC++G K+GT  TWL D V+ G  VI   C+A + ++   + G+++   
Sbjct  399   SESHFCGSCSYGCREGDKRGTDTTWLVDAVNCG-AVIITGCKAERFILEENEPGKKKKKC  457

Query  1501  VMFVYQ--NNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWG  1674
             V  + +  ++   +   ++++VT+ ACG+L TP L+ +SGL NPNIG+NLHLHPVVFAWG
Sbjct  458   VGLIAKSLSSMVTKKLKIQAKVTISACGSLLTPPLMISSGLTNPNIGKNLHLHPVVFAWG  517

Query  1675  YFPDAPGSKAWPEPEKKSYQGGIMTAMSKV-VANFEESGYGALIQTPSLHPGMFSAIMPW  1851
             YFPD+ GS    E + ++++GGI+T++ KV  A   +S   A+I+TP L P  F+A++PW
Sbjct  518   YFPDS-GSD---ELKGRAFEGGIITSLHKVKAAEDSDSSLRAIIETPGLGPAAFAALVPW  573

Query  1852  LSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRIL  2031
             +SG + K RM R+SRTA+LFAL RD+ S +      ++Y   ++D+ +L+ GL + LRIL
Sbjct  574   VSGLETKERMTRYSRTAVLFALVRDRGSAKVEREGRVNYRFDRSDRENLRVGLRRALRIL  633

Query  2032  AAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLG------NLSTLIGSAHQMG  2193
              AAGA E+GT    G+ +K KG   +E++EF+  +  R +G       L T+  SAHQMG
Sbjct  634   VAAGAVEVGTHRSDGQRIKCKGMKEEELEEFL--DGIRTVGGPMSKSELWTMYASAHQMG  691

Query  2194  SCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
             SCRMGV      V+  GE+WE +GLF+ D SV PTA+G+NP++T+Q+ AYC ++ + + L
Sbjct  692   SCRMGVSEEEGGVDEKGESWEAQGLFVCDGSVLPTAVGINPLITIQSTAYCLSKGIAESL  751

Query  2374  K  2376
             K
Sbjct  752   K  752



>ref|XP_009376994.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Pyrus x bretschneideri]
Length=749

 Score =   533 bits (1372),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 326/783 (42%), Positives = 475/783 (61%), Gaps = 54/783 (7%)
 Frame = +1

Query  61    LFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAV-DVPQHAAVDDDSVKLFFQT  237
             L + G+   G+D  YS G   S A M ++ SI +  LP + ++       + +V+ F++T
Sbjct  8     LLNGGRGYTGDDRKYSHG--FSSAEMQSLASICEALLPPLYEIKGEQPTINKAVQSFYKT  65

Query  238   SASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFP  417
             SA+    P  VA ++ +R     V+L+R+ LW+L T++GTL+LCG       +P++ +F 
Sbjct  66    SAAQTPIPDEVAQLMVKRALIEAVVLVRVVLWILGTKLGTLLLCGSLCFGKTWPFVHNFS  125

Query  418   EISPHKRAEIVRSW-SCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPD  594
              +S  KR ++++ W    ++  ++  ++ +K + L  FFS+V EN EN+ W+AI Y    
Sbjct  126   SLSLEKREKVLQKWFKHRFLTPIRLAFVYIKFLCLYIFFSRVGENAENLIWQAIGYHVET  185

Query  595   PDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQ  774
              D + +           + H  + E+++                PL KG+I    E    
Sbjct  186   DDQDDQ-----------KNHSKMQEQER----------------PLQKGIIETMLETDTT  218

Query  775   VFDRLQKLGFPV-SPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLE  951
             + + L + GF V   C +        + ++CD +VVGSG GGGV A VLA++GHKV+VLE
Sbjct  219   LLNSLAQKGFQVIHDCTKN------IYNVKCDVIVVGSGCGGGVAAAVLASSGHKVIVLE  272

Query  952   KGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPH  1131
             KG YF  S  S LE  S D++Y  GG++ + D  I+L AGS VGGGS INWSA I+TP +
Sbjct  273   KGNYFTPSDYSSLEAPSHDQLYESGGILVTVDGKIVLQAGSTVGGGSAINWSACIKTPNY  332

Query  1132  VLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETI  1311
             VL+EW++ HK++ FG  EY  AM+TVC R+GV     +EGFQN VLRKGC  LG  V+ +
Sbjct  333   VLQEWNKDHKIKFFGGSEYLSAMDTVCERIGVIENCVEEGFQNQVLRKGCENLGLGVDFV  392

Query  1312  PRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVK-VVHNKKTG--  1482
             PRN+S  HYCG C +GC+ G+KKGT  TWL D VD G  VI   C+A + V+   K+G  
Sbjct  393   PRNSSEKHYCGSCGYGCRKGEKKGTDSTWLMDAVDYG-AVIITGCKAERFVLETNKSGSK  451

Query  1483  -REQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPV  1659
              +++  GVM    +N   +   ++++VT+ ACGAL TP L+ +SGL+N NIG+NLHLHPV
Sbjct  452   RKKKCLGVMAKPLSNNITKRLQIEAKVTISACGALLTPPLMLSSGLKNKNIGQNLHLHPV  511

Query  1660  VFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSA  1839
             + AWGYFPD+       E + K+Y+GGI+T++ KVV+   +S   A+I+TP+L PG FSA
Sbjct  512   LMAWGYFPDSN-----SEFKGKNYEGGIITSVYKVVS--ADSKVKAIIETPALGPGTFSA  564

Query  1840  IMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKV  2019
             + PW+SG DIK RM +FSRTA L ++ RDK SG       +SY     DK ++K GL + 
Sbjct  565   LSPWVSGEDIKNRMLKFSRTAHLISIIRDKGSGVVTKGGRVSYEFSALDKENIKGGLRQA  624

Query  2020  LRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVE----KESSRDLGNLSTLIGSAHQ  2187
             LRIL AAGA E+GT    G  LK KG  ++E++EF++     E  + L    T   SAHQ
Sbjct  625   LRILIAAGAIEVGTHRSDGLRLKCKGIDKEELEEFLDMVIANEGPQSLVENWTTYSSAHQ  684

Query  2188  MGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLK  2367
             MGSCRMG++ +   V+  GE+WE E LF+ D SV P+A+GVNPM+T+Q+ AYC ++ +  
Sbjct  685   MGSCRMGINAKEGAVDENGESWEAESLFVCDGSVLPSAVGVNPMITIQSTAYCLSKRIAD  744

Query  2368  FLK  2376
              L+
Sbjct  745   SLR  747



>ref|XP_011030464.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Populus euphratica]
Length=745

 Score =   531 bits (1368),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 322/779 (41%), Positives = 474/779 (61%), Gaps = 65/779 (8%)
 Frame = +1

Query  85    RGNDGVYSGGCPLSPAVMATVTSISDTFLPAVD-VPQHAAVDDD---SVKLFFQTSASIA  252
             R  +  Y+ G  LS A M  ++S+ +T  P++  +P+     +    +++ F++ SAS  
Sbjct  13    RNRESKYNHG--LSSAEMEALSSLCETIFPSLSPIPKFDGKQNQPTKAMQAFYRASASQT  70

Query  253   GTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPH  432
               P  +A ++++R     V L+RL LWLLSTR+GT +LCG      ++PY ++F  I   
Sbjct  71    PMPDEMAELLTKRGLLEAVFLVRLVLWLLSTRLGTFLLCGSLCFEEKWPYFKNFSSIPLD  130

Query  433   KRAEIVRSW-SCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDY-CGPDPDSN  606
             KR  +++ W    +   ++  ++ +K+++L  FFS+V+E  +N +W+AI+Y  G D   +
Sbjct  131   KRERVLQKWFKHRFFTPIRAAFVYVKILILYVFFSRVDEKGDNPAWEAIEYNVGADESPD  190

Query  607   KKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDR  786
             + P  +                                  PL KG+I+ NQE    +   
Sbjct  191   QVPKER----------------------------------PLQKGLIDTNQETASTLLHS  216

Query  787   LQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYF  966
             L++ G  V+    Q    N  + I+CD V+VGSG GGGV A VLA +G KV VLEKG YF
Sbjct  217   LKEKGLRVT----QDPRKN-VYKIKCDVVIVGSGCGGGVAAAVLAASGQKVFVLEKGNYF  271

Query  967   ARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEW  1146
               S  S LEG S+D++Y  GG +A+ D ++L++AGS VGGGS +NWSASI+TP  VL+EW
Sbjct  272   TASDYSGLEGPSMDQLYESGGKLATTDAEMLIMAGSAVGGGSAVNWSASIKTPNSVLQEW  331

Query  1147  DETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNAS  1326
                 K+ LFGS EY  AM+ VC+R+GV     +EGFQN VLRKGC  LG PV+T+PRN+S
Sbjct  332   TRNQKIPLFGSSEYFSAMDAVCTRIGVTESCGEEGFQNQVLRKGCESLGIPVKTVPRNSS  391

Query  1327  RDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTG----REQA  1494
               HYCG C +GC+ G+KKGT  TWL D VD G  VI   C+A + +     G    +++ 
Sbjct  392   ERHYCGSCGYGCRKGEKKGTDRTWLVDAVDHG-AVIITGCKAERFMLENNEGGSKRKKKC  450

Query  1495  AGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWG  1674
              GV     NN  +    ++++VT+ ACGAL TP L+ +SGL+N NIGRNLHLHPV+ AWG
Sbjct  451   VGVTAKIVNNNIRTRLQIEAKVTISACGALLTPPLMISSGLKNQNIGRNLHLHPVLMAWG  510

Query  1675  YFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWL  1854
             YFP++       E + K Y+GGI+TA+ +V+    +S   A+I+TP+L P  F+A+ PW+
Sbjct  511   YFPESNS-----EFKGKVYEGGIITAVHEVLTG--DSNARAIIETPALGPSSFAALYPWV  563

Query  1855  SGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILA  2034
             SG D+K RM +++RTA L A+ RD  SG+  +   ISYN+   DK +LK GL + LRIL 
Sbjct  564   SGHDMKDRMAKYARTAHLIAIIRDSGSGKVTTEGRISYNLDAMDKENLKAGLRQALRILV  623

Query  2035  AAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLS-----TLIGSAHQMGSC  2199
             AAGA E+GT    G+ +K +G  +++++EF++   +   G LS      L  SAHQMGSC
Sbjct  624   AAGAVEVGTHRSDGQRIKCRGIKKEDLEEFLDTVYA-TAGPLSLAEDWMLYTSAHQMGSC  682

Query  2200  RMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             RMG++ +   V+  GE+WE EGLF+ D+SV P+A+GVNPM+T+Q+ AYC ++ + + L+
Sbjct  683   RMGINKKEGAVDENGESWEAEGLFICDASVLPSAVGVNPMITIQSTAYCLSKKIAESLR  741



>ref|XP_010262397.1| PREDICTED: long-chain-alcohol oxidase FAO2-like isoform X2 [Nelumbo 
nucifera]
Length=757

 Score =   530 bits (1366),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 329/783 (42%), Positives = 466/783 (60%), Gaps = 66/783 (8%)
 Frame = +1

Query  97    GVYSGGCPLSPAVMATVTSISDTFLP-----AVDVPQHAAVDDDSVKLFFQTSASIAGTP  261
             G YS G  LS   M  VT+I +  +P     ++ V    +    S++ F+  S S    P
Sbjct  24    GSYSHGFSLSE--MQVVTAICEALIPPIPLGSLHVNGKESPPSKSIQSFYLASGSQKPIP  81

Query  262   QRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRA  441
               VA +I  +     V+++RL LW+LSTR+GTL++CG  S  S++P+L  F E+S  KR 
Sbjct  82    DEVAELIVTKALWHGVLVVRLLLWMLSTRLGTLLICGTLSFGSRWPFLCKFSELSLEKRE  141

Query  442   EIVRSWSCCYIKI-LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPA  618
             E+++ WS    +I L+  +   K+    +FFS  +EN+ N +W AI Y            
Sbjct  142   EVLKKWSRARYQIHLRLMFAMFKIFCCFAFFSLTDENSTNPAWDAIGY------------  189

Query  619   GKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKL  798
                        H+   E   K ++            PL KG+I    E    +   L + 
Sbjct  190   -----------HVDTYESSHKTDKKR----------PLQKGIIETMNESDSTLVQSLTQK  228

Query  799   GFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARss  978
             GF V+   ++         IECD VVVGSG GGGV A VLA++G KV+VLEKG YFA   
Sbjct  229   GFKVTEDPKRN-----LHKIECDVVVVGSGCGGGVAASVLASSGQKVIVLEKGNYFAPED  283

Query  979   lsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETH  1158
              S +EG SL+++Y  GG++++ D  ++++AGS VGGGS +NWSASI+TP  VL+EW   H
Sbjct  284   YSSVEGPSLNQLYESGGMLSTFDGKVMIMAGSTVGGGSAVNWSASIKTPSSVLREWFVGH  343

Query  1159  KLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHY  1338
             K+ LFGS +Y  AM+ V  R GV      EG QN VL+KGC  LG  VE++PRN+S +HY
Sbjct  344   KIPLFGSSDYLSAMDVVFKRNGVTENCVKEGLQNQVLQKGCENLGLKVESVPRNSSENHY  403

Query  1339  CGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNK----KTGREQAAGVM  1506
             CG C FGC+ G K+GT  TWL D VD G  VI   C A + +  K    +T +++  GVM
Sbjct  404   CGSCGFGCRRGDKRGTDTTWLVDAVDHG-AVILTGCLAKRFMLEKNNHGRTKKKKCLGVM  462

Query  1507  F-VYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFP  1683
                Y  N  KE   ++++VT+ ACG+L TP L+ +SGL+NPNIG+NL LHPV  AWGYFP
Sbjct  463   ARAYSKNITKEL-QIEAKVTISACGSLLTPPLMISSGLKNPNIGKNLRLHPVTMAWGYFP  521

Query  1684  DAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGT  1863
             +     + P+ + K+++GGI+T++ KVV   E+S   A+I+TP+L P  F +++PW+SG 
Sbjct  522   E-----SMPKLKGKAFEGGIITSIHKVVT--EKSDVQAIIETPALGPAAFGSLVPWVSGL  574

Query  1864  DIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAG  2043
             D+K RM +++RTA LFAL RD+ SGE  S   I+Y   K+DK +LK GL++ LRIL AAG
Sbjct  575   DMKKRMVKYARTAHLFALIRDQGSGEVKSRGMITYEFSKSDKENLKAGLQQALRILIAAG  634

Query  2044  AEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLS-----TLIGSAHQMGSCRMG  2208
             A E+GT    G+ +K KG   ++++EF+E  ++   G LS     TL  SAHQMGSCRM 
Sbjct  635   AVEVGTHRNDGQRIKCKGIKEEDLEEFLETVTTAG-GFLSGEENWTLYSSAHQMGSCRMS  693

Query  2209  VDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHNH  2388
                +   V+  GE+WE EGL++ D SV P A+GVNPM+T+Q+IAYC ++ + K L     
Sbjct  694   STEKEGAVDENGESWEAEGLYVCDGSVLPNAVGVNPMITIQSIAYCLSKKIAKSLNKGKF  753

Query  2389  MQG  2397
              +G
Sbjct  754   SEG  756



>ref|XP_010934290.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Elaeis guineensis]
Length=755

 Score =   530 bits (1364),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 314/780 (40%), Positives = 463/780 (59%), Gaps = 62/780 (8%)
 Frame = +1

Query  85    RGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQ-HAAVDDD-----SVKLFFQTSAS  246
             R  +G Y  G   SP+ + ++ ++ + F+P++ + + H +   +     +++ F+  S S
Sbjct  18    RREEGGYRHG--FSPSQIQSLAAMCEAFIPSLSMEELHVSSGKEDPPTKNLQAFYLASGS  75

Query  247   IAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEIS  426
              +  P  VA ++ +R     V+L++L LWLL+T++GTL+LCG  SL  +FP++  F ++S
Sbjct  76    ESPVPDEVAELMVKRGLREAVLLVKLVLWLLATKLGTLVLCGSLSLCGEFPFINKFSDMS  135

Query  427   PHKRAEIVRSWSCCYIKI-LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDS  603
               KR E+++ W+   I I L+  ++ +KV  L  F+S  NEN+EN+SW AI Y    P  
Sbjct  136   VEKREEVLKRWNKENIFIPLRMVFVMVKVFCLHIFYSMTNENSENLSWNAIGY--SLPTE  193

Query  604   NKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFD  783
              K P  +S++                               PL KG+I    +    +  
Sbjct  194   EKPPKSQSER-------------------------------PLEKGIIETMDQNDSSLLH  222

Query  784   RLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKY  963
              L K G  VS    Q       + I CD  +VGSG GGGV A VLA+AGHKV+V+EKG Y
Sbjct  223   SLTKKGLAVSQDPIQN-----MYRIRCDVAIVGSGCGGGVAAAVLASAGHKVVVIEKGNY  277

Query  964   FARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKE  1143
             F     + +E  S+ EMY  GG++++ D  ++LLAGS VGGGS +NWSA I+TP +VLKE
Sbjct  278   FTSEDYTSIEAPSMYEMYESGGILSTLDGKMMLLAGSTVGGGSAVNWSACIKTPDYVLKE  337

Query  1144  WDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNA  1323
             W E H+L LF S +Y  +M+ VC R+GV      EGFQN VLRKGC  LG  V+++PRN+
Sbjct  338   WAEEHQLPLFRSTDYLSSMDAVCKRLGVTENCTQEGFQNEVLRKGCQNLGLKVDSVPRNS  397

Query  1324  SRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVK--VVHNKKTG--REQ  1491
             S  H+CG C +GC+ G K+GT  TWL D VD G  VI   C+A +   V N+  G  R++
Sbjct  398   SESHFCGSCCYGCRSGDKRGTDTTWLVDAVDCG-AVIVTGCKAERFLFVENEPGGKKRKK  456

Query  1492  AAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAW  1671
               G++    ++       ++++VTV ACG+L TP L+K SGL NPNIGRNLHLHP V AW
Sbjct  457   CVGLIAKSLSHKVTMKLEIEAKVTVSACGSLLTPPLMKASGLTNPNIGRNLHLHPAVLAW  516

Query  1672  GYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFE-ESGYGALIQTPSLHPGMFSAIMP  1848
             GYFPD+       +   K+++GGI+T++ +V A  + +S   A+I+TP++ P  F+ ++P
Sbjct  517   GYFPDSV-----SDLRGKTFEGGIITSLHEVRAREDSDSSLRAIIETPAVGPAAFATLVP  571

Query  1849  WLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRI  2028
             W+SG D+K RM R+SRTA LFAL RD+ +G       + Y     D+ +++ GL + LRI
Sbjct  572   WVSGLDMKERMARYSRTAHLFALVRDRGTGTVEGEGMVRYRFDALDRENMREGLRRALRI  631

Query  2029  LAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKES----SRDLGNLSTLIGSAHQMGS  2196
             L AAGA E+GT    G+ ++ KG    E++EF++  +     R    L T    AHQMGS
Sbjct  632   LVAAGAVEVGTHRSDGQRIQCKGIKEAELEEFLDGITMVGGPRSRNELWTFYCCAHQMGS  691

Query  2197  CRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             CRMGV      V+  GE+WE +GLF+ D SV P+A+G+NPM+T+Q+IAYC ++ + K L+
Sbjct  692   CRMGVSEEEGGVDETGESWEAQGLFVCDGSVLPSAVGINPMITIQSIAYCLSKGIAKSLR  751



>ref|XP_010684652.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Beta vulgaris subsp. 
vulgaris]
Length=750

 Score =   528 bits (1359),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 321/792 (41%), Positives = 463/792 (58%), Gaps = 68/792 (9%)
 Frame = +1

Query  61    LFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDD--------DS  216
             L   G      D  +  G   S + + T+T++ +T +P++    H +V          +S
Sbjct  6     LLRGGNKRSDKDNSFKHG--FSSSQIQTLTAMCETIIPSLP---HTSVTQQILSLHPQNS  60

Query  217   VKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQF  396
             +  FF  SAS    P  VA +I +R+    VIL+R+ L LLSTR+GTL+ CG   L  ++
Sbjct  61    ILSFFGNSASQPPIPDEVAEIIVKRVLPEAVILIRVVLKLLSTRLGTLLFCGCLCLEWKW  120

Query  397   PYLQSFPEISPHKRAEIVRSWSC-CYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKA  573
             P++  F E+S  KR ++++ WS   Y   L+  +L +K+     FF++ ++N EN +W+A
Sbjct  121   PFIHKFSEMSLEKREKLLQRWSTESYWTSLRVVFLLIKIACCFIFFTRTDDNAENPAWEA  180

Query  574   IDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINL  753
             I Y   + D             TRE  +  S+EQ+                P+ KG++  
Sbjct  181   IGY---NVD-------------TREPPVHSSQEQR----------------PIQKGIVEC  208

Query  754   NQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGH  933
                    V   L++ G  VS  + Q         ++CD V+VGSG GGGV A +LA+ GH
Sbjct  209   RMMNDSTVVQILEEKGLTVSEDVDQS-----VLKVQCDVVIVGSGCGGGVAAAILASHGH  263

Query  934   KVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSAS  1113
             KV++LEKG YFA    S LEG SL+E+YL GG++ + D  +++ +GS VGGGS +NWSA 
Sbjct  264   KVVILEKGNYFAPGDYSSLEGPSLNELYLSGGMLTTLDGKMIVFSGSTVGGGSAVNWSAC  323

Query  1114  IQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELG  1293
             I+TP  VL EW   HKL +FGS +Y+ AM  V  R+GV  +  +EGFQN VLRKGC  LG
Sbjct  324   IKTPDSVLNEWSVNHKLPIFGSPDYKSAMNEVWKRLGVTEDCSEEGFQNQVLRKGCEHLG  383

Query  1294  YPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVK-VVHN  1470
               VE +P N+S+DHYCG C +GC+ G KKGT  TWL D V++G  +I   C+A K ++  
Sbjct  384   LKVEKVPTNSSKDHYCGSCCYGCRMGDKKGTDTTWLVDAVNNG-AIILTGCKANKFILEE  442

Query  1471  KKTG--REQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNL  1644
              + G  R++  GV+    +    +   ++S+VT+ ACG+L TP LL +SGL+N NIG NL
Sbjct  443   TQNGEKRKRCHGVLATLLSKDVSKKLQIESKVTISACGSLSTPPLLISSGLQNSNIGTNL  502

Query  1645  HLHPVVFAWGYFPDA-PGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLH  1821
             HLHP + AWGYFP++ PG K       K Y+GGI+T++ KVV+  E+S   A+I+  +L 
Sbjct  503   HLHPTLLAWGYFPESTPGLKG------KCYEGGIITSLHKVVS--EKSNVHAIIEASALG  554

Query  1822  PGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLK  2001
             P  FS++MPW+SG D K R+ ++ RTA LF+L RDK+SGE      + Y +   DK +LK
Sbjct  555   PASFSSLMPWVSGLDFKERLVKYGRTASLFSLVRDKSSGEVKKEGRVRYRLNNHDKENLK  614

Query  2002  NGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTL  2169
              GL + LRIL AAGA E+GT    G+ L  KG   +E++EF++       +R      T+
Sbjct  615   MGLRQCLRILVAAGAVEVGTYRSDGQRLNCKGVKEEEMEEFLDSVIAPGGARSRTEHWTM  674

Query  2170  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  2349
              G AHQM SCRMG       V+  GETWE +GL++ D SV PTALGVNPM+T++++AYC 
Sbjct  675   YGCAHQMSSCRMGASKEDGAVDENGETWEAKGLYVCDGSVLPTALGVNPMITIESVAYCI  734

Query  2350  AQSVLKFLKTHN  2385
             +  +   L+  N
Sbjct  735   STRIASVLEEEN  746



>ref|XP_004134405.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Cucumis sativus]
Length=738

 Score =   527 bits (1357),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 320/764 (42%), Positives = 459/764 (60%), Gaps = 61/764 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
              S A M T+TSI DT LP +           + K F+Q S + +  P+ VA    +R   
Sbjct  23    FSTAEMDTLTSICDTLLPPLPF-NSPTTTTPAEKAFYQVSGAQSPIPEEVAETARKRGLI  81

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW--SCCYI  474
               V+L+R+ LW+L+TR+GTL+LCG      ++P++  F E+   KR E +R W  +  + 
Sbjct  82    EIVLLVRVVLWILATRLGTLLLCGSLCFCEKWPFVCKFSEMPLEKREEALRRWFKNKVFT  141

Query  475   KILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQH  654
              +     L +K++ L  FFS+V+ N +N SW+AI Y  P+ D                +H
Sbjct  142   PVRAALAL-IKLVFLYVFFSRVDVNGDNPSWEAIKYV-PEID----------------EH  183

Query  655   MTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKG  834
              + S + +                PL KG+I  N E        L + G  ++      G
Sbjct  184   PSKSSDAR----------------PLEKGIIEPNNETESSFKKSLLQKGIRIA------G  221

Query  835   SGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEM  1014
                 +  +ECD VVVGSG GGGV A +LA++G KV++LEKG YF  S  S LEG SL+++
Sbjct  222   DDGHTLSVECDVVVVGSGCGGGVAAAILASSGQKVMILEKGNYFIASDYSSLEGPSLEQL  281

Query  1015  YLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRH  1194
             Y  G + A+ D  +L+LAGS VGGGS +NWSASI+TP HVL+EW E+HK+  FG+ EY+ 
Sbjct  282   YEAGAIFATDDGKVLILAGSTVGGGSAVNWSASIKTPDHVLQEWAESHKIPFFGTSEYQV  341

Query  1195  AMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGK  1374
             AM+ VC R+GV  + E+EGFQN VLRKGC  LG  VE +PRN++  HYCG C +GC+ G+
Sbjct  342   AMDAVCKRIGVSEDCEEEGFQNQVLRKGCENLGLKVEKVPRNSTTGHYCGSCGYGCRKGE  401

Query  1375  KKGTSETWLADLVDSGNGVIFPECEAVKVV----HNKKTGREQAAGVMF-VYQNNGAKEF  1539
             K+GT  TWL D V+ G  VI   C+A + +     N    + +  GV+  V+ +N  K+ 
Sbjct  402   KQGTDSTWLVDAVNHG-AVIITNCKAERFILERNKNGSMKKSKCLGVIANVWSDNITKKL  460

Query  1540  CFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDA-PGSKAWPEP  1716
               +K++ T+ ACGAL TP L+ +SGLRN +IGRNLHLHPV+  WGYFP++  G K     
Sbjct  461   -HIKAKATISACGALLTPPLMISSGLRNKHIGRNLHLHPVLMTWGYFPESNSGFKG----  515

Query  1717  EKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSR  1896
               KSY+GGI+T++ KVV+   +S    +I+TP L PG  + ++PW+SG DIK RM ++SR
Sbjct  516   --KSYEGGIITSVHKVVSEESKSNPKTIIETPLLGPGSCAVLVPWVSGLDIKQRMLKYSR  573

Query  1897  TAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAG  2076
             TA    + RD  SG   S   +SYN+ + D+ +LK GL + LRIL AAGA E+GT    G
Sbjct  574   TAHFITIVRDSGSGAVRSEGRVSYNLSEEDRENLKKGLRQSLRILVAAGATEVGTHRSDG  633

Query  2077  KILKPKGASRDEIDEFVEKESSR-DLGNLS---TLIGSAHQMGSCRMGVDPRSSVVNPMG  2244
             + L+ KG  ++E++EF++  S+   L +LS    +  SAHQMGSC++GV      ++  G
Sbjct  634   QRLECKGIGKEELEEFLDSVSAEGGLLSLSKDWNVYTSAHQMGSCKIGVSETEGAIDQNG  693

Query  2245  ETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             E+WE EGLF+ D+SV PTA+GVNPM+T+Q+ AYC +  +   L+
Sbjct  694   ESWEAEGLFVCDASVLPTAVGVNPMITIQSTAYCISNRIAALLR  737



>ref|XP_009594479.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Nicotiana tomentosiformis]
Length=745

 Score =   526 bits (1356),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 305/760 (40%), Positives = 453/760 (60%), Gaps = 55/760 (7%)
 Frame = +1

Query  103   YSGGCPLSPAVMATVTSISDTFLPAVDV-PQHAA-VDDDSVKLFFQTSASIAGTPQRVAW  276
             YS G   S + + T+ S  +T +P +   PQH +  ++ ++  FF +SAS    P  VA 
Sbjct  19    YSHG--FSSSQIQTIASFCETLIPPLPYNPQHLSPCNNKALDSFFSSSASQPPFPNEVAE  76

Query  277   MISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRS  456
             ++ +R     ++++R+ ++LLSTR+G+L+LCG+  L  ++P++ +F E+S  +R  +++ 
Sbjct  77    LLVKRSNPEAMLIIRIVVFLLSTRLGSLVLCGRVCLDKRWPFVHNFSELSLKQRESLLQR  136

Query  457   WSC-CYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKK  633
             WS   ++  L+  +L +K M    FFS  +EN +N +W+AI Y    PD+ + P      
Sbjct  137   WSRESFLLPLRITFLLIKTMCFFIFFSWTDENCKNPAWEAIGY---QPDTRQTP------  187

Query  634   WITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVS  813
                       SE  K+               PL KG++    E    + + L K G P++
Sbjct  188   ----------SENHKER--------------PLEKGIVETINESDETLKESLSKKGVPLT  223

Query  814   PCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslslle  993
                  + + + +F I CD V+VGSG GGGV A +LA +GHKV+VLEKG YF     S LE
Sbjct  224   -----EDTKDNTFKIRCDVVIVGSGCGGGVAAAILAKSGHKVVVLEKGHYFVPEDYSGLE  278

Query  994   gsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELF  1173
             G SL+E+Y  G ++ + D  ++++AG+ VGGGS +NWSASI+TP  VL +W   HK+  F
Sbjct  279   GPSLNELYETGAMLTTDDGKVMVMAGTTVGGGSAVNWSASIRTPTDVLNDWSVKHKIPWF  338

Query  1174  GSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCS  1353
             G+ EY+ AM+ VC R+GV     +EG QN  +R+GC  LG  VE IPRN+S +HYCG C 
Sbjct  339   GTSEYQSAMDAVCKRIGVTENCANEGLQNQAIRRGCENLGLKVENIPRNSSENHYCGSCG  398

Query  1354  FGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQAAGVMFVYQNNGAK  1533
             +GCK G KKGT  TWL D V++G  VI P C A + +       +   GV+   ++    
Sbjct  399   YGCKTGDKKGTDTTWLVDAVNAG-AVILPGCTAERFILEDDMNEKICIGVIATTESKKIT  457

Query  1534  EFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPE  1713
             +   +++R T+ +CG+L TP LL +SGL+N NIG NLHLHPV+ AWGYFP+     +  E
Sbjct  458   KKLHIEARATISSCGSLLTPPLLISSGLKNKNIGTNLHLHPVLLAWGYFPE-----SMSE  512

Query  1714  PEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFS  1893
              + K+Y+GGIMTA+ K+V   EE+   A+I+  +L P  F+   PW SG D+K RM ++S
Sbjct  513   IKGKNYEGGIMTAVHKMVP--EETNAQAIIEATALGPASFACFFPWTSGQDMKERMTKYS  570

Query  1894  RTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRA  2073
             RTA L ALA+D+ SGE      I Y + + DK ++K G+ + LRIL AAGA E+GT    
Sbjct  571   RTANLLALAKDQGSGEVKKAGKIKYRLDEIDKENIKAGVRRALRILVAAGAAEVGTYRSD  630

Query  2074  GKILKPKGASRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPM  2241
             G+ +  KG + +E++EF++   +       G    + GSAHQMGSCRMG +     V+  
Sbjct  631   GQKISCKGITNEELEEFLDTVGATGGPSSKGEQWAIYGSAHQMGSCRMGANEEDGAVDEN  690

Query  2242  GETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSV  2361
             GE WE +GL++ D SV PTA+GVNPM+T+Q+ AYC A  +
Sbjct  691   GECWEAKGLYVCDGSVLPTAVGVNPMITIQSTAYCIANRI  730



>ref|XP_006489686.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Citrus 
sinensis]
Length=744

 Score =   526 bits (1354),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 319/782 (41%), Positives = 464/782 (59%), Gaps = 65/782 (8%)
 Frame = +1

Query  76    KAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDD---DSVKLFFQTSAS  246
             KAE+ N G       LS A + ++ S+ + FLP +        +D    +++ F++ S +
Sbjct  15    KAEKHNHG-------LSSAELLSLASLCEVFLPTLPSVSSEGKEDRPSQALESFYKASGA  67

Query  247   IAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEIS  426
              A  P +VA ++ +RL    VIL+R+ L +LST++GTLMLCG   LS ++PY+ +F  +S
Sbjct  68    QAPVPDKVAEIVVKRLLTEGVILIRVVLLMLSTKLGTLMLCGSLCLSEKWPYINNFSSMS  127

Query  427   PHKRAEIVRSWSCCYIKI-LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDS  603
               KR ++++ W   +I   ++  +  +K+  L  FFSQ++EN +N +W+AIDY       
Sbjct  128   LEKREKVLQKWFKNWIFTPVRIAFFILKIFCLFVFFSQLDENGKNPAWEAIDY-------  180

Query  604   NKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFD  783
                                      + +EDV  +  E    PL KG++    E    +  
Sbjct  181   -----------------------HAENDEDVSEVQQER---PLEKGIVETMYETGSTIVQ  214

Query  784   RLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKY  963
              L + G  V+     K S    + I+CD V+VGSG GGGV A VLA+AG KV+V+EKG Y
Sbjct  215   SLTQKGLQVT-----KDSKQNVYKIKCDVVIVGSGCGGGVAAAVLASAGQKVVVIEKGNY  269

Query  964   FARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKE  1143
             F     SLLEG S +++Y  GG++ + D  + +LAGS VGGGS +NWSA I+TP  +L+E
Sbjct  270   FTPKDYSLLEGPSFEQLYESGGILPTTDASMTILAGSTVGGGSAVNWSACIKTPKSLLQE  329

Query  1144  WDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNA  1323
             W   +KL LFGS +Y  AM+ V  R+GV      EGFQN VLRKGC  LG  VE IPRN+
Sbjct  330   WAGQYKLPLFGSPDYLSAMDIVWERIGVTENCVQEGFQNQVLRKGCKNLGLDVERIPRNS  389

Query  1324  SRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVV----HNKKTGREQ  1491
             S +HYCG C  GCK G KKGT  TWL D V+ G  VI   C+A + +     N  T   +
Sbjct  390   SENHYCGSCGHGCKSGDKKGTDSTWLVDAVNHG-AVILTGCKAERFILEKSDNGSTRTMK  448

Query  1492  AAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAW  1671
              +GV+    NN  +    ++++ T+ ACGAL TP L+ +SGL+N +IG+NLHLHPV+ AW
Sbjct  449   CSGVIAKALNNDIRMKFQIETKATISACGALLTPPLMISSGLKNQHIGKNLHLHPVLMAW  508

Query  1672  GYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPW  1851
             GYFPD+       E + K+Y+GGI+T+  KVV+   +S   ALI+TP   P  FS + PW
Sbjct  509   GYFPDSN-----LEFKGKNYEGGIITSAHKVVSG--DSEVRALIETPEFSPAKFSVLWPW  561

Query  1852  LSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRIL  2031
             LSG D K  M ++SRTA L  + RD+ SGE      IS+ + + DK +LK GL + LRIL
Sbjct  562   LSGIDFKQTMLKYSRTAHLITIIRDRGSGEVKVEGRISHKLDQLDKENLKAGLRQALRIL  621

Query  2032  AAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLST----LIGSAHQMGSC  2199
              AAGA E+GT    G+ LK +G +  E+++F++   + +    S     + G+AHQMGSC
Sbjct  622   LAAGAVEVGTHRSDGQRLKCEGITEKEVEQFLDTVYAAEGPKSSVENWMVYGTAHQMGSC  681

Query  2200  RMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKT  2379
             RMGV+ +   V+  G++WE EGL++ D+SVFP+A+GVNPM+T+Q+ AYC ++ + + L+ 
Sbjct  682   RMGVNDKEGAVDENGQSWEAEGLYVCDASVFPSAVGVNPMITIQSTAYCLSKRIAESLRE  741

Query  2380  HN  2385
              +
Sbjct  742   QS  743



>gb|KCW60303.1| hypothetical protein EUGRSUZ_H03017 [Eucalyptus grandis]
Length=781

 Score =   527 bits (1357),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 310/746 (42%), Positives = 450/746 (60%), Gaps = 60/746 (8%)
 Frame = +1

Query  205   DDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASL  384
             +D++V+ F+++S S A  PQ VA ++  R     VI++R+ L +LSTR+GTL+LCG   +
Sbjct  66    EDEAVRFFYESSGSQAPVPQEVAELLGRRGLLAAVIVVRVVLLVLSTRLGTLLLCGSLCV  125

Query  385   SSQFPYLQSFPEISPHKRAEIVRSW-SCCYIKILKTFYLGMKVMVLLSFFSQVNENNENI  561
               ++PY+ +F  +   +R +++R W    ++  +++ ++ +KVM L   FS+V+E  EN 
Sbjct  126   GGRWPYVNTFSSMGSDQREKVLRGWLKHRFLTPIRSAFVYLKVMCLYVLFSRVDEKGENP  185

Query  562   SWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKG  741
              WKAI Y                  +  EQ M+  ++ +                PL KG
Sbjct  186   LWKAIGY-----------------QVDEEQEMSKPDQGR----------------PLEKG  212

Query  742   VINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLA  921
             +I  N      +   L++ G  V+     + S N  + I+CDAV+VGSG GGGV A VLA
Sbjct  213   IIETNYSTDLGLLQSLKQKGLEVT-----QDSKNKIYRIKCDAVIVGSGCGGGVAAAVLA  267

Query  922   NAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTIN  1101
               G+KV+VLEKG Y+     S LEG S+D++Y  GG++ S   ++L+LAGS VGGGS +N
Sbjct  268   GCGYKVVVLEKGNYYTHKDYSSLEGPSMDQLYESGGILPSCTANVLILAGSTVGGGSAVN  327

Query  1102  WSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGC  1281
             WSASI+TP  VL++W E H +ELFGSKEY  AM+ VC R+GV     ++ FQN VL++GC
Sbjct  328   WSASIRTPHAVLQDWAEKHGMELFGSKEYASAMDIVCKRIGVTDRCVEQSFQNKVLQEGC  387

Query  1282  LELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKV  1461
              +LG  +  +PRN+S DHYCG C +GC+ G K+GT  TWL D V+ G  VI   C+A ++
Sbjct  388   EKLGLEINAVPRNSSEDHYCGSCGYGCRRGDKQGTDYTWLVDAVNCG-AVILSGCKAEQL  446

Query  1462  VHNK----KTGREQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPN  1629
             V  K    +  R++  GV     N+  +     +++VTV ACGAL TP LL +SGL+N +
Sbjct  447   VFEKNAPGRARRKKCTGVRAKSMNSDIENVLQFEAKVTVSACGALLTPPLLISSGLKNKH  506

Query  1630  IGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQT  1809
             IGRNLHLHPV  AWG+FP    S+        SYQGGI+T + KVV         A+I+T
Sbjct  507   IGRNLHLHPVAMAWGHFPQDSSSQL----SGTSYQGGIITLIHKVVEGNSNPNVQAIIET  562

Query  1810  PSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDK  1989
             P L P  F+ + PW SG DIK R+ +++RTA L  + RD+  GE      I+Y M   DK
Sbjct  563   PLLGPATFTVLCPWESGLDIKDRLAKYARTAHLLTIVRDRGHGEVTREGIINYKMDSVDK  622

Query  1990  VSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKG--ASRDEIDEFVEKESSRDLGNLS  2163
              +++ GL + LRIL AAGA+E+GT    G  +K +G  AS  +++EF+++ S+ D G L+
Sbjct  623   ENIRAGLRQSLRILIAAGADEVGTHRSDGLRMKCRGGTASEYQVEEFLDRVSAED-GPLA  681

Query  2164  -----TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTV  2328
                  T   SAHQMGSCRMG++ +   V+  GE+WE EGLF+ D+SV PTA+GVNPM+T+
Sbjct  682   MDEKWTFYTSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPTAVGVNPMITI  741

Query  2329  QAIAYCTAQSVLKFLKTHNHMQGYIK  2406
             ++ AYC A  + ++L      QG +K
Sbjct  742   ESTAYCIANRIAEYLSK----QGLLK  763



>ref|XP_010036770.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Eucalyptus grandis]
 gb|KCW48412.1| hypothetical protein EUGRSUZ_K02114 [Eucalyptus grandis]
Length=748

 Score =   526 bits (1354),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 311/770 (40%), Positives = 458/770 (59%), Gaps = 65/770 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQ---HAAVDDDSVKLFFQTSASIAGTPQRVAWMISER  291
              SPA +  + +I +T +P+V +         DD ++  F+  S S    P  VA ++++R
Sbjct  22    FSPAQIQALAAICETLIPSVSLDSINPKIPHDDPALHGFYSASGSQPSVPDEVAEILTKR  81

Query  292   LQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS-CC  468
              Q   V+++ + L +LS R+GTL+LC  + L+S +P++ +F E+   +R  ++ +WS   
Sbjct  82    AQRQVVVMVSIVLKMLSFRLGTLVLCWGSCLASTWPFILNFSEMPVERRERVLMNWSRQK  141

Query  469   YIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITRE  648
             ++  L+  ++ +K+  L  F+++ +EN+ N++W+AI Y     D  +KP           
Sbjct  142   FVVPLRVVFMMIKIYCLFIFYTRTDENSNNLAWEAIGY---RVDKRQKP-----------  187

Query  649   QHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQ  828
                  +E   K E             PL +G++    E    +   L + G  V+   Q 
Sbjct  188   -----NESHNKQER------------PLQRGLVETVHETDSSLIQSLTQKGLKVTQIPQH  230

Query  829   KGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslD  1008
                   +F I+CD V++GSG GGGV A VLA++G KV+VLEKG YF     S LEG SLD
Sbjct  231   N-----AFKIKCDVVIIGSGCGGGVAAAVLAHSGQKVVVLEKGNYFVPQDYSSLEGPSLD  285

Query  1009  EMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEY  1188
             ++Y    L+++ D  I++LAGS VGGGS +NWSA I+TP HVLKEW   HK+ LFG+ +Y
Sbjct  286   QLYESSALLSTVDGKIVVLAGSTVGGGSAVNWSACIRTPSHVLKEWSVDHKIRLFGTPDY  345

Query  1189  RHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKD  1368
               AM+ VC ++GV  + E EGFQN +LRKGC  LG  VE + RN+S  H+CG C +GC+ 
Sbjct  346   GSAMDAVCKKIGVTQKCEQEGFQNQILRKGCESLGLKVEAVARNSSEGHFCGSCCYGCRT  405

Query  1369  GKKKGTSETWLADLVDSGNGVIFPECEAVKVV-----HNKKTGREQAAGVMFVYQNNGAK  1533
             G KKGT  TWL D V++G  VI   C+A K++     H +K  +        V   +  K
Sbjct  406   GDKKGTDSTWLVDAVENG-AVILTGCKAKKLILENTPHGEKPKKCLGVIASSVLNKDVTK  464

Query  1534  EFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPE  1713
             E   ++++VT+ AC A+ TP LL +SGL+NPNIGRNLHLHP  FAWGYFP+         
Sbjct  465   EL-HIEAKVTIAACSAVSTPPLLISSGLKNPNIGRNLHLHPCAFAWGYFPE-----NLTG  518

Query  1714  PEKKSYQGGIMTAMSKVVANFEESG--YGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQR  1887
              + K Y+GGI+T++++VV    E+G    A+I+TPSL PG+FSA+ PW SG ++K RM++
Sbjct  519   IQGKVYEGGIITSLNRVVL---ETGAPVPAIIETPSLGPGLFSALCPWTSGANMKERMRK  575

Query  1888  FSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCH  2067
             +SRTA LF L RDK SGE      I YN+ + DK  +K GL + LRIL AAGAEE+GT  
Sbjct  576   YSRTAHLFTLVRDKGSGEVREEGKIVYNLSEFDKEHMKIGLRQALRILIAAGAEEVGTHR  635

Query  2068  RAGKILKPKGASRDEIDEFVEK------ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSV  2229
               G+ +K +G   ++I+EF+         +SR+   L  L   AH MGSCR+G   R   
Sbjct  636   SDGQRMKCQGTKEEDIEEFLNDIVISGGPTSRE--ELWNLYCCAHPMGSCRIGASERDGA  693

Query  2230  VNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKT  2379
             V+  GE+WE +GLF+ D S+ PTA+GVNPM+T+++ AYC A+ + + L +
Sbjct  694   VDESGESWEAKGLFVCDGSLMPTAIGVNPMITIESTAYCIAKKIAESLSS  743



>ref|XP_010023906.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Eucalyptus grandis]
 gb|KCW60304.1| hypothetical protein EUGRSUZ_H03017 [Eucalyptus grandis]
Length=776

 Score =   526 bits (1356),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 310/746 (42%), Positives = 450/746 (60%), Gaps = 60/746 (8%)
 Frame = +1

Query  205   DDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASL  384
             +D++V+ F+++S S A  PQ VA ++  R     VI++R+ L +LSTR+GTL+LCG   +
Sbjct  66    EDEAVRFFYESSGSQAPVPQEVAELLGRRGLLAAVIVVRVVLLVLSTRLGTLLLCGSLCV  125

Query  385   SSQFPYLQSFPEISPHKRAEIVRSW-SCCYIKILKTFYLGMKVMVLLSFFSQVNENNENI  561
               ++PY+ +F  +   +R +++R W    ++  +++ ++ +KVM L   FS+V+E  EN 
Sbjct  126   GGRWPYVNTFSSMGSDQREKVLRGWLKHRFLTPIRSAFVYLKVMCLYVLFSRVDEKGENP  185

Query  562   SWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKG  741
              WKAI Y                  +  EQ M+  ++ +                PL KG
Sbjct  186   LWKAIGY-----------------QVDEEQEMSKPDQGR----------------PLEKG  212

Query  742   VINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLA  921
             +I  N      +   L++ G  V+     + S N  + I+CDAV+VGSG GGGV A VLA
Sbjct  213   IIETNYSTDLGLLQSLKQKGLEVT-----QDSKNKIYRIKCDAVIVGSGCGGGVAAAVLA  267

Query  922   NAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTIN  1101
               G+KV+VLEKG Y+     S LEG S+D++Y  GG++ S   ++L+LAGS VGGGS +N
Sbjct  268   GCGYKVVVLEKGNYYTHKDYSSLEGPSMDQLYESGGILPSCTANVLILAGSTVGGGSAVN  327

Query  1102  WSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGC  1281
             WSASI+TP  VL++W E H +ELFGSKEY  AM+ VC R+GV     ++ FQN VL++GC
Sbjct  328   WSASIRTPHAVLQDWAEKHGMELFGSKEYASAMDIVCKRIGVTDRCVEQSFQNKVLQEGC  387

Query  1282  LELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKV  1461
              +LG  +  +PRN+S DHYCG C +GC+ G K+GT  TWL D V+ G  VI   C+A ++
Sbjct  388   EKLGLEINAVPRNSSEDHYCGSCGYGCRRGDKQGTDYTWLVDAVNCG-AVILSGCKAEQL  446

Query  1462  VHNK----KTGREQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPN  1629
             V  K    +  R++  GV     N+  +     +++VTV ACGAL TP LL +SGL+N +
Sbjct  447   VFEKNAPGRARRKKCTGVRAKSMNSDIENVLQFEAKVTVSACGALLTPPLLISSGLKNKH  506

Query  1630  IGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQT  1809
             IGRNLHLHPV  AWG+FP    S+        SYQGGI+T + KVV         A+I+T
Sbjct  507   IGRNLHLHPVAMAWGHFPQDSSSQL----SGTSYQGGIITLIHKVVEGNSNPNVQAIIET  562

Query  1810  PSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDK  1989
             P L P  F+ + PW SG DIK R+ +++RTA L  + RD+  GE      I+Y M   DK
Sbjct  563   PLLGPATFTVLCPWESGLDIKDRLAKYARTAHLLTIVRDRGHGEVTREGIINYKMDSVDK  622

Query  1990  VSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKG--ASRDEIDEFVEKESSRDLGNLS  2163
              +++ GL + LRIL AAGA+E+GT    G  +K +G  AS  +++EF+++ S+ D G L+
Sbjct  623   ENIRAGLRQSLRILIAAGADEVGTHRSDGLRMKCRGGTASEYQVEEFLDRVSAED-GPLA  681

Query  2164  -----TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTV  2328
                  T   SAHQMGSCRMG++ +   V+  GE+WE EGLF+ D+SV PTA+GVNPM+T+
Sbjct  682   MDEKWTFYTSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPTAVGVNPMITI  741

Query  2329  QAIAYCTAQSVLKFLKTHNHMQGYIK  2406
             ++ AYC A  + ++L      QG +K
Sbjct  742   ESTAYCIANRIAEYLSK----QGLLK  763



>ref|XP_010264984.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Nelumbo nucifera]
Length=750

 Score =   525 bits (1352),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 321/783 (41%), Positives = 464/783 (59%), Gaps = 66/783 (8%)
 Frame = +1

Query  73    GKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVD-----DDSVKLFFQT  237
             G  ++GN   YS G   S   M  +++I + F+P++      A       + SV+ F+  
Sbjct  11    GGRKKGN---YSHG--FSYYQMEALSAICEAFIPSIPFDPLRATGGEGSPNKSVQSFYLV  65

Query  238   SASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFP  417
             S S    P  VA ++  R     V +++  LW+LSTR+GT +LCG  +    +P+L  F 
Sbjct  66    SGSQKPIPDEVAELLVSRSLWHAVFMVKFLLWMLSTRLGTSLLCGVLTFGCGWPFLYKFS  125

Query  418   EISPHKRAEIVRSWSCC-YIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPD  594
             E+   KR +I++ WS   Y + L+ F++ +KV  +L+FFS  NEN+EN +W AI Y    
Sbjct  126   ELPLEKREQILQKWSGARYHRHLRMFFMLLKVFCMLTFFSMTNENSENPAWDAIGY---H  182

Query  595   PDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQ  774
              D+ ++               +   E+K+               PL KG+I    E    
Sbjct  183   VDTERR---------------SYKTERKR---------------PLEKGIIETVSESDST  212

Query  775   VFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEK  954
             +   L   GF V+     +G       IECD ++VGSG GGGV A VLA++G KV+VLEK
Sbjct  213   LVQSLTIKGFKVT-----RGPRWNLHKIECDVIIVGSGCGGGVAAAVLASSGQKVIVLEK  267

Query  955   GKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHV  1134
             G YF     S LEG S  ++Y  GG++ S D  I+++AGS VGGGS +NWSA I+TP  V
Sbjct  268   GNYFVPEDYSSLEGPSFSQLYESGGILPSLDGKIMMMAGSTVGGGSAVNWSACIKTPSSV  327

Query  1135  LKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIP  1314
             L+EW   HK+ LFGS +Y  AM+TVC R GV     +EGFQN VLR+GC  LG  ++ +P
Sbjct  328   LREWHMDHKIPLFGSSDYLSAMDTVCERNGVTDTCLEEGFQNQVLRRGCENLGLKIDPVP  387

Query  1315  RNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVK-VVHNKKTGREQ  1491
             RN+S +HYCG C FGC+ G K+GT  TWL D V+ G  VI   C+A + ++   K G  +
Sbjct  388   RNSSENHYCGSCGFGCRRGDKQGTDSTWLVDAVNHG-AVILTGCKAKRFILKRNKFGSAK  446

Query  1492  A---AGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVV  1662
                  GV+    +   +    ++++VT+ ACG+L TP L+ +SGLRNPNIG+NLHLHPV+
Sbjct  447   TMKCVGVIARTFSRNIRNKLQIEAKVTISACGSLLTPPLMISSGLRNPNIGKNLHLHPVM  506

Query  1663  FAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAI  1842
              AWGYFPD     +  E + K+Y+GGI+T++ KVV   +      +I+TP+L PG F+A+
Sbjct  507   MAWGYFPD-----SMKEFKGKTYEGGIITSLHKVVTE-KSDDVCTIIETPALGPGSFAAL  560

Query  1843  MPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVL  2022
              PW+SG D+K  M +++RTA LFAL RD+ SGE      I+Y + + DK +LK GL + L
Sbjct  561   FPWVSGLDMKECMVKYARTAHLFALVRDQGSGEVKIQGRITYRLSELDKENLKAGLRRAL  620

Query  2023  RILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLS-----TLIGSAHQ  2187
             RIL AAGA E+GT    G+ +K +G   ++++EF++  S+ + G +S     T+  SAHQ
Sbjct  621   RILIAAGAVEVGTHRSDGQRIKCRGIKEEDLEEFLDTVSAVE-GPMSREEHWTIYASAHQ  679

Query  2188  MGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLK  2367
             MGSCRM    +   V+  GE+WE EGL++ D SVFP ALGVNPM+T+Q+IAYC ++ + +
Sbjct  680   MGSCRMSAKEKDGAVDENGESWEAEGLYVCDGSVFPNALGVNPMITIQSIAYCLSKKIAE  739

Query  2368  FLK  2376
              L+
Sbjct  740   SLE  742



>ref|XP_006489687.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X2 [Citrus 
sinensis]
Length=744

 Score =   524 bits (1350),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 319/782 (41%), Positives = 463/782 (59%), Gaps = 65/782 (8%)
 Frame = +1

Query  76    KAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDD---DSVKLFFQTSAS  246
             KAE+ N G       LS A +  + S+ + FLP +        +D    +++ F++ S +
Sbjct  15    KAEKYNHG-------LSSAELLALASLCEVFLPPLPSVSLEGKEDRPGQALESFYKASGA  67

Query  247   IAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEIS  426
              A  P +VA ++ +RL    VIL+R+ L +LST++GTLMLCG   LS ++PY+ +F  +S
Sbjct  68    QAPVPDKVAEIVVKRLLTEGVILIRVVLLMLSTKLGTLMLCGSLCLSEKWPYINNFSSMS  127

Query  427   PHKRAEIVRSWSCCYIKI-LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDS  603
               KR ++++ W   +I   ++  +  +K+  L  FFSQ++EN +N +W+AIDY       
Sbjct  128   LEKREKVLQKWFKNWIFTPVRIAFFILKIFCLFVFFSQLDENGKNPAWEAIDY-------  180

Query  604   NKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFD  783
                                      + +EDV  +  E    PL KG++    E    +  
Sbjct  181   -----------------------HAENDEDVSEVQQER---PLEKGIVETMYETGSTIVQ  214

Query  784   RLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKY  963
              L + G  V+     K S    + I+CD V+VGSG GGGV A VLA+AG KV+V+EKG Y
Sbjct  215   SLTQKGLQVT-----KDSKQNVYKIKCDVVIVGSGCGGGVAAAVLASAGQKVVVIEKGNY  269

Query  964   FARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKE  1143
             F     SLLEG S +++Y  GG++ + D  + +LAGS VGGGS +NWSA I+TP  +L+E
Sbjct  270   FTPKDYSLLEGPSFEQLYESGGILPTTDASMTILAGSTVGGGSAVNWSACIKTPKSLLQE  329

Query  1144  WDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNA  1323
             W   +KL LFGS +Y  AM+ V  R+GV      EGFQN VLRKGC  LG  VE IPRN+
Sbjct  330   WAGQYKLPLFGSPDYLSAMDIVWERIGVTENCVQEGFQNQVLRKGCKNLGLDVERIPRNS  389

Query  1324  SRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVV----HNKKTGREQ  1491
             S +HYCG C  GCK G KKGT  TWL D V+ G  VI   C+A + +     N  T   +
Sbjct  390   SENHYCGSCGHGCKSGDKKGTDSTWLVDAVNHG-AVILTGCKAERFILEKSDNGSTRTMK  448

Query  1492  AAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAW  1671
              +GV+    NN  +    ++++ T+ ACGAL TP L+ +SGL+N +IG+NLHLHPV+ AW
Sbjct  449   CSGVIAKALNNDIRMKFQIETKATISACGALLTPPLMISSGLKNQHIGKNLHLHPVLMAW  508

Query  1672  GYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPW  1851
             GYFPD+       E + K+Y+GGI+T+  KVV+   +S   ALI+TP   P  FS + PW
Sbjct  509   GYFPDSN-----LEFKGKNYEGGIITSAHKVVSG--DSEVRALIETPEFSPAKFSVLWPW  561

Query  1852  LSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRIL  2031
             LSG D K  M ++SRTA L  + RD+ SGE      IS+ + + DK +LK GL + LRIL
Sbjct  562   LSGIDFKQTMLKYSRTAHLITIIRDRGSGEVKVEGRISHKLDQLDKENLKAGLRQALRIL  621

Query  2032  AAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLST----LIGSAHQMGSC  2199
              AAGA E+GT    G+ LK +G +  E+++F++   + +    S     + G+AHQMGSC
Sbjct  622   LAAGAVEVGTHRSDGQRLKCEGITEKEVEQFLDTVYAAEGPKSSVENWMVYGTAHQMGSC  681

Query  2200  RMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKT  2379
             RMGV+ +   V+  G++WE EGL++ D+SVFP+A+GVNPM+T+Q+ AYC ++ + + L+ 
Sbjct  682   RMGVNDKEGAVDENGQSWEAEGLYVCDASVFPSAVGVNPMITIQSTAYCLSKRIAESLRE  741

Query  2380  HN  2385
              +
Sbjct  742   QS  743



>ref|XP_010262396.1| PREDICTED: long-chain-alcohol oxidase FAO2-like isoform X1 [Nelumbo 
nucifera]
Length=763

 Score =   524 bits (1350),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 329/790 (42%), Positives = 468/790 (59%), Gaps = 74/790 (9%)
 Frame = +1

Query  97    GVYSGGCPLSPAVMATVTSISDTFLP-----AVDVPQHAAVDDDSVKLFFQTSASIAGTP  261
             G YS G  LS   M  VT+I +  +P     ++ V    +    S++ F+  S S    P
Sbjct  24    GSYSHGFSLSE--MQVVTAICEALIPPIPLGSLHVNGKESPPSKSIQSFYLASGSQKPIP  81

Query  262   QRVA-------WMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPE  420
               V         ++++ L H  V+++RL LW+LSTR+GTL++CG  S  S++P+L  F E
Sbjct  82    DEVTVVELVAELIVTKALWH-GVLVVRLLLWMLSTRLGTLLICGTLSFGSRWPFLCKFSE  140

Query  421   ISPHKRAEIVRSWSCCYIKI-LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDP  597
             +S  KR E+++ WS    +I L+  +   K+    +FFS  +EN+ N +W AI Y     
Sbjct  141   LSLEKREEVLKKWSRARYQIHLRLMFAMFKIFCCFAFFSLTDENSTNPAWDAIGY-----  195

Query  598   DSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQV  777
                               H+   E   K ++            PL KG+I    E    +
Sbjct  196   ------------------HVDTYESSHKTDKKR----------PLQKGIIETMNESDSTL  227

Query  778   FDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKG  957
                L + GF V+   ++         IECD VVVGSG GGGV A VLA++G KV+VLEKG
Sbjct  228   VQSLTQKGFKVTEDPKRN-----LHKIECDVVVVGSGCGGGVAASVLASSGQKVIVLEKG  282

Query  958   KYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVL  1137
              YFA    S +EG SL+++Y  GG++++ D  ++++AGS VGGGS +NWSASI+TP  VL
Sbjct  283   NYFAPEDYSSVEGPSLNQLYESGGMLSTFDGKVMIMAGSTVGGGSAVNWSASIKTPSSVL  342

Query  1138  KEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPR  1317
             +EW   HK+ LFGS +Y  AM+ V  R GV      EG QN VL+KGC  LG  VE++PR
Sbjct  343   REWFVGHKIPLFGSSDYLSAMDVVFKRNGVTENCVKEGLQNQVLQKGCENLGLKVESVPR  402

Query  1318  NASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNK----KTGR  1485
             N+S +HYCG C FGC+ G K+GT  TWL D VD G  VI   C A + +  K    +T +
Sbjct  403   NSSENHYCGSCGFGCRRGDKRGTDTTWLVDAVDHG-AVILTGCLAKRFMLEKNNHGRTKK  461

Query  1486  EQAAGVMF-VYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVV  1662
             ++  GVM   Y  N  KE   ++++VT+ ACG+L TP L+ +SGL+NPNIG+NL LHPV 
Sbjct  462   KKCLGVMARAYSKNITKEL-QIEAKVTISACGSLLTPPLMISSGLKNPNIGKNLRLHPVT  520

Query  1663  FAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAI  1842
              AWGYFP+     + P+ + K+++GGI+T++ KVV   E+S   A+I+TP+L P  F ++
Sbjct  521   MAWGYFPE-----SMPKLKGKAFEGGIITSIHKVVT--EKSDVQAIIETPALGPAAFGSL  573

Query  1843  MPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVL  2022
             +PW+SG D+K RM +++RTA LFAL RD+ SGE  S   I+Y   K+DK +LK GL++ L
Sbjct  574   VPWVSGLDMKKRMVKYARTAHLFALIRDQGSGEVKSRGMITYEFSKSDKENLKAGLQQAL  633

Query  2023  RILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLS-----TLIGSAHQ  2187
             RIL AAGA E+GT    G+ +K KG   ++++EF+E  ++   G LS     TL  SAHQ
Sbjct  634   RILIAAGAVEVGTHRNDGQRIKCKGIKEEDLEEFLETVTTAG-GFLSGEENWTLYSSAHQ  692

Query  2188  MGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLK  2367
             MGSCRM    +   V+  GE+WE EGL++ D SV P A+GVNPM+T+Q+IAYC ++ + K
Sbjct  693   MGSCRMSSTEKEGAVDENGESWEAEGLYVCDGSVLPNAVGVNPMITIQSIAYCLSKKIAK  752

Query  2368  FLKTHNHMQG  2397
              L      +G
Sbjct  753   SLNKGKFSEG  762



>ref|XP_009790215.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Nicotiana sylvestris]
Length=742

 Score =   523 bits (1348),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 316/769 (41%), Positives = 456/769 (59%), Gaps = 61/769 (8%)
 Frame = +1

Query  103   YSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDS--VKLFFQTSASIAGTPQRVAW  276
             YS G   S + M T+TSI +T LP +  PQ+   + +S  ++   + SAS    P   A 
Sbjct  18    YSHG--FSSSEMETLTSICETILPPL--PQNEIPEKNSHNIQYLHKASASQYPIPDECAE  73

Query  277   MISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRS  456
             ++ +R     +IL+R  L +LSTRIGTL+LCG      ++PY+  F +I   KR  +++ 
Sbjct  74    VVMKRGFLEAIILVRGLLRILSTRIGTLLLCGSFCFVQKWPYINKFCDIPLEKREIVLQK  133

Query  457   W-SCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKK  633
             W    ++  ++  ++ +K + L  FF+QV E+++N +W  I Y                +
Sbjct  134   WFKNRFLTPVRLAFMFIKFLCLYIFFTQVGEDSKNQAWDDIGY----------------Q  177

Query  634   WITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVS  813
                 E+H   +EE+                 PL KG++    E    +   L + G  V 
Sbjct  178   VDNEEKHSETAEER-----------------PLEKGIVEAIYETESTIVKSLVQKGLKVI  220

Query  814   PCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslslle  993
                    + N  + ++CD V+VGSG GGGV A VLA++GHKV+VLEKG Y+ +S  S LE
Sbjct  221   -----DDTKNNMYKVQCDVVIVGSGCGGGVAASVLASSGHKVIVLEKGNYYTKSDYSSLE  275

Query  994   gsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELF  1173
             G S+++MY  GG++++ D  I+++AGS VGGGS INWSA I+TP  V++EW +  +L +F
Sbjct  276   GPSMNQMYESGGILSTLDAKIMIMAGSTVGGGSAINWSACIKTPDCVIQEWGDDKRLPIF  335

Query  1174  GSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCS  1353
              S EY  AM+ VC R+GV      EG QN +LRKGC  LG  VE + RN S +HYCG C 
Sbjct  336   QSPEYVSAMDKVCERIGVTENCTQEGLQNQILRKGCENLGLEVEGVARNTSENHYCGSCC  395

Query  1354  FGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNK----KTGREQAAGVMFVYQN  1521
             +GC+ G+KKGT  TWL D VDSG  VI   C+A + +  K    KT  ++  GV+    N
Sbjct  396   YGCRRGEKKGTDTTWLVDAVDSG-AVIITGCKAERFILEKNKYGKTRDKKCLGVIATSTN  454

Query  1522  NGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSK  1701
                 +   ++++VT+ ACG+L TP L+ +SGLRNPNIGRNLHLHPV+ AWGYFP++    
Sbjct  455   KDITKRICIEAKVTISACGSLLTPPLMISSGLRNPNIGRNLHLHPVIMAWGYFPESD---  511

Query  1702  AWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRM  1881
                + + K Y+GGI+T++ KV +   +S   A+I+  +L PG F+A+ PW SG D+K R+
Sbjct  512   --SDLKGKIYEGGIITSVHKVGSY--DSNVRAIIEATALGPGSFAALCPWTSGEDLKNRL  567

Query  1882  QRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGT  2061
              ++SRTA LFA+ +D  SGE  S   ISY    TDK SLK GL++ LRIL AAGA+E+GT
Sbjct  568   LKYSRTAHLFAMVKDVGSGEVRSDGRISYTFNATDKESLKQGLKQALRILIAAGADEVGT  627

Query  2062  CHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSV  2229
                 G+ +K KG S  EI+ F+      E  + L    T   SAHQMGSCRMG+  +   
Sbjct  628   QRSDGQRMKCKGKSEKEIEAFLNTVTAAEGPKSLVKNFTTYSSAHQMGSCRMGMSEKDGA  687

Query  2230  VNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             V+  GE+WE  GLF+ D+SV P A+GVNPM+T+Q+ AYC ++ + + +K
Sbjct  688   VDENGESWEANGLFVCDASVLPGAVGVNPMITIQSTAYCLSKKIAEMIK  736



>ref|XP_010069617.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Eucalyptus grandis]
 gb|KCW58025.1| hypothetical protein EUGRSUZ_H00753 [Eucalyptus grandis]
Length=746

 Score =   522 bits (1344),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 326/791 (41%), Positives = 475/791 (60%), Gaps = 71/791 (9%)
 Frame = +1

Query  49    DGDSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDS----  216
             DG  L S    E G    +S G   S   + ++ ++ +T LP +  P   ++D+DS    
Sbjct  4     DGHPLLSRVGREAG----FSHG--FSADQIQSLAAMCETLLPPLS-PD--SIDEDSPRNE  54

Query  217   -VKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQ  393
              V  FF+ S S    P  +A  +++R Q   ++++ L L +LS R+GTL+LCG   L  +
Sbjct  55    AVYSFFRASGSQHPIPDEIAERLAKRGQRSALLVVSLVLKILSYRLGTLLLCGFLCLDWR  114

Query  394   FPYLQSFPEISPHKRAEIVRSWSCCYIKI-LKTFYLGMKVMVLLSFFSQVNENNENISWK  570
             +P+++ F E+   +R  ++  WS     I LK  +  +K+  L  FFS+ +EN++N SW+
Sbjct  115   WPFIRKFHEMPLERREIVLNRWSRQKKLIPLKVAFAMVKLFCLFHFFSRTDENSKNPSWE  174

Query  571   AIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVIN  750
             AI Y   + D+ +KP  KSK    RE+                         PL KG I 
Sbjct  175   AIGY---EVDTQEKPV-KSK----RER-------------------------PLEKGTIE  201

Query  751   LNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAG  930
                E    +   L   G  VS C     S   S  I+CDAV++GSG GGGV A VLA +G
Sbjct  202   TMYESGSSLVQSLTGKGLKVSEC-----SKTNSCNIKCDAVIIGSGCGGGVAAAVLAQSG  256

Query  931   HKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSA  1110
              KV+VLEKG YF     S LE  S+++MY  GGL+++ D   +++AGS VGGGS +NWSA
Sbjct  257   QKVVVLEKGDYFTPQDYSSLEAPSMNQMYESGGLLSTVDGKFMIMAGSTVGGGSAVNWSA  316

Query  1111  SIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLEL  1290
             SI+TP  VL EW   HK+ LFGS EY  AM+ VC R+GV     +EGFQN +LRKGC  L
Sbjct  317   SIKTPSSVLHEWSVDHKIPLFGSPEYLSAMDAVCKRIGVTENCSEEGFQNQILRKGCSNL  376

Query  1291  GYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVV--  1464
             G  VET+PRN+  +HYCGWC +GC+ G+K+GT  TWL D V+ G  VI   C+A K++  
Sbjct  377   GLHVETVPRNSPENHYCGWCCYGCRMGEKRGTDRTWLVDAVEHG-AVILTGCKADKLILE  435

Query  1465  --HNKKTGREQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGR  1638
                ++K G  + +GV     +    +   ++++VT+ ACG+L TP LL +SGL+NPNIGR
Sbjct  436   TGDDEKVG-HRCSGVTATVSSRDFFKKLRIEAKVTISACGSLLTPPLLISSGLKNPNIGR  494

Query  1639  NLHLHPVVFAWGYFPD-APGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPS  1815
             NL LHPV+  WGYFP+ + G +       +SY GGI+T++ KVV+  + S   A+I+TP+
Sbjct  495   NLRLHPVLLVWGYFPENSTGYRG------RSYDGGIITSVHKVVSE-DSSEVQAIIETPA  547

Query  1816  LHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVS  1995
             L PG F+++ PW+SG ++K  M ++SRTA LFAL RD+ SG       I+Y + + DK +
Sbjct  548   LGPGSFASLFPWVSGAEVKNSMVKYSRTAHLFALVRDQGSGVVKEEGVITYRLSQEDKEN  607

Query  1996  LKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESS-RDLGNLS---  2163
             LK GL + LRIL AAGA E+GT    G+ +K +GA +++I+EF++  ++   LG+     
Sbjct  608   LKLGLRQALRILIAAGAVEVGTYRSDGQRIKCRGAKQEDIEEFLDSITTPGGLGSRQEHW  667

Query  2164  TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAY  2343
             T+  SAHQMGSCRMG +  +  V+  GE+WE +GLF+ D S+ P+A+GVNPM+T+Q+ AY
Sbjct  668   TMYCSAHQMGSCRMGANEGAGAVDENGESWEAKGLFVCDGSMLPSAVGVNPMITIQSTAY  727

Query  2344  CTAQSVLKFLK  2376
             C ++ + + L+
Sbjct  728   CISKRIAESLR  738



>ref|XP_006420282.1| hypothetical protein CICLE_v10004403mg [Citrus clementina]
 gb|ESR33522.1| hypothetical protein CICLE_v10004403mg [Citrus clementina]
Length=744

 Score =   521 bits (1342),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 318/782 (41%), Positives = 462/782 (59%), Gaps = 65/782 (8%)
 Frame = +1

Query  76    KAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDD---DSVKLFFQTSAS  246
             KAE+ N G       LS A + ++ S+ + FLP +        +D    +++ F++ S +
Sbjct  15    KAEKHNHG-------LSSAELLSLASLCEVFLPTLSSVSSEGKEDRPSQALESFYKASGA  67

Query  247   IAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEIS  426
              A  P +VA ++ +RL    VIL+R+ L +LST++GTLMLCG   LS ++PY+ +F  +S
Sbjct  68    QAPVPDKVAEIVVKRLLTEAVILIRVVLLMLSTKLGTLMLCGSLCLSEKWPYINNFSSMS  127

Query  427   PHKRAEIVRSWSCCYIKI-LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDS  603
               KR ++++ W   +I   ++  +  +K   L  FF Q++EN +N +W+AIDY       
Sbjct  128   LEKREKVLQKWFKNWIFTPVRIAFFILKTFCLFVFFCQLDENGKNPAWEAIDY-------  180

Query  604   NKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFD  783
                             H+       + +EDV  +  E    PL KG++    E    +  
Sbjct  181   ----------------HV-------ENDEDVSEVQQER---PLEKGIVETMYETDSTIVQ  214

Query  784   RLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKY  963
              L + G  V+     K S    + I+CD V+VGSG GGGV A VLA+AG KV+V+EKG Y
Sbjct  215   SLTQKGLQVT-----KDSKQNVYKIKCDVVIVGSGCGGGVAAAVLASAGQKVVVIEKGNY  269

Query  964   FARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKE  1143
             F     SLLEG S +++Y  GG++ + D  + +LAGS VGGGS +NWSA I+TP  +L+E
Sbjct  270   FTPKDYSLLEGPSFEQLYESGGILPTTDASMTILAGSTVGGGSAVNWSACIKTPKSLLQE  329

Query  1144  WDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNA  1323
             W   +KL LFGS +Y  AM+ V  R+GV      EGFQN VL+KGC  LG  VE IPRN+
Sbjct  330   WAGDYKLPLFGSPDYLSAMDIVWERIGVTENCVQEGFQNQVLQKGCKNLGLDVERIPRNS  389

Query  1324  SRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVV----HNKKTGREQ  1491
             S +HYCG C  GCK G KKGT  TWL D V+ G  VI   C+A + +     N  T   +
Sbjct  390   SENHYCGSCGHGCKSGDKKGTDSTWLVDAVNHG-AVILTGCKAERFILEKSDNGSTRTMK  448

Query  1492  AAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAW  1671
              +GV+    NN  +    ++++ T+ ACGAL TP L+ +SGL+N +IG+NLHLHPV+ AW
Sbjct  449   CSGVIAKALNNDIRMKFQIETKATISACGALLTPPLMISSGLKNQHIGKNLHLHPVLMAW  508

Query  1672  GYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPW  1851
             GYFPD+       E + K+Y+GGI+T+  KVV+   +S   ALI+TP   P  FS   PW
Sbjct  509   GYFPDSN-----LEFKGKNYEGGIITSAHKVVS--ADSEVRALIETPEFSPAKFSVFCPW  561

Query  1852  LSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRIL  2031
             LSG D K  M ++SRTA L  + RD+ SGE      IS+ + + DK +LK GL + LRIL
Sbjct  562   LSGIDFKQTMLKYSRTAHLITIIRDRGSGEVKVEGRISHKLDQLDKENLKAGLRQALRIL  621

Query  2032  AAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSC  2199
              AAGA E+GT    G+ LK +G +  E+++F++     E  +       + G+AHQMGSC
Sbjct  622   IAAGAVEVGTHRSDGQQLKCEGITEKEVEQFLDTVYAAEGPKSPVENWMVYGTAHQMGSC  681

Query  2200  RMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKT  2379
             RMGV+ +   V+  G++WE EGL++ D+SVFP+A+GVNPM+T+Q+ AYC ++ + + L+ 
Sbjct  682   RMGVNEKEGAVDENGQSWEAEGLYVCDASVFPSAVGVNPMITIQSTAYCLSKRIAESLRE  741

Query  2380  HN  2385
              +
Sbjct  742   QS  743



>gb|KDP40361.1| hypothetical protein JCGZ_02359 [Jatropha curcas]
Length=755

 Score =   520 bits (1340),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 315/766 (41%), Positives = 453/766 (59%), Gaps = 63/766 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVD-DDSVKLFFQTSASIAGTPQRVAWMISERLQ  297
              S A M  ++SI +T LP + +P     +    V+ FF+ S      P ++A ++ +R  
Sbjct  22    FSSAEMKALSSICETVLPPISIPGKGGHEISKPVQAFFKASGFENPVPDQIAELLVKRAI  81

Query  298   HPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW--SCCY  471
                +IL+RL L  LSTR+GTL+LCG      ++PYL +F  IS  KR +I++ W  +  +
Sbjct  82    IEGLILVRLVLLALSTRLGTLLLCGSLCFGEKWPYLNTFSSISLDKREKIMQKWFKNRFF  141

Query  472   IKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDY-CGPDPDSNKKPAGKSKKWITRE  648
               I   F L +KV  L +FF+Q +EN +N +W+AI Y    D  +N+ P  +        
Sbjct  142   TPIRLVFQL-IKVGCLYTFFAQADENGKNPAWEAIGYSVDTDEIANQVPQER--------  192

Query  649   QHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQ  828
                                       PL +G+I   QE    +   L + G  V+   ++
Sbjct  193   --------------------------PLQEGIIETMQENESTLMHNLTQKGLKVTKDPKK  226

Query  829   KGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslD  1008
             K        I CD  +VGSG GGGV A VLA +G KVLVLEKG YF     S LEG S D
Sbjct  227   K-----ICKINCDVAIVGSGCGGGVAAAVLATSGQKVLVLEKGNYFTAKDYSGLEGPSHD  281

Query  1009  EMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEY  1188
             ++Y  G ++ + D +++++AGS VGGGS INWSA I TP  +L+EW E HKL+LFG+ EY
Sbjct  282   QLYESGAILPTTDANLMIMAGSAVGGGSAINWSACINTPQSLLQEWSENHKLKLFGTAEY  341

Query  1189  RHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKD  1368
               AMETVC R+GV     +EGFQN VLRKGC  LG  V T+PRN+S  HYC  C +GC  
Sbjct  342   LSAMETVCQRIGVTRNCVEEGFQNQVLRKGCENLGLEVNTVPRNSSEKHYCWSCGYGCPT  401

Query  1369  GKKKGTSETWLADLVDSGNGVIFPECEAVKVV--HNKKTG---REQAAGVMFVYQNNGAK  1533
             G KKGT  TWL D V+ G  VI   C+A + +   NKK G   +++  GV+    NN   
Sbjct  402   GDKKGTDTTWLVDAVNHG-AVILTGCKAERFILEENKKKGSRRQKKCLGVIAKTLNNNIH  460

Query  1534  EFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPE  1713
                 +++++T+ ACGAL TP L+ +SGL+NPNIG+NLHLHPV+ AWGYFPD+       +
Sbjct  461   LRLQIEAKITIAACGALLTPPLMISSGLKNPNIGQNLHLHPVLMAWGYFPDSN-----KD  515

Query  1714  PEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFS  1893
              + K ++GGI+T++ KV++N  ++   A+I+TP L P  +  + PW SG DIK R+ ++S
Sbjct  516   LKGKCHEGGIITSVHKVISN--DNNLRAIIETPQLGPSAYGVLCPWESGLDIKKRLVKYS  573

Query  1894  RTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRA  2073
             RTA L  + RD+ +G+  +   ISYN+   D  +LK GL + LRIL AAGA E+GT    
Sbjct  574   RTAHLITIVRDRGAGKVKTEGRISYNLDPFDMENLKAGLRQSLRILVAAGAVEVGTHRSD  633

Query  2074  GKILKPKGASRDEIDEFVEKESSRDLGNLS-----TLIGSAHQMGSCRMGVDPRSSVVNP  2238
             G+ L+ +G ++ +++EF++       G LS      +  SAHQMGSC+MG++ +   V+ 
Sbjct  634   GQRLQCQGITKKDLEEFLDTVFPCR-GILSPVKDWMIYSSAHQMGSCKMGINEKEGAVDE  692

Query  2239  MGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
              GE+WE EGLF+ D+SV P+A+GVNPM+T+Q+ AYC ++ + + LK
Sbjct  693   NGESWEAEGLFVCDASVLPSAVGVNPMITIQSTAYCLSKGIAESLK  738



>ref|XP_008438494.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Cucumis melo]
Length=737

 Score =   520 bits (1338),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 319/766 (42%), Positives = 458/766 (60%), Gaps = 65/766 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAV--DVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERL  294
              S A M ++TSI DT LP +  + P  +   +   + F+  S + +  P  VA M  +R 
Sbjct  22    FSTAEMESLTSICDTVLPPLPFNSPTTSTAAE---RAFYAVSGAQSPIPDEVAEMARKRG  78

Query  295   QHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW--SCC  468
                 V+L+R+ LW+L+TR+GTL+LCG      ++P++  F E+    R E +R W  +  
Sbjct  79    LVEIVLLVRVVLWILATRLGTLLLCGSLCFCEKWPFVWKFSEMPLKNREEALRRWFKNKV  138

Query  469   YIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITRE  648
             +  I     L +K++ L  FFS+V+ N +N SW+AI Y    P+ ++ P+  S       
Sbjct  139   FTPIRAALAL-IKLVSLYIFFSRVDVNGDNPSWEAIKYV---PEIDEHPSKSSD------  188

Query  649   QHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQ  828
                                     + PL KG+I  N E        L + G  ++     
Sbjct  189   ------------------------VRPLQKGIIEPNNETESSFKKSLLQKGIRIA-----  219

Query  829   KGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslD  1008
              G    +  +ECD VVVGSG GGGV A +LA++G KV+VLEKG YF  S  S LEG SL+
Sbjct  220   -GDDGHTLSVECDVVVVGSGCGGGVAAAILASSGQKVMVLEKGNYFTASDYSSLEGPSLE  278

Query  1009  EMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEY  1188
             ++Y  GG+ A+ D  +L+LAGS VGGGS +NWSASI+TP HVL+EW E+HK+  FG+ EY
Sbjct  279   QLYEAGGIFATDDGKMLILAGSTVGGGSAVNWSASIRTPDHVLQEWAESHKIPFFGTSEY  338

Query  1189  RHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKD  1368
             + AM+ VC R+GV  + E+EGFQN VLRKGC  LG  VE + RN+   HYCG C +GC+ 
Sbjct  339   QVAMDAVCKRIGVSEDCEEEGFQNQVLRKGCENLGLKVEKVARNSPTGHYCGSCGYGCRK  398

Query  1369  GKKKGTSETWLADLVDSGNGVIFPECEAVKVV----HNKKTGREQAAGVMF-VYQNNGAK  1533
             G+K+GT  TWL D V+ G  VI   C+A + +     N    + +  GV+  V+ +N  K
Sbjct  399   GEKQGTDSTWLVDSVNHG-AVIITNCKAERFILARNKNGSMRKSKCLGVIANVWSDNITK  457

Query  1534  EFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDA-PGSKAWP  1710
             +   +K++ T+ ACGAL TP L+ +SGLRN +IGRNLHLHPV+  WGYFP++  G K   
Sbjct  458   KL-HIKAKATISACGALLTPPLMISSGLRNKHIGRNLHLHPVLMTWGYFPESDSGFKG--  514

Query  1711  EPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRF  1890
                 KSY+GGI+T++ KVV+   +S    +I+TP L PG  + ++PW+SG D K RM ++
Sbjct  515   ----KSYEGGIITSVHKVVSEESKSNPKTIIETPLLGPGSCAVLVPWVSGLDTKQRMLKY  570

Query  1891  SRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHR  2070
             SRTA    + RD  SG   S   +SYN+ + D+ +LK GL + LRIL AAGA E+GT   
Sbjct  571   SRTAHFITIVRDSGSGAVRSEGRVSYNLSEEDRENLKKGLRQSLRILVAAGATEVGTHRS  630

Query  2071  AGKILKPKGASRDEIDEFVEKESSR-DLGNLS---TLIGSAHQMGSCRMGVDPRSSVVNP  2238
              G+ L+ KG  ++E++EF++  S+   L +LS    +  SAHQMGSC++GV  +   V+ 
Sbjct  631   DGQRLECKGIGKEELEEFLDNVSAEGGLLSLSRNWNVYTSAHQMGSCKIGVSEKEGAVDE  690

Query  2239  MGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
              GE+WE EGLF+ D+SV PTA+GVNPM+T+Q+ AYC +  +   L+
Sbjct  691   NGESWEAEGLFVCDASVLPTAVGVNPMITIQSTAYCISNRIAALLR  736



>ref|XP_011029789.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Populus euphratica]
Length=744

 Score =   520 bits (1339),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 319/770 (41%), Positives = 466/770 (61%), Gaps = 68/770 (9%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVP-------QHAAVDDDSVKLFFQTSASIAGTPQRVAWM  279
             LS A M ++ S+ +T LP++  P       QH  +   +V+  ++ SAS    P  +A +
Sbjct  23    LSSAEMDSLASLCETILPSLPPPVTTFDGKQH--LPTKAVQALYRASASQTPVPDEIAEL  80

Query  280   ISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW  459
             + +R     V L+RL LWLLSTR+GT +LCG      ++  +Q+F  IS  KR ++++ W
Sbjct  81    LRKRGLPEAVFLVRLVLWLLSTRLGTFLLCGSLCFGEKWLCIQNFSSISLDKREKVLQKW  140

Query  460   -SCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYC-GPDPDSNKKPAGKSKK  633
                 +   ++  ++ +KV+ +  FFS+V +N +N +W+AI+YC G D + N+        
Sbjct  141   FKRRFFTPIRIAFIYVKVLCVFVFFSRVGQNGDNPAWEAIEYCAGTDENPNQ--------  192

Query  634   WITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVS  813
              +++E+                         PL KG+I+ NQE    +   L + G  V+
Sbjct  193   -VSKER-------------------------PLQKGLIDTNQETDSTLLRSLTEKGLEVT  226

Query  814   PCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslslle  993
                  +        I+CD V+VGSG GGGV A VLA +G KV VLEKG YF  +  S LE
Sbjct  227   -----RDPRRNLCKIKCDVVIVGSGCGGGVAAAVLAASGQKVFVLEKGNYFTAADYSGLE  281

Query  994   gsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELF  1173
             G S+ ++Y  GGL+AS D  ++++AGS VGGGS +NWSASI+TP  VL+EW +  K+ LF
Sbjct  282   GPSIAQLYESGGLLASADAGMIIMAGSAVGGGSVVNWSASIKTPNSVLQEWTKNQKIPLF  341

Query  1174  GSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCS  1353
             GS EY  AM+TVC+R+GV    + EGFQN VLRKGC  LG PV+T+PRN S  HYCG C 
Sbjct  342   GSPEYFSAMDTVCARIGVTENCKVEGFQNQVLRKGCERLGVPVKTVPRNTSERHYCGSCG  401

Query  1354  FGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTG----REQAAGVMFVYQN  1521
             +GC+ G+KKGT  TWL D VD G  VI   C+A + +  K  G    +++  GV+    N
Sbjct  402   YGCRKGEKKGTDRTWLVDAVDHG-AVILTGCKAERFLLEKNKGLGKRKKKCLGVIAKIIN  460

Query  1522  NGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSK  1701
             +       ++++VT+ ACGAL TP L+ +SGL+N NIGRNLHLHPV+ AWGYFP++    
Sbjct  461   SNIITRLQIEAKVTISACGALLTPPLMISSGLKNQNIGRNLHLHPVLMAWGYFPESNS--  518

Query  1702  AWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRM  1881
                E + K Y GGI+TA+ +VVA   +S   A+++TP L P  FS + PW+SG D+K RM
Sbjct  519   ---EFKGKVYDGGIITAVHEVVAG--DSNVRAIVETPGLGPSSFSVLCPWVSGHDMKNRM  573

Query  1882  QRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGT  2061
              +++RTA L  + RD  SG+  +   ISY +  +D+ +LK GL + LRIL AAGA E+GT
Sbjct  574   MKYARTAHLITIIRDSGSGKVTTEGRISYKLDASDRDNLKVGLRQALRILVAAGAVEVGT  633

Query  2062  CHRAGKILKPKGASRDEIDEFVEKESSRDLGNLS-----TLIGSAHQMGSCRMGVDPRSS  2226
                 G+ +K +G  +++++EF++   +   G LS         SAHQMGSCRMG+  +  
Sbjct  634   HRSDGQRIKCRGIKKEDLEEFLDTVYATG-GALSMEEDWMFYSSAHQMGSCRMGIKEKEG  692

Query  2227  VVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
              V+  GE+WE EGLF+ D+SV P+A+GVNPM+T+Q+ AYC ++ + + L+
Sbjct  693   AVDENGESWEAEGLFVCDASVLPSAVGVNPMITIQSTAYCLSKKIAESLR  742



>ref|XP_001763007.1| predicted protein [Physcomitrella patens]
 gb|EDQ72212.1| predicted protein [Physcomitrella patens]
Length=775

 Score =   520 bits (1339),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 316/772 (41%), Positives = 451/772 (58%), Gaps = 54/772 (7%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
              + A + T+ SI D F P++  P     +   +  F+  SAS  G P+ +A ++   L+ 
Sbjct  32    FTKAQLRTLISICDAFSPSLSPPAECE-EKQEIASFYTCSASDMGVPEDIAGLLHVLLKP  90

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  480
               ++ +R+ LWLLSTRIGTL+L G+ASL++QFP+ QSF  +S  K+ +I+R WS   +  
Sbjct  91    QLLMAIRVFLWLLSTRIGTLILGGRASLTTQFPFFQSFAYLSTDKQEDILRGWSLSTLGA  150

Query  481   LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITRE--QH  654
              +  Y   K++ + + ++++     N +WKAI YCG DP   +     S   +     Q 
Sbjct  151   FRAVYKLFKMITMWAVYTKIENGGFNRNWKAIGYCGADPQVIRSRKCSSNDGVRSNPLQD  210

Query  655   MTLSE-------EQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVS  813
             M ++        E+      V  +N ++ L  L  G  N N                   
Sbjct  211   MVIATQAAGDKLEKVLSRAGVKVLNDDIPLKKLASGNRNRNNS-----------------  253

Query  814   PCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslslle  993
                    +      I CD VVVGSG GGGVIA VLA AG++V++LEKGKYF    L+ LE
Sbjct  254   -------AAGGDLGISCDVVVVGSGCGGGVIASVLAKAGYQVVILEKGKYFRTEDLTTLE  306

Query  994   gsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELF  1173
             G S   M+   G +A+ D  + L+AG+ VGGG+ INWSA  +TP HVL+EW +   LELF
Sbjct  307   GPSQMAMFEKLGSLATDDGGVNLVAGATVGGGTAINWSACFETPSHVLQEWKQISGLELF  366

Query  1174  GSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCS  1353
              S  Y+ AM+ +  R+ VQ  +  E  QN VLR GC +L   V T+ RNA  DH CGWC+
Sbjct  367   TSTRYKLAMKKIWHRLNVQPNIARENLQNSVLRAGCEKLSAEVGTLARNAPVDHDCGWCT  426

Query  1354  FGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKK-TGRE--QAAGVMFVYQNN  1524
             +GC  G+K  T+ TWL D  +S N V+  ECEA +++ +K  +GR+  +A GVM V    
Sbjct  427   YGCPSGQKGSTTSTWLKDAAESKNAVLLSECEAQRILFSKNHSGRKHYKARGVMAVV--G  484

Query  1525  GAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKA  1704
              +K+  F++++  V+A G+L TP LL NSGLRNPNIG+ LHLHPVVF WGYFP+  G   
Sbjct  485   SSKKRIFIEAQSVVVASGSLMTPPLLLNSGLRNPNIGKGLHLHPVVFMWGYFPEESGFPG  544

Query  1705  WPEPEKKSYQGGIMTAMSKVVANFEESGYG--ALIQTPSLHPGMFSAIMPWLSGTDIKTR  1878
                     Y+G IMT+ S +   ++++G    AL++ PS HPG F++  PW S  D K R
Sbjct  545   ------TCYEGAIMTSYSPI---YKKNGSFPVALLEVPSTHPGSFASFQPWTSAADFKER  595

Query  1879  MQRFSRTAILFALARDKTSG----EAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGA  2046
             M+RFSRT  L A+ RD ++G    EA     I Y +   D+ ++  G+EK LR+L AAGA
Sbjct  596   MRRFSRTVTLCAVTRDTSNGQVSVEADGKPKIDYTLNAVDEETILEGIEKGLRVLIAAGA  655

Query  2047  EEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSS  2226
              EIGT  + G+    KGA+  +I+ ++++  SR +     +IGS H MGSC+MG DPR S
Sbjct  656   TEIGTHQQDGERFCVKGANSRDIEAYIKRVRSRGVKKNKIIIGSGHHMGSCKMGSDPRRS  715

Query  2227  VVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTH  2382
              V+  GETWEVEGL+++D SV P+A+GVNPMVT+Q++AYC A SVL+ L + 
Sbjct  716   AVDGEGETWEVEGLYVSDGSVLPSAIGVNPMVTIQSVAYCIAHSVLQSLDSQ  767



>ref|XP_004152057.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Cucumis sativus]
 ref|XP_004172632.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Cucumis sativus]
 gb|KGN58167.1| Electron carrier [Cucumis sativus]
Length=738

 Score =   518 bits (1335),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 312/762 (41%), Positives = 456/762 (60%), Gaps = 58/762 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
              S + M  + +  +  +P V + + + +D  S+  F+Q+SA  A  P  VA ++ ER   
Sbjct  23    FSSSQMEAMAAFCEALIPPVPLFKESPLDQ-SLLSFYQSSAFQAPIPDEVADLLVERANP  81

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCC---Y  471
               V L++L L LLS RIGTL+LCG      ++P+   F EIS  KR  I+++WS     Y
Sbjct  82    KAVFLVKLVLRLLSFRIGTLLLCGNVCFDWRWPFFLKFSEISLEKRERILKNWSMAHHKY  141

Query  472   IKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQ  651
               +L+  ++ +K+     FFS+++E  +N++WK + Y                K  TR+Q
Sbjct  142   TVLLRMTFMIIKIFCCFKFFSRIDEGTKNVAWKGMGY----------------KVDTRKQ  185

Query  652   HMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQK  831
                L+  QK+               PL +G+I    E    +   L + G  V   I+ K
Sbjct  186   ---LNHTQKER--------------PLERGMIETGNEDDSTLLRSLSQKGLEV---IEDK  225

Query  832   GSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDE  1011
               GN ++ I+CD V+VGSG GGGV A VLA +G KV+VLEKG YF     S LEG S++E
Sbjct  226   KHGN-AYKIKCDVVIVGSGCGGGVAAAVLAKSGLKVVVLEKGNYFVAEDYSSLEGPSMNE  284

Query  1012  MYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYR  1191
             +Y  GGL ++ D  ++LLAG+ VGGGS INWSASI+TP  +L EW   +K+ L+GS +Y+
Sbjct  285   LYESGGLKSTLDGKVMLLAGTTVGGGSAINWSASIKTPKSILDEWSTDYKIPLYGSIDYQ  344

Query  1192  HAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDG  1371
              AM+ VC R+GV  E   E FQN VLRKGC  LG  V+++ RN+S+DHYCG C +GC+ G
Sbjct  345   LAMDAVCDRIGVTEECPVESFQNQVLRKGCENLGLKVDSVSRNSSKDHYCGSCCYGCRVG  404

Query  1372  KKKGTSETWLADLVDSGNGVIFPECEAVKVV---HNKKTGREQAAGVMFVYQNNGAKEFC  1542
              KKGT  TWL D V+ G  VI   C+A K +    N  + R++  GV+   ++    +  
Sbjct  405   DKKGTDTTWLVDAVEYG-AVILTGCQADKFILDNTNNTSKRKRCIGVIATPRSKNITKKL  463

Query  1543  FVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEK  1722
              ++++ T+ ACG+L TP LL  SGLRN NIG NLHLHPV   WGYFP+        + + 
Sbjct  464   HIEAKATISACGSLLTPPLLIASGLRNKNIGTNLHLHPVSLVWGYFPE-----ELSDFKG  518

Query  1723  KSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTA  1902
             K Y+GG++T++ KVV+ +  S   A+I+TP++ P  F+A+ PW SG ++K  M ++SRTA
Sbjct  519   KIYEGGLITSLHKVVSKYSNS--HAIIETPAVGPASFAALFPWTSGREMKDAMVKYSRTA  576

Query  1903  ILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKI  2082
              LFAL RD+ +GE     ++ Y + +TDK +L+ GL + LRIL AAGA E+GT    G+ 
Sbjct  577   HLFALIRDQGAGEIKVKANVKYRLNQTDKENLRIGLRQALRILIAAGATEVGTYRSDGQR  636

Query  2083  LKPKGASRDEIDEFVEKESSRDLGNLS-----TLIGSAHQMGSCRMGVDPRSSVVNPMGE  2247
             ++ +G +++E++EF++   +   G LS     T+  SAHQM SCRMG       V+  GE
Sbjct  637   IRCQGTNKEELEEFLDSVEAVG-GPLSRQKYWTMYCSAHQMSSCRMGSTKEEGAVDENGE  695

Query  2248  TWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
             +WE EGLF+ D SV PTA+GVNPM+T+Q+ AYC ++ + + L
Sbjct  696   SWEAEGLFVCDGSVLPTAVGVNPMITIQSTAYCISKKIAESL  737



>gb|KHN02487.1| Long-chain-alcohol oxidase FAO2 [Glycine soja]
Length=744

 Score =   518 bits (1334),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 312/761 (41%), Positives = 461/761 (61%), Gaps = 59/761 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
             LS   M  + +I D  +P++ + +  +  D ++  F+ TSAS    P   A ++ +R   
Sbjct  26    LSTTQMHVMAAICDALIPSLPLNKDTS-QDQALSDFYNTSASQLPFPDEAAELLYKRTVP  84

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  480
               V L+   LW+LS R+GTL+LCG+ SL  ++P+++ F EIS  KR +I R+W+     +
Sbjct  85    EAVSLVSWVLWILSFRLGTLLLCGRLSLDWKWPFIRKFSEISLEKREQIFRNWTREKSWV  144

Query  481   -LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHM  657
              L+  ++ +K+    +FFS+ + N +N +WKAI Y               +K I +E+  
Sbjct  145   ALRVVFVLIKLFCFYNFFSRTDANGQNPTWKAIGY----------QVDTKEKLIRKER--  192

Query  658   TLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGS  837
                                    PL KG+I    E    +   L + G  V+   +Q   
Sbjct  193   -----------------------PLEKGLIETMYETDSTLIQSLTEKGLEVTEDKRQN--  227

Query  838   GNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMY  1017
                 + ++CD V+VGSG GGGV A VLAN+GHKV+VLEKG+YF     S LEG S+DE Y
Sbjct  228   ---LYKVKCDVVIVGSGCGGGVAAAVLANSGHKVVVLEKGEYFVSHDYSSLEGPSMDEQY  284

Query  1018  LGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHA  1197
               GG++ S D  +++LAGS VGGGS +NWSASI+TP  VL+EW + +K+ LFGS +Y+ A
Sbjct  285   ESGGIMPSLDGKMMILAGSTVGGGSAVNWSASIRTPDSVLREWSKKYKIPLFGSSDYQSA  344

Query  1198  METVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKK  1377
             M++VC R+GV  + + E FQN +L +GC ++G+ VE++  N+S D YCG C +GC+ G K
Sbjct  345   MDSVCRRIGVTEKCKKESFQNQILIQGCEKMGFKVESVAINSSADDYCGSCCYGCRTGDK  404

Query  1378  KGTSETWLADLVDSGNGVIFPECEAVK-VVHNKKTG--REQAAGVMFV--YQNNGAKEFC  1542
             KGT  TWL D V +G  VI   C+A + ++ N K G  +++  GV+    +++   K+  
Sbjct  405   KGTDSTWLVDSVGNG-AVILTGCKAERFILENVKNGMKKKKCLGVIAAASWRSKVTKKL-  462

Query  1543  FVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEK  1722
              ++S+VT+ ACG+L TP L+ +SGL+NPNIGRNLHLHPV FAWGYFP+   +        
Sbjct  463   QIESKVTISACGSLNTPPLMISSGLKNPNIGRNLHLHPVQFAWGYFPEDMTTNF----SG  518

Query  1723  KSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTA  1902
              +Y+GGI+T++ K  A  E+S    +I+TPSL PG FSA +PWLSG D+K RM +++RTA
Sbjct  519   NNYEGGIITSIHKEYA--EDSTPRFIIETPSLGPGSFSAFVPWLSGQDMKDRMAKYARTA  576

Query  1903  ILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKI  2082
              +FAL RD+ SGE  +   ++Y + K DK SL+ GL K LRIL AAGA E+GT    G+ 
Sbjct  577   NIFALIRDQGSGEVKAEGRVTYRLDKEDKESLRVGLRKALRILVAAGAMEVGTYRSDGQR  636

Query  2083  LKPKGASRDEIDEFVEKES----SRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGET  2250
             +K KG   ++++EF++  +     R    + T+  +AHQM SCRMG       ++  GET
Sbjct  637   IKCKGMKEEDLEEFLDTVTIVGGPRSRNEVWTVFTTAHQMSSCRMGASEEEGALDENGET  696

Query  2251  WEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
             WE EGL++ D SV P+A+GVNPMVT+Q+ +YC A  + + L
Sbjct  697   WEAEGLYVCDGSVLPSAVGVNPMVTIQSTSYCIASKIAESL  737



>gb|AGC65582.1| fatty alcohol oxidase [Simmondsia chinensis]
Length=721

 Score =   517 bits (1331),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 311/743 (42%), Positives = 453/743 (61%), Gaps = 56/743 (8%)
 Frame = +1

Query  169   LPAVDVP----QHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwl  336
             LP+ DV     Q +A    +++ FF    S    P+ VA ++  R     V+ +R+AL L
Sbjct  13    LPSDDVHVEGIQPSAARKIAIRAFFSAPGSRPPIPEAVAELMKRRALPEAVVAVRVALRL  72

Query  337   lSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS-CCYIKILKTFYLGMKVM  513
             LSTRIGTL+LCG  SL+ ++P+L  F +I  HKR +I++SWS   +   L+  +L +KV+
Sbjct  73    LSTRIGTLLLCGFRSLTWKWPFLLKFSQIQLHKREKILQSWSKQSFWTSLRVVFLLIKVV  132

Query  514   VLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEED  693
                 FFSQ +EN++N +W+AI Y     + + KP                 +E++     
Sbjct  133   CCFVFFSQTDENSKNPAWEAIGYNLDSRECSTKP-----------------QEER-----  170

Query  694   VIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDav  873
                        PL KG++         +   L++    V+   ++       F ++CD V
Sbjct  171   -----------PLQKGIVECTNTDNDNLLRSLKEKCVEVTEDHEKN-----MFKVKCDVV  214

Query  874   vvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMD  1053
             +VGSG GGGV AGVLA++G KVLV+EKG YFA    S LEG SLDE+Y+ GG++ + D  
Sbjct  215   IVGSGCGGGVAAGVLASSGLKVLVIEKGNYFAPGDYSSLEGPSLDELYVSGGMLTTLDGK  274

Query  1054  ILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQS  1233
             +LL +GS VGGGS INWSASI+TP  V+KEW   H+L +F S +YR AM+ VC R+GV  
Sbjct  275   MLLFSGSTVGGGSAINWSASIRTPDPVIKEWSVNHRLPIFNSSDYRLAMDEVCKRIGVTE  334

Query  1234  EVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLV  1413
             +  +EGFQN VLR+GC  LG  VE +PRN+S +HYCG C++GC+ G KKGT  TWL D V
Sbjct  335   KCTEEGFQNQVLRQGCENLGLEVEKVPRNSSENHYCGSCTYGCRLGDKKGTDTTWLVDAV  394

Query  1414  DSGNGVIFPECEAVK-VVHNKKTG--REQAAGVMFVYQNNGAKEFCFVKSRVTVIACGAL  1584
             + G  V+   C+A K V+ + KTG  +++  G++    +    +   +++RV++ ACG++
Sbjct  395   EHG-AVVLTGCKAEKFVLEDVKTGTRKKKCTGIIAAVSDKNVTKKLQIEARVSISACGSV  453

Query  1585  CTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKV  1764
              TP LLK+SGLRNPNIG NLHLHPV+ AWGYFP++  S      + KS++GGI+T++ KV
Sbjct  454   LTPPLLKSSGLRNPNIGANLHLHPVLLAWGYFPESANS-----VKGKSFEGGIITSLHKV  508

Query  1765  VANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEA  1944
              ++ E+    A+I+ P L P  FS+++PW+SG D+K RM ++ RTA LFAL RD+++GE+
Sbjct  509   TSDPEKRNIHAIIEAPGLGPAAFSSLIPWVSGRDMKERMVKYDRTANLFALVRDQSTGES  568

Query  1945  PSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEF  2124
                   S + +  DK +LK GL + LRIL AAGA E+GT    G+ ++ KG    E++EF
Sbjct  569   QRRGKDSISFKDFDKQNLKIGLRQCLRILIAAGAAEVGTYRSDGQRMRCKGVKAGELEEF  628

Query  2125  VEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVF  2292
             ++   +    R       +  SA QMGS RMG    +  V+  GE+WE EGL++ D S  
Sbjct  629   LDTVIAPGGPRSRTEEWPIYASALQMGSFRMGDAAETGPVDSNGESWEPEGLYVCDGSFL  688

Query  2293  PTALGVNPMVTVQAIAYCTAQSV  2361
             PTA GVNPM+T+Q+ AYC + ++
Sbjct  689   PTAFGVNPMITIQSTAYCISSAI  711



>ref|XP_006420281.1| hypothetical protein CICLE_v10004405mg [Citrus clementina]
 gb|ESR33521.1| hypothetical protein CICLE_v10004405mg [Citrus clementina]
Length=744

 Score =   516 bits (1330),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 317/782 (41%), Positives = 462/782 (59%), Gaps = 65/782 (8%)
 Frame = +1

Query  76    KAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDD---DSVKLFFQTSAS  246
             KAE+ N G       LS A +  + S+ + FLP +        +D    +++ F++ S +
Sbjct  15    KAEKYNHG-------LSSAELLALASLCEVFLPPLPSVSLEGKEDRPGQALESFYKASGA  67

Query  247   IAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEIS  426
              A  P +VA ++ +RL    VIL+R+ L +LST++GTLMLCG   LS ++PY+ +F  +S
Sbjct  68    QAPVPDKVAEIVVKRLLTEAVILIRVVLLMLSTKLGTLMLCGSLCLSEKWPYINNFSSMS  127

Query  427   PHKRAEIVRSWSCCYIKI-LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDS  603
               KR ++++ W   +I   ++  ++ +K+  L  FF Q++EN +N +W+AIDY       
Sbjct  128   LEKREKVLQKWFKNWIFTPVRIAFVTLKIFCLFVFFCQLDENGKNPAWEAIDY-------  180

Query  604   NKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFD  783
                             H+       + +EDV  +  E    PL KG++    E    +  
Sbjct  181   ----------------HV-------ENDEDVSEVQQER---PLEKGIVETMYETDSTIVH  214

Query  784   RLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKY  963
              L + G  V+     K S    + I+CD V+VGSG GGGV A VLA+AG KV+V+EKG Y
Sbjct  215   SLTQKGLQVT-----KDSKQKVYKIKCDVVIVGSGCGGGVAAAVLASAGQKVVVIEKGNY  269

Query  964   FARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKE  1143
             F     SLLEG S +++Y  GG++ + D ++ +LAGS +GGGS INWSA I+TP  +L+E
Sbjct  270   FTPKDYSLLEGPSFEQLYESGGILPTTDANMTILAGSTIGGGSAINWSACIKTPKSLLQE  329

Query  1144  WDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNA  1323
             W   +KL LFGS +Y  AM+ V  R+GV      EGFQN VLRKGC  LG  VE IPRN+
Sbjct  330   WAGDYKLPLFGSPDYLSAMDIVWERIGVTENCVQEGFQNQVLRKGCKNLGLDVERIPRNS  389

Query  1324  SRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVV----HNKKTGREQ  1491
             S +HYCG C  GCK G KKGT  TWL D V+ G  VI   C+A + +     N  T   +
Sbjct  390   SENHYCGSCGHGCKSGDKKGTDSTWLVDAVNHG-AVILTGCKAERFIIEKSDNGSTRTMK  448

Query  1492  AAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAW  1671
              +GV+    NN  +    ++++ T+ ACGAL TP L+ +SGL+N +IG+NLHLHPV+ AW
Sbjct  449   CSGVIAKALNNDIRMKFQIETKATISACGALLTPPLMISSGLKNQHIGKNLHLHPVLMAW  508

Query  1672  GYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPW  1851
             GYFPD+       E + K+Y+GGI+T+  KVV+   +S   ALI+TP   P  FS   PW
Sbjct  509   GYFPDSN-----LEFKGKNYEGGIITSAHKVVS--ADSEVRALIETPEFSPAKFSVFCPW  561

Query  1852  LSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRIL  2031
             LSG D K  M ++SRTA L  + RD+ SGE      IS+ + + DK +LK GL + LRIL
Sbjct  562   LSGIDFKQTMLKYSRTAHLITIIRDRGSGEVKVEGRISHKLDQLDKENLKAGLRQALRIL  621

Query  2032  AAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSC  2199
              AAGA E+GT    G+ LK +G +  E+++F++     E  +       +  +AHQMGSC
Sbjct  622   IAAGAVEVGTHRSDGQRLKCEGITEKEVEQFLDTVYAAEGPKSPVENWMVYATAHQMGSC  681

Query  2200  RMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKT  2379
             RMGV+ +   V+  G++WE EGL++ D+SV P+A+GVNPM+T+Q+ AYC ++ + + L+ 
Sbjct  682   RMGVNEKEGGVDENGQSWEAEGLYVCDASVLPSAVGVNPMITIQSTAYCLSKRIAESLRE  741

Query  2380  HN  2385
              +
Sbjct  742   QS  743



>ref|XP_004495357.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Cicer arietinum]
Length=744

 Score =   516 bits (1330),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 311/766 (41%), Positives = 456/766 (60%), Gaps = 60/766 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVP----QHAAVDDDSVKLFFQTSASIAGTPQRVAWMISE  288
              S A M  + S+ +  LP ++      +     + ++ LF++ S S    P +VA M+ E
Sbjct  24    FSSANMEALASMCEALLPPIESEYLDKKGMKPTNKAIHLFWKLSGSHLSVPHQVAEMLVE  83

Query  289   RLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW-SC  465
             R     + L+R+ L +LSTR+GTL+LCG   L+ ++P++ +F  IS   R ++++ W   
Sbjct  84    RALPEALTLIRVILSMLSTRLGTLLLCGSLCLNKKWPFINNFSNISLENREKVIQKWLKH  143

Query  466   CYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITR  645
              ++  ++  ++ +KV+ L+ FFS+ NEN EN +W+AI Y   + D N     K +     
Sbjct  144   RFLTPVRLVFIYIKVLCLIVFFSRCNENGENQAWEAIGY-EVESDENTSNDHKER-----  197

Query  646   EQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQ  825
                                        PL KG++    E    +   L + G  +     
Sbjct  198   ---------------------------PLEKGIVEAMNEDNLSLPQSLSQKGLEI-----  225

Query  826   QKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegssl  1005
             +  + N    ++CD V+VGSG GGGV A VLA +G KVLVLEKG YF ++  S LEG SL
Sbjct  226   EIDAKNNILKVKCDVVIVGSGCGGGVAAAVLAKSGLKVLVLEKGNYFTQNDYSSLEGPSL  285

Query  1006  DEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKE  1185
             +E+Y  GG  AS D +I +LAGS VGGGS +NWSASI+TP +VLKEW E HKL LF S E
Sbjct  286   NELYELGGTFASCDGNIAILAGSTVGGGSAVNWSASIRTPDYVLKEWSENHKLPLFSSHE  345

Query  1186  YRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCK  1365
             Y  AM+ VC R+GV     +EG QN VLRKGC +LG  V+ +PRN+S+ HYCG C++GC+
Sbjct  346   YVSAMDMVCKRIGVTDTCVEEGLQNQVLRKGCEKLGLQVDYVPRNSSQHHYCGSCNYGCR  405

Query  1366  DGKKKGTSETWLADLVDSGNGVIFPECEAVK--VVHNKK--TGREQAAGVMFVYQNNGAK  1533
              G+K+GT  TWLAD VD G  VI   C+A K  +V NK+    R++  G+M  +      
Sbjct  406   KGEKQGTDVTWLADAVDDG-AVILTRCKAKKFILVDNKEGCVRRKKCLGLMANFLTENIT  464

Query  1534  EFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPE  1713
                 V+++ T+ +CGAL TP L+ +SGL+N NIG NLHLHPV+  WGYFPD+       +
Sbjct  465   WRLQVEAKATISSCGALSTPPLMISSGLKNKNIGNNLHLHPVLMTWGYFPDSI-----SD  519

Query  1714  PEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFS  1893
              + +SY+GGI+T++ KV++  ++S   A+I+TP+L PG FS + PW SG   K RM R+S
Sbjct  520   LKGRSYEGGIITSIHKVLS--DDSKVKAIIETPALAPGTFSTLFPWESGFGFKERMLRYS  577

Query  1894  RTAILFALARDKTSGEAPSPFSISYNM-QKTDKVSLKNGLEKVLRILAAAGAEEIGTCHR  2070
             R      + +DK+ GE  S   I Y + ++ DK ++K+GL++ LRIL AAGA E+GT   
Sbjct  578   RMVHFITIIQDKSCGEVKSEGRIKYELDEEFDKENIKDGLQQALRILIAAGAVEVGTHRS  637

Query  2071  AGKILKPKGASRDEIDEFVEKESSR----DLGNLSTLIGSAHQMGSCRMGVDPRSSVVNP  2238
              G+ +   G++  E+++FVE   +       G   ++  SAHQMGSCR+GV  +   V+ 
Sbjct  638   DGQRIACSGSNEKELNKFVESVYATGGPMSHGENWSIYASAHQMGSCRVGVTEKEGAVDE  697

Query  2239  MGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
              G++WE EGLF+ DSS+ PTA+GVNPM+T+Q++AYC A  +   L+
Sbjct  698   NGQSWEAEGLFVCDSSLLPTAIGVNPMITIQSVAYCIANRIAVILR  743



>gb|KHG17178.1| Long-chain-alcohol oxidase FAO1 [Gossypium arboreum]
Length=746

 Score =   516 bits (1330),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 310/772 (40%), Positives = 465/772 (60%), Gaps = 62/772 (8%)
 Frame = +1

Query  103   YSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDD----DSVKLFFQTSASIAGTPQRV  270
             YS G     A + T+ S+++ F P++         D     +V+ F + SAS    P  V
Sbjct  20    YSHG--FCSAEIQTLASVAEVFFPSLPPDSWFQGKDTQPSKAVQSFLKASASQPPFPDEV  77

Query  271   AWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIV  450
             A ++ +R     VI++R+ L LL TR+G+L+LCG+  L  ++P +  F  +   KR +++
Sbjct  78    AELLGKRAFIESVIVVRIVLMLLWTRVGSLLLCGRQCLGKEWPIINDFGSMGLEKREKVM  137

Query  451   RSW--SCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGK  624
             ++W         ++  ++ +KV  L  +FS+V E+ EN +W+AI Y              
Sbjct  138   QNWLKHGFLFTPIRAAFIYLKVFCLFVYFSRVGEDGENPAWEAIGY--------------  183

Query  625   SKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGF  804
                      ++   E+Q +  ++           PL KG+I    E    ++  L + G 
Sbjct  184   ---------NVDKVEDQPQARKER----------PLQKGMIETVHEKDSTLYRSLSQKGL  224

Query  805   PVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARssls  984
              V+   QQ       + I+CDAV++GSG GGGV A +LA +G KV+V+EKG YF  +  S
Sbjct  225   LVTEDTQQN-----VYRIKCDAVIIGSGCGGGVAAAMLAGSGLKVVVVEKGNYFTSTDYS  279

Query  985   llegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKL  1164
               EG S+D++Y  GG++ S D  +L+LAGS VGGGS +NWSA I+TP  VLKEW E  K+
Sbjct  280   PFEGPSMDKLYESGGILPSLDGQLLILAGSTVGGGSAVNWSACIKTPKSVLKEWAEDCKI  339

Query  1165  ELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCG  1344
              LFGS EY  AMETVC R+GV  + ++EGFQN VLRKGC  LG  VE +PRN+S  HYCG
Sbjct  340   PLFGSNEYVSAMETVCERIGVTHDCKEEGFQNQVLRKGCENLGVKVEKVPRNSSESHYCG  399

Query  1345  WCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVV---HNKKTGRE-QAAGVMFV  1512
              C FGC+ G KKGT  TWL D V++ N VI   C+A + +   +N  + R+ +  GV+  
Sbjct  400   SCGFGCRRGDKKGTDRTWLVDAVNN-NAVIITGCKADRFILERNNVGSVRKLKCLGVIAK  458

Query  1513  YQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAP  1692
               N    +   ++++VT+ ACGAL TP L+ +SGL+N NIG+NLHLHPV+ AWGYFP++ 
Sbjct  459   PSNQNITKELHIEAKVTISACGALLTPLLMHSSGLKNRNIGQNLHLHPVLMAWGYFPNSD  518

Query  1693  GSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIK  1872
                   + + K+Y+GGI+T++ KVV N  ++   A+I+TPSL P  +SA+ PW+SG D+K
Sbjct  519   -----SKFKGKAYEGGIITSVHKVVGN--DNKVQAIIETPSLGPAQYSAVCPWVSGLDMK  571

Query  1873  TRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEE  2052
              RM +FSRTA +  + RD+ SG+  +   ++Y  ++ D+ +L+ GL + LRIL AAGA E
Sbjct  572   ARMLKFSRTAHMITIIRDQGSGKVHAGGRVTYKFEEVDRQNLRAGLRQSLRILVAAGAVE  631

Query  2053  IGTCHRAGKILKPKGASRDEIDEFVEKESSRD----LGNLSTLIGSAHQMGSCRMGVDPR  2220
             +GT    G+ ++ KG S +E+DEF++  S        G    +  +AHQMGSCRMG++ +
Sbjct  632   VGTHRSDGQRIRCKGISNEELDEFLDSVSMLTSPLCTGENWVVHTTAHQMGSCRMGINEK  691

Query  2221  SSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
                V+  GE+WE EGLF+ D+S+ P+A+GVNPM+TVQ+ AYC ++ + + L+
Sbjct  692   EGAVDENGESWEAEGLFVCDASILPSAVGVNPMITVQSTAYCLSKKIAESLR  743



>ref|XP_009764096.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Nicotiana sylvestris]
Length=733

 Score =   515 bits (1327),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 306/769 (40%), Positives = 458/769 (60%), Gaps = 67/769 (9%)
 Frame = +1

Query  103   YSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMI  282
             YS G   S + + T+ S  +T +P    P +   D      FF +S S    P  VA ++
Sbjct  15    YSHG--FSSSQIQTIASFCETLIP----PPYDHQDS-----FFSSSGSQPPFPNEVAELL  63

Query  283   SERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  462
              +R +   + ++R+ +++LSTR+G+L+LCG+  L  + P++ +F E+S  +R  +++ WS
Sbjct  64    VKRSKPEAMFIIRIVVFMLSTRLGSLVLCGRVCLDKRRPFVHNFSELSLKQREPLLQRWS  123

Query  463   C-CYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWI  639
                ++  L+  +L +K+M    FFS  +EN +N +W+AI Y    PD+ + P        
Sbjct  124   RESFLLPLRITFLLIKIMSFFIFFSWTDENFKNPAWEAIGY---HPDTRQTP--------  172

Query  640   TREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPC  819
                     SE  K+               PL KG++    E    + + L K G P++  
Sbjct  173   --------SEYHKER--------------PLEKGIVETINESDETLKESLTKKGVPLT--  208

Query  820   IQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegs  999
                + + + +F I CD V+VGSG GGGV A +LA +GHKV+VLEKG YF     S LEG 
Sbjct  209   ---EDTKDNTFKIRCDVVIVGSGCGGGVAAAILAKSGHKVVVLEKGHYFVPEDYSGLEGP  265

Query  1000  slDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGS  1179
             SL+E+Y  G ++++ D  I+++AG+ VGGGS +NWSAS++TP  VL +W   HK+  FG+
Sbjct  266   SLNELYESGAMLSTLDGKIMIMAGTTVGGGSAVNWSASLRTPTDVLNDWSVKHKIPWFGT  325

Query  1180  KEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFG  1359
              EY+ AM+ VC R+GV     +EG QN V+R+GC  LG  VE IPRN+S +HYCG C +G
Sbjct  326   SEYQSAMDAVCKRIGVTENCSNEGLQNQVIRRGCENLGLKVENIPRNSSENHYCGSCGYG  385

Query  1360  CKDGKKKGTSETWLADLVDSGNGVIFPECEAVK-VVHNKKTG--REQAAGVMFVYQNNGA  1530
             CK G KKGT  TWL D V++G  VI   C A + ++ +   G  R++  GV+   ++   
Sbjct  386   CKTGDKKGTDTTWLVDAVNAG-AVILTGCTAERFILEDDMDGKMRKRCLGVVATTESKKL  444

Query  1531  KEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWP  1710
                  +++R T+ +CG+L TP LL +SGL+N NIG NLHLHPV+ AWGYFP+     +  
Sbjct  445   TRKLHIEARATISSCGSLFTPPLLISSGLKNKNIGTNLHLHPVLLAWGYFPE-----SMS  499

Query  1711  EPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRF  1890
             E + K+Y+GGIMT++ K+V   EE+   A+I+  +L P +F+ + PW SG D+K RM ++
Sbjct  500   EFKGKNYEGGIMTSLHKMVP--EETNARAIIEATALGPAIFAVLFPWTSGQDMKERMTKY  557

Query  1891  SRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHR  2070
             SRT  L ALA+D+ SGE      I+Y + + DK ++K GL + LRIL AAGA E+GT   
Sbjct  558   SRTVNLLALAKDQGSGEVKKAGRIAYRLDEIDKENIKAGLRRALRILVAAGAVEVGTYQS  617

Query  2071  AGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNP  2238
              G+ +  KG   +E++EF++   +       G   T+ GSAHQMGSCRMG +     V+ 
Sbjct  618   DGQKISCKGIKNEELEEFLDTVRATGGPNSKGEQWTIYGSAHQMGSCRMGANEEDGAVDE  677

Query  2239  MGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHN  2385
              GE WE +GL++ D SV PTA+GVNPM+T+Q+ AYC A+ + + +  HN
Sbjct  678   NGECWEAKGLYVCDGSVLPTAVGVNPMITIQSTAYCIAKRIAESM--HN  724



>ref|XP_002311685.2| alcohol oxidase-related family protein [Populus trichocarpa]
 gb|EEE89052.2| alcohol oxidase-related family protein [Populus trichocarpa]
Length=744

 Score =   515 bits (1327),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 324/790 (41%), Positives = 470/790 (59%), Gaps = 73/790 (9%)
 Frame = +1

Query  61    LFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVP-------QHAAVDDDSV  219
             L S G   R  +  Y+ G  LS A M ++ S+ +T LP++  P       QH      +V
Sbjct  8     LLSGG---RTRESKYNHG--LSSAEMDSLASLCETILPSLPPPVTTLDGKQHQPTK--AV  60

Query  220   KLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFP  399
             +  ++ S S    P  +A ++ +R     V L+RL LWLLSTR+GT +LCG      ++ 
Sbjct  61    QALYRASGSQTPMPDEIAELLRKRGLPEAVFLVRLVLWLLSTRLGTFLLCGSLCFGEKWL  120

Query  400   YLQSFPEISPHKRAEIVRSW-SCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAI  576
              +++F  IS  KR ++++ W    +   ++  ++ +KV+ +  FFS+V +N +N +W+AI
Sbjct  121   CIKNFSSISLDKREKVLQKWFKRRFFTAIRIAFIYVKVLCVFVFFSRVGQNGDNPAWEAI  180

Query  577   DYC-GPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINL  753
             +YC G D + ++ P  +                                  PL KG+I+ 
Sbjct  181   EYCAGTDENPDQVPKER----------------------------------PLQKGLIDT  206

Query  754   NQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGH  933
             NQE    +   L + G  V+     +        I+CD V+VGSG GGGV A VLA +G 
Sbjct  207   NQETDSTLLRSLTEKGLEVT-----RDPRRNLCKIKCDVVIVGSGCGGGVAAAVLAASGQ  261

Query  934   KVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSAS  1113
             KV VLEKG YF  +  S LEG SL ++Y  GGL+ S D  ++++AGS VGGGS +NWSAS
Sbjct  262   KVFVLEKGNYFTATDYSGLEGPSLAQLYESGGLLTSADAGVIIMAGSAVGGGSVVNWSAS  321

Query  1114  IQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELG  1293
             I+TP  VL+EW +  K+ LFGS EY  AM+TVC+R+GV    + EGFQN VLRKGC  LG
Sbjct  322   IKTPNSVLQEWTKNQKIPLFGSSEYLSAMDTVCARIGVTENCKVEGFQNQVLRKGCERLG  381

Query  1294  YPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNK  1473
              PV+T+PRN+S  HYCG C +GC+ G+KKGT  TWL D VD+G  VI   C+A + +  K
Sbjct  382   VPVKTVPRNSSERHYCGSCGYGCRKGEKKGTDRTWLVDAVDNG-AVILTGCKAERFILEK  440

Query  1474  KTG----REQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRN  1641
               G    +++  GV+    NN       ++++VT+ ACGAL TP L+ +SGL+N NIGRN
Sbjct  441   NKGLGKRKKKCLGVIAKIINNNIITRLQIEAKVTISACGALLTPPLMISSGLKNQNIGRN  500

Query  1642  LHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLH  1821
             LHLHPV+ AWGYFP++       E + K Y GGI+TA+ +VVA   +S   A+++TP L 
Sbjct  501   LHLHPVLMAWGYFPESN-----SEFKGKVYDGGIITAVHEVVAG--DSNVRAIVETPGLG  553

Query  1822  PGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLK  2001
             P  FS + PW+SG D+K RM ++SRTA L  + RD  SG+  +   ISY +  +D+ +LK
Sbjct  554   PSSFSVLCPWVSGHDMKNRMMKYSRTAHLITIIRDSGSGKVTTEGRISYYLNASDRDNLK  613

Query  2002  NGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLS-----T  2166
              GL + LRIL AAGA E+GT    G+ +K +G   ++++EF++   +   G LS      
Sbjct  614   VGLRQALRILVAAGAVEVGTHRSDGQRIKCRGIKIEDLEEFLDTVYATG-GALSLEEDWM  672

Query  2167  LIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYC  2346
                SAHQMGSCRMG++ +   V+  GE+WE EGLF+ D+SV P+A+GVNPM+T+Q+ AYC
Sbjct  673   FYSSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPSAVGVNPMITIQSTAYC  732

Query  2347  TAQSVLKFLK  2376
              ++ + + L+
Sbjct  733   LSKKIAESLR  742



>gb|ACF22878.1| alcohol oxidase [Glycine max]
Length=723

 Score =   514 bits (1325),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 309/761 (41%), Positives = 454/761 (60%), Gaps = 59/761 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
             LS   M  + +I D  +P++ + +  +  D ++  F+ TSAS    P   A ++ +R   
Sbjct  5     LSTTQMHVMAAICDALIPSLPLNKDTS-QDQALSDFYNTSASQLPFPDEAAELLYKRTVP  63

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  480
               V L+   LW+LS R+GTL+LCG+ SL  ++P+++ F EIS  KR +I R+W+     +
Sbjct  64    EAVSLVSWVLWILSFRLGTLLLCGRLSLDWKWPFIRKFSEISLEKREQIFRNWTREKSWV  123

Query  481   -LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHM  657
              L+  ++ +K+    +FFS+ + N +N +WKAI Y     D+ +K   K +         
Sbjct  124   ALRVVFVLIKLFCFYNFFSRTDANGQNPTWKAIGY---QVDTKEKLIRKER---------  171

Query  658   TLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGS  837
                                    PL KG+I    E    +   L + G  V+   +Q   
Sbjct  172   -----------------------PLEKGLIETMYETDSTLIQSLTEKGLEVTEDKRQN--  206

Query  838   GNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMY  1017
                 + ++CD V+VGSG GGGV A VLAN+GHKV+VLEKG+YF     S LEG S+DE Y
Sbjct  207   ---LYKVKCDVVIVGSGCGGGVAAAVLANSGHKVVVLEKGEYFVSHDYSSLEGPSMDEQY  263

Query  1018  LGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHA  1197
               GG++ S D  +++LAGS VGGGS +NWSASI+TP  VL+EW + +K+ LFGS +Y+ A
Sbjct  264   ESGGIMPSLDGKMMILAGSTVGGGSAVNWSASIRTPDSVLREWSKKYKIPLFGSSDYQSA  323

Query  1198  METVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKK  1377
             M++VC R+GV  + + E FQN +L +GC ++G  VE++  N+S DHYCG C +GC+ G K
Sbjct  324   MDSVCRRIGVTEKCKKESFQNQILIQGCEKMGLKVESVAINSSADHYCGSCCYGCRTGDK  383

Query  1378  KGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQAAGVMFV-----YQNNGAKEFC  1542
             KGT  TWL D V +G  VI   C+A + +        +    + V     +++   K+  
Sbjct  384   KGTDSTWLVDSVGNG-AVILTGCKAERFILENGKNGMKKKKCLGVIAAASWRSKVTKKL-  441

Query  1543  FVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEK  1722
              ++S+VT+ ACG+L TP L+ +SGL+NPNIGRNLHLHPV FAWGYFP+   +        
Sbjct  442   QIESKVTISACGSLNTPPLMISSGLKNPNIGRNLHLHPVQFAWGYFPEDMTTNF----SG  497

Query  1723  KSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTA  1902
              +Y+GGI+T++ K  A  E+S    +I+TPSL PG FSA +PWLSG D+K RM +++RTA
Sbjct  498   NNYEGGIITSIHKEYA--EDSTPRFIIETPSLGPGSFSAFVPWLSGQDMKDRMAKYARTA  555

Query  1903  ILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKI  2082
              +FAL RD+ SGE  +   ++Y + K DK SL+ GL K LRIL AAGA E+GT    G+ 
Sbjct  556   NIFALIRDQGSGEVKAEGRVTYRLDKEDKESLRVGLRKALRILVAAGAMEVGTYRSDGQR  615

Query  2083  LKPKGASRDEIDEFVEKES----SRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGET  2250
             +K KG   ++++EF++  +     R    + T+  +AHQM SCRMG       ++  GET
Sbjct  616   IKCKGMKEEDLEEFLDTVTIVGGPRSRNEVWTVFTTAHQMSSCRMGASEEEGALDENGET  675

Query  2251  WEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
             WE EGL++ D SV P+A+GVNPMVT+Q+ +YC A  + + L
Sbjct  676   WEAEGLYVCDGSVLPSAVGVNPMVTIQSTSYCIASKIAESL  716



>ref|XP_003554295.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Glycine max]
Length=744

 Score =   514 bits (1324),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 309/761 (41%), Positives = 454/761 (60%), Gaps = 59/761 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
             LS   M  + +I D  +P++ + +  +  D ++  F+ TSAS    P   A ++ +R   
Sbjct  26    LSTTQMHVMAAICDALIPSLPLNKDTS-QDQALSDFYNTSASQLPFPDEAAELLYKRTVP  84

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  480
               V L+   LW+LS R+GTL+LCG+ SL  ++P+++ F EIS  KR +I R+W+     +
Sbjct  85    EAVSLVSWVLWILSFRLGTLLLCGRLSLDWKWPFIRKFSEISLEKREQIFRNWTREKSWV  144

Query  481   -LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHM  657
              L+  ++ +K+    +FFS+ + N +N +WKAI Y     D+ +K   K +         
Sbjct  145   ALRVVFVLIKLFCFYNFFSRTDANGQNPTWKAIGY---QVDTKEKLIRKER---------  192

Query  658   TLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGS  837
                                    PL KG+I    E    +   L + G  V+   +Q   
Sbjct  193   -----------------------PLEKGLIETMYETDSTLIQSLTEKGLEVTEDKRQN--  227

Query  838   GNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMY  1017
                 + ++CD V+VGSG GGGV A VLAN+GHKV+VLEKG+YF     S LEG S+DE Y
Sbjct  228   ---LYKVKCDVVIVGSGCGGGVAAAVLANSGHKVVVLEKGEYFVSHDYSSLEGPSMDEQY  284

Query  1018  LGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHA  1197
               GG++ S D  +++LAGS VGGGS +NWSASI+TP  VL+EW + +K+ LFGS +Y+ A
Sbjct  285   ESGGIMPSLDGKMMILAGSTVGGGSAVNWSASIRTPDSVLREWSKKYKIPLFGSSDYQSA  344

Query  1198  METVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKK  1377
             M++VC R+GV  + + E FQN +L +GC ++G  VE++  N+S DHYCG C +GC+ G K
Sbjct  345   MDSVCRRIGVTEKCKKESFQNQILIQGCEKMGLKVESVAINSSADHYCGSCCYGCRTGDK  404

Query  1378  KGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQAAGVMFV-----YQNNGAKEFC  1542
             KGT  TWL D V +G  VI   C+A + +        +    + V     +++   K+  
Sbjct  405   KGTDSTWLVDSVGNG-AVILTGCKAERFILENGKNGMKKKKCLGVIAAASWRSKVTKKL-  462

Query  1543  FVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEK  1722
              ++S+VT+ ACG+L TP L+ +SGL+NPNIGRNLHLHPV FAWGYFP+   +        
Sbjct  463   QIESKVTISACGSLNTPPLMISSGLKNPNIGRNLHLHPVQFAWGYFPEDMTTNF----SG  518

Query  1723  KSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTA  1902
              +Y+GGI+T++ K  A  E+S    +I+TPSL PG FSA +PWLSG D+K RM +++RTA
Sbjct  519   NNYEGGIITSIHKEYA--EDSTPRFIIETPSLGPGSFSAFVPWLSGQDMKDRMAKYARTA  576

Query  1903  ILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKI  2082
              +FAL RD+ SGE  +   ++Y + K DK SL+ GL K LRIL AAGA E+GT    G+ 
Sbjct  577   NIFALIRDQGSGEVKAEGRVTYRLDKEDKESLRVGLRKALRILVAAGAMEVGTYRSDGQR  636

Query  2083  LKPKGASRDEIDEFVEKES----SRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGET  2250
             +K KG   ++++EF++  +     R    + T+  +AHQM SCRMG       ++  GET
Sbjct  637   IKCKGMKEEDLEEFLDTVTIVGGPRSRNEVWTVFTTAHQMSSCRMGASEEEGALDENGET  696

Query  2251  WEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
             WE EGL++ D SV P+A+GVNPMVT+Q+ +YC A  + + L
Sbjct  697   WEAEGLYVCDGSVLPSAVGVNPMVTIQSTSYCIASKIAESL  737



>sp|B5WWZ8.1|FAO1_LOTJA RecName: Full=Long-chain-alcohol oxidase FAO1; AltName: Full=Long-chain 
fatty alcohol oxidase 1 [Lotus japonicus]
 emb|CAP15762.1| long chain fatty alcohol oxidase FAO1 [Lotus japonicus]
Length=749

 Score =   513 bits (1321),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 316/769 (41%), Positives = 462/769 (60%), Gaps = 62/769 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLP-----AVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMIS  285
              S + M ++ SI +  LP     A+ + +H  V  + V+ F+ TSAS    P  VA ++S
Sbjct  22    FSSSEMESLASICEVILPPLPMDALKIKKHDDVSIEDVEFFWNTSASHYPIPHEVAEILS  81

Query  286   ERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW-S  462
             +R     VIL+R+ LWLL+TR+GT +LCG    S ++P++ +F  +S  KR  +++ W  
Sbjct  82    KRSLIEAVILIRVVLWLLATRLGTFLLCGLLCFSEKWPFINNFSSMSLKKRERVMQWWLK  141

Query  463   CCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWIT  642
               +I  ++  +  +KV+ L ++F+ V+EN +N +WKAI Y                    
Sbjct  142   NRFITPIRLAFAYLKVLCLFAYFTWVDENGDNPAWKAIGY--------------------  181

Query  643   REQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCI  822
                   +S ++K      +P +    L  L KG++    E    +   L + G  V+   
Sbjct  182   -----EVSADEK------LPNSSNGRL--LEKGIVETMHETNSTLQQSLTEKGLNVT---  225

Query  823   QQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegss  1002
                 S N    ++CDA+VVGSG GGGV A VL+ AGHKV+VLEKG YFA    S LEG S
Sbjct  226   --LDSRNNILKVKCDAIVVGSGCGGGVAASVLSGAGHKVVVLEKGNYFAPRDYSSLEGPS  283

Query  1003  lDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSK  1182
             +D++Y  GG++AS D  ILLLAGS VGGGS +NWSA I+TP  VLKEW E H L LF + 
Sbjct  284   MDQLYETGGILASVDSRILLLAGSTVGGGSAVNWSACIKTPHEVLKEWSENHNLSLFSTS  343

Query  1183  EYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGC  1362
             EY  AMETVC R+GV      EGFQN VLRKGC  LG  V+ +PRN+S +H+CG C +GC
Sbjct  344   EYLSAMETVCERIGVTESCTHEGFQNQVLRKGCQNLGLKVDYVPRNSSGNHFCGSCGYGC  403

Query  1363  KDGKKKGTSETWLADLVDSGNGVIFPECEAVK-VVHNKKTG---REQAAGVMFVYQNNGA  1530
               G+K+GT +TWL D V++G  VI   C+A + ++ N + G   +++  GV+    ++  
Sbjct  404   PKGEKQGTQDTWLVDAVENG-AVIITGCKAERFLLENNRNGSGRKKKCLGVLAKALSSRV  462

Query  1531  KEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWP  1710
                  ++++VT+ A GAL TP L+ +SGL+N NIG+NLHLHPV+  WGYFP++       
Sbjct  463   TMKLQIEAKVTISAGGALLTPPLMISSGLKNKNIGKNLHLHPVLMTWGYFPESTS-----  517

Query  1711  EPEKKSYQGGIMTAMSKVVANFEESGYG---ALIQTPSLHPGMFSAIMPWLSGTDIKTRM  1881
             E + K ++GGI+T++ KV +  + + Y    A+I+TPSL PG F+++ PW SG D K RM
Sbjct  518   ELKGKIFEGGIITSVHKVPSR-DSNSYSDTRAIIETPSLGPGSFASLCPWESGLDFKERM  576

Query  1882  QRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGT  2061
               + RTA L  + RDK  G+  +   +SY +   DK ++K GL++ LRIL AAGA E+GT
Sbjct  577   LNYPRTAHLITIIRDKACGQVTTEGRVSYKLSAFDKENMKCGLQQALRILKAAGAVEVGT  636

Query  2062  CHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSV  2229
                 G+ +K    S +E+ EF++     E +   G    +  SAHQMGSCRMG++ +   
Sbjct  637   HRSDGQRVKCGEVSENEMAEFIDSVCPMEGALSPGENWNIYTSAHQMGSCRMGMNEKEGA  696

Query  2230  VNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             V+  GE+WE +GLF+ D+S+ PTA+GVNPM+T+Q+ AYC +  V+ +LK
Sbjct  697   VDENGESWEAQGLFVCDASLLPTAVGVNPMITIQSTAYCISNRVVDYLK  745



>ref|XP_008804287.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Phoenix dactylifera]
Length=759

 Score =   513 bits (1321),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 303/780 (39%), Positives = 458/780 (59%), Gaps = 60/780 (8%)
 Frame = +1

Query  85    RGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQ-HAAVDDD-----SVKLFFQTSAS  246
             R   G +S G   SP+ + ++ ++ + F+P++ + + H +   +     S++ F+  S S
Sbjct  20    RTEKGGHSHG--FSPSQIQSLAAMCEAFIPSLPMEELHVSSGKEDPPTKSLQAFYLASGS  77

Query  247   IAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEIS  426
              +  P  VA ++ +R     ++L++L LWLL+T++GTL+LC   SL  +FP++  F ++ 
Sbjct  78    ESPIPDEVAELLVKRGMKEALLLVKLVLWLLATKLGTLVLCRSLSLCGRFPFINKFSDMP  137

Query  427   PHKRAEIVRSWSCCYIKI-LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDS  603
               KR E+++ W+     + L+  ++ +K+  L  F+S  NEN+EN SW AI Y  P  + 
Sbjct  138   IEKREEVLKRWNKEKNFVPLRMVFVMVKIFCLYIFYSMTNENSENQSWNAIGYSLPTEE-  196

Query  604   NKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFD  783
              K P  +S++                               PL KG+I    +    +  
Sbjct  197   -KPPKSQSER-------------------------------PLEKGIIETMDQTDSSLLQ  224

Query  784   RLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKY  963
              L   G  VS    Q       + I+CD  +VGSG GGGV A VLA+AG KV+V+EKG Y
Sbjct  225   SLTMKGLAVSQDPNQN-----LYEIKCDVAIVGSGCGGGVAAAVLASAGRKVVVIEKGNY  279

Query  964   FARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKE  1143
             F     + +E  S++EMY  GG++++ D  I+LLAGS VGGGS +NWSA I+TP HVLKE
Sbjct  280   FTSEDYTSIEAPSMNEMYESGGILSTLDGKIMLLAGSTVGGGSAVNWSACIKTPDHVLKE  339

Query  1144  WDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNA  1323
             W    +L LFGS +Y  AM+ VC R+GV     +EGFQN VLRKGC  LG  V+++PRN 
Sbjct  340   WAGERRLRLFGSTDYLSAMDAVCRRLGVTENCTEEGFQNKVLRKGCENLGLQVDSVPRNT  399

Query  1324  SRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNK----KTGREQ  1491
             S  H+CG C +GC++G K+GT  TWL D V+ G  VI   C+A + V  +    K   ++
Sbjct  400   SERHFCGSCCYGCREGDKRGTDTTWLVDAVNHG-AVIITGCKAERFVFKENEPGKKKTKK  458

Query  1492  AAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAW  1671
               G++    +    +   ++++ T+ ACG+L TP L+ +SGL N NIGRNLHLHPVVFAW
Sbjct  459   CVGLIAKSLSRMVTKKLRIQAKATISACGSLLTPPLMISSGLTNSNIGRNLHLHPVVFAW  518

Query  1672  GYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVA-NFEESGYGALIQTPSLHPGMFSAIMP  1848
             GYFPD+           ++++GGI+T++ KV A    +S   A+I+ P++ P  F++++P
Sbjct  519   GYFPDSASDH---HHRGRAFEGGIITSLHKVKAVEDSDSSLRAIIEAPAMGPASFASLVP  575

Query  1849  WLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRI  2028
             W+SG D K RM R+SRTA+LFAL RD+ SG       + Y     D+ +L+ GL + LRI
Sbjct  576   WVSGQDSKERMARYSRTALLFALVRDRGSGTVEGEGRVKYRFDALDRENLREGLRRALRI  635

Query  2029  LAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGS  2196
             L AAGA E+GT    G+ +K KG    +++EF++  S+         L TL  SAHQ+GS
Sbjct  636   LVAAGAVEVGTHRSDGQRMKCKGIEEKDLEEFLDGISAVGGPMSRRELWTLHASAHQIGS  695

Query  2197  CRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             CR+G       V+  GE+WE +GLF+ D+SV P+A+G+NPM+T+Q++AYC ++ + + LK
Sbjct  696   CRIGASEEEGGVDESGESWEAQGLFVCDASVLPSAVGINPMITIQSVAYCLSKGIAESLK  755



>ref|XP_010093072.1| Long-chain-alcohol oxidase FAO2 [Morus notabilis]
 gb|EXB53500.1| Long-chain-alcohol oxidase FAO2 [Morus notabilis]
Length=743

 Score =   512 bits (1319),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 313/771 (41%), Positives = 460/771 (60%), Gaps = 58/771 (8%)
 Frame = +1

Query  103   YSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMI  282
             YS G   S A + ++ S+ +  +P + +P    +   S++ F++ S S +  P   A M+
Sbjct  21    YSHG--YSSAQIQSLASMCEALIPPL-IPNKNPLHK-SLQTFYEASGSQSPIPDETAEMV  76

Query  283   SERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  462
              ++   P   L+   L +LS R+GTL+LCG      ++P+L  F E+S  KR  +++ WS
Sbjct  77    VKKALPPAASLVSWVLKILSFRLGTLLLCGFICFDWKWPFLHKFSEMSLEKREAVLKKWS  136

Query  463   CCYIKI-LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWI  639
                  + L+  ++ +K+    +FFS+V+EN+ N +W+AI Y     D+ K+         
Sbjct  137   KQRRFVPLRLAFVLIKLFCFFTFFSRVDENSHNPAWEAIGY---HVDTRKR---------  184

Query  640   TREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPC  819
                  MT +E+++                PL  GVI   +E    +   L + G  V+  
Sbjct  185   -----MTKTEKER----------------PLDNGVIETMKETDSSLVQSLIQKGLEVT--  221

Query  820   IQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegs  999
                +   + ++ I+CDAVVVGSG GGGV A VLA +G KV+VLE+G YF     S LEG 
Sbjct  222   ---EDPNDNNYKIKCDAVVVGSGCGGGVAAAVLAKSGQKVIVLEQGNYFVAQDYSSLEGP  278

Query  1000  slDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGS  1179
             S++E+Y  GG+ ++ D  I+LLAGS VGGGS +NWSASI+TP  VL EW   HK+ LFGS
Sbjct  279   SMEELYKFGGISSTIDGKIMLLAGSTVGGGSAVNWSASIRTPSSVLHEWSVDHKIPLFGS  338

Query  1180  KEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFG  1359
              EY+ AM+ VC R+GV  +   E FQN +LRKGC  LG  + ++PRN+S DHYC +C +G
Sbjct  339   SEYQSAMDVVCKRLGVTDKCTKENFQNQILRKGCQNLGLEIVSVPRNSSADHYCSFCCYG  398

Query  1360  CKDGKKKGTSETWLADLVDSGNGVIFPECEAVK-VVHNKKTG--REQAAGVMFVYQNNGA  1530
             C  G+KKGT  TWL D V  G  VI   C A K V+ N K G  R++  GV+    +   
Sbjct  399   CPTGEKKGTDTTWLVDAVACG-AVILTGCRAEKFVLENGKDGGARKKCLGVIARCSSKKI  457

Query  1531  KEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWP  1710
              +   ++++VTV ACGAL TP L+ +SGL+NPNIGRNLHLHPV+  WGYFP+  GS    
Sbjct  458   TKKLKIEAKVTVSACGALSTPPLMISSGLQNPNIGRNLHLHPVLLTWGYFPE-DGS----  512

Query  1711  EPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRF  1890
             E + K Y+GGI+T++ KV++  E +   A+I+TP L P  F+ + PW+SG+D+K RM ++
Sbjct  513   EFKGKMYEGGIITSLHKVIS--EGNNTRAIIETPVLGPATFATLFPWVSGSDMKDRMVKY  570

Query  1891  SRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHR  2070
             +RT+ LFA+ RD+ SGE      + Y + + DK +L+ GL + LRIL AAGA E+GT   
Sbjct  571   ARTSHLFAMVRDQGSGEVKEEGMVKYRLTQLDKENLQCGLRQALRILVAAGAVEVGTYRS  630

Query  2071  AGKILKPKGASRDEIDEFVEKESSR----DLGNLSTLIGSAHQMGSCRMGVDPRSSVVNP  2238
              G+ +K KG    + +EF++  ++       G   T+  SAHQMGSCRMG +     V+ 
Sbjct  631   DGQRIKCKGLKEKDFEEFLDTVTAVGGPGTRGEHWTIYCSAHQMGSCRMGANEEEGAVDE  690

Query  2239  MGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHNHM  2391
              GE+WE E LF+ D SV PTA GVNPM+++++ A+C +  ++K LK  +H+
Sbjct  691   NGESWEAESLFVCDGSVLPTAAGVNPMISIESTAFCISTRIVKSLKRQSHV  741



>gb|KGN56837.1| hypothetical protein Csa_3G134850 [Cucumis sativus]
Length=669

 Score =   509 bits (1310),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 296/691 (43%), Positives = 424/691 (61%), Gaps = 60/691 (9%)
 Frame = +1

Query  340   STRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW--SCCYIKILKTFYLGMKVM  513
             +TR+GTL+LCG      ++P++  F E+   KR E +R W  +  +  +     L +K++
Sbjct  26    ATRLGTLLLCGSLCFCEKWPFVCKFSEMPLEKREEALRRWFKNKVFTPVRAALAL-IKLV  84

Query  514   VLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEED  693
              L  FFS+V+ N +N SW+AI Y  P+ D                +H + S + +     
Sbjct  85    FLYVFFSRVDVNGDNPSWEAIKYV-PEID----------------EHPSKSSDAR-----  122

Query  694   VIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDav  873
                        PL KG+I  N E        L + G  ++      G    +  +ECD V
Sbjct  123   -----------PLEKGIIEPNNETESSFKKSLLQKGIRIA------GDDGHTLSVECDVV  165

Query  874   vvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMD  1053
             VVGSG GGGV A +LA++G KV++LEKG YF  S  S LEG SL+++Y  G + A+ D  
Sbjct  166   VVGSGCGGGVAAAILASSGQKVMILEKGNYFIASDYSSLEGPSLEQLYEAGAIFATDDGK  225

Query  1054  ILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQS  1233
             +L+LAGS VGGGS +NWSASI+TP HVL+EW E+HK+  FG+ EY+ AM+ VC R+GV  
Sbjct  226   VLILAGSTVGGGSAVNWSASIKTPDHVLQEWAESHKIPFFGTSEYQVAMDAVCKRIGVSE  285

Query  1234  EVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLV  1413
             + E+EGFQN VLRKGC  LG  VE +PRN++  HYCG C +GC+ G+K+GT  TWL D V
Sbjct  286   DCEEEGFQNQVLRKGCENLGLKVEKVPRNSTTGHYCGSCGYGCRKGEKQGTDSTWLVDAV  345

Query  1414  DSGNGVIFPECEAVK-VVHNKKTG---REQAAGVMF-VYQNNGAKEFCFVKSRVTVIACG  1578
             + G  VI   C+A + ++   K G   + +  GV+  V+ +N  K+   +K++ T+ ACG
Sbjct  346   NHG-AVIITNCKAERFILERNKNGSMKKSKCLGVIANVWSDNITKKL-HIKAKATISACG  403

Query  1579  ALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDA-PGSKAWPEPEKKSYQGGIMTAM  1755
             AL TP L+ +SGLRN +IGRNLHLHPV+  WGYFP++  G K       KSY+GGI+T++
Sbjct  404   ALLTPPLMISSGLRNKHIGRNLHLHPVLMTWGYFPESNSGFKG------KSYEGGIITSV  457

Query  1756  SKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTS  1935
              KVV+   +S    +I+TP L PG  + ++PW+SG DIK RM ++SRTA    + RD  S
Sbjct  458   HKVVSEESKSNPKTIIETPLLGPGSCAVLVPWVSGLDIKQRMLKYSRTAHFITIVRDSGS  517

Query  1936  GEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEI  2115
             G   S   +SYN+ + D+ +LK GL + LRIL AAGA E+GT    G+ L+ KG  ++E+
Sbjct  518   GAVRSEGRVSYNLSEEDRENLKKGLRQSLRILVAAGATEVGTHRSDGQRLECKGIGKEEL  577

Query  2116  DEFVEKESSR-DLGNLS---TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADS  2283
             +EF++  S+   L +LS    +  SAHQMGSC++GV      ++  GE+WE EGLF+ D+
Sbjct  578   EEFLDSVSAEGGLLSLSKDWNVYTSAHQMGSCKIGVSETEGAIDQNGESWEAEGLFVCDA  637

Query  2284  SVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             SV PTA+GVNPM+T+Q+ AYC +  +   L+
Sbjct  638   SVLPTAVGVNPMITIQSTAYCISNRIAALLR  668



>ref|XP_007224435.1| hypothetical protein PRUPE_ppa021498mg, partial [Prunus persica]
 gb|EMJ25634.1| hypothetical protein PRUPE_ppa021498mg, partial [Prunus persica]
Length=721

 Score =   509 bits (1311),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 312/762 (41%), Positives = 454/762 (60%), Gaps = 60/762 (8%)
 Frame = +1

Query  136   MATVTSISDTFLPAVDVP------QHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQ  297
             M ++ S+ +  LPA+ +       +     D +V+ F Q S +    P  VA ++ +R  
Sbjct  1     MQSLASVCEALLPALPLNDFCFEGKEEQPTDKAVQSFHQASGAQTPIPDEVAELLVKRAF  60

Query  298   HPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW-SCCYI  474
                V+L+R+ LW+LSTR+GTL+LCG      ++P++ +F  +   KR  +++ W    ++
Sbjct  61    IEAVVLVRVVLWVLSTRLGTLLLCGSLCFGERWPFILNFSSLPLAKRERLLQKWFKHRFL  120

Query  475   KILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQH  654
               ++  ++ +K + L  FFS+V++N EN  W+AI Y     D N   A K +        
Sbjct  121   TPIRLAFVYIKFLCLYIFFSRVDKNAENPIWQAIGYHVDTDDQNTPTAPKER--------  172

Query  655   MTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKG  834
                                     PL KG+I    E    +     + G  V    Q+K 
Sbjct  173   ------------------------PLQKGIIETIYETDTTLLHSFAEKGLTVRHDPQEK-  207

Query  835   SGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEM  1014
                  + I+CD VVVGSG GGGV A VLA++G KV+VLEKG Y+  S  S LEG S D+M
Sbjct  208   ----LYKIKCDVVVVGSGCGGGVAAAVLASSGQKVVVLEKGNYYTHSDYSSLEGPSQDQM  263

Query  1015  YLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRH  1194
             Y  GG+ A+ D  +++ AGS VGGGS +NWSA I+TP +VL+EW + H++  FG  EY  
Sbjct  264   YESGGIFATIDGKLVIQAGSTVGGGSAVNWSACIRTPDNVLEEWAKDHEIRFFGEPEYVS  323

Query  1195  AMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGK  1374
             AM+TVC R+GV     +EGFQN VLRKGC  LG  V+ +PRN+S  HYCG C +GC+ G+
Sbjct  324   AMDTVCERIGVTDNCVEEGFQNQVLRKGCENLGLGVDFVPRNSSEKHYCGSCGYGCRKGE  383

Query  1375  KKGTSETWLADLVDSGNGVIFPECEAVK-VVHNKKTG---REQAAGVMFVYQNNGAKEFC  1542
             KKGT  TWL D VD G  VI   C A K V+ N K+G   +++ +GVM    +N   +  
Sbjct  384   KKGTDSTWLLDAVDHG-AVILTGCRAEKFVLENIKSGSLRKKKCSGVMGKSLSNNISKKL  442

Query  1543  FVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEK  1722
              ++++VT+ ACGAL TP L+ +SGL+N NIGRNLHLHPV+ AWGYFP++       E + 
Sbjct  443   QIEAKVTISACGALLTPPLMISSGLKNKNIGRNLHLHPVLMAWGYFPESNS-----EFKG  497

Query  1723  KSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTA  1902
             K Y+GGI+T++ KV +   +S   A+I+TP+L PG FS++ PW+SG DIK RM ++ RT 
Sbjct  498   KIYEGGIITSVHKVAS--VDSKVKAIIETPALGPGAFSSLCPWVSGEDIKKRMLKYGRTC  555

Query  1903  ILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKI  2082
              L ++ RD+ SG       +SY  + +DK +L+ GL + LRIL AAGA E+GT    G  
Sbjct  556   HLISIIRDRGSGIVMKGGRVSYEFEASDKENLEAGLRQALRILIAAGAVEVGTHRSDGLR  615

Query  2083  LKPKGASRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGET  2250
             +K KG  +++++EF++  S+    + L    T   SAHQMGSCRMG++ +   V+  GE+
Sbjct  616   IKCKGIEKEKLEEFLDMVSAEKGPQSLVENWTTYSSAHQMGSCRMGINEKEGAVDENGES  675

Query  2251  WEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             WE EGLF+ D+SV P+A+GVNPM+T+Q+ AYC ++ +   LK
Sbjct  676   WEAEGLFVCDASVLPSAVGVNPMITIQSTAYCLSKRIAGSLK  717



>ref|XP_008447391.1| PREDICTED: LOW QUALITY PROTEIN: long-chain-alcohol oxidase FAO2-like 
[Cucumis melo]
Length=739

 Score =   510 bits (1313),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 309/763 (40%), Positives = 447/763 (59%), Gaps = 60/763 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
              S + M  + +  +  +P + +     +D   +  F+Q+SA  A  P  VA ++ ER   
Sbjct  23    FSSSQMEAMAAFCEALIPPLPLFSETPLDQFLLS-FYQSSAFQAPIPDEVADLLVERANP  81

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCC---Y  471
               V L++L L LLS RIGTL+LCG      ++P+   F EIS  KR +I+++WS     Y
Sbjct  82    KAVFLVKLVLRLLSFRIGTLLLCGNVCFDWRWPFFLKFSEISLEKREQILKNWSMAHHKY  141

Query  472   IKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQ  651
               +L+  ++ +K+     FFS+++E  +N++WKA+ Y   + D+ K+             
Sbjct  142   TVLLRMTFMIIKIFCCFKFFSRIDEGTKNVAWKAMGY---EVDTRKQ-------------  185

Query  652   HMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQK  831
                L+  QK+               PL +G+I    E    +F  L + G  V   I+ K
Sbjct  186   ---LNHTQKER--------------PLERGMIETGNEDDSTLFRSLSQKGLEV---IEDK  225

Query  832   GSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDE  1011
               GN ++ I+CD V+VGSG GGGV A VLA +G KV+VLEKG YF     S LEG S++E
Sbjct  226   KHGN-AYKIKCDVVIVGSGCGGGVAAAVLAKSGLKVVVLEKGNYFVAEDYSSLEGPSMNE  284

Query  1012  MYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYR  1191
             +Y  GGL ++ D  ++LLAG+ VGGGS INWSASI+TP  VL EW   HK+ L+GS +Y+
Sbjct  285   LYESGGLKSTLDGKVMLLAGTTVGGGSAINWSASIRTPKSVLDEWSTDHKIPLYGSIDYQ  344

Query  1192  HAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDG  1371
              AM+ VC R+GV      E FQN VLRKGC  LG  V+++ RN+S DHYCG C +GC+ G
Sbjct  345   LAMDAVCDRIGVTRGCRVESFQNQVLRKGCENLGLKVDSVSRNSSEDHYCGSCCYGCRVG  404

Query  1372  KKKGTSETWLADLVDSGNGVIFPECEAVKVV---HNKKTGREQAAGVMFVYQNNGAKEFC  1542
              KKGT  TWL D V  G  VI   C A K +    N  + +++  GV+    +    +  
Sbjct  405   DKKGTDTTWLVDAVKCG-AVILTGCHADKFILENTNNTSXKKKCIGVIATPLSKNVTKKL  463

Query  1543  FVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEK  1722
              ++++ T+ ACG+L TP LL  SGLRN NIG NLHLHPV   WGYFP+        + + 
Sbjct  464   HIEAKATISACGSLLTPPLLIASGLRNKNIGTNLHLHPVSLVWGYFPE-----ELSDFKG  518

Query  1723  KSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTA  1902
             K Y+GG++T +  VV+ +  S   A+I+TP++ P  F+A+ PW SG ++K  M ++SRTA
Sbjct  519   KIYEGGLITCLHNVVSKYSNS--HAIIETPAVGPASFAALFPWTSGREMKDAMVKYSRTA  576

Query  1903  ILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKI  2082
              LFAL RD+ +GE     ++ Y + +TDK +LK GL + LRIL AAGA EIGT    G+ 
Sbjct  577   HLFALVRDQGAGEIKVKANVKYRLNQTDKENLKIGLRQALRILIAAGATEIGTYRSDGQR  636

Query  2083  LKPKGASRDEIDEFVEKESSRDLG------NLSTLIGSAHQMGSCRMGVDPRSSVVNPMG  2244
             ++ +G  +++++EF+  +S   +G         T+  SAHQM SCRMG       V+  G
Sbjct  637   IRCQGTKKEDLEEFL--DSVEAVGGPWSRQKYWTMYCSAHQMSSCRMGSTKEEGAVDENG  694

Query  2245  ETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
             E+WE EGLF+ D SV PTA+GVNPM+T+Q+ AYC ++ + + L
Sbjct  695   ESWEAEGLFVCDGSVLPTAVGVNPMITIQSTAYCISKKIAESL  737



>ref|NP_566729.1| long-chain-alcohol oxidase FAO3 [Arabidopsis thaliana]
 sp|Q9LW56.1|FAO3_ARATH RecName: Full=Long-chain-alcohol oxidase FAO3; AltName: Full=Long-chain 
fatty alcohol oxidase 3 [Arabidopsis thaliana]
 gb|AAK32839.1|AF361827_1 AT3g23410/MLM24_23 [Arabidopsis thaliana]
 dbj|BAB02285.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO11629.1| At3g23410/MLM24_23 [Arabidopsis thaliana]
 gb|AEE76762.1| long-chain-alcohol oxidase FAO3 [Arabidopsis thaliana]
Length=746

 Score =   510 bits (1313),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 313/774 (40%), Positives = 452/774 (58%), Gaps = 60/774 (8%)
 Frame = +1

Query  112   GCP-LSPAVMATVTSISDTFLPAVDVPQHAAV-------DDDSVKLFFQTSASIAGTPQR  267
             G P ++ A M ++ S  +  LP+V  P            + ++++ F+ TS S     ++
Sbjct  11    GLPDITVAEMESLASFCEAVLPSVQPPPEELSGEGDNHRNKEALRSFYSTSGSKTPVLRQ  70

Query  268   VAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEI  447
                ++++R      I  RL L+LL+TR+GTL++CG   L S++P+++ F E+S  KR  +
Sbjct  71    SIELVTKRGTIEAYIATRLILFLLATRLGTLLICGTECLVSRWPFVEKFSELSLEKRERV  130

Query  448   V-RSWSCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGK  624
             + + +    +  ++  ++ +KV  L  FFS+VN N EN +W+AI Y   +PD NK     
Sbjct  131   LQKQFKNWILTPIRAAFVYIKVAFLFCFFSRVNPNGENPAWEAIGY-RVNPDENKPSETH  189

Query  625   SKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGF  804
             +++                               PL KG++   +E  + + + L   G 
Sbjct  190   NER-------------------------------PLEKGIVETMEETEQTLLESLAHKGL  218

Query  805   PVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARssls  984
                   +       +  I+CD VVVGSGSGGGV A VLA +G KV+VLEKG YF  S   
Sbjct  219   EAVLDTEHD-----AIRIKCDVVVVGSGSGGGVAASVLAKSGLKVVVLEKGSYFTPSEHR  273

Query  985   llegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKL  1164
               EG  LD++Y  GG++ S D   ++LAG+ VGGGS +NWSA I+TP  VL+EW E   +
Sbjct  274   PFEGPGLDKLYENGGILPSVDGSFMVLAGATVGGGSAVNWSACIKTPKSVLQEWSEDQNI  333

Query  1165  ELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCG  1344
              LFG+KEY  AME V  RMGV  + E E FQN +LRKGC  LG+ VE +PRN+S  HYCG
Sbjct  334   PLFGTKEYLTAMEVVWKRMGVTEKCELESFQNQILRKGCENLGFNVENVPRNSSESHYCG  393

Query  1345  WCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNK----KTGRE-QAAGVMF  1509
              C +GC+ G KKG+  TWL D V  G  VI   C+A + +  K    K G++ +  GVM 
Sbjct  394   SCGYGCRQGDKKGSDRTWLVDAVGHG-AVILTGCKAERFILEKNGSNKGGKQMKCLGVMA  452

Query  1510  VYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDA  1689
                N    +   ++++VTV A GAL TP L+ +SGLRN NIG+NLHLHPV+ AWGYFPD 
Sbjct  453   KSLNGNIAKMLKIEAKVTVSAGGALLTPPLMISSGLRNRNIGKNLHLHPVLMAWGYFPDK  512

Query  1690  PGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDI  1869
               S      +  SY+GGI+T++SKV++  E+S   A+I+TP L PG FS + PW SG D+
Sbjct  513   ESSNI--SFKGNSYEGGIITSVSKVLS--EDSEVRAIIETPQLGPGSFSVLTPWTSGLDM  568

Query  1870  KTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAE  2049
             K RM R+SRTA L  + RD+ SGE  +   I+Y + KTD+ +LK GL + LRIL AAGAE
Sbjct  569   KKRMARYSRTASLITIVRDRGSGEVKTEGRINYTVDKTDRDNLKAGLRESLRILIAAGAE  628

Query  2050  EIGTCHRAGKILKPKGASRDEIDEFVE----KESSRDLGNLSTLIGSAHQMGSCRMGVDP  2217
             E+GT    G+ L  KG + + I EF++    +E ++ +     +  SAHQMGSCR+G + 
Sbjct  629   EVGTHRSDGQRLICKGVNENSIQEFLDSVSTEEGAKGMTEKWNVYSSAHQMGSCRIGENE  688

Query  2218  RSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKT  2379
             +   ++  GE+WE E LF+ D+S  P+A+GVNPM+TV + AYC +  + K + T
Sbjct  689   KEGAIDLNGESWEAEKLFVCDASALPSAVGVNPMITVMSTAYCISTRIAKSMTT  742



>ref|XP_003540021.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Glycine max]
 gb|KHN27785.1| Long-chain-alcohol oxidase FAO1 [Glycine soja]
Length=751

 Score =   510 bits (1313),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 326/779 (42%), Positives = 460/779 (59%), Gaps = 63/779 (8%)
 Frame = +1

Query  94    DGVYSGGCPLSPAVMATVTSISDTFLP-----AVDVPQHAAVDD----DSVKLFFQTSAS  246
             D  Y  G   S A M ++ SI +  LP     A+ + +   +DD     S+K F+  SAS
Sbjct  16    DSKYKHG--FSAAEMESLASICEVVLPPLPMDALKIRKEDQIDDYDSSKSLKSFWDISAS  73

Query  247   IAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEIS  426
                 P  VA M+++R     VIL+R+ LWLL+TR+GTL+LCG   L  ++PY+ +F  IS
Sbjct  74    RYPIPHEVAEMLTKRSLIEAVILIRVVLWLLATRLGTLLLCGFLCLGEKWPYVNNFSNIS  133

Query  427   PHKRAEIVRSW-SCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDS  603
               KR  +++ W    ++  ++  +  +KV+ L  FFS V+EN +N +WKAI Y  P  D 
Sbjct  134   LEKREMVMQKWLKHRFLTPIRLAFAYIKVLCLFVFFSWVDENGDNPAWKAIGYEVP-ADE  192

Query  604   NKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFD  783
             N   A K++                                PL KG+I    E    +  
Sbjct  193   NLTNASKTR--------------------------------PLEKGIIETMNESDSALQQ  220

Query  784   RLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKY  963
              L   G  V+       S +    ++CDA+VVGSG GGGV A VL++AG+KV+VLEKG Y
Sbjct  221   SLANKGLNVT-----LDSKSNILKVKCDALVVGSGCGGGVAAAVLSSAGYKVVVLEKGNY  275

Query  964   FARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKE  1143
             F+    S LEG S++++Y  GG++AS D  +L+LAGS VGGGS +NWSA I+TP  VL E
Sbjct  276   FSTQDYSSLEGPSMNQLYETGGILASVDSRVLVLAGSTVGGGSAVNWSACIKTPHKVLNE  335

Query  1144  WDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNA  1323
             W E HKL  F S+EY  AMETVC R+GV      EGFQN VLRKGC  LG  V+ +PRN+
Sbjct  336   WSENHKLPFFSSQEYLSAMETVCERIGVTENCTQEGFQNQVLRKGCQNLGLKVDYVPRNS  395

Query  1324  SRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVK-VVHNKKTG---REQ  1491
             S +HYCG C +GC  G+K+GT  TWL D V+  + VI   C+A + ++ + ++G   +++
Sbjct  396   SGNHYCGSCGYGCPKGEKQGTQATWLVDAVER-DAVIITGCKAERFLLESNRSGNGRKKK  454

Query  1492  AAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAW  1671
               GVM    N+       ++++VT+ A GAL TP LL +SGL+N NIG+NLHLHPV+  W
Sbjct  455   CLGVMAKALNSRVTMKLQIEAKVTISAGGALLTPPLLISSGLKNKNIGKNLHLHPVLMTW  514

Query  1672  GYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPW  1851
             GYFP++  S    E + K Y+GGI+T++ KV +    S   A+I+TPSL P  F+A+ PW
Sbjct  515   GYFPESNDS----EFKGKVYEGGIITSVHKVPSTDSNSDSRAIIETPSLGPASFAALCPW  570

Query  1852  LSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRIL  2031
              SG D K RM  + RT+ L  + RD   G+  +   ISY + + DK ++K GL++ L+IL
Sbjct  571   ESGLDFKERMLNYPRTSHLITIIRDMACGQVSTEGRISYKLNEIDKENMKAGLKQALKIL  630

Query  2032  AAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSC  2199
              AAGA E+GT    G+ LK  G   +E+ EF++     E +   G    +  SAHQMGSC
Sbjct  631   IAAGAVEVGTHRSDGQRLKCDGIGENEVQEFLDSVCPMEGALSPGEYWNIYSSAHQMGSC  690

Query  2200  RMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             RMGV+ +   V+  GETWE EGLF+ D+SV P+A+GVNPM+TVQ+ AYC +  +  +L+
Sbjct  691   RMGVNEKEGAVDENGETWEAEGLFVCDASVLPSAVGVNPMITVQSTAYCISNRIADYLR  749



>ref|XP_004289970.1| PREDICTED: long-chain-alcohol oxidase FAO2-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=743

 Score =   509 bits (1311),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 304/770 (39%), Positives = 459/770 (60%), Gaps = 60/770 (8%)
 Frame = +1

Query  97    GVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAW  276
             G +S G   S A + ++ ++ +  +P + +       D ++  F++ S S    P  VA 
Sbjct  18    GKFSHG--FSAAQIQSLAAMCEALIPPLSLDD---TSDQALHSFYKASGSEPPIPDEVAD  72

Query  277   MISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRS  456
             +I +R     V +L   L +LS R+G L++CG   L   +P++ +F E+S  KR E ++ 
Sbjct  73    LIRKRGAPEAVGVLSFFLKVLSYRLGNLLVCGYPCLDKNWPFIHNFAEMSLEKREEALQR  132

Query  457   WSCCYIKI-LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKK  633
             WS     I L+  ++ +K+     FFS++  +++N SWKAI Y     + NK        
Sbjct  133   WSREKRLIPLRLLFVVVKIFCFFCFFSRIVGDSQNPSWKAIGY-----NVNK--------  179

Query  634   WITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVS  813
                RE+ +   +E+                 PL KG+I   ++    + + L K G  V+
Sbjct  180   ---REKLIKTPKER-----------------PLEKGIIETMKKTDSTLIESLTKKGIEVT  219

Query  814   PCIQQKGSGNPSF-VIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsll  990
                   G+ +P    I+CD V+VGSG GGGV A VLA +G KV+VLEKG YF     SLL
Sbjct  220   -----DGAAHPQIHKIKCDVVIVGSGCGGGVAAAVLAQSGQKVVVLEKGNYFVPKDYSLL  274

Query  991   egsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLEL  1170
             EG S++E+Y  GG++ASKD  +++LAGS VGGGS +NWSASI+TP  VL+EW   HK+ L
Sbjct  275   EGPSMNELYESGGIMASKDGKMMILAGSTVGGGSAVNWSASIRTPNSVLEEWFVDHKIPL  334

Query  1171  FGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWC  1350
             FGS +Y+ AM+ VC R+GV     +E  QN +LRKGC +LG  V+++PRN+S DHYCG C
Sbjct  335   FGSPDYQSAMDAVCKRIGVTDSCTEENMQNQILRKGCEKLGLKVDSVPRNSSADHYCGSC  394

Query  1351  SFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVV----HNKKTGREQAAGVMFVYQ  1518
             ++GC  G K+GT  TWL D V  G  VI   C+A + +    H   T R++  GV  +  
Sbjct  395   NYGCPTGDKQGTDSTWLVDAVKCG-AVILTGCKAERFIMENDHQGGTSRKRCLGVQAISL  453

Query  1519  NNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGS  1698
                  +   ++++VT+ ACG+L TP L+  SGL+NPNIGRNLHLHPV+ AWG FP+    
Sbjct  454   CKNITKKIQIEAKVTISACGSLLTPPLMITSGLKNPNIGRNLHLHPVLLAWGNFPEDSS-  512

Query  1699  KAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTR  1878
                 E + K+++GGI+T++ KVV+  +     A+++T +L P  F+ ++PW+SG D+K R
Sbjct  513   ----EFKGKAFEGGIITSLHKVVSE-DNQNVRAIVETAALGPASFATLVPWVSGLDMKDR  567

Query  1879  MQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIG  2058
             + +++RTA LFAL RDK SGE  +   I Y + ++DK +++ GL + +RIL AAGA E+G
Sbjct  568   VAKYARTAHLFALVRDKGSGEVRAENKIEYRLDRSDKENIQAGLRQAVRILIAAGAVEVG  627

Query  2059  TCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSS  2226
             T    G+ +  KG  +++++EF++   +    R  G   T+  +AHQMGSC+MG   +  
Sbjct  628   TYRNDGQRIVCKGTKKEDLEEFLDSVIAVGGPRTRGEYWTMYSTAHQMGSCKMGATEKEG  687

Query  2227  VVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
              V+  GE+WE EGLF+ D S+ PTA+GVNPM+T+Q+ AYC ++ +   LK
Sbjct  688   GVDENGESWEAEGLFVCDGSLLPTAIGVNPMITIQSTAYCVSKKIADSLK  737



>ref|XP_004289971.1| PREDICTED: long-chain-alcohol oxidase FAO2-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=743

 Score =   509 bits (1311),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 303/762 (40%), Positives = 456/762 (60%), Gaps = 58/762 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
              S A + ++ ++ +  +P + +       D ++  F++ S S    P  VA +I +R   
Sbjct  24    FSAAQIQSLAAMCEALIPPLSLDD---TSDQALHSFYKASGSEPPIPDEVADLIKKRGVP  80

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  480
               V LL   L +LS R+GTL++CG   L  + P++ +F E+S  KR E ++ WS     I
Sbjct  81    EAVGLLSFFLKVLSYRLGTLLVCGYPCLDRKGPFIHNFAEMSLEKREEALQRWSREKRLI  140

Query  481   -LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHM  657
              L+  ++ +K+     FFS++  +++N SWKAI Y     + NK           RE+ +
Sbjct  141   PLRLLFVVVKIFCFFCFFSRIVGDSQNPSWKAIGY-----NVNK-----------REKLI  184

Query  658   TLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGS  837
                +E+                 PL KG+I   ++    + + L K G  V+      G+
Sbjct  185   KTPKER-----------------PLEKGIIETMKKTDSTLIESLTKKGIEVT-----DGA  222

Query  838   GNPSF-VIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEM  1014
              +P    I+CD V+VGSG GGGV A VLA +G KV+VLEKG YF     SLLEG S++E+
Sbjct  223   AHPQIHKIKCDVVIVGSGCGGGVAAAVLAQSGQKVVVLEKGNYFVPKDYSLLEGPSMNEL  282

Query  1015  YLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRH  1194
             Y  GG++ASKD  +++LAGS VGGGS +NWSASI+TP  VL+EW   HK+ LFGS +Y+ 
Sbjct  283   YESGGIMASKDGKMMILAGSTVGGGSAVNWSASIRTPNSVLEEWFVDHKIPLFGSPDYQS  342

Query  1195  AMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGK  1374
             AM+ VC R+GV     +E  QN +LRKGC +LG  V+++PRN+S DHYCG C++GC  G 
Sbjct  343   AMDAVCKRIGVTDSCTEENMQNQILRKGCEKLGLKVDSVPRNSSADHYCGSCNYGCPTGD  402

Query  1375  KKGTSETWLADLVDSGNGVIFPECEAVKVV----HNKKTGREQAAGVMFVYQNNGAKEFC  1542
             K+GT  TWL D V  G  VI   C+A + +    H   T R++  GV  +       +  
Sbjct  403   KQGTDSTWLVDAVKCG-AVILTGCKAERFIMENDHQGGTSRKRCLGVQAISLCKNITKKI  461

Query  1543  FVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEK  1722
              ++++VT+ ACG+L TP L+  SGL+NPNIGRNLHLHPV+ AWG FP+        E + 
Sbjct  462   QIEAKVTISACGSLLTPPLMITSGLKNPNIGRNLHLHPVLLAWGNFPEDSS-----EFKG  516

Query  1723  KSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTA  1902
             K+++GGI+T++ KVV+  +     A+++T +L P  F+ ++PW+SG D+K R+ +++RTA
Sbjct  517   KAFEGGIITSLHKVVSE-DNQNVRAIVETAALGPASFATLVPWVSGLDMKDRVAKYARTA  575

Query  1903  ILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKI  2082
              LFAL RDK SGE  +   I Y + ++DK +++ GL + +RIL AAGA E+GT    G+ 
Sbjct  576   HLFALVRDKGSGEVRAENKIEYRLDRSDKENIQAGLRQAVRILIAAGAVEVGTYRNDGQR  635

Query  2083  LKPKGASRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGET  2250
             +  KG  +++++EF++   +    R  G   T+  +AHQMGSC+MG   +   V+  GE+
Sbjct  636   IVCKGTKKEDLEEFLDSVIAVGGPRTRGEYWTMYSTAHQMGSCKMGATEKEGGVDENGES  695

Query  2251  WEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             WE EGLF+ D S+ PTA+GVNPM+T+Q+ AYC ++ +   LK
Sbjct  696   WEAEGLFVCDGSLLPTAIGVNPMITIQSTAYCVSKKIADSLK  737



>ref|XP_010670985.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Beta vulgaris subsp. 
vulgaris]
Length=748

 Score =   509 bits (1310),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 320/786 (41%), Positives = 453/786 (58%), Gaps = 80/786 (10%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVP---QHAAVDDDSVKLFFQTSASIAGTPQRVAWMISER  291
             LS + M ++ SI +TF P +D P    H    ++S+K FFQ+SAS    P  VA ++ +R
Sbjct  24    LSSSEMESLISICETFFPPLDPPSKLDHHDQINNSIKYFFQSSASQKPIPNEVAEVMKDR  83

Query  292   LQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCC-  468
                  VIL+R+ LWL+STR+GTL+LCG      ++PY+  F  +   +R  I+++WS   
Sbjct  84    GLVEAVILVRVVLWLISTRLGTLLLCGFLCFGKEWPYITKFSHLPIERRERILKNWSSHR  143

Query  469   YIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITRE  648
             +   L+  +  +K + L   FS V+++  N +W+AIDY         KP   + K I +E
Sbjct  144   FFSPLRLVFYFLKSLCLYFCFSLVDDHAHNPAWEAIDY---------KPDTTNSKAINQE  194

Query  649   QHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQ  828
             +                         PL  G+I    E    +   L   G  V+     
Sbjct  195   R-------------------------PLENGIIETFYETPTTLLQSLTSKGLSVT-----  224

Query  829   KGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslD  1008
             +   +  + I+CD V+VGSG GGGV A +LA AG KV+VLEKG Y+     S LEG S+D
Sbjct  225   EDHIDNLYRIKCDVVIVGSGCGGGVAAAILAGAGQKVVVLEKGNYYTAPDYSSLEGPSMD  284

Query  1009  EMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEY  1188
             E+   GG++ + D  ++LLAGS VGGG+ +NWSA++ TP  VLKEW E H L LFGS +Y
Sbjct  285   ELLEKGGMIPTTDGAVMLLAGSTVGGGTAVNWSAALNTPDPVLKEWSEEHGLSLFGSPQY  344

Query  1189  RHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKD  1368
             + AM++V  R+GV +E   EGFQN VLRKGC  LG   + +PRN+S  HYCG C +GC+ 
Sbjct  345   KFAMQSVTQRLGVTTECVKEGFQNQVLRKGCENLGLEADRVPRNSSESHYCGSCYYGCRS  404

Query  1369  GKKKGTSETWLADLVDSGNGVIFPECEA--VKVVHNKKTGREQAAGVMFVYQNNGAKEFC  1542
               K+GT  TWL D V+ G  VI   C+A  +++V + +    +  GV+    NN  K   
Sbjct  405   ADKQGTDVTWLVDAVNLG-AVIITGCKAEKLRLVKHGRRRENRCIGVVARSLNNEIKREL  463

Query  1543  FVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYF-PDAPGSKAWPEPE  1719
              ++++VT+ ACG+L TP LL +SGLRN  IG+NLHLHP +  WGYF P  P S    E E
Sbjct  464   QIEAKVTISACGSLRTPPLLMSSGLRNKKIGKNLHLHPSLMVWGYFPPQGPTS----EFE  519

Query  1720  KKSYQGGIMTAMSKVVANFEESGY-GALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSR  1896
              KSY+GG++T+  +V+ +   +    ALI+TP+L P   +A+ PW SG DIK RM R+SR
Sbjct  520   GKSYEGGLITSAHRVILDQRPNSMPRALIETPALGPAACAALSPWESGNDIKKRMLRYSR  579

Query  1897  TAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAG  2076
             TA LF + RDK SGE  S   ISY + + D+ ++  GL + L+IL AAGA E+GT    G
Sbjct  580   TAHLFVMVRDKGSGEVKSERRISYELTQEDRENMTAGLRRALKILIAAGAVEVGTYRSDG  639

Query  2077  KILKPKGASRDEIDEFVEKESSRDLGNLSTLIG-----------SAHQMGSCRMGVDPRS  2223
             + ++  G + +EI+EF        LG++S   G           +AHQMGSCRM      
Sbjct  640   QRIECIGKNEEEIEEF--------LGSVSATKGPMAACFWAVYCTAHQMGSCRMSKRENE  691

Query  2224  SVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHNHMQGYI  2403
               V+  GE+WE EGLF+ D SV P+A+GVNPM+T+Q+ AYC A+ + + LK         
Sbjct  692   GAVDENGESWEAEGLFVCDGSVLPSAVGVNPMITIQSTAYCIAKKLAESLK---------  742

Query  2404  KGDSNF  2421
             KG+ NF
Sbjct  743   KGEFNF  748



>gb|EPS58840.1| hypothetical protein M569_15969, partial [Genlisea aurea]
Length=668

 Score =   506 bits (1302),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 295/687 (43%), Positives = 414/687 (60%), Gaps = 53/687 (8%)
 Frame = +1

Query  340   STRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW-SCCYIKILKTFYLGMKVMV  516
             STR+G+L++CG+  L  ++PY++ F EI    R EIVR W    ++  ++  ++ +K+++
Sbjct  24    STRLGSLLICGRLCLVGKWPYVRRFSEIGVEDREEIVRRWFGNWFLTPIRVAFVFLKLLI  83

Query  517   LLSFFSQVNENNENISWKAIDYCGPDPDSN-KKPAGKSKKWITREQHMTLSEEQKKGEED  693
             LL FFS+V+EN++N +WKAI Y   DP    KK  G+                       
Sbjct  84    LLVFFSRVDENSQNPAWKAIGYEVDDPGRRCKKSDGRR----------------------  121

Query  694   VIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDav  873
                        PL +G++    E      D L + G   +P  ++      ++ +ECDAV
Sbjct  122   -----------PLERGIVEGRLETESSFVDSLAEKGLTATPSEREN-----AYRVECDAV  165

Query  874   vvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMD  1053
             VVGSG GGGV A VLA AGHKV+VLEKG YFA    S LEG SL ++Y  GG+ +S +  
Sbjct  166   VVGSGCGGGVAAAVLARAGHKVVVLEKGDYFAADDYSGLEGPSLRQLYESGGVFSSLEGK  225

Query  1054  ILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQS  1233
             +++LAG+ VGGGS +NWSA I+TPP VL +W   +KL LF S  Y  AM+ + SR+GV  
Sbjct  226   LMILAGATVGGGSAVNWSACIKTPPEVLNQWANDYKLPLFTSPGYASAMDEIWSRIGVTQ  285

Query  1234  EVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLV  1413
                 E FQN VLRKGC  LG   E++  N+S +H+CG C +GC  G KKGT  TWL D V
Sbjct  286   NCAAESFQNKVLRKGCEALGLKSESVATNSSENHFCGSCCYGCMRGDKKGTDTTWLVDAV  345

Query  1414  DSGNGVIFPECEAVK-VVHNKKTGREQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCT  1590
             +SG  VI   C+A K ++ N    + +  G+   + N+  K+   + +R TV ACGAL T
Sbjct  346   ESG-AVIISGCKAQKLILQNGGRRKNKCVGIEASFTNSHIKKRIKIIARATVSACGALST  404

Query  1591  PSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVA  1770
             P  L +SGLRN NIGRNLHLHPV+ AWGYFP+         P  KSYQGGI+T++ KV++
Sbjct  405   PPFLISSGLRNRNIGRNLHLHPVLMAWGYFPET------ESPNGKSYQGGIITSLHKVIS  458

Query  1771  -NFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAP  1947
              N       A++++P L PG F+A+ PW SG D+K RM R+SRTA LF++ +D+  GE  
Sbjct  459   ENGSSPKVKAIVESPILGPGSFAALCPWESGEDMKNRMMRYSRTAHLFSIIKDEAGGEVI  518

Query  1948  SPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFV  2127
                 ISY++ + DK ++ +GL   LRIL +AGA E+GT    G+ LK +G S  EI+EF+
Sbjct  519   REGRISYHLNQIDKENITSGLRTALRILISAGAVEVGTHRSDGQRLKCRGISEKEIEEFL  578

Query  2128  EK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFP  2295
             +     E  + +    ++  SAHQMGSCRMG +     V+  GE+WE EGLF+ DSS+ P
Sbjct  579   DGVTAPEGPKSMVRDWSVYCSAHQMGSCRMGRNEEEGGVDENGESWEAEGLFVCDSSLLP  638

Query  2296  TALGVNPMVTVQAIAYCTAQSVLKFLK  2376
              A+GVNPM+T+QA +YC + ++   LK
Sbjct  639   GAIGVNPMITIQATSYCISLNIADNLK  665



>ref|XP_007200494.1| hypothetical protein PRUPE_ppa018458mg [Prunus persica]
 gb|EMJ01693.1| hypothetical protein PRUPE_ppa018458mg [Prunus persica]
Length=754

 Score =   509 bits (1310),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 306/777 (39%), Positives = 457/777 (59%), Gaps = 68/777 (9%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVP---------QHAAVDDDSVKLFFQTSASIAGTPQRVA  273
              SPA + ++ +I +  +P + +          +  + DD ++   ++ S S    P  VA
Sbjct  25    FSPAQIQSLAAICEALVPPLSLEDTINNNNNNKEESPDDQALHSIYRASGSQPPIPDEVA  84

Query  274   WMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVR  453
              ++ +R     +  ++L L +LS R+GTL+LCG   LS ++P++ SF E+S  KR E+++
Sbjct  85    ELMLKRALPEVMEGMKLFLKMLSFRLGTLLLCGHRCLSWKWPFIHSFSEMSLEKREEVLK  144

Query  454   SWSCCYIKI-LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSK  630
              WS   + + L+  +L +K+    +FFS+++EN+ N +WKA+ Y   D ++NKK     K
Sbjct  145   KWSKEKLVLTLRLMFLVVKIFCFYTFFSRLDENSRNPAWKAVGY---DLNTNKKLIKTPK  201

Query  631   KWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPV  810
             +                               PL +G+I    E        L K G  V
Sbjct  202   E------------------------------RPLEQGIIETLNESDSTFVQSLTKRGLQV  231

Query  811   SPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsll  990
             S       + +    I+CD V+VGSG GGGV A VLA +G KV+V+EKG YF     S L
Sbjct  232   S-----DDTTHNIHKIKCDVVIVGSGCGGGVAAAVLAQSGQKVMVVEKGNYFLPKDYSSL  286

Query  991   egsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLEL  1170
             EG S++E+Y  GG+++S D  I++LAGS VGGGS INWSASI+TP  VL EW   HK+ L
Sbjct  287   EGPSMNELYESGGIMSSVDGMIMILAGSTVGGGSAINWSASIRTPDTVLHEWSVDHKVPL  346

Query  1171  FGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWC  1350
             + S +Y++AM+ VC R+ V     +E FQN +LRKGC  LG  V+ +PRN+  DHYCG C
Sbjct  347   YASSDYKYAMDVVCKRISVTDSCTEENFQNQILRKGCDTLGLKVDLVPRNSPGDHYCGSC  406

Query  1351  SFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVK-VVHNKKTG---REQAAGVMFVYQ  1518
             ++GC  G+K+GT  TWL D V  G  VI   C+A K ++ N   G   R++  GV     
Sbjct  407   NYGCPTGEKQGTDSTWLVDAVKCG-AVILTGCKAEKFILENDSQGGGTRKRCLGVEATSL  465

Query  1519  NNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGS  1698
             +   K+   ++++VT+ ACG+L TP L+ +SGL+NPNIGRNLHLHPV+ +WGYFP+    
Sbjct  466   SKNMKKKLQIEAKVTISACGSLLTPPLMISSGLKNPNIGRNLHLHPVLLSWGYFPEHES-  524

Query  1699  KAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTR  1878
                 E   ++Y+GGI+T++ KVV++   +   A+I+TP+L P  F+ + PW+S  D+K R
Sbjct  525   ----EFRGRTYEGGIITSLHKVVSD--TTNVRAIIETPALGPASFATLSPWISRLDMKDR  578

Query  1879  MQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIG  2058
             M++++RTA LFAL RDK SG       I Y + + DK +L+ GL + LRIL AAGA E+G
Sbjct  579   MEKYARTAHLFALVRDKGSGVVKREGRIHYTLDQLDKENLQVGLRQALRILIAAGAVEVG  638

Query  2059  TCHRAGKILKPKGASRDEIDEFVEK------ESSRDLGNLSTLIGSAHQMGSCRMGVDPR  2220
             T    G+ +K KG   ++++EF++        SSR+   L T   SAHQMGSCRM     
Sbjct  639   TYRNDGQRIKCKGTKHEDLEEFLDSVVAAAGPSSRE--ELWTTYSSAHQMGSCRMSASEE  696

Query  2221  SSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHNHM  2391
                V+  GE+WE +GLF+ D S+ PTA+GVNPM+T+Q+ AYC ++ + + L+   ++
Sbjct  697   EGGVDENGESWEAKGLFVCDGSLLPTAIGVNPMITIQSTAYCISKKIAESLEKEKYI  753



>ref|XP_008785203.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Phoenix dactylifera]
Length=758

 Score =   508 bits (1309),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 303/774 (39%), Positives = 454/774 (59%), Gaps = 63/774 (8%)
 Frame = +1

Query  103   YSGGCPLSPAVMATVTSISDTFLPAVDVPQ-HAAVDDD-----SVKLFFQTSASIAGTPQ  264
             YS G   SP+ + ++ ++ +  +P++ + + H +   +     S++ F+  S S +  P 
Sbjct  26    YSHG--FSPSQIQSLAAMCEALIPSLPMEELHVSSGKEDPPTKSLQAFYLASGSESPVPD  83

Query  265   RVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAE  444
              VA ++ +R     V+L++L LWLL+T++GTL+LCG  SL   FP++  F ++   KR E
Sbjct  84    EVAELLVKRGLREAVLLVKLVLWLLATKLGTLVLCGFLSLRGGFPFINKFSDMPVEKREE  143

Query  445   IVRSWSCCYIKI-LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAG  621
             +++ W+     I L+  ++ +KV     F+S  NEN+EN+SW AI Y  P  +  +K   
Sbjct  144   VLKRWNKENFFIPLRMVFVMVKVFCFHIFYSMTNENSENLSWNAIGYSLPTEEKPRKS--  201

Query  622   KSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLG  801
                    RE+                         PL KG+I    +    + + L K G
Sbjct  202   ------QRER-------------------------PLEKGIIETMDQTDASLLESLAKKG  230

Query  802   FPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARssl  981
               VS    Q       + I CD  +VGSG GGGV A VLA+AG KV+V+EKG YF     
Sbjct  231   LTVSQDPMQN-----IYRIRCDVAIVGSGCGGGVAAAVLASAGRKVVVIEKGNYFTSEDY  285

Query  982   sllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHK  1161
             + +E  S+ E+Y  GG+ ++ D  ++LLAGS VGGGS +NW+A I+TP HVL+EW E  +
Sbjct  286   TSIEAPSMYELYESGGIHSTVDGKVMLLAGSTVGGGSAVNWAACIKTPDHVLREWAEERQ  345

Query  1162  LELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYC  1341
             L LF S +Y  AM+ VC R+GV     +EGFQN VLRKGC  LG  V+++PRN+S  H+C
Sbjct  346   LPLFTSTDYLSAMDAVCRRLGVTESCSEEGFQNKVLRKGCQNLGLRVDSVPRNSSESHFC  405

Query  1342  GWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNK----KTGREQAAGVMF  1509
             G C +GC+ G K+GT  TWL D VD G   I   C+A + V  +    +  R++  G++ 
Sbjct  406   GSCCYGCRAGDKRGTDATWLVDAVDCG-AAILTGCKAERFVFVENEPGEKKRKKCVGLIA  464

Query  1510  VYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDA  1689
                ++   +   ++++VT+ ACG+L TP L+  SGL NPNIGRNL LHP   AWGYFPD+
Sbjct  465   RSSSHKVTKKLEIEAKVTISACGSLLTPPLMIASGLANPNIGRNLRLHPAALAWGYFPDS  524

Query  1690  PGSKAWPEPEKKSYQGGIMTAMSKVVAN-FEESGYGALIQTPSLHPGMFSAIMPWLSGTD  1866
                    +   ++++GGI+T++ +V A    ++   A+I+TP+L P  F+ ++PW+SG D
Sbjct  525   V-----SDLRGRAFEGGIITSLHEVRAQENSDASLRAIIETPALGPAAFATLVPWVSGRD  579

Query  1867  IKTRMQRFSRTAILFALARDKTSGEAPSPFSI-SYNMQKTDKVSLKNGLEKVLRILAAAG  2043
             +K RM R+SRTA LFAL RD+ SG       I  Y     D+ +++ GL + LRIL AAG
Sbjct  580   MKERMARYSRTAHLFALVRDRGSGTVEGKEGIVRYRFDGLDRENMREGLRRALRILVAAG  639

Query  2044  AEEIGTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGV  2211
             A E+GT    G+ +K KG   ++++EF++  ++    R    L T+ GSAHQMGSCRMGV
Sbjct  640   AVEVGTHRSDGQRIKCKGIKEEDLEEFLDGITAVGGPRSRSELWTIYGSAHQMGSCRMGV  699

Query  2212  DPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
                   V+  GE+WE +GLF+ D SV PTALG+NPM+T+Q++AYC ++ + + L
Sbjct  700   SEEEGGVDERGESWEAQGLFVCDGSVLPTALGINPMITIQSVAYCLSKGIAESL  753



>ref|XP_006354463.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Solanum 
tuberosum]
Length=741

 Score =   508 bits (1307),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 305/768 (40%), Positives = 460/768 (60%), Gaps = 60/768 (8%)
 Frame = +1

Query  103   YSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDS-VKLFFQTSASIAGTPQRVAWM  279
             YS G   S + + T+TSI +T LP +  P ++  +++  ++ F + S S    P  VA +
Sbjct  18    YSHG--FSSSEIETLTSICETILPPL--PLNSLQENNKKIQNFHKVSGSQYPIPDEVAEI  73

Query  280   ISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW  459
             + +R      +L+R  L +LSTRIG+L+LCG       +PY+  F +IS  KR  +++ W
Sbjct  74    VMKRAFFEARMLVRGLLRILSTRIGSLLLCGLFCFGKSWPYINKFSDISLDKREIVMQKW  133

Query  460   -SCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKW  636
              +  +   ++  ++ +K + L  FF+QV E+++N +W  I Y                  
Sbjct  134   FNNRFFTPVRLAFVFVKFLCLYIFFTQVGEDSKNPAWDDIGY-----------------Q  176

Query  637   ITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSP  816
             +  E++ + + +++                PL KG+I    E    +   L + G  V+ 
Sbjct  177   VDNEENSSETPDER----------------PLQKGIIETIYETESTIVKSLVEKGLKVT-  219

Query  817   CIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslslleg  996
                 + + N  + ++CD V+VGSG GGGV A VLA++G KV+VLEKG YFA+S  S LEG
Sbjct  220   ----EDTKNNMYKVQCDVVIVGSGCGGGVAASVLASSGQKVVVLEKGNYFAKSDYSSLEG  275

Query  997   sslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFG  1176
              S  +MY  GG+ ++ D  +++LAGS VGGGS +NWSA I+TP  +++EW +  ++ +F 
Sbjct  276   PSQSQMYESGGIFSTLDGKVMILAGSTVGGGSAVNWSACIKTPDSIIQEWGDDKRISMFK  335

Query  1177  SKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSF  1356
             + EY  AM+ VC R+ V  +   EG QN +L+KGC  LG  VE + RN+S DHYCG C +
Sbjct  336   TPEYVSAMDKVCERINVTEKCTQEGLQNQILQKGCERLGLEVEGVARNSSEDHYCGSCCY  395

Query  1357  GCKDGKKKGTSETWLADLVDSGNGVIFPECEAVK-VVHNKKTGR---EQAAGVMFVYQNN  1524
             GC+ G+KKGT  TWL D VD G  VI   C+A + ++ NKK G+   ++  GV+    N 
Sbjct  396   GCRRGEKKGTDTTWLVDAVDCG-AVIITGCKAERFILENKKYGKTRSKKCLGVISTSMNK  454

Query  1525  GAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKA  1704
                +   ++++VT+ ACG+L TP L+ +SGL+N NIGRNLHLHPV+ AWGYFP++     
Sbjct  455   DITKSICIEAKVTISACGSLLTPPLMISSGLKNRNIGRNLHLHPVIMAWGYFPESN----  510

Query  1705  WPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQ  1884
               + + K Y+GGI+T++ KV ++  +S   A+I+ P+L PG F+A+ PW SG DIK R+ 
Sbjct  511   -SDLKGKIYEGGIITSVHKVGSH--DSNVRAIIEAPALGPGSFAALCPWTSGEDIKNRLL  567

Query  1885  RFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTC  2064
             ++ RTA LFA+ +D  SGE  S   I+Y    TDK SLK GL + LRIL AAGA E+GT 
Sbjct  568   KYDRTAHLFAMVKDVGSGEVRSEGRINYTFNGTDKESLKLGLRQALRILIAAGAAEVGTQ  627

Query  2065  HRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVV  2232
                G+ +K KG S   ++ F++     E  + L    T   SAHQMGSCRMG++ + S V
Sbjct  628   RSDGQRIKCKGQSEKALESFLDTVTAAEGPKSLVKDFTTYCSAHQMGSCRMGMNEKDSAV  687

Query  2233  NPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             +  GE+WE EGLF+ D+SV P A+GVNPM+T+Q+ AYC ++ + + +K
Sbjct  688   DENGESWEAEGLFVCDASVLPGAVGVNPMITIQSTAYCLSKKIAEMIK  735



>gb|EYU46421.1| hypothetical protein MIMGU_mgv1a001868mg [Erythranthe guttata]
Length=747

 Score =   508 bits (1308),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 302/762 (40%), Positives = 450/762 (59%), Gaps = 56/762 (7%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAV-DDDSVKLFFQTSASIAGTPQRVAWMISERLQ  297
              S + + ++ ++ +  +P++       + DD+++  ++ +SAS    P   A +I +R  
Sbjct  25    FSSSQIQSLAAVCEALIPSLPTNGVNQISDDNALYSYYTSSASQTPFPNETAELIVKRGI  84

Query  298   HPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIK  477
                V+++ L L  LSTRIGTL+LCG   L  ++P++  F E+S +KR  I++ WS   + 
Sbjct  85    PKAVLVVSLVLKFLSTRIGTLLLCGSNCLDWKWPFIHKFSELSINKRESILQKWSRGTLV  144

Query  478   I-LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQH  654
             + L+T +  +KV    +FFS  +E ++N +W+AI Y                       H
Sbjct  145   LPLRTVFFMLKVTCFYTFFSLTDEKSQNPAWEAIGY-----------------------H  181

Query  655   MTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKG  834
             +   E   + E++           PL KGVI   +E +  + + L + G  V+   +   
Sbjct  182   IEKVEISGQPEKER----------PLEKGVIETEKENKLTLRESLVQKGLKVAENPKDHN  231

Query  835   SGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEM  1014
             + N    IECD V+VGS  GGGV A VLA AG KV+VLEKG YF     S LEG S++EM
Sbjct  232   TLN----IECDVVIVGSDCGGGVAAAVLAKAGLKVVVLEKGHYFTAEDYSELEGPSMNEM  287

Query  1015  YLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRH  1194
             Y  GG+ ++     +LLAGS VGGGS +NWSASI+TP HVL+EW    K+ +FG  EY+ 
Sbjct  288   YASGGIFSTLHGKFILLAGSTVGGGSAVNWSASIKTPDHVLQEWSAEKKISMFGGAEYQS  347

Query  1195  AMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGK  1374
             AM+ V  R+GV     +EGFQN V+RKGC  LG  VE + RN++ +HYCG C +GC+ G+
Sbjct  348   AMDEVWGRIGVTENCVEEGFQNQVVRKGCENLGLKVEGVARNSTENHYCGSCGYGCRRGE  407

Query  1375  KKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQ---AAGVMFVY--QNNGAKEF  1539
             KKGT  TWL D V++G  VI   C+A K +  K    EQ     GV+     ++   +  
Sbjct  408   KKGTDSTWLVDAVNNG-AVILTGCKAEKFLLVKDKNLEQRKRCKGVIATVESESESTRMK  466

Query  1540  CFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPE  1719
               ++++ +V ACGAL TP LL +SGL+N NIG+NLHLHPV+FAWGYFP++ GS+      
Sbjct  467   LHIEAKASVAACGALFTPPLLVSSGLKNKNIGKNLHLHPVLFAWGYFPES-GSQL----R  521

Query  1720  KKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRT  1899
              K+++GGI+T+M+KV+    E  +  ++QT    P  ++  +PW++G D+K RM ++SRT
Sbjct  522   GKNFEGGIITSMNKVITG--EPNFRTIVQTAGFGPASYAVFLPWVAGKDMKDRMSKYSRT  579

Query  1900  AILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGK  2079
             A+LF L RD  SGE      +SY + K D+ +LK GL + LRI+ AAGA E+GT    G+
Sbjct  580   ALLFTLVRDVGSGEVREEGRVSYKLNKFDEENLKAGLRQCLRIMIAAGAAEVGTFQNNGQ  639

Query  2080  ILKPKGASRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGE  2247
              L+ +G   +++++F+EK  +       G       SAHQM SCRMG D R   V+  GE
Sbjct  640   RLECEGVGGEDVEKFLEKVMAAGGPSSGGQYWNTYASAHQMSSCRMGADERDGAVDGNGE  699

Query  2248  TWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
             +WE +GLF+ D SV PTA+GVNPM+T+++ AYC ++ +  +L
Sbjct  700   SWEGKGLFVCDGSVLPTAVGVNPMITIESTAYCISKRIADYL  741



>ref|XP_008224323.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Prunus mume]
Length=751

 Score =   508 bits (1308),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 320/787 (41%), Positives = 466/787 (59%), Gaps = 66/787 (8%)
 Frame = +1

Query  61    LFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVP------QHAAVDDDSVK  222
             L S G+      G YS G   S A M ++ S+ +  LPA+ +       +     + +V+
Sbjct  8     LLSGGR----RSGKYSHG--FSSAEMQSLASVCEALLPALPLNDFCFEGKEEQRTNKAVQ  61

Query  223   LFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPY  402
              F + S +    P  VA ++ +R     V+L+R+ LW+LSTR+GTL+LCG      ++P+
Sbjct  62    SFHKASGAQTPIPDEVAELLVKRAFIEAVVLVRVVLWVLSTRLGTLLLCGSLCFGERWPF  121

Query  403   LQSFPEISPHKRAEIVRSW-SCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAID  579
             + +F  +   KR  +++ W    ++  ++  ++ +K + L  FFS+V++N EN  W+AI 
Sbjct  122   ILNFSSLPLAKRERLLQKWFKHRFLTPIRLAFVYIKFLCLYIFFSRVDKNAENPIWQAIG  181

Query  580   YCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQ  759
             Y                       H+ + ++        IP  P+    PL KG+I    
Sbjct  182   Y-----------------------HVDIDDQN-------IPTAPKER--PLQKGMIETIY  209

Query  760   EPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKV  939
             E    +   L + G  V    Q+       + I+CD VVVGSG GGGV A VLA++G KV
Sbjct  210   ETDTTLLHSLAEKGLTVRHDPQEN-----LYKIKCDVVVVGSGCGGGVAAAVLASSGQKV  264

Query  940   LVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQ  1119
             +VLEKG YF  S  S LEG S D+MY  GG+ A+ D  +++ AGS VGGGS +NWSA I+
Sbjct  265   IVLEKGNYFTHSDYSSLEGPSQDQMYELGGIFATIDGKLVIQAGSTVGGGSAVNWSACIR  324

Query  1120  TPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYP  1299
             TP +VL+EW + H +  FG  EY  AM+TVC R+GV     +EGFQN VLRKGC  LG  
Sbjct  325   TPDNVLEEWAKDHDIRFFGEPEYVSAMDTVCERIGVTDNCVEEGFQNQVLRKGCENLGLG  384

Query  1300  VETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVK-VVHNKK  1476
             V+ +PRN+S  HYCG C +GC+ G+KKGT  TWL D VD G  VI   C A K V+ N K
Sbjct  385   VDFVPRNSSEKHYCGSCGYGCRKGEKKGTDSTWLLDAVDHG-AVILTGCRAEKFVLENIK  443

Query  1477  TG---REQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLH  1647
             +G   +++ +GVM    +N   +   ++++VT+ ACGAL TP L+ +SGL+N NIGRNLH
Sbjct  444   SGSLRKKKCSGVMAKSLSNNISKKLQIEAKVTISACGALLTPLLMISSGLKNKNIGRNLH  503

Query  1648  LHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPG  1827
             LHPV+ AWGYFP++       E + K Y+GGI+T++ KV +   +S   A+I+TP+L PG
Sbjct  504   LHPVLMAWGYFPESN-----SEFKGKIYEGGIITSVHKVAS--ADSKLRAIIETPALGPG  556

Query  1828  MFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNG  2007
              FS++ PW SG DIK RM ++ RT  L ++ RD+ SG       +SY  + +DK +L+ G
Sbjct  557   AFSSLCPWESGEDIKKRMLKYGRTCHLISIIRDRGSGIVMKGGRVSYEFEASDKENLEAG  616

Query  2008  LEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLIG  2175
             L + LRIL AAGA E+GT    G  +K KG  +++++EF++  S+    + L    T   
Sbjct  617   LRQALRILIAAGAVEVGTHRSDGLRIKCKGIEKEKLEEFLDMVSAEKGPQSLVENWTTYS  676

Query  2176  SAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQ  2355
             SAHQMGSCRMG++ +   V+  GE+WE EGLF+ D+SV P+A+GVNPM+T+Q+ AYC ++
Sbjct  677   SAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPSAVGVNPMITIQSTAYCLSK  736

Query  2356  SVLKFLK  2376
              +   LK
Sbjct  737   RIAGSLK  743



>gb|KDO60414.1| hypothetical protein CISIN_1g004496mg [Citrus sinensis]
Length=748

 Score =   507 bits (1305),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 312/763 (41%), Positives = 446/763 (58%), Gaps = 66/763 (9%)
 Frame = +1

Query  136   MATVTSISDTFLPAVD----VPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHP  303
             + ++ +I  T +P +       QH+   + ++  F++ SAS    P  VA ++ +R Q  
Sbjct  28    IESLAAICQTLVPPLPPETITKQHS--HNQAIVSFYKASASQHPIPHEVAELMVKRGQPQ  85

Query  304   KVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSC-CYIKI  480
              V L RL L LLS R+GTL+LCG       +P++ +F EIS  KR +I++ WS   Y+  
Sbjct  86    AVFLARLILTLLSFRLGTLLLCGYLCFDWNWPFIHNFSEISLEKREKILKKWSRERYLLP  145

Query  481   LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMT  660
             L+  ++ +K+  L  FF++ +E +EN +W+AI Y     + + KP G+            
Sbjct  146   LRIVFVMIKMFCLFDFFARTDEKSENPAWEAIGYHVDTREPSNKPRGER-----------  194

Query  661   LSEEQKKGEEDVIPMNPELLLGPLHKGVINL--NQEPRRQVFDRLQKLGFPVSPCIQQKG  834
                                   PL KG++      E    +F RL   G  V+   +   
Sbjct  195   ----------------------PLQKGIVETVHENENDHSLFQRLVDHGLQVTVDHEHN-  231

Query  835   SGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEM  1014
                  F I+CD VVVGSG GGGV A VLA++G KVLVLEKG YF     S LEG S+ E+
Sbjct  232   ----LFEIKCDVVVVGSGCGGGVAAAVLASSGQKVLVLEKGNYFVAEDYSSLEGPSMHEL  287

Query  1015  YLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRH  1194
             Y  GGL+++ D   ++ AGS VGGGS +NWSA I+TP  VL++W   HK+ LFGS +YR 
Sbjct  288   YESGGLLSTLDGKFMVFAGSAVGGGSAVNWSACIETPDSVLRDWFVEHKIPLFGSLDYRA  347

Query  1195  AMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGK  1374
             AM+ V  R+GV     +EGFQN VLRKGC  LG+ VE++ RN   +HYCG C++GC+ G 
Sbjct  348   AMDKVSKRIGVTEHCTEEGFQNQVLRKGCENLGFKVESVARNTPEEHYCGSCNYGCRTGD  407

Query  1375  KKGTSETWLADLVDSGNGVIFPECEAVK--VVHNKKTGR-EQAAGVMFVYQNNGAKEFCF  1545
             KKGT  TWL D VD+G  VI    +A K  +V NK + R ++  GV     N        
Sbjct  408   KKGTDVTWLVDAVDNG-AVILAGFKAEKFILVDNKDSIRSKKCLGVTATALNKNVTRKLQ  466

Query  1546  VKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKK  1725
             +K++ T+ ACG+L TP L+ +SGL NPNIG NLHLHPV+ AWGY PD        E + K
Sbjct  467   IKAKATISACGSLLTPPLMISSGLENPNIGTNLHLHPVLLAWGYIPDHVS-----ELKGK  521

Query  1726  SYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAI  1905
             +++GGI+T++ KVV+  E+S   A+I++P++ P  F+A  PW+SG ++K RM R+ R A 
Sbjct  522   TFEGGIITSIHKVVS--EDSKVQAIIESPAMGPASFAASFPWISGRELKDRMLRYGRIAQ  579

Query  1906  LFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKIL  2085
             LFAL RD+ SGE      I Y + K DK +LK GL + LRIL AAGAEE+GT    G  +
Sbjct  580   LFALVRDQGSGEVKVEGKIKYRLSKNDKENLKTGLRQALRILIAAGAEEVGTYRSDGHRI  639

Query  2086  KPKGASRDEIDEFVEKESSRDLGNLS------TLIGSAHQMGSCRMGVDPRSSVVNPMGE  2247
             + KG   ++++EF+   S   +G ++      ++  SAHQMGSCRMG       V+  GE
Sbjct  640   RCKGIKEEDLEEFI--GSIEVVGGMASRGEHWSVYFSAHQMGSCRMGATEEDGAVDENGE  697

Query  2248  TWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             +WE EGLF+ D SV P+A+G+NPM+T+++ +YC ++ +   LK
Sbjct  698   SWEAEGLFVCDGSVLPSAIGINPMITIESTSYCISKKIADSLK  740



>ref|XP_009610950.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Nicotiana tomentosiformis]
Length=742

 Score =   506 bits (1304),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 309/769 (40%), Positives = 455/769 (59%), Gaps = 61/769 (8%)
 Frame = +1

Query  103   YSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDS--VKLFFQTSASIAGTPQRVAW  276
             YS G   S + M T+TSI +T LP +  PQ+   +++S  ++   + S S    P   A 
Sbjct  18    YSHG--FSSSEMETLTSICETILPPL--PQNEIPENNSQNIQYLHRASGSQYPIPDECAE  73

Query  277   MISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRS  456
             ++ +R     +ILLR  L +LSTR GTL+LCG      ++PY+  F +I   KR  +++ 
Sbjct  74    VVMKRGFSEAIILLRGLLRILSTRFGTLLLCGSFCFVQKWPYINKFCDIPLEKREIVLQK  133

Query  457   W-SCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKK  633
             W    ++  ++  +L +K + L  FF+QV E+++N +W  I Y                +
Sbjct  134   WFKNRFLTPVRLAFLFIKFLSLYIFFTQVGEDSKNQAWDDIGY----------------Q  177

Query  634   WITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVS  813
                 E+H   +EE+                 PL KG++    E    V   L + G  V 
Sbjct  178   VDNEEKHSETAEER-----------------PLEKGIVETIYETESTVVKSLVQKGLKVI  220

Query  814   PCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslslle  993
                  + + N  + ++CD V+VGSG GGGV A VLA++G+KV+VLEKG Y+ +S  S LE
Sbjct  221   -----EDTKNNMYKVQCDVVIVGSGCGGGVAASVLASSGNKVIVLEKGNYYTKSDYSSLE  275

Query  994   gsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELF  1173
             G S+++MY  GG++++ +  I+++AGS VGGGS INWSA ++TP  V++EW +  +L +F
Sbjct  276   GPSMNQMYESGGILSTLNAKIMIMAGSTVGGGSAINWSACLKTPDSVIQEWGDDKRLPIF  335

Query  1174  GSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCS  1353
              S EY   M+ VC R+GV      EG QN +LRKGC  LG  VE + RN+S +HYCG C 
Sbjct  336   QSPEYVSVMDKVCERIGVTENCTQEGLQNQILRKGCENLGLEVEGVARNSSENHYCGSCC  395

Query  1354  FGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNK----KTGREQAAGVMFVYQN  1521
             +GC+ G+KKGT  TWL D V+ G  VI   C+A + +  K    KT  ++  GV+    N
Sbjct  396   YGCRRGEKKGTDTTWLVDAVECG-AVIITGCKAERFILEKNKYGKTRDKKCLGVIATSTN  454

Query  1522  NGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSK  1701
                 +   ++++VT+ ACG+L TP L+ +SGL+NPNIGRNLHLHPV+ AWGYFP++  + 
Sbjct  455   KDITKRICIEAKVTISACGSLLTPPLMISSGLKNPNIGRNLHLHPVIMAWGYFPESKSN-  513

Query  1702  AWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRM  1881
                  + K Y+GGI+T++ KV +   +S   A+I+ P+L PG F+A+ PW SG D+K R+
Sbjct  514   ----FKGKIYEGGIITSVHKVESY--DSNVRAIIEAPALGPGSFAALCPWTSGEDLKNRL  567

Query  1882  QRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGT  2061
              ++SRTA LFA+ +D  SG+  S   ISY     DK SLK GL + LRIL AAGA+E+GT
Sbjct  568   LKYSRTAHLFAMVKDVGSGKVRSDGRISYKFNAMDKESLKQGLRQALRILIAAGADEVGT  627

Query  2062  CHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSV  2229
                 G+ +K KG S  EI+ F++     E  + L    T   SAHQMGSCRMG+  +   
Sbjct  628   QRSDGQRMKCKGKSEKEIEAFLDTVTAAEGPKSLVKNFTTYSSAHQMGSCRMGMSKKDGA  687

Query  2230  VNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             V+  GE+WE  GLF+ D+SV P A+GVNPM+T+Q+ AYC ++ + + +K
Sbjct  688   VDENGESWEANGLFVCDASVLPGAVGVNPMITIQSTAYCLSKKIAETIK  736



>emb|CDX85097.1| BnaC07g08090D [Brassica napus]
Length=743

 Score =   506 bits (1304),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 312/774 (40%), Positives = 454/774 (59%), Gaps = 69/774 (9%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDD------SVKLFFQTSASIAGTPQRVAWMI  282
             ++ A M ++ S  +  LP V  P+    +DD      +++ F+ T  S     ++   +I
Sbjct  15    ITAAEMESLASFCEAVLPPVPHPEELLGEDDHHPNKEALRSFYTTCGSQTPVARQTIDLI  74

Query  283   SERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIV----  450
              +R      +  RL L+LL+TR+GTL++CG   L S +P+++ F E+S  KR  ++    
Sbjct  75    IKRGTMEAYLAARLVLFLLATRLGTLLICGTECLVSSWPFVEKFSELSLEKRERVLQKQF  134

Query  451   RSWSCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSK  630
             R+W   ++  ++  ++ +KV  L  FFS+V+ N EN +W+AI Y   + D NK       
Sbjct  135   RNW---FLTPIRAAFVYIKVAFLFCFFSRVSSNGENPAWEAIGY-RVNLDENKP------  184

Query  631   KWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPV  810
                        SE QK+               PL KGV+   +E  + + + L + G   
Sbjct  185   -----------SETQKER--------------PLEKGVVETMKETEQTLLESLTQKGL--  217

Query  811   SPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsll  990
                  +  + + +  I+CDAVVVGSGSGGGV A VLA AG KV+V+EKG Y   S     
Sbjct  218   -----ESDTDHDAIRIKCDAVVVGSGSGGGVAASVLAKAGLKVVVMEKGSYCTESDYPPF  272

Query  991   egsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLEL  1170
             EG  ++++Y  GG++ S D  +++LAG+ VGGGS +NWSA I+TP  VL+EW E HK+ L
Sbjct  273   EGHGMEKLYENGGILPSIDGCLMILAGATVGGGSAVNWSACIKTPKSVLQEWSEDHKIPL  332

Query  1171  FGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWC  1350
             FG+KEY  AM+ +  RMGV    E EGFQN VLRKGC  LG  V+ + RN+S  HYCG C
Sbjct  333   FGTKEYVSAMDLMWKRMGVTETCEKEGFQNQVLRKGCENLGINVQNVARNSSEKHYCGSC  392

Query  1351  SFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVV------HNKKTGREQAAGVMFV  1512
              +GC+ G+KKG+  TWL D V  G  V+   C+A + +       N+   + +  GV+  
Sbjct  393   GYGCRQGEKKGSDRTWLVDAVSHG-AVVLTGCKAERFILENNGNKNRGGKKMKCLGVLAK  451

Query  1513  YQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAP  1692
               N    +   ++++VTV A G+L TP L+ +SGLRN +IG+NLHLHPV+ AWG+FPD  
Sbjct  452   SLNGNIAKKIKIEAKVTVSAAGSLLTPPLMISSGLRNRHIGKNLHLHPVLMAWGFFPDKE  511

Query  1693  GSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIK  1872
              S      + KSY+GGI+T+MSKV++  E+S   A+I+TP+L P  FS + PW SG D+K
Sbjct  512   SSSF----KGKSYEGGIITSMSKVLS--EDSEVRAIIETPALGPASFSVLCPWTSGVDMK  565

Query  1873  TRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEE  2052
              RM R+SRTA L  + RD+ SGE  +   ISY + KTDK +L+ GL + LRIL AAGAEE
Sbjct  566   KRMSRYSRTANLITIVRDRGSGEVKTEGRISYVVDKTDKENLRAGLRQSLRILIAAGAEE  625

Query  2053  IGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLST----LIGSAHQMGSCRMGVDPR  2220
             +GT    G+ L  KG     I+EF++  S+ +     T    +  SAHQMGSCR+G D +
Sbjct  626   VGTHRSDGQKLVCKGVDEKSIEEFLDSVSAEEGPKAMTEKWGVYSSAHQMGSCRIGEDEK  685

Query  2221  SSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTH  2382
                ++  GE+WE E LF+ D SV P+A+GVNPM+T+ + AYC +  ++K + T 
Sbjct  686   EGALDLNGESWEAERLFVCDGSVLPSAVGVNPMITIMSTAYCISTRIVKSMTTR  739



>gb|AES89853.2| long-chain-alcohol oxidase FAO2-like protein [Medicago truncatula]
Length=754

 Score =   507 bits (1305),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 325/772 (42%), Positives = 452/772 (59%), Gaps = 64/772 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDS---VKLFFQTSASIAGTPQRVAWMISER  291
              S A M ++TSI +   P++ +      DD+S   V+ FF  SAS    P  VA M  +R
Sbjct  22    FSVAEMESLTSICEVMFPSLPMDDALTKDDESSKDVQSFFNISASKYPIPDEVAEMFEKR  81

Query  292   LQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIV-RSWSCC  468
                  VIL+R+ LWLL+TR+GTL++CG   LS ++P++ +F  +S  KR +IV R     
Sbjct  82    AVIEAVILIRVILWLLATRLGTLLICGLLCLSKKWPFINNFSSLSLDKREKIVQRGLKHK  141

Query  469   YIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITRE  648
             ++   +  ++ +K++ L  FFS V+EN +N +WKAI Y                  ++  
Sbjct  142   FLTPFRLAFVYIKILCLFVFFSWVDENGDNPAWKAIGY-----------------EVSTA  184

Query  649   QHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQ  828
                 +++ +K+               PL KG+I +  E    +   L   G  V+     
Sbjct  185   DEKMINDTKKR---------------PLEKGIIEIMHEHDTTLQQSLSNKGLNVTL----  225

Query  829   KGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslD  1008
               S N    I+CDAVVVGSG GGGV A VL+ AG+KV+VLEKG YF     S LEG S+D
Sbjct  226   -DSKNNILKIKCDAVVVGSGCGGGVAASVLSKAGYKVVVLEKGNYFVPKDYSSLEGPSMD  284

Query  1009  EMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEY  1188
             + Y  GG++AS D  IL+LAGS VGGGS +NWSA I+TP  VLKEW E HKL LF S EY
Sbjct  285   QQYENGGILASIDSRILILAGSTVGGGSAVNWSACIKTPEKVLKEWSEKHKLSLFDSIEY  344

Query  1189  RHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKD  1368
               AMETVC R+GV      EGFQN VLRKGC  LG  V+ +PRN+  +HYCG C +GC  
Sbjct  345   LSAMETVCERIGVNENCTQEGFQNQVLRKGCQNLGLKVDYVPRNSPGNHYCGSCGYGCPK  404

Query  1369  GKKKGTSETWLADLVDSGNGVIFPECEAVKVV-----HNKKTGR-EQAAGVMFVYQNNGA  1530
             G+K+GT  TWL D VD G  VI   C+A + +      N  T + ++  GV+    N+G 
Sbjct  405   GEKQGTQATWLVDAVDKG-AVIITGCKAERFLFENNYRNANTRKNKKCLGVLAKTLNSGV  463

Query  1531  KEFCFVKSRVTVIACGALCTPSLLKNSGL-RNPNIGRNLHLHPVVFAWGYFPDAPGSKAW  1707
                   +++VT+ A GAL TP L+ +SGL +N NIGRNLHLHPV+  WGYFP++      
Sbjct  464   TMKLQFEAKVTISAGGALLTPPLMISSGLTKNKNIGRNLHLHPVLMTWGYFPESKS----  519

Query  1708  PEPEKKSYQGGIMTAMSKV---VANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTR  1878
              + + K+ +GGI+T++ +V     +   S   A+I+TP L P  FSA+ PW SG D K R
Sbjct  520   -DFKGKANEGGIITSVHRVPSSSNDDSISDTRAIIETPLLGPSSFSALYPWESGLDYKQR  578

Query  1879  MQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIG  2058
             M  + RTA    + RDK  G+  +   ISY +   DK +++ G+++ LRIL AAGA E+G
Sbjct  579   MLNYPRTAHFITIIRDKAGGQVTTERRISYKLNSIDKENMRAGIQQALRILIAAGAVEVG  638

Query  2059  TCHRAG--KILKPKGASRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPR  2220
             T HR+G  +I   +  S  EI+EF++     E +   G    L  SAHQMGSCRMGV+ +
Sbjct  639   T-HRSGGQRIKCNENTSEKEIEEFIDSVYPMEGALWPGENWNLYTSAHQMGSCRMGVNEK  697

Query  2221  SSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
                V+  GE+WE EGLF+ D+SV PTA+GVNPM+T+Q+ A+C +  ++ FL+
Sbjct  698   EGAVDENGESWEAEGLFVCDASVLPTAVGVNPMITIQSTAFCISNRIVDFLR  749



>ref|XP_009102621.1| PREDICTED: long-chain-alcohol oxidase FAO3 [Brassica rapa]
Length=745

 Score =   506 bits (1304),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 308/773 (40%), Positives = 452/773 (58%), Gaps = 67/773 (9%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDD------SVKLFFQTSASIAGTPQRVAWMI  282
             ++ A M ++ S  +  LP V  P+    +DD      +++ F+ T  S     ++   +I
Sbjct  15    VTAAEMESLASFCEAVLPPVPHPEELLGEDDHHPNKEALRSFYTTCGSQTPVARQTIDLI  74

Query  283   SERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIV----  450
              +R      +  RL L+LL+TR+GTL++CG   L S +P+++ F E++  KR  ++    
Sbjct  75    IKRGTMEAYLATRLVLFLLATRLGTLLICGTECLVSSWPFVEKFSELTLEKRERVLQKQF  134

Query  451   RSWSCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSK  630
             R+W   ++  ++  ++ +KV  L  FFS+V+ N EN +W+AI Y   + D NK    + +
Sbjct  135   RNW---FLTPIRAAFVYIKVAFLFCFFSRVSSNGENPAWEAIGY-RVNLDENKPSETRKE  190

Query  631   KWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPV  810
             +                               PL KGV+   +E  + + + L + G   
Sbjct  191   R-------------------------------PLEKGVVETMKETEQTLLESLTQKGL--  217

Query  811   SPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsll  990
                  +  + + +  I+CDAVVVGSGSGGGV A VLA AG KV+V+EKG Y+  S     
Sbjct  218   -----EADTDHDAIRIKCDAVVVGSGSGGGVAASVLAKAGLKVIVMEKGSYYTESDYPPF  272

Query  991   egsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLEL  1170
             EG  ++++Y  GG++ S D  +++LAG+ VGGGS +NWSA I+TP  VL+EW E HK+ L
Sbjct  273   EGHGMEKLYENGGILPSIDGCLMILAGATVGGGSAVNWSACIKTPKSVLQEWSEDHKIPL  332

Query  1171  FGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWC  1350
             FG+KEY  AM+ V  RMGV    E EGFQN VLRKGC  LG  V+ + RN+S  HYCG C
Sbjct  333   FGTKEYVSAMDLVWKRMGVTETCEKEGFQNQVLRKGCENLGINVQNVARNSSEKHYCGSC  392

Query  1351  SFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQAA------GVMFV  1512
              +GC+ G+KKG+  TWL D V  G  V+   C+A + +  K   + +        GV+  
Sbjct  393   GYGCRQGEKKGSDRTWLVDAVSHG-AVVLTGCKAERFILEKNGNKNRGGKKMKCLGVLSK  451

Query  1513  YQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAP  1692
               N    +   ++++VTV A G+L TP L+ +SGLRN +IG+NLHLHPV+ AWGYF D  
Sbjct  452   SLNGNIAKKIKIEAKVTVSAAGSLLTPPLMISSGLRNRHIGKNLHLHPVLMAWGYFSDKE  511

Query  1693  GSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIK  1872
              S +    + KSY+GGI+T+MSKV++  E+S   A+I+TP+L P  FS + PW SG D+K
Sbjct  512   SSSS--NFKGKSYEGGIITSMSKVLS--EDSEVRAIIETPALGPASFSVLCPWTSGVDMK  567

Query  1873  TRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEE  2052
              RM R+SRTA L  + RD+ SGE  +   ISY + KTDK +L+ GL + LRIL AAGAEE
Sbjct  568   KRMSRYSRTANLITIVRDRGSGEVKTEGRISYVVDKTDKENLRAGLRQSLRILIAAGAEE  627

Query  2053  IGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLST----LIGSAHQMGSCRMGVDPR  2220
             +GT    G+ L  KG     I+EF++  S+ +     T    +  SAHQMGSCR+G D +
Sbjct  628   VGTHRSDGQKLVCKGVDEKSIEEFLDSVSAEEGPKAMTEKWGVYSSAHQMGSCRIGEDEK  687

Query  2221  SSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKT  2379
                ++  GE+WE E LF+ D SV P+A+GVNPM+T+ + AYC +  ++K + T
Sbjct  688   EGALDLNGESWEAERLFVCDGSVLPSAVGVNPMITIMSTAYCISTRIVKSMTT  740



>ref|XP_006367233.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Solanum tuberosum]
Length=734

 Score =   506 bits (1302),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 295/762 (39%), Positives = 453/762 (59%), Gaps = 60/762 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
              S   + T++S  +T +P  +   +  +DD+S   FF +S +    P  VA ++ +R + 
Sbjct  24    FSSTQIQTISSFCETLVPPCN---NKGIDDNS---FFASSGARPPYPNEVAELLVKRSKP  77

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSC-CYIK  477
               + ++R+ ++LLSTR+G+L+LCG+  L  ++P++ +F E+    R  +++ WS   ++ 
Sbjct  78    EALFIIRIVVFLLSTRLGSLLLCGRVCLDKRWPFVHNFSELDLKDREALLQRWSRETFLI  137

Query  478   ILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHM  657
              L+  +L +K++    FFS  +EN +N +W+AI Y  P                  E   
Sbjct  138   PLRITFLMIKIVCFFIFFSWTDENCKNPTWEAIGYHLP------------------ETTE  179

Query  658   TLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGS  837
             TLS  +K+               PL +G++    E    + + L K G  ++     + +
Sbjct  180   TLSVNKKER--------------PLERGIVETINESDETLKESLSKKGVAIA-----EDT  220

Query  838   GNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMY  1017
              + +F I+CD ++VGSG GGGV AG+LA +G+KV+VLEKG YF     S LEG SL E+Y
Sbjct  221   KDNTFKIKCDVLIVGSGCGGGVAAGILAKSGYKVVVLEKGHYFVPEDYSGLEGPSLSELY  280

Query  1018  LGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHA  1197
               G +++S D  ++++AG+ VGGGS +NWSASI+TP  VLK+W E HK+  FG+ EY+ A
Sbjct  281   ETGAMLSSLDGKVMIMAGTTVGGGSAVNWSASIRTPNDVLKDWSENHKISWFGTSEYQSA  340

Query  1198  METVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKK  1377
             M+TVC R+GV     +EG QN V+RKGC  LG  V+ IPRN+S +HYCG C +GCK G K
Sbjct  341   MDTVCKRIGVTENCSEEGLQNQVIRKGCENLGLKVDKIPRNSSENHYCGSCGYGCKTGDK  400

Query  1378  KGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQAAGVMFVYQNNGAKEFCFVKSR  1557
             KGT  TWL D V++G  VI   C A + +      R+   GV+   +     +   +++R
Sbjct  401   KGTDSTWLVDAVNAG-AVILTGCTAQRFILEDGKMRKTCLGVIATTETKKIPKKLHIEAR  459

Query  1558  VTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQG  1737
              T+ +CG+L TP LL +SGL+N NIG NLHLHPV+ AWGYFP+     +  E + K+Y+G
Sbjct  460   ATISSCGSLFTPPLLISSGLQNKNIGTNLHLHPVLLAWGYFPE-----SMAEIKGKNYEG  514

Query  1738  GIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFAL  1917
             GIMT++ K++   EE+   A+++  ++ P  F+++ PW SG D+K +M ++SRT  L AL
Sbjct  515   GIMTSLHKMLP--EETNAQAIVEATAMGPAAFASLFPWTSGQDMKEQMTKYSRTVTLLAL  572

Query  1918  ARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKG  2097
              +D+  GE      I Y++ + DK ++K GL + LRIL AAGA E+GT    G+ +    
Sbjct  573   VKDQGRGEVKKAGRIKYSLDRIDKENIKAGLRRALRILIAAGAVEVGTYRSDGQKISCTD  632

Query  2098  ASRDEIDEFVEKESSRDLGNLS-----TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVE  2262
                +E++EF++   + + G +S     T+  SAHQMGSCRMG       V+  GE WE +
Sbjct  633   MKNEELEEFLDTVEAPE-GPMSKEENWTVYASAHQMGSCRMGSSKEDGAVDENGECWEAK  691

Query  2263  GLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHNH  2388
             GL++ D SV PTA+GVNPM+T+Q+ AYC A+ + + L  HN 
Sbjct  692   GLYVCDGSVLPTAVGVNPMITIQSTAYCIAKRIAESL--HNE  731



>ref|XP_004247745.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Solanum lycopersicum]
Length=741

 Score =   505 bits (1300),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 307/768 (40%), Positives = 450/768 (59%), Gaps = 60/768 (8%)
 Frame = +1

Query  103   YSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMI  282
             YS G   S + + T+TSI +T LP + +      ++  ++ F + S S    P  VA ++
Sbjct  18    YSHG--FSSSEIQTLTSICETILPPIPL-NSLQKNNKKIQNFHKVSGSQYPIPDEVAEIV  74

Query  283   SERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW-  459
              +R      +L+R  L +LSTRIG+L+LCG       +PY+  F +IS  KR  +++ W 
Sbjct  75    MKRGFFEARMLVRSLLRILSTRIGSLLLCGLFCFGKSWPYINKFSDISLDKREIVMQKWF  134

Query  460   SCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWI  639
             +  +   ++  ++ +K + L  FF+QV E++ N +W  I Y                  +
Sbjct  135   NNRFFTPVRLAFVFVKFLCLYIFFTQVGEDSNNPAWDDIGY-----------------QV  177

Query  640   TREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPC  819
               E++ + + +++                PL KG+I    E    +   L + G  V+  
Sbjct  178   DNEENSSETPDER----------------PLQKGIIETIYETESSIVKSLVEKGLKVT--  219

Query  820   IQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegs  999
                + + N  + ++CD V+VGSG GGGV A VLA++G KV+VLEKG YFA+S  S LEG 
Sbjct  220   ---EDTTNNMYKVQCDVVIVGSGCGGGVAASVLASSGQKVVVLEKGNYFAKSDYSSLEGP  276

Query  1000  slDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGS  1179
             S  +MY  GG++++ D  +++LAGS VGGGS +NWSA I+TP  V++EW +  ++ +F +
Sbjct  277   SQSQMYESGGILSTLDGKVMILAGSTVGGGSAVNWSACIKTPDSVIQEWGDDKRISMFKT  336

Query  1180  KEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFG  1359
              EY  AM+ VC R+ V  +   EG QN +LRKGC  LG  VE + RN+S DHYCG C +G
Sbjct  337   PEYVSAMDKVCERINVTEKCTQEGLQNQILRKGCERLGLEVEGVARNSSEDHYCGSCCYG  396

Query  1360  CKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNK----KTGREQAAGVMFVYQNNG  1527
             C+ G+KKGT  TWL D VD G  VI   C+A + +  K    KT  ++  GV+    N  
Sbjct  397   CRRGEKKGTDTTWLVDAVDCG-AVIITGCKAERFILEKKKYGKTRSKKCLGVISTSMNKD  455

Query  1528  AKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDA-PGSKA  1704
               +   ++++VT+ ACG+L TP L+ +SGL+N NIGRNLHLHPV+ AWGYFP++  G K 
Sbjct  456   ITKSICIEAKVTISACGSLLTPPLMISSGLKNRNIGRNLHLHPVIMAWGYFPESNSGLKG  515

Query  1705  WPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQ  1884
                   K Y+GGI+T++ KV +   +S   A+I+ P+L PG F+A+ PW SG DIK R+ 
Sbjct  516   ------KIYEGGIITSVHKVGSY--DSNVRAIIEAPALGPGSFAALCPWTSGEDIKNRLL  567

Query  1885  RFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTC  2064
              + RTA LFA+ +D  SGE  S   ISY     DK SLK GL + LRIL AAGA E+GT 
Sbjct  568   NYDRTAHLFAMVKDVGSGEVRSEGRISYTFNGMDKESLKLGLRQALRILIAAGAAEVGTQ  627

Query  2065  HRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVV  2232
                G+ +K  G S   ++ F+E     E  + L    T   SAHQMGSCRMG++ + S V
Sbjct  628   RSDGQRIKCTGQSEKALESFLETVTAAEGPKSLVKDFTTYSSAHQMGSCRMGMNEKDSAV  687

Query  2233  NPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             +  GE+WE EGLF+ D+SV P A+GVNPM+T+Q+ AYC ++ + + +K
Sbjct  688   DENGESWEAEGLFVCDASVLPGAVGVNPMITIQSTAYCLSKKIAEMIK  735



>ref|XP_008364320.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Malus domestica]
Length=743

 Score =   505 bits (1300),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 306/767 (40%), Positives = 452/767 (59%), Gaps = 67/767 (9%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSA--SIAGT----PQRVAWMI  282
              S A M ++ +I +  +P + + +   + DD   L + +S+  + +G+    P  VA MI
Sbjct  25    FSSAQMQSLAAICEALIPPLSLEE---IPDDHQALHYSSSSYHTASGSQPPIPDEVAEMI  81

Query  283   SERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  462
              +R Q   V  +RL L +LS R+GT +LCGK     ++P++  F E S  KR +++  WS
Sbjct  82    VKRAQPEAVDAMRLFLKMLSLRLGTFLLCGKICFDWKWPFIHKFSEXSLDKREQVLNKWS  141

Query  463   CCYIKI-LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWI  639
                + I ++  ++ +K+    +FFS+++EN+ N +WKAI +     D +KK         
Sbjct  142   RGKLVITIRLMFMVVKMFCFYTFFSRIDENSRNPAWKAIGF-----DLDKK---------  187

Query  640   TREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPC  819
               E+ +   +E+                 PL KG+I    E    +   L K G  V+  
Sbjct  188   --EKLIKTPKER-----------------PLDKGIIETVYESDSTLVQSLTKKGLEVA--  226

Query  820   IQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegs  999
                  + N    I CD V+VGSG GGGV A VLA +G KV+VLEKG YF     S LEG 
Sbjct  227   ---DDAANNIHRINCDVVIVGSGCGGGVAAAVLAQSGQKVVVLEKGNYFVPKDYSSLEGP  283

Query  1000  slDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGS  1179
             S+ E+Y  GG++AS D  +++LAGS VGGGS +NWSASI+TP +VL+EW   HK+ L+ S
Sbjct  284   SMSELYESGGIMASVDAMVMILAGSTVGGGSAVNWSASIRTPHNVLREWSVDHKIPLYAS  343

Query  1180  KEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFG  1359
             ++Y+ AM+ VC R+ V     +E FQN +LRKGC  LG  VE++PRN+S DHYCG+C++G
Sbjct  344   EDYQSAMDIVCKRISVTEGCTEENFQNQILRKGCENLGLKVESVPRNSSADHYCGFCNYG  403

Query  1360  CKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVV---HNKKTGREQAAGVMFVYQNNGA  1530
             C  G KKGT  TWL D V+ G  VI   C+A K +    N    R++  GV     +   
Sbjct  404   CPTGDKKGTDSTWLVDAVECG-AVILTGCKAEKFILESDNDGGRRKRCLGVQATSXSKNI  462

Query  1531  KEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWP  1710
             K    ++++VT+ ACG+L TP L+ +SGL+N NIGRNLHLHPV+ +WGYFP         
Sbjct  463   KRKLKIEAKVTISACGSLLTPPLMISSGLKNRNIGRNLHLHPVLLSWGYFPQHES-----  517

Query  1711  EPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRF  1890
             E   K Y+GGI+T++ KVV+  E +   A+I+T  L P  F+ + PW+S  D+K +M+++
Sbjct  518   EFXXKKYEGGIITSIHKVVS--ETANARAIIETAVLGPASFATLSPWISRLDMKDKMEKY  575

Query  1891  SRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHR  2070
             +RTA LFAL RD +SG       + Y + + DK +L  GL + LRIL AAGA E+GT   
Sbjct  576   ARTANLFALVRDXSSGVVKREGRVHYTLDQLDKENLLAGLRQALRILIAAGAVEVGTYRN  635

Query  2071  AGKILKPKGASRDEIDEFVEK------ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVV  2232
              G+ +K KG   ++++EF++        S+R+   L T+  SAHQMGSCRMG       V
Sbjct  636   DGQRIKCKGVKEEDLEEFLDTVVTSAGPSARE--ELWTIYSSAHQMGSCRMGATEEEGGV  693

Query  2233  NPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
             +  GE+WE +GLF+ D+S+ PTA+GVNPM+T+++ AYC ++ + + L
Sbjct  694   DENGESWEAKGLFVCDASLLPTAVGVNPMITIESTAYCISKKIAQSL  740



>ref|XP_006582261.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Glycine max]
Length=749

 Score =   504 bits (1298),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 328/779 (42%), Positives = 460/779 (59%), Gaps = 64/779 (8%)
 Frame = +1

Query  94    DGVYSGGCPLSPAVMATVTSISDTFLP-----AVDVPQHAAVDDDS----VKLFFQTSAS  246
             D  Y  G   S A M ++TSI +  LP     A+ + +    DDDS    ++ F   SAS
Sbjct  15    DNKYKHG--FSTAEMESLTSICEVVLPPLPMDALKIRKEDHDDDDSSNKSLQSFLDISAS  72

Query  247   IAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEIS  426
                 P  VA MI++R     VIL+R+ LWLL+TR+GTL+LCG   L   +PY+  F  IS
Sbjct  73    RYPIPHEVAEMITKRSLIETVILIRVVLWLLATRLGTLLLCGFLCLGENWPYINKFSNIS  132

Query  427   PHKRAEIVRSW-SCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDS  603
               KR +I++ W    ++  ++  +  +KV+ L  FFS V+EN +N +WKAI Y       
Sbjct  133   LEKREKIMQKWLKHRFLTPIRLTFACIKVLCLFVFFSWVDENGDNPAWKAIGY-------  185

Query  604   NKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFD  783
              + PA         ++ MT +   +                PL KG+I    E    +  
Sbjct  186   -EVPA---------DEKMTNTSNTR----------------PLEKGIIETMNESDSTLQQ  219

Query  784   RLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKY  963
              L   G  V+       S +    ++CDA+VVGSG GGGV A VL++AGHKV+VLEKG Y
Sbjct  220   SLANKGLNVT-----LDSKSNILKVKCDALVVGSGCGGGVAAAVLSSAGHKVVVLEKGNY  274

Query  964   FARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKE  1143
             F     S LEG S++++Y  GG++AS D  +L+LAGS VGGGS +NWSA I+TP  VLKE
Sbjct  275   FTPQDYSSLEGPSMNQLYETGGILASVDSRVLVLAGSTVGGGSAVNWSACIKTPHKVLKE  334

Query  1144  WDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNA  1323
             W E+HKL  F S+EY  AME VC R+GV      EGFQN VLRKGC  LG  V+ +PRN+
Sbjct  335   WSESHKLPFFSSQEYLSAMENVCERIGVTENCSQEGFQNQVLRKGCQNLGLKVDYVPRNS  394

Query  1324  SRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVK-VVHNKKTG---REQ  1491
             S +HYC  C +GC  G+K+GT +TWLAD V+  + VI   C+A + ++ + ++G   +++
Sbjct  395   SGNHYCS-CGYGCPKGEKQGTQDTWLADAVER-DAVIITGCKAERFLLESNRSGNGRKKK  452

Query  1492  AAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAW  1671
               GV     N+       ++++VT+ A GAL TP LL +SGL+N NIG+NLHLHPV+  W
Sbjct  453   CLGVTAKTLNSRITMKLQIEAKVTISAGGALLTPPLLISSGLKNKNIGKNLHLHPVLMTW  512

Query  1672  GYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPW  1851
             GYFP++  S    E + K Y+GGI+T++ KV +    S   A+I+TP L P  F+A+ PW
Sbjct  513   GYFPESNDS----EFKGKVYEGGIITSVHKVPSPDSNSDSRAIIETPLLGPASFAALCPW  568

Query  1852  LSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRIL  2031
              SG D K RM  + RT+ L  + RD   G+  +   ISY + + DK ++K GL++ LRIL
Sbjct  569   ESGQDFKERMLNYPRTSHLITIIRDMACGQVTTEGRISYKLNEVDKENMKAGLKQALRIL  628

Query  2032  AAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSC  2199
              AAGA E+GT    G+ LK  G   +E+ EF++     E +   G    +  SAHQMGSC
Sbjct  629   IAAGAVEVGTHRSDGQRLKCDGIGENEVQEFLDSVCPMEGALSPGEKWNIYSSAHQMGSC  688

Query  2200  RMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             RMGV  +   V+  GETWE EGLF+ D+SV P+A+GVNPM+TVQ+ AYC +  ++ +L+
Sbjct  689   RMGVSEKEGAVDENGETWEAEGLFVCDASVLPSAVGVNPMITVQSTAYCISNRIVDYLR  747



>ref|XP_007132926.1| hypothetical protein PHAVU_011G136600g [Phaseolus vulgaris]
 gb|ESW04920.1| hypothetical protein PHAVU_011G136600g [Phaseolus vulgaris]
Length=755

 Score =   504 bits (1299),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 320/768 (42%), Positives = 454/768 (59%), Gaps = 60/768 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDV------PQHAAVDDDS--VKLFFQTSASIAGTPQRVAW  276
              S A M ++ S+ +  LP + +       +  A DDD+  ++ F   S S    P  VA 
Sbjct  22    FSAAEMESLASMCEVVLPPLPMDAFKSRKEDQAGDDDTKLLQSFCDISGSRYPIPHEVAE  81

Query  277   MISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRS  456
             +++       +IL+R+ LW+L+TR+GTL+LCG   L  ++PY+ +F  +S  KR +IV+ 
Sbjct  82    LLTNTSLIEALILVRVVLWMLATRLGTLLLCGFLCLGEKWPYINNFSNMSLEKREKIVQK  141

Query  457   W-SCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKK  633
             W    ++  ++  ++ +KV+ L SFFS V+EN +N +WKAI Y   D             
Sbjct  142   WLKHRFLTPIRLAFVYVKVLCLYSFFSMVDENGDNPAWKAIGYEVSD-------------  188

Query  634   WITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVS  813
                 E+   +S  +                 PL KG I    E    +   L K G  V+
Sbjct  189   ---NEKQNNVSNNR-----------------PLEKGTIETMHESDSTLQQSLAKKGLNVT  228

Query  814   PCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslslle  993
                +          ++CDAVVVGSG GGGV A VL++AGHKV+VLEKG YF+    S LE
Sbjct  229   LDFKSN-----ILKVKCDAVVVGSGCGGGVAAAVLSSAGHKVVVLEKGNYFSPQDYSSLE  283

Query  994   gsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELF  1173
             G S+ ++Y  GG++AS D  +L+LAGS VGGGS +NWSA I+TP  VLK+W E HKL  F
Sbjct  284   GPSMKQLYETGGILASADSRVLILAGSTVGGGSAVNWSACIKTPHKVLKDWSEGHKLPFF  343

Query  1174  GSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCS  1353
              S+EY  AMETVC R+GV      EGFQN VLRKGC  LG  V+ + RN+S +HYCG C 
Sbjct  344   SSQEYLSAMETVCERIGVTENCTQEGFQNQVLRKGCQNLGLKVDYVARNSSGNHYCGSCG  403

Query  1354  FGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVK-VVHNKKTG---REQAAGVMFVYQN  1521
             +GC  G+K+GT  TWL D VD G  VI   C+A K ++ + ++G   +++  GV+    N
Sbjct  404   YGCPKGEKQGTQATWLVDAVDKG-AVIITGCKAEKLLLESNRSGNGRKKKCLGVVAKVLN  462

Query  1522  NGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSK  1701
                     ++++VT+ + GAL TPSLL +SGL N NIGRNLHLHPV+  WGYFP++  S 
Sbjct  463   KVVTMKLQIEAKVTISSGGALLTPSLLISSGLHNKNIGRNLHLHPVLMTWGYFPESNNS-  521

Query  1702  AWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRM  1881
                E + K Y+GGI+T++ KV +   +S   A+I+TPSL P  F+A+ PW SG D K RM
Sbjct  522   ---EFKGKVYEGGIITSVHKVPSTDSKSDSRAIIETPSLGPACFAALFPWESGLDFKERM  578

Query  1882  QRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGT  2061
               + RTA L  + RD   G+  S   I Y + + D+ +++ G+++ LRIL AAGA E+GT
Sbjct  579   LNYPRTAHLITIIRDMACGQVTSEGRIIYKLNEIDRENMRAGMQQALRILIAAGAVEVGT  638

Query  2062  CHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSV  2229
                 G+ L+  G S D++ EF++     E +   G+   L  SAHQMGSCRMGV+ +   
Sbjct  639   HRSDGQRLRCSGVSEDKVQEFLDSVCPMEGALSPGDKWNLYSSAHQMGSCRMGVNEKEGA  698

Query  2230  VNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
             V+  GETWE EGLF+ D+SV PTA+GVNPM+T+Q+ AYC +  ++ +L
Sbjct  699   VDENGETWEAEGLFVCDASVLPTAVGVNPMITIQSTAYCISNRIVDYL  746



>ref|XP_011080081.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Sesamum indicum]
Length=742

 Score =   504 bits (1297),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 295/725 (41%), Positives = 431/725 (59%), Gaps = 58/725 (8%)
 Frame = +1

Query  226   FFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYL  405
             F+++S      P  VA ++ +R     V ++ L L  LS+R+GTL+LCG   L  ++P++
Sbjct  63    FYKSSG-----PDEVAELLVKRGIPAAVFIVSLVLKFLSSRLGTLLLCGWICLDWKWPFV  117

Query  406   QSFPEISPHKRAEIVRSWSCCYIKI-LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDY  582
              SF E++  KR  I++ WS   + + L+  +L +K+M L  FFS  +EN+ N +W+AI Y
Sbjct  118   HSFCELTLKKREAILQKWSRETLFLPLRIAFLLLKIMCLFVFFSWTDENSSNPAWEAIGY  177

Query  583   CGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQE  762
                                   Q   +  E K+ +E            PL KG+I +  E
Sbjct  178   ----------------------QVEAIERETKREKER-----------PLEKGIIEIMNE  204

Query  763   PRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVL  942
                 +   L + G  ++     +      + I+CD V++GSG GGGV A VLA +G KVL
Sbjct  205   DELSLKKSLVQKGINIA-----EDENENVYKIKCDVVIIGSGCGGGVAAAVLAKSGQKVL  259

Query  943   VLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQT  1122
             +LEKG YF     S LEG +  E+Y  GG++ + D  I+++AG+ +GGGS+INWSA I+T
Sbjct  260   ILEKGHYFVPEDYSGLEGPAFSELYESGGMLTTTDGKIMVMAGTALGGGSSINWSACIRT  319

Query  1123  PPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPV  1302
             P ++LKEW   +K+ LFGS EY+ A++ VC R+GV      EGFQN VLR+GC  LG  V
Sbjct  320   PDYILKEWSTENKIHLFGSHEYQSAVDAVCERIGVTENCVQEGFQNQVLRRGCENLGLKV  379

Query  1303  ETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEA---VKVVHNK  1473
             E +PRN+S  HYCG C +GC+ G KKGT  TWL D V + + VI   C+A   + V  NK
Sbjct  380   EPVPRNSSTYHYCGSCCYGCRRGDKKGTDSTWLVDAVKN-SAVILTGCKAEALMLVTDNK  438

Query  1474  KTGREQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLH  1653
             +  R++  GV+   +N   ++   +++RVTV ACG+L TP LL +SGL+N NIG+NLHLH
Sbjct  439   EKDRKRCLGVIATAENKNIRKKLQIEARVTVSACGSLLTPPLLISSGLQNKNIGKNLHLH  498

Query  1654  PVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMF  1833
             PV   WGYFP+     +  E + KS++GGI+T++ KV +  +ES   A+++  +L PG F
Sbjct  499   PVSLVWGYFPE-----SLVELKGKSFEGGILTSLHKVQSE-QESDIQAIVEAAALGPGSF  552

Query  1834  SAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLE  2013
              A+ PW+S  D+  RM +++RTA+LFAL RD  SGE      I Y +   DK +LK GL 
Sbjct  553   GALFPWVSRRDMNDRMTKYARTAVLFALPRDHGSGEVRKQGHIKYRLSAVDKENLKTGLR  612

Query  2014  KVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLIGSA  2181
             + LRIL  AGA E+GT    G+ ++ KG   ++++EF++  ++    R      TL  SA
Sbjct  613   RALRILVGAGAAEVGTFRSDGQRIRCKGTKNEDLEEFLDTVTAVGGPRSRSEYWTLYCSA  672

Query  2182  HQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSV  2361
             HQMGSCRMG +     V+  GE WE +GLF+ D SV P+A+GVNPM+T+Q+ AYC ++ +
Sbjct  673   HQMGSCRMGANEEDGAVDENGECWEAKGLFVCDGSVLPSAVGVNPMITIQSTAYCISKRL  732

Query  2362  LKFLK  2376
                LK
Sbjct  733   ADSLK  737



>ref|XP_002883430.1| hypothetical protein ARALYDRAFT_479855 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59689.1| hypothetical protein ARALYDRAFT_479855 [Arabidopsis lyrata subsp. 
lyrata]
Length=743

 Score =   503 bits (1296),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 310/768 (40%), Positives = 451/768 (59%), Gaps = 66/768 (9%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDD------SVKLFFQTSASIAGTPQRVAWMI  282
             ++ A M ++ S  +  LP V  P+  + + D      +++ F+ TS S     ++   +I
Sbjct  15    ITEAEMESLASFCEAVLPPVLPPEEVSSEGDNHRNKEALRSFYSTSGSQTPVLRQSIELI  74

Query  283   SERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIV----  450
             ++R      +  RL L+LL+TR+GTL++CG   L S++P+++ F E+S  KR  ++    
Sbjct  75    TKRGTIEAYLATRLILFLLATRLGTLLICGTECLVSRWPFVEKFSELSLEKRERVLQKQF  134

Query  451   RSWSCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSK  630
             R+W   ++  ++  ++ +KV  L  FFS+V  + EN +W+AI Y   + D NK    + +
Sbjct  135   RNW---FLTPIRAAFVYIKVAFLFCFFSRVTPDGENPAWEAIGY-HVNLDENKPSETRKE  190

Query  631   KWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPV  810
             +                               PL KG++   +E  + + + L + G   
Sbjct  191   R-------------------------------PLEKGIVETMEETEQTLLELLAQKGLEA  219

Query  811   SPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsll  990
                     + + +  I+CDAVVVGSGSGGGV A VLA +G KV+VLEKG YF  S     
Sbjct  220   -----DLDTVHDAIRIKCDAVVVGSGSGGGVAASVLAKSGLKVVVLEKGSYFTPSDYRPF  274

Query  991   egsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLEL  1170
             EG  LD++Y  GG++ S D ++++LAG+ VGGGS +NWSA I+TP  VL+EW E   + L
Sbjct  275   EGPGLDKLYENGGILPSVDGNLMVLAGATVGGGSAVNWSACIKTPKSVLQEWSEDQNIPL  334

Query  1171  FGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWC  1350
             F +KEY  AME V  RMGV  + E E FQN VLRKGC  LG  VE +PRN+S  HYCG C
Sbjct  335   FATKEYVSAMEVVWERMGVTDKCEMESFQNQVLRKGCQNLGVNVENVPRNSSESHYCGSC  394

Query  1351  SFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGRE-----QAAGVMFVY  1515
              +GC  G KKG+  TWL D V  G  VI   C+A + +  K +G E     +  GVM   
Sbjct  395   GYGCIQGDKKGSDRTWLVDAVSQG-AVILTGCKAERFILEKNSGNEGGKKMKCLGVMAKS  453

Query  1516  QNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPG  1695
              N    +   ++++VTV A GAL TP L+ +SGLRN +IG+NLHLHPV+ AWGYFP    
Sbjct  454   LNGNIAKTLKIEAKVTVSAGGALLTPPLMISSGLRNRHIGKNLHLHPVLMAWGYFPMKES  513

Query  1696  SKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKT  1875
             S      + KSY+GGI+T++SKV++  E+S   A+I+TP+L PG FS + PW SG D+K 
Sbjct  514   SNF----KGKSYEGGIITSVSKVLS--EDSEVRAIIETPALGPGSFSVLCPWTSGLDMKK  567

Query  1876  RMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEI  2055
             RM R+SRTA L  + RD+ SGE  +   ISY + KTD+ +LK GL + L+IL AAGAEE+
Sbjct  568   RMARYSRTASLITIVRDRGSGEVKTEGRISYAVDKTDRDNLKAGLRQSLKILIAAGAEEV  627

Query  2056  GTCHRAGKILKPKGASRDEIDEFVE----KESSRDLGNLSTLIGSAHQMGSCRMGVDPRS  2223
             GT    G+ L  KG+  + I+EF++    +E  + +     +  SAHQMGSCR+G + + 
Sbjct  628   GTHRSDGQRLICKGSDENSIEEFLDSVSTEEGPKGMTEKWNVYSSAHQMGSCRIGENEKE  687

Query  2224  SVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLK  2367
               ++  GE+WE E LF+ D+S  P+A+GVNPM+TV + AYC +  + K
Sbjct  688   GAIDLNGESWEAEKLFVCDASALPSAVGVNPMITVMSTAYCISTRIAK  735



>gb|EYU46424.1| hypothetical protein MIMGU_mgv1a001883mg [Erythranthe guttata]
Length=744

 Score =   503 bits (1296),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 302/728 (41%), Positives = 433/728 (59%), Gaps = 60/728 (8%)
 Frame = +1

Query  211   DSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSS  390
             + V+ F+ ++      P  VA +I +R     V ++ L L  LS+R+GTL+LCG      
Sbjct  65    NHVQAFYSSNG-----PDEVAELIVKRGVPKAVFIVSLVLKFLSSRLGTLVLCGYICFDK  119

Query  391   QFPYLQSFPEISPHKRAEIVRSWSCCYIKI-LKTFYLGMKVMVLLSFFSQVNENNENISW  567
              +P++++F E+   KR  ++++WS   + + L+  +L +K++ L  FFS  +EN+ N +W
Sbjct  120   NWPFVRTFSELPLKKRESVLQNWSRQTLLLPLRIAFLLLKIITLFIFFSWTDENSSNPAW  179

Query  568   KAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVI  747
             +AI Y                       H+    E+++ E             PL KGVI
Sbjct  180   EAIGY-----------------------HVEEILEKQENEP------------PLKKGVI  204

Query  748   -NLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLAN  924
               +  E    + + L + G  V   I+     N +F I+CD  +VGSGSGGGV A VLA 
Sbjct  205   ETMKNEDDASLKESLLQKGVSV---IEDPNEKN-TFKIKCDVAIVGSGSGGGVAAAVLAK  260

Query  925   AGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINW  1104
             +G KV+++EKG YF     S LEG SL E+Y  GG+++++D  I++ AGS VGGGS++NW
Sbjct  261   SGQKVIIIEKGNYFTPQDYSGLEGPSLSELYESGGILSTEDGKIMIQAGSTVGGGSSVNW  320

Query  1105  SASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCL  1284
             SA I+TP +VL+EW + +KL LF + EY+ AM+ VC R+GV     +EGFQN VLRKG  
Sbjct  321   SACIRTPDYVLQEWSKQNKLPLFTTNEYKSAMDDVCERLGVTENCVEEGFQNKVLRKGVE  380

Query  1285  ELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVV  1464
              LG  +E +PRN+S DHYCG C +GCK G KKGT  TWL D V+ G  VI   C+A K V
Sbjct  381   NLGLKIEPVPRNSSADHYCGSCCYGCKRGDKKGTESTWLVDAVNEG-AVILSGCKAEKFV  439

Query  1465  HNKKTGREQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNL  1644
               K     +  GV+   +N   K+  ++++RVT+ ACG+L TP LL +SGL+N NIG NL
Sbjct  440   LVKN----RCIGVIATSENKNIKKKLYIEARVTISACGSLLTPPLLISSGLKNKNIGSNL  495

Query  1645  HLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHP  1824
             HLHPV F WGYFP+ P S    E + K ++GGI+T++ KV  N E   +  +I+  +L P
Sbjct  496   HLHPVSFVWGYFPE-PSS----EIKGKCFEGGILTSLHKVQQNQESDNFETVIEVSALGP  550

Query  1825  GMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKN  2004
               F+ ++PW S  +I  RM ++SRTA+LFAL RD+  GE      + Y + K D+ ++K 
Sbjct  551   ASFAGLIPWASRQEINERMTKYSRTAVLFALTRDQGLGEVKRQGHVKYRLSKIDRENIKT  610

Query  2005  GLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLI  2172
             GL + LRIL AAGAEE+GT    G+ +K +G   +E+DEF++   +    R      T+ 
Sbjct  611   GLRRALRILIAAGAEEVGTFRSDGQRIKCRGIKDEELDEFLDNVGAVGGPRSRSEYWTIY  670

Query  2173  GSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTA  2352
              SAHQMGSCRMG       V+  GE WE +GLF+ D SV P+ALGVNPMVT+Q+ AYC +
Sbjct  671   CSAHQMGSCRMGESDEDGAVDENGECWEAKGLFVCDGSVLPSALGVNPMVTIQSTAYCIS  730

Query  2353  QSVLKFLK  2376
             + +   LK
Sbjct  731   KRLAASLK  738



>emb|CAC87643.1| alcohol oxidase [Arabidopsis thaliana]
Length=678

 Score =   501 bits (1290),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 293/690 (42%), Positives = 413/690 (60%), Gaps = 52/690 (8%)
 Frame = +1

Query  340   STRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIV-RSWSCCYIKILKTFYLGMKVMV  516
             +TR+GTL++CG   L S++P+++ F E+S  KR  ++ + +    +  ++  ++ +KV  
Sbjct  27    ATRLGTLLICGTECLVSRWPFVEKFSELSLEKRERVLQKQFKNWILTPIRAAFVYIKVAF  86

Query  517   LLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDV  696
             L  FFS+VN N EN +W+AI Y   +PD NK     +++                     
Sbjct  87    LFCFFSRVNPNGENPAWEAIGY-RVNPDENKPSETHNER---------------------  124

Query  697   IPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavv  876
                       PL KG++   +E  + + + L   G       +       +  I+CD VV
Sbjct  125   ----------PLEKGIVETMEETEQTLLESLAHKGLEAVLDTEHD-----AIRIKCDVVV  169

Query  877   vgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDI  1056
             VGSGSGGGV A VLA +G KV+VLEKG YF  S     EG  LD++Y  GG++ S D   
Sbjct  170   VGSGSGGGVAASVLAKSGLKVVVLEKGSYFTPSEHRPFEGPGLDKLYENGGILPSVDGSF  229

Query  1057  LLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSE  1236
             ++LAG+ VGGGS +NWSA I+TP  VL+EW E   + LFG+KEY  AME V  RMGV  +
Sbjct  230   MVLAGATVGGGSAVNWSACIKTPKSVLQEWSEDQNIPLFGTKEYLTAMEVVWKRMGVTEK  289

Query  1237  VEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVD  1416
              E E FQN +LRKGC  LG+ VE +PRN+S  HYCG C +GC+ G KKG+  TWL D V 
Sbjct  290   CELESFQNQILRKGCENLGFNVENVPRNSSESHYCGSCGYGCRQGDKKGSDRTWLVDAVG  349

Query  1417  SGNGVIFPECEAVKVVHNK----KTGRE-QAAGVMFVYQNNGAKEFCFVKSRVTVIACGA  1581
              G  VI   C+A + +  K    K G++ +  GVM    N    +   ++++VTV A GA
Sbjct  350   HG-AVILTGCKAERFILEKNGSNKGGKQMKCLGVMAKSLNGNIAKMLKIEAKVTVSAGGA  408

Query  1582  LCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSK  1761
             L TP L+ +SGLRN NIG+NLHLHPV+ AWGYFPD   S      +  SY+GGI+T++SK
Sbjct  409   LLTPPLMISSGLRNRNIGKNLHLHPVLMAWGYFPDKESSNI--SFKGNSYEGGIITSVSK  466

Query  1762  VVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGE  1941
             V++  E+S   A+I+TP L PG FS + PW SG D+K RM R+SRTA L  + RD+ SGE
Sbjct  467   VLS--EDSEVRAIIETPQLGPGSFSVLTPWTSGLDMKKRMARYSRTASLITIVRDRGSGE  524

Query  1942  APSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDE  2121
               +   I+Y + KTD+ +LK GL + LRIL AAGAEE+GT    G+ L  KG + + I E
Sbjct  525   VKTEGRINYTVDKTDRDNLKAGLRESLRILIAAGAEEVGTHRSDGQRLICKGVNENSIQE  584

Query  2122  FVE----KESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSV  2289
             F++    +E ++ +     +  SAHQMGSCR+G + +   ++  GE+WE E LF+ D+S 
Sbjct  585   FLDSVSTEEGAKGMTEKWNVYSSAHQMGSCRIGENEKEGAIDLNGESWEAEKLFVCDASA  644

Query  2290  FPTALGVNPMVTVQAIAYCTAQSVLKFLKT  2379
              P+A+GVNPM+TV + AYC +  + K + T
Sbjct  645   LPSAVGVNPMITVMSTAYCISTRIAKSMTT  674



>ref|XP_007035183.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 ref|XP_007035184.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 ref|XP_007035185.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 gb|EOY06109.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 gb|EOY06110.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 gb|EOY06111.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
Length=750

 Score =   503 bits (1296),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 318/779 (41%), Positives = 461/779 (59%), Gaps = 59/779 (8%)
 Frame = +1

Query  79    AERGNDGVYSGGCPLSPAVMATVTSISDTFLPAV----DVPQHAAVDDDSVKLFFQTSAS  246
              ER + G       LS A + T+ SI +   P++    D          +V+ F + SAS
Sbjct  13    GERRDRGKRRYAHGLSSAEVQTLASIGEAVFPSLKPNSDFEGKQNQPRKAVQSFLEASAS  72

Query  247   IAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEIS  426
              +  P  VA ++ +R      ILLR+ L LLSTR+GTL+LCG   L  ++PY+  F  + 
Sbjct  73    ESPIPDEVAQLLVKRTFMETRILLRVVLLLLSTRLGTLLLCGSLCLGDKWPYINYFSCMP  132

Query  427   PHKRAEIVRSWSCCYI-KILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDS  603
                R ++++ W   ++  +++  ++ +KV  L  FFS+V ENN+N +W+AI Y   + ++
Sbjct  133   LENREKVLQMWFKSWLFTLVRIAFIYLKVACLYVFFSRVGENNDNPAWEAIGYQVDNVEN  192

Query  604   NKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFD  783
             +K+        +++E+                         PL KG+I    E    +  
Sbjct  193   SKQ--------VSKER-------------------------PLQKGMIETMHEKDSTLLQ  219

Query  784   RLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKY  963
              L + G  V+   ++       + I+CDAV+VGSG GGGV A +LA++G KV+VLEKG Y
Sbjct  220   SLTQKGLQVTEDTERN-----VYKIKCDAVIVGSGCGGGVAAAILASSGLKVVVLEKGSY  274

Query  964   FARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKE  1143
             FA S  S  EG S+D++Y  GG++ S D  +L+LAGS VGGGS INWSASI+TP  +L+E
Sbjct  275   FAPSDYSPFEGPSMDQLYESGGILPSIDGQMLILAGSTVGGGSAINWSASIKTPKSILQE  334

Query  1144  WDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNA  1323
             W E  +L LFGS EY  AM+ VC R+GV    ++EGFQN +LRKGC  LG  VE +PRN+
Sbjct  335   WAEDCQLPLFGSPEYLSAMDNVCERIGVTENCKEEGFQNQILRKGCKNLGLEVENVPRNS  394

Query  1324  SRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKK----TGREQ  1491
             S  HYCG C FGC+ G KKGT  TWL D V +G  VI   C+A K +  K       + +
Sbjct  395   SESHYCGSCGFGCRRGDKKGTDRTWLVDAVSNG-AVILTGCKAEKFILEKNKICSKRKLK  453

Query  1492  AAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAW  1671
               GV+    N    +   ++++VT+ ACGAL TP L+ +SGL+N NIGRNLHLHPV+ AW
Sbjct  454   CLGVIAKTSNKNITKKLHIEAKVTISACGALFTPLLMHSSGLKNRNIGRNLHLHPVLMAW  513

Query  1672  GYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPW  1851
             GYFPD+       E + K Y+GGI+T++ KVVA   ++   A+I+TPSL P  ++A+ PW
Sbjct  514   GYFPDSDS-----EFKGKVYEGGIITSVHKVVA--ADNKVRAIIETPSLGPAQYAALCPW  566

Query  1852  LSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRIL  2031
              SG D+K RM  FSRTA +  + RD+ SG+  +   ++Y     D+ ++++GL + LRIL
Sbjct  567   ESGLDMKRRMLNFSRTAHMITIIRDQGSGKVHAGGRVTYKFDALDRQNMQSGLRQALRIL  626

Query  2032  AAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRD----LGNLSTLIGSAHQMGSC  2199
              AAGA E+GT    G+ ++ KG S  E++EF+E  S  +             SAHQMGSC
Sbjct  627   VAAGAVEVGTHRSDGQSIRCKGISNKELEEFLESVSPVEGPMFPAEKWVTHTSAHQMGSC  686

Query  2200  RMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             RMG++ +   V+  GE+WE EGLF+ D+SV P A+GVNPM+TVQ+ AYC ++ + + L+
Sbjct  687   RMGINEKEGAVDENGESWEAEGLFVCDASVLPGAIGVNPMITVQSTAYCLSKRIAESLR  745



>ref|XP_006296686.1| hypothetical protein CARUB_v10013046mg [Capsella rubella]
 gb|EOA29584.1| hypothetical protein CARUB_v10013046mg [Capsella rubella]
Length=744

 Score =   503 bits (1295),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 316/773 (41%), Positives = 453/773 (59%), Gaps = 67/773 (9%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDD------DSVKLFFQTSASIAGTPQRVAWMI  282
             ++ A M T+ S  +  LP V  P      D      ++++ F+ TS S     ++   +I
Sbjct  15    ITAAEMETLASFCEAVLPPVPPPPEEISGDSNHRNKEALRSFYSTSGSQTPVLRQSIELI  74

Query  283   SERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIV----  450
             ++R      ++ RL L+LL+TRIGTL++CG   L S++P+++ F E+S  KR  ++    
Sbjct  75    TKRGTIEAYLVTRLILFLLATRIGTLLICGTECLVSRWPFVEKFSELSLEKRERVLQKQF  134

Query  451   RSWSCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSK  630
             R+W   ++  ++  ++ +KV +L  FFS+V+ N EN +W+AI Y   + D NK    K++
Sbjct  135   RNW---FLTPVRAGFVYIKVAILFCFFSRVSPNGENSAWEAIGY-KVNLDENKPETHKAR  190

Query  631   KWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPV  810
                                             PL KG++    E    + + L +     
Sbjct  191   --------------------------------PLEKGIVETMNETEETLLESLAR-----  213

Query  811   SPCIQQKGS-GNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsl  987
               C+Q      N +  I+CDAVVVGSGSGGGV A VLA +G KV+VLEKG Y+  S    
Sbjct  214   -KCLQTDHDVDNDAIRIKCDAVVVGSGSGGGVAASVLAKSGLKVVVLEKGSYYTPSEYLP  272

Query  988   legsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLE  1167
              EG  +D++Y  GG++ S D +I++LAG+ VGGGS +NWSA I+TP  VL+EW E  K+ 
Sbjct  273   FEGPGMDKLYENGGILPSVDGNIMVLAGATVGGGSAVNWSACIKTPKTVLQEWSEDQKIP  332

Query  1168  LFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGW  1347
              FG+KEY  AME V  RMGV  + E E  QN VLRKGC  LG+ VE +PRN+S  HYCG 
Sbjct  333   FFGTKEYVLAMEAVWERMGVTEKCEMESLQNQVLRKGCENLGFNVENVPRNSSEKHYCGS  392

Query  1348  CSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVV-----HNKKTGREQAAGVMFV  1512
             C +GC+ G KKG+  TWL D V  G  VI    +A + +      NK   + +  GV+  
Sbjct  393   CGYGCRQGDKKGSDRTWLVDAVSHG-AVILTGSKAERFILEKNCSNKGGKKMKCLGVVAK  451

Query  1513  YQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAP  1692
               N   ++   ++++VTV A GAL TP L+ +SGLRN +IGRNLHLHPV+ AWGYFPD  
Sbjct  452   SLNGNIEKKIKIEAKVTVSAGGALLTPPLMISSGLRNRHIGRNLHLHPVLMAWGYFPDKA  511

Query  1693  GSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIK  1872
              S      + KSY+GGI+T++SKV++  E+S   A+I+TP+L PG FS + PW SG D+K
Sbjct  512   SSNF--NIKGKSYEGGIITSVSKVLS--EDSEVRAIIETPALGPGSFSVLCPWTSGLDMK  567

Query  1873  TRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEE  2052
              RM R+SRTA L  + RD+ SGE  +   ISY + KTD+ ++K GL + LRIL AAGAEE
Sbjct  568   KRMARYSRTANLITIVRDRGSGEVKTEGRISYVVDKTDRDNIKAGLRQSLRILIAAGAEE  627

Query  2053  IGTCHRAGKILKPKGASRDEIDEFVE----KESSRDLGNLSTLIGSAHQMGSCRMGVDPR  2220
             +GT    G+ L  KG   D I EF++    +E  + +     +  SAHQMGSCR+G + +
Sbjct  628   VGTHRSDGQRLICKGVDEDSIQEFLDAVSTEEGPKGMTEKWNVYSSAHQMGSCRIGENEK  687

Query  2221  SSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKT  2379
                ++  GE+WE E LF+ D+S  P+A+GVNPM+TV + AYC +  + K + T
Sbjct  688   EGAIDLNGESWEAEKLFVCDASALPSAVGVNPMITVMSTAYCISTRIAKSMTT  740



>emb|CDP11641.1| unnamed protein product [Coffea canephora]
Length=749

 Score =   503 bits (1295),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 308/782 (39%), Positives = 466/782 (60%), Gaps = 67/782 (9%)
 Frame = +1

Query  82    ERGNDGVYSGGCPLSPAVMATVTSISDTFLPAV------DVPQHAAVDDDSVKLFFQTSA  243
             E G +  YS G   S + +  +T + + F+P +      D+        ++++ F+++S 
Sbjct  12    EGGRETKYSHG--FSSSELEALTGMCEAFIPPLPLNNSPDIVGKDGKTKEAIQSFYKSSG  69

Query  244   SIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEI  423
             +    P +VA ++ +R     V+L+R+ L +LSTR+GTL+LCG      ++PY+  F +I
Sbjct  70    AQYPNPDKVAELVVKRGFMEAVMLVRILLIILSTRLGTLLLCGALCFGKKWPYINKFSDI  129

Query  424   SPHKRAEIVRSW-SCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDY-CGPDP  597
                 R ++++ W    ++  ++  ++ +K + L +FF+QV E+ +N +W+A+DY      
Sbjct  130   PVDNREKVIQKWLKHKFLTPIRLPFVLIKFLCLYAFFTQVWEDFKNPAWEAMDYQVDNRK  189

Query  598   DSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQV  777
             DS+  P  K                                  PL KG++    E    +
Sbjct  190   DSSTTPHEK----------------------------------PLMKGMVETTHETESTI  215

Query  778   FDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKG  957
                L + G  V+   ++K      + I+CD V+VGSG GGGV A VLA +G KV+V+EKG
Sbjct  216   VSSLVQKGLRVAEDPKEK-----LYKIKCDVVIVGSGCGGGVAAAVLAKSGQKVVVIEKG  270

Query  958   KYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVL  1137
              YF ++  S LEG S++E+Y  GG++A+ D  +L+LAGS VGGGS +NWSA ++TP  VL
Sbjct  271   NYFTKTDYSSLEGPSMNELYESGGILATLDGKLLMLAGSTVGGGSAVNWSACLKTPMSVL  330

Query  1138  KEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPR  1317
             +EW +  ++ LF S +Y  AM+TV  R+GV  +  +EGFQN +LR+GC +LG  VE++PR
Sbjct  331   QEWAKDCQIPLFTSSQYVSAMDTVSQRIGVTEKCSEEGFQNQILRQGCEKLGLEVESVPR  390

Query  1318  NASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNK-KTGREQA  1494
             N+S +HYCG C++GC+ G KKGT  TWL D VD G  VI   C+A K V  K K GR + 
Sbjct  391   NSSENHYCGSCNYGCRTGDKKGTDSTWLVDAVDCG-AVIITGCKAEKFVLEKNKYGRSRK  449

Query  1495  AGVMFVYQN--NG--AKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVV  1662
             +  + V     NG   K  C ++++VT+ ACG+L TP L+ +SGL N +IGRNLHLHPV+
Sbjct  450   SKCLGVIAKCLNGDITKRIC-IEAKVTISACGSLLTPPLMISSGLTNQHIGRNLHLHPVL  508

Query  1663  FAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAI  1842
              AWGYFP++         + K Y+GGI+T++ KV ++  +SG  ALI++P+L PG F+A+
Sbjct  509   MAWGYFPESDSV-----LKGKIYEGGIITSVHKVGSD--DSGVRALIESPALGPGSFAAL  561

Query  1843  MPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVL  2022
              PW SG + K R+ +++RTA LF++ RD+ SGE  +   ISY    TDK ++  GL + L
Sbjct  562   RPWESGLETKKRILKYARTAHLFSMIRDRGSGEVRAEGRISYTFDATDKENITAGLRQAL  621

Query  2023  RILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLIGSAHQM  2190
              IL AAGA E+GT    G+  K KG S  E++EF+++    E  + L    T   SAHQM
Sbjct  622   MILVAAGAVEVGTLQSNGQKFKCKGTSERELEEFLDEVTAAEGPKSLVQNWTTYFSAHQM  681

Query  2191  GSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKF  2370
             GSCRMG   + S V+  GE+WE E LF+ D+SV P A+GVNPM+T+Q+ A+C +  + + 
Sbjct  682   GSCRMGKSEKVSAVDENGESWEAEDLFVCDASVLPGAVGVNPMITIQSTAFCLSNKIAEI  741

Query  2371  LK  2376
             LK
Sbjct  742   LK  743



>ref|XP_006443786.1| hypothetical protein CICLE_v10018992mg [Citrus clementina]
 ref|XP_006479488.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Citrus sinensis]
 gb|ESR57026.1| hypothetical protein CICLE_v10018992mg [Citrus clementina]
Length=748

 Score =   503 bits (1294),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 311/763 (41%), Positives = 446/763 (58%), Gaps = 66/763 (9%)
 Frame = +1

Query  136   MATVTSISDTFLPAVD----VPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHP  303
             + ++ +I  T +P +       QH+   + ++  F++ SAS    P  VA ++ +R Q  
Sbjct  28    IESLAAICQTLVPPLPPETITKQHS--HNQAIVSFYKASASQHPIPHEVAELMVKRGQPQ  85

Query  304   KVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSC-CYIKI  480
              V L RL L LLS R+GTL+LCG       +P++ +F EIS  KR +I+++WS   Y+  
Sbjct  86    AVFLARLILTLLSFRLGTLLLCGYLCFDWNWPFIHNFSEISLEKREKILKNWSRERYLLP  145

Query  481   LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMT  660
             L+  ++ +K+  L  FF++ +E +EN +W+AI Y     + + KP G+            
Sbjct  146   LRVVFVMIKMFCLFYFFARTDEKSENPAWEAIGYHVDTREPSNKPRGER-----------  194

Query  661   LSEEQKKGEEDVIPMNPELLLGPLHKGVINL--NQEPRRQVFDRLQKLGFPVSPCIQQKG  834
                                   PL KG++      E    +F  L   G  V+   +   
Sbjct  195   ----------------------PLQKGIVETVHENENDHSLFQCLVDHGLQVTVDHEHN-  231

Query  835   SGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEM  1014
                  F I+CD VVVGSG GGGV A VLA++G KVLVLEKG YF     S LEG S+ E+
Sbjct  232   ----LFEIKCDVVVVGSGCGGGVAAAVLASSGQKVLVLEKGNYFVAEDYSSLEGPSMLEL  287

Query  1015  YLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRH  1194
             Y  GGL+++ D   ++ AGS VGGGS +NWSA I+TP  VL++W   HK+ LFGS +YR 
Sbjct  288   YESGGLLSTLDGKFMVFAGSAVGGGSAVNWSACIETPDSVLRDWFVEHKIPLFGSLDYRA  347

Query  1195  AMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGK  1374
             AM+ V  R+GV     +EGFQN VLRKGC  LG+ VE++ RN   +HYCG C++GC+ G 
Sbjct  348   AMDKVSKRIGVTEHCTEEGFQNQVLRKGCENLGFKVESVARNTPEEHYCGSCNYGCRTGD  407

Query  1375  KKGTSETWLADLVDSGNGVIFPECEAVK--VVHNKKTGR-EQAAGVMFVYQNNGAKEFCF  1545
             KKGT  TWL D VD+G  VI    +A K  +V NK + R ++  GV     N        
Sbjct  408   KKGTDVTWLVDAVDNG-AVILAGFKAEKFILVDNKDSIRSKKCLGVTATALNKNVTRKLQ  466

Query  1546  VKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKK  1725
             +K++ T+ ACG+L TP L+ +SGL NPNIG NLHLHPV+ AWGY PD        E + K
Sbjct  467   IKAKATISACGSLLTPPLMISSGLENPNIGTNLHLHPVLLAWGYIPDHVS-----ELKGK  521

Query  1726  SYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAI  1905
             +++GGI+T++ KVV+  E+S   A+I++P++ P  F+A  PW+SG ++K RM R+ R A 
Sbjct  522   TFEGGIITSIHKVVS--EDSKVQAIIESPAMGPASFAASFPWISGRELKDRMLRYGRIAQ  579

Query  1906  LFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKIL  2085
             LFAL RD+ SGE      I Y + K DK +LK GL + LRIL AAGAEE+GT    G  +
Sbjct  580   LFALVRDQGSGEVKVEGKIKYRLSKNDKENLKTGLRQALRILVAAGAEEVGTYRSDGHRI  639

Query  2086  KPKGASRDEIDEFVEKESSRDLGNLS------TLIGSAHQMGSCRMGVDPRSSVVNPMGE  2247
             + KG   ++++EF+   S   +G ++      ++  SAHQMGSCRMG       V+  GE
Sbjct  640   RCKGIKEEDLEEFI--GSIEVVGGMASRGEHWSVYFSAHQMGSCRMGATEEDGAVDENGE  697

Query  2248  TWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             +WE EGLF+ D SV P+A+G+NPM+T+++ +YC ++ +   LK
Sbjct  698   SWEAEGLFVCDGSVLPSAIGINPMITIESTSYCISKKIADSLK  740



>gb|KEH30749.1| long-chain-alcohol oxidase FAO2-like protein [Medicago truncatula]
Length=766

 Score =   503 bits (1296),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 323/771 (42%), Positives = 455/771 (59%), Gaps = 62/771 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDS---VKLFFQTSASIAGTPQRVAWMISER  291
              S A M ++TSI +  LP++ +      DD+S   V+ FF  SAS+   P  VA M+ + 
Sbjct  31    FSVAEMESLTSICEVVLPSLPMDDALTKDDESSKDVQSFFNISASMYPIPDEVAEMLVKS  90

Query  292   LQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIV-RSWSCC  468
                  VIL+R+ LWLL+TR+GTL++CG   LS ++P++ +F  +S  KR +IV R+    
Sbjct  91    GVTEAVILIRVILWLLATRLGTLLICGLLCLSKKWPFINNFSSLSLDKREKIVQRALKLR  150

Query  469   YIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITRE  648
             ++   +  +  +KV+ L  FFS V+EN +N +WKAI Y                +  T +
Sbjct  151   FLTPFRLAFAYIKVLCLFVFFSWVDENGDNPAWKAIGY----------------EVSTAD  194

Query  649   QHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQ  828
             + MT   +++                PL KG+I +  E    +   L   G  V+     
Sbjct  195   EKMTNDTKKR----------------PLEKGIIEIMHEHDTTLQQSLSNKGLNVTL----  234

Query  829   KGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslD  1008
               S N    I+CDAVVVGSG GGGV A VL+ AG+KV+VLEKG YF     S LEG S+D
Sbjct  235   -DSKNNILKIKCDAVVVGSGCGGGVAASVLSKAGYKVVVLEKGNYFVPKDYSSLEGPSMD  293

Query  1009  EMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEY  1188
             + Y  GG++AS D  I+L AGS VGGGS +NWSA I+TP +VLKEW + HKL LF + EY
Sbjct  294   QQYEKGGMLASVDSRIVLFAGSTVGGGSAVNWSACIRTPQNVLKEWSDEHKLPLFETLEY  353

Query  1189  RHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKD  1368
               AMETVC R+GV      EGFQN VLRKGC  LG  V+ +PRN+  +HYCG C +GC  
Sbjct  354   LSAMETVCERIGVNENCTQEGFQNQVLRKGCQNLGLKVDYVPRNSPGNHYCGSCGYGCPK  413

Query  1369  GKKKGTSETWLADLVDSGNGVIFPECEAVKVV-----HNKKTGR-EQAAGVMFVYQNNGA  1530
             G+K+GT  TWL D VD G  VI   C+A + +      N  T + ++  GV+    N+G 
Sbjct  414   GEKQGTQATWLVDAVDKG-AVIITGCKAERFLFENNYRNANTRKNKKCLGVLAKTLNSGV  472

Query  1531  KEFCFVKSRVTVIACGALCTPSLLKNSGL-RNPNIGRNLHLHPVVFAWGYFPDAPGSKAW  1707
                   +++VT+ A GAL TP L+ +SGL +N NIGRNLHLHPV+  WGYFP++      
Sbjct  473   TMKLQFEAKVTISAGGALLTPPLMISSGLTKNKNIGRNLHLHPVLMTWGYFPESKS----  528

Query  1708  PEPEKKSYQGGIMTAMSKV---VANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTR  1878
              + + K+ +GGI+T++ +V     +   S   A+I+TP L P  F++I PW SG D K R
Sbjct  529   -DFKGKANEGGIITSVHRVPSSSNDDSISDTRAIIETPLLGPSSFASIYPWESGLDFKQR  587

Query  1879  MQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIG  2058
             M ++ RTA L  + RDK SG+  +   ISY +   D+ +++ GL++ LRIL AAGA E+G
Sbjct  588   MLKYPRTAHLITIIRDKASGQVKTEGRISYKLNSIDRENMRAGLQQGLRILIAAGAVEVG  647

Query  2059  TCHRAGKILK-PKGASRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRS  2223
             T    G+ +K  +     EI+EF++     E +   G    L  SAHQMGSCRMGV+ + 
Sbjct  648   THRSDGQRIKCNENTGEKEIEEFIDSVYPMEGALWPGENWNLYTSAHQMGSCRMGVNEKE  707

Query  2224  SVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
               V+  GE+WE EGLF+ D+SV PTA+GVNPM+T+Q+ A+C +  ++ FL+
Sbjct  708   GAVDENGESWEAEGLFVCDASVLPTAVGVNPMITIQSTAFCISNRIVDFLR  758



>gb|KHN28101.1| Long-chain-alcohol oxidase FAO1-like protein [Glycine soja]
Length=749

 Score =   503 bits (1294),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 327/779 (42%), Positives = 459/779 (59%), Gaps = 64/779 (8%)
 Frame = +1

Query  94    DGVYSGGCPLSPAVMATVTSISDTFLP-----AVDVPQHAAVDDDS----VKLFFQTSAS  246
             D  Y  G   S A M ++TSI +  LP     A+ + +    DDDS    ++ F   SAS
Sbjct  15    DNKYKHG--FSAAEMESLTSICEVVLPPLPMDALKIRKEDHDDDDSSNKSLQSFLDISAS  72

Query  247   IAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEIS  426
                 P  VA MI++R     VIL+R+ LWLL+TR+GTL+LCG   L   +PY+  F  IS
Sbjct  73    RYPIPHEVAEMITKRSLIETVILIRVVLWLLATRLGTLLLCGFLCLGENWPYINKFSNIS  132

Query  427   PHKRAEIVRSW-SCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDS  603
               KR +I++ W    ++  ++  +  +KV+ L  FFS V+EN +N +WKAI Y       
Sbjct  133   LEKREKIMQKWLKHRFLTPIRLTFACIKVLCLFVFFSWVDENGDNPAWKAIGY-------  185

Query  604   NKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFD  783
              + PA         ++ MT +   +                PL KG+I    E    +  
Sbjct  186   -EVPA---------DEKMTNTSNTR----------------PLEKGIIETMNESDSTLQQ  219

Query  784   RLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKY  963
              L   G  V+       S +    ++CDA+VVGSG GGGV A VL++AGHKV+VLEKG Y
Sbjct  220   SLANKGLNVT-----LDSKSNILKVKCDALVVGSGCGGGVAAAVLSSAGHKVVVLEKGNY  274

Query  964   FARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKE  1143
             F     S LEG S++++Y  GG++AS D  +L+LAGS VGGGS +NWSA I+TP  VLKE
Sbjct  275   FTPQDYSSLEGPSMNQLYETGGILASVDSRVLVLAGSTVGGGSAVNWSACIKTPHKVLKE  334

Query  1144  WDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNA  1323
             W E+HKL  F S+EY  AME VC R+GV      EGFQN VLRKGC  LG  V+ +PRN+
Sbjct  335   WSESHKLPFFSSQEYLSAMENVCERIGVTENCSQEGFQNQVLRKGCQNLGLKVDYVPRNS  394

Query  1324  SRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVK-VVHNKKTG---REQ  1491
             S +HYC  C +GC  G+K+GT +TWLAD V+  + VI   C+A + ++ + ++G   +++
Sbjct  395   SGNHYCS-CGYGCPKGEKQGTQDTWLADAVER-DAVIITGCKAERFLLESNRSGNGRKKK  452

Query  1492  AAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAW  1671
               GV     N+       ++++VT+ A GAL TP LL +SGL+N NIG+NLHLHPV+  W
Sbjct  453   CLGVTAKTLNSRITMKLQIEAKVTISAGGALLTPPLLISSGLKNKNIGKNLHLHPVLMTW  512

Query  1672  GYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPW  1851
             GYFP++  S    E +   Y+GGI+T++ KV +    S   A+I+TP L P  F+A+ PW
Sbjct  513   GYFPESNDS----EFKGNVYEGGIITSVHKVPSPDSNSDSRAIIETPLLGPASFAALCPW  568

Query  1852  LSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRIL  2031
              SG D K RM  + RT+ L  + RD   G+  +   ISY + + DK ++K GL++ LRIL
Sbjct  569   ESGQDFKERMLNYPRTSHLITIIRDMACGQVTTEGRISYKLNEVDKENMKAGLKQALRIL  628

Query  2032  AAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSC  2199
              AAGA E+GT    G+ LK  G   +E+ EF++     E +   G    +  SAHQMGSC
Sbjct  629   IAAGAVEVGTHRSDGQRLKCDGIGENEVQEFLDSVCPMEGALSPGEKWNIYSSAHQMGSC  688

Query  2200  RMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             RMGV  +   V+  GETWE EGLF+ D+SV P+A+GVNPM+TVQ+ AYC +  ++ +L+
Sbjct  689   RMGVSEKEGAVDENGETWEAEGLFVCDASVLPSAVGVNPMITVQSTAYCISNRIVDYLR  747



>emb|CDX94858.1| BnaC03g43300D [Brassica napus]
Length=741

 Score =   502 bits (1293),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 309/776 (40%), Positives = 456/776 (59%), Gaps = 66/776 (9%)
 Frame = +1

Query  109   GGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDD------SVKLFFQTSASIAGTPQRV  270
             G   ++ A M ++ S  +  LP V  P+  +  DD      +++ FF TS S     +  
Sbjct  12    GHLGITTAEMESLGSFCEAVLPPVSPPEEYSAGDDHCRNKEALRSFFSTSGSRTPVVRES  71

Query  271   AWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIV  450
               +I++R      ++ RL L+LL+TR+GTL++CG   L S++P+++ F E+S  KR  ++
Sbjct  72    IELITKRGTVETYLVTRLVLFLLATRLGTLLICGTECLVSRWPFVEKFSELSLEKRERVL  131

Query  451   ----RSWSCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPA  618
                 R+W    +  ++  ++ +KV  L  FFS V+ N EN +W+AI Y   + ++N+   
Sbjct  132   QKQFRNW---ILTPIRAAFVYIKVAFLFCFFSWVSPNGENPAWEAIGY---NVNTNENKP  185

Query  619   GKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKL  798
              ++     RE+                         PL KG++   QE  + + + L ++
Sbjct  186   SETH----RER-------------------------PLEKGMVETMQETEQTLLESLAQM  216

Query  799   GFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARss  978
             G        +  + + +  I+CDAVVVGSGSGGGV A VLA AG KV+V+EKG Y+  S+
Sbjct  217   GL-------EAETDHDTIRIKCDAVVVGSGSGGGVAASVLAKAGLKVVVMEKGSYYTPST  269

Query  979   lsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETH  1158
                 EG  +D++Y  GG++ + D ++++LAG+ VGGGS +NWSA I+TP  VL+EW E  
Sbjct  270   YPSTEGPGMDKLYENGGILPTIDGNMMVLAGATVGGGSAVNWSACIKTPKSVLQEWSEDR  329

Query  1159  KLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHY  1338
              + L+ +KEY  AME V  RMGV    E EGFQN VLRKGC  LG  VE + RN+S  HY
Sbjct  330   NIPLYATKEYVSAMELVWERMGVTETCELEGFQNQVLRKGCENLGINVENVARNSSERHY  389

Query  1339  CGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVV---HNKKTGRE--QAAGV  1503
             CG C +GC+ G KKG+  TWL D V  G  VI   C+A + +   +    GR+  +  GV
Sbjct  390   CGSCGYGCRQGDKKGSDRTWLVDAVSHG-AVILTGCKAERFILENNGNNVGRKKMKCLGV  448

Query  1504  MFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFP  1683
             +    N    +   +++RVT+ A G+L TP L+  SGL+N +IG+NLHLHPV+  WGYFP
Sbjct  449   IAKSLNGNIAKKIKIEARVTISASGSLLTPPLMIKSGLKNRHIGKNLHLHPVLMTWGYFP  508

Query  1684  DAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGT  1863
             D   S  +   + KSY+GGI+T+MSKV++  E+S   A+I+TP+L P  FS + PW SG 
Sbjct  509   DKASSSFY--FKGKSYEGGIITSMSKVLS--EDSEVRAIIETPALGPASFSVLCPWTSGL  564

Query  1864  DIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAG  2043
             D+K RM R+SRTA L  + RD+ SGE  +   ISY + K D+ ++  GL + LRIL AAG
Sbjct  565   DMKKRMSRYSRTANLITIVRDRGSGEVRTEGRISYVVDKVDRENITAGLRQSLRILIAAG  624

Query  2044  AEEIGTCHRAGKILKPKGASRDEIDEFVE----KESSRDLGNLSTLIGSAHQMGSCRMGV  2211
             AEE+GT    G+ L  KG     IDEF++    +E  + +    ++  SAHQMGSCR+GV
Sbjct  625   AEEVGTHRSDGQKLICKGVDEKSIDEFLDSVSAEEGPKAMTENWSVYSSAHQMGSCRIGV  684

Query  2212  DPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKT  2379
             D     ++  GE+WE + LF+ D SV P+A+GVNPM+T+ + AYC A  ++K + T
Sbjct  685   DEDEGAIDLNGESWEADKLFVCDGSVLPSAVGVNPMITIMSTAYCIATRIVKSMTT  740



>ref|XP_010466677.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Camelina sativa]
Length=746

 Score =   502 bits (1293),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 308/773 (40%), Positives = 453/773 (59%), Gaps = 65/773 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQH---AAVDD----DSVKLFFQTSASIAGTPQRVAWM  279
             ++ A M T+ S  +   P V  PQ     A D+    ++++ F+ TSAS      +   +
Sbjct  15    ITAAEMETLASFCEAVFPPVAPPQEELSGAGDNNHRKEALRSFYSTSASQTPILCQSMEL  74

Query  280   ISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIV---  450
             +++R      ++ RL L+LL++R+GTL++CG   L +++P+++ F E+S  KR  ++   
Sbjct  75    LTKRATMEACLVTRLILFLLASRLGTLLICGTECLVTRWPFVEKFSELSLEKRERVIQKQ  134

Query  451   -RSWSCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKS  627
              R+W    +  ++  ++ +KV+ L  FFS+V+   EN +W+AI Y               
Sbjct  135   FRNW---ILTPIRAGFVYIKVIFLFCFFSRVSPKGENPAWEAIGY---------------  176

Query  628   KKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFP  807
                     H+ L E +          +      PL KG++    E  + + + L + G  
Sbjct  177   --------HVNLDENKP---------SETYKARPLEKGIVETMNETEQTLLESLARKGLE  219

Query  808   VSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsl  987
                 + Q      +  I+CDAVV+GSGSGGGV A VLA +G KV+VLEKG Y+  S    
Sbjct  220   ADHDMDQD-----TIRIKCDAVVIGSGSGGGVAASVLAKSGLKVVVLEKGSYYTPSDYRP  274

Query  988   legsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLE  1167
              EG  +D++Y  GG++ + D ++++LAG+ VGGGS +NWSA I+TP  VL+EW E  K+ 
Sbjct  275   YEGPGMDKLYENGGILPTVDGNLMVLAGATVGGGSAVNWSACIKTPKSVLQEWSEDQKIP  334

Query  1168  LFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGW  1347
              +G+KEY  AM+ V  RMGV  + E E FQN +LRKGC  +G  VE +PRN+S  HYCG 
Sbjct  335   FYGTKEYVSAMDVVWKRMGVTEKCEMESFQNQILRKGCENIGVNVENVPRNSSEGHYCGS  394

Query  1348  CSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKK---TGREQ--AAGVMFV  1512
             C +GC+ G KKG+ +TWL D V  G  V+   C+A + +  KK    G +Q    GVM  
Sbjct  395   CGYGCRQGDKKGSDQTWLVDAVSHG-AVVLTGCKAERFILEKKGSNVGGKQMKCLGVMAK  453

Query  1513  YQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAP  1692
               N    +   ++++VTV A G+L TP L+ +SGLRN NIGRNLHLHP + +WGYFP+  
Sbjct  454   SLNGNIAKKLIIEAKVTVSAGGSLLTPPLMISSGLRNRNIGRNLHLHPTLMSWGYFPEKK  513

Query  1693  GSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIK  1872
              S      + KSY+GGI+T++SKV +  E+S   A+I+T SL PG FS + PW SG D+K
Sbjct  514   SSSL--SFKGKSYEGGIITSVSKVFS--EDSEVRAIIETASLGPGSFSVLFPWTSGLDMK  569

Query  1873  TRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEE  2052
             TRM R+SRTA L  + RD+ SGE  +   I Y + KTDK ++  GL + LRIL AAGAEE
Sbjct  570   TRMARYSRTASLITIVRDRGSGEVKTEGRIRYVVDKTDKGNIIAGLRQSLRILIAAGAEE  629

Query  2053  IGTCHRAGKILKPKGASRDEIDEFVEKESSRD----LGNLSTLIGSAHQMGSCRMGVDPR  2220
             +GT    GKILK KG   + I+EF++  SS +    +     +  SAHQMGSCR+G + +
Sbjct  630   VGTHRSDGKILKCKGVDENSIEEFLDSVSSEEGPKGMTEKWNIYCSAHQMGSCRIGENEK  689

Query  2221  SSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKT  2379
                ++  GE+WE E LF+ D+S  P+A+GVNPM+TV + AYC +  + K + T
Sbjct  690   EGAIDLNGESWEAERLFVCDASALPSAVGVNPMITVMSTAYCISTRIAKSMTT  742



>ref|XP_008235630.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Prunus mume]
Length=760

 Score =   502 bits (1293),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 304/777 (39%), Positives = 455/777 (59%), Gaps = 68/777 (9%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVP---------QHAAVDDDSVKLFFQTSASIAGTPQRVA  273
              SPA + ++ +I +  +P + +          +  + DD ++   ++ S S    P  VA
Sbjct  25    FSPAQIQSLAAICEALVPPLSLEDTINNNNNNKEESPDDQALHSIYRASGSQPPIPDEVA  84

Query  274   WMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVR  453
              ++ +R     +  ++L L +LS R+GTL+LC    LS ++P++ SF E+S  KR E+++
Sbjct  85    ELMVKRALPEVLEGMKLFLKMLSFRLGTLLLCRHRCLSWKWPFIHSFSEMSLEKREEVLK  144

Query  454   SWSCCYIKI-LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSK  630
              WS   + + L+  +L +K+    +FFS ++EN+ N +WKA+ Y   D ++NKK     K
Sbjct  145   KWSREKLVLTLRLMFLVVKIFCFYTFFSWLDENSRNPAWKAVGY---DLNTNKKLIKTPK  201

Query  631   KWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPV  810
             +                               PL +G+I    E    +   L K G  V
Sbjct  202   E------------------------------RPLEQGIIETMNESDSTLVQSLTKRGLRV  231

Query  811   SPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsll  990
             S       + +    I+CD V+VGSG GGGV A VLA +G KV+V+EKG YF     S L
Sbjct  232   S-----DDTTHNLHKIQCDVVIVGSGCGGGVAAAVLAESGQKVIVVEKGNYFLPKDYSSL  286

Query  991   egsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLEL  1170
             EG S++E+Y  GG+++S D  I++LAGS VGGGS INWSASI+TP  VL EW   HK+ L
Sbjct  287   EGPSMNELYESGGIMSSVDGMIMILAGSTVGGGSAINWSASIRTPDTVLHEWSVDHKVRL  346

Query  1171  FGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWC  1350
             + S +Y+ AM+ VC R+ V     +E FQN +LRKGC  LG  V+ +PRN+  DHYCG C
Sbjct  347   YASSDYKSAMDVVCKRIRVTDSCTEENFQNQILRKGCDTLGLKVDLVPRNSPGDHYCGSC  406

Query  1351  SFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVK-VVHNKKTG---REQAAGVMFVYQ  1518
             ++GC  G+K+GT  TWL D V  G  VI   C+A K ++ N   G   R++  GV     
Sbjct  407   NYGCPTGEKQGTDSTWLVDAVKCG-AVILTGCKAEKFILENDSQGGGTRKRCLGVEATSL  465

Query  1519  NNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGS  1698
                 K+   ++++VT+ ACG+L TP L+ +SGL+NPNIG NLHLHPV+ +WGYFP+    
Sbjct  466   GKNIKKKLQIEAKVTISACGSLLTPPLMISSGLKNPNIGTNLHLHPVLLSWGYFPEHES-  524

Query  1699  KAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTR  1878
                 E   ++Y+GGI+T++ KVV++   +   A+I+TP+L P  F+++ PW+S  D+K R
Sbjct  525   ----EFRGRTYEGGIITSLHKVVSD--TTNVRAIIETPALGPASFASLSPWISRLDMKDR  578

Query  1879  MQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIG  2058
             M++++RTA LFAL RDK SG       I Y + + DK +L+ GL + LRIL AAGA E+G
Sbjct  579   MEKYARTAHLFALVRDKGSGVVKREGRIHYTLDQLDKENLQVGLRQALRILIAAGAVEVG  638

Query  2059  TCHRAGKILKPKGASRDEIDEFVEK------ESSRDLGNLSTLIGSAHQMGSCRMGVDPR  2220
             T    G+ +K KG   ++++EF++        SSR+   L T+  SAHQMGSCRM     
Sbjct  639   TYRNDGQRIKCKGTKHEDLEEFLDTVVAPAGPSSRE--ELWTIYSSAHQMGSCRMSASEE  696

Query  2221  SSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHNHM  2391
                V+  GE+WE +GLF+ D S+ PTA+GVNPM+T+Q+ AYC ++ + + L+   ++
Sbjct  697   EGGVDENGESWEAKGLFVCDGSLLPTAIGVNPMITIQSTAYCISKKIAESLEKEKYI  753



>gb|KEH23950.1| long-chain-alcohol oxidase FAO1 [Medicago truncatula]
Length=737

 Score =   501 bits (1291),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 322/789 (41%), Positives = 467/789 (59%), Gaps = 67/789 (8%)
 Frame = +1

Query  46    DDGDSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKL  225
             +D   L   G   RG +  YS G   S   M  + SI DT  P++ + +  +  D+++  
Sbjct  2     EDSHPLLRGG---RGKEKGYSHGFLTSQ--MHVLASICDTLFPSIPLNKEVS-QDENLSS  55

Query  226   FFQTSASIAGTPQRVAWMISE-RLQHPKVI-llrlalwllSTRIGTLMLCGKASLSSQFP  399
             F+ TS S    P   A ++   +   P+ I L+R  LW+LS ++GTL LCG   L  ++P
Sbjct  56    FYSTSGSQFPFPDEAAELVLLFKKSAPEAIPLVRWILWILSFKLGTLFLCGTLCLHWKWP  115

Query  400   YLQSFPEISPHKRAEIVRSWSC-CYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAI  576
             ++  F EIS  KR EI++ WS       L+  ++ +K++   + FS+ + N  N  WKAI
Sbjct  116   FVLKFSEISLEKREEILKKWSKENKWTPLRAVFVLIKIVFFYTLFSRTDVNGHNPMWKAI  175

Query  577   DYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLN  756
              Y                K  TRE+                    +L   PL +G++   
Sbjct  176   GY----------------KVDTREKL-------------------KLKKRPLQEGLVETT  200

Query  757   QEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHK  936
              E    +   L + G  V+   +Q       + I+CD V+VGSGSGGGV A +LAN+GHK
Sbjct  201   YETNSTLIQSLSEKGLEVTEDEEQN-----VYKIKCDVVIVGSGSGGGVAAAILANSGHK  255

Query  937   VLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASI  1116
             V++LEKG+YF     S LE S+++E+Y  GG++ + D  +++LAGS VGGGS INW+A +
Sbjct  256   VIILEKGEYFVSQDYSSLESSAMNELYESGGIMPTLDGKMMILAGSTVGGGSAINWAACV  315

Query  1117  QTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGY  1296
             +TP  V KEW E +KL LF S +Y+ AM++VC R+GV  +   + FQN VLRKGC  +G 
Sbjct  316   RTPDSVKKEWSEKYKLPLFTSSDYQSAMDSVCRRIGVTDKCNKQSFQNQVLRKGCERIGL  375

Query  1297  PVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVK-VVHNK  1473
              VE++  NAS DHYCG C +GC+ G KKGT  TWL D V++G  VI   C A K ++ N 
Sbjct  376   KVESVAVNASEDHYCGSCCYGCRTGDKKGTDSTWLVDAVENG-AVILTGCRAEKFIIENG  434

Query  1474  K--TGREQAAGVMFV--YQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRN  1641
             K  T R+  +GV+    +++   K+   ++S+VT+ +CG+L TP L+ +SGL+NPNIGRN
Sbjct  435   KNETKRKNCSGVIAATSWRSKITKKL-QIESKVTISSCGSLLTPPLMISSGLQNPNIGRN  493

Query  1642  LHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLH  1821
             LHLHPV FAWGYFP+   + +       +++GGI+T++ KV+A  E S    +I+ P+L 
Sbjct  494   LHLHPVQFAWGYFPENMTNLS-----GNNHEGGIITSIHKVLA--ENSTPKIIIEAPALG  546

Query  1822  PGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLK  2001
             PG FS ++PW+SG D+K RM +++RTA LFAL RD  SGE  S   ISY + + D+ +L+
Sbjct  547   PGSFSVLVPWISGLDMKDRMAKYARTANLFALVRDIGSGEVRSEGKISYRLDQMDRENLR  606

Query  2002  NGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKES----SRDLGNLSTL  2169
              GL K LRIL AAGA E+GT    G+ +K +G   +E++EF++  S     R    L T+
Sbjct  607   IGLRKSLRILVAAGAVEVGTYRSDGQKIKCEGIKEEELEEFLDTVSVVGGPRSRSELWTM  666

Query  2170  IGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCT  2349
               SAHQMGSCRMG +     V+  GE+WE +GL++ D SV P+A+GVNPMVT+Q+ AYC 
Sbjct  667   FSSAHQMGSCRMGKNEEEGAVDENGESWEAKGLYVCDGSVLPSAVGVNPMVTIQSTAYCI  726

Query  2350  AQSVLKFLK  2376
             A  + + LK
Sbjct  727   ASKIAESLK  735



>gb|KDP26499.1| hypothetical protein JCGZ_17657 [Jatropha curcas]
Length=659

 Score =   499 bits (1284),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 292/684 (43%), Positives = 416/684 (61%), Gaps = 55/684 (8%)
 Frame = +1

Query  346   RIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS-CCYIKILKTFYLGMKVMVLL  522
             R+GTL+LCG       +P+   F E+S  KR EI+  WS   YI  L+  ++ +++  L 
Sbjct  23    RLGTLLLCGFICFDWNWPFFHKFSELSVKKREEILLKWSRQKYIFPLRAAFVAVRIFCLY  82

Query  523   SFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIP  702
             +FFS+ +EN+EN +W+AI Y     D+ +K        + RE+                 
Sbjct  83    TFFSRTDENSENPAWEAIGY---HKDNREK--------LRREER----------------  115

Query  703   MNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvg  882
                     PL KG++ L  E    +   L + G  V+     + S +    I+CD V+VG
Sbjct  116   --------PLQKGIVELANEDDSTILQSLIEKGLEVT-----EDSEHKICKIKCDVVIVG  162

Query  883   sgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILL  1062
             SG GGGV A VLA++G KVLVLEKG YF     S LEG S+ E+Y  GG++++ +  +++
Sbjct  163   SGCGGGVAAAVLASSGLKVLVLEKGNYFVAEDYSSLEGPSMAELYESGGILSTLNGKVMI  222

Query  1063  LAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVE  1242
             LAGS VGGGS INWSA I+TP +VL+EW   HK+  +GS +Y++AM+ V  R+GV     
Sbjct  223   LAGSTVGGGSAINWSACIRTPDYVLREWSLDHKIRFYGSSDYQYAMDAVSKRIGVTDNCL  282

Query  1243  DEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSG  1422
             +E FQN VLRKGC  LG  VE++ RN+S DHYCG C+FGC+ G KKGT  TWL D V S 
Sbjct  283   NESFQNQVLRKGCENLGLKVESVARNSSADHYCGSCNFGCRTGDKKGTDSTWLVDAV-SC  341

Query  1423  NGVIFPECEAVK-VVHNKKTG--REQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTP  1593
             N  I   C+A K ++ +  TG  +++  GV+    N    +   +++R TV ACG+L TP
Sbjct  342   NATIITGCKAEKLILEDDTTGNRKKKCLGVIARAANTNITKKLQIEARATVSACGSLLTP  401

Query  1594  SLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVAN  1773
              L+ +SGL NPNIG NLHLHPVV AWGYFP+        + + KSY+GGI+T+M +V++ 
Sbjct  402   PLMISSGLLNPNIGSNLHLHPVVVAWGYFPEHE-----SDFKGKSYEGGIITSMHRVIS-  455

Query  1774  FEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSP  1953
              EES   A+IQTP+L P  ++A+ PW+SG D K +M ++ RTA LFAL RD+ SGE  + 
Sbjct  456   -EESKVRAIIQTPALGPSSYAALSPWVSGQDFKDKMVKYPRTAGLFALIRDQGSGEVKAE  514

Query  1954  FSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK  2133
               I +   + DK +LK GL + LRIL  AGA E+GT    G+ +  KG    ++++F++ 
Sbjct  515   GRIKHWQNQFDKENLKIGLRQALRILVGAGAVEVGTYRSDGQKIACKGIQDKDLEDFLDT  574

Query  2134  ESSRDLGNLS---TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTAL  2304
              +   L +     TL+ SAHQMGSCRMG   +   V+  GE+WE + LF+ D SV PTA+
Sbjct  575   VTVSGLTSKEEHWTLLFSAHQMGSCRMGATEKEGAVDENGESWEAKDLFVCDGSVLPTAI  634

Query  2305  GVNPMVTVQAIAYCTAQSVLKFLK  2376
             GVNPM+T+Q+ AYC ++ +++ LK
Sbjct  635   GVNPMITIQSTAYCISRKIVESLK  658



>ref|XP_011091281.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Sesamum indicum]
Length=748

 Score =   502 bits (1292),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 312/772 (40%), Positives = 446/772 (58%), Gaps = 62/772 (8%)
 Frame = +1

Query  103   YSGGCPLSPAVMATVTSISDTFLPAVDV--PQHAAVD---DDSVKLFFQTSASIAGTPQR  267
             YS G   S + +  +TSI +  LP + +   Q  +     D S + F   S S    P  
Sbjct  18    YSHG--FSTSELEILTSICEVLLPPIPLMNSQENSTKNEVDQSYEAFCNASGSQYPVPDE  75

Query  268   VAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEI  447
             VA +I +R      IL+R  L +LSTR+GTL++CG  S   ++PYL+ F EIS  KR ++
Sbjct  76    VAELIKKRGSWEAKILVRATLRILSTRLGTLLICGSHSFDKKWPYLKKFSEISLEKREKV  135

Query  448   VRSW-SCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGK  624
             V+ W     +  ++  ++ +K +VL  FF+QV E+ +N +WKA+DY   D D   + A K
Sbjct  136   VQKWFRNRLLTPVRLAFVFIKFLVLYVFFTQVGEDAKNPAWKAMDY-RVDVDEKLRDAPK  194

Query  625   SKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGF  804
              +                                PL +G++    E      + L   G 
Sbjct  195   ER--------------------------------PLEQGMVETRHETDLTFANSLAAKGL  222

Query  805   PVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARssls  984
              V+   Q+       + ++CD V+VGSG GGGV A VL+ AG KV+VLEKG Y+     S
Sbjct  223   KVTQNAQR-----SMYKVKCDVVIVGSGCGGGVAAAVLSRAGLKVVVLEKGNYYTSKDYS  277

Query  985   llegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKL  1164
              LEG S+ E+Y  GGL+++ D   ++LAGS VGGGS +NWSA I+TP  VL EW    KL
Sbjct  278   ALEGPSMSELYESGGLLSTLDGKTMILAGSTVGGGSAVNWSACIKTPDFVLDEWGNGQKL  337

Query  1165  ELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCG  1344
              LF S EY  AME VC R+GV  + + EGFQN +LRKGC +LG   + + RN+S  H+CG
Sbjct  338   PLFSSSEYIAAMEKVCGRIGVTEKCDKEGFQNQILRKGCEKLGLKADPVARNSSEGHFCG  397

Query  1345  WCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVK-VVHNKKTG---REQAAGVMFV  1512
              C +GC  G KKGT  TWL D V+ G  VI   C+A + V+ +KK G   +++  GV+  
Sbjct  398   SCCYGCIRGDKKGTDTTWLVDAVNCG-AVIISGCKAERFVIEDKKYGSARKKRCLGVIAK  456

Query  1513  YQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAP  1692
              +    ++   +++RVT+ ACG+L TP LL  SGL+N NIGRNLHLHPV+ AWGYFP+  
Sbjct  457   SKIADTEQMIHIEARVTISACGSLLTPPLLIKSGLKNRNIGRNLHLHPVLMAWGYFPETS  516

Query  1693  GSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIK  1872
                   + E K Y+GGI+T++ KV    +     A+I++P L PG F+A+ PW SG +IK
Sbjct  517   -----SDIEGKIYEGGIITSVHKV--GQDAKNLRAIIESPILGPGQFAALCPWESGVEIK  569

Query  1873  TRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEE  2052
              R+ +++RTA LF++ RD+ SGE      I+Y + K DK ++K GL + LRIL AAGA E
Sbjct  570   NRILKYARTAHLFSMIRDRGSGEVMLEGRINYKLDKYDKENMKVGLRRALRILIAAGAVE  629

Query  2053  IGTCHRAGKILKPKGASRDEIDEFVEKESSRD----LGNLSTLIGSAHQMGSCRMGVDPR  2220
             +GT    G+ LK KG +  E+++F++   + D    +    T   SAHQMGSCRM    +
Sbjct  630   VGTHQSDGQKLKCKGITEKEVEKFLDNVIAEDGPKSMVEKWTTYSSAHQMGSCRMAKSEK  689

Query  2221  SSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
                V+  GE+WE EGLF+ D+SV P A+GVNPM+T+Q  +YC ++ + + LK
Sbjct  690   DGAVDENGESWEAEGLFVCDASVLPGAVGVNPMITIQTTSYCLSKKIAEKLK  741



>ref|XP_002966834.1| hypothetical protein SELMODRAFT_87621 [Selaginella moellendorffii]
 gb|EFJ31433.1| hypothetical protein SELMODRAFT_87621 [Selaginella moellendorffii]
Length=747

 Score =   501 bits (1291),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 318/770 (41%), Positives = 439/770 (57%), Gaps = 60/770 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
             L P  +  V +I DTFLPA+ + +    ++++ + FF TSAS AG P +VA  I E L  
Sbjct  16    LDPPQLEAVAAICDTFLPALPL-RALECEEEAQRAFFATSASDAGIPAQVAGWIFECLDS  74

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  480
              +   +   L LLS+RIGTL+LCG+ + S++FP+L  F  +    R   +RSWS   I  
Sbjct  75    AQQAGVLRVLSLLSSRIGTLILCGRHAFSAEFPFLHRFARLPASNRERTLRSWSGGSIAQ  134

Query  481   LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMT  660
               + Y   K   + +FF++ +    N SWKAI Y  PDP  N        K     +   
Sbjct  135   FHSLYKLFKCFAMFAFFTKADARGRNDSWKAIGYPVPDPLWN------GLKDDDDAKVTD  188

Query  661   LSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKG--  834
              +EE +                PL   V +++Q    ++ D L    F VS  ++  G  
Sbjct  189   DNEEPRP---------------PLR--VFDVHQNSAAELVDYLSSSKFRVSEEVRDGGDG  231

Query  835   -SGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDE  1011
              SG     I+CD VV+GSG GGGV AGVL+  G+KV+V+EKGKY+    LSLLEG S+  
Sbjct  232   GSGQAMLAIDCDVVVIGSGCGGGVCAGVLSQKGYKVVVIEKGKYYVGDQLSLLEGPSMRA  291

Query  1012  MYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYR  1191
             MY GGGL+ + D  I L+AGS VGGG+ +NW+AS++TP  V +EW   H L+LF S+EY 
Sbjct  292   MYEGGGLLTTADGGINLMAGSTVGGGTVMNWAASLRTPQAVREEWSSVHGLKLFTSEEYE  351

Query  1192  HAMETVCSRMGVQS---EVEDEGFQNMVLRKGCLELGYPVETIPRNA-SRDHYCGWCSFG  1359
              AM+ VC R+GV++   E E E FQN VLR GC ++G  VETIP N   R H CG C FG
Sbjct  352   AAMDKVCERLGVETLGNEEEHESFQNKVLRSGCKKIGLDVETIPTNCRGRRHKCGLCGFG  411

Query  1360  CKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHN----KKTGREQAAGVMFVYQNNG  1527
             CK   K+GT ETWL D VD+G  VI   C A +++      +   + +A GV+      G
Sbjct  412   CKSRTKQGTHETWLMDAVDAG-AVILCGCNAERILLEPGELRSAKQWKAGGVI----ATG  466

Query  1528  AKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAW  1707
               +  F++++ TV +CGAL TP LL+ SGL N +IG NLHLHP    WGY P   G    
Sbjct  467   GGKSLFIRAKATVTSCGALNTPVLLQKSGLVNRHIGSNLHLHPSQLLWGYVPSGEGL---  523

Query  1708  PEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQR  1887
               P  +   G IM+A+S++          A+++ P+ +PG    + PW SG   K +M R
Sbjct  524   --PAGRISDGPIMSAVSRIA--------DAVLEVPAFYPGGLGVMFPWRSGLSFKEQMLR  573

Query  1888  FSRTAILFALARDKTSGEAPSPFS-------ISYNMQKTDKVSLKNGLEKVLRILAAAGA  2046
             +SR A +  + RD+ SG      S       ++Y +   D+ +LK G EK +R+L AAGA
Sbjct  574   YSRLAHVVVITRDRGSGTVRPSSSSSSQLPKVTYTISAEDEKTLKAGAEKAIRVLIAAGA  633

Query  2047  EEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSS  2226
              E+GT H  G  L  +G+    +++F+    S+ L + +    SAHQMGSCRMG DP SS
Sbjct  634   VEVGTQHPDGDSLVVEGSDEKALEKFLRVIGSKQLTHAAMATASAHQMGSCRMGNDPASS  693

Query  2227  VVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
              V+P GE WE  GLF+AD+SVFPTALGVNPMVT Q++A C A+SV +FL+
Sbjct  694   AVDPRGEAWESTGLFVADTSVFPTALGVNPMVTAQSVALCIAKSVHRFLE  743



>ref|XP_002961172.1| hypothetical protein SELMODRAFT_73531 [Selaginella moellendorffii]
 gb|EFJ38711.1| hypothetical protein SELMODRAFT_73531 [Selaginella moellendorffii]
Length=747

 Score =   501 bits (1290),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 318/770 (41%), Positives = 439/770 (57%), Gaps = 60/770 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
             L P  +  V +I DTFLPA+ + +    ++++ + FF TSAS AG P +VA  I E L  
Sbjct  16    LDPPQLEAVAAICDTFLPALPL-RALECEEEAQRAFFATSASDAGIPAQVAGWIFECLDS  74

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  480
              +   +   L LLS+RIGTL+LCG+ + S++FP+L  F  +    R   +RSWS   I  
Sbjct  75    AQQAGVLRVLSLLSSRIGTLILCGRHAFSAEFPFLHRFARLPASNRERTLRSWSGGSIAQ  134

Query  481   LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMT  660
               + Y   K   + +FF++ +    N SWKAI Y  PDP  N        K     +   
Sbjct  135   FHSLYKLFKCFAMFAFFTKADARGRNDSWKAIGYPVPDPLWN------GLKDDDDAKVTD  188

Query  661   LSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKG--  834
              +EE +                PL   V +++Q    ++ D L    F VS  ++  G  
Sbjct  189   DNEEPRP---------------PLR--VFDVHQNSAAELVDYLSSSKFRVSEEVRDGGDG  231

Query  835   -SGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDE  1011
              SG     I+CD VV+GSG GGGV AGVL+  G+KV+V+EKGKY+    LSLLEG S+  
Sbjct  232   GSGQAMLAIDCDVVVIGSGCGGGVCAGVLSQKGYKVVVIEKGKYYVGDQLSLLEGPSMRA  291

Query  1012  MYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYR  1191
             MY GGGL+ + D  I L+AGS VGGG+ +NW+AS++TP  V +EW   H L+LF S+EY 
Sbjct  292   MYEGGGLLTTADGGINLMAGSTVGGGTVMNWAASLRTPQAVREEWSSVHGLKLFTSEEYE  351

Query  1192  HAMETVCSRMGVQS---EVEDEGFQNMVLRKGCLELGYPVETIPRNA-SRDHYCGWCSFG  1359
              AM+ VC R+GV++   E E E FQN VLR GC ++G  VETIP N   R H CG C FG
Sbjct  352   AAMDKVCERLGVETLGNEEEHESFQNKVLRSGCKKIGLDVETIPTNCRGRRHKCGLCGFG  411

Query  1360  CKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHN----KKTGREQAAGVMFVYQNNG  1527
             CK   K+GT ETWL D VD+G  VI   C A +++      +   + +A GV+      G
Sbjct  412   CKSRTKQGTHETWLMDAVDAG-AVILCGCNAERILLEPGELRSAKQWKAGGVI----ATG  466

Query  1528  AKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAW  1707
               +  F++++ TV +CGAL TP LL+ SGL N +IG NLHLHP    WGY P   G    
Sbjct  467   GGKSLFIRAKATVTSCGALNTPVLLQKSGLVNRHIGSNLHLHPSQLLWGYVPSGEGL---  523

Query  1708  PEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQR  1887
               P  +   G IM+A+S++          A+++ P+ +PG    + PW SG   K +M R
Sbjct  524   --PAGRISDGPIMSAVSRIA--------DAVLEVPAFYPGGLGVMFPWRSGLSFKEQMLR  573

Query  1888  FSRTAILFALARDKTSGEAPSPFS-------ISYNMQKTDKVSLKNGLEKVLRILAAAGA  2046
             +SR A +  + RD+ SG      S       ++Y +   D+ +LK G EK +R+L AAGA
Sbjct  574   YSRLAHVVVITRDQGSGTVRPSSSSSSQLPKVTYTISAEDEKTLKAGAEKAIRVLIAAGA  633

Query  2047  EEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSS  2226
              E+GT H  G  L  +G+    +++F+    S+ L + +    SAHQMGSCRMG DP SS
Sbjct  634   VEVGTQHPDGDSLVVEGSDEKALEKFLRVIDSKQLTHAAMATASAHQMGSCRMGNDPASS  693

Query  2227  VVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
              V+P GE WE  GLF+AD+SVFPTALGVNPMVT Q++A C A+SV +FL+
Sbjct  694   AVDPRGEAWESTGLFVADTSVFPTALGVNPMVTAQSVALCIAKSVHRFLE  743



>ref|XP_009336115.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Pyrus x bretschneideri]
Length=750

 Score =   501 bits (1290),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 310/772 (40%), Positives = 450/772 (58%), Gaps = 63/772 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAV---DVPQ-HAAVDDDSVKLFFQT-SASIAGTPQRVAWMIS  285
              S A M ++ +I ++ +P +   ++P  H A+   S    + T S S    P  VA MI 
Sbjct  25    FSSAQMQSLAAICESLIPPLPLEEIPDDHQALHSSSSSSSYHTASGSQPPIPDEVAEMIV  84

Query  286   ERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSC  465
             +R     V  +RL L +LS R+GT +LCGK     ++P++  F E+S  KR +++  WS 
Sbjct  85    KRALPEGVDAMRLFLKMLSLRLGTFLLCGKICFDWKWPFIHKFSEMSLDKREQVLNKWSR  144

Query  466   CYIKI-LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWIT  642
               + I ++  ++ +K+    +FFS+++EN+ N +WKAI +                    
Sbjct  145   GKLVITIRLMFMVVKMCCFYTFFSRIDENSRNPAWKAIGF--------------------  184

Query  643   REQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCI  822
                     E  KK  E +I    E    PL KG+I    E    +   L K G  V+   
Sbjct  185   --------ELDKK--EKLIKTPKER---PLDKGIIETVYESDSTLVQSLTKKGLEVA---  228

Query  823   QQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegss  1002
                 + N    I+CD V+VGSG GGGV A VLA +G KV+VLEKG YF     S LEG S
Sbjct  229   --DDAENNIHRIKCDVVIVGSGCGGGVAAAVLAQSGQKVVVLEKGNYFVPKDYSSLEGPS  286

Query  1003  lDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSK  1182
             + E+Y  GG+++S D  +++LAGS VGGGS +NWSASI+TP +VL+EW   HK+ L+ S+
Sbjct  287   MSELYESGGIMSSVDAMVMILAGSTVGGGSAVNWSASIRTPNNVLREWSVDHKIPLYASE  346

Query  1183  EYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGC  1362
             +Y+ AM+ VC R+GV      E FQN +LRKGC  LG  VE++PRN+S DHYCG+C++GC
Sbjct  347   DYQSAMDIVCKRIGVTESCTKENFQNQILRKGCENLGLKVESVPRNSSADHYCGFCNYGC  406

Query  1363  KDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTG---REQAAGVMFVYQNNGAK  1533
               G KKGT  TWL D V+ G  VI   C+A K +  K      R++  GV     +   K
Sbjct  407   PTGDKKGTDSTWLVDAVECG-AVILTGCKAEKFILEKDNDGGRRKRCLGVQATSLSKNLK  465

Query  1534  EFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPE  1713
                 ++++V + ACG+L TP L+ +SGL+N NIGRNLHLHPV+ +WGYFP         E
Sbjct  466   RKLEIEAKVIISACGSLLTPPLMVSSGLKNRNIGRNLHLHPVLLSWGYFPQHES-----E  520

Query  1714  PEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFS  1893
              + K Y+GGI+T++ KVV+  E +   A+I+T  L P  F+ + PW+S  D+K +M++++
Sbjct  521   FKGKKYEGGIITSIHKVVS--ETANARAIIETAVLGPASFATLSPWISRLDMKDKMEKYA  578

Query  1894  RTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRA  2073
             RTA LFAL RD +SG       I Y + + DK ++  GL + LRIL AAGA E+GT    
Sbjct  579   RTANLFALVRDHSSGVVKREGRIHYTLDQLDKENILAGLRQALRILIAAGAVEVGTYRND  638

Query  2074  GKILKPKGASRDEIDEFVEK------ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVN  2235
             G+ LK KG   ++++EF++        S+R+   L T+  SAHQMGSCRMG       V+
Sbjct  639   GQRLKCKGVKEEDLEEFLDTVVTSAGPSARE--ELWTIYSSAHQMGSCRMGATEEEGGVD  696

Query  2236  PMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHNHM  2391
               GE+WE +GLF+ D+S+ PTA+GVNPM+TV++ AYC A+ + + L    ++
Sbjct  697   ENGESWEAKGLFVCDASLLPTAVGVNPMITVESTAYCIAKKIAQSLDKQKYI  748



>ref|XP_007050220.1| Alcohol oxidase [Theobroma cacao]
 gb|EOX94377.1| Alcohol oxidase [Theobroma cacao]
Length=740

 Score =   498 bits (1283),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 309/766 (40%), Positives = 435/766 (57%), Gaps = 67/766 (9%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDD----SVKLFFQTSASIAGTPQRVAWMISE  288
              S A + ++ +I +TF+P +  P  A  DD     ++  F + S +    P  VA  + +
Sbjct  24    FSSAQIQSLAAICETFVPPL--PLDAKFDDKQNSAALDAFHKASGAEPPFPDEVADFLMK  81

Query  289   RLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCC  468
             R Q   V   +L L L+S R+GTL+LCG      ++P++  F EI   +R +I+  WS  
Sbjct  82    RGQPKAVSFAKLVLTLVSFRLGTLLLCGWDCCDWKWPFIHKFSEIPVERREKILIKWSWK  141

Query  469   YIKI-LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITR  645
                + L+  +  +K   L  FFS  +EN+ N +WKAI Y   +      P G+       
Sbjct  142   VHPLPLRAVFALIKTYCLFIFFSMTDENSGNPAWKAIGYQVDNRQKKAYPQGR-------  194

Query  646   EQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQ  825
                                        PL KG+I    E        L + G  V     
Sbjct  195   ---------------------------PLQKGIIETMHEDDSTFVQSLTEKGLQV-----  222

Query  826   QKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegssl  1005
              +   +  + I+CD V+VGSG GGGV A VLA++G KV+V+EKG YFA    + LEG S+
Sbjct  223   MEDPEHNVYKIKCDVVIVGSGCGGGVAAAVLASSGQKVVVIEKGNYFAPQDYTSLEGPSM  282

Query  1006  DEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKE  1185
              E+Y  GG + + +  I+++AGS VGGGS INWSASI+TP +VL+EW   HK+  FGS E
Sbjct  283   SELYESGGFLTTTNGKIMIMAGSTVGGGSAINWSASIKTPKNVLREWCVDHKIPFFGSSE  342

Query  1186  YRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCK  1365
             Y  AM+ V  R+GV     +EGFQN VLRKGC +LG  VE +PRN + +HYCG C+ GC+
Sbjct  343   YEIAMDAVRKRIGVTENCTEEGFQNQVLRKGCEKLGLKVEAVPRNTADNHYCGSCNLGCR  402

Query  1366  DGKKKGTSETWLADLVDSGNGVIFPECEAVKVV---HNKKTGREQAAGVMFVYQNNGAKE  1536
              G KKGT  TWL D V  G  VI   C+A K +   +N    R++  GV+    N    +
Sbjct  403   TGDKKGTDSTWLVDAVGCG-AVILTACKADKFILVNNNDARRRKKCLGVIATSWNKKLTK  461

Query  1537  FCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFP-DAPGSKAWPE  1713
                ++++ TV ACG+L TP L+ +SGL+NPNIGRNLHLHPV+  WGYFP DA G K    
Sbjct  462   KLHIEAKATVSACGSLLTPPLMISSGLKNPNIGRNLHLHPVLVGWGYFPEDASGLKG---  518

Query  1714  PEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFS  1893
                K+Y+GGI+T+  KVV+  EE+   A+IQTP+L P   +A+ PW+SG++ K RM R+ 
Sbjct  519   ---KTYEGGIITSFHKVVS--EETNVHAIIQTPALGPASVAALSPWVSGSEFKERMVRYP  573

Query  1894  RTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRA  2073
             R A LF L RD+ SGE      I Y   + DK +LK GL +VLRI+ AAGA E+GT    
Sbjct  574   RLAHLFTLIRDQGSGEVMEEGKIRYRFSEMDKENLKIGLRQVLRIIIAAGAVEVGTHRSD  633

Query  2074  GKILKPKGASRDEIDEFVEK------ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVN  2235
             G+ +K KG + + + EF++        SS++     T+  SAHQMGSCR+G       V+
Sbjct  634   GQRIKCKGLTEESLQEFLDDVPVVGGASSKE--EYWTMYVSAHQMGSCRIGATQEEGAVD  691

Query  2236  PMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
               G++WE EGLF+ D+SV PTA+G+NPM+T+Q+ +YC +  +   L
Sbjct  692   ENGQSWEAEGLFVCDASVLPTAIGINPMLTIQSTSYCISNKIADLL  737



>ref|XP_006857358.1| hypothetical protein AMTR_s00067p00112750 [Amborella trichopoda]
 gb|ERN18825.1| hypothetical protein AMTR_s00067p00112750 [Amborella trichopoda]
Length=798

 Score =   500 bits (1287),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 326/831 (39%), Positives = 459/831 (55%), Gaps = 107/831 (13%)
 Frame = +1

Query  40    ISDDGDS---LFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQ-HAAVD  207
             + DD ++   L   G+ E+     +S G   + A + ++T+I +  +P++ +   H +  
Sbjct  1     MEDDQNTAHPLLRGGRKEKS----FSHG--FTKAQIQSLTAICEALIPSMPITALHVSSQ  54

Query  208   DD-----SVKLFFQTSASIAGTPQR-----------VAWMISERLQHPKVIllrlalwll  339
              D     S+  F++ S S    P +           VA ++ +R     V L+   LW L
Sbjct  55    RDPPPSPSLVSFYKASGSDYQVPDQALFRSRNSETFVAELMVKRGLPDAVTLVSWVLWAL  114

Query  340   STRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSC--CYIKILKTFYLGMKVM  513
             STR+GTL+LCG   LS  FP+++SF E+   KR +++ +WS    +   L+  +   K+ 
Sbjct  115   STRLGTLLLCGSTCLSLNFPFIRSFSEMPVEKREKVLMAWSRERSFFSALRLSFALFKIF  174

Query  514   VLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEED  693
              +  F+S  + N++N SW+AIDY        K P  KS K                  + 
Sbjct  175   CVYVFYSWTDVNSKNPSWEAIDYSPGPLKPPKNPPPKSFK------------------DS  216

Query  694   VIP---MNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIEC  864
             +I    +  E L+  +    I + ++P   +                          +EC
Sbjct  217   IISTTTLTKESLVSTIKTKGITVTEDPSADLL------------------------TLEC  252

Query  865   DavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASK  1044
             DAVVVGSG GG V A  LA +G++VLVLEKG YF     SLLEG S+D+MY  GG++++ 
Sbjct  253   DAVVVGSGPGGSVAAAKLAKSGYQVLVLEKGLYFTPQDYSLLEGPSMDQMYESGGILSTT  312

Query  1045  DMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMG  1224
             D  +L+ AGS VGGGS INWSA I+TP  VLK+W E   L LFGS  YR AME VC R+G
Sbjct  313   DAKVLITAGSTVGGGSAINWSACIKTPDKVLKQWSEDFSLSLFGSHNYRAAMEAVCKRLG  372

Query  1225  VQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLA  1404
             V  + E E FQN V R GC  LG  VE +PRN+   HYCG C +GC+ G+K+GT  TWL 
Sbjct  373   VTEKCEKENFQNEVFRSGCERLGLKVEFVPRNSPEGHYCGQCGYGCRTGEKQGTQCTWLV  432

Query  1405  DLVDSGNGVIFPECEAVKVVHNKKTGRE--------------QAAGVMFV----YQNNGA  1530
             D  ++G  +IF   +A K V  +  G E              +  GVM V        G 
Sbjct  433   DAAEAG-ALIFTGVKAKKFVMRENDGLERKESGKPWSRERDQRCVGVMAVTGCKVNQKGK  491

Query  1531  KEF--CFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKA  1704
             K      +K++++V ACG+L TP LL +SGLRNPNIGRNL LHPV  AWGYFP+    ++
Sbjct  492   KSSLRLMIKAKLSVSACGSLLTPPLLISSGLRNPNIGRNLRLHPVSMAWGYFPEQDCGES  551

Query  1705  WPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQ  1884
                   K YQGGI+T++ K+V   ++   G +I+TP L P  FSAI PWLSG+++K  M+
Sbjct  552   L---RGKCYQGGIITSIHKLVLENQDHDSGVIIETPFLGPASFSAIFPWLSGSEMKEAMR  608

Query  1885  RFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTC  2064
             R++RT  +F L RD  SGE      I+YN+ +TD+   K GL   LRIL AAGA E+GT 
Sbjct  609   RYARTVHIFVLVRDTGSGEVMKERKITYNLHRTDREKFKKGLRTALRILVAAGAVEVGTH  668

Query  2065  HRAGKILKPKGASRDEIDEFVE-------KESSRDLGNLSTLIGSAHQMGSCRMGVDPRS  2223
                G+ +K KG   ++ +EF++         S  +  NL T   SAHQMGSCRMG D   
Sbjct  669   RSDGQRIKTKGMRDEDFEEFLDGIEVFGGAYSGEEKWNLYT---SAHQMGSCRMGADEEK  725

Query  2224  SVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             S V+  GE+WE EGLF+ D S+ PTALGVNPM+TVQ+IA+C + ++++FL+
Sbjct  726   SAVDERGESWEAEGLFVCDGSLMPTALGVNPMITVQSIAHCISDNMVEFLR  776



>ref|XP_004247518.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Solanum lycopersicum]
Length=731

 Score =   497 bits (1279),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 295/762 (39%), Positives = 451/762 (59%), Gaps = 63/762 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
              S + + T+++  +T +P  +       +D+S   FF +S +   +   VA ++ +R + 
Sbjct  24    FSSSQIQTISAFCETLVPPCNN------NDNS---FFASSGAHPPSTNEVAELLVKRSKP  74

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSC-CYIK  477
               ++++R+ ++LL+TR+G+L+LCG+  L  ++P++ +F E+    R  +++ WS   ++ 
Sbjct  75    EALLIIRIVVFLLTTRLGSLLLCGRVCLDKRWPFVHNFTELDLKDREALLQRWSRETFLI  134

Query  478   ILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHM  657
              L+  +L +K++ L  FFS  +EN +N +W+AI Y  P                  E   
Sbjct  135   PLRITFLMIKIIYLFIFFSWTDENCKNPTWEAIGYHLP------------------ETTE  176

Query  658   TLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGS  837
              L E +K+               PL +G++    E    + + L K    ++     + +
Sbjct  177   ALYENKKER--------------PLERGIVETINESDETLKESLSKKDVVIT-----EDA  217

Query  838   GNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMY  1017
              +  F IECD ++VGSG GGGV AG+LA +G+KV+VLEKG YF     S LEG SL E+Y
Sbjct  218   KDNIFKIECDVLIVGSGCGGGVAAGILAKSGYKVVVLEKGHYFVPEDYSGLEGPSLSELY  277

Query  1018  LGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHA  1197
               G +++S D  ++++AG+ VGGGS +NWSASI+TP  VLK+W   HK+  FG+ EY+ A
Sbjct  278   ETGAMLSSLDGKVMIMAGTTVGGGSAVNWSASIKTPNDVLKDWSVNHKISWFGTSEYQSA  337

Query  1198  METVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKK  1377
             M+ VC R+GV     +EG QN V+RKGC  LG  VE IPRN+S +HYCG C +GCK G K
Sbjct  338   MDAVCKRIGVTENCSEEGLQNQVIRKGCENLGLKVEKIPRNSSENHYCGSCGYGCKTGDK  397

Query  1378  KGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQAAGVMFVYQNNGAKEFCFVKSR  1557
             KGT  TWL D V++G  VI   C A + +      R+   GV+   ++        +K+R
Sbjct  398   KGTDSTWLVDAVNAG-AVILTGCTAERFILEDGKMRKTCLGVIATTESKKITRKLHIKAR  456

Query  1558  VTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQG  1737
              T+ +CGAL TP LL +SGL+N NIG NL+LHPV+ AWGYFP+     +  E + K+Y+G
Sbjct  457   ATISSCGALFTPPLLLSSGLQNKNIGTNLYLHPVLLAWGYFPE-----SMSEIKGKNYEG  511

Query  1738  GIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFAL  1917
             GIMT++ ++V   EE+   A+I+  ++ P  F+++ PW SG D+K +M ++SRT  L AL
Sbjct  512   GIMTSLHEMVP--EETNAQAIIEATAVGPASFASLFPWTSGQDMKEQMTKYSRTVTLLAL  569

Query  1918  ARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKG  2097
              +D+  GE      I Y++ + DK ++K GL + LRIL AAGA E+GT    G+ +K K 
Sbjct  570   VKDQGRGEVKKAGRIKYSLDRIDKENIKAGLRRALRILIAAGAVEVGTYRSDGQKIKCKD  629

Query  2098  ASRDEIDEFVEKESSRDLGNLS-----TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVE  2262
                +E++EFV+   + + G +S     T+  SAHQMGSCRMG       V+  GE WE +
Sbjct  630   IKNEELEEFVDTVEAPE-GPMSKEENWTVYASAHQMGSCRMGSSKEDGAVDENGECWEAK  688

Query  2263  GLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHNH  2388
             GL++ D SV PTA+GVNPM+T+Q+ AYC A+ + + L  HN 
Sbjct  689   GLYVCDGSVLPTAVGVNPMITIQSTAYCIAKRIAESL--HNE  728



>ref|XP_006354464.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X2 [Solanum 
tuberosum]
Length=667

 Score =   494 bits (1273),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 282/688 (41%), Positives = 418/688 (61%), Gaps = 55/688 (8%)
 Frame = +1

Query  340   STRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW-SCCYIKILKTFYLGMKVMV  516
             STRIG+L+LCG       +PY+  F +IS  KR  +++ W +  +   ++  ++ +K + 
Sbjct  20    STRIGSLLLCGLFCFGKSWPYINKFSDISLDKREIVMQKWFNNRFFTPVRLAFVFVKFLC  79

Query  517   LLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDV  696
             L  FF+QV E+++N +W  I Y                  +  E++ + + +++      
Sbjct  80    LYIFFTQVGEDSKNPAWDDIGY-----------------QVDNEENSSETPDER------  116

Query  697   IPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavv  876
                       PL KG+I    E    +   L + G  V+     + + N  + ++CD V+
Sbjct  117   ----------PLQKGIIETIYETESTIVKSLVEKGLKVT-----EDTKNNMYKVQCDVVI  161

Query  877   vgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDI  1056
             VGSG GGGV A VLA++G KV+VLEKG YFA+S  S LEG S  +MY  GG+ ++ D  +
Sbjct  162   VGSGCGGGVAASVLASSGQKVVVLEKGNYFAKSDYSSLEGPSQSQMYESGGIFSTLDGKV  221

Query  1057  LLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSE  1236
             ++LAGS VGGGS +NWSA I+TP  +++EW +  ++ +F + EY  AM+ VC R+ V  +
Sbjct  222   MILAGSTVGGGSAVNWSACIKTPDSIIQEWGDDKRISMFKTPEYVSAMDKVCERINVTEK  281

Query  1237  VEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVD  1416
                EG QN +L+KGC  LG  VE + RN+S DHYCG C +GC+ G+KKGT  TWL D VD
Sbjct  282   CTQEGLQNQILQKGCERLGLEVEGVARNSSEDHYCGSCCYGCRRGEKKGTDTTWLVDAVD  341

Query  1417  SGNGVIFPECEAVK-VVHNKKTGR---EQAAGVMFVYQNNGAKEFCFVKSRVTVIACGAL  1584
              G  VI   C+A + ++ NKK G+   ++  GV+    N    +   ++++VT+ ACG+L
Sbjct  342   CG-AVIITGCKAERFILENKKYGKTRSKKCLGVISTSMNKDITKSICIEAKVTISACGSL  400

Query  1585  CTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKV  1764
              TP L+ +SGL+N NIGRNLHLHPV+ AWGYFP++       + + K Y+GGI+T++ KV
Sbjct  401   LTPPLMISSGLKNRNIGRNLHLHPVIMAWGYFPESN-----SDLKGKIYEGGIITSVHKV  455

Query  1765  VANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEA  1944
              ++  +S   A+I+ P+L PG F+A+ PW SG DIK R+ ++ RTA LFA+ +D  SGE 
Sbjct  456   GSH--DSNVRAIIEAPALGPGSFAALCPWTSGEDIKNRLLKYDRTAHLFAMVKDVGSGEV  513

Query  1945  PSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEF  2124
              S   I+Y    TDK SLK GL + LRIL AAGA E+GT    G+ +K KG S   ++ F
Sbjct  514   RSEGRINYTFNGTDKESLKLGLRQALRILIAAGAAEVGTQRSDGQRIKCKGQSEKALESF  573

Query  2125  VEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVF  2292
             ++     E  + L    T   SAHQMGSCRMG++ + S V+  GE+WE EGLF+ D+SV 
Sbjct  574   LDTVTAAEGPKSLVKDFTTYCSAHQMGSCRMGMNEKDSAVDENGESWEAEGLFVCDASVL  633

Query  2293  PTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             P A+GVNPM+T+Q+ AYC ++ + + +K
Sbjct  634   PGAVGVNPMITIQSTAYCLSKKIAEMIK  661



>ref|XP_002529832.1| electron carrier, putative [Ricinus communis]
 gb|EEF32533.1| electron carrier, putative [Ricinus communis]
Length=745

 Score =   496 bits (1278),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 299/769 (39%), Positives = 452/769 (59%), Gaps = 64/769 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHA---AVDDDSVKL-FFQTSASIAGTPQRVAWMISE  288
              S A + T+++  +T +P + V   +     D     L F++ S S    P  VA ++  
Sbjct  25    FSSAQIQTLSAFCETLIPPLPVNNFSNELPFDKQKALLSFYKASGSEQPIPDEVAELMVN  84

Query  289   RLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCC  468
             R     V+++   L +LS R+GTL+LCG   L   +P++  F EIS  KR +IV+ W+  
Sbjct  85    RGLKEVVLVVDFLLKVLSFRLGTLLLCGFICLEWNWPFIHKFSEISLSKREDIVKRWAKQ  144

Query  469   -YIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITR  645
              Y   L+  ++ +K+    +FFS+ ++N+EN +W+AI Y                   TR
Sbjct  145   KYFFPLRVLFMAVKIFCSYTFFSRTDDNSENPAWEAIGYHKD----------------TR  188

Query  646   EQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQ  825
             E+ +T S +++                PL KG++ L  E    +   L + G  V+    
Sbjct  189   EK-LTKSRKER----------------PLEKGIVELANEDDLTLVKSLMQKGIQVT----  227

Query  826   QKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegssl  1005
              +   + ++ I+CD V++GSG GGGV A VLA++G KVLVLEKG YF     S +EG S+
Sbjct  228   -EDPDHNTYKIKCDVVIIGSGCGGGVAAAVLASSGQKVLVLEKGNYFVPEDYSSVEGPSM  286

Query  1006  DEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKE  1185
              E+Y  GG + + +  I++LAGS VGGGS INWSA I+TP  VLKEW   +++ LFGS +
Sbjct  287   AELYESGGFLPTLNGKIMILAGSTVGGGSAINWSACIKTPDTVLKEWCVDYRIPLFGSPD  346

Query  1186  YRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCK  1365
             Y +AM+ V  R+GV     +EGFQN VLR+GC  LG  V+++PRN+S DHYCG C +GC+
Sbjct  347   YHYAMDVVQKRIGVTDNCSNEGFQNQVLRRGCENLGLKVDSVPRNSSADHYCGSCCYGCR  406

Query  1366  DGKKKGTSETWLADLVDSGNGVIFPECEAVKVV----HNKKTGREQAAGVMFVYQNNGAK  1533
              G KKGT  TWL D V SG  VI     A K +    H+ ++ R++  GV+    N    
Sbjct  407   TGDKKGTDSTWLVDAVGSG-AVILTGTRAEKFILEEDHSGRS-RKRCIGVIAKTSNTNVT  464

Query  1534  EFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPE  1713
             +   +++R T+ ACG+L TP L+ +SGL NPNIGRNLHLHPV+ AWGYFP+        +
Sbjct  465   KKLQIEARATISACGSLLTPPLMISSGLANPNIGRNLHLHPVIMAWGYFPEHIS-----D  519

Query  1714  PEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFS  1893
                K Y+GGI+T++ KVV+  EES   A+++ P+L P  ++A+ PW+SG D K +M +++
Sbjct  520   LSGKIYEGGIITSVHKVVS--EESKVCAILEAPALGPASYAALSPWVSGQDFKDKMVKYA  577

Query  1894  RTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRA  2073
             RTA LFAL RD+ SGE      I + M ++D  +L+ GL + LRIL  AGA E+GT    
Sbjct  578   RTANLFALIRDQGSGEVKLEKKIKHRMSRSDNENLRIGLRQALRILVGAGAVEVGTYRSD  637

Query  2074  GKILKPKGASRDEIDEFVEKESSRDLGNLST------LIGSAHQMGSCRMGVDPRSSVVN  2235
             G+ ++ KG    +++EF++  ++   G L++      ++ SAHQM SCRMG       V+
Sbjct  638   GQRIECKGVKETDLEEFLDTVTAS--GGLTSKEEYWNMLFSAHQMSSCRMGATEEEGAVD  695

Query  2236  PMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTH  2382
               GE+WE + LF+ D S+ P+A+G+NPM+T+Q+ AYC ++ + + +K +
Sbjct  696   ENGESWEAKNLFVCDGSILPSAVGINPMITIQSTAYCISKRIAESMKKY  744



>ref|XP_010488398.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Camelina sativa]
Length=750

 Score =   496 bits (1278),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 298/732 (41%), Positives = 435/732 (59%), Gaps = 59/732 (8%)
 Frame = +1

Query  226   FFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYL  405
             F+ TS S     ++   ++++R      ++ RL L+LL+TR+GTL++CG   L +++P++
Sbjct  60    FYSTSGSQTPVLRQSIELLTKRATMEACLVTRLILFLLATRLGTLLICGTECLVTRWPFV  119

Query  406   QSFPEISPHKRAEIV----RSWSCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKA  573
             + F E+S  KR  ++    R+W    +  ++  ++ +KV+ L  FFS+V+   EN +W+A
Sbjct  120   EKFSELSLEKRERVIQKQFRNW---ILTPIRAGFVYIKVIFLFCFFSRVSPKGENPAWEA  176

Query  574   IDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINL  753
             I Y   + D NK  A    +                               PL KG++  
Sbjct  177   IGY-HVNLDENKPSATYKAR-------------------------------PLEKGIVET  204

Query  754   NQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGH  933
               E  + + + L + G      + Q      +  I+CDAVV+GSGSGGGV A VLA +G 
Sbjct  205   MNETEQTLLESLARKGLEADHDMDQD-----TIRIKCDAVVIGSGSGGGVAASVLAKSGL  259

Query  934   KVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSAS  1113
             KV+VLEKG Y+  S     EG  +D++Y  GG++ + D ++++LAG+ VGGGS +NWSA 
Sbjct  260   KVVVLEKGSYYTPSDYRPYEGPGMDKLYENGGILPTVDGNLMVLAGATVGGGSAVNWSAC  319

Query  1114  IQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELG  1293
             I+TP  VL+EW +  K+  +G+KEY  AM+ V  RMGV  + E E FQN +LRKGC  +G
Sbjct  320   IKTPKSVLQEWSDDQKIPFYGTKEYVSAMDVVWKRMGVTEKCEMESFQNQILRKGCENIG  379

Query  1294  YPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNK  1473
               VE + RN+S  HYCG C +GCK G KKG+ +TWL D V  G  V+   C+A + V  K
Sbjct  380   VHVENVARNSSEGHYCGSCGYGCKQGDKKGSDQTWLVDAVSHG-AVVLTGCKAERFVLEK  438

Query  1474  KTG------REQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIG  1635
             K G      + +  GVM    N    +   ++++VTV A G+L TP L+ +SGLRN NIG
Sbjct  439   KGGSNVEGKQMKCLGVMAKSLNGNIAKKLKIEAKVTVSAGGSLLTPPLMISSGLRNRNIG  498

Query  1636  RNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPS  1815
             +NLHLHP + +WGYFP+   S      + KSY+GGI+T++SKV++  E+S   A+I+T S
Sbjct  499   KNLHLHPTLMSWGYFPEKESSSL--SFKGKSYEGGIITSVSKVLS--EDSEVRAIIETAS  554

Query  1816  LHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVS  1995
             L PG FS + PW SG D+KTRM R+SRTA L  + RD+ SGE  +   ISY + KTDK +
Sbjct  555   LGPGSFSVLFPWTSGLDMKTRMARYSRTASLITIVRDRGSGEVKTEGRISYVVDKTDKEN  614

Query  1996  LKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRD----LGNLS  2163
             +K GL + LRIL AAGAEE+GT    G+ILK KG     I+EF++  SS +    +    
Sbjct  615   IKAGLRQSLRILIAAGAEEVGTHRSDGQILKCKGVDEKSIEEFLDSVSSEEGPKGMTEKW  674

Query  2164  TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAY  2343
              +  SAHQMGSCR+G + +   ++  GE+WE E LF+ D+S  P+A+GVNPM+TV + AY
Sbjct  675   NIYCSAHQMGSCRIGENEKEGAIDVNGESWEAEKLFVCDASALPSAVGVNPMITVMSTAY  734

Query  2344  CTAQSVLKFLKT  2379
             C +  + K + T
Sbjct  735   CISTRIAKSMTT  746



>emb|CDX92985.1| BnaA03g37070D [Brassica napus]
Length=721

 Score =   495 bits (1275),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 306/763 (40%), Positives = 447/763 (59%), Gaps = 66/763 (9%)
 Frame = +1

Query  136   MATVTSISDTFLPAVDVPQHAAVDDD------SVKLFFQTSASIAGTPQRVAWMISERLQ  297
             M ++ S  +  LP V  P+     DD      +++ FF TS S     +    +I++R  
Sbjct  1     MESLASFCEAVLPPVSPPEEYCGGDDHYRNKETLRSFFFTSGSRTPVVRESIELITKRGT  60

Query  298   HPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIV----RSWSC  465
                 ++ RL L+LL+TR+GTL++CG   L S++P+++ F E+S  KR  ++    R+W  
Sbjct  61    VETYLVTRLVLFLLATRLGTLLICGTECLVSRWPFVEKFSELSLEKRERVLQKQFRNW--  118

Query  466   CYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITR  645
               +  ++  ++ +KV  L  FFS+V+ N EN +W+AI Y                  IT 
Sbjct  119   -LLTPIRAAFVYIKVAFLFCFFSRVSPNGENPAWEAIGY----------------NVITN  161

Query  646   EQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQ  825
             E   + + +++                PL KG++   QE  + + + L + G        
Sbjct  162   ENKPSETHKER----------------PLQKGMVETMQETDQTLLESLAQKGL-------  198

Query  826   QKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegssl  1005
             +  + + +  I+CDAVVVGSGSGGGV A VLA AG KV+V+EKG Y+  S+    EG  +
Sbjct  199   EAETDHDTIRIKCDAVVVGSGSGGGVAASVLAKAGMKVVVMEKGSYYTPSTYPSTEGPGM  258

Query  1006  DEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKE  1185
             D++Y  GG++ + D ++++LAG+ VGGGS +NWSA I+TP  VL+EW E  K+ L+ +KE
Sbjct  259   DKLYENGGILPTIDGNMMVLAGATVGGGSAVNWSACIKTPKSVLQEWSEDRKIPLYATKE  318

Query  1186  YRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCK  1365
             Y  AME V  R+GV    E EGFQN VLRKGC  LG  VE + RN+S  HYCG C +GC+
Sbjct  319   YVSAMELVWKRIGVTERCELEGFQNQVLRKGCENLGINVENVARNSSERHYCGSCGYGCR  378

Query  1366  DGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNK---KTGR--EQAAGVMFVYQNNGA  1530
              G KKG+  TWL D V  G  VI   C+A + +  K     GR  ++  GVM    N   
Sbjct  379   QGDKKGSDRTWLVDAVSHG-AVILTGCKAERFILEKNGNNVGRKKKKCLGVMAKSLNGNI  437

Query  1531  KEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWP  1710
              +   +++RVTV A G+L TP L+  SGL+N +IG+NLHLHPV+  WGYFPD   S    
Sbjct  438   AKKIKIEARVTVSAAGSLLTPPLMIKSGLKNRHIGKNLHLHPVLMTWGYFPDKESSSF--  495

Query  1711  EPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRF  1890
               + +SY+GGI+T+MSKV++  E+S   A+I+TP+L P  FS + PW SG D+K RM R+
Sbjct  496   NFKGRSYEGGIITSMSKVLS--EDSEVRAIIETPALGPASFSVLCPWTSGLDMKKRMSRY  553

Query  1891  SRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHR  2070
             SRTA L  + RD+ SGE  +   ISY + K D+ ++  GL + LRIL AAGAEE+GT   
Sbjct  554   SRTANLITIVRDRGSGEVRTEGRISYVVDKIDRENITAGLRQSLRILIAAGAEEVGTHRS  613

Query  2071  AGKILKPKGASRDEIDEFVE----KESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNP  2238
              G+ L  KG     I+EF++    +E  + +    ++  SAHQMGSCR+GVD     ++ 
Sbjct  614   DGQKLICKGVDEKSIEEFLDSVSAEEGPKAMTENWSVYSSAHQMGSCRIGVDEDEGAIDL  673

Query  2239  MGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLK  2367
              GE+WE + LF+ D SV P+A+GVNPM+T+ + AYC +  ++K
Sbjct  674   DGESWEADKLFVCDGSVLPSAVGVNPMITIMSTAYCISTRIVK  716



>ref|XP_010512451.1| PREDICTED: long-chain-alcohol oxidase FAO3 [Camelina sativa]
Length=749

 Score =   495 bits (1275),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 299/748 (40%), Positives = 444/748 (59%), Gaps = 60/748 (8%)
 Frame = +1

Query  175   AVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIG  354
             A D  +H   + ++++ F+ TS S     ++   ++++R      ++ RL L+LL+TR+G
Sbjct  45    AGDTNKHR--NTEALRSFYSTSGSQTPVLRQSIELLTKRGTMEAYLVTRLILFLLATRLG  102

Query  355   TLMLCGKASLSSQFPYLQSFPEISPHKRAEIV----RSWSCCYIKILKTFYLGMKVMVLL  522
             TL++CG   L +++P+++ F E+S  KR  ++    R+W    +  ++  ++ +KV+ L 
Sbjct  103   TLLICGTECLVTRWPFVEKFSELSLEKRERVIQKQFRNW---ILTPIRAGFVYIKVVFLF  159

Query  523   SFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIP  702
              FFS+V+   EN +W+AI Y                       H+ L E +         
Sbjct  160   CFFSRVSPKGENPAWEAIGY-----------------------HVNLDENKP--------  188

Query  703   MNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvg  882
              +      PL KG++    E  + + + L + G      + Q      +  I+CDAVV+G
Sbjct  189   -SETYKARPLEKGIVETMNETEQTLLESLARKGLKADHDMDQ-----DTIRIKCDAVVIG  242

Query  883   sgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILL  1062
             SGSGGGV A VLA +G KV+VLEKG Y+  S     EG  +D++Y  GG++ + D ++++
Sbjct  243   SGSGGGVAASVLAKSGLKVVVLEKGSYYTPSDYRPYEGPGMDKLYENGGILPTVDGNLMV  302

Query  1063  LAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVE  1242
             LAG+ VGGGS +NWSA I+TP  VL+EW E  K+  +G+K+Y  AM  V  RMGV  + E
Sbjct  303   LAGATVGGGSAVNWSACIKTPKSVLQEWSEDQKIHFYGTKDYVSAMNVVWKRMGVTEKCE  362

Query  1243  DEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSG  1422
              E FQN +LRKGC  +G  VE + RN+S  HYCG C +GC+ G KKG+ +TWL D V  G
Sbjct  363   MESFQNQILRKGCENIGVHVENVARNSSEGHYCGSCGYGCRQGDKKGSDQTWLVDAVSHG  422

Query  1423  NGVIFPECEAVKVVHNKK---TGREQ--AAGVMFVYQNNGAKEFCFVKSRVTVIACGALC  1587
               V+   C+A +++  KK    G +Q    GVM    N    +   ++++VTV A G+L 
Sbjct  423   -AVVLTGCKAERLILEKKGSNVGGKQMKCLGVMAKSLNGNIAKKLKIEAKVTVSAGGSLL  481

Query  1588  TPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVV  1767
             TP L+ +SGLRN NIG+NLHLHP + +WGYFP+   S      + KSY+GGI+T++SKV+
Sbjct  482   TPPLMISSGLRNRNIGKNLHLHPTLMSWGYFPEKESSSL--SFKGKSYEGGIITSVSKVL  539

Query  1768  ANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAP  1947
             +  E+S   A+I+T SL PG FS + PW SG D+KTRM R+SRTA L  + RD+ SGE  
Sbjct  540   S--EDSEVRAIIETASLGPGSFSVLFPWTSGLDLKTRMSRYSRTASLITIVRDRGSGEVK  597

Query  1948  SPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFV  2127
             +   ISY + KTDK ++K GL + LRIL AAGAEE+GT    G+ILK KG     I+EF+
Sbjct  598   TEGRISYVVDKTDKENIKAGLRQSLRILIAAGAEEVGTHRSDGQILKCKGVDEKSIEEFL  657

Query  2128  EKESSRD----LGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFP  2295
             +  SS +    +     +  SAHQMGSCR+G + +   ++  GE+WE E LF+ D+S  P
Sbjct  658   DSVSSEEGPKGMTEKWNIYCSAHQMGSCRIGENEKEGAIDVNGESWEAEKLFVCDASALP  717

Query  2296  TALGVNPMVTVQAIAYCTAQSVLKFLKT  2379
             +A+GVNPM+TV + AYC +  + K + T
Sbjct  718   SAVGVNPMITVMSTAYCISTRIAKSMTT  745



>ref|XP_009136067.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Brassica rapa]
Length=740

 Score =   494 bits (1273),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 309/773 (40%), Positives = 457/773 (59%), Gaps = 68/773 (9%)
 Frame = +1

Query  109   GGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDD------SVKLFFQTSASIAGTPQRV  270
             G   ++ A M ++ S  +  LP V  P+  +  DD      +++ FF TS S     +  
Sbjct  11    GHLGITTAEMESLASFCEAVLPPVSPPEEYSGGDDHYRNKETLRSFFFTSGSRTPVVRES  70

Query  271   AWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIV  450
               +I++R      ++ RL L+LL+TR+GTL++CG   L S++P+++ F E+S  KR  ++
Sbjct  71    IELITKRGTVETYLVTRLVLFLLATRLGTLLICGTECLVSRWPFVEKFSELSLEKRERVL  130

Query  451   ----RSWSCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNK-KP  615
                 R+W    +  ++  ++ +KV  L  FFS+V+ N EN++W+AI Y   + ++N+ KP
Sbjct  131   QKQFRNW---LLTPIRAAFVYIKVAFLFCFFSRVSPNGENLAWEAIGY---NVNTNENKP  184

Query  616   AGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQK  795
                             SE  K+               PL KG++   QE  + + + L +
Sbjct  185   ----------------SETHKER--------------PLEKGMVETMQETEQTLVESLAQ  214

Query  796   LGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARs  975
              G        +  + + +  I+CDAVVVGSGSGGGV A VLA AG KV+V+EKG Y+  S
Sbjct  215   KGL-------EAETDHDTIRIKCDAVVVGSGSGGGVAASVLAKAGMKVVVMEKGSYYTPS  267

Query  976   slsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDET  1155
             +    EG  ++++Y  GG++ + D ++++LAG+ VGGGS +NWSA I+TP  VL+EW E 
Sbjct  268   TYPSTEGPGMNKLYENGGILPTIDGNMMVLAGATVGGGSAVNWSACIKTPKSVLQEWSED  327

Query  1156  HKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDH  1335
              K+ L+ +KEY  AME V  R+GV    E EGFQN VLRKGC  LG  VE + RN+S  H
Sbjct  328   RKIPLYATKEYVSAMELVWKRIGVTETCELEGFQNQVLRKGCENLGINVENVARNSSERH  387

Query  1336  YCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNK---KTGRE--QAAG  1500
             YCG C +GC+ G KKG+  TWL D V  G  VI   C+A + +  K     GR+  +  G
Sbjct  388   YCGSCGYGCRQGDKKGSDRTWLVDAVSHG-AVILTGCKAERFILEKNGNNVGRKKMKCLG  446

Query  1501  VMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYF  1680
             VM    N    +   +++RVTV A G+L TP L+  SGL+N +IG+NLHLHPV+  WGYF
Sbjct  447   VMAKSLNGNIAKKIKIEARVTVSAAGSLLTPPLMIKSGLKNRHIGKNLHLHPVLMTWGYF  506

Query  1681  PDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSG  1860
             P+   S      + +SY+GGI+T+MSKV++  E+S   A+I+TP+L P  FS + PW+SG
Sbjct  507   PNKESSSF--NFKGRSYEGGIITSMSKVLS--EDSEVRAIIETPALGPASFSVLCPWISG  562

Query  1861  TDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAA  2040
              D+K RM R+SRTA L  + RD+ SGE  +   ISY + K D+ ++  GL + LRIL AA
Sbjct  563   LDMKKRMSRYSRTANLITIVRDRGSGEVRTEGRISYVVDKIDRENITAGLRQSLRILIAA  622

Query  2041  GAEEIGTCHRAGKILKPKGASRDEIDEFVE----KESSRDLGNLSTLIGSAHQMGSCRMG  2208
             GAEE+GT    G+ L  KG     I+EF++    +E  + +    ++  SAHQMGSCR+G
Sbjct  623   GAEEVGTHRSDGQKLICKGVDEKLIEEFLDSVSAEEGPKAMTENWSVYSSAHQMGSCRIG  682

Query  2209  VDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLK  2367
             VD     ++  GE+WE + LF+ D SV P+A+GVNPM+T+ + AYC +  ++K
Sbjct  683   VDEDEGAIDLDGESWEADKLFVCDGSVLPSAVGVNPMITIMSTAYCISTRIVK  735



>dbj|BAJ86655.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=752

 Score =   495 bits (1274),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 297/770 (39%), Positives = 440/770 (57%), Gaps = 66/770 (9%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVD-------DDSVKLFFQTSASIAGTPQRVAWM  279
             L PA M  + ++ D  +P++  P   A+D       D  ++ F+  S + +  P  VA +
Sbjct  29    LYPAQMEALRAMCDALIPSL--PPEEALDGRRDTPRDKDLERFYLASGADSTIPDEVAEL  86

Query  280   ISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW  459
                R      +L+ + LWLL TR+GTL LCG+  +S +FPY++ F ++   +R E +  W
Sbjct  87    AFTRCVWEAGLLVHVTLWLLCTRLGTLALCGRLCVSGEFPYVRRFADMPVGRREEALGRW  146

Query  460   SCC-YIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKW  636
             +   ++  +K  +  +K +    F+++VNEN+EN  WKAI +  P+              
Sbjct  147   TRARWLIPVKIAFAIVKSLCFNVFYTKVNENSENPCWKAIGFSVPN--------------  192

Query  637   ITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSP  816
                     + E++KK   +   + P      L KGV+   +     +   L   G  V P
Sbjct  193   --------VKEQRKKHPTEAAALRP------LDKGVVETRELDDATLLRSLADKGLAVKP  238

Query  817   CIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslslleg  996
                   +      +ECD V+VGSG GGGV A VLA+ GHKVLV+EKG YF     S +EG
Sbjct  239   -----ATSGYYHAVECDVVIVGSGCGGGVAAAVLASVGHKVLVVEKGDYFTPDDYSSVEG  293

Query  997   sslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFG  1176
              S++ +Y  GG+  + ++  +L AG+ VGGGS +NWSASI+TP  VL EW   H L +FG
Sbjct  294   PSMERLYEQGGIFCTSNVTTVLFAGTTVGGGSAVNWSASIRTPREVLLEWSRDHGLPVFG  353

Query  1177  SKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSF  1356
             S  Y  +M+ VC+R+ V     +EGFQN V+R+GC  LG PV+ +PRN+S  HYCG C  
Sbjct  354   SAGYVQSMDAVCARLAVTDGCREEGFQNKVVRRGCEALGLPVDCVPRNSSEGHYCGNCYL  413

Query  1357  GCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVH----NKKTGR-EQAAGVMFVYQN  1521
             GC  G K+GT  TWL D V  G  VI   C+A + +     N K GR ++  G++     
Sbjct  414   GCPTGDKRGTDTTWLVDAVQDG-AVILAGCKAERFILQNNINGKNGRSKKCVGLVATCVG  472

Query  1522  NGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSK  1701
             +G  +   ++++V++ ACGAL TP LL+NSGLRN ++GRNLHLHPV  AWGYFPD   + 
Sbjct  473   SGITKKLRIEAKVSISACGALMTPPLLRNSGLRNRHVGRNLHLHPVSMAWGYFPD---TN  529

Query  1702  AWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRM  1881
               P+   K Y+GGI+T+M +V           +I+TP+L PG F++++PW SG D+K RM
Sbjct  530   QVPQLTGKCYEGGIITSMHRVTER-------TIIETPALGPGAFASLVPWESGRDMKERM  582

Query  1882  QRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGT  2061
             +R++RTA  FAL RD+ +G       + Y+  + D   L++GL + LRI+ AAGA E+GT
Sbjct  583   RRYARTAHAFALVRDRAAGSVYGEGRVHYSPSRDDIEELRDGLRRALRIMVAAGAAEVGT  642

Query  2062  CHRAGKILKPKGASRDEIDEFVEKESSRDLGNLS------TLIGSAHQMGSCRMGVDPRS  2223
                 G  L+ KG    +++ F++ E +   G +        L+ SAHQMGSCRMG  P+ 
Sbjct  643   HRSDGLRLRCKGVQDKDLEAFLD-EVTVPRGPMQPGTDTWALLCSAHQMGSCRMGSSPKE  701

Query  2224  SVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
               V+  GE+WE E L++ D S+ PTA+GVNPM+T+Q++AYC A  + + L
Sbjct  702   GAVDGRGESWEAEDLYVCDGSLLPTAVGVNPMITIQSLAYCLAMDIAQSL  751



>ref|XP_004982881.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Setaria italica]
Length=761

 Score =   494 bits (1272),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 294/766 (38%), Positives = 438/766 (57%), Gaps = 60/766 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDD----DSVKLFFQTSASIAGTPQRVAWMISE  288
             + PA M  + ++    +P++         D      ++ F++ SA+ +  P  VA ++  
Sbjct  35    MHPAQMEALRAMCGALIPSLPADGAHGRGDPPGGKDLERFYRASAADSTIPDEVAELMVT  94

Query  289   RLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCC  468
             R     V L  + LW+LSTR+GTL+LCG+  L+  FPY++ F +++P +R   ++ W+  
Sbjct  95    RCIREAVALAWVVLWVLSTRVGTLLLCGRLCLAGGFPYVRKFADMTPERREAALQRWNRV  154

Query  469   -YIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITR  645
              ++  L+  +  +K++    F++ VNEN+EN  WKAI Y   +P  ++  A  S      
Sbjct  155   RWLFPLRIAFAIVKILCHYVFYAMVNENSENPYWKAIGYSVHEPREDQTEAAPSPS----  210

Query  646   EQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQ  825
                                        PL  GV+         +   L   G  V P   
Sbjct  211   --------------------------RPLDVGVVETRLLDDNALLRSLVGRGLTVKPV--  242

Query  826   QKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegssl  1005
                S     V++CDAV+VGSG GGGV A VLA+AG+KV+V+EKG YF  S  S +EG S+
Sbjct  243   --ASDANHHVVQCDAVIVGSGCGGGVAAAVLASAGYKVVVVEKGDYFTASDYSSIEGPSM  300

Query  1006  DEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKE  1185
             + ++  GG+  + ++  ++  G+ VGGGS +NWSASI+TP  V +EW   H L +F S  
Sbjct  301   ERLFERGGIFCTSNVTTMIFTGATVGGGSAVNWSASIRTPKEVTQEWAREHGLPVFASPG  360

Query  1186  YRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCK  1365
             Y  AM+ VC+R+ V     +EGFQN V+R+GC  LG   + +PRN+S  H+CG C+FGC 
Sbjct  361   YAQAMDAVCARLSVTDGCREEGFQNKVVRRGCEALGLCADAVPRNSSEGHFCGSCNFGCP  420

Query  1366  DGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKT-----GREQAAGVMFVYQNNGA  1530
              G K+GT  TWL D V SG  VI   C+A + V  K +       ++  G++    ++G 
Sbjct  421   TGDKRGTDTTWLVDAVASG-AVILTGCKAERFVFEKNSGGGRGRGKKCVGLVSTCASDGI  479

Query  1531  KEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWP  1710
              +   ++++V++ ACGAL TP LL+NSGL+N +IGRNLHLHPV  AWGYFP+   ++  P
Sbjct  480   TKKLRIEAKVSIAACGALMTPPLLRNSGLKNRHIGRNLHLHPVSMAWGYFPE---NRQDP  536

Query  1711  EPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRF  1890
             +   KSY+GGI+T+M +V           +I+TP+L PG F+A++PW SG D+K RM+R+
Sbjct  537   QLTGKSYEGGIITSMHRVTER-------TIIETPALGPGAFAAMVPWESGRDMKERMRRY  589

Query  1891  SRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHR  2070
             SRTA  FAL RD+ +G       + +   + D   L+NGL +VLRIL AAGA E+GT   
Sbjct  590   SRTAHAFALVRDRGAGFVDGEGRVRFTPSREDVEELRNGLRRVLRILVAAGAAEVGTHRS  649

Query  2071  AGKILKPKGASRDEIDEF-----VEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVN  2235
              G  L+ KG   ++++ F     +EK       +   L  SAHQMGSCRMG  PR   V+
Sbjct  650   DGLRLRCKGLRDEDLEAFLDEVTIEKGPMHSTADKWALHCSAHQMGSCRMGSSPRDGAVD  709

Query  2236  PMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
               GE+WE EGL++ D S+ PTA+GVNPM+T+Q+IAYC ++ + + L
Sbjct  710   GRGESWEAEGLYVCDGSLLPTAVGVNPMITIQSIAYCLSKGIAETL  755



>ref|XP_006406028.1| hypothetical protein EUTSA_v10020141mg [Eutrema salsugineum]
 gb|ESQ47481.1| hypothetical protein EUTSA_v10020141mg [Eutrema salsugineum]
Length=746

 Score =   493 bits (1270),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 301/738 (41%), Positives = 437/738 (59%), Gaps = 59/738 (8%)
 Frame = +1

Query  205   DDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASL  384
             + ++++ F+ TS S     ++   +I++R      ++ RL L+LL+TR+GTL++CG+  L
Sbjct  51    NKEALRSFYSTSGSQTPVVRQTIELITKRGTIEAYLITRLVLFLLATRLGTLLICGRECL  110

Query  385   SSQFPYLQSFPEISPHKRAEIV-RSWSCCYIKILKTFYLGMKVMVLLSFFSQVNENNENI  561
              +++P+++ F E+S  KR  +  + +   +   ++  ++ +KV  L  FFS+V+ N EN 
Sbjct  111   VTKWPFVEKFSELSLEKRERVFQKQFKNWFFTPIRAAFVYIKVAFLFCFFSRVSPNGENP  170

Query  562   SWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKG  741
             SW+AI Y   + D  KKP                SE QK+               PL KG
Sbjct  171   SWEAIGY-RANLD-QKKP----------------SETQKER--------------PLEKG  198

Query  742   VINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLA  921
             ++   +E  + + + L + G        +  + + +  I+CDAVVVGSGSGGGV A VLA
Sbjct  199   IVETMKETEQTLLESLAQKGL-------EADADHDAITIKCDAVVVGSGSGGGVAASVLA  251

Query  922   NAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTIN  1101
              +G KV+V+EKG YF  S     EG  +D++Y  GG++ S D ++++LAGS VGGGS +N
Sbjct  252   KSGLKVVVMEKGSYFTESDYPPFEGPGMDKLYENGGILPSVDGNVMILAGSTVGGGSAVN  311

Query  1102  WSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGC  1281
             WSA I+TP  VL EW E  K+ LF +KEY  AME V  R+GV    E EGFQN +LRKGC
Sbjct  312   WSACIKTPKSVLHEWSEDQKIPLFATKEYVSAMELVWKRIGVTERCEKEGFQNQILRKGC  371

Query  1282  LELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKV  1461
               LG  VE + RN+S  HYCG C +GC+ G+KKG+  TWL D V  G  VI   C+A + 
Sbjct  372   ENLGINVENVARNSSEKHYCGSCGYGCRQGEKKGSDRTWLVDAVSHG-AVILTGCKAERF  430

Query  1462  VHNKKTGREQAA------GVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRN  1623
             +  K   + +        GVM    N    +   ++++VTV A GAL TP L+ +SGLRN
Sbjct  431   ILEKNNCKNRGGKKMKCLGVMAKSLNGNILKKIKIEAKVTVSAAGALLTPPLMISSGLRN  490

Query  1624  PNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKS--YQGGIMTAMSKVVANFEESGYGA  1797
              +IG+NLHLHPV+ AWGYFP+    KA P    K   Y+GGI+T+MSKV++  E+S   A
Sbjct  491   RHIGKNLHLHPVLMAWGYFPE----KASPNSNFKGNCYEGGIITSMSKVLS--EDSEVRA  544

Query  1798  LIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQ  1977
             +I+TP+L P  F+ + PW+SG D+K RM R+SRT  L  + RD+ SGE  +   +SY + 
Sbjct  545   IIETPALGPASFAVLCPWISGLDMKKRMSRYSRTVNLITIVRDRGSGEVKTEGRVSYVVD  604

Query  1978  KTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVE----KESSR  2145
             KTDK +L  GL + LRIL  AGAEE+GT    G+ L  KG     I+EF++    +E  +
Sbjct  605   KTDKENLNAGLRQSLRILIQAGAEEVGTHRSDGQKLVCKGVDEKSIEEFLDSVNAEEGPK  664

Query  2146  DLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVT  2325
              +    ++  SAHQMGSC++G D     ++  GE+WE E LF+ D S  P+A+GVNPM+T
Sbjct  665   AMTEKWSVYSSAHQMGSCKIGEDEEEGAIDLNGESWEAEKLFVCDGSALPSAVGVNPMIT  724

Query  2326  VQAIAYCTAQSVLKFLKT  2379
             + A AYC +  + K + T
Sbjct  725   IMATAYCISTRIAKSMTT  742



>gb|EYU18303.1| hypothetical protein MIMGU_mgv1a001896mg [Erythranthe guttata]
Length=742

 Score =   493 bits (1269),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 316/776 (41%), Positives = 453/776 (58%), Gaps = 71/776 (9%)
 Frame = +1

Query  103   YSGGCPLSPAVMATVTSISDTFLPAVDVPQ-HAAVD--DDSVKLFFQTSASIAGTPQRVA  273
             YS G   S + + T+TSI +  LP   +   H  ++  +D V+ F++ SAS    P  VA
Sbjct  20    YSHG--FSSSQIQTLTSICEVLLPPTPLNNPHENINPQNDVVQAFYKASASQYPVPDEVA  77

Query  274   WMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVR  453
              ++ +R      IL+   + +LSTR+GTL++CG + +S ++P+L+ F EI    R ++V+
Sbjct  78    ELVMKRAFFEAKILVIAIVRILSTRVGTLLICGSSGVSKKWPFLKKFSEIPLENREKVVQ  137

Query  454   SWSCCYIKI-LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSK  630
              W   ++   ++  ++ +K +VLL FF+QV E++ N +WKA+DY                
Sbjct  138   KWFTNWLLTPVRLAFVFLKFLVLLVFFTQVGEDSSNPAWKAMDY----------------  181

Query  631   KWITREQHMTLSEEQKKGEEDVIPMN-PELLLG--PLHKGVINLNQEPRRQVFDRLQKLG  801
                               + DVI  N PE +    PL KG+I    E    +   L   G
Sbjct  182   ------------------KVDVIGENSPEEMSKERPLDKGIIETRLETDSSLAAALAGKG  223

Query  802   FPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARssl  981
                 P +    +   ++ ++CDAV+VGSG GGGV A VLA AG KV+VLEKG YF     
Sbjct  224   L--KPTLNP--ASRDTYTVKCDAVIVGSGCGGGVAAAVLAAAGLKVVVLEKGDYFTAGDY  279

Query  982   sllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHK  1161
             S LEG SLD +Y  GG++++ D   +LLAGS VGGGS +NWSA  +TP H++ +W     
Sbjct  280   SSLEGPSLDRLYESGGILSTLDGKTMLLAGSTVGGGSAVNWSACFKTPDHIINDWAHGQN  339

Query  1162  LELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYC  1341
             L LF   EY  AM+ VC R+GV      EGFQN +LR+GC  LG   + +PRN+S  HYC
Sbjct  340   LPLFSGPEYLDAMDKVCDRIGVTVGCTKEGFQNQILRQGCENLGLKADPVPRNSSESHYC  399

Query  1342  GWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVV----HNKKTGREQAAGVMF  1509
             G C +GC  G KKGT  TWL D V+S + VI    +AV+ V    +  +  +++  GV+ 
Sbjct  400   GSCCYGCIRGDKKGTDTTWLVDAVNS-DAVIISGAKAVRFVINQNNKNQRKKKKCHGVIA  458

Query  1510  VYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDA  1689
              + N   K    +++RVT+ ACGAL TP LL NSGL+N NIGRNLHLHPV+ AWGYF   
Sbjct  459   KFTNQDIKITLRIEARVTISACGALLTPPLLINSGLKNRNIGRNLHLHPVLMAWGYF---  515

Query  1690  PGSKAWPEP---EKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSG  1860
                   PEP   E K+Y+GGI+T++ KVV   E+    A+I++P L PG F+A++P+ SG
Sbjct  516   ------PEPDIVEGKAYEGGIITSVHKVV---EQDKVRAIIESPILGPGSFAALLPFESG  566

Query  1861  TDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAA  2040
              ++K R+ ++SRT  LF++ +D  SG   S   I Y +  +DK ++K GL + LRIL AA
Sbjct  567   IELKNRIIKYSRTCHLFSMIKDNGSGSVLSEGRIDYKLDSSDKENMKIGLVRALRILIAA  626

Query  2041  GAEEIGTCHRAGKILKPKGASRDEIDEF----VEKESSRDLGNLSTLIGSAHQMGSCRMG  2208
             GA E+GT    G+ +K +G   + ++EF    V  E  + +    +   SAHQMGSCRMG
Sbjct  627   GAVEVGTHQSDGQRVKCEGGDDEGVEEFLKGVVAPEGPKSMVEKWSTYCSAHQMGSCRMG  686

Query  2209  VDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             VD R   V+  GE+WE EGLF+ D+SV P A+GVNPM+T+QA AYC ++ + + LK
Sbjct  687   VDERCGAVDTWGESWEAEGLFVCDASVLPGAVGVNPMITIQATAYCISKKIAEKLK  742



>ref|XP_002528823.1| disulfide oxidoreductase, putative [Ricinus communis]
 gb|EEF33557.1| disulfide oxidoreductase, putative [Ricinus communis]
Length=747

 Score =   493 bits (1269),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 316/769 (41%), Positives = 453/769 (59%), Gaps = 63/769 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVD--DDSVKLFFQTSASIAGTPQRVAWMISERL  294
              S A M ++ S+  T  P +   QH   +  + +V+ FF+ S S    P  VA +I+ R 
Sbjct  23    FSSAEMDSLASLCHTIWPPISAAQHHNQEPANPAVQEFFKASGSQYPLPDEVAELIAMRG  82

Query  295   QHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW-SCCY  471
                 V+++RL L LLSTR+GTL+L G      ++P++  F  I   KR ++++ W    +
Sbjct  83    LIEAVMVVRLVLLLLSTRLGTLLLSGSLCFGEKWPFINKFSSIPVEKREKVLQKWLRHRF  142

Query  472   IKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQ  651
             +  ++  +  +K + L  FF+Q++EN  N +W+AI Y                       
Sbjct  143   LTPIRLAFFYVKAICLHVFFTQIDENGNNPAWEAIGY-----------------------  179

Query  652   HMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQK  831
                    + + EE+   +  E    PL KG++    E      + + + G  V+      
Sbjct  180   -------KVQNEENATQVPKER---PLEKGIVETMHESDSTFLNSIAQKGLKVAHV----  225

Query  832   GSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDE  1011
               G+    I+CD V+VGSG GGGV A VLA +G KVLVLEKG YF     S LEG S + 
Sbjct  226   -PGHNLCKIKCDVVIVGSGCGGGVAAAVLAASGQKVLVLEKGNYFTAKDFSGLEGPSYNH  284

Query  1012  MYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYR  1191
             +Y  GGL+ S D   ++LAGS VGGGS +NWSA I TP +VLKEW E HK++LFGS EY 
Sbjct  285   LYEAGGLMPSADAKFIILAGSVVGGGSAVNWSACINTPNYVLKEWAENHKIQLFGSPEYL  344

Query  1192  HAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDG  1371
              AM+ VC R+GV     +EGFQN V+RKGC  LG  + T+PRN+S  HYCG C +GC+ G
Sbjct  345   SAMDIVCKRIGVTENCVEEGFQNQVIRKGCENLGLEINTVPRNSSEKHYCGSCGYGCQTG  404

Query  1372  KKKGTSETWLADLVDSGNGVIFPECEAVKVV---HNKKTG----REQAAGVMF-VYQNNG  1527
              KKGT  TWL D V++G  VI   C+A + +   +NKK+G    +++  GV+  + +N+ 
Sbjct  405   DKKGTDSTWLVDAVNNG-AVILTGCKAERFILEENNKKSGGSQRKKKCLGVIAKILKNDN  463

Query  1528  AKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAW  1707
                   +++RVT+ ACGAL TP L+ +SGL NPNIGRNLHLHPV+  WGYFPD+      
Sbjct  464   IWMRLQIEARVTISACGALSTPPLMISSGLNNPNIGRNLHLHPVLMTWGYFPDSNTVF--  521

Query  1708  PEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQR  1887
                + KS++GGI+T++ KV +  E+S   A+I+TP L P  F+A+ PW S  D K R+ +
Sbjct  522   ---KGKSFEGGIITSVHKVAS--EDSNVRAIIETPQLGPASFAALCPWESALDFKERLLK  576

Query  1888  FSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCH  2067
             +SRTA L  + RD+ SGE  S   I+YN    D  +LK GL + LRIL AAGA E+GT  
Sbjct  577   YSRTANLITIIRDRGSGEVKSEGRIAYNFDALDIENLKAGLRQSLRILVAAGAVEVGTHR  636

Query  2068  RAGKILKPKGASRDEIDEFVEKESSRDLGNLS-----TLIGSAHQMGSCRMGVDPRSSVV  2232
               G+ LK +G ++ +++EF++  S    G LS         SAHQ+GSCRMG+  +   V
Sbjct  637   SDGQRLKCQGITKKQLEEFLDTVSP-PRGPLSPGKDWVAYTSAHQLGSCRMGISEKEGAV  695

Query  2233  NPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKT  2379
             +  GE+WE EGLF+ D+SV P+A+GVNPM+T+Q+ AYC ++ + K+L+T
Sbjct  696   DENGESWEAEGLFVCDASVLPSAIGVNPMITIQSTAYCLSERISKYLRT  744



>ref|XP_006589281.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Glycine 
max]
Length=740

 Score =   493 bits (1268),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 313/763 (41%), Positives = 458/763 (60%), Gaps = 58/763 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
             LS A M +++SI +  LP +   Q  +    +V+ F++ S S    P  +A ++ +R   
Sbjct  23    LSSAEMESLSSICEALLPPL---QLDSTKSKTVQHFWKASGSQFSIPHEIAEILIKRALK  79

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW-SCCYIK  477
               +ILLR+ LWLLSTR+GTL+LCG   LS ++P++ SF  +S   R ++++ W    ++ 
Sbjct  80    EALILLRVILWLLSTRLGTLLLCGTLCLSKKWPFINSFSNLSLDNREKVLQKWFKHRFLT  139

Query  478   ILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHM  657
              ++  ++ +KV+    FFSQ ++N EN +W+AI Y   D D     +      + RE+  
Sbjct  140   PIRLVFIYIKVLCFFVFFSQCDDNGENPAWEAIGY-QVDSDGITTTSN-----VHRER--  191

Query  658   TLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGS  837
                                    PL KG++   +E    +   L + G  V+       S
Sbjct  192   -----------------------PLEKGIVEAMKESNLSLPKSLIEKGLEVAI-----DS  223

Query  838   GNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMY  1017
              N +  I+CD V+VGSG GGGV A +LA++G KVLVLEKG YF  +  S LEG SL+E+Y
Sbjct  224   KNNTLNIKCDVVIVGSGCGGGVAASILASSGLKVLVLEKGNYFTPNDYSSLEGPSLNELY  283

Query  1018  LGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHA  1197
               GG  AS+D  + +L G+ VGGGS +NW+ASI+TP  VL+EW + HKL LF S EY  A
Sbjct  284   ELGGTFASRDGKMAILTGTTVGGGSAVNWAASIRTPDFVLEEWGKDHKLSLFSSHEYLSA  343

Query  1198  METVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKK  1377
             M+ VC R+GV  +  +EG QN VLRKGC  LG PV+ +PRN+S  HYCG C++GC  G+K
Sbjct  344   MDMVCKRIGVTDKCIEEGLQNQVLRKGCKNLGLPVDYVPRNSSERHYCGSCNYGCTRGEK  403

Query  1378  KGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTG-----REQAAGVMFVYQNNGAKEFC  1542
             +GT  TWL D VD G  VI    +A + +  KK       R++  GVM     N      
Sbjct  404   QGTEVTWLVDAVDHG-AVILTGTKAERFILGKKNKGGGVRRKKCLGVMANVVTNNITWRL  462

Query  1543  FVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEK  1722
              V+++VTV ACGAL TP L+ +SGL+N +IG+NLHLHPV+ +WGYFPD+       E + 
Sbjct  463   KVEAKVTVSACGALFTPPLMISSGLKNKHIGKNLHLHPVLMSWGYFPDSN-----SELKG  517

Query  1723  KSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTA  1902
             K Y+GGI+T++ KVV+  + S   A+++TP+L PG  S ++PW+SG D K RM ++SRT 
Sbjct  518   KCYEGGIITSVHKVVSE-DYSKVKAIVETPALGPGALSTLIPWVSGLDFKDRMLKYSRTV  576

Query  1903  ILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKI  2082
              L  + RD   GE  S   + Y + ++DK ++++G+++ LRIL AAGA E+GT    G  
Sbjct  577   HLITIIRDMGCGEVRSEGRVHYELDESDKENIRDGVKQALRILIAAGAVEVGTHRSDGHR  636

Query  2083  LKPKGASRDEIDEFVEKESSRDLGNLS-----TLIGSAHQMGSCRMGVDPRSSVVNPMGE  2247
             ++  G +  E++ FVE   + + G +S     ++  SAHQMGSCRMG+  +   V+  G 
Sbjct  637   IECNGKNEKELERFVESVYATE-GLMSHEEKWSIYSSAHQMGSCRMGMSEKEGAVDENGM  695

Query  2248  TWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             +WE EGLF+ D+S+ PTA+GVNPM+T+Q+ AYC A+ +  FLK
Sbjct  696   SWEAEGLFVCDASLLPTAIGVNPMITIQSTAYCVAKRIAAFLK  738



>gb|KFK39637.1| hypothetical protein AALP_AA3G269600 [Arabis alpina]
Length=744

 Score =   492 bits (1267),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 299/730 (41%), Positives = 432/730 (59%), Gaps = 60/730 (8%)
 Frame = +1

Query  211   DSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSS  390
             +S++ F+ TS S     ++   +I +R      ++ RL L+LL+TR+GTL++CG   L S
Sbjct  52    ESLRSFYSTSGSQTPILRQTIELIVKRGTIEAYLMSRLVLFLLATRLGTLLICGTECLVS  111

Query  391   QFPYLQSFPEISPHKRAEIV----RSWSCCYIKILKTFYLGMKVMVLLSFFSQVNENNEN  558
             ++P+++ F E+S  +R  ++    ++W    +   +  ++ +K   L  FFS+V+ N EN
Sbjct  112   RWPFVEKFSELSLERRERVIQKQFKNW---LLTPFRAAFVYLKSAFLFCFFSRVSSNGEN  168

Query  559   ISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHK  738
              +W+AI YC  + + NK                  SE  K+               PL K
Sbjct  169   PAWEAIGYC-VNLEENKP-----------------SETHKER--------------PLEK  196

Query  739   GVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvL  918
             G++   +E  + + + L + G  V            +  I+CDAV+VGSGSGGGV A VL
Sbjct  197   GMVETMKETNQTLLESLAQKGLEVD-------HDTDAIRIKCDAVIVGSGSGGGVAASVL  249

Query  919   ANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTI  1098
             A +G KV+V+EKG YF     +  EG S+++MY  GG++ S D + ++LAG+ VGGGS +
Sbjct  250   AKSGLKVVVMEKGSYFTPLDYTPFEGPSVEKMYENGGVLPSLDGNFMVLAGATVGGGSAV  309

Query  1099  NWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKG  1278
             NWSA I+TP  VL+EW E  K+ LF +KEY  AME VC R+GV  + E E FQN +LRKG
Sbjct  310   NWSACIKTPKSVLQEWSEDQKIPLFATKEYVSAMELVCKRIGVTEKCETESFQNQILRKG  369

Query  1279  CLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVK  1458
             C  LG  VE +PRN+S  HYCG C  GC+ G KKG+  TWL D V  G  VI   C+A +
Sbjct  370   CENLGINVENVPRNSSERHYCGSCGHGCRQGDKKGSDRTWLVDAVSHG-AVILTGCKAER  428

Query  1459  VVHNKKTGR-----EQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRN  1623
              +  K   R      +  GVM    N    +   ++++VTV A G+L TP L+ +SGL+N
Sbjct  429   FILEKNNNRVGGKKMKCLGVMAKSLNGNITKKIKIEAKVTVSAAGSLLTPPLMISSGLKN  488

Query  1624  PNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALI  1803
              +IG+NLHLHPV+ AWGYFP+   S    + + KSY+GGI+T++SKV++  E+S   A+I
Sbjct  489   QHIGKNLHLHPVLMAWGYFPEKESSNY--DFKGKSYEGGIITSVSKVLS--EDSEVRAII  544

Query  1804  QTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKT  1983
             +TP+L P  FSA+ PW SG D+K RM R+SRTA L  + RD  SGE  +   I Y + KT
Sbjct  545   ETPALGPASFSALCPWTSGLDMKRRMSRYSRTANLITIVRDCGSGEVKTEGRIRYTVDKT  604

Query  1984  DKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVE----KESSRDL  2151
             D+ +LK GL + LRIL AAGAEE+GT    G+ L  KG     I+EF++    +E  + +
Sbjct  605   DRENLKAGLRQSLRILIAAGAEEVGTNTSDGQRLICKGVDEKSIEEFLDSVNAEEGPKSM  664

Query  2152  GNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQ  2331
                  +  SAHQMGSCR+G D +   ++  GE+WE E LF+ D SV P+A+GVNPM+T+ 
Sbjct  665   TENWNVYSSAHQMGSCRIGEDEKEGALDLNGESWEAEKLFVCDGSVLPSAIGVNPMITIM  724

Query  2332  AIAYCTAQSV  2361
             + AYC +  +
Sbjct  725   STAYCISTRI  734



>ref|XP_004505474.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Cicer arietinum]
Length=762

 Score =   493 bits (1269),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 321/773 (42%), Positives = 450/773 (58%), Gaps = 61/773 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVP----------QHAAVDDDSVKLFFQTSASIAGTPQRV  270
              S A M ++TSI +  LP++ V                    V+ F   SAS    P  V
Sbjct  22    FSVAEMESLTSICEVVLPSLPVDAMNQRKDDQHDDDDESRKHVQSFLNLSASQYPIPHEV  81

Query  271   AWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIV  450
             A  + +R     V+L+R+ LWLL+TR+GTL+LCG   LS ++P++  F  +S  KR +IV
Sbjct  82    AEALVKRGLIEAVMLIRVVLWLLATRLGTLLLCGFLCLSKEWPFVNKFSSMSLDKREKIV  141

Query  451   RSW-SCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKS  627
             + W    ++  ++  +  +KV+    FFS V+EN +N +WKAI Y   +   N+K    S
Sbjct  142   QRWLKHRFLTPIRVAFGYIKVLCHFVFFSWVDENGDNPTWKAIGY---EVSPNEKMTNVS  198

Query  628   KKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFP  807
             K+          SEE+                 PL KG+I    E    +   L   G  
Sbjct  199   KE----------SEER-----------------PLEKGIIETMHEHDSTLQKSLSDKGLN  231

Query  808   VSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsl  987
             V        S N    I+CDAVVVGSGSGGGV A VL+NAG+KV+VLEKG YF     S 
Sbjct  232   VIV-----DSKNNILKIKCDAVVVGSGSGGGVAASVLSNAGYKVIVLEKGNYFVPKDYSS  286

Query  988   legsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLE  1167
             LEG S+++ Y  GG++ S D  IL+LAGS VGGGS INWSA ++TP  V+KEW E HKL 
Sbjct  287   LEGPSMNQQYECGGMLVSADSRILVLAGSTVGGGSAINWSACLKTPQEVIKEWSEKHKLS  346

Query  1168  LFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGW  1347
             +F S EY  AMETVC R+GV      EGFQN VLRKGC  LG  V+ +PRN+S +HYCG 
Sbjct  347   MFSSLEYLSAMETVCERIGVNQNCTQEGFQNQVLRKGCQNLGLKVDYVPRNSSGNHYCGS  406

Query  1348  CSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVV---HNKKTGREQAAGVMFVYQ  1518
             C +GC  G+K GT  TWL D V+ G  VI   C+A K +   +N    ++   GV+    
Sbjct  407   CGYGCPKGEKLGTQVTWLVDAVEKG-AVIITGCKAEKFLFQTNNNTRKKKSCLGVLAKTL  465

Query  1519  NNGAKEFCF-VKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPG  1695
             NN        ++++VTV +CGAL TP L+  SGL+N NIGRNLHLHPV+  WGYFP++  
Sbjct  466   NNTRVTMKLQIEAKVTVSSCGALLTPPLMITSGLKNKNIGRNLHLHPVLMTWGYFPESKN  525

Query  1696  SKAWPEPEKKSYQGGIMTAMSKVVANFEESGYG-ALIQTPSLHPGMFSAIMPWLSGTDIK  1872
                  + + K Y+GGI+T++ K++++ + + Y  A+I+TP + P  F+++ PW SG D K
Sbjct  526   ----LDLKGKVYEGGIITSVHKLLSSNDSNSYTRAIIETPLIGPASFASMCPWESGLDFK  581

Query  1873  TRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEE  2052
              RM  +SRT+    + RD + G+  S   ISY + + DK ++++GL++ LRIL AAGA+E
Sbjct  582   QRMLNYSRTSHFITIIRDSSCGKVTSEGRISYKLNEIDKENIRSGLQQALRILIAAGADE  641

Query  2053  IGTCHRAGKILK----PKGASRDEIDEFVEKESSRDLGNLS-TLIGSAHQMGSCRMGVDP  2217
             +GT    G+ +K     +    + I+     E +   GN    +  SAHQMGSCRMGV+ 
Sbjct  642   VGTHRSDGQRIKCSEKSEIEIEEFIESVCPMEGALLPGNEKWNIYTSAHQMGSCRMGVNE  701

Query  2218  RSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             +   V+  GE+WE EGLF+ D+SV PTA+GVNPM+TVQ+ AYC +  ++ +L+
Sbjct  702   KEGGVDENGESWEAEGLFVCDASVLPTAVGVNPMITVQSTAYCISNRIVDYLR  754



>ref|XP_004493801.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Cicer arietinum]
Length=738

 Score =   491 bits (1265),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 323/790 (41%), Positives = 464/790 (59%), Gaps = 68/790 (9%)
 Frame = +1

Query  46    DDGDSLFSNG-KAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVK  222
             +D   L   G K E+G    YS G  LS + M  + SI DT  P++ + +H +  +  + 
Sbjct  2     EDCHPLLRGGRKTEKG----YSHG--LSTSQMHVMASICDTLFPSLPLNKHIS-QNQILS  54

Query  223   LFFQTSASIAGTPQRVA--WMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQF  396
              F+  S S    P   A   M+ ++     + L+R  L +LS R+GTL+LCG   L  ++
Sbjct  55    SFYSASGSHFPFPDEAAESLMLFKKSIPKAMPLVRWILLILSFRLGTLLLCGTLCLHWKW  114

Query  397   PYLQSFPEISPHKRAEIVRSWSCCYIKI-LKTFYLGMKVMVLLSFFSQVNENNENISWKA  573
             P++  F EIS  KR +I+ +WS     I L+  ++ +K++   + FS+V+ N  N  WKA
Sbjct  115   PFVLKFTEISLEKREKILNNWSREKFWIPLRVVFVLIKLVFFFTLFSRVDVNGHNPMWKA  174

Query  574   IDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINL  753
             I Y                K  TRE+      +QKK               PL +G+I  
Sbjct  175   IGY----------------KVDTREKL-----KQKKR--------------PLQEGLIET  199

Query  754   NQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGH  933
               E    +   L + G  V+  +         + I+CD  +VGSGSGGGV A +LAN+GH
Sbjct  200   TYESDSTLIQSLTEKGLEVTEDVDHN-----LYKIKCDVAIVGSGSGGGVAAAILANSGH  254

Query  934   KVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSAS  1113
             KV+VLEKG+YF     S LE SS+ E+Y  GG++ + D   ++LAGS VGGGS+INW+A 
Sbjct  255   KVIVLEKGEYFVSHDYSSLESSSMKELYESGGMMPTVDGKTMILAGSTVGGGSSINWAAC  314

Query  1114  IQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELG  1293
             ++TP  V KEW + +KL LF + +YR AM++VC R+GV  +   E FQN VLRKGC  +G
Sbjct  315   VRTPDSVTKEWSKKYKLSLFATSDYRSAMDSVCRRIGVTEKCNKESFQNQVLRKGCEGIG  374

Query  1294  YPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVK-VVHN  1470
               VE++  N+S DHYCG C FGC+ G KKGT  TWL D V++G  VI   C A K ++ N
Sbjct  375   LKVESVAVNSSEDHYCGSCCFGCRTGDKKGTDSTWLVDAVNNG-AVIITGCNAEKFILEN  433

Query  1471  KKTG---REQAAGVMFVYQNNGA-KEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGR  1638
              K G   R+  +GV+    N     +   ++S+VT+ +CG+L TP L+ +SGL+N NIGR
Sbjct  434   GKNGTIKRKNCSGVIAAASNKSKITKKLQIESKVTISSCGSLFTPPLMISSGLQNSNIGR  493

Query  1639  NLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSL  1818
             NLHLHPV FAWGYFP+   +         +Y+GGI+T++ K++A  E S    +I+ P+L
Sbjct  494   NLHLHPVQFAWGYFPEEMTNLI-----GNNYEGGIITSIHKILA--ENSTPKIIIEAPAL  546

Query  1819  HPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSL  1998
              PG FSA++PW SG D+K R+ +++RTA LFAL RDK SGE  +   +SY + K DK +L
Sbjct  547   GPGSFSALIPWTSGLDMKERLVKYARTANLFALVRDKGSGEIKTEGRVSYRLDKIDKENL  606

Query  1999  KNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLST  2166
             + GL + LRIL AAGA E+GT    G+ +K +G    +++EF++  +     R  G + T
Sbjct  607   RVGLRQSLRILVAAGAVEVGTYRSDGQRIKCRGIKDKDLEEFLDNVAVVGGPRSRGEVWT  666

Query  2167  LIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYC  2346
             +  SAHQMGSCRMG +     V+  GE+WE +GLF+ D SV P+A+GVNPM+T+Q+ AYC
Sbjct  667   VFSSAHQMGSCRMGANEEEGAVDENGESWEAKGLFVCDGSVLPSAVGVNPMITIQSTAYC  726

Query  2347  TAQSVLKFLK  2376
              A  + + LK
Sbjct  727   IASKIAESLK  736



>ref|XP_008382898.1| PREDICTED: LOW QUALITY PROTEIN: long-chain-alcohol oxidase FAO2 
[Malus domestica]
Length=674

 Score =   489 bits (1259),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 280/694 (40%), Positives = 416/694 (60%), Gaps = 58/694 (8%)
 Frame = +1

Query  340   STRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI-LKTFYLGMKVMV  516
             S R+GT +LCGK     ++P++  F E+S  KR ++++ WS   + I ++  ++ +K+  
Sbjct  28    SLRLGTFLLCGKCCFDWKWPFIHKFAEMSLDKREQVLKKWSRQKLVITIRLMFMVVKMFC  87

Query  517   LLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDV  696
               +FFS+V+EN+ N +WKAI Y                  + R++ +  + +++      
Sbjct  88    FYTFFSRVDENSRNPAWKAIGY-----------------ELDRKEKLIKTPKER------  124

Query  697   IPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavv  876
                       PL KG+I    E    + + L K G  ++       + N    I+CD V+
Sbjct  125   ----------PLEKGIIETAYESDSTLVESLTKKGLDLA-----DDAVNNIHKIKCDVVI  169

Query  877   vgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDI  1056
             VGSG GGGV A VLA +G KV+VLEKG YF     S LEG S++E+Y  GG+++S D  +
Sbjct  170   VGSGCGGGVAAAVLAQSGQKVVVLEKGNYFVPKDYSSLEGPSMNELYESGGILSSVDGMV  229

Query  1057  LLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSE  1236
             ++LAGS VGGGS +NWSASI+TP +VL++W   HK+ L+ S++Y+ AM+ VC R+GV   
Sbjct  230   MILAGSTVGGGSAVNWSASIKTPDNVLRDWSVDHKIPLYASEDYKSAMDIVCKRIGVTES  289

Query  1237  VEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVD  1416
               +E F N +LRKGC  LG  V+ +P N+S DHYCG+C++GC  G KKGT  TWL D V 
Sbjct  290   CTEENFPNQILRKGCENLGLKVDAVPXNSSADHYCGFCNYGCPTGDKKGTDSTWLVDAVK  349

Query  1417  SGNGVIFPECEAVK-VVHNKKTG--REQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALC  1587
              G  VI   C+A K ++ N   G  R+Q  GV     +   K    +++ VT+ ACG+L 
Sbjct  350   FG-AVILTGCKAEKFILENDNEGGIRKQCLGVQATSLSKNIKRKLQIEANVTISACGSLL  408

Query  1588  TPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVV  1767
             TP L+ +SGL+N NIGRNLHLHPV+ AWGYFP+       PE + KSY+GGI+T++ KVV
Sbjct  409   TPPLMISSGLKNRNIGRNLHLHPVLLAWGYFPEHE-----PEFKGKSYEGGIITSLHKVV  463

Query  1768  ANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAP  1947
             +    +    +I+T ++ P  FS + PW S  D+K  M++++RTA LFAL RD+ SG   
Sbjct  464   SG--TANVRTIIETAAVGPATFSTLFPWTSRLDMKDTMEKYARTANLFALVRDRGSGAVK  521

Query  1948  SPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFV  2127
                 I Y + + DK +L+ GL + LRIL AAGA E+GT    G+ +K KG   ++++ F+
Sbjct  522   REGRIHYTLDQLDKENLQVGLRQTLRILIAAGAVEVGTYRNDGQRIKCKGVEEEDLEVFL  581

Query  2128  EK------ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSV  2289
             +        S+R+   L T   SAHQMGSCRMG       V+  GE+WE +GLF+ D S+
Sbjct  582   DTVVAAAGPSARE--ELWTTYSSAHQMGSCRMGATEEEGGVDENGESWEAKGLFVCDGSL  639

Query  2290  FPTALGVNPMVTVQAIAYCTAQSVLKFLKTHNHM  2391
              PTA+GVNPM+T+++ AYC ++ + + L+   ++
Sbjct  640   LPTAVGVNPMITIESTAYCISKRIAQSLEKQKYI  673



>ref|XP_002272123.2| PREDICTED: long-chain-alcohol oxidase FAO2-like [Vitis vinifera]
Length=749

 Score =   491 bits (1264),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 316/775 (41%), Positives = 457/775 (59%), Gaps = 60/775 (8%)
 Frame = +1

Query  97    GVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDD-DSVKLFFQTSASIAGTPQRVA  273
             G YS G   S + +  + SI +T +P + +   +  +  +++  F++ S S    P   A
Sbjct  23    GSYSHG--FSSSQIQALASICETLIPPLHLESISKENPPEALYSFYKASGSQFPVPDEAA  80

Query  274   WMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVR  453
              ++ +R     V+L+ + L +LSTR+GTL+LCG   L  ++P++  F EIS  KR ++++
Sbjct  81    ELLKKRGLPEGVMLVSIVLKILSTRLGTLLLCGFLCLGWKWPFILKFSEISLEKREQVLK  140

Query  454   SWSCC-YIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSK  630
             +WS   ++  L+ F+  MK+     FFS+ ++N EN +W AI Y     +  KKP  +  
Sbjct  141   NWSRQRFLFPLRLFFAIMKIFCFFIFFSRTDDNLENPAWDAIGYHVETKEYVKKPPKER-  199

Query  631   KWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPV  810
                                             P+ KG++    E    +   L + G  V
Sbjct  200   --------------------------------PIRKGIVETMYENDSTLVQSLSQRGIKV  227

Query  811   SPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsll  990
                  QK        I+CD V++GSG GGGV A VLA++G+KVL+LEKG YF     S L
Sbjct  228   IE--DQKNICK----IKCDVVIIGSGCGGGVTAAVLASSGYKVLILEKGNYFEPEDYSSL  281

Query  991   egsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLEL  1170
             EG S+ E Y  GG++++ D  +++LAGS VGGGS +NWSA+I+TP  +L+EW   HKL L
Sbjct  282   EGPSMSEQYESGGVMSTIDAKVMILAGSTVGGGSAVNWSAAIKTPNSILREWSTDHKLPL  341

Query  1171  FGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWC  1350
             FGS EY  AM+TV  R+GV  +  +EGFQN VLRKGC  LG  VE+IPRN+S +HYCG C
Sbjct  342   FGSSEYLSAMDTVWKRIGVTEKCTEEGFQNQVLRKGCENLGLDVESIPRNSSENHYCGSC  401

Query  1351  SFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVV-HNKKTGREQ--AAGVMFVYQN  1521
             ++GC  G K+GT  TWL D V  G  VI   C+A K++   KK GR++   +GV+    +
Sbjct  402   AYGCTRGDKQGTQSTWLVDAVGCG-AVILTGCKAEKLIFKEKKNGRKRRKCSGVIVASSS  460

Query  1522  NGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDA-PGS  1698
                 +   +++RVTV ACG+L TP LL +SGL NP+IG+NLHLHPV+  WGYFP++  G 
Sbjct  461   KNVTKKLQIEARVTVSACGSLLTPPLLLSSGLENPHIGKNLHLHPVLMVWGYFPESQSGI  520

Query  1699  KAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTR  1878
             K       K ++GG++T++ KVV+  EES   A+++  +L P  F+AI PW+SG D+K R
Sbjct  521   KG------KCFEGGLLTSLHKVVS--EESRVQAIVEPTALGPASFAAIHPWVSGLDMKER  572

Query  1879  MQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIG  2058
             M ++SRTA LFALARDK +GE      I Y +   DK +L+ GL + LRIL AAGA E+G
Sbjct  573   MVKYSRTATLFALARDKGAGEVKVERRIKYRLHPADKENLRVGLRQALRILIAAGAVEVG  632

Query  2059  TCHRAGKILKPKGASRDEIDEFVEKESSR----DLGNLSTLIGSAHQMGSCRMGVDPRSS  2226
             T    G+ +K KG   + ++EF++   +       G+  TL  SAHQMGSCRMG      
Sbjct  633   TYRSDGQSIKCKGVKEEAVEEFLDGVVAGGGPCSRGDHWTLYCSAHQMGSCRMGATEEEG  692

Query  2227  VVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHNHM  2391
              V+  GETWE +GLF+ D SV P+A+G+NPM+T+Q  AYC ++ + + LK    +
Sbjct  693   AVDENGETWEAKGLFVCDGSVLPSAVGINPMITIQTTAYCISKRIAESLKKQEFL  747



>ref|XP_007144044.1| hypothetical protein PHAVU_007G124200g [Phaseolus vulgaris]
 gb|ESW16038.1| hypothetical protein PHAVU_007G124200g [Phaseolus vulgaris]
Length=741

 Score =   491 bits (1263),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 314/765 (41%), Positives = 460/765 (60%), Gaps = 61/765 (8%)
 Frame = +1

Query  118   PLSPAVMATVTSISDTFLPAVDVP---QHAAVDDDSVKLFFQTSASIAGTPQRVAWMISE  288
             PL  A M ++TSI + F P + +    +H +    +V+ F+++SAS    PQ  A M+ +
Sbjct  22    PLPSAEMESLTSICEAFFPPLQLEHLDKHNS-KTKAVQHFWKSSASQFPIPQETADMLIK  80

Query  289   RLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW-SC  465
             R     +I +RL LW+LSTR+GTL+LCG   LS ++P + +F  IS   R ++++ W   
Sbjct  81    RALKEALIFVRLILWMLSTRLGTLLLCGTLCLSKKWPCIHNFSNISLDNREKVLQKWFKH  140

Query  466   CYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITR  645
              +   ++  +L +KV+ L  FFSQ +E  +N +W+A+ Y   D D   K   K +     
Sbjct  141   RFFTPIRLAFLYVKVLCLFVFFSQCDEKGQNPAWEAVGY-KVDTDGITKQVQKER-----  194

Query  646   EQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQ  825
                                        PL KG++    E    +   L + G  VS    
Sbjct  195   ---------------------------PLEKGIVEGRNESDWSLPKSLGEKGLEVSV---  224

Query  826   QKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegssl  1005
                +GN    I+CD V+VGSG GGGV A  LA++G KVLVLEKG Y+  S  S LEG SL
Sbjct  225   --DAGNNVLGIKCDVVIVGSGCGGGVAAATLASSGLKVLVLEKGNYYTSSDYSSLEGPSL  282

Query  1006  DEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKE  1185
             +E+Y  GG  AS D ++ +LAGS VGGGS +NW+ASI+TP  VLKEW++ HKL LF S E
Sbjct  283   NELYELGGTFASWDGNMAILAGSTVGGGSAVNWAASIRTPDSVLKEWEKEHKLSLFSSHE  342

Query  1186  YRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCK  1365
             Y  AM+ VC R+GV  +  +EG QN VLRKGC  LG  V+ +PRN+S  HYCG C++GC 
Sbjct  343   YLSAMDMVCKRIGVTDKCVEEGLQNQVLRKGCKNLGLQVDYVPRNSSERHYCGSCNYGCT  402

Query  1366  DGKKKGTSETWLADLVDSGNGVIFPECEAVK-VVHNKKTGR---EQAAGVMFVYQNNGAK  1533
              G K+GT  TWL D VD  + VI    +A + ++ N K GR   ++  GVM     N   
Sbjct  403   RGDKQGTEVTWLVDAVDH-DAVILTGTKAERFILGNNKGGRVRKKKCLGVMANVLTNNIT  461

Query  1534  EFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPE  1713
                 V+++VTV ACGAL TP L+ +SGL+N +IG+NLH+HPV+ +WGYFPD+       +
Sbjct  462   WRLKVEAKVTVSACGALLTPPLMISSGLKNKHIGKNLHMHPVLMSWGYFPDSN-----SD  516

Query  1714  PEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFS  1893
              + K Y+GGI+T++ KVV+  E+S   A+++TP+L P + S ++PW+SG+D K RM ++S
Sbjct  517   LKGKCYEGGIITSVHKVVS--EDSNVKAIVETPALGPAVLSTLLPWVSGSDFKERMLKYS  574

Query  1894  RTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRA  2073
             RT  L  + RDK  G   S   + Y++ ++DK ++++G+++ LRIL AAGA E+GT    
Sbjct  575   RTVHLITIIRDKGCGVVRSEGRVHYDLDESDKENIRDGVKQALRILIAAGAVEVGTHRSD  634

Query  2074  GKILKPKGASRDEIDEFVEKESSRDLGNLS-----TLIGSAHQMGSCRMGVDPRSSVVNP  2238
             G+ ++  G +  E++ FVE   +   G++S     ++  SAHQMGSC+MG+  +   V+ 
Sbjct  635   GQRIECNGNNEKELERFVESIYATG-GSMSQEEKWSIYSSAHQMGSCKMGMSEKEGAVDE  693

Query  2239  MGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
              G +WE EGLF+ D+S+ PTA+GVNPM+T+Q+ AYC A+ +  FL
Sbjct  694   NGMSWEAEGLFVCDASLLPTAIGVNPMITIQSTAYCVAKRIAAFL  738



>ref|XP_007035188.1| Fatty alcohol oxidase 3 isoform 6, partial [Theobroma cacao]
 gb|EOY06114.1| Fatty alcohol oxidase 3 isoform 6, partial [Theobroma cacao]
Length=655

 Score =   487 bits (1254),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 291/687 (42%), Positives = 419/687 (61%), Gaps = 55/687 (8%)
 Frame = +1

Query  340   STRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYI-KILKTFYLGMKVMV  516
             STR+GTL+LCG   L  ++PY+  F  +    R ++++ W   ++  +++  ++ +KV  
Sbjct  15    STRLGTLLLCGSLCLGDKWPYINYFSCMPLENREKVLQMWFKSWLFTLVRIAFIYLKVAC  74

Query  517   LLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDV  696
             L  FFS+V ENN+N +W+AI Y   + +++K+        +++E+               
Sbjct  75    LYVFFSRVGENNDNPAWEAIGYQVDNVENSKQ--------VSKER---------------  111

Query  697   IPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavv  876
                       PL KG+I    E    +   L + G  V+   ++       + I+CDAV+
Sbjct  112   ----------PLQKGMIETMHEKDSTLLQSLTQKGLQVTEDTERN-----VYKIKCDAVI  156

Query  877   vgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDI  1056
             VGSG GGGV A +LA++G KV+VLEKG YFA S  S  EG S+D++Y  GG++ S D  +
Sbjct  157   VGSGCGGGVAAAILASSGLKVVVLEKGSYFAPSDYSPFEGPSMDQLYESGGILPSIDGQM  216

Query  1057  LLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSE  1236
             L+LAGS VGGGS INWSASI+TP  +L+EW E  +L LFGS EY  AM+ VC R+GV   
Sbjct  217   LILAGSTVGGGSAINWSASIKTPKSILQEWAEDCQLPLFGSPEYLSAMDNVCERIGVTEN  276

Query  1237  VEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVD  1416
              ++EGFQN +LRKGC  LG  VE +PRN+S  HYCG C FGC+ G KKGT  TWL D V 
Sbjct  277   CKEEGFQNQILRKGCKNLGLEVENVPRNSSESHYCGSCGFGCRRGDKKGTDRTWLVDAVS  336

Query  1417  SGNGVIFPECEAVKVVHNKK----TGREQAAGVMFVYQNNGAKEFCFVKSRVTVIACGAL  1584
             +G  VI   C+A K +  K       + +  GV+    N    +   ++++VT+ ACGAL
Sbjct  337   NG-AVILTGCKAEKFILEKNKICSKRKLKCLGVIAKTSNKNITKKLHIEAKVTISACGAL  395

Query  1585  CTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKV  1764
              TP L+ +SGL+N NIGRNLHLHPV+ AWGYFPD+       E + K Y+GGI+T++ KV
Sbjct  396   FTPLLMHSSGLKNRNIGRNLHLHPVLMAWGYFPDSD-----SEFKGKVYEGGIITSVHKV  450

Query  1765  VANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEA  1944
             VA   ++   A+I+TPSL P  ++A+ PW SG D+K RM  FSRTA +  + RD+ SG+ 
Sbjct  451   VA--ADNKVRAIIETPSLGPAQYAALCPWESGLDMKRRMLNFSRTAHMITIIRDQGSGKV  508

Query  1945  PSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEF  2124
              +   ++Y     D+ ++++GL + LRIL AAGA E+GT    G+ ++ KG S  E++EF
Sbjct  509   HAGGRVTYKFDALDRQNMQSGLRQALRILVAAGAVEVGTHRSDGQSIRCKGISNKELEEF  568

Query  2125  VEKESSRD----LGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVF  2292
             +E  S  +             SAHQMGSCRMG++ +   V+  GE+WE EGLF+ D+SV 
Sbjct  569   LESVSPVEGPMFPAEKWVTHTSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVL  628

Query  2293  PTALGVNPMVTVQAIAYCTAQSVLKFL  2373
             P A+GVNPM+TVQ+ AYC ++ + + L
Sbjct  629   PGAIGVNPMITVQSTAYCLSKRIAESL  655



>ref|XP_007162567.1| hypothetical protein PHAVU_001G162800g [Phaseolus vulgaris]
 gb|ESW34561.1| hypothetical protein PHAVU_001G162800g [Phaseolus vulgaris]
Length=729

 Score =   489 bits (1260),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 313/784 (40%), Positives = 459/784 (59%), Gaps = 86/784 (11%)
 Frame = +1

Query  61    LFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKL---FF  231
             L   G+ E+G    YS G  LS + M  + SI +T  P++  P +   ++ S  L   + 
Sbjct  10    LLRGGRREKG----YSHG--LSTSQMHVMASICNTLFPSL--PLNPLTNETSQPLSPCYN  61

Query  232   QTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQS  411
              TSAS        A ++ +R+    + L+   LW+LS R+GTL++CG+  L  ++P++  
Sbjct  62    NTSAS-----HEAAELLHKRVVPEALSLVGWVLWMLSFRLGTLLICGRLCLDWKWPFIHK  116

Query  412   FPEISPHKRAEIVRSWSCCYIKI-LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCG  588
             F EIS  KR EI+R+WS     + L+  ++ +K++   +FFS+ +EN  N  WKAI Y  
Sbjct  117   FSEISLEKREEILRNWSREKRWVPLRLVFVLIKLIFFCTFFSRSDENGHNPVWKAIGY--  174

Query  589   PDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPR  768
                D+ KK   K +                                PL KG+I    E  
Sbjct  175   -QVDTKKKLVRKER--------------------------------PLEKGLIETMHETD  201

Query  769   RQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVL  948
               +   L + G  VS    Q       + ++CD V+VGSG GGGV A VLAN+G KV+VL
Sbjct  202   HTLMQSLAEKGLEVSEDKLQN-----LYKVKCDVVIVGSGCGGGVAAAVLANSGQKVIVL  256

Query  949   EKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPP  1128
             EKG+YF     S LEG S+DE+Y  GG+++S D  +++LAGS VGGGS INWSA I+TP 
Sbjct  257   EKGEYFVSHDYSSLEGPSMDELYESGGILSSLDGKMMILAGSTVGGGSAINWSACIRTPD  316

Query  1129  HVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVET  1308
              VL+E             +Y+ AM++VC R+GV  + + E FQN VL +GC ++G+ VE+
Sbjct  317   SVLRE-----------CSDYQSAMDSVCRRIGVTEKCKKESFQNRVLIQGCEKMGFKVES  365

Query  1309  IPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVV---HNKKT  1479
             +  N+S DHYCG C +GC+ G KKGT  TWL D V +G  VI   C+A + +    N   
Sbjct  366   VATNSSADHYCGSCCYGCRTGDKKGTDSTWLVDAVGNG-AVILSGCKAERFILEDGNDGM  424

Query  1480  GREQAAGVMF--VYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLH  1653
              +++  GV+    +++   K+   ++S+VT+ ACG+L TP L+ +SGL+NPNIGRNLHLH
Sbjct  425   KKKKCLGVIAAATWRSKVTKKL-LIESKVTISACGSLSTPPLMISSGLKNPNIGRNLHLH  483

Query  1654  PVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMF  1833
             PV FAWGYFP+   + +       +++GGI+T++ KV+A  E+S    +I+TP+L PG F
Sbjct  484   PVQFAWGYFPEDMTNFS-----GNNHEGGIITSIHKVLA--EDSTPRFIIETPALGPGSF  536

Query  1834  SAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLE  2013
             SA++PWLSG D+K RM +++RTA +FAL RD  SG+  +   ++Y + + DK +L+ GL 
Sbjct  537   SALVPWLSGHDMKDRMAKYARTANIFALIRDHGSGKVKAEGRVTYRLDQVDKENLRIGLR  596

Query  2014  KVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLIGSA  2181
             K LRIL AAGA E+GT    G+  K +G   ++++EF++        R    L T++ SA
Sbjct  597   KALRILVAAGAVEVGTYRSDGQRFKCRGVKEEDLEEFLDTVKIVGGPRSRNELWTVLTSA  656

Query  2182  HQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSV  2361
             HQM SCRMG       V+  GE+WE +GL++ D SV PTA+GVNPMVT+Q+ AYC A  +
Sbjct  657   HQMTSCRMGATEEEGAVDETGESWEAKGLYVCDGSVLPTAVGVNPMVTIQSTAYCIASKI  716

Query  2362  LKFL  2373
              + L
Sbjct  717   AESL  720



>ref|XP_009369442.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Pyrus x bretschneideri]
Length=749

 Score =   490 bits (1261),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 304/772 (39%), Positives = 451/772 (58%), Gaps = 63/772 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAV---DVPQ-HAAVDDDSVKLFFQT-SASIAGTPQRVAWMIS  285
              S A + ++ +I +  LP +   D+P  H  +        + T SAS    P  VA ++ 
Sbjct  25    FSSAQIQSLAAICEALLPPLSPEDIPDDHNPLHSSFSSSSYCTASASQPPIPDEVAELMV  84

Query  286   ERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSC  465
             +R     V  +R+ L +LS R+GT +LCGK+    ++P++  F E+S  KR  + + WS 
Sbjct  85    KRTLPEVVGGVRVFLKMLSLRLGTFLLCGKSCFDWKWPFIHKFSEMSLDKRELVRKKWSR  144

Query  466   CYIKI-LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWIT  642
               + I ++  ++ +K+    +FFS+V+EN+ N +WKAI Y                  + 
Sbjct  145   QKLVITIRLMFMVIKMFCFYTFFSRVDENSRNPAWKAIGY-----------------ELD  187

Query  643   REQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCI  822
             R++ +  + +Q+                PL KG+I    E    + + L K G  ++   
Sbjct  188   RKEKLIKTPKQR----------------PLEKGIIETAYESDSTLVESLTKKGLDLT---  228

Query  823   QQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegss  1002
                 + N    I+CD V+VGSG GGGV A +LA +G KV+VLEKG YF     S LEG S
Sbjct  229   --DDAVNNIHKIKCDVVIVGSGCGGGVAAAILAQSGQKVVVLEKGNYFVPKDYSSLEGPS  286

Query  1003  lDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSK  1182
             ++E+Y  GG+++S D  +++LAGS VGGGS +NWSASI+TP +VL++W   HK+ L+ S+
Sbjct  287   MNELYESGGIMSSVDGMVMILAGSTVGGGSAVNWSASIKTPDNVLRDWSVDHKIPLYASE  346

Query  1183  EYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGC  1362
             +Y+ AM+ VC R+GV     +E F N +LRKGC  LG  V+ +PRN+S DHYCG+C++GC
Sbjct  347   DYKSAMDIVCKRIGVTESCTEENFPNQILRKGCENLGLKVDAVPRNSSADHYCGFCNYGC  406

Query  1363  KDGKKKGTSETWLADLVDSGNGVIFPECEAVK-VVHNKKTG--REQAAGVMFVYQNNGAK  1533
               G KKGT  TWL D V  G  VI   C+A K ++ N   G  R+Q  GV     +   K
Sbjct  407   PTGDKKGTDSTWLVDAVKFG-AVILTGCKAEKFILENDNEGGIRKQCLGVQATSLSKNIK  465

Query  1534  EFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPE  1713
                 +++ VT+ ACG+LCTP L+ +SGL+N NIGRNLHLHPV+ AWGYFP+       PE
Sbjct  466   RKLQIEANVTISACGSLCTPPLMISSGLKNRNIGRNLHLHPVLLAWGYFPEHE-----PE  520

Query  1714  PEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFS  1893
              + KSY+GGI+T++ KVV+    +    +I+T  L P  FS + PW S  D+K  M +++
Sbjct  521   FKGKSYEGGIITSLHKVVSG--TANVRTIIETAVLGPATFSTLFPWTSRLDMKDTMDKYA  578

Query  1894  RTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRA  2073
             RTA LFA+ RD+ SG       I Y + + DK +L+ GL + LRIL AAGA E+GT    
Sbjct  579   RTANLFAMVRDRGSGTVKREGRIHYTLDQLDKENLQVGLRQTLRILIAAGAVEVGTYRND  638

Query  2074  GKILKPKGASRDEIDEFVEK------ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVN  2235
             G+ +K KG   ++++EF++        SSR+   L T   SAHQMGSCRMG       V+
Sbjct  639   GQRMKCKGVEEEDLEEFLDTVVAAAGPSSRE--ELWTTYSSAHQMGSCRMGTTEEDGGVD  696

Query  2236  PMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHNHM  2391
               GE+WE +GLF+ D S+ PTA+GVNPM+T+++ AYC ++ + + L+   ++
Sbjct  697   ENGESWEAKGLFVCDGSLLPTAVGVNPMITIESTAYCISKRIAQSLEKQKYI  748



>ref|XP_002967201.1| hypothetical protein SELMODRAFT_87684 [Selaginella moellendorffii]
 gb|EFJ31800.1| hypothetical protein SELMODRAFT_87684 [Selaginella moellendorffii]
Length=724

 Score =   489 bits (1259),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 321/770 (42%), Positives = 439/770 (57%), Gaps = 73/770 (9%)
 Frame = +1

Query  136   MATVTSISDTFLPAVDVPQHAAVDDDSVKL-FFQTSASIAGTPQRVAWMISERLQHPKVI  312
             M  + +I DT +P++  P  A+  D+S K  FF+ SAS +G    VA MI       +  
Sbjct  1     MKVLDAICDTLVPSL--PVEASKQDNSAKAKFFELSASESGIVPEVAGMICAWTTAQQYF  58

Query  313   llrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTF  492
             L+ +A  +LSTR+GTL+L G + ++++FP++Q FP +   KR +I+ +WS      L+  
Sbjct  59    LIYIAFLMLSTRLGTLLLAGFSCVTTEFPFVQPFPLLELGKREKILLNWSRSIFHKLQML  118

Query  493   YLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEE  672
             +  +K   L  F+S+ ++   N +WKAI Y  P+P                     L  E
Sbjct  119   FKVVKCYTLFKFYSRADKKGRNPAWKAIGYEVPEP--------------------VLEHE  158

Query  673   QKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGN-PS  849
                          E L  PL + +++  + P  Q   RL +LG  +   +      N PS
Sbjct  159   -------------EPLPSPLERRLVD-AKAPDFQ--SRLAELGCAMLDKVDHLEERNDPS  202

Query  850   ------FVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDE  1011
                   F I+CD VVVGSGSGG VIA  LA  G KV+VLEKG YF R  LSLLEG S+  
Sbjct  203   TASGKDFGIKCDVVVVGSGSGGSVIAARLAQQGFKVVVLEKGGYFPRRGLSLLEGPSMKA  262

Query  1012  MYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYR  1191
             MY   G + ++D  ++LLAG+ +GGGS +NW+AS++TP HVL EW        FG  EY+
Sbjct  263   MYEQSGALTTEDGSVILLAGTTLGGGSAVNWAASLKTPKHVLDEWTSLGLENRFGGPEYQ  322

Query  1192  HAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDG  1371
             HAME VC R+GVQ    +E FQN VLR+GC E GY V  IPRNA+RDH CG+C FGC   
Sbjct  323   HAMEAVCQRLGVQDGCTEESFQNRVLRRGCTEKGYSVGDIPRNAARDHGCGFCGFGCPAA  382

Query  1372  ---KKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGR-EQAAGVMFVYQNNGAKEF  1539
                +K+   +TWL D   +G  V+   C   ++V   + G+ E++     +    G   F
Sbjct  383   AAVRKQSACDTWLCDAATAG-AVVVTGCRVDRIVTAPQGGQGERSYRARGISSRAGEARF  441

Query  1540  CFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDA---PGSKAWP  1710
              +V+SRVTV ACGAL TP LL+ SG RNP+IGR+L +HPVV AWGYFP     PG+    
Sbjct  442   -YVESRVTVAACGALFTPPLLRRSGGRNPHIGRHLSVHPVVAAWGYFPREDILPGN----  496

Query  1711  EPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRF  1890
                  SY GGIMTA S   A ++ +GYG++++TP +HPG ++ + PW SG D K +M RF
Sbjct  497   -----SYTGGIMTAFSSEAARWDTTGYGSILETPCVHPGNYAVLAPWRSGVDAKRQMLRF  551

Query  1891  SRTAILFALARDKTSG---EAP-SPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIG  2058
              RTA +  L RD+  G   E P     + Y +  +D+ SL  G E  +R L AAGAE +G
Sbjct  552   PRTATIIVLNRDRGRGTVDETPGGKLILDYPLCFSDRESLVEGTELAVRALVAAGAEAVG  611

Query  2059  TCHRAGKILKPKGA-----SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRS  2223
                 AG+I     +        E++ F+++   R    LST I SAHQMGSCRMG D R 
Sbjct  612   LHSVAGEIFSVDQSWTPLQREKELEIFLKRVLGRMFQRLSTPIISAHQMGSCRMGTDQRC  671

Query  2224  SVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
             SVV+P  E+WEVEGLF+ D SV PTA GVNPM+T+Q+IA+ TA  + + L
Sbjct  672   SVVDPNCESWEVEGLFVGDGSVLPTASGVNPMITIQSIAHSTATRIARSL  721



>ref|XP_002960521.1| hypothetical protein SELMODRAFT_74601 [Selaginella moellendorffii]
 gb|EFJ38060.1| hypothetical protein SELMODRAFT_74601 [Selaginella moellendorffii]
Length=724

 Score =   488 bits (1257),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 319/770 (41%), Positives = 441/770 (57%), Gaps = 73/770 (9%)
 Frame = +1

Query  136   MATVTSISDTFLPAVDVPQHAAVDDDSVKL-FFQTSASIAGTPQRVAWMISERLQHPKVI  312
             M  + +I DT +P++  P  A+  D+S K  FF+ SAS +G    VA MI       +  
Sbjct  1     MKVLNAICDTLVPSL--PVEASKQDNSAKAKFFELSASESGIVPEVAGMICAWTTAQQYF  58

Query  313   llrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTF  492
             L+ +A  +LSTR+GTL+L G + ++++FP++Q FP +   KR +I+ +WS      L+  
Sbjct  59    LIYIAFLMLSTRLGTLLLAGFSCVTTEFPFVQPFPLLELGKREKILLTWSRSIFHKLQML  118

Query  493   YLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEE  672
             +  +K   L  F+S+ ++   N +WKAI Y  P+P                     + E 
Sbjct  119   FKVVKCYTLFKFYSRADKKGRNPAWKAIGYEVPEP---------------------VLEH  157

Query  673   QKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGN-PS  849
             Q            E L  PL + +++  + P  Q   RL +LG  +   +      N PS
Sbjct  158   Q------------EPLPSPLERRLVD-AKAPDFQ--SRLAELGCAMLDNVDHLEERNDPS  202

Query  850   ------FVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDE  1011
                   F I+CD VVVGSGSGG VIA  LA  G KV+VLEKG YF R  LSLLEG S+  
Sbjct  203   TASGKDFGIKCDVVVVGSGSGGSVIAARLAQQGFKVVVLEKGGYFPRRGLSLLEGPSMKA  262

Query  1012  MYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYR  1191
             MY   G + ++D  ++LLAG+ +GGGS +NW+AS++TP HVL EW      + FG  EY+
Sbjct  263   MYEQSGALTTEDGSVILLAGTTLGGGSAVNWAASLKTPKHVLDEWTSLGLEDRFGGPEYQ  322

Query  1192  HAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDG  1371
             HAME VC R+GVQ    +E FQN VLR+GC + GY V  IPRNA+RDH CG+C FGC   
Sbjct  323   HAMEAVCQRLGVQDVCTEESFQNRVLRRGCTKKGYSVGDIPRNAARDHGCGFCGFGCPAA  382

Query  1372  ---KKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGR-EQAAGVMFVYQNNGAKEF  1539
                +K+   +TWL D   +G  V+   C   +++   + G+ E++     +    G   F
Sbjct  383   AAVRKQSACDTWLCDAATAG-AVVVTGCRVDRILTAPQGGQGERSYRARGISSRAGEARF  441

Query  1540  CFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDA---PGSKAWP  1710
              +V+SRVTV ACGAL TP LL+ SG RNP+IGR+L +HPVV AWGYFP     PG+    
Sbjct  442   -YVESRVTVAACGALFTPPLLRRSGGRNPHIGRHLSVHPVVAAWGYFPREDILPGN----  496

Query  1711  EPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRF  1890
                  SY GGIMTA S   A ++ +GYG++++TP +HPG ++ + PW SG D K +M RF
Sbjct  497   -----SYTGGIMTAFSSEAARWDTTGYGSILETPCVHPGNYAVLAPWRSGVDAKRQMLRF  551

Query  1891  SRTAILFALARDKTSG---EAP-SPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIG  2058
              RTA +  L RD+  G   E P     + Y +  +D+ SL  G E  +R L AAGAE +G
Sbjct  552   PRTATIIVLNRDRGRGTVDETPGGKLILEYPLCFSDRESLVEGTELAVRALVAAGAEAVG  611

Query  2059  TCHRAGKILKPKGA-----SRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRS  2223
                 AG+I     +        E++ F+++   R    LST I SAHQMGSCRMG D R 
Sbjct  612   LHSVAGEIFSVDQSWTPLQREKELEIFLKRVLGRMFQRLSTPIISAHQMGSCRMGTDQRC  671

Query  2224  SVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
             SVV+P  E+WEVEGLF+ D SV PTA GVNPM+T+Q+IA+ TA  + + L
Sbjct  672   SVVDPNCESWEVEGLFVGDGSVLPTASGVNPMITIQSIAHSTATRIARSL  721



>ref|XP_004296386.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Fragaria vesca 
subsp. vesca]
Length=765

 Score =   489 bits (1258),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 316/774 (41%), Positives = 457/774 (59%), Gaps = 66/774 (9%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDD---------DSVKLFFQTSASIAGTPQRVA  273
             LS   M  + S+ +  LP +     A+  +          +V+ F+Q S + +G P  VA
Sbjct  27    LSSGEMEALASVCEALLPPLPFGDPASYYEGKNEELSGTKAVQSFYQASGAQSGIPDEVA  86

Query  274   WMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVR  453
              ++ +R     +IL+R+ LW+LSTR+G+L+LCG   L  ++P++  F  +   KR  +++
Sbjct  87    DLLVKRAFTEAIILVRVVLWILSTRLGSLLLCGSLCLGDKWPFIHKFSCLPLEKRERVLQ  146

Query  454   SW-SCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDY-CGPDPDSNKKPAGKS  627
              W    ++  ++  +L +K++ + +FFS+V+EN EN +WKAI Y   P  +  K P  +S
Sbjct  147   WWFRHWFLTPIRLAFLYIKILCVFTFFSRVDENAENPAWKAIGYEVEPAANPEKVPEERS  206

Query  628   KKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFP  807
                                               LHKG+I    +    + D L   G  
Sbjct  207   ----------------------------------LHKGIIETMYQTDTSLLDSLADKGLK  232

Query  808   VSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsl  987
             V+       S N  + I+CD V+VGSG GGGV A VLA++G KV+VLEKG YF  S  S 
Sbjct  233   VT-----HDSKNNLYKIKCDVVIVGSGCGGGVAAAVLASSGQKVIVLEKGNYFTASDYSS  287

Query  988   legsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLE  1167
             LEG S D++Y  GG++A+ D  ++L AGS VGGGS +NWSA I+ P  +L+EW +  K+ 
Sbjct  288   LEGPSQDQLYESGGILATFDGKVMLQAGSTVGGGSAVNWSACIRPPDSLLQEWAKDQKIA  347

Query  1168  LFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGW  1347
              FG  EY  AM  V  R+GV     +EGFQN VLRKGC  LG  V   PRN+S  HYCG 
Sbjct  348   FFGGSEYVSAMNAVWERIGVTESCVEEGFQNQVLRKGCETLGLDVHFTPRNSSEKHYCGS  407

Query  1348  CSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNK--KTG---REQAAGVMFV  1512
             C +GCK G+KKGT  TWL D VD G  VI   C+A + V  K  K+G   +++  GV+  
Sbjct  408   CGYGCKKGEKKGTDTTWLVDAVDHG-AVILSGCKAERFVLAKSYKSGSMRKKKCLGVVAK  466

Query  1513  YQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAP  1692
               +N   +   ++++VT+ ACGAL TP L+ +SGL+N +IGRNLHLHPV+ AWGYFPD+ 
Sbjct  467   SLSNNITKRLQIEAKVTISACGALLTPPLMISSGLKNRHIGRNLHLHPVLMAWGYFPDSI  526

Query  1693  GSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIK  1872
              S    E + KSY+GGI+T++ +VV+  E+S   A+I+TP+L PG F+A+ PW SG D+K
Sbjct  527   NS----EFKGKSYKGGIITSVHEVVS--EDSKPRAIIETPALGPGSFAALCPWESGLDMK  580

Query  1873  TRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEE  2052
              RM RFSRTA L  + RDK SG   +    SY +  +DK ++K G+ + LRIL AAGA E
Sbjct  581   KRMLRFSRTAHLITIIRDKGSGVIRTEGRASYELDVSDKENMKAGMRQALRILIAAGAVE  640

Query  2053  IGTCHRAGKILKPKGASRDEIDEFVEKESSRD----LGNLSTLIGSAHQMGSCRMGVDPR  2220
             +GT    G  LK +G  ++ ++EF++K S+ +    L    T   SAHQMGSCRMG++ +
Sbjct  641   VGTHRSDGLRLKCEGIDKEGLEEFLDKVSAEEGPQSLVEKWTPYSSAHQMGSCRMGINEK  700

Query  2221  SSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTH  2382
                V+  GE+WE EGLF+ D SV P+A+GVNPM+T+++ AY  ++ + + L+  
Sbjct  701   EGAVDQNGESWEAEGLFVCDGSVLPSAVGVNPMITIESTAYYLSKRLAESLRNQ  754



>ref|XP_009369441.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Pyrus x bretschneideri]
Length=746

 Score =   488 bits (1256),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 303/771 (39%), Positives = 450/771 (58%), Gaps = 64/771 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAV---DVPQ-HAAVDDDSVKLFFQTSASIAGTPQRVAWMISE  288
              S A + ++++I +  LP +   D+P  H  +   S   +   SAS    P  VA ++ +
Sbjct  25    FSSAQIQSLSAICEALLPPISPEDIPDDHNPLHSSSS--YCTASASQPPIPDEVAELMVK  82

Query  289   RLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS-C  465
             R     V  +R+ L +LS R+GT +LCGK     ++ ++  F E+S  KR ++++ WS  
Sbjct  83    RTLPEVVGGVRVFLKMLSLRLGTFLLCGKCCFDWKWTFIDKFSEMSLDKREQVLKKWSRQ  142

Query  466   CYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITR  645
               +  ++  ++ +K+     FFS+V+EN+ N +WKAI Y                  + R
Sbjct  143   KSVITIRLMFMVIKMFCFYIFFSRVDENSRNPAWKAIGY-----------------ELDR  185

Query  646   EQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQ  825
             ++ +  + +Q+                PL KG+I    E    + + L K G  ++    
Sbjct  186   KEKLIKTPKQR----------------PLEKGIIETAYESDSTLVESLTKKGLDLT----  225

Query  826   QKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegssl  1005
                + N    I+CD V+VGSG GGGV A VLA +G KV+VLEKG YF     S LEG S+
Sbjct  226   -DDAVNNIHKIKCDVVIVGSGCGGGVAAAVLARSGQKVVVLEKGNYFVPKDYSSLEGPSM  284

Query  1006  DEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKE  1185
             +E+Y  GG+++S D  +++LAGS VGGGS +NWSASI+TP +VL++W   HK+ L+ S++
Sbjct  285   NELYESGGIMSSVDGMVMILAGSTVGGGSAVNWSASIKTPDNVLRDWSVDHKIPLYASED  344

Query  1186  YRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCK  1365
             Y+ AM+ VC R+GV     +E F N +LRKGC  LG  V+ +PRN+S DHYCG+C++GC 
Sbjct  345   YKSAMDIVCKRIGVTESCTEENFPNQILRKGCENLGLKVDAVPRNSSADHYCGFCNYGCP  404

Query  1366  DGKKKGTSETWLADLVDSGNGVIFPECEAVK-VVHNKKTG--REQAAGVMFVYQNNGAKE  1536
              G KKGT  TWL D V  G  VI   C+A K ++ N   G  R+Q  GV     +   K 
Sbjct  405   TGDKKGTDSTWLVDAVKFG-AVILTGCKAEKFILENDNEGGIRKQCLGVQATSLSKNIKR  463

Query  1537  FCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEP  1716
                +++ VT+ ACG+LCTP L+ +SGL+N NIGRNLHLHPV+ AWGYFP+       PE 
Sbjct  464   KLQIEANVTISACGSLCTPPLMISSGLKNRNIGRNLHLHPVLLAWGYFPEHE-----PEF  518

Query  1717  EKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSR  1896
             + KSY+GGI+T++ KVV+    +    +I+T  L P  FS + PW S  D+K  M +++R
Sbjct  519   KGKSYEGGIITSLHKVVSG--TANVRTIIETAVLGPATFSTLFPWTSRLDMKDTMDKYAR  576

Query  1897  TAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAG  2076
             TA LFA+ RD+ SG       I Y + + DK +L+ GL + LRIL AAGA E+GT    G
Sbjct  577   TANLFAMVRDRGSGTVKREGRIHYTLDQLDKENLQVGLRQTLRILIAAGAVEVGTYRNDG  636

Query  2077  KILKPKGASRDEIDEFVEK------ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNP  2238
             + +K KG   ++++EF++        SSR+   L T   SAHQMGSCRMG       V+ 
Sbjct  637   QRMKCKGVEEEDLEEFLDTVVAAAGPSSRE--ELWTTYSSAHQMGSCRMGTTEEDGGVDE  694

Query  2239  MGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHNHM  2391
              GE+WE +GLF+ D S+ PTA+GVNPM+T+++ AYC ++ + + L+   ++
Sbjct  695   NGESWEAKGLFVCDGSLLPTAVGVNPMITIESTAYCISKRIAQSLEKQKYI  745



>gb|EPS66779.1| hypothetical protein M569_07992, partial [Genlisea aurea]
Length=724

 Score =   487 bits (1253),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 299/764 (39%), Positives = 441/764 (58%), Gaps = 71/764 (9%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
              S + + ++ +I  T +P +    + A    S   FF + +      + VA ++ +R   
Sbjct  19    FSSSQIQSLAAICQTLIPPLADHGNKAAPHSS---FFDSPSG----SEEVAELLVKRGVP  71

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFP-YLQSFPEISPHKRAEIVRSWS---CC  468
               V ++ L LW+LSTR+GTL+LCG   L  + P +L +F E+   KR  +++ WS     
Sbjct  72    QAVFVVGLVLWVLSTRLGTLLLCGFTCLDWRSPPFLPTFSELQLSKREAVLQRWSRQGGT  131

Query  469   YIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITRE  648
             ++ +  TF L +K+M   +FFS+ +EN++N +W++I Y    P   ++P  +        
Sbjct  132   FLPLRITFLL-VKIMSFFTFFSRTDENSQNPAWESIGYHIETPVVVERPLQRR-------  183

Query  649   QHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQ  828
                                       PL  G+I    E        L++ G  V   I +
Sbjct  184   --------------------------PLQNGIIETITE------SSLRQKGLRV---ITE  208

Query  829   KGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslD  1008
             +   +    ++CD VVVGSG GG V A +LA +GHKV+VLEKG YFA    S LEG SL 
Sbjct  209   EDDDDDYLNVDCDVVVVGSGCGGSVAAAILAKSGHKVVVLEKGHYFAAQDYSGLEGPSLS  268

Query  1009  EMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEY  1188
             E+Y  G ++++   +++++AGS VGGGS INWSA I+TP H+L EW +TH L L+ ++EY
Sbjct  269   ELYESGAVLSTLGGELMIMAGSTVGGGSAINWSACIRTPDHILDEWSKTHNLPLYRTREY  328

Query  1189  RHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKD  1368
             + AM+ VC R+GV    ++EGFQN VLR+GC  LG  V+++PRN+  DHYCG C +GC+ 
Sbjct  329   QSAMDAVCERIGVTDACDEEGFQNQVLRRGCESLGLKVDSVPRNSPSDHYCGSCGYGCRR  388

Query  1369  GKKKGTSETWLADLVDSGNGVIFPECEAVKVV----HNKKTGREQAAGVMFVYQNNGAKE  1536
             G K+G   TWL D VD+ + VI   C+A + +     N+KT R++  GV+   +N   K 
Sbjct  389   GAKRGADSTWLVDAVDN-SAVIMTGCKAERFILAKDENEKT-RKRCIGVIATAENIEKK-  445

Query  1537  FCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEP  1716
                + +RVT+ ACG+L TP LL +SGL+N NIGRNLHLHPV F WGYFP+          
Sbjct  446   -LKINARVTISACGSLSTPPLLISSGLKNKNIGRNLHLHPVSFIWGYFPETD-----TRL  499

Query  1717  EKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSR  1896
             +  SY+GGI+T++ KV +   +    A+++  SL PG FS++ PW S  ++  RM+++SR
Sbjct  500   KGTSYEGGIITSIHKVQSEERKPAVQAIVEAASLGPGAFSSLFPWTSRNNMDDRMRKYSR  559

Query  1897  TAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAG  2076
             TA+LF L RD+ SGE      I Y + + DK +LK G+ + LRIL AAGA E GT    G
Sbjct  560   TAVLFTLVRDEGSGEVKKLKQIQYKLSEVDKENLKTGMRRALRILIAAGATEAGTFRSDG  619

Query  2077  KILKPKGASRDEIDEF----VEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMG  2244
             + +  KG + D ++EF    V  +  R       + GSAHQMGSCRMG +     V+  G
Sbjct  620   QRIWCKGTNDDAVEEFLDTVVAADGPRTKSMFWNIYGSAHQMGSCRMGRNEDEGAVDERG  679

Query  2245  ETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             E+WE +GLF+ D S+ PTA+GVNPMV++ A AYC A  + + +K
Sbjct  680   ESWEAKGLFVCDGSLLPTAVGVNPMVSILATAYCVANRIAESMK  723



>gb|KHG12235.1| Long-chain-alcohol oxidase FAO1 [Gossypium arboreum]
Length=748

 Score =   487 bits (1254),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 309/787 (39%), Positives = 453/787 (58%), Gaps = 68/787 (9%)
 Frame = +1

Query  52    GDSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVD-------D  210
             G      GK E      Y  G   S A + T+ +I++   P++  P     +        
Sbjct  6     GKGFMKGGKIEEIEGKKYDHG--FSSAEVNTLAAIAEALFPSLP-PSSCCFERRENQTIS  62

Query  211   DSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSS  390
              +V+ F +TSAS +  P   A M+ +RL    V+++R+ L LLST++GTL+LCG      
Sbjct  63    KAVRSFMETSASQSPFPDEAAEMLWKRLFIECVVVVRVVLLLLSTKVGTLLLCGSHCWGK  122

Query  391   QFPYLQSFPEISPHKRAEIVRSW-SCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISW  567
             ++PY+  F  +   KR +++++W    +    +  +L  KV +L   FS+V+EN EN +W
Sbjct  123   EWPYINGFTSMPLAKREQVLQAWFKHRFFTPFRVAFLYFKVAILFIIFSRVDENGENPAW  182

Query  568   KAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVI  747
             +AI Y   D   N       ++ I    H+           D I ++  L      KG +
Sbjct  183   EAIGY-NIDKVENVPNERPLQQGIVETMHVI----------DSIDLHKLLT----EKG-L  226

Query  748   NLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANA  927
              + Q+P +                            I+CDAV+VGSG GGGV A  LA++
Sbjct  227   QVTQDPHKNAIK------------------------IKCDAVIVGSGCGGGVAAATLASS  262

Query  928   GHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWS  1107
             G KV+VLEKG YF  +  S  EG S++++Y  GG + S D    +LAGS VGGGS +NWS
Sbjct  263   GLKVVVLEKGSYFGPADYSPFEGPSMEKLYELGGSLPSIDGQFAILAGSTVGGGSAVNWS  322

Query  1108  ASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLE  1287
             A I+TP  VLKEW +  K+ +FGS EY  AM+ VC R+GV  + E+EGFQN+VL KGC  
Sbjct  323   ACIKTPESVLKEWTDECKIPVFGSNEYVSAMDIVCERIGVTEDCEEEGFQNLVLCKGCKN  382

Query  1288  LGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVH  1467
             LG+ +E +PRN+S  HYCG C FGC+ G KKGT +TWL D V++G  VI   C+A K + 
Sbjct  383   LGFDIEKVPRNSSSRHYCGSCGFGCRRGDKKGTDKTWLVDAVNNGT-VILTACKAEKFML  441

Query  1468  NKKTG-----REQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNI  1632
              + T      + +  GV+    N    +   ++++VT+ ACGAL TP L+ +SGL+NPNI
Sbjct  442   EQNTTMISTRKMKCTGVIATTFNKNITKKLQIEAKVTISACGALHTPLLMYSSGLKNPNI  501

Query  1633  GRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTP  1812
             GRNL LHPV+ +WGYFPD+       + E K+  GGI+T++ KV+     +   A+I+TP
Sbjct  502   GRNLRLHPVLMSWGYFPDSD-----SDIEGKAVDGGIITSVHKVLG--PNNNVQAIIETP  554

Query  1813  SLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKV  1992
             SL PG ++A+ PW+SG D K RM +FSRTA L  + +D+ SGE      ++Y    TD+ 
Sbjct  555   SLGPGQYTALCPWVSGLDFKQRMLKFSRTAHLITIVKDRGSGEVHMGGRVTYKFDATDRE  614

Query  1993  SLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRD----LGNL  2160
             +L+ GL + LR+L AAGA E+GT    G+ LK KG S++E++EF++   S       G+ 
Sbjct  615   NLRAGLRRSLRVLVAAGAVEVGTHRSDGQKLKCKGVSKEELEEFLDTVFSVGGPLFGGDK  674

Query  2161  STLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIA  2340
               +  +AHQMGSC+MG + +   V+  GE+WE EGL++ D+SV PTA+GVNPM+TV + A
Sbjct  675   WMVHTTAHQMGSCKMGRNEKDGGVDENGESWEAEGLYVCDASVLPTAIGVNPMITVMSTA  734

Query  2341  YCTAQSV  2361
             YC ++ +
Sbjct  735   YCLSKRI  741



>ref|XP_006283182.1| hypothetical protein CARUB_v10004212mg [Capsella rubella]
 gb|EOA16080.1| hypothetical protein CARUB_v10004212mg [Capsella rubella]
Length=754

 Score =   488 bits (1255),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 316/795 (40%), Positives = 447/795 (56%), Gaps = 69/795 (9%)
 Frame = +1

Query  52    GDSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFF  231
             G  L  + K E    G Y+ G   SP+ + ++ +I  T LP  D          S   F 
Sbjct  14    GHPLLRSKKREEEQVGYYNHG--FSPSQIHSLAAICQTLLPPSD--------QQSFDSFN  63

Query  232   QTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQS  411
               S++       VA MI +  +   V +LR+ L +LS R GTL+LCG   L   +P++  
Sbjct  64    VASSTQPPFTDEVAEMIVKNGRSEAVKVLRIILMILSFRFGTLLLCGSLCLDKSWPFVLK  123

Query  412   FPEISPHKRAEIVRSWS---CCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDY  582
             F E+   +R EI+R WS      +    TF+L  K   L  FFSQ +EN +N + +AI Y
Sbjct  124   FSELPLDRREEILRKWSRKSGFLLPFRITFFLS-KFYTLFYFFSQTDENQKNPALEAIGY  182

Query  583   C--GPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLN  756
                  D  SNKK               T ++E+++               PL +G++   
Sbjct  183   SLDTADASSNKK---------------TEADEKRR---------------PLQRGIVETM  212

Query  757   QEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHK  936
              E    +   L + G  V+     K  G     I CDAVVVGSGSGGGV A  LA AG K
Sbjct  213   HESDITITQTLTEKGVYVA-----KDDGENVHRIRCDAVVVGSGSGGGVAAANLAKAGLK  267

Query  937   VLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASI  1116
             VLVLEKG YFA    S LEG S+ E+Y  GG + S D   ++LAGS VGGG+ INWSASI
Sbjct  268   VLVLEKGNYFAAQDYSGLEGPSMLELYEKGGFLTSVDGKFMILAGSAVGGGTAINWSASI  327

Query  1117  QTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGY  1296
             +TP HVL+EW E  K++ FGS+EY+ AM+ V +R+GV  +   +GFQN VLRKGC  LG 
Sbjct  328   RTPDHVLQEWSEESKIKFFGSQEYKTAMDEVTTRIGVTDKCVKDGFQNQVLRKGCERLGL  387

Query  1297  PVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVV----  1464
              VE++PRN+  DHYCG C +GC+ G K GT +TWL D V++G  VI    +A + +    
Sbjct  388   QVESVPRNSHEDHYCGLCGYGCRAGDKNGTDQTWLVDAVENG-AVILTGIKAERFILVDN  446

Query  1465  HNKKTGREQAAGVMFVYQNNGAK--EFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGR  1638
              +  +   Q   V  +  + G K  +   +++RVTV + G+L TP L+ +SGL+N NIGR
Sbjct  447   TDSSSNERQKRCVGVIASSVGGKIGKKFMIEARVTVSSAGSLLTPPLMLSSGLKNQNIGR  506

Query  1639  NLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSL  1818
             NL LHPV+  WGYFP+        E   K Y+GGI+T++  +  N  ESG  A+++ P +
Sbjct  507   NLTLHPVLMTWGYFPEKD-----SEFSGKMYEGGIITSLHHM--NDAESGCKAILENPLI  559

Query  1819  HPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSL  1998
              P  ++ + PW+SG D+K RM +++RTA LFAL RD  SGE      I+Y   K D+ +L
Sbjct  560   GPASYAGLSPWVSGADLKERMMKYARTAHLFALVRDIGSGEVMKENEITYRTTKKDRENL  619

Query  1999  KNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLST  2166
             + GL + LR+L AAGA E+GT    G+ +K +G SR+ I+EF+++  +       G   T
Sbjct  620   RAGLRQALRVLIAAGAAEVGTYRSDGQRIKCEGTSREAIEEFLDEVDAVGGVSTKGEYWT  679

Query  2167  LIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYC  2346
                SAHQM SCRMG       ++  GE++E EGLF+ D SV P+A+GVNPM+T+Q+ AYC
Sbjct  680   TYFSAHQMSSCRMGATAEEGALDENGESFEAEGLFVCDGSVLPSAVGVNPMITIQSTAYC  739

Query  2347  TAQSVLKFLKTHNHM  2391
              +  ++  L++ + +
Sbjct  740   ISTRIVDSLQSKDKV  754



>sp|B5WWZ9.1|FAO2_LOTJA RecName: Full=Long-chain-alcohol oxidase FAO2; AltName: Full=Long-chain 
fatty alcohol oxidase 2 [Lotus japonicus]
 emb|CAP15763.1| long chain fatty alcohol oxidase FAO2 [Lotus japonicus]
Length=750

 Score =   487 bits (1254),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 317/789 (40%), Positives = 461/789 (58%), Gaps = 71/789 (9%)
 Frame = +1

Query  76    KAERGNDGVYSGGCPLSPAVMATVTSISDTFLPA--VDVPQHAAVDDDSVKLFFQTSASI  249
             K  R  +  YS G  LS + M  + +I +   P+  +D   + +  D ++  F+  S S 
Sbjct  14    KGGRRKEKGYSHG--LSSSQMHVIAAICEALFPSQPLDSQNNQSSVDKALSAFYTASGSQ  71

Query  250   AGTPQRVAWMISE-RLQHPKVIllrl-alwllSTRIGTLMLCGKASLSSQFPYLQSFPEI  423
             A  P   A ++ +     P+ + L    L +LS R+GTL+LCG   L  ++P++  F EI
Sbjct  72    APLPDEAAELLFKFNRSFPEALSLVSWVLLILSFRLGTLLLCGTLCLDWRWPFIHKFSEI  131

Query  424   SPHKRAEIVRSWS--CCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDP  597
                KR EI++ WS   C+I +   F L  K++   + FS+ + N  N  WKAI Y     
Sbjct  132   PLEKREEILKRWSREKCWIPLRLVFVL-TKLVCFYNLFSRADVNGHNPIWKAIGY-----  185

Query  598   DSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQV  777
                        +  TRE+   L+++++                PL +G+I    E    +
Sbjct  186   -----------QVDTREK---LTQKKR----------------PLQEGLIETMYETDSTL  215

Query  778   FDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKG  957
                L + G  V+  ++Q       + I+CDAV+VGSG GGGV A VLAN+GHKV++LEKG
Sbjct  216   IQSLTEKGLEVTEDLEQN-----MYKIKCDAVIVGSGCGGGVAAAVLANSGHKVIILEKG  270

Query  958   KYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVL  1137
             +YF     S LEG S++E+Y  GG++ S D  +++LAGS +GG S INWSA I+TP  VL
Sbjct  271   EYFVSHDYSSLEGPSMNELYESGGILPSLDGKMMILAGSTLGGXSAINWSACIRTPDSVL  330

Query  1138  KEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPR  1317
             +EW E HK+ LF S +Y+ AM+TVC R+GV      E FQN +LR+GC ++G+ VE +  
Sbjct  331   REWSEKHKIPLFASPDYQSAMDTVCRRIGVTENCNKESFQNQILRQGCAKIGFKVEPVAI  390

Query  1318  NASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTG-----  1482
             N+S DHYCG C +GC+ G KKGT  TWL D V +G  VI   C+A K+    K G     
Sbjct  391   NSSADHYCGSCCYGCRTGDKKGTESTWLVDAVGNG-AVILTGCKAEKLNFTLKDGDNGTK  449

Query  1483  REQAAGVM--FVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHP  1656
             R+  +GV+    +++   K+   ++S+VT+ ACG+L TP L+ +SGL+NPNIG+NLHLHP
Sbjct  450   RKTCSGVIASATWRSKVTKKL-QIESKVTISACGSLSTPPLMISSGLKNPNIGKNLHLHP  508

Query  1657  VVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFS  1836
               FAWGYFP+   + +       +Y+GGI+T++ KV      S    +I+ P+L PG FS
Sbjct  509   CQFAWGYFPEDMTNFS-----GNNYEGGIITSIHKVFEEDSTSTPRIIIEAPALGPGSFS  563

Query  1837  AIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEK  2016
             A++PW+SG D+K RM +++RTA LFAL RD  SGE  +   ISY + K D+ SL+ GL K
Sbjct  564   ALVPWVSGLDVKERMVKYARTANLFALVRDHGSGEVKAEGRISYKLDKIDRESLQTGLRK  623

Query  2017  VLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLS------TLIGS  2178
              LRIL AAGA E+GT    G+ +K +G    +++EF+  +S R +G  S      T+  S
Sbjct  624   ALRILVAAGAVEVGTYRSDGQRIKCRGIKESDLEEFL--DSVRVVGGPSSRNEVWTVFTS  681

Query  2179  AHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQS  2358
             AHQM SCRM        V+  GE+WE +GL++ D SV P+A+GVNPM+T+Q+ AYC A +
Sbjct  682   AHQMTSCRMSATEEEGAVDENGESWEAKGLYVCDGSVLPSAVGVNPMITIQSTAYCIASN  741

Query  2359  VLKFLKTHN  2385
             + + LK  N
Sbjct  742   IAESLKKQN  750



>ref|XP_003571871.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Brachypodium 
distachyon]
Length=786

 Score =   488 bits (1256),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 301/793 (38%), Positives = 443/793 (56%), Gaps = 75/793 (9%)
 Frame = +1

Query  91    NDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDS--------VKLFFQTSAS  246
              +G Y+ G  + PA M  + +I   F+P++   + A     +        ++ F+  SA+
Sbjct  31    REGKYTHG--MHPAQMEALRAICGAFIPSMPAEEAAGAGGRADPPPGGKDLERFYLASAA  88

Query  247   IAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQ-------FPYL  405
              +  P  VA ++  R     V+L  + LW+LSTR+GTL+LCG+ SLS         FP +
Sbjct  89    DSTIPDEVAELMVTRCIREAVLLAWVVLWVLSTRVGTLLLCGRLSLSFSGGARDFSFPCV  148

Query  406   QSFPEISPHKRAEIVRSW-SCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDY  582
               F ++   +R   ++ W S  ++  L+  +  +K++    F++ VNE +EN  WKAI Y
Sbjct  149   SRFADMPVARREAALQRWNSTRWLLPLRIVFTLVKILSHYVFYAMVNEKSENPHWKAIGY  208

Query  583   CGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQE  762
                                       + + + +  +D    +P     PL  GV+     
Sbjct  209   -------------------------RVDKRRTEQADDAAAKSPSPSR-PLDSGVVETRAL  242

Query  763   PRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVL  942
                 +   L   G  VS       S      ++CDAV+VGSG GGGV A +LA+AG KV+
Sbjct  243   NDTTLLRSLADRGLAVS-------SDARHHTVQCDAVIVGSGCGGGVAAAMLASAGLKVV  295

Query  943   VLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQT  1122
             VLEKG YF     S +EG S++ ++  GG+  + ++  ++  GS VGGGS +NWSASI+T
Sbjct  296   VLEKGDYFTAEDYSSVEGPSMERLFEKGGIFCTSNVTTMVFTGSTVGGGSAVNWSASIRT  355

Query  1123  PPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPV  1302
             P  VL+EW + H L +FGS  Y  AM+ VCSR+ V     +EGFQN V+R+GC  LG PV
Sbjct  356   PGTVLQEWSQEHGLPVFGSDGYVQAMDAVCSRLAVTDACLEEGFQNKVVRRGCEALGLPV  415

Query  1303  ETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKT-  1479
             + +PRN+S  HYCG C+FGC  G K+GT  TWL D V+ G  VI   C+A + +    T 
Sbjct  416   DAVPRNSSAGHYCGSCNFGCPTGDKRGTDTTWLVDAVEHG-AVILTGCKADRFILESNTA  474

Query  1480  ---GREQA------AGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNI  1632
                G++ A       G++    +NG  +   +++RV++ ACGAL TP LL+NSGLRN +I
Sbjct  475   DTGGKDNARRSKKCVGLVATCMSNGITKKLRIEARVSISACGALMTPPLLRNSGLRNRHI  534

Query  1633  GRNLHLHPVVFAWGYFPDAP-GSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQT  1809
             GRNLHLHPV  AWGYF D    +        KSY+GGI+T+M ++           +++T
Sbjct  535   GRNLHLHPVSMAWGYFSDNKLPTSGQTIITGKSYEGGIITSMHRITDR-------TIVET  587

Query  1810  PSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDK  1989
             P+L PG F+A++PW SG D+K RM+R++RTA  FAL RD+ +G       + +   + D 
Sbjct  588   PALSPGAFAAMVPWESGRDMKERMRRYARTAHAFALVRDRGAGFVDCEGRLRFTPSRDDT  647

Query  1990  VSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEF-----VEKESSRDLG  2154
               L+NGL +VLRIL AAGA E+GT    G  L+ KG   ++++ F     +EK       
Sbjct  648   DELRNGLRRVLRILVAAGAAEVGTHRSDGLRLRCKGVRDEDLEAFLDEVTIEKGPMHSTT  707

Query  2155  NLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQA  2334
             +   L  SAHQMGSCRMG  PR   V+  GE+WE EGL++ D S+ PTA+GVNPM+T+Q+
Sbjct  708   DKWALFSSAHQMGSCRMGSSPREGAVDGSGESWEAEGLYVCDGSLLPTAVGVNPMITIQS  767

Query  2335  IAYCTAQSVLKFL  2373
             +AYC ++ + + L
Sbjct  768   VAYCLSKDIAQAL  780



>gb|AAM63097.1| unknown [Arabidopsis thaliana]
Length=748

 Score =   485 bits (1249),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 305/766 (40%), Positives = 435/766 (57%), Gaps = 63/766 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
              SP+ + ++  I  TFLP     +  AV+      F   S++       VA MI +  + 
Sbjct  27    FSPSQIQSLAVICQTFLPPETTSEQQAVNS-----FHVASSTQPPFTDEVAEMIVKNGRS  81

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS---CCY  471
               V +LR+ L +LS R GTL+LCG   L   +P++  F ++   KR  I+R+WS      
Sbjct  82    EAVKVLRIILMILSFRFGTLLLCGSLCLDKSWPFVLKFSQLPLDKREAILRNWSRQSGFL  141

Query  472   IKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYC--GPDPDSNKKPAGKSKKWITR  645
             +    TF+L  K   L  FFSQ +EN +N + +AI YC  G +  SNKK     K+    
Sbjct  142   LPFRITFFLA-KFYTLFYFFSQTDENLKNPALEAIGYCIDGTERSSNKKSEADEKRR---  197

Query  646   EQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQ  825
                                        PL KG+I    E    +   L + G  V+    
Sbjct  198   ---------------------------PLEKGIIETMHESDLTITQSLTEKGVHVA----  226

Query  826   QKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegssl  1005
              +  G+  + I CDAVVVGSGSGGGV A  LA AG KVLVLEKG YF     S LE  S+
Sbjct  227   -RDDGDNVYRIRCDAVVVGSGSGGGVAAANLAKAGLKVLVLEKGNYFTAHDYSGLEVPSM  285

Query  1006  DEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKE  1185
              E+Y  GGL+ + D   +LLAGS VGGG+ +NWSASI+TP HVL+EW E  K++ FGS+E
Sbjct  286   LELYEKGGLLTTVDGKFMLLAGSAVGGGTAVNWSASIRTPDHVLQEWSEGSKIKFFGSQE  345

Query  1186  YRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCK  1365
             Y+ AM+ V  R+GV       GFQN VLRKGC  LG  VE++PRN+  DHYCG C +GC+
Sbjct  346   YQSAMDEVTIRIGVTERCVKHGFQNQVLRKGCERLGLQVESVPRNSPEDHYCGLCGYGCR  405

Query  1366  DGKKKGTSETWLADLVDSGNGVIFP-ECEAVKVVHNKKTGREQAAGVMFVYQNNG----A  1530
              G K GT +TWL D V++G  ++   + E   +V N  +  E+    + V+ ++      
Sbjct  406   AGAKNGTDQTWLVDAVENGAVILTGIKAERFVLVDNTSSSNERKKRCVGVFASSVGGKIG  465

Query  1531  KEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWP  1710
             K+F  +++RVTV + G+L TP L+ +SGL+NPNIGRNL LHPV+  WGYFP+        
Sbjct  466   KKF-IIEARVTVSSAGSLLTPPLMLSSGLKNPNIGRNLKLHPVLMTWGYFPEKD-----S  519

Query  1711  EPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRF  1890
             E   K Y+GGI+T++  +  N  ESG  A+++ P + P  ++ + PW+SG D+K RM ++
Sbjct  520   EFSGKMYEGGIITSVHHM--NDTESGCKAILENPLIGPASYAGLSPWVSGPDLKERMIKY  577

Query  1891  SRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHR  2070
              RTA LFAL RD  SGE      ++Y   K D+ +L+ GL + LR+  AAGA E+GT   
Sbjct  578   GRTAHLFALVRDLGSGEVMMENEVTYRTTKKDRENLRAGLRQALRVSVAAGAVEVGTYRS  637

Query  2071  AGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNP  2238
              G+ +K +  +++ ++EF+++  +       G   T   SAHQMGSCRMGV      ++ 
Sbjct  638   DGQKMKCEAITKEAMEEFLDEVDAVGGVGTKGEYWTTYFSAHQMGSCRMGVTAEEGALDE  697

Query  2239  MGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
              GE+WE EGLF+ D S+ P+A+GVNPM+T+Q+ AYC +  ++  L+
Sbjct  698   NGESWEAEGLFVCDGSILPSAVGVNPMITIQSTAYCISSKIVDSLQ  743



>ref|XP_010532671.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Tarenaya hassleriana]
Length=741

 Score =   485 bits (1248),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 299/765 (39%), Positives = 452/765 (59%), Gaps = 62/765 (8%)
 Frame = +1

Query  136   MATVTSISDTFLPAVDVPQHAAVDDD------SVKLFFQTSASIAGTPQRVAWMISERLQ  297
             M ++ ++ +T LP +  P+++  D+D      +++ F+  S S +    + A +I++R  
Sbjct  21    MESLAAVCETILPPLS-PEYSNTDEDDHPNKEALRSFYSGSGSQSHVLHQAAELITKRGL  79

Query  298   HPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYI-  474
                V+++RL L LLS+R+GTL+LCG   L   +P+++ F  +S  KR  +++ W    I 
Sbjct  80    IEVVLVMRLVLVLLSSRLGTLVLCGTHCLVPNWPFVERFGSLSLEKRERVLQKWFRSKIL  139

Query  475   KILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQH  654
               ++  ++ +K++ L  FFS VN N EN +W+AI Y                     + +
Sbjct  140   AAIRVAFVHIKIVFLFCFFSWVNTNGENPAWEAIQY---------------------QVN  178

Query  655   MTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKG  834
             +  SE     +E            PL KG++   +E    + + L + G  V+      G
Sbjct  179   LEESESSNILKER-----------PLEKGMVETVKETDSTLPESLSEKGLEVT-----SG  222

Query  835   SGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEM  1014
             S +    I+CD V++GSGSGGGV A VLA++  KV++LEKG+YFA S  S  EG   D++
Sbjct  223   SNHDPIKIKCDVVIIGSGSGGGVAAAVLASSDLKVVILEKGRYFAPSEYSPFEGHGFDQL  282

Query  1015  YLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRH  1194
             Y  GG++ + D + +++AG+ VGGGS ++WSA I+TP  VL+EW + H++  FG++EY  
Sbjct  283   YESGGVLPTLDGNAMIIAGATVGGGSAVSWSACIKTPESVLQEWVKDHRIPFFGTQEYVS  342

Query  1195  AMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGK  1374
             AM+ VC R+GV     +E FQN VLRKGC  LG  VE +PRN+S +HYCG C +GC+ G 
Sbjct  343   AMDAVCKRIGVTYRCNEESFQNQVLRKGCHNLGLKVENVPRNSSENHYCGSCCYGCRQGD  402

Query  1375  KKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQAA------GVMFVYQNNGAKE  1536
             KKG+  TWL D V+ G  V+   C+A +++  K   R   A      GVM    N     
Sbjct  403   KKGSDRTWLLDAVNHG-AVVLTGCKAERLILEKNMNRGVGAKKMKCLGVMAKCLNGNISR  461

Query  1537  FCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEP  1716
                ++++VTV+ACGAL TP L+  S L+N NIGRNLHLH    AWGYFP+   S      
Sbjct  462   NLQIEAKVTVMACGALLTPPLMIRSSLKNRNIGRNLHLHLAQVAWGYFPEKETSHL----  517

Query  1717  EKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSR  1896
             + K Y+GGI+T+ +KV++  ++S   ALI+TP+L P +F+A+ PW SG D+K RM ++SR
Sbjct  518   KGKIYEGGIITSANKVLS--KDSEVRALIETPALGPSLFTALSPWSSGLDMKNRMTKYSR  575

Query  1897  TAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAG  2076
             TA L  + RD+ SGE  +   I Y + KTDK ++  GL + LRIL +AGA E+GT    G
Sbjct  576   TANLVTIVRDRGSGEIKAEGRIKYALDKTDKENIVAGLRQSLRILISAGAVEVGTHRSDG  635

Query  2077  KILKPKGASRDEIDEFVEKESSRD-LGNLS---TLIGSAHQMGSCRMGVDPRSSVVNPMG  2244
             + LK KG     I+EF++  ++ D  G+ +    + G+  QMGSCR+GV+     ++P G
Sbjct  636   QSLKCKGIDEKAIEEFLDTVTAEDGPGSFTEKWMVYGTTQQMGSCRIGVNEEEGALDPNG  695

Query  2245  ETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKT  2379
             E+WE E LF+ D SV P+A+GVNPM+TV A AYC +  + K ++T
Sbjct  696   ESWEAEKLFVCDGSVLPSAIGVNPMITVMATAYCISTGIAKSIRT  740



>ref|NP_194586.1| Long-chain-alcohol oxidase FAO4B [Arabidopsis thaliana]
 sp|Q94BP3.2|FAO4B_ARATH RecName: Full=Long-chain-alcohol oxidase FAO4B; AltName: Full=Long-chain 
fatty alcohol oxidase 4B [Arabidopsis thaliana]
 emb|CAB81445.1| putative protein [Arabidopsis thaliana]
 emb|CAC87644.1| alcohol oxidase [Arabidopsis thaliana]
 gb|AAN71941.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85508.1| Long-chain-alcohol oxidase FAO4B [Arabidopsis thaliana]
Length=748

 Score =   485 bits (1248),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 305/766 (40%), Positives = 435/766 (57%), Gaps = 63/766 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
              SP+ + ++  I  TFLP     +  AV+      F   S++       VA MI +  + 
Sbjct  27    FSPSQIQSLAVICQTFLPPETTSEQQAVNS-----FHVASSTQPPFTDEVAEMIVKNGRS  81

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS---CCY  471
               V +LR+ L +LS R GTL+LCG   L   +P++  F ++   KR  I+R+WS      
Sbjct  82    EAVKVLRIILMILSFRFGTLLLCGSLCLDKSWPFVLKFSQLPLDKREAILRNWSRQSGFL  141

Query  472   IKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYC--GPDPDSNKKPAGKSKKWITR  645
             +    TF+L  K   L  FFSQ +EN +N + +AI YC  G +  SNKK     K+    
Sbjct  142   LPFRITFFLA-KFYTLFYFFSQTDENLKNPALEAIGYCIDGTERSSNKKSEADEKRR---  197

Query  646   EQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQ  825
                                        PL KG+I    E    +   L + G  V+    
Sbjct  198   ---------------------------PLEKGIIETMHESDVTITQSLTEKGVHVA----  226

Query  826   QKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegssl  1005
              +  G+  + I CDAVVVGSGSGGGV A  LA AG KVLVLEKG YF     S LE  S+
Sbjct  227   -RDDGDNVYRIRCDAVVVGSGSGGGVAAANLAKAGLKVLVLEKGNYFTAHDYSGLEVPSM  285

Query  1006  DEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKE  1185
              E+Y  GGL+ + D   +LLAGS VGGG+ +NWSASI+TP HVL+EW E  K++ FGS+E
Sbjct  286   LELYEKGGLLTTVDGKFMLLAGSAVGGGTAVNWSASIRTPDHVLQEWSEGSKIKFFGSQE  345

Query  1186  YRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCK  1365
             Y+ AM+ V  R+GV       GFQN VLRKGC  LG  VE++PRN+  DHYCG C +GC+
Sbjct  346   YQSAMDEVTIRIGVTERCVKHGFQNQVLRKGCERLGLQVESVPRNSPEDHYCGLCGYGCR  405

Query  1366  DGKKKGTSETWLADLVDSGNGVIFP-ECEAVKVVHNKKTGREQAAGVMFVYQNNG----A  1530
              G K GT +TWL D V++G  ++   + E   +V N  +  E+    + V+ ++      
Sbjct  406   AGAKNGTDQTWLVDAVENGAVILTGIKAERFVLVDNTSSSNERKKRCVGVFASSVGGKIG  465

Query  1531  KEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWP  1710
             K+F  +++RVTV + G+L TP L+ +SGL+NPNIGRNL LHPV+  WGYFP+        
Sbjct  466   KKF-IIEARVTVSSAGSLLTPPLMLSSGLKNPNIGRNLKLHPVLMTWGYFPEKD-----S  519

Query  1711  EPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRF  1890
             E   K Y+GGI+T++  +  N  ESG  A+++ P + P  ++ + PW+SG D+K RM ++
Sbjct  520   EFSGKMYEGGIITSVHHM--NDTESGCKAILENPLIGPASYAGLSPWVSGPDLKERMIKY  577

Query  1891  SRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHR  2070
              RTA LFAL RD  SGE      ++Y   K D+ +L+ GL + LR+  AAGA E+GT   
Sbjct  578   GRTAHLFALVRDLGSGEVMMENEVTYRTTKKDRENLRAGLRQALRVSVAAGAVEVGTYRS  637

Query  2071  AGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNP  2238
              G+ +K +  +++ ++EF+++  +       G   T   SAHQMGSCRMGV      ++ 
Sbjct  638   DGQKMKCEAITKEAMEEFLDEVDAVGGVGTKGEYWTTYFSAHQMGSCRMGVTAEEGALDE  697

Query  2239  MGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
              GE+WE EGLF+ D S+ P+A+GVNPM+T+Q+ AYC +  ++  L+
Sbjct  698   NGESWEAEGLFVCDGSILPSAVGVNPMITIQSTAYCISSKIVDSLQ  743



>gb|AAK64154.1| unknown protein [Arabidopsis thaliana]
Length=748

 Score =   485 bits (1248),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 305/766 (40%), Positives = 435/766 (57%), Gaps = 63/766 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
              SP+ + ++  I  TFLP     +  AV+      F   S++       VA MI +  + 
Sbjct  27    FSPSQIQSLAVICQTFLPPETTSEQQAVNS-----FHVASSTQPPFTDEVAEMIVKNGRS  81

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS---CCY  471
               V +LR+ L +LS R GTL+LCG   L   +P++  F ++   KR  I+R+WS      
Sbjct  82    EAVKVLRIILMILSFRFGTLLLCGSLCLDKSWPFVLRFSQLPLDKREAILRNWSRQSGFL  141

Query  472   IKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYC--GPDPDSNKKPAGKSKKWITR  645
             +    TF+L  K   L  FFSQ +EN +N + +AI YC  G +  SNKK     K+    
Sbjct  142   LPFRITFFLA-KFYTLFYFFSQTDENLKNPALEAIGYCIDGTERSSNKKSEADEKRR---  197

Query  646   EQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQ  825
                                        PL KG+I    E    +   L + G  V+    
Sbjct  198   ---------------------------PLEKGIIETMHESDVTITQSLTEKGVHVA----  226

Query  826   QKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegssl  1005
              +  G+  + I CDAVVVGSGSGGGV A  LA AG KVLVLEKG YF     S LE  S+
Sbjct  227   -RDDGDNVYRIRCDAVVVGSGSGGGVAAANLAKAGLKVLVLEKGNYFTAHDYSGLEVPSM  285

Query  1006  DEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKE  1185
              E+Y  GGL+ + D   +LLAGS VGGG+ +NWSASI+TP HVL+EW E  K++ FGS+E
Sbjct  286   LELYEKGGLLTTVDGKFMLLAGSAVGGGTAVNWSASIRTPDHVLQEWSEGSKIKFFGSQE  345

Query  1186  YRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCK  1365
             Y+ AM+ V  R+GV       GFQN VLRKGC  LG  VE++PRN+  DHYCG C +GC+
Sbjct  346   YQSAMDEVTIRIGVTERCVKHGFQNQVLRKGCERLGLQVESVPRNSPEDHYCGLCGYGCR  405

Query  1366  DGKKKGTSETWLADLVDSGNGVIFP-ECEAVKVVHNKKTGREQAAGVMFVYQNNG----A  1530
              G K GT +TWL D V++G  ++   + E   +V N  +  E+    + V+ ++      
Sbjct  406   AGAKNGTDQTWLVDAVENGAVILTGIKAERFVLVDNTSSSNERKKRCVGVFASSVGGKIG  465

Query  1531  KEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWP  1710
             K+F  +++RVTV + G+L TP L+ +SGL+NPNIGRNL LHPV+  WGYFP+        
Sbjct  466   KKF-IIEARVTVSSAGSLLTPPLMLSSGLKNPNIGRNLKLHPVLMTWGYFPEKD-----S  519

Query  1711  EPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRF  1890
             E   K Y+GGI+T++  +  N  ESG  A+++ P + P  ++ + PW+SG D+K RM ++
Sbjct  520   EFSGKMYEGGIITSVHHM--NDTESGCKAILENPLIGPASYAGLSPWVSGPDLKERMIKY  577

Query  1891  SRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHR  2070
              RTA LFAL RD  SGE      ++Y   K D+ +L+ GL + LR+  AAGA E+GT   
Sbjct  578   GRTAHLFALVRDLGSGEVMMENEVTYRTTKKDRENLRAGLRQALRVSVAAGAVEVGTYRS  637

Query  2071  AGKILKPKGASRDEIDEFVEKESSR----DLGNLSTLIGSAHQMGSCRMGVDPRSSVVNP  2238
              G+ +K +  +++ ++EF+++  +       G   T   SAHQMGSCRMGV      ++ 
Sbjct  638   DGQKMKCEAITKEAMEEFLDEVDAVGGVGTKGEYWTTYFSAHQMGSCRMGVTAEEGALDE  697

Query  2239  MGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
              GE+WE EGLF+ D S+ P+A+GVNPM+T+Q+ AYC +  ++  L+
Sbjct  698   NGESWEAEGLFVCDGSILPSAVGVNPMITIQSTAYCISSKIVDSLQ  743



>ref|XP_011080082.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Sesamum indicum]
Length=742

 Score =   484 bits (1245),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 291/725 (40%), Positives = 423/725 (58%), Gaps = 58/725 (8%)
 Frame = +1

Query  226   FFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYL  405
             F+++S      P  VA ++ +R     V ++ L L  LS+R+GTL+LCG      ++P++
Sbjct  63    FYKSSG-----PDEVAELLVKRGIPAAVFIVSLVLKFLSSRLGTLLLCGWICSDWKWPFV  117

Query  406   QSFPEISPHKRAEIVRSWSCCYIKI-LKTFYLGMKVMVLLSFFSQVNENNENISWKAIDY  582
              SF E++  KR  I++ WS   + + L+  +L +K+M L  FFS  +EN+ N +W+AI Y
Sbjct  118   HSFCELTLKKREAILQKWSRETLFLPLRIAFLLLKIMCLFVFFSWTDENSSNPAWEAIGY  177

Query  583   CGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQE  762
                                     +  +E + K E++           PL KG+I +  E
Sbjct  178   -----------------------QVEATERETKYEKER----------PLEKGIIEIMNE  204

Query  763   PRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVL  942
                 + + L + G   +     +      + I+CDAV++GSG GGGV A VLA +G KVL
Sbjct  205   DESSLKESLMQKGINFA-----EDEDENVYKIKCDAVIIGSGCGGGVTAAVLAKSGQKVL  259

Query  943   VLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQT  1122
             +LEKG YF     S LEG +  E+Y  GG++ ++D  I+++AG+ VGGGS +N S  I+T
Sbjct  260   ILEKGHYFVPEDYSGLEGPAFSELYESGGMLTTQDGKIMVMAGTTVGGGSYMNLSHWIRT  319

Query  1123  PPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPV  1302
             P ++LKEW    K+ LFGS EY+ AM+ VC R+GV      EGFQN VLR+GC  LG  V
Sbjct  320   PDYILKEWSTESKIHLFGSHEYQSAMDAVCERIGVTENCVQEGFQNQVLRRGCENLGLNV  379

Query  1303  ETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEA---VKVVHNK  1473
             E +PRN+S DHYCG C   C+ G KKGT  TWL D V +G  VI   C+A   + V   K
Sbjct  380   EPVPRNSSPDHYCGSCCSDCRRGDKKGTGSTWLVDAVKNG-AVILTGCKAETLMLVSDKK  438

Query  1474  KTGREQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLH  1653
             +  R+   GV+   +N   ++   +++RVT+ ACG+L TP LL +SGL N NI +NLHLH
Sbjct  439   EKDRKSCLGVIAAAENKNIRKKIQIEARVTISACGSLLTPPLLISSGLENKNIRKNLHLH  498

Query  1654  PVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMF  1833
             PV   WGYFP+     +  E + KS+ GGI T++ KV +  E+S   A++Q  +L P +F
Sbjct  499   PVSLVWGYFPE-----SLVELKGKSFGGGISTSLHKVQSE-EKSDIQAIVQAGALGPALF  552

Query  1834  SAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLE  2013
             + + PW+S  D+  RM +++RTA+LFAL+RD  SGE      I Y +   DK +LK GL 
Sbjct  553   ATLFPWVSRNDMNDRMTKYARTAVLFALSRDYGSGEVRKQGHIKYRLSAVDKENLKTGLR  612

Query  2014  KVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLIGSA  2181
             + LRIL  AGA E+GT    G+ ++ KG   ++++EF++  ++    R      TL  SA
Sbjct  613   RALRILVGAGAAEVGTFRSDGQRIRCKGTKNEDLEEFLDAVTAVGGPRTRSEYWTLYCSA  672

Query  2182  HQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSV  2361
             HQMGSCRMG +     V+  GE WE +GLF+ D SV PTA+GVNPM+T+Q+ AYC ++ +
Sbjct  673   HQMGSCRMGANEEDGAVDENGECWEAKGLFVCDGSVLPTAVGVNPMITIQSTAYCISKRL  732

Query  2362  LKFLK  2376
                LK
Sbjct  733   ADSLK  737



>ref|XP_002464496.1| hypothetical protein SORBIDRAFT_01g019480 [Sorghum bicolor]
 gb|EER91494.1| hypothetical protein SORBIDRAFT_01g019480 [Sorghum bicolor]
Length=732

 Score =   481 bits (1239),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 294/740 (40%), Positives = 419/740 (57%), Gaps = 65/740 (9%)
 Frame = +1

Query  211   DSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSS  390
             D ++ F++ SA+    P  VA M++ R     ++L+R+ LW+LSTR+GTL LCG+  L  
Sbjct  33    DDLERFYRASAADGVIPDEVAEMVT-RCVWEAMLLMRVILWMLSTRVGTLALCGRLCLCF  91

Query  391   Q-----FPYLQSFPEISPHKRAEIVRSWS-CCYIKILKTFYLGMKVMVLLSFFSQVNENN  552
                   FP++  F ++   +R ++++ WS   ++  LK  +L  K++   SF++ VNEN+
Sbjct  92    SDNGKFFPFVCKFADMPVKRREQVLKRWSKARWLFPLKITFLIAKLLSHYSFYTMVNENS  151

Query  553   ENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPL  732
             +N SWKAI Y  P+PD ++ P      W                              PL
Sbjct  152   DNPSWKAIGYSVPEPDVDRPPEEAPSAW------------------------------PL  181

Query  733   HKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviag  912
               G++         +   L + G  V   +           ++CD V+VGSG GGGV A 
Sbjct  182   DAGIVETRSLNDATLLRSLTERGLAVKADVS-----GAHHTVQCDVVIVGSGCGGGVAAA  236

Query  913   vLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGS  1092
             VLA AGHKV+V+EKG YF   S + +EG S++ +Y  GG+  + ++  ++  G+ VGGGS
Sbjct  237   VLAAAGHKVIVVEKGDYFTAESYTSVEGPSMERLYEKGGIFCTSNVTTIMFTGATVGGGS  296

Query  1093  TINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLR  1272
              INWSASI+TP  V KEW   H L +FG+ EY  AM+ VC+R+ V      EGFQN  LR
Sbjct  297   AINWSASIRTPEWVTKEWARDHGLPVFGTPEYARAMDAVCARLAVTGGCRQEGFQNKALR  356

Query  1273  KGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEA  1452
             +GC  LG   + +PRN+S  H+CG C  GC  G+K+GT  TWL D VD G  VI   C+A
Sbjct  357   RGCEALGLRGDAVPRNSSEGHFCGSCHLGCPTGEKRGTDTTWLVDAVDRG-AVILTGCKA  415

Query  1453  VKVVHNKKTG-------REQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNS  1611
              + +     G        ++  G++    ++G  +   ++++V++ ACGAL TP LL+NS
Sbjct  416   ERFILESNPGGGGDNGRSKKCVGLVAACMSDGISKKLRIEAKVSISACGALMTPPLLRNS  475

Query  1612  GLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGY  1791
             GL+N +IGRNLHLHPV  AWGYFPD     A  E   K Y+GGI+T M +V A       
Sbjct  476   GLKNRHIGRNLHLHPVSMAWGYFPDGTPENA--ELSGKCYEGGIITTMHRVTAR------  527

Query  1792  GALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYN  1971
               +IQTP+L PG +++++PW SG D+K RM R++RTA  FAL RD+ +G       + Y 
Sbjct  528   -TIIQTPALGPGCWASLIPWESGRDMKERMLRYARTAHAFALVRDRGAGHVDGEGRVRYA  586

Query  1972  MQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDL  2151
               + D   L+NGL + LRIL AAGA E+GT    G  L+  G  RDE  E   KE +   
Sbjct  587   PSREDVEELRNGLRQALRILVAAGAAEVGTHRSDGLRLRCDGGLRDEDLEAFLKEVTVGE  646

Query  2152  GNLS------TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVN  2313
             G +        L  SAHQMGSCRMG  P+   V+  GE+WE EGL++ D SV PTA+GVN
Sbjct  647   GPMLPGPDKWALHCSAHQMGSCRMGCSPKDGAVDGRGESWEAEGLYVCDGSVLPTAVGVN  706

Query  2314  PMVTVQAIAYCTAQSVLKFL  2373
             PM+T+Q+ AYC ++ + + L
Sbjct  707   PMITIQSTAYCVSKGIAESL  726



>ref|XP_004982884.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Setaria 
italica]
Length=764

 Score =   482 bits (1241),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 304/808 (38%), Positives = 440/808 (54%), Gaps = 72/808 (9%)
 Frame = +1

Query  10    SVQIMNKKKMISDDGDSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVP  189
             S Q   K    +  G  L    K ER   G       L P  M  + ++    +P++ V 
Sbjct  2     STQQQEKASAAAGRGSPLLRRCKRERYTHG-------LRPPQMEALRAMCGALIPSLPVE  54

Query  190   ------QHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRI  351
                   +H   + D V+ F++ SA+    P  VA M +       ++L+R+ LW+LST++
Sbjct  55    GPFHGDKHGGGNKDDVERFYRASAADGAIPDEVAEMATG-CAREAMLLVRVILWMLSTKV  113

Query  352   GTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS-CCYIKILKTFYLGMKVMVLLSF  528
             GT +LCG   +SS+FPY+  F ++   +R E+++ WS   ++  LK  ++ +K++   SF
Sbjct  114   GTFVLCGWLCVSSRFPYVFKFADMPLERREEVLKWWSKTRWLFPLKVTFVLVKILSHYSF  173

Query  529   FSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMN  708
             ++ +NE+++N SWKAI Y  PD D                          + +ED+    
Sbjct  174   YTTINEHSDNPSWKAIGYSVPDVD--------------------------RPQEDLSEAA  207

Query  709   PELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsg  888
             P     PL  GV+         +   L   G  V   +       P   ++CD V+VGSG
Sbjct  208   PSPSPRPLDSGVVETRSLDDAALLRSLMDKGLAVKADVS-----GPHHTVQCDVVIVGSG  262

Query  889   sgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLA  1068
              GGGV A VLA AGHKV+V+EKG YF     S +EG S++ +Y  GG+  + +   ++  
Sbjct  263   CGGGVAAAVLAAAGHKVVVVEKGDYFTAEDYSSIEGPSMERLYEKGGIFCTSNASTIMFT  322

Query  1069  GSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDE  1248
             G+ VGGGS INWSASI+TP  V +EW   H L +FGS EY HAM+ VC+R+ V S   +E
Sbjct  323   GATVGGGSAINWSASIRTPEWVTQEWAREHGLPVFGSPEYAHAMDAVCTRLAVTSGCREE  382

Query  1249  GFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNG  1428
             GFQN  LR GC  LG   + +PRN S  H+CG C  GC  G+K+GT  TWL D V  G  
Sbjct  383   GFQNKALRNGCEALGLRADAVPRNTSEGHFCGSCHLGCPTGEKRGTDTTWLVDAVAQG-A  441

Query  1429  VIFPECEAVKVVHNKKTGR-----EQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTP  1593
             V+   C+A + V     G+     ++  G++     +G      ++++V++ ACGAL TP
Sbjct  442   VVLTGCKAERFVLESNPGKNGCRSKRCVGLVAKCMGDGITRKLRIEAKVSISACGALMTP  501

Query  1594  SLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEK---KSYQGGIMTAMSKV  1764
              LL+ SGL+N +IGRNLHLHPV  AWGYFPD       PEP     K Y+GGI+T + +V
Sbjct  502   PLLRRSGLKNRHIGRNLHLHPVSMAWGYFPDGT-----PEPRPLTGKCYEGGIITTLHRV  556

Query  1765  VANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEA  1944
              A         ++QTP+L PG  ++++PW SG D+K RM R++RTA  FAL RD+ +G  
Sbjct  557   TAR-------TIVQTPALGPGSMASLIPWESGRDMKERMLRYARTAHAFALVRDRGAGTV  609

Query  1945  PSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEF  2124
                  + Y     D   L+NGL + LRIL AAGA E+GT    G  L+ +G   ++++ F
Sbjct  610   GREGRVRYVPSSEDVEELRNGLRRALRILVAAGAAEVGTHRSDGLRLRCEGLRDEDLEAF  669

Query  2125  -----VEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSV  2289
                  V K       +   L+ SAHQMGSCRMG  PR   V+  GE+WE EGL++ D S+
Sbjct  670   LNEVTVAKGPMIPGSDTWALLCSAHQMGSCRMGSRPRDGAVDGRGESWEAEGLYVCDGSL  729

Query  2290  FPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
              PTA+GVNPM+T+Q+ AY  ++ + + L
Sbjct  730   LPTAVGVNPMITIQSTAYYVSKGIAESL  757



>ref|XP_010532672.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Tarenaya hassleriana]
Length=746

 Score =   481 bits (1239),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 310/768 (40%), Positives = 454/768 (59%), Gaps = 59/768 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDD-----SVKLFFQTSASIAGTPQRVAWMIS  285
              + A M ++ ++ +T LP +        +DD     +++ F+  S S +    +   +I+
Sbjct  17    FTAAEMESLAAVCETLLPPLSPEYSPDGEDDHPNKEALRSFYSDSGSKSHVLHQGVELIT  76

Query  286   ERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW-S  462
              R     V+++RL L LLS+R+GTL+LCG   L   +P+++ F  +S  KR  +++ W  
Sbjct  77    RRGLIEAVLVVRLVLLLLSSRLGTLLLCGTHCLVPNWPFVERFGSLSLEKRERVLQKWFR  136

Query  463   CCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWIT  642
                +  ++  ++ +KV+ L  FFS V  N EN +W+AI Y     +S  KP+      I 
Sbjct  137   NRLLAPIRLAFVYIKVVFLYCFFSWVGPNGENPAWEAIGYRVNLEES--KPSN-----IM  189

Query  643   REQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCI  822
             +E+                         PL KG++   +E    +   L + G  V    
Sbjct  190   KER-------------------------PLEKGMVETVKETDSTLPKSLSEKGLEV----  220

Query  823   QQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegss  1002
                GS +    I+CDAV+VGSGSGGGV A VLA+AG KV+VLEKG YFA S  S  EG  
Sbjct  221   -MSGSNHDPIKIKCDAVIVGSGSGGGVAAAVLASAGLKVVVLEKGTYFAPSEYSPFEGHG  279

Query  1003  lDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSK  1182
              D++Y  GG++ + D ++++LAG+ VGGGS +NWSA I+TP  VL+EW E HK+ LFG++
Sbjct  280   FDQLYESGGVLPTVDGNVMILAGATVGGGSAVNWSACIKTPEPVLQEWSEDHKIPLFGTQ  339

Query  1183  EYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGC  1362
             EY  AME V  R+GV  +   E FQN VLRKGCL LG  VE +PRN+S +HYCG C +GC
Sbjct  340   EYGSAMEVVWKRIGVTEKCRQESFQNQVLRKGCLNLGLKVENVPRNSSENHYCGSCCYGC  399

Query  1363  KDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVH----NKKTG--REQAAGVMFVYQNN  1524
             + G K+G+  TWL D V+ G  VI   CEA +++     NK  G  + + +GVM    N 
Sbjct  400   RQGDKQGSDRTWLLDAVNHG-AVILTGCEAERLILEKNINKGVGAKKMKCSGVMAKSLNG  458

Query  1525  GAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKA  1704
                +   ++++VTV+ACGA+ TP L+  SGL+N NIGRNLHLHPV+ AWGYFP+   S  
Sbjct  459   NISKKLQIEAKVTVVACGAISTPPLIIKSGLKNRNIGRNLHLHPVLMAWGYFPEKETSHL  518

Query  1705  WPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQ  1884
                 + K Y+GGIMT+++KV+   ++S   A+I+TP++ P  F+AI PW+SG D+K RM 
Sbjct  519   ----KGKIYEGGIMTSVNKVLLA-KDSEVRAIIETPAMGPASFTAICPWISGLDMKKRMT  573

Query  1885  RFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTC  2064
             ++SRTA L  + RD+ SGE  +   I Y + KTDK ++  GL + LRIL +AGA E+GT 
Sbjct  574   KYSRTAHLITIVRDRRSGEVMAEGRIRYTLDKTDKENIVAGLRQSLRILISAGAVEVGTH  633

Query  2065  HRAGKILKPKGASRDEIDEFVEKESSRD----LGNLSTLIGSAHQMGSCRMGVDPRSSVV  2232
                G+ LK KG   + I+ F++  ++ D          +  SAHQMGSCR+G +     +
Sbjct  634   RSDGQRLKCKGIDEETIEAFLDTVTAEDGPGSYAEKWAVYASAHQMGSCRIGENEEKGAL  693

Query  2233  NPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             +  GE+WE +GLF+ D S  P+ALGVNPM+T+ A +YC +  ++K LK
Sbjct  694   DLNGESWEAKGLFVCDGSALPSALGVNPMITIMATSYCISTGIVKSLK  741



>ref|XP_008668721.1| PREDICTED: uncharacterized protein LOC100274574 isoform X1 [Zea 
mays]
 gb|ACR36691.1| unknown [Zea mays]
 tpg|DAA49652.1| TPA: hypothetical protein ZEAMMB73_468308 [Zea mays]
Length=783

 Score =   482 bits (1241),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 292/768 (38%), Positives = 432/768 (56%), Gaps = 61/768 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDD----DSVKLFFQTSASIAGTPQRVAWMISE  288
             + PA M  + ++    +P++     A   D      ++ F+  SA+ +  P  VA ++  
Sbjct  52    MRPAQMEALRAMCGALIPSLPADADAGRGDPPGGKDLERFYLASAADSTIPDEVAELMVT  111

Query  289   RLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCC  468
             R     V L  + LW LSTR GTL+LCG+ SL + FPY++ F +++P +R   +R W+  
Sbjct  112   RCIREAVALAWVVLWALSTRAGTLLLCGRLSLGAGFPYVRRFADMAPERREAALRRWNRV  171

Query  469   -YIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITR  645
              ++  L+  +  +K++    F++ VNEN+EN  WKAI Y   +P  +            R
Sbjct  172   RWLFPLRIAFAIVKILCHYVFYAMVNENSENPYWKAIGYSVDEPRED------------R  219

Query  646   EQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQ  825
              +  T S  +                 PL  GV+        ++   L   G  V P   
Sbjct  220   ARTATPSPSR-----------------PLDVGVVETRLLDDNKLLRSLVGRGLTVKP---  259

Query  826   QKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegssl  1005
                S      ++CDAV+VGSG GGGV A VLA+AG+KV+V+EKG YF     S +EG S+
Sbjct  260   -ASSDANHHTVQCDAVIVGSGCGGGVAAAVLASAGYKVVVVEKGDYFTAEDYSSIEGPSM  318

Query  1006  DEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKE  1185
             + ++  GG+  + ++  ++  G+ VGGGS +NWSASI+TP  V +EW   H L +F S  
Sbjct  319   ERLFERGGIFCTSNVTTMIFTGATVGGGSAVNWSASIRTPEEVTQEWAREHGLPVFASPG  378

Query  1186  YRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCK  1365
             Y  AM+ VC+R+GV    ++EGFQN V+R+GC  LG   + +PRN+S  H+CG C+FGC 
Sbjct  379   YAQAMDAVCARLGVTDGCQEEGFQNKVVRRGCEALGLCADAVPRNSSDAHFCGSCNFGCP  438

Query  1366  DGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKK-------TGREQAAGVMFVYQNN  1524
              G K+GT  TWL D V  G  VI   C+A   V  K           ++  G++    +N
Sbjct  439   TGDKRGTDTTWLVDAVARG-AVILTGCKAEYFVLEKNHSSGSGSGRGKKCVGLVATCASN  497

Query  1525  GAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKA  1704
             G  +   ++++V++ ACGAL TP LL+ SGL+N +IG NLHLHPV  AWGYFP+   +K 
Sbjct  498   GVTKKLRIEAKVSIAACGALMTPPLLRRSGLKNRHIGSNLHLHPVSMAWGYFPE---NKQ  554

Query  1705  WPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQ  1884
              P    K Y+GGI+T+M +V           +I+TP+L PG F+A++PW SG D+K RM+
Sbjct  555   DPPLSGKCYEGGIITSMHRVTDR-------TIIETPALGPGAFAAMVPWESGRDMKERMR  607

Query  1885  RFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTC  2064
             R+SRTA  FAL RD+  G       + +   + D   L+NGL +VLRIL AAGA E+GT 
Sbjct  608   RYSRTAHAFALVRDRGVGFVDGEGRVRFTPSREDVDELRNGLRRVLRILVAAGAAEVGTH  667

Query  2065  HRAGKILKPKGASRDEIDEF-----VEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSV  2229
                G  L+ KG   ++++ F     +EK       +   L  SAHQMGSCRMG  P+   
Sbjct  668   RSDGLRLRCKGLRDEDLEGFLDEVTIEKGPMHSRVDKWALHCSAHQMGSCRMGSSPKDGA  727

Query  2230  VNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
             V+  GE+WE EGL++ D S+ PTA+GVNPM+T+Q+IA+C ++ + + +
Sbjct  728   VDGRGESWEAEGLYVCDGSLLPTAVGVNPMITIQSIAFCLSKGIAETM  775



>ref|XP_008664883.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Zea mays]
 tpg|DAA49658.1| TPA: hypothetical protein ZEAMMB73_936795 [Zea mays]
Length=762

 Score =   479 bits (1233),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 307/777 (40%), Positives = 441/777 (57%), Gaps = 60/777 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDV------PQHAAVDDDSVKLFFQTSASIAGTPQRVAWMI  282
             L P  M  + ++    +P++ V      PQ     DD +  FF+ SA+    P  VA M+
Sbjct  23    LRPPQMEALRAMCGALIPSLPVEGLHVQPQPGRGKDD-LDRFFRASAADGAIPDEVAEMV  81

Query  283   SERLQHPKVIllrlalwllSTRIGTLMLCGKASLS---SQFPYLQSFPEISPHKRAEIVR  453
             + R     V+L+R+ LW+LSTRIGTL LCG+   S   S FPY   F ++   +R  +++
Sbjct  82    T-RCVWEGVLLMRIVLWVLSTRIGTLALCGRLCFSAGKSSFPYACRFADMPVERRERVLQ  140

Query  454   SWSCC-YIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSK  630
              WS   ++  LK  ++  K++   +F++ VNEN++N SWKAI Y  P P +    A    
Sbjct  141   RWSGARWLFPLKITFVIAKLLSHYAFYTMVNENSDNPSWKAIGYSVPVPAA----AADVD  196

Query  631   KWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPV  810
             +   RE           G  +    +P     PL  GV+         +   L + G  V
Sbjct  197   RLRPREL----------GPAEAEAPSPR----PLDSGVVETRSLNDATLLKSLTERGVAV  242

Query  811   SPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsll  990
                  + G       ++CD V+VGSG GGGV A VLA AG KV+V+EKG YF   S + +
Sbjct  243   -----KAGVSGAHHTVQCDVVIVGSGCGGGVAAAVLAAAGRKVVVVEKGDYFTAESYTSV  297

Query  991   egsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLEL  1170
             EG S++ +Y  GG+  + ++  ++ AG+ VGGGS INWSAS++TP  V +EW   H L +
Sbjct  298   EGPSMERLYEKGGIFCTSNVTTIMFAGTTVGGGSAINWSASVRTPEWVTQEWAREHGLPM  357

Query  1171  FGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWC  1350
             FG  EY HAM+ VC+R+ V     +EGFQN VLR+GC  LG   + +PRN+S  H+CG C
Sbjct  358   FGRPEYAHAMDAVCARLAVTGGCREEGFQNKVLRRGCEALGLRGDAVPRNSSEGHFCGSC  417

Query  1351  SFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVK-VVHNKKTGRE----QAAGVMFVY  1515
               GC  G K+GT  TWL D V  G  V+   C+A + V+ +   GR+    +  G++   
Sbjct  418   HLGCPTGDKRGTDTTWLVDAVARG-AVVLTGCKAERFVLESNPGGRDGRSNRCVGLVATC  476

Query  1516  QNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPG  1695
              ++G  +   ++++V+V ACGAL TP LL+NSGL+N ++GRNLHLHPV  AWGYFPD+  
Sbjct  477   MSDGITKKLRIEAKVSVSACGALMTPPLLRNSGLQNSHVGRNLHLHPVSMAWGYFPDST-  535

Query  1696  SKAWPEPE--KKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDI  1869
                 PE E   K Y+GGI+T M +V A         +IQTP+L PG +++++PW SG D+
Sbjct  536   ----PEAELSGKCYEGGIITTMRRVTAR-------TIIQTPALGPGCWASLVPWESGRDM  584

Query  1870  KTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAE  2049
             K RM R++RTA  FAL RD+ +G       + Y   + D   L+NGL + LRIL AAGA 
Sbjct  585   KERMLRYARTAHAFALVRDRGAGHVDGEGRVRYTPSREDVDELRNGLRQTLRILVAAGAA  644

Query  2050  EIGTCHRAGKILKPKGASRDEIDEF-----VEKESSRDLGNLSTLIGSAHQMGSCRMGVD  2214
             E+GT    G  L+  G   ++++ F     VEK       +   L  SAHQMGSCRMG  
Sbjct  645   EVGTHRSDGLRLRCDGLRDEDLEAFLKQVTVEKGPMVPGHDKWALHCSAHQMGSCRMGSS  704

Query  2215  PRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHN  2385
             P+   V+  GE+WE EGL++ D S+ PTA+GVNPM+T+Q+ AYC ++ + + L   N
Sbjct  705   PKHGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPMITIQSTAYCVSKGIAESLARDN  761



>ref|XP_002869492.1| hypothetical protein ARALYDRAFT_491906 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45751.1| hypothetical protein ARALYDRAFT_491906 [Arabidopsis lyrata subsp. 
lyrata]
Length=748

 Score =   477 bits (1227),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 302/767 (39%), Positives = 432/767 (56%), Gaps = 63/767 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
              SP+ + ++  I  T LP     +  A++      F   S++     + VA MI +  + 
Sbjct  27    FSPSQIQSLAVICQTLLPPETTAEQQALNS-----FNVASSTQPPFTEEVAEMIVKNGRS  81

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS---CCY  471
               V +L++ L +LS R GTL+LCG   L   +P++  F ++   KR EI+R WS      
Sbjct  82    EAVKVLKIILIILSFRFGTLLLCGSLCLDKSWPFVLKFSQLPLDKREEILRKWSRQSGFL  141

Query  472   IKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYC--GPDPDSNKKPAGKSKKWITR  645
             +    TF+L  K   L  FFSQ +EN +N + + I YC  G +  SNKK           
Sbjct  142   LPFRITFFLA-KFYTLFYFFSQTDENLKNPALETIGYCLDGIETSSNKK-----------  189

Query  646   EQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQ  825
                   SE  K+               PL  G+I    E    +   L   G  V+    
Sbjct  190   ------SEADKRRR-------------PLETGIIETTHESDVTITQSLIGKGVHVA----  226

Query  826   QKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegssl  1005
              +  G+    I CDAVVVGSGSGGGV A  LA AG KVLVLEKG YFA    S LEG S+
Sbjct  227   -RDDGDNVHRIRCDAVVVGSGSGGGVAAANLAKAGFKVLVLEKGNYFAPQDYSGLEGPSM  285

Query  1006  DEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKE  1185
              E+Y   GL+ + D   +LLAGS VGGG+ +NWSASI+TP HVL+EW E  K++ FGS+E
Sbjct  286   LELYEKSGLLTTVDGKFMLLAGSTVGGGTAVNWSASIRTPDHVLQEWSEGSKIKFFGSQE  345

Query  1186  YRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCK  1365
             Y+ AM+ V +R+GV      +GFQN VLRKGC  LG  VE++PRN+  DHYCG C +GC+
Sbjct  346   YQSAMDEVMTRIGVTERCVKDGFQNQVLRKGCERLGLQVESVPRNSPEDHYCGLCGYGCR  405

Query  1366  DGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTG-----REQAAGVMFVYQNNGA  1530
              G K GT  TWL D V++G  VI    +A + V    T      +++  GV+        
Sbjct  406   AGAKNGTDRTWLVDAVENG-AVILTGIKAERFVLVDNTSSSNERKKRCVGVIASSVGGKI  464

Query  1531  KEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWP  1710
              +   +++R+T  + G+L TP L+ +SGL+NPNIGRNL LHPV+  WGYFP+        
Sbjct  465   GKKFIIEARMTASSAGSLLTPPLMLSSGLKNPNIGRNLKLHPVLMTWGYFPEKD-----S  519

Query  1711  EPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRF  1890
             E   K Y+GGI+T++  +  N  ESG  A+++ P + P  ++ + PW+SG D+K RM ++
Sbjct  520   EFSGKMYEGGIITSVHHM--NDAESGCRAILENPLIGPASYAGLSPWVSGADLKERMIKY  577

Query  1891  SRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHR  2070
              RTA +FAL RD  SGE      ++Y   K D+ +L+ GL + LR+  AAGA E+GT   
Sbjct  578   GRTAHVFALVRDIGSGEVMKESEVTYRTTKKDRENLRAGLRQALRVSVAAGAVEVGTYRS  637

Query  2071  AGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNP  2238
              G+ +K +G +++ ++EF+++  +       G   T   SAHQMGSCRMG       ++ 
Sbjct  638   DGQRMKCEGITKEAMEEFLDEVDAVGGVSTKGEYWTTYFSAHQMGSCRMGATAEEGALDE  697

Query  2239  MGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKT  2379
             +GE+WE EGLF+ D SV P+A+GVNPM+T+Q+ AYC +  ++  L++
Sbjct  698   IGESWEAEGLFVCDGSVLPSAVGVNPMITIQSTAYCISSKIVDSLQS  744



>emb|CDO99261.1| unnamed protein product [Coffea canephora]
Length=749

 Score =   477 bits (1227),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 307/774 (40%), Positives = 457/774 (59%), Gaps = 65/774 (8%)
 Frame = +1

Query  103   YSGGCPLSPAVMATVTSISDTFLPAV------DVPQHAAVDDDSVKLFFQTSASIAGTPQ  264
             YS G   S + +  +T I + F+P +      D+        ++++ F+++S +    P 
Sbjct  19    YSHG--FSSSELEALTGICEAFIPPLPLNNSPDIVGKDGKTKEAIQSFYKSSGAQYPIPD  76

Query  265   RVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAE  444
              VA +  +R     VIL+RL L +LSTR+GTL+LCG      ++PY+  F +I    R +
Sbjct  77    EVAELAVKRGFLEAVILVRLLLIILSTRLGTLLLCGTLCFGEKWPYINKFSDIPVENREK  136

Query  445   IVRSW-SCCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDY-CGPDPDSNKKPA  618
             +++ W    ++  ++  ++ +K + L +FF+QV ++ +N +W+A+DY      DS+  P 
Sbjct  137   VIQKWFKHRFLTPIRLPFVFIKFLCLYAFFTQVWDDLKNPAWEAMDYQVDNRKDSSTTPH  196

Query  619   GKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKL  798
              K                                  PL KG++    E    +   L + 
Sbjct  197   EK----------------------------------PLMKGMVETTHETESTIVSSLVQK  222

Query  799   GFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARss  978
             G  V    ++K      + I+CD V+VGSG GGGV A VLA +G KV+V+EKG YF ++ 
Sbjct  223   GLRVKEVPKEK-----LYKIKCDVVIVGSGCGGGVAAAVLAKSGQKVVVIEKGNYFTKTD  277

Query  979   lsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETH  1158
              S LEG S++E+Y  GG++A+ D  ++LLAGS VGGGS +NWSA I+TP  VL+EW    
Sbjct  278   YSSLEGPSMNELYESGGILATLDGKMMLLAGSTVGGGSAVNWSACIKTPMSVLQEWANDC  337

Query  1159  KLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHY  1338
             ++ LF S +Y  AM+TV  R+GV  +  +EGFQN +LR+GC +LG  VE++PRN+S +HY
Sbjct  338   QIPLFTSSQYISAMDTVSQRIGVTEKCSEEGFQNQILRRGCEKLGLEVESVPRNSSENHY  397

Query  1339  CGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNK-KTGREQAA---GVM  1506
             CG C++GC+ G KKGT  TWL D V  G  VI   C+  K V  K K GR + +   GV+
Sbjct  398   CGSCNYGCRTGDKKGTDSTWLVDAVACG-AVIITGCKTEKFVLEKNKYGRSRKSKCLGVI  456

Query  1507  FVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPD  1686
                 N   +    ++++VT+ ACG+L TP L+ +SGL N +IGRNLHLHPV+ AWGYFP+
Sbjct  457   AKCLNGDIRNRLCIEAKVTISACGSLLTPPLMISSGLTNQHIGRNLHLHPVLMAWGYFPE  516

Query  1687  APGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTD  1866
             +       E + K Y+GGI+T++ KV ++  +S   ALI++P+L P  F+A+ PW SG +
Sbjct  517   SDS-----ELKGKIYEGGIITSVHKVGSD--DSSVRALIESPALGPASFAALRPWESGLE  569

Query  1867  IKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGA  2046
              K RM +++RTA LF++ RD+ SGE  S   IS+    TDK +L  GL + LRIL AAGA
Sbjct  570   SKKRMLKYARTAHLFSMIRDRGSGEVRSEGRISHTFDATDKENLTAGLRQALRILVAAGA  629

Query  2047  EEIGTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVD  2214
              E+GT    G+  K KG S  E++EF+++ ++    + L    T   SAHQMGSCRMG  
Sbjct  630   VEVGTLQSDGQKFKCKGTSEGELEEFLDEVTAAGGPKSLVQNWTTYFSAHQMGSCRMGKS  689

Query  2215  PRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
              +   V+  GE+WE EGLF+ D+SV P A+GVNPM+T+Q+ AYC +  + + LK
Sbjct  690   EKVGAVDENGESWEAEGLFVCDASVLPGAVGVNPMITIQSTAYCLSNKIAEILK  743



>emb|CDX92884.1| BnaC07g41420D [Brassica napus]
Length=742

 Score =   476 bits (1226),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 307/778 (39%), Positives = 438/778 (56%), Gaps = 66/778 (8%)
 Frame = +1

Query  76    KAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAG  255
             ++++  +G YS G  +S   + T++ I  T LP    P     + ++V  F   S S   
Sbjct  14    RSKKRQEGGYSHGFSISQ--IQTLSVICQTLLPP---PPETTAEQNAVDSFKVASGSQPP  68

Query  256   TPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHK  435
                 VA MI +  +   V + ++   +L+ R GTL LCG   L+  +P++  F E+   K
Sbjct  69    FTDEVAEMIVKNGRSEAVKVFKIISTVLAYRFGTLFLCGSLCLAKDWPFVLKFSELPLDK  128

Query  436   RAEIVRSWS---CCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSN  606
             R EI+R WS     ++ +  TF+L  K   L SFFSQ +EN +N + +AI Y        
Sbjct  129   REEILRMWSRQSGFFLPLRITFFLA-KFYTLFSFFSQRDENMKNPALEAIGYS-------  180

Query  607   KKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDR  786
                             +  +E +K   ED  P        PL +G+I    E    +   
Sbjct  181   ----------------IDTTEMRK---EDETPR-------PLERGIIETKNESDVTIRQS  214

Query  787   LQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYF  966
             L + G  V+     +   +    I CD V+VGSGSGGGV A  LA AG KVLVLEKG YF
Sbjct  215   LTQKGVHVA-----REDNDNIHRIRCDVVIVGSGSGGGVAAANLAKAGLKVLVLEKGNYF  269

Query  967   ARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEW  1146
                  S LEG S+ E+Y  G L+ + D   ++LAGS VGGG+ +NWSASI+TP HVL+EW
Sbjct  270   TSRDYSGLEGPSMLELYEKGALMTTVDGKFMVLAGSTVGGGTAVNWSASIRTPDHVLREW  329

Query  1147  DETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNAS  1326
              E  K+E FGS+EY+ AM+ V  R+GV      EG QN VLR GC  LG  V ++PRN+ 
Sbjct  330   SEESKIEFFGSQEYQLAMDEVTRRLGVTERCVKEGLQNQVLRGGCERLGLEVVSVPRNSP  389

Query  1327  RDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTG---REQAA  1497
              DHYCG C +GC+ G K GT +TWL D V++G  VI    +A + V     G   +++  
Sbjct  390   EDHYCGSCGYGCRGGGKNGTDKTWLVDAVENG-AVIMTGVKAERFVFTDNEGKKKKKRCV  448

Query  1498  GVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGY  1677
             GV+        ++   +++RVTV + G+L TP L+++SGL N NIGRNL LHPV+  WGY
Sbjct  449   GVIASSVGGKVEKKFMIEARVTVSSAGSLLTPPLMRSSGLENRNIGRNLKLHPVLMTWGY  508

Query  1678  FPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLS  1857
             FP+  GS    E   K Y+GGI+T++  V  +  ESG  A+++TP   P  ++ + PW+S
Sbjct  509   FPEN-GS----EFSGKMYEGGIITSVHHV--HDGESGCRAILETPLAGPASYAGLSPWVS  561

Query  1858  GTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAA  2037
             G D+K RM ++ RT+ LFAL RD  SGE      ++Y   K D+ +L+ GL + LR+L A
Sbjct  562   GADLKERMMKYGRTSHLFALVRDYGSGEVLKENEVTYRTSKKDRENLRVGLRQALRVLVA  621

Query  2038  AGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLS------TLIGSAHQMGSC  2199
             AGA E+GT    G+ +K +G +R+ ++EF+  +S   +G +S      T   SAHQMGSC
Sbjct  622   AGAVEVGTYRSDGQRIKCEGITREAMEEFL--DSVDAVGGVSTKGEYWTTYFSAHQMGSC  679

Query  2200  RMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
             RMG       V+  GE+WE EGLF+ D SV P+A+GVNPM+T+Q+ AYC +  ++  L
Sbjct  680   RMGRTAEEGAVDEKGESWEAEGLFVCDGSVLPSAVGVNPMITIQSTAYCISTRIVASL  737



>emb|CDP03771.1| unnamed protein product [Coffea canephora]
Length=766

 Score =   477 bits (1227),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 296/776 (38%), Positives = 446/776 (57%), Gaps = 66/776 (9%)
 Frame = +1

Query  103   YSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAV---------DDDSVKLFFQTSASIAG  255
             YS G   SP+ +  ++++ + FLP++  P  A           ++ +++ +++ S S + 
Sbjct  24    YSHG--FSPSQIQALSAVCEAFLPSLSPPSDAISHSQGDPQLHNEAALEYYYKASGSQSP  81

Query  256   TPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHK  435
              P  VA ++ +R     + +++L L LLSTR+GTL++CG   L+ ++P++  F E+   K
Sbjct  82    FPDEVAEILVKRGLPEGLSVVKLVLKLLSTRLGTLLVCGLICLNWKWPFVHRFSELPVKK  141

Query  436   RAEIVRSWSC-CYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKK  612
             R  I++ WS   ++  L+  +L +K+M    FFS  +EN ++ +  AI Y   + D+   
Sbjct  142   RETILQKWSTETFLIPLRIVFLMIKIMCCYVFFSWTDENYKSRTLDAIGY---NTDA---  195

Query  613   PAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQ  792
                       RE  +   EE+                 PL KGVI    E    +   L 
Sbjct  196   ----------REDKIKPREER-----------------PLEKGVIETLYENDSTLKTSLI  228

Query  793   KLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFAR  972
             + G  V     ++      + I+CD V+VGSG GGGV A +LA +GHKVLVLEKG YF  
Sbjct  229   QKGLFV-----EEEPNEDLYKIKCDVVIVGSGCGGGVAAAILAASGHKVLVLEKGHYFVP  283

Query  973   sslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDE  1152
                S LEG S +E+YL G  + + D  +LLLAGS VGGG+ +NWSASI+TP HVLKEW  
Sbjct  284   EDYSGLEGPSFEELYLSGAKLTTVDGKVLLLAGSTVGGGTAVNWSASIKTPDHVLKEWSV  343

Query  1153  THKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRD  1332
               K+  +G+  Y+ AM+ V  R+GV      E FQN ++++GC +LG     + RN+S +
Sbjct  344   DRKIPFYGTSAYQSAMDEVFKRIGVTKNCTVESFQNEIIKQGCEKLGLEAGQVARNSSEN  403

Query  1333  HYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVV----HNKKTGREQAAG  1500
             HYCG C +GCK G KKGT  TWL D V++G  VI   C+A K +     N++  R     
Sbjct  404   HYCGSCGYGCKTGDKKGTHSTWLVDAVNNG-AVILTGCKAEKFILGNNKNEEMRRRCRGV  462

Query  1501  VMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYF  1680
             +  V   N  K    +++RVT+ ACG+L TP LL ++GL+N NIG NLHLHPV+FAWGYF
Sbjct  463   IAAVEGRNITKRKLHIEARVTISACGSLMTPPLLVSTGLKNKNIGHNLHLHPVLFAWGYF  522

Query  1681  PDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSG  1860
             P++       + +  SY+GGI+T + KV     +S    +I++  L PG  ++++PW+SG
Sbjct  523   PESKS-----KIKGNSYEGGIITRLHKVQTG--DSNNNCIIESAGLGPGACASLLPWISG  575

Query  1861  TDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAA  2040
              D+K +M +++RTA +FAL RD+ SGE      ++Y++ + DK  LK GL + LRIL AA
Sbjct  576   NDMKDQMSKYARTARIFALIRDEGSGEVREEGRVTYHLNEMDKEHLKLGLRQCLRILIAA  635

Query  2041  GAEEIGTCHRAGKILKPKGASRDEIDEF----VEKESSRDLGNLSTLIGSAHQMGSCRMG  2208
             GA E+GT    G+ L+  G  +++++EF    V     +      T+  SAHQ+ SCRMG
Sbjct  636   GAVEVGTYRSDGQRLRCDGIKKEDVEEFLDTIVADPGPKSAAEYWTIYCSAHQLSSCRMG  695

Query  2209  VDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
                    V+  GE+WE EGLFL D SV P+A+GVNPM+T+Q+ A+C ++ + + LK
Sbjct  696   STEEDGAVDENGESWEAEGLFLCDGSVIPSAIGVNPMITIQSTAFCISKKIAESLK  751



>ref|XP_006412936.1| hypothetical protein EUTSA_v10024496mg [Eutrema salsugineum]
 gb|ESQ54389.1| hypothetical protein EUTSA_v10024496mg [Eutrema salsugineum]
Length=756

 Score =   476 bits (1224),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 296/724 (41%), Positives = 416/724 (57%), Gaps = 60/724 (8%)
 Frame = +1

Query  268   VAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEI  447
             VA MI +  +   V +LR+ L +LS R GTL+LCG   L   +P++  F E+   KR E+
Sbjct  76    VAEMIVKNGRSQAVKILRIILTILSFRFGTLLLCGSLCLDKDWPFVHKFSELPLDKREEV  135

Query  448   VRSWS--CCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDY--CGPDPDSNKKP  615
             +R WS    ++  L+  +   K   L  FFSQ +EN +N + +AI Y     +  SNK  
Sbjct  136   LRKWSRQSGFLLPLRITFFLTKFYTLFYFFSQTDENLKNPALEAIGYSIATTETSSNK--  193

Query  616   AGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQK  795
                     TR++  T                      PL  G+I    E    +   L +
Sbjct  194   --------TRKEEGTRR--------------------PLEAGIIETKHETDITITQSLIE  225

Query  796   LGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARs  975
              G  V+     +   N    I CDAV+VGSGSGGGV A  LA AG KVLVLEKG YFA  
Sbjct  226   KGVHVA-----RDDDNGVHRIRCDAVIVGSGSGGGVAAANLAKAGLKVLVLEKGNYFAAQ  280

Query  976   slsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDET  1155
               S LEG S+ E+Y  GGL+ + D   ++LAGS VGGG+ +NWSASI+TP HVL+EW E 
Sbjct  281   DYSALEGPSMQELYEKGGLMTTVDGKFMILAGSTVGGGTAVNWSASIRTPDHVLQEWSER  340

Query  1156  HKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDH  1335
              K+E FGS+EY+ AM+ V  R+GV      EGFQN VLR+GC  LG  V ++PRN+  DH
Sbjct  341   SKIEFFGSQEYQSAMDEVTRRIGVTERCVKEGFQNQVLREGCERLGLKVVSVPRNSPEDH  400

Query  1336  YCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVK--VVHNKKTGRE---QAAG  1500
             YCG C +GC++G K GT  TWL D V++G  VI    +A +  +V N  +G E   +  G
Sbjct  401   YCGSCGYGCREGYKNGTDRTWLVDAVENG-AVILTGVKAERFILVENTNSGNERKKRCVG  459

Query  1501  VMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYF  1680
             V+        ++   +++RVTV + G+L TP L+ +SGL N NIGRNL LHPV+  WGYF
Sbjct  460   VIASSVGGKMEKKFMIEARVTVSSAGSLLTPPLMLSSGLENRNIGRNLRLHPVLMTWGYF  519

Query  1681  PDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSG  1860
             P+        E   K Y+GGI+T++  +  N  E G  A+++ P + P  F+ + PW+SG
Sbjct  520   PEES-----SEFSGKMYEGGIITSVHHI--NDGEKGCRAILENPLIGPASFAGLSPWVSG  572

Query  1861  TDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAA  2040
              D++ RM ++ RTA +FAL RD  SGE      + Y   K DK +L+ G+ + LR+L AA
Sbjct  573   ADLEERMMKYGRTAHVFALVRDNGSGEVMKESEVRYRTSKKDKENLRVGIRQALRVLVAA  632

Query  2041  GAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRDLGNLS------TLIGSAHQMGSCR  2202
             GA EIGT    G+ +K +G +R+ ++EF+++  +   G +S      T   SAHQMGSCR
Sbjct  633   GAVEIGTYRSDGQRMKCEGVTREAVEEFLDRVDAD--GGVSTNREYWTTYFSAHQMGSCR  690

Query  2203  MGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTH  2382
             MG       V+  GE+WE EGLF+ D SV P+A+GVNPM+T+Q+ AYC ++ ++  L+  
Sbjct  691   MGHTEEEGAVDENGESWEAEGLFVCDGSVLPSAVGVNPMITIQSAAYCISKRIVDSLQRQ  750

Query  2383  NHMQ  2394
              + +
Sbjct  751   KNKE  754



>ref|XP_010532673.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Tarenaya hassleriana]
Length=770

 Score =   476 bits (1224),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 302/797 (38%), Positives = 461/797 (58%), Gaps = 64/797 (8%)
 Frame = +1

Query  37    MISDDGDSLFSNG---KAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVD  207
             + SD    LF+N      E+ + G + G    + A M ++ ++ DT LP +     A   
Sbjct  15    LFSDRQHLLFNNTLPIMGEKSDPGKF-GRRGFTAAEMESLAAVCDTILPPLSPEDSAGGG  73

Query  208   DD------SVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLC  369
             +D      +++ F   SAS      +   ++ +R     V+++RL L LLS+R GTL+LC
Sbjct  74    EDDHPNKEALRSFCSASASQPLFLHQTVELMLKRGFIEAVLVVRLVLLLLSSRFGTLLLC  133

Query  370   GKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI-LKTFYLGMKVMVLLSFFSQVNE  546
             G   L   +P+++ F  +S  KR  +++ W    +   ++  ++ +KV+ L  FFS +  
Sbjct  134   GTHCLVPNWPFVERFGSLSLEKRERVLQKWFRNRLLFPIRVAFIFIKVIFLFCFFSWIGP  193

Query  547   NNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLG  726
             N +N +W+AI Y         K       ++ +E+                         
Sbjct  194   NGDNPAWEAIQY-------QVKAEDNESSYVPKER-------------------------  221

Query  727   PLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggvi  906
             PL KG+++  +E    + + +++    V+      GS + +  I+CDAV++GSGSGGGV 
Sbjct  222   PLEKGMVDTMKETDSTLPETIRQKELGVT-----FGSKHDTIEIKCDAVIIGSGSGGGVA  276

Query  907   agvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGG  1086
             A VLANAG KV+VLEKG YF  S  S  EG  L E+Y  GG++ + D ++++LAG+ VGG
Sbjct  277   AAVLANAGLKVVVLEKGSYFVSSEYSPFEGPGLSELYESGGILPTVDGNLMILAGATVGG  336

Query  1087  GSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMV  1266
             GS +N+SASI+TP  VL+EW E HK+ LFG++EY  AM+ V  R+ V  +   E FQN V
Sbjct  337   GSVVNYSASIKTPESVLREWAEDHKIPLFGTQEYVSAMDVVWKRISVTEKCRQESFQNQV  396

Query  1267  LRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPEC  1446
             LRKGCL LG  VE +PRN+S +H CG C +GC+ G K+G+  TWL D V+ G  +I   C
Sbjct  397   LRKGCLNLGLKVENVPRNSSENHCCGSCCYGCRQGDKQGSDRTWLLDAVNHG-AIILTGC  455

Query  1447  EAVKVVHNKKTGR------EQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKN  1608
             +A +++  K   R       + +GVM    N    +   ++++VTV+ACGA+ TP L+  
Sbjct  456   KAERLILEKNMNRGVGAKKMKCSGVMANSLNGNISKKLHIEAKVTVVACGAISTPPLMIK  515

Query  1609  SGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESG  1788
             SGL+N NIGRNLHLHPV+ AWGYFP+    K   + +   Y+G I+T+++KVV+ +++S 
Sbjct  516   SGLKNRNIGRNLHLHPVLMAWGYFPE----KETSDLKGSIYEGEILTSINKVVS-YQDSE  570

Query  1789  YGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISY  1968
               A+I+TP+L P  F+A+ PW+SG D+K RM ++SRTA L  + RD+ SGE  +   + Y
Sbjct  571   VRAIIETPALGPSSFAAVCPWISGLDMKNRMIKYSRTAHLLTIVRDRGSGEIKTEGRVKY  630

Query  1969  NMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSRD  2148
              + KTDK ++  GL + LRIL +A A E+GT    G+  K KG     I+EF++  ++ D
Sbjct  631   VVDKTDKENIVAGLRQSLRILISARAVEVGTHRSDGQRFKCKGMDEKAIEEFLDTVTAED  690

Query  2149  ----LGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNP  2316
                 L     + GSAHQMGSCR+G +     ++P GE+WE EGLF+ D SV P+A+GVNP
Sbjct  691   GASSLTEKWAVYGSAHQMGSCRIGENEEEGALDPNGESWEAEGLFVCDGSVLPSAIGVNP  750

Query  2317  MVTVQAIAYCTAQSVLK  2367
             M+T+ A +Y  +  + +
Sbjct  751   MITIMATSYGISTGIAR  767



>ref|XP_003574052.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Brachypodium 
distachyon]
Length=757

 Score =   474 bits (1220),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 291/763 (38%), Positives = 440/763 (58%), Gaps = 52/763 (7%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
             L PA M  + ++    +P++ +P     + D ++ F+  S + +  P  VA +   R   
Sbjct  29    LRPAQMEALRAMCGALIPSLPLPPEEGGNKD-LERFYLASGADSAVPDEVAELAFTRCVW  87

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCC-YIK  477
                +L+ +ALWLL+TR+GTL LCG   +      ++ F ++   +R   ++ W+   ++ 
Sbjct  88    EAGVLVSVALWLLTTRLGTLALCGWLCVVDS--SVRRFADMPVERREAALQRWTRARWLI  145

Query  478   ILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHM  657
              +K  +  +K ++   F+++VNEN+EN  WKAI Y  PD +  ++          R ++ 
Sbjct  146   PVKIAFAIVKSLLFNVFYTKVNENSENPCWKAIGYSVPDVEEQRR----------RRKNG  195

Query  658   TLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGS  837
             T +  +++               PL KGV+   +     +   L   G  V P      S
Sbjct  196   TEATARRR---------------PLDKGVVETRELDDAALLRSLAAKGLTVKP----AAS  236

Query  838   GNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMY  1017
               P   ++CDAV+VGSG GGGV A VLA AGHKV+VLEKG YFA    S +EG S++ +Y
Sbjct  237   NGPHHTVQCDAVIVGSGCGGGVAAAVLAAAGHKVVVLEKGDYFAAQDYSSVEGPSMERLY  296

Query  1018  LGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHA  1197
               GG+  + ++  +L +G+ VGGGS +NWSASI+TP  +L+EW   H L +F S  Y  A
Sbjct  297   EQGGIFCTSNVTTVLYSGTTVGGGSAVNWSASIRTPREILQEWSRGHGLPVFASAGYAQA  356

Query  1198  METVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKK  1377
             M+ V +R+ V     +EGFQN V+R+GC  LG PV+ +PRN+S DHYCG C+ GC  G K
Sbjct  357   MDAVSARLAVSDACLEEGFQNKVVRRGCEALGLPVDAVPRNSSADHYCGSCNLGCPTGDK  416

Query  1378  KGTSETWLADLVDSGNGVIFPECEAVKVVHNKK---TGREQAAGVMFVYQNNGAKEFCFV  1548
             +GT  TWL D V+ G  VI   C+A + +        GR     V  V      ++   +
Sbjct  417   RGTDTTWLVDAVEHG-AVIITGCKADRFILESSYTGKGRRGKKCVGLVATCGITQKKLRI  475

Query  1549  KSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPE---  1719
             +++V++ ACGAL TP LL++SGL+N +IGRNLHLHPV  AWGYFP+ P  +     E   
Sbjct  476   EAKVSISACGALMTPPLLRSSGLKNRHIGRNLHLHPVSMAWGYFPEEPEPQEQDAEEIIS  535

Query  1720  KKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRT  1899
              K Y+GGI+T+M +V           +I+TP+L PG F++++PW SG D+K RM+R++RT
Sbjct  536   GKCYEGGIITSMHRVTER-------TIIETPALGPGAFASLVPWESGRDMKERMRRYART  588

Query  1900  AILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGK  2079
             A  FAL RD+ +G       + +   + D   L+NGL + LRI+ AAGA E+GT    G 
Sbjct  589   AHAFALVRDRGAGSVDGEGRVHFVPSRDDNEELRNGLRRALRIMVAAGAAEVGTHRSDGL  648

Query  2080  ILKPKGASRDEIDEFVEKES-SRDLGNLST----LIGSAHQMGSCRMGVDPRSSVVNPMG  2244
              L+ KG   ++++ F++  + +R      T    L+ SAHQMGSCRMG  PR   V+  G
Sbjct  649   RLRCKGVRDEDLEAFLDDVAVARGPMQAGTDTWALLCSAHQMGSCRMGSSPREGAVDGSG  708

Query  2245  ETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
             E+WE EGL++ D S+ PTA+GVNPM+T+Q++AYC ++++ + L
Sbjct  709   ESWEAEGLYVCDGSLLPTAVGVNPMITIQSLAYCLSKNIAESL  751



>ref|NP_001142399.1| uncharacterized protein LOC100274574 [Zea mays]
 gb|ACN25897.1| unknown [Zea mays]
 tpg|DAA49653.1| TPA: hypothetical protein ZEAMMB73_468308 [Zea mays]
Length=675

 Score =   469 bits (1208),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 274/691 (40%), Positives = 399/691 (58%), Gaps = 57/691 (8%)
 Frame = +1

Query  340   STRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCC-YIKILKTFYLGMKVMV  516
             STR GTL+LCG+ SL + FPY++ F +++P +R   +R W+   ++  L+  +  +K++ 
Sbjct  21    STRAGTLLLCGRLSLGAGFPYVRRFADMAPERREAALRRWNRVRWLFPLRIAFAIVKILC  80

Query  517   LLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDV  696
                F++ VNEN+EN  WKAI Y   +P  +            R +  T S  +       
Sbjct  81    HYVFYAMVNENSENPYWKAIGYSVDEPRED------------RARTATPSPSR-------  121

Query  697   IPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavv  876
                       PL  GV+        ++   L   G  V P      S      ++CDAV+
Sbjct  122   ----------PLDVGVVETRLLDDNKLLRSLVGRGLTVKP----ASSDANHHTVQCDAVI  167

Query  877   vgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDI  1056
             VGSG GGGV A VLA+AG+KV+V+EKG YF     S +EG S++ ++  GG+  + ++  
Sbjct  168   VGSGCGGGVAAAVLASAGYKVVVVEKGDYFTAEDYSSIEGPSMERLFERGGIFCTSNVTT  227

Query  1057  LLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSE  1236
             ++  G+ VGGGS +NWSASI+TP  V +EW   H L +F S  Y  AM+ VC+R+GV   
Sbjct  228   MIFTGATVGGGSAVNWSASIRTPEEVTQEWAREHGLPVFASPGYAQAMDAVCARLGVTDG  287

Query  1237  VEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVD  1416
              ++EGFQN V+R+GC  LG   + +PRN+S  H+CG C+FGC  G K+GT  TWL D V 
Sbjct  288   CQEEGFQNKVVRRGCEALGLCADAVPRNSSDAHFCGSCNFGCPTGDKRGTDTTWLVDAVA  347

Query  1417  SGNGVIFPECEAVKVVHNKK-------TGREQAAGVMFVYQNNGAKEFCFVKSRVTVIAC  1575
              G  VI   C+A   V  K           ++  G++    +NG  +   ++++V++ AC
Sbjct  348   RG-AVILTGCKAEYFVLEKNHSSGSGSGRGKKCVGLVATCASNGVTKKLRIEAKVSIAAC  406

Query  1576  GALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAM  1755
             GAL TP LL+ SGL+N +IG NLHLHPV  AWGYFP+   +K  P    K Y+GGI+T+M
Sbjct  407   GALMTPPLLRRSGLKNRHIGSNLHLHPVSMAWGYFPE---NKQDPPLSGKCYEGGIITSM  463

Query  1756  SKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTS  1935
              +V           +I+TP+L PG F+A++PW SG D+K RM+R+SRTA  FAL RD+  
Sbjct  464   HRVTDR-------TIIETPALGPGAFAAMVPWESGRDMKERMRRYSRTAHAFALVRDRGV  516

Query  1936  GEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEI  2115
             G       + +   + D   L+NGL +VLRIL AAGA E+GT    G  L+ KG   +++
Sbjct  517   GFVDGEGRVRFTPSREDVDELRNGLRRVLRILVAAGAAEVGTHRSDGLRLRCKGLRDEDL  576

Query  2116  DEF-----VEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLAD  2280
             + F     +EK       +   L  SAHQMGSCRMG  P+   V+  GE+WE EGL++ D
Sbjct  577   EGFLDEVTIEKGPMHSRVDKWALHCSAHQMGSCRMGSSPKDGAVDGRGESWEAEGLYVCD  636

Query  2281  SSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
              S+ PTA+GVNPM+T+Q+IA+C ++ + + +
Sbjct  637   GSLLPTAVGVNPMITIQSIAFCLSKGIAETM  667



>ref|XP_009137800.1| PREDICTED: long-chain-alcohol oxidase FAO4B [Brassica rapa]
Length=744

 Score =   471 bits (1213),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 308/774 (40%), Positives = 434/774 (56%), Gaps = 61/774 (8%)
 Frame = +1

Query  82    ERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTP  261
             +R  +G YS G  +S   + T++ I  T LP       A  + ++V  F   S S     
Sbjct  17    KRQGEGGYSHGFSISQ--IQTLSFICQTLLPPPPPETTA--EQNAVDSFNVASGSQPPFT  72

Query  262   QRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRA  441
               VA MI +  +   V +LR+ L +LS R GTL LCG   L+  +P++  F ++   KR 
Sbjct  73    DEVAEMIVKNGRSEAVKVLRIILTILSYRFGTLFLCGSLCLAKDWPFVHKFSDLPLDKRE  132

Query  442   EIVRSWS---CCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKK  612
             EI+R WS     ++ +  TF+L  K   L SFFSQ ++N +N + +AI Y     +  K 
Sbjct  133   EILRMWSRQSGLFLPLRITFFLA-KFYTLFSFFSQRDQNMKNPALEAIGYSIDTTEMRK-  190

Query  613   PAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQ  792
                                      +D  P        PL KG+I    E    +   L 
Sbjct  191   -------------------------DDEAPR-------PLEKGIIETKNESDVTIRQSLT  218

Query  793   KLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFAR  972
             + G  V+     +   +    I CD V+VGSGSGGGV A  LA AG KVLVLEKG YF  
Sbjct  219   QKGVHVA-----RDDNDNIHRIRCDVVIVGSGSGGGVAAANLAKAGLKVLVLEKGNYFTS  273

Query  973   sslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDE  1152
                S LEG S+ E+Y  G L+ + D   ++LAGS VGGG+ +NWSASI+TP HVLKEW E
Sbjct  274   RDYSGLEGPSMLELYEKGALMTTVDGKFMVLAGSTVGGGTAVNWSASIRTPDHVLKEWSE  333

Query  1153  THKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRD  1332
               K+E FGS+EY+ AM+ V  R+GV      EG QN VLR+GC  LG  V ++PRN+  D
Sbjct  334   ESKIEFFGSQEYQLAMDEVVRRLGVTERCVKEGLQNQVLREGCERLGLKVVSVPRNSPED  393

Query  1333  HYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTG---REQAAGV  1503
             HYCG C +GC++G K GT +TWL D V++G  VI    +A + V     G   +++  GV
Sbjct  394   HYCGSCGYGCREGGKNGTDKTWLVDAVENG-AVILTGVKAERFVFTDNEGKKKKKRCVGV  452

Query  1504  MFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFP  1683
             +        ++   +++RVTV + G+L TP L+++SGL N NIGRNL LHPV+  WGYFP
Sbjct  453   IASSVGGKIEKKVMIEARVTVSSAGSLLTPPLMRSSGLENRNIGRNLKLHPVLMTWGYFP  512

Query  1684  DAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGT  1863
             +  GS    E   K Y+GGI+T++  V  +  ESG  A+++TP   P  ++ + PW+SG 
Sbjct  513   E-KGS----EFSGKMYEGGIITSVHHV--HDAESGCRAILETPLAGPASYAGLSPWVSGA  565

Query  1864  DIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAG  2043
             D+K RM ++ RT+ LFAL RD  SGE      ++Y   K D+ +L+ GL + LR+L AAG
Sbjct  566   DLKERMMKYGRTSHLFALVRDYGSGEVLKENEVTYRTSKKDRENLRVGLRQALRVLVAAG  625

Query  2044  AEEIGTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGV  2211
             A E+GT    G+ +K +G +R+ ++EF++   +       G   T   SAHQMGSCRMG 
Sbjct  626   AVEVGTYRSDGQRIKCEGMTREAMEEFLDGVDAVGGVSTKGEYWTTYFSAHQMGSCRMGR  685

Query  2212  DPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
                   V+  GE+WE EGLF+ D SV P+A+GVNPM+T+Q+ AYC +  ++  L
Sbjct  686   TAEEGAVDEKGESWEAEGLFVCDGSVLPSAVGVNPMITIQSTAYCISTRIVASL  739



>gb|KFK29401.1| hypothetical protein AALP_AA7G128800 [Arabis alpina]
Length=745

 Score =   471 bits (1213),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 306/776 (39%), Positives = 431/776 (56%), Gaps = 68/776 (9%)
 Frame = +1

Query  94    DGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVA  273
             +G YS G   S + + ++  I  T LP    P   A++D     F   S S       VA
Sbjct  19    EGGYSHG--FSHSQIQSLAVICQTLLPP---PSQQAINDS----FKVASGSQPPFTDEVA  69

Query  274   WMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVR  453
              MI +  +   V +LR+ L +LS R+GTL+LCG   L   +P++  F ++    R EI+R
Sbjct  70    DMIVKNGRGEAVKVLRIILMILSFRLGTLLLCGSLCLDKNWPFVLKFSQLPLDTREEILR  129

Query  454   SWSC---CYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGK  624
              WS      +    TF+L  K   L  FFSQ +EN +N + +AI YC  D  S+KK    
Sbjct  130   KWSTQSGFLLPFRITFFLA-KFYTLFYFFSQTDENLKNPALEAIGYC-VDTSSSKKSQVD  187

Query  625   SKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGF  804
              K+                               PL  G+I    E    +   L + G 
Sbjct  188   EKR------------------------------PPLESGIIETKHENDITITKSLIEKGL  217

Query  805   PVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARssls  984
              V+         +    I CDAVVVGSGSGGGV A  LA AG KV+VLEKG YFA    S
Sbjct  218   HVA-------RDDNVHRIRCDAVVVGSGSGGGVAAANLAKAGFKVVVLEKGNYFAAQDYS  270

Query  985   llegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKL  1164
              LE  S+ E+Y   GL+ + D   ++LAGS VGGG+ +NWSASI+TP HVL+EW E  KL
Sbjct  271   GLEAPSMLELYEKSGLLTTIDGKFMILAGSTVGGGTAVNWSASIRTPDHVLQEWSEESKL  330

Query  1165  ELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCG  1344
             + FGS+EY+ AM+ V  R+GV      +GFQN +LRKGC  LG  V+++PRN+  DHYCG
Sbjct  331   KFFGSQEYQSAMDEVTRRIGVTERCVKDGFQNQILRKGCERLGLEVDSVPRNSPDDHYCG  390

Query  1345  WCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTG-----REQAAGVMF  1509
              C +GC+ G+K GT  TWL D +++G  VI    +A + +    T      +++  GV+ 
Sbjct  391   SCGYGCRTGEKNGTDRTWLVDAIENG-AVILTGIKAERFILEDNTSSSNGRKKRCVGVIA  449

Query  1510  VYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDA  1689
                     +   +++RVTV + G+L TP L+ +SGL N NIGRNL LHPV+  WGYFP+ 
Sbjct  450   SSIGGKIGKKLMIEARVTVSSAGSLLTPPLMLSSGLENRNIGRNLRLHPVLMTWGYFPE-  508

Query  1690  PGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDI  1869
              GS    E   K Y+GGI+T++  +  N  ESG  A+++ P + P  ++ + PW+SG D+
Sbjct  509   KGS----EFSGKMYEGGIITSVHHM--NDTESGCRAILENPLMGPASYAGLSPWVSGADL  562

Query  1870  KTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAE  2049
             K RM ++ RTA LFAL RD  SGE      ++Y   K D+ +L+ GL + LR+L AAGA 
Sbjct  563   KERMMKYGRTAHLFALVRDSGSGEVMKESEVTYRTTKKDRENLRVGLRQALRVLVAAGAV  622

Query  2050  EIGTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDP  2217
             E+GT    G+ +K +G S++ ++EF++   +       G   T   SAHQMGSCRMG   
Sbjct  623   EVGTYRSDGQRIKCEGISKEAMEEFLDGVDAVGGVSTKGEYWTSYFSAHQMGSCRMGHST  682

Query  2218  RSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTHN  2385
                 ++  GE+WE EGLF+ D SV P+A+GVNPM+T+Q+ AYC +  ++  L+T  
Sbjct  683   EEGALDDNGESWEAEGLFVCDGSVLPSAVGVNPMITIQSTAYCISTRIVHLLQTRQ  738



>ref|XP_010457422.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Camelina sativa]
Length=752

 Score =   471 bits (1211),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 283/771 (37%), Positives = 450/771 (58%), Gaps = 65/771 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVP------QHAAVDDDSVKLFFQTSASIAGTPQRVAWMI  282
              SP+ +  +++I +  LP V +       +   + +D++  FF++S+     P  VA ++
Sbjct  23    FSPSDLQALSAICEAILPPVPLQSLDLEMKLKVLRNDALLSFFKSSSGPHVRPDEVAELL  82

Query  283   SERLQHPKVIllrlalwllSTRIGTLMLCGKASLS-SQFPYLQSFPEISPHKRAEIVRSW  459
             + +     VI++R+ L +L+ R+GTL+LCG   L  + +P+L  F EIS  KR ++++ W
Sbjct  83    ATKAIPVTVIVVRIVLRILTFRLGTLLLCGLVCLDQANWPFLLKFSEISLEKREKVLQRW  142

Query  460   SC-CYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKW  636
             +   Y  + +  ++ +K + L  +F+  +EN EN +W AI Y                  
Sbjct  143   NTQWYNPLARIGFMMIKAIFLFYYFTWTDENTENPAWDAIGY------------------  184

Query  637   ITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSP  816
                   M  SE  +  E             PL KG+I  ++E    +  R+   G  V+ 
Sbjct  185   ---SVDMNESEGMEHKER------------PLEKGIIETDKEDEMTIKQRMINKGLKVT-  228

Query  817   CIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslslleg  996
                 +   + ++ IECDAVVVGSG GGGV A  LA +G +V+VLEKG YF     S LEG
Sbjct  229   ----EDRESDTYKIECDAVVVGSGCGGGVAAANLAKSGLRVVVLEKGNYFVPRDYSSLEG  284

Query  997   sslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFG  1176
              S  EM+    L+ + D     +AGS VGGGS +NW+AS++TP  +++EW     + +F 
Sbjct  285   PSTFEMFESNSLLMTHDGRFRFMAGSTVGGGSVVNWAASLKTPDAIIEEWSVQRGISVFS  344

Query  1177  SKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSF  1356
             S++Y+ AM+ VC R+GV   V  EGFQN +LRKGC +LG  V T+PRN++  HYCG CSF
Sbjct  345   SEKYKTAMDRVCKRIGVTERVIREGFQNQILRKGCEKLGLDVTTVPRNSTDGHYCGSCSF  404

Query  1357  GCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVV-------HNKKTGREQAAGVMFVY  1515
             GC  G+K+GT  TWL D V++ N VI  +C+A KV+         K++GR++    +   
Sbjct  405   GCPTGEKRGTDLTWLVDAVNN-NAVILTQCKAEKVILAENDAHKRKESGRKKRCLGVAAS  463

Query  1516  QNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPG  1695
              +N  ++   + ++VT++ACG+L TP LL +SGL+NPNIGR LH+HP++ AWGYFP+   
Sbjct  464   LSNRTRKKLQINAKVTIVACGSLKTPQLLASSGLKNPNIGRGLHIHPILMAWGYFPEKKS  523

Query  1696  SKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKT  1875
                  + E  +++G I+TA+   V   + +     ++TP++ PG F+A++PW+SG+DIK 
Sbjct  524   -----DFEGAAHEGEIVTAL-HYVHPMDSTTSNITLETPAIGPGTFAALVPWVSGSDIKE  577

Query  1876  RMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEI  2055
             R+ ++SRT+ +F + RD+  GE      + Y + K D+ +L  GL++ L+ILAAAGA E+
Sbjct  578   RLAKYSRTSHIFVMVRDEGVGEVKGGI-VKYRLTKADEENLTIGLKQALQILAAAGAAEV  636

Query  2056  GTCHRAGKILKPKGASRDEIDEFVEK-ESSRDLGNLS---TLIGSAHQMGSCRMGVDPRS  2223
             GT    G+ +K  G   ++++ F++  E+   + ++S   T   +AHQMG CRMG   + 
Sbjct  637   GTYRSDGQRIKCDGMKHNDLEAFLQTVEAPAGVMSMSKHWTHSFTAHQMGCCRMGATEKE  696

Query  2224  SVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
               ++  GE+WE E L++ D+SV PTALGVNPM+T+Q+ AYC +  + + +K
Sbjct  697   GAIDGKGESWEAEDLYVCDASVLPTALGVNPMITIQSTAYCISNRIAELMK  747



>ref|XP_002464495.1| hypothetical protein SORBIDRAFT_01g019470 [Sorghum bicolor]
 gb|EER91493.1| hypothetical protein SORBIDRAFT_01g019470 [Sorghum bicolor]
Length=774

 Score =   471 bits (1211),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 297/799 (37%), Positives = 443/799 (55%), Gaps = 74/799 (9%)
 Frame = +1

Query  52    GDSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVP--QHAAVDDDS---  216
             G  L    + ER   G++        A M  + ++    +P++ +P     ++  DS   
Sbjct  17    GHPLLRGCRRERYTHGLHL-------AQMEALRAMCGALIPSLPLPPVTERSLHGDSSDG  69

Query  217   -----VKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKAS  381
                  ++ F+  SA+    P+ VA +++ R     V+L+ + LW+LST++GTL LCG+  
Sbjct  70    GERKDLERFYLASAADGTIPEEVAELVT-RCVWEAVVLVNVVLWILSTKVGTLALCGRLC  128

Query  382   LSS-QFPYLQSFPEISPHKRAEIVRSWSCC-YIKILKTFYLGMKVMVLLSFFSQVNEN-N  552
             +S  +FPY++ F ++   +R + +  W+   ++  LK  ++ +K++   +F++ +NEN +
Sbjct  129   ISGGKFPYVRKFADMPVERREQALTQWNRTRWLFPLKITFVVVKILSHYAFYTTINENSD  188

Query  553   ENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPL  732
             +N SWKAI Y  P                    H      + + E    P        PL
Sbjct  189   DNPSWKAIGYSVP--------------------HGEEETREDETEAAPSPR-------PL  221

Query  733   HKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviag  912
               G++         +   L   G  V P        N    + CD V+VGSG GGGV A 
Sbjct  222   DNGIVETKALDDTALLTSLMARGLEVKPAAP---PANAYHTVRCDVVIVGSGCGGGVAAA  278

Query  913   vLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGS  1092
             VLA+AGHKV+V+EKG YF     S +EG S++ +Y  GG+  + ++  +L  G+ VGGGS
Sbjct  279   VLASAGHKVVVIEKGDYFTAEDYSSVEGPSMERLYEKGGIFCTTNVTTILFTGTTVGGGS  338

Query  1093  TINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLR  1272
              INWSASI+TP  V +EW   H L +F S  Y  AM+ VC+R+ V     DEGFQN V+R
Sbjct  339   AINWSASIRTPEEVRQEWAREHGLPVFASPGYVQAMDAVCARLAVTDGCRDEGFQNKVVR  398

Query  1273  KGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEA  1452
             +GC  L    + +PRN+S DH+CG C  GC  G+K+GT  TWL D V  G  VI   C+A
Sbjct  399   RGCEALALRADAVPRNSSEDHFCGSCYIGCPTGEKRGTDTTWLVDAVARG-AVILTGCKA  457

Query  1453  VKVV----HNKKTGRE--QAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSG  1614
              + +     N  +GR+  +  GV+    +NG  +   ++++V++  CGAL TP LL+NSG
Sbjct  458   ERFILESNSNSSSGRKGRKCVGVVARCMSNGITKELRIEAKVSISGCGALMTPPLLRNSG  517

Query  1615  LRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYG  1794
             L+N +IGRNLHLHPV  AWGYFP+   +K   +   K ++GGI+T+M +V          
Sbjct  518   LKNRHIGRNLHLHPVSMAWGYFPE---NKQQAQITGKCFEGGIITSMHRVTER-------  567

Query  1795  ALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNM  1974
              +I+TP+L PG F+++MPW SG D+K RM+R++RTA  FAL RD+ +G       + Y  
Sbjct  568   TIIETPALGPGCFASLMPWESGRDMKERMRRYARTAHAFALVRDRGAGTVDGEGRVRYTP  627

Query  1975  QKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDE-----IDEFVEKES  2139
              + D   L+NGL + LRIL AAGA E+GT    G  L+  G  RD+     +DE    E 
Sbjct  628   NRADAEELRNGLRRALRILVAAGAAEVGTHRSDGFGLRCNGGVRDDELEAFLDEVTVAEG  687

Query  2140  SRDLG-NLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNP  2316
                 G +   L  SAHQMGSCRMG  P+   V+  GE+WE EGL++ D S+ PTA+GVNP
Sbjct  688   PMRPGPDKWALHCSAHQMGSCRMGSSPKDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNP  747

Query  2317  MVTVQAIAYCTAQSVLKFL  2373
             M+T+Q+IA+C ++ + + L
Sbjct  748   MITIQSIAFCLSKGIAETL  766



>ref|NP_001176205.1| Os10g0474966 [Oryza sativa Japonica Group]
 dbj|BAH94933.1| Os10g0474966 [Oryza sativa Japonica Group]
Length=760

 Score =   470 bits (1209),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 293/777 (38%), Positives = 425/777 (55%), Gaps = 72/777 (9%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAV---------DDDSVKLFFQTSASIAGTPQRVA  273
             L  A M  + +I   F+P++     A            D  ++ F+  SA+ A  P  VA
Sbjct  28    LGAAQMEALRAICGAFIPSLPEAAAALAEADDEGRGGGDKDLERFYLASAADAAVPDEVA  87

Query  274   WMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQ------FPYLQSFPEISPHK  435
              ++  R     V L+ + LWLL+TR GTL LCG A+  +        P ++ F ++ P +
Sbjct  88    ELMVNRCAWEAVALVTVVLWLLATRAGTLALCGAAACVASSAAGGWLPSVRRFADLPPER  147

Query  436   RAEIVRSWSCC-YIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKK  612
             R   +R WS   ++  LK  +  +K++    F+++++E + N SWKAI Y          
Sbjct  148   REAALRRWSSARWLFPLKITFTVIKIICHFVFYTKLDEKSRNPSWKAIGY----------  197

Query  613   PAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQ  792
                              + EQ++      P +P     PL  GV+   +     +   L 
Sbjct  198   ---------AAPAAAAAAVEQRR------PASPSRR--PLEDGVVETRRMDDNALLRSLV  240

Query  793   KLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFAR  972
             + G  V      K        ++CDAVVVGSG GGGV A VLA+ G+KV+V+EKG YFA 
Sbjct  241   EKGLAV------KTGTAAHHTVQCDAVVVGSGCGGGVAAAVLASKGYKVVVVEKGDYFAT  294

Query  973   sslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDE  1152
                + LEG S++ +Y  GG+  + ++  +L  G+ VGGGS +NWSA I+TP  + +EW  
Sbjct  295   EDYTSLEGPSMERLYEKGGVFGTSNVTTILFTGATVGGGSAVNWSACIRTPAEIREEWSR  354

Query  1153  THKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRD  1332
              H L +F S  Y  AM+ VC R+ V    E+EGFQN VLR+GC  LG   + +PRN+S  
Sbjct  355   EHGLPVFASTAYAQAMDAVCDRIRVTGGCEEEGFQNRVLRRGCDALGMRADAVPRNSSEG  414

Query  1333  HYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTG-----REQAA  1497
             H+CG C+ GC  G KKGT  TWL D V+ G  VI   C+A   +  +  G      ++  
Sbjct  415   HFCGSCNLGCPTGDKKGTDTTWLVDAVERG-AVILTGCKAEHFILERNAGGRGGRSKRCV  473

Query  1498  GVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGY  1677
             G+M    ++G  +   ++++V++ ACGAL TP LL+NSGL+N +IGRNLHLHPV  AWGY
Sbjct  474   GLMATCTSSGITKKLRIEAKVSISACGALMTPPLLRNSGLKNRHIGRNLHLHPVSMAWGY  533

Query  1678  FPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLS  1857
             FPD+       E   K Y+GGI+T+M +V           +I+TP+L PG FSA++PW S
Sbjct  534   FPDSTA-----ELPGKCYEGGIITSMHRVTDR-------TIIETPALGPGAFSAVVPWES  581

Query  1858  GTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAA  2037
             G D+K RM+R++RTA  FAL RD+ +G       + ++  + D   L+ GL + LRIL A
Sbjct  582   GRDMKERMRRYARTAHAFALVRDRGAGAVDGEGRVRFSPSRDDAEELRAGLRRALRILVA  641

Query  2038  AGAEEIGTCHRAGKILKPKGASRDEIDEF-----VEKESSRDLGNLSTLIGSAHQMGSCR  2202
             AGA E+GT    G  L+ KG    +++ F     +EK       +   +  SAHQMGSCR
Sbjct  642   AGAAEVGTHRSDGLRLRCKGVRDADVEAFLDEVTIEKGPMYPGSDKWAIFCSAHQMGSCR  701

Query  2203  MGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
             MG  PR   V+  GE+WE EGL++ D S+ PTA+GVNPM+T+Q+IAYC +  +   L
Sbjct  702   MGASPRDGAVDGAGESWEAEGLYVCDGSLLPTAVGVNPMITIQSIAYCLSNGIADTL  758



>ref|XP_004982882.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Setaria 
italica]
Length=762

 Score =   470 bits (1209),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 296/796 (37%), Positives = 436/796 (55%), Gaps = 78/796 (10%)
 Frame = +1

Query  52    GDSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQ--------HAAVD  207
             G  L    K ER   G       L P  M  + ++    +P++ V +        H    
Sbjct  17    GHPLLGGCKRERYTHG-------LRPPQMEALRAMCGALIPSLPVVEGHHGGDADHGRGS  69

Query  208   DDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLS  387
              D V+ F+  SA+    P  VA +++ R     V+L+ + LW+LSTR+GTL LCG+  +S
Sbjct  70    KDVVERFYLASAADGTIPDEVAELVT-RCVWEAVVLVNVVLWILSTRVGTLALCGRLCMS  128

Query  388   SQFPYLQSFPEISPHKRAEIVRSWS-CCYIKILKTFYLGMKVMVLLSFFSQVNENNENIS  564
              +FPY++ F ++   +R E +  W+   ++  LK  ++ +KV+   +F++ VNEN++N  
Sbjct  129   GKFPYVRKFADMPVERREEALGRWNKARWLFPLKITFVVIKVLSHYAFYTMVNENSDNPC  188

Query  565   WKAIDYCGPDPDSNKK-PAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKG  741
             WKAI Y  PD +  ++ P+ +S                                  L  G
Sbjct  189   WKAIGYSVPDMEEPREAPSPRS----------------------------------LDNG  214

Query  742   VINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLA  921
             V+         +   L   G  V      +   +    ++CD V+VGSG GGGV A  LA
Sbjct  215   VVETKALNDTTLLRSLVDKGLVV------RTDASTYHTVQCDVVIVGSGCGGGVAAAALA  268

Query  922   NAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTIN  1101
             +AGHKV+V+EKG+YF     S +EG S++ +Y  GG+  + ++  +L  GS VGGGS +N
Sbjct  269   SAGHKVVVVEKGEYFTAEDYSSVEGPSMERLYEKGGIFCTSNVTTVLFTGSMVGGGSAVN  328

Query  1102  WSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGC  1281
             WSASI+TP  V +EW   H L +F S  Y  AM+ VC+R+ V     +EGFQN  +R+GC
Sbjct  329   WSASIRTPEEVRQEWAREHGLPVFASPGYVEAMDAVCARLAVTDGCREEGFQNKAVRRGC  388

Query  1282  LELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKV  1461
               LG   + +PRN+S  H+CG C  GC  G K+GT  TWL D V  G  VI   C+A   
Sbjct  389   EALGLRADAVPRNSSEGHFCGSCHLGCPTGDKRGTDTTWLVDSVARG-AVILTGCKAECF  447

Query  1462  VHNKKTGR-----EQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNP  1626
             +    +G       +  G++      G  +   ++++V++ ACGAL TP LL+NSGL+N 
Sbjct  448   ILESNSGENARRSRKCVGLVATCMVAGVTKKLRIEAKVSIAACGALMTPPLLRNSGLKNR  507

Query  1627  NIGRNLHLHPVVFAWGYFPDAPGSKAWPEP-EKKSYQGGIMTAMSKVVANFEESGYGALI  1803
             +IGRNLHLHPV  AWGYFP+    +  P P   K Y+GGI+T M +V           ++
Sbjct  508   HIGRNLHLHPVSMAWGYFPENKQQEPQPPPLTGKCYEGGIITTMHRVTER-------TIV  560

Query  1804  QTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKT  1983
             +TP+L PG F++++PW SG D+K RM+R++RTA  FAL RD+ +G       + Y+  + 
Sbjct  561   ETPALGPGCFASMVPWESGRDMKDRMRRYARTAHAFALVRDRGAGTVDGEGRVCYSPARD  620

Query  1984  DKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASR-DEIDEFVEKESSRDLGNL  2160
             D   L+NGL + LRIL AAGA E+GT    G  L+  G  R DE+D F+++ +      L
Sbjct  621   DVDELRNGLRRALRILVAAGAAEVGTHRSDGHRLRCDGGVRDDELDAFLDEVTVATGPML  680

Query  2161  S-----TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVT  2325
                    L+ SAHQMGSCRMG  PR   V+  GE+WE EGL++ D S+ PTA+GVNPM+T
Sbjct  681   PGSDKWALLCSAHQMGSCRMGSSPRDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPMIT  740

Query  2326  VQAIAYCTAQSVLKFL  2373
             +Q+ AYC ++ + + L
Sbjct  741   IQSTAYCLSEGIAESL  756



>ref|XP_010433200.1| PREDICTED: long-chain-alcohol oxidase FAO4B [Camelina sativa]
Length=748

 Score =   469 bits (1207),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 302/762 (40%), Positives = 428/762 (56%), Gaps = 59/762 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  300
              SP+ + ++  I  T LP    P+       S   F   S++       VA MI +  + 
Sbjct  29    FSPSQIQSLAVICQTLLPPS--PKQ------SFDSFNVVSSTQPPFTDEVAEMIVKNGRS  80

Query  301   PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS--CCYI  474
               V +LR+ L +LS R GTL+LCG       +P++  F E+   +R EI+R WS    Y+
Sbjct  81    EAVKVLRIILMVLSFRFGTLLLCGSLCFDKSWPFVLKFSELPLDRREEILRKWSRQSGYL  140

Query  475   KILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQH  654
                +  +   K   L  FFS  +EN +N + +AI +C  DP  +     KS+        
Sbjct  141   LPFRITFFLAKFYTLFYFFSHTDENMKNPALEAIGFC-LDPKDSSISNKKSE--------  191

Query  655   MTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKG  834
                ++E+++               PL  G+I    E    +   L + G   +     + 
Sbjct  192   ---ADEKRR---------------PLESGIIETLHESDITITQSLIEKGVHAA-----RD  228

Query  835   SGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEM  1014
                    I CD VVVGSGSGGGV A  LA AG KVLVLEKG YF     S LEG S+ E+
Sbjct  229   DDENVHRIRCDVVVVGSGSGGGVAAANLAKAGLKVLVLEKGNYFTAQDYSGLEGPSMLEL  288

Query  1015  YLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRH  1194
             Y  GG + + D   ++LAGS VGGG+ INWSASI+TP HVL+EW E  K++ FGS+EY+ 
Sbjct  289   YEKGGFLTTVDGKFMVLAGSAVGGGTAINWSASIRTPDHVLQEWSEGSKIKFFGSQEYKT  348

Query  1195  AMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGK  1374
             AM+ V +R+GV  +   +GFQN VLRKGC  LG  VE++PRN+S DHYCG C +GC+ G 
Sbjct  349   AMDQVTTRIGVTEKCVKDGFQNQVLRKGCERLGLQVESVPRNSSEDHYCGLCGYGCRAGH  408

Query  1375  KKGTSETWLADLVDSGNGVIFPECEAVK--VVHNKKTGRE-QAAGVMFVYQNNGAK--EF  1539
             K GT  TWL D V++G  VI    +A +  +V N  + +E Q   V  +  + G K  + 
Sbjct  409   KNGTDRTWLVDAVENG-AVILTGIKAERFILVDNTSSSKERQKRCVGVIASSVGGKIGKK  467

Query  1540  CFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPE  1719
               +++RVTV + G+L TP L+ +SGL+N NIGRNL LHPV+  WGYFP+        E  
Sbjct  468   FIIEARVTVSSAGSLLTPPLMLSSGLKNQNIGRNLRLHPVLMTWGYFPEKD-----SEFS  522

Query  1720  KKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRT  1899
              K Y+GGI+T++  +  N  ESG  A+++ P + P  ++ + PW+SG D+K RM ++ RT
Sbjct  523   GKMYEGGIITSLHYM--NDAESGCKAILENPLIGPASYAGLSPWVSGADLKERMMKYGRT  580

Query  1900  AILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGK  2079
             A LFAL RD  SGE      ++Y   K D+ +L+ GL + LR+L AAGA E+GT    G+
Sbjct  581   AHLFALVRDIGSGEVMKENEVTYRTTKKDRENLRAGLRQALRVLIAAGAVEVGTYRSDGQ  640

Query  2080  ILKPKGASRDEIDEFVEKES----SRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGE  2247
              +K +G +R+ I+EF+++          G   T   SAHQM SCRMG       ++  GE
Sbjct  641   RMKCEGTTRESIEEFLDEVDVVGGVSTKGEYWTSYFSAHQMSSCRMGATEEEGALDENGE  700

Query  2248  TWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
             +WE EGLF+ D SV P+A+GVNPM+T+Q+ AYC A  ++  L
Sbjct  701   SWEAEGLFVCDGSVLPSAVGVNPMITIQSTAYCIATRIVNSL  742



>emb|CDY51703.1| BnaA03g58930D [Brassica napus]
Length=737

 Score =   469 bits (1206),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 307/770 (40%), Positives = 433/770 (56%), Gaps = 60/770 (8%)
 Frame = +1

Query  94    DGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVA  273
             +G YS G  +S   + T++ I  T LP    P+  A + ++V  F   S S       VA
Sbjct  13    EGGYSHGFSISQ--IQTLSFICQTLLPPPPPPESTA-EQEAVDSFNVASGSQPPFTDEVA  69

Query  274   WMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVR  453
              MI +  +   V +LR+ L +LS R GTL LCG   L+  +P++  F ++   KR EI+R
Sbjct  70    EMIVKNGRSEAVKVLRIILTILSYRFGTLFLCGSLCLAKDWPFVLKFSDLPLDKREEILR  129

Query  454   SWS---CCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGK  624
              WS     ++ +  TF+L  K   L SFFSQ ++N +N + +AI Y     + +K     
Sbjct  130   MWSRQSGLFLPLRITFFLA-KFYTLFSFFSQRDQNMKNPALEAIGYSIDTTEMSK-----  183

Query  625   SKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGF  804
                                  +D  P        PL KG+I    E    +   L + G 
Sbjct  184   ---------------------DDEAPR-------PLEKGIIETKNESDVTIRQSLTQKGV  215

Query  805   PVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARssls  984
              V+     +   +    I CD V+VGSGSGGGV A  LA AG KVLVLEKG YF     S
Sbjct  216   HVA-----RDDNDNIHRIRCDVVIVGSGSGGGVAAANLAKAGLKVLVLEKGNYFTSRDYS  270

Query  985   llegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKL  1164
              LEG S+ E+Y  G L+ + D   ++LAGS VGGG+ +NWSASI+TP HVLKEW E  K+
Sbjct  271   GLEGPSMLELYEKGALMTTVDGKFMVLAGSTVGGGTAVNWSASIRTPDHVLKEWSEESKI  330

Query  1165  ELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCG  1344
             E FGS+EY+ AM+ V  R+GV      EG QN VLR+GC  LG  V ++PRN+  DHYCG
Sbjct  331   EFFGSQEYQLAMDEVVRRLGVTERCVKEGLQNQVLREGCERLGLEVVSVPRNSPEDHYCG  390

Query  1345  WCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTG---REQAAGVMFVY  1515
              C +GC++G K GT +TWL D V++G  VI    +A + V     G   +++  GV+   
Sbjct  391   SCGYGCREGGKNGTDKTWLVDAVENG-AVIMTGVKAERFVFTDNEGKKKKKRCVGVIASS  449

Query  1516  QNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPG  1695
                  ++   +++RVTV + G+L TP L++ SGL N NIGRNL LHPV+  WGYFP+  G
Sbjct  450   VGGKIEKKFMIEARVTVSSAGSLLTPPLMRTSGLENRNIGRNLKLHPVLMTWGYFPE-KG  508

Query  1696  SKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKT  1875
             S    E   K Y+GGI++++  V  +  ESG  A+++TP   P  ++ + PW+SG D+K 
Sbjct  509   S----EFSGKMYEGGIISSVHHV--HDGESGCRAILETPLAGPASYAGLSPWVSGADLKD  562

Query  1876  RMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEI  2055
             RM ++ RT+ LFAL RD  SGE      ++Y   K D+ +L+ GL + LR+L AAGA E+
Sbjct  563   RMMKYGRTSHLFALVRDYGSGEVLKENEVTYRTSKKDRENLRVGLRQALRVLVAAGAVEV  622

Query  2056  GTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRS  2223
             GT    G+ +K +G +R+ ++EF++   +       G   T   SAHQM SCRMG     
Sbjct  623   GTYRSDGQRIKCEGITREAMEEFLDGVDAVGGVSTKGEYWTTYFSAHQMCSCRMGRTAEE  682

Query  2224  SVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
               V+  GE+WE EGLF+ D SV PTA+GVNPM+T+Q+ AYC +  ++  L
Sbjct  683   GAVDEKGESWEAEGLFVCDGSVLPTAVGVNPMITIQSTAYCISTRIVASL  732



>ref|XP_010102592.1| Long-chain-alcohol oxidase FAO1 [Morus notabilis]
 gb|EXB93709.1| Long-chain-alcohol oxidase FAO1 [Morus notabilis]
Length=742

 Score =   467 bits (1202),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 294/763 (39%), Positives = 448/763 (59%), Gaps = 66/763 (9%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAVDD---DSVKLFFQTSASIAGTPQRVAWMISER  291
              S A M ++ SI + F+P + +      +D    +V+ F+ +SAS    P  VA  I  R
Sbjct  29    FSAAEMESLASICEAFIPPLPLNSLEGKEDPPSKAVQSFYSSSASQNPIPHEVAEFIVRR  88

Query  292   LQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW-SCC  468
                   ++++L L LLSTR+GTL+LCG      ++ ++ +F  +   KR ++++ W    
Sbjct  89    AIIEGFLIVKLLLLLLSTRLGTLLLCGPLCFCEKWTFIHNFSRMPLEKREKVLQKWLRHK  148

Query  469   YIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITRE  648
             ++  ++  +L +KV+ L +FFS+++EN EN +++AI Y       N K            
Sbjct  149   FLTPIRLAFLYIKVVCLHTFFSRLDENGENQTYEAIGY-------NIK------------  189

Query  649   QHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQ  828
                          E+++P  P+    PL KG+I    +    +   L   G  V+   +Q
Sbjct  190   ------------SEEILPKTPKER--PLEKGIIETIYKTDSTLLHSLHLKGLNVTEDTEQ  235

Query  829   KGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslD  1008
                    + I+CD V+VGSG GGGV  G     G          Y  R ++SL + +   
Sbjct  236   N-----LYKIKCDVVIVGSGCGGGVAGGPPQAKG--------SLYLRRETISLPQITPPQ  282

Query  1009  EMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEY  1188
             ++Y  GG  AS    + ++AG+ VGGGS +NWSASI+TP  VL EW E +++ LFGS EY
Sbjct  283   KLYENGGTFASLCGKMAIMAGTAVGGGSVVNWSASIRTPKSVLNEWAEENRISLFGSSEY  342

Query  1189  RHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKD  1368
               AM+ V  R+GV  + ++EGFQN VLRKGC  LG  V+ +PRN+S +HYCG C FGC+ 
Sbjct  343   DSAMDIVFERLGVTEKCQEEGFQNQVLRKGCENLGLEVDFVPRNSSENHYCGSCGFGCRS  402

Query  1369  GKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTG----REQAAGVMFVYQNNGAKE  1536
             G KKGT  TWL D V++G  VI   C+A + V  K +     +++  GV+     NG + 
Sbjct  403   GDKKGTDLTWLVDAVENG-AVILSGCKAERFVLEKNSNGAKRKKKCLGVIAKSGGNGVQR  461

Query  1537  FCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEP  1716
                ++++VT+ ACGAL TP L+ +SGL+N NIGRNLHLHPV+ +WGYFP++       + 
Sbjct  462   RLQIEAKVTISACGALYTPPLMISSGLKNKNIGRNLHLHPVLMSWGYFPESNS-----DF  516

Query  1717  EKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSR  1896
             + K Y+GGI+T++ KVV+  E+S   A+I+TP+L P  ++A++PW SG D+K RM ++SR
Sbjct  517   KGKCYEGGIITSVHKVVS--EDSRVMAIIETPALGPASYAALVPWTSGLDMKNRMMKYSR  574

Query  1897  TAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAG  2076
             TA L  + RD+ SGE      +S+ +  TDK ++  GL + LRIL AAGA E+GT    G
Sbjct  575   TAHLITIIRDRGSGEVKKEGRVSFELDDTDKENMTAGLRQALRILVAAGAVEVGTHRSDG  634

Query  2077  KILKPKGASRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMG  2244
             + +K KG +++E+DEF++       + ++    T  GSAHQ+GSCRMGV+ +   V+  G
Sbjct  635   QRIKCKGINKNELDEFLDSVYAVGGAMEMSECWTNYGSAHQLGSCRMGVNEKEGAVDENG  694

Query  2245  ETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
             E+WE EGLF+ D+SV P+A+GVNPM+T+Q+ AYC ++ + + L
Sbjct  695   ESWEAEGLFVCDASVLPSAVGVNPMITIQSTAYCLSKKIAESL  737



>gb|EEC73620.1| hypothetical protein OsI_08118 [Oryza sativa Indica Group]
Length=770

 Score =   468 bits (1203),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 290/730 (40%), Positives = 414/730 (57%), Gaps = 48/730 (7%)
 Frame = +1

Query  205   DDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASL  384
             D  +V+ F   SA+    P  VA +++       + L+R  LWLL TR+GTL LCG   +
Sbjct  77    DAKAVRDFLLASAADPPVPDEVAELMTRMCLREALALVRAVLWLLGTRLGTLALCGGRCV  136

Query  385   S-SQFPYLQSFPEISPHKRAEIVRSWS-CCYIKILKTFYLGMKVMVLLSFFSQVNENNEN  558
             S  ++P++ +F E+   +R E +R WS    +  L+ F+L +KV  L  F+S ++E++EN
Sbjct  137   SWGRWPFVLTFAEMPVERREEALRRWSRVTVLPPLRAFFLVVKVFCLYVFYSWIDESSEN  196

Query  559   ISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHK  738
               W+AI Y    P +++ PA         E+H   +E  K+               PL  
Sbjct  197   PHWRAIGY---SPPTDEPPA---------EEH---TEATKR---------------PLDD  226

Query  739   GVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvL  918
             GV+         +   L + G  V+       +      +ECD  +VGSG GGGV A VL
Sbjct  227   GVVETINLTDASLPSSLAEKGLAVT-----DDAARNVCRVECDVAIVGSGCGGGVAAAVL  281

Query  919   ANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTI  1098
             A AGHKV+V+EKG YF     +  EG S++++Y  GG V + +   LLLAGS VGGGS +
Sbjct  282   AGAGHKVVVIEKGNYFTSRDYTSFEGPSINQLYESGGFVTTMNGGGLLLAGSTVGGGSAV  341

Query  1099  NWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKG  1278
             NWSA ++TP  V +EW   H L LF S +Y  AM+ V  R+GV S   +EG QN VLRKG
Sbjct  342   NWSACLKTPEFVRREWAAAHGLPLFASPDYAAAMDKVFERLGVTSGCTEEGLQNKVLRKG  401

Query  1279  CLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVK  1458
             C +LGY V+ + RN+S  HYCG C FGC+ G K+GT  TWL D V  G  VI   C+A K
Sbjct  402   CEKLGYKVDAVARNSSEGHYCGSCGFGCRTGDKRGTDTTWLVDAVGRG-AVILTGCKAEK  460

Query  1459  VVHNKKTGR-EQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIG  1635
             +V  +   R  +  GV+    N    +   V+++VTV A G+L TP LL+ SGL NP+IG
Sbjct  461   LVLERGGARGRRCVGVVARSTNPAITKTLEVRAKVTVSAAGSLLTPVLLQRSGLTNPHIG  520

Query  1636  RNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPS  1815
             +NLHLHP   AWGYFPD       P+ + K+Y+GGI+T+M KV  +   + + A+++TP 
Sbjct  521   KNLHLHPTALAWGYFPD-----TMPDLKGKAYEGGIITSMHKVETSGAGAPHRAILETPM  575

Query  1816  LHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVS  1995
             +        MPWLSG D K RM RF+RT  +F+L RD+ SG       ++Y +   D+  
Sbjct  576   MAVAATGTQMPWLSGRDSKERMLRFARTVHIFSLVRDRGSGTVHGERRVAYRLDAADRED  635

Query  1996  LKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLS  2163
             +++GL + LR+L AAGA E+GT    G+ L+ +G + + ++EF++        +      
Sbjct  636   IRDGLRRALRVLVAAGAAEVGTHRSDGQRLRCEGLTEESLEEFLDGVTVVRGPQSRSETW  695

Query  2164  TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAY  2343
              L  SAH MGSCRMG       V+  GE+WE E L++ D SV PTA+GVNPM+T+Q++AY
Sbjct  696   GLFCSAHHMGSCRMGATAGDGAVDARGESWEAERLYVCDGSVLPTAVGVNPMITIQSVAY  755

Query  2344  CTAQSVLKFL  2373
             C A  +   L
Sbjct  756   CLANGIADSL  765



>ref|XP_001753124.1| predicted protein [Physcomitrella patens]
 gb|EDQ82165.1| predicted protein [Physcomitrella patens]
Length=699

 Score =   464 bits (1195),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 286/697 (41%), Positives = 394/697 (57%), Gaps = 53/697 (8%)
 Frame = +1

Query  358   LMLCGKA--SLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTFYLGMKVMVLLSFF  531
             L+ CG    ++S ++P+ + F  ++P +R ++++ WS   +  L+  +  MK +   + +
Sbjct  24    LLACGGGVNTVSLKYPFFRKFANLTPEEREKMLQGWSTSLLSPLRRLFKSMKSITGYTLY  83

Query  532   SQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNP  711
             S++N+  EN +WKAI Y G DP    +   K + W  R     L +     +E  + +  
Sbjct  84    SKINDEGENAAWKAIGYTGMDPTVRSR--SKEEYWKPRP----LGDGHVDAKEAGVRL--  135

Query  712   ELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgs  891
             + +LG   KG   L++    +V  R  K G+  S         +    +ECD V+VGSGS
Sbjct  136   KAILGA--KGFSVLDEIKSFRVQSR--KWGYSES---------SSDIYMECDVVIVGSGS  182

Query  892   gggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAG  1071
             GGGV+A VLA  G KVLVLEKG+YFA   ++ LEG  +  MY   G  ++ D  + L+AG
Sbjct  183   GGGVMAAVLAKQGFKVLVLEKGQYFAAQDITSLEGPGMVNMYEKMGAQSTDDGGVSLIAG  242

Query  1072  SNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEG  1251
               VGGG+ +NW  S +TP HV  EW   H L+LF S +Y  AM+ V  R+ VQ EV+   
Sbjct  243   KTVGGGTAVNWCVSFKTPEHVRNEWVNDHGLDLFTSAQYEQAMQAVWKRLAVQPEVDKHS  302

Query  1252  FQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGV  1431
              QN VL +GC +LGY   T+ RN S  HYCGWCS+GC  GKK+ T+ETWL D V++GN V
Sbjct  303   LQNTVLLEGCKKLGYECGTLQRNCSPGHYCGWCSYGCPTGKKQSTAETWLVDAVNTGNAV  362

Query  1432  IFPECEAVKVVHNKKTGREQA-AGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKN  1608
             I   C A  V H+   G ++A  G   V          FVK+  TVIACGAL TP LL  
Sbjct  363   ILSNCHAKHVFHDANPGGKKARKGHGVVATIGEGSTRIFVKANATVIACGALLTPPLLLR  422

Query  1609  SGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESG  1788
             SGL+NPNIG+ L +HP    +GYFP+        EP+ KSY+GGIMT  S V    + + 
Sbjct  423   SGLKNPNIGKYLRVHPATTCFGYFPEE------VEPKGKSYEGGIMTTYSPVTLR-KPTE  475

Query  1789  YGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFS---  1959
             YG L++T   HP +F+A  PW SG D K R+   +RT+ +  + RDK  G A        
Sbjct  476   YGGLLETGVFHPAVFAAFHPWQSGADGKERLLHHARTSHITVVTRDKGFGTAKIDNDGLP  535

Query  1960  -ISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGK------------------I  2082
               SY +   D+ +L  G+ + LRIL AAGA EIGT    G+                  I
Sbjct  536   MYSYKISPYDEQTLIAGMIQSLRILVAAGAVEIGTQQLDGERFKHCNSNWPIRTDSSNCI  595

Query  2083  LKPKGASRDEIDEFVEKESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVE  2262
             +   GA+  +I+E++++   R     S  I SAHQ+GSCRMG  PR+S V+  GETWE E
Sbjct  596   VVTAGATPAQIEEYLDRVKRRRARQSSIQIASAHQLGSCRMGTSPRTSAVDARGETWEAE  655

Query  2263  GLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
             G+F+AD SV PT+ GVNPMVT+Q+IAYCTA SV  FL
Sbjct  656   GVFVADGSVLPTSSGVNPMVTIQSIAYCTADSVAHFL  692



>ref|XP_002454188.1| hypothetical protein SORBIDRAFT_04g026370 [Sorghum bicolor]
 gb|EES07164.1| hypothetical protein SORBIDRAFT_04g026370 [Sorghum bicolor]
Length=773

 Score =   466 bits (1198),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 292/739 (40%), Positives = 421/739 (57%), Gaps = 60/739 (8%)
 Frame = +1

Query  208   DDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCG-KASL  384
             D  V+ F   SA+    P  VA  +S +     + L+R  LWLL TR+G+L LCG ++ L
Sbjct  70    DKVVEEFLLASAADPPVPGEVAEQMSRKCLPEALALVRTVLWLLGTRLGSLALCGARSCL  129

Query  385   SSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI-LKTFYLGMKVMVLLSFFSQVNENNENI  561
             S +FP+++ F E+   +R   +R WS   + + L+ F++ +K + L  F+S  +EN++N 
Sbjct  130   SWRFPFVRRFDELPLEQREAALRRWSRQTLLLPLRMFFVIIKAICLHVFYSWTDENSKNP  189

Query  562   SWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKG  741
              W+AI Y  P  D    PA                 E ++ E+            PL  G
Sbjct  190   HWRAIGYSPPLADDEPAPA-----------------ESERPEKR-----------PLDDG  221

Query  742   VINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLA  921
             V+   +E    +   L   G  V+       S      +ECD V+VGSG GGGV A VLA
Sbjct  222   VVETTKETDASLPALLAAKGLTVA-----DDSAQNVCRVECDVVIVGSGCGGGVAAAVLA  276

Query  922   NAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTIN  1101
              AGHKV+V+EKG YF     + +E  S++++Y GGG V++     L+LAGS VGGG+ +N
Sbjct  277   GAGHKVVVIEKGNYFTARDYTAIEAPSMEQLYEGGGAVSTLSGSALVLAGSTVGGGTAVN  336

Query  1102  WSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGC  1281
             WSA I+TP  V +EW     L LF + EY  AM+ V  R+GV +   +EG QN VLRKGC
Sbjct  337   WSACIKTPDDVREEWASDQGLPLFATDEYAAAMDKVFERLGVTAGCAEEGLQNKVLRKGC  396

Query  1282  LELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKV  1461
              +LGY VE++ RN+S  HYCG C +GC+ G K+GT  TWL D V  G  VI   C+A K+
Sbjct  397   EKLGYKVESVSRNSSEGHYCGSCGYGCRSGDKRGTDRTWLVDAVSRG-AVILTGCKAEKL  455

Query  1462  VHNK------KTGREQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRN  1623
             +  +      ++  ++  GV+    N        V++RVTV ACG+L TP LL+ SGL N
Sbjct  456   LLERTGTGGAESRAKRCVGVVARSTNPTITRTLEVRARVTVSACGSLLTPVLLRGSGLSN  515

Query  1624  PNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYG---  1794
              +IG+NLHLHP    WGYFPD       P+ + K+Y+GGI+T++ KV     E   G   
Sbjct  516   RHIGKNLHLHPTALVWGYFPD-----TMPDLKGKTYEGGIITSLHKV-----EGAPGAPA  565

Query  1795  -ALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYN  1971
              A+++TP++       + PW+SG+D+K RM R+ RT  LF+L RD+ SG       ++Y+
Sbjct  566   RAILETPAMGLAGAGTLFPWVSGSDLKERMLRYGRTVHLFSLVRDRGSGSVLGERRVAYH  625

Query  1972  MQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ES  2139
             +  TD  +++ GL + LRILAAAGA EIGT    G+    +GA+   ++EF++       
Sbjct  626   LDATDAENMREGLRRALRILAAAGAAEIGTHRSDGQRFACRGATEAALEEFLDGVDVVRG  685

Query  2140  SRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPM  2319
              +      +L  +AHQMGSCRMGV  R   V+  GE+WEVE L++ D SV P+A+GVNPM
Sbjct  686   PQSKAEAWSLCCTAHQMGSCRMGVTARDGAVDARGESWEVESLYVCDGSVLPSAVGVNPM  745

Query  2320  VTVQAIAYCTAQSVLKFLK  2376
             VT+Q++AYC A  + + L+
Sbjct  746   VTIQSVAYCLATGIAESLR  764



>dbj|BAK02336.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=759

 Score =   464 bits (1195),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 298/762 (39%), Positives = 428/762 (56%), Gaps = 50/762 (7%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVP-QHAAVDDD--SVKLFFQTSASIAGTPQRVAWMISER  291
              S   M  +T++    +P++     H A+ D+  +V+ F   SA+    P  VA ++S  
Sbjct  30    FSATQMMALTAVCGALVPSLPPDGHHLAMADNGKAVREFLLASAADPPVPDEVAQLMSAM  89

Query  292   LQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSC-C  468
                  + L+R  LWLL TR+GTL LCG   LS   P++  F E+   +R + +R WS   
Sbjct  90    CLREALALVRTVLWLLGTRLGTLALCGARCLSWSSPFVHRFAEMPVDRREDALRRWSRET  149

Query  469   YIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITRE  648
              I  L+ F+L +KV  L  F+S  ++N+EN  W+AI Y  P  ++ ++            
Sbjct  150   MIPPLRLFFLLVKVYCLYVFYSWTDDNSENPHWQAIGYSPPTDEAAEQ------------  197

Query  649   QHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQ  828
                   EEQ              +  PL  GV+    +    +   L + G  V+     
Sbjct  198   ------EEQAS------------IKRPLEDGVVETIHQTDASLPTSLAEKGLAVT-----  234

Query  829   KGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslD  1008
             + +      IECD V+VGSG GGGV A VLA AGHKV+V+EKG YF     + +EG S+ 
Sbjct  235   EDAARNVCRIECDVVIVGSGCGGGVAAAVLAGAGHKVVVIEKGNYFTARDYTSIEGPSMS  294

Query  1009  EMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEY  1188
             ++Y  GG +++     LLLAGS VGGGS +NWSA I+TP  V KEW   H L LF   EY
Sbjct  295   QLYEYGGFMSTLSGSGLLLAGSTVGGGSAVNWSACIKTPDSVRKEWAAAHGLPLFDKSEY  354

Query  1189  RHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKD  1368
               AM+ V  R+GV S  ++EG QN VLRKGC +LGY VE + RN+S  H+CG C +GC+ 
Sbjct  355   TAAMDVVFKRLGVTSGCKEEGRQNKVLRKGCEKLGYNVEPVSRNSSEGHFCGSCGYGCRT  414

Query  1369  GKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGR--EQAAGVMFVYQNNGAKEFC  1542
             G K+GT  TWL D V  G  VI    +A K++     G+  ++ AGV+    N       
Sbjct  415   GDKRGTDTTWLVDAVSRG-AVILTGSKAEKLLFTDAAGKRGKRCAGVVAASSNPAITRKL  473

Query  1543  FVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEK  1722
              V+++VTV A G+L TP LL+ SGL+NP+IG+NLHLHP+  AWGYFP        PE + 
Sbjct  474   EVRAKVTVAAGGSLLTPVLLRGSGLKNPHIGKNLHLHPIAMAWGYFP----PDKMPELKG  529

Query  1723  KSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTA  1902
             K Y+GGI+T++ KV A+ +   + A+++TP + P       PW+SG D+K RM  + RT 
Sbjct  530   KMYEGGIITSLHKVEADGDGLPHRAILETPLMGPAAAGTQFPWVSGRDMKERMLNYGRTV  589

Query  1903  ILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKI  2082
              +F+L RD  SG       I+Y++   D+ + + GL + LRIL AAGA E+GT    G+ 
Sbjct  590   HIFSLVRDHGSGTVHGERRIAYHLDPVDRENQREGLRRALRILVAAGATEVGTHRSDGQK  649

Query  2083  LKPKGASRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGET  2250
             L+ KGA+ +E++EF++  S     +      +L  +AHQMGSCRM        V+  GE+
Sbjct  650   LRCKGATDEEVEEFLDGVSGVRGPQSKSEKWSLCCTAHQMGSCRMAATAGDGAVDTRGES  709

Query  2251  WEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
             WEVE L++ D SV P A+GVNPM+T+Q++AYC A  + + L+
Sbjct  710   WEVERLYVCDGSVLPGAVGVNPMITIQSVAYCLATGIAEQLR  751



>ref|XP_007035186.1| Alcohol oxidase, putative isoform 4, partial [Theobroma cacao]
 ref|XP_007035187.1| Alcohol oxidase, putative isoform 4, partial [Theobroma cacao]
 gb|EOY06112.1| Alcohol oxidase, putative isoform 4, partial [Theobroma cacao]
 gb|EOY06113.1| Alcohol oxidase, putative isoform 4, partial [Theobroma cacao]
Length=657

 Score =   461 bits (1185),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 270/621 (43%), Positives = 380/621 (61%), Gaps = 54/621 (9%)
 Frame = +1

Query  538   VNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPEL  717
             V ENN+N +W+AI Y   + +++K+        +++E+                      
Sbjct  81    VGENNDNPAWEAIGYQVDNVENSKQ--------VSKER----------------------  110

Query  718   LLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgg  897
                PL KG+I    E    +   L + G  V+   ++       + I+CDAV+VGSG GG
Sbjct  111   ---PLQKGMIETMHEKDSTLLQSLTQKGLQVTEDTERN-----VYKIKCDAVIVGSGCGG  162

Query  898   gviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSN  1077
             GV A +LA++G KV+VLEKG YFA S  S  EG S+D++Y  GG++ S D  +L+LAGS 
Sbjct  163   GVAAAILASSGLKVVVLEKGSYFAPSDYSPFEGPSMDQLYESGGILPSIDGQMLILAGST  222

Query  1078  VGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQ  1257
             VGGGS INWSASI+TP  +L+EW E  +L LFGS EY  AM+ VC R+GV    ++EGFQ
Sbjct  223   VGGGSAINWSASIKTPKSILQEWAEDCQLPLFGSPEYLSAMDNVCERIGVTENCKEEGFQ  282

Query  1258  NMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIF  1437
             N +LRKGC  LG  VE +PRN+S  HYCG C FGC+ G KKGT  TWL D V +G  VI 
Sbjct  283   NQILRKGCKNLGLEVENVPRNSSESHYCGSCGFGCRRGDKKGTDRTWLVDAVSNG-AVIL  341

Query  1438  PECEAVKVVHNKK----TGREQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLK  1605
               C+A K +  K       + +  GV+    N    +   ++++VT+ ACGAL TP L+ 
Sbjct  342   TGCKAEKFILEKNKICSKRKLKCLGVIAKTSNKNITKKLHIEAKVTISACGALFTPLLMH  401

Query  1606  NSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEES  1785
             +SGL+N NIGRNLHLHPV+ AWGYFPD+       E + K Y+GGI+T++ KVVA   ++
Sbjct  402   SSGLKNRNIGRNLHLHPVLMAWGYFPDSD-----SEFKGKVYEGGIITSVHKVVA--ADN  454

Query  1786  GYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSIS  1965
                A+I+TPSL P  ++A+ PW SG D+K RM  FSRTA +  + RD+ SG+  +   ++
Sbjct  455   KVRAIIETPSLGPAQYAALCPWESGLDMKRRMLNFSRTAHMITIIRDQGSGKVHAGGRVT  514

Query  1966  YNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESSR  2145
             Y     D+ ++++GL + LRIL AAGA E+GT    G+ ++ KG S  E++EF+E  S  
Sbjct  515   YKFDALDRQNMQSGLRQALRILVAAGAVEVGTHRSDGQSIRCKGISNKELEEFLESVSPV  574

Query  2146  D----LGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVN  2313
             +             SAHQMGSCRMG++ +   V+  GE+WE EGLF+ D+SV P A+GVN
Sbjct  575   EGPMFPAEKWVTHTSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPGAIGVN  634

Query  2314  PMVTVQAIAYCTAQSVLKFLK  2376
             PM+TVQ+ AYC ++ + + L+
Sbjct  635   PMITVQSTAYCLSKRIAESLR  655



>ref|XP_010548742.1| PREDICTED: long-chain-alcohol oxidase FAO4B-like [Tarenaya hassleriana]
Length=729

 Score =   462 bits (1189),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 276/680 (41%), Positives = 389/680 (57%), Gaps = 67/680 (10%)
 Frame = +1

Query  367   CGKASLSSQFPYLQSFPEISPHKRAEIVRSWS---CCYIKILKTFYLGMKVMVLLSFFSQ  537
             CG   + +++P+L +F ++  H R  I+R+WS     ++ +  TF L +K   L  FF++
Sbjct  94    CGTLCIDAKWPFLHTFSQLPLHTREAILRAWSKQSGVFVPLRITFLL-VKFFCLFYFFAR  152

Query  538   VNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPEL  717
              +EN++N +W++I Y         +   + + W          EE+              
Sbjct  153   ADENSKNPAWESIGY---------RVDTRERGW---------KEER--------------  180

Query  718   LLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgg  897
                PL KG+I    E    +   L   G  V+              I CD VVVGSG GG
Sbjct  181   ---PLEKGIIETVDEDDISIRQSLLDKGVHVAE----------DNTIRCDVVVVGSGCGG  227

Query  898   gviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSN  1077
             GV A  LA AG KV+VLEKG YF+    S LEG S+ E+Y   GL+ + D   ++LAGS 
Sbjct  228   GVAAANLAMAGLKVVVLEKGNYFSPRDYSSLEGPSMAELYEKSGLMTTVDGKFMVLAGST  287

Query  1078  VGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQ  1257
             VGGGS +NWSASI+TP HVL+EW   HK++LF S+EY  AM+ V +R+G+    E EGFQ
Sbjct  288   VGGGSAVNWSASIRTPDHVLQEWSTEHKIKLFNSQEYHSAMDQVMTRLGITESCEREGFQ  347

Query  1258  NMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIF  1437
             N VLRKGC  LG  VE +PRN+ RDHYCG C +GC+ G K GT  TWL D VD+G  VI 
Sbjct  348   NQVLRKGCERLGLKVEPVPRNSPRDHYCGSCGYGCRTGDKNGTDRTWLVDAVDNG-AVIL  406

Query  1438  PECEAVKVV----HNKKTGREQ----AAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTP  1593
                +A K +    ++   GR Q      GV+        K+  ++++R T+ A G+L TP
Sbjct  407   TGIKAEKFILEDSNDNSNGRHQRRKRCVGVIASSLGGKIKKKLWLEARATISAAGSLLTP  466

Query  1594  SLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVAN  1773
              L+ +S L NP+IGRNL LHPV+  WGYFP+  GS    E   K Y+GGI+T++  V   
Sbjct  467   PLMLSSKLENPHIGRNLRLHPVLMTWGYFPE-EGS----EFSGKMYEGGIITSVHHVTGT  521

Query  1774  FEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSP  1953
                SG  A+++TP + P  ++ ++PW+S  D K RM R+ RTA +FAL RD  SGE    
Sbjct  522   ESGSGSRAVLETPLIGPASYAGLVPWVSAADFKDRMVRYGRTAHVFALVRDNGSGEVVKE  581

Query  1954  FSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK  2133
               + Y + + DK SL+ GL + LRIL AAGA E+GT    G+ +K +G + + ++EF++ 
Sbjct  582   GDVKYRLSQKDKESLRVGLRQALRILIAAGAAEVGTYRSDGQRMKCEGLTAEAMEEFLDS  641

Query  2134  ESS----RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTA  2301
               +    R  G   T   SAHQMGSCRMG       V+  G++WE EGLF+ D SV P+A
Sbjct  642   VDAVGGVRTRGEHWTTYFSAHQMGSCRMGASAGEGAVDENGQSWEAEGLFVCDGSVLPSA  701

Query  2302  LGVNPMVTVQAIAYCTAQSV  2361
             +G+NPM+T+Q+ AYC ++ +
Sbjct  702   IGINPMITIQSTAYCISRRI  721



>ref|NP_001047464.1| Os02g0621800 [Oryza sativa Japonica Group]
 dbj|BAD21547.1| putative alcohol oxidase [Oryza sativa Japonica Group]
 dbj|BAF09378.1| Os02g0621800 [Oryza sativa Japonica Group]
Length=770

 Score =   463 bits (1191),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 288/730 (39%), Positives = 413/730 (57%), Gaps = 48/730 (7%)
 Frame = +1

Query  205   DDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASL  384
             D  +V+ F   SA+    P  VA +++       + L+R  LWLL TR+GTL LCG   +
Sbjct  77    DAKAVRDFLLASAADPPVPDEVAELMTRMCLREALALVRAVLWLLGTRLGTLALCGGRCV  136

Query  385   S-SQFPYLQSFPEISPHKRAEIVRSWS-CCYIKILKTFYLGMKVMVLLSFFSQVNENNEN  558
             S  ++P++ +F E+   +R E +  WS    +  L+ F+L +KV  L  F+S ++E++EN
Sbjct  137   SWGRWPFVLTFAEMPVERREEALGRWSRVTVLPPLRAFFLVVKVFCLYVFYSWIDESSEN  196

Query  559   ISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHK  738
               W+AI Y    P +++ PA         E+H   +E  K+               PL  
Sbjct  197   PHWRAIGY---SPPTDEPPA---------EEH---TEATKR---------------PLDD  226

Query  739   GVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvL  918
             GV+         +   L + G  V+       +      +ECD  +VGSG GGGV A VL
Sbjct  227   GVVETINLTDASLPSSLAEKGLAVT-----DDAARNVCRVECDVAIVGSGCGGGVAAAVL  281

Query  919   ANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTI  1098
             A AGHKV+V+EKG YF     +  EG S++++Y  GG V + +   LLLAGS VGGGS +
Sbjct  282   AGAGHKVVVIEKGNYFTSRDYTSFEGPSINQLYESGGFVTTMNGGGLLLAGSTVGGGSAV  341

Query  1099  NWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKG  1278
             NWSA ++TP  V +EW   H L LF + +Y  AM+ V  R+GV S   +EG QN VLRKG
Sbjct  342   NWSACLKTPEFVRREWAAAHGLPLFATPDYAAAMDKVFERLGVTSGCTEEGLQNKVLRKG  401

Query  1279  CLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVK  1458
             C +LGY V+ + RN+S  HYCG C FGC+ G K+GT  TWL D V  G  VI   C+A K
Sbjct  402   CEKLGYKVDAVARNSSEGHYCGSCGFGCRTGDKRGTDTTWLVDAVGRG-AVILTGCKAEK  460

Query  1459  VVHNKKTGR-EQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIG  1635
             +V  +   R  +  GV+    N    +   V+++VTV A G+L TP LL+ SGL NP+IG
Sbjct  461   LVLERGGARGRRCVGVVARSTNPAITKTLEVRAKVTVSAAGSLLTPVLLQRSGLTNPHIG  520

Query  1636  RNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPS  1815
             +NLHLHP   AWGYFPD       P+ + K+Y+GGI+T+M KV  +   + + A+++TP 
Sbjct  521   KNLHLHPTALAWGYFPD-----TMPDLKGKAYEGGIITSMHKVETSGAGAPHRAILETPM  575

Query  1816  LHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVS  1995
             +        MPWLSG D K RM RF+RT  +F+L RD+ SG       ++Y +   D+  
Sbjct  576   MAVAATGTQMPWLSGRDSKERMLRFARTVHIFSLVRDRGSGTVHGERRVAYRLDAADRED  635

Query  1996  LKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLS  2163
             +++GL + LR+L AAGA E+GT    G+ L+ +G + + ++EF++        +      
Sbjct  636   IRDGLRRALRVLVAAGAAEVGTHRSDGQRLRCEGLTEEALEEFLDGVTVVRGPQSRSETW  695

Query  2164  TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAY  2343
              L  SAH MGSCRMG       V+  GE+WE E L++ D SV PTA+GVNPM+T+Q++AY
Sbjct  696   GLFCSAHHMGSCRMGATAGDGAVDARGESWEAERLYVCDGSVLPTAVGVNPMITIQSVAY  755

Query  2344  CTAQSVLKFL  2373
             C A  +   L
Sbjct  756   CLANGIADSL  765



>gb|KEH23951.1| long-chain-alcohol oxidase FAO1 [Medicago truncatula]
Length=567

 Score =   456 bits (1172),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 258/559 (46%), Positives = 366/559 (65%), Gaps = 23/559 (4%)
 Frame = +1

Query  727   PLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggvi  906
             PL +G++    E    +   L + G  V+   +Q       + I+CD V+VGSGSGGGV 
Sbjct  21    PLQEGLVETTYETNSTLIQSLSEKGLEVTEDEEQN-----VYKIKCDVVIVGSGSGGGVA  75

Query  907   agvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGG  1086
             A +LAN+GHKV++LEKG+YF     S LE S+++E+Y  GG++ + D  +++LAGS VGG
Sbjct  76    AAILANSGHKVIILEKGEYFVSQDYSSLESSAMNELYESGGIMPTLDGKMMILAGSTVGG  135

Query  1087  GSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMV  1266
             GS INW+A ++TP  V KEW E +KL LF S +Y+ AM++VC R+GV  +   + FQN V
Sbjct  136   GSAINWAACVRTPDSVKKEWSEKYKLPLFTSSDYQSAMDSVCRRIGVTDKCNKQSFQNQV  195

Query  1267  LRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPEC  1446
             LRKGC  +G  VE++  NAS DHYCG C +GC+ G KKGT  TWL D V++G  VI   C
Sbjct  196   LRKGCERIGLKVESVAVNASEDHYCGSCCYGCRTGDKKGTDSTWLVDAVENG-AVILTGC  254

Query  1447  EAVK-VVHNKK--TGREQAAGVMFV--YQNNGAKEFCFVKSRVTVIACGALCTPSLLKNS  1611
              A K ++ N K  T R+  +GV+    +++   K+   ++S+VT+ +CG+L TP L+ +S
Sbjct  255   RAEKFIIENGKNETKRKNCSGVIAATSWRSKITKKL-QIESKVTISSCGSLLTPPLMISS  313

Query  1612  GLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGY  1791
             GL+NPNIGRNLHLHPV FAWGYFP+   + +       +++GGI+T++ KV+A  E S  
Sbjct  314   GLQNPNIGRNLHLHPVQFAWGYFPENMTNLS-----GNNHEGGIITSIHKVLA--ENSTP  366

Query  1792  GALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYN  1971
               +I+ P+L PG FS ++PW+SG D+K RM +++RTA LFAL RD  SGE  S   ISY 
Sbjct  367   KIIIEAPALGPGSFSVLVPWISGLDMKDRMAKYARTANLFALVRDIGSGEVRSEGKISYR  426

Query  1972  MQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESS---  2142
             + + D+ +L+ GL K LRIL AAGA E+GT    G+ +K +G   +E++EF++  S    
Sbjct  427   LDQMDRENLRIGLRKSLRILVAAGAVEVGTYRSDGQKIKCEGIKEEELEEFLDTVSVVGG  486

Query  2143  -RDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPM  2319
              R    L T+  SAHQMGSCRMG +     V+  GE+WE +GL++ D SV P+A+GVNPM
Sbjct  487   PRSRSELWTMFSSAHQMGSCRMGKNEEEGAVDENGESWEAKGLYVCDGSVLPSAVGVNPM  546

Query  2320  VTVQAIAYCTAQSVLKFLK  2376
             VT+Q+ AYC A  + + LK
Sbjct  547   VTIQSTAYCIASKIAESLK  565



>gb|AAP54248.2| GMC oxidoreductase family protein, expressed [Oryza sativa Japonica 
Group]
Length=784

 Score =   462 bits (1189),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 289/771 (37%), Positives = 429/771 (56%), Gaps = 54/771 (7%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVPQHAAV---DDDSVKLFFQTSASIAGTPQRVAWMISER  291
             L  A M  + ++    +PA+   +        D  V+ F+  +A+ +  P  VA +   R
Sbjct  31    LGAAQMGALRAMCGALIPALPAEEEDGARGGGDMDVERFYLATAAESTVPDEVAELTMTR  90

Query  292   LQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCY  471
                   +L+R+ LW+L+TR+GTL LCG+  +S +FPY++ F ++   +R   ++      
Sbjct  91    CIWEAGVLVRIILWILATRVGTLALCGRRCVSGEFPYVRRFADMPVERREAALKRSRSSL  150

Query  472   IKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQ  651
                  +          +  +  V+EN EN SWKAI Y    P + ++P  +     T   
Sbjct  151   PSSRSSATSSSTPRFQVLIYHIVDENLENPSWKAIGY--SVPAAEEEPQKEEPTEATPTP  208

Query  652   HMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQK  831
                 +   +                PL  GV+   Q     +   L + G  +     + 
Sbjct  209   APATAPPCR----------------PLDNGVVETKQLDDNALLMSLAEKGLAL-----KT  247

Query  832   GSGNPS---FVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegss  1002
             G+ +PS     + CDAVVVGSG GGGV A VLA+AG+KV+V+EKG YFA    S LEG +
Sbjct  248   GASSPSAHHHTVLCDAVVVGSGCGGGVAAAVLASAGYKVVVVEKGDYFAARDYSSLEGPT  307

Query  1003  lDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSK  1182
             ++ +Y  GG+ ++ ++   + AG+ VGGGS +NWSA I+TP +VL+EW   H L LFG +
Sbjct  308   MERLYENGGVFSTANVTTTMFAGATVGGGSAVNWSACIRTPANVLQEWSNDHGLPLFGGQ  367

Query  1183  EYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGC  1362
              Y  AM+ VC+R+GV     +EGFQN  +R+GC  LG  VE + RN+S  H+CG C+ GC
Sbjct  368   GYVQAMDAVCARLGVTGRCREEGFQNKAVRRGCEALGLRVEAVSRNSSEGHFCGSCNLGC  427

Query  1363  KDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKKTGREQA-----AGVMFVYQNNG  1527
               G+K+GT  TWL D V  G  VI   C+A + +    TG          GV+      G
Sbjct  428   PTGEKRGTDTTWLVDAVGRG-AVILTGCKAERFILETNTGGGGGRRKKCVGVVAKCLGKG  486

Query  1528  AKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAW  1707
               +   ++++V+V ACGAL TP LL+NSGL+N +IGRNLHLHPV  AWGYFPD+      
Sbjct  487   ITKKLRIEAKVSVSACGALMTPPLLRNSGLKNRHIGRNLHLHPVSMAWGYFPDSTA----  542

Query  1708  PEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQR  1887
              E   KSY+GGI+T+M +V           +I+TP+L PG F+A++PW SG D+K RM+R
Sbjct  543   -ELPGKSYEGGIITSMHRVTDR-------TIIETPALGPGAFAAVVPWESGRDMKERMRR  594

Query  1888  FSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCH  2067
             ++RTA    L RD+ +G       + +   + D   L+ GL + LRIL AAGA E+GT  
Sbjct  595   YARTAHAVVLVRDRAAGTVGGEGRVRFTPSRGDAGELRAGLRRALRILVAAGAAEVGTNR  654

Query  2068  RAGKILKPKGASRDEIDEFVEKESSRDLGNLS------TLIGSAHQMGSCRMGVDPRSSV  2229
               G  L+ KGA  ++++ F++ E S + G +        L+ SAHQMGSCRMG   +   
Sbjct  655   SDGLRLRCKGARDEDVEAFLD-EVSVEKGPMHPGSDKWALLASAHQMGSCRMGRSAKHGG  713

Query  2230  VNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLKTH  2382
             V+  GE+WE EGL++ D S+ PTA+GVNPM+T++++AYC A+ + + L + 
Sbjct  714   VDGGGESWEAEGLYVCDGSLLPTAVGVNPMITIESVAYCVAKGIAESLASR  764



>ref|XP_010438427.1| PREDICTED: long-chain-alcohol oxidase FAO4B-like [Camelina sativa]
Length=745

 Score =   461 bits (1185),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 301/785 (38%), Positives = 432/785 (55%), Gaps = 66/785 (8%)
 Frame = +1

Query  52    GDSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFF  231
             G  L  + K E  N G        SP+ + ++  I  T LP             S   F 
Sbjct  10    GHRLLRSKKREGYNHG-------FSPSQIHSLAVICQTLLPPSG--------KQSFDSFN  54

Query  232   QTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQS  411
               S++       VA MI +  +   V +LR+ L +LS R GTL+LCG   L   +P++  
Sbjct  55    VVSSTQPPFTDEVAEMIVKNGRSEAVKVLRIILMILSFRFGTLLLCGSLCLDKSWPFVLK  114

Query  412   FPEISPHKRAEIVRSWS--CCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYC  585
             F E+   +R EI++ WS    Y+   +  +   K   L  FFS  +EN +N + +AI +C
Sbjct  115   FSELPLDRREEILKKWSRQSGYLLPFRITFFLAKFYTLFYFFSHTDENLKNPALEAIGFC  174

Query  586   GPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEP  765
                 DS+      S K I        ++E+++               PL  G++    E 
Sbjct  175   LDTKDSSS-----SNKKIE-------ADEKRR---------------PLESGIVETLHES  207

Query  766   RRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLV  945
                +   L + G   +     +        I CD ++VGSGSGGGV A  LA AG KVLV
Sbjct  208   DITITQTLIEKGVHAA-----RDDDENVHRIRCDVIIVGSGSGGGVAAANLAKAGLKVLV  262

Query  946   LEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTP  1125
             LEKG YF     S LEG S+ E+Y  GG + + D   ++LAGS VGGG+ INWSASI+TP
Sbjct  263   LEKGNYFTAQDYSGLEGPSMLELYEKGGFLTTVDGKFMVLAGSAVGGGTAINWSASIRTP  322

Query  1126  PHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVE  1305
              HVL+EW E  K++ FGS+EY+ AM+ V +R+GV  +   +GFQN VLRKGC  LG  VE
Sbjct  323   DHVLQEWSEGSKIKFFGSQEYKTAMDEVKTRIGVTEKCVKDGFQNQVLRKGCERLGLKVE  382

Query  1306  TIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVK--VVHNKKT  1479
             ++PRN+  DHYCG C +GC+ G K GT  TWL D V++G  VI    +A +  +V N  +
Sbjct  383   SVPRNSREDHYCGLCGYGCRAGHKNGTDRTWLVDAVENG-AVILTGIKAERFILVDNTSS  441

Query  1480  GRE-QAAGVMFVYQNNGAK--EFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHL  1650
              +E Q   V  +  + G K  +   +++RVTV + G+L TP L+ +SGL+N NIGRNL L
Sbjct  442   SKERQKRCVGVIASSVGGKIGKKFIIEARVTVSSAGSLLTPPLMLSSGLKNQNIGRNLRL  501

Query  1651  HPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGM  1830
             HPV+  WGYFP+        E   K Y+GGI+T++  +  N  ESG  A+++ P + P  
Sbjct  502   HPVLMTWGYFPEKD-----SEFSGKMYEGGIITSLHNM--NDAESGCKAILENPLIGPAS  554

Query  1831  FSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGL  2010
             ++ + PW+SG D+K RM ++ RTA LFAL RD  SGE      ++Y     D+ +L+ GL
Sbjct  555   YAGLSPWVSGADLKERMMKYGRTAHLFALVRDIGSGEVMKENEVTYRTTTKDRENLRAGL  614

Query  2011  EKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLIGS  2178
                LR+L AAGA E+GT    G+ +K +G +R+ ++EF+++  +       G   T   S
Sbjct  615   RLALRVLIAAGAVEVGTYRSDGQRIKCEGTTREAMEEFLDEVDAVGGVSTKGEYWTSYFS  674

Query  2179  AHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQS  2358
             AHQM SCRMG       ++  GE+WE EGLF+ D SV P+A+GVNPM+T+Q+ AYC +  
Sbjct  675   AHQMSSCRMGATEEEGALDENGESWEAEGLFVCDGSVLPSAVGVNPMITIQSTAYCISTR  734

Query  2359  VLKFL  2373
             ++  L
Sbjct  735   IVNSL  739



>ref|XP_010526493.1| PREDICTED: long-chain-alcohol oxidase FAO4B-like [Tarenaya hassleriana]
Length=761

 Score =   460 bits (1183),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 291/732 (40%), Positives = 427/732 (58%), Gaps = 58/732 (8%)
 Frame = +1

Query  226   FFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYL  405
             F++ +AS    P  VA M+    +   ++++++AL +LS+R+G+L+LCG     S++P+L
Sbjct  69    FYRATASQPPIPDEVAEMMVRHGRPEAIMVVKIALKILSSRLGSLLLCGTLCFDSKWPFL  128

Query  406   QSFPEISPHKRAEIVRSWS---CCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAI  576
              +F E+  + R EI+R+WS     ++ +  TF L +K   +  +FSQ +  ++N +W+AI
Sbjct  129   HTFSELPLNVREEIMRTWSKQGGLFVPLRITFLL-VKFFSMFYYFSQSDGRSKNPAWEAI  187

Query  577   DYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLN  756
              Y                   TRE     +EE++                PL KG+I   
Sbjct  188   GYTVD----------------TREGSWDETEEER----------------PLDKGIIETA  215

Query  757   QEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHK  936
             QE    +   L   G  V+    ++   +    I CDAVV+GSGSGGGV A  LA AG  
Sbjct  216   QENDVTIRQSLINRGVHVA----EEEDDDGVHKIRCDAVVIGSGSGGGVAAANLAKAGLN  271

Query  937   VLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASI  1116
             V+VLEKG YF     S LEG SL E+Y   G++ + D   ++LAGS VGGGST+NWSASI
Sbjct  272   VIVLEKGNYFTPRDYSSLEGPSLVELYEKSGILTTVDGKFMILAGSAVGGGSTVNWSASI  331

Query  1117  QTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGY  1296
             +TP HVL+EW   +K+ LF S+EY+ AM+ V  R+GV+     +GFQN VLRKGC  LG 
Sbjct  332   RTPDHVLREWSAENKINLFTSREYQSAMDEVIRRIGVEERCGRDGFQNQVLRKGCERLGL  391

Query  1297  PVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHNKK  1476
              V+ +PRN+  DHYCG C +GC+ G KKGT +TWL D VD G  VI    +A + +    
Sbjct  392   KVDPVPRNSPGDHYCGSCGYGCRTGDKKGTDQTWLVDAVDYG-AVILTGIKAERFILEDN  450

Query  1477  TG--------REQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNI  1632
                       R++  GV+        K+  ++++RV++ A G+L TP L+ +SGL+NP+I
Sbjct  451   NNSDSSYNGRRKRCVGVVAGSLGGKMKKKLWIEARVSISAAGSLLTPPLMISSGLKNPHI  510

Query  1633  GRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTP  1812
             GRNL LHPV+  WGYFP+  GS    E + K Y+GGI+T++  V     +SG  A+++TP
Sbjct  511   GRNLRLHPVLMTWGYFPE-EGS----EFQGKMYEGGIITSVHHVRDAESKSGSRAVLETP  565

Query  1813  SLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKV  1992
              + P  ++ ++PW+S  D K RM R+ RTA +FAL RD  SGE      ++Y + + DK 
Sbjct  566   LIGPASYAGLVPWVSAADFKERMVRYGRTAHVFALVRDNGSGEVVKEGDVTYRLSQLDKE  625

Query  1993  SLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNL  2160
              L  GL + LRIL AAGA E+GT    G+ +K KG ++  ++EF++   +    R  G  
Sbjct  626   RLSVGLRQALRILIAAGAVEVGTYRSDGQRMKCKGLTKQAMEEFLDSVDAVGGVRTRGEH  685

Query  2161  STLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIA  2340
              T   SAHQMGSCRMG       V+  GE+WE +GLF+ D SV P+A+G+NPM+T+Q+ +
Sbjct  686   WTTYFSAHQMGSCRMGASAGEGAVDENGESWETQGLFVCDGSVLPSAVGINPMITIQSTS  745

Query  2341  YCTAQSVLKFLK  2376
             YC +  + + L+
Sbjct  746   YCISTRIAESLQ  757



>ref|XP_010447958.1| PREDICTED: long-chain-alcohol oxidase FAO4B-like [Camelina sativa]
Length=750

 Score =   459 bits (1182),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 301/772 (39%), Positives = 429/772 (56%), Gaps = 62/772 (8%)
 Frame = +1

Query  85    RGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQ  264
             RG +  Y+ G   SP+ + ++  I  T LP             S   F   S++      
Sbjct  20    RGEEEGYNHG--FSPSQIQSLAVICQTLLPPSG--------KQSFDSFNVVSSTQPPFTD  69

Query  265   RVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAE  444
              VA MI +  +   V +LR+ L +LS R GTL+LCG   L   +P++  F E+   +R E
Sbjct  70    EVAEMIVKNGRSEAVKVLRIILMVLSFRFGTLLLCGSLCLDKSWPFVLKFSELPLDRREE  129

Query  445   IVRSWS---CCYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKP  615
             I+R WS      +    TF+L  K   L  FFS  +EN +N + +AI +C    DS+   
Sbjct  130   ILRKWSRQSGFLLPFRITFFLA-KFYTLFYFFSHTDENLKNPALEAIGFCLDTKDSSSNS  188

Query  616   AGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQK  795
               KS+           ++E+++               PL  G+I    E    +   L  
Sbjct  189   NKKSE-----------ADEKRR---------------PLESGIIETLHESDITITQTLIG  222

Query  796   LGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARs  975
              G   +     +        I CD V+VGSGSGGGV A  LA AG KVLVLEKG YF   
Sbjct  223   KGVHAA-----RDDDENVHRIRCDVVIVGSGSGGGVAAANLAKAGLKVLVLEKGNYFTAQ  277

Query  976   slsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDET  1155
               S LEG S+ E+Y  GG + + D   ++LAGS VGGG+ INWSASI+TP +VL+EW E 
Sbjct  278   DYSGLEGPSMLELYEKGGFLTTVDGKFMVLAGSAVGGGTAINWSASIRTPDYVLEEWSEG  337

Query  1156  HKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDH  1335
              K++ FGSKEY+ AM+ V +R+GV  +   EGFQN VLRKGC  LG  VE++PRN+  DH
Sbjct  338   SKIKFFGSKEYKTAMDEVTTRIGVTEKCVKEGFQNQVLRKGCERLGLKVESVPRNSREDH  397

Query  1336  YCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVV---HNKKTGREQAAGVM  1506
             YCG C +GC  G K GT  TWL D V++G  VI    +A + +   +N  +   Q   V 
Sbjct  398   YCGLCGYGCTAGHKNGTDGTWLVDAVENG-AVILTGIKAERFILVDNNSSSKERQKRCVG  456

Query  1507  FVYQNNGAK--EFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYF  1680
              +  + G K  +   +++RVTV + G+L TP L+ +SGL+N NIGRNL LHPV+  WGYF
Sbjct  457   VIASSVGGKIGKKFIIEARVTVSSAGSLLTPPLMLSSGLKNQNIGRNLRLHPVLMTWGYF  516

Query  1681  PDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSG  1860
             P+        +   K Y+GGI+T++  +  N  ESG  A+++ P + P  ++ + PW+SG
Sbjct  517   PEKD-----SDFSGKMYEGGIITSLHYM--NDAESGCKAILENPLIGPASYAGLSPWVSG  569

Query  1861  TDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAA  2040
              D+K RM ++ RTA LFAL RD  SGE      ++Y   K D+ +L+ GL + LR+L AA
Sbjct  570   ADLKERMMKYGRTAHLFALVRDIGSGEVMKENEVTYRTTKKDRENLRAGLRQALRVLIAA  629

Query  2041  GAEEIGTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMG  2208
             GA E+GT    G+ +K +G +R+ ++EF+++  +       G   T   SAHQM SCRMG
Sbjct  630   GAVEVGTYRSDGQRMKCEGTTREAMEEFLDEVDAVGGVSTKGEYWTSYFSAHQMSSCRMG  689

Query  2209  VDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  2364
                    ++  GE+WE EGLF+ D SV P+A+GVNPM+T+Q+ AYC +  ++
Sbjct  690   ATEEEGALDENGESWEAEGLFVCDGSVLPSAVGVNPMITIQSTAYCISTRIV  741



>ref|XP_004982883.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X2 [Setaria 
italica]
Length=685

 Score =   457 bits (1176),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 270/692 (39%), Positives = 393/692 (57%), Gaps = 62/692 (9%)
 Frame = +1

Query  340   STRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS-CCYIKILKTFYLGMKVMV  516
             STR+GTL LCG+  +S +FPY++ F ++   +R E +  W+   ++  LK  ++ +KV+ 
Sbjct  36    STRVGTLALCGRLCMSGKFPYVRKFADMPVERREEALGRWNKARWLFPLKITFVVIKVLS  95

Query  517   LLSFFSQVNENNENISWKAIDYCGPDPDSNKK-PAGKSKKWITREQHMTLSEEQKKGEED  693
               +F++ VNEN++N  WKAI Y  PD +  ++ P+ +S                      
Sbjct  96    HYAFYTMVNENSDNPCWKAIGYSVPDMEEPREAPSPRS----------------------  133

Query  694   VIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDav  873
                         L  GV+         +   L   G  V      +   +    ++CD V
Sbjct  134   ------------LDNGVVETKALNDTTLLRSLVDKGLVV------RTDASTYHTVQCDVV  175

Query  874   vvgsgsgggviagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMD  1053
             +VGSG GGGV A  LA+AGHKV+V+EKG+YF     S +EG S++ +Y  GG+  + ++ 
Sbjct  176   IVGSGCGGGVAAAALASAGHKVVVVEKGEYFTAEDYSSVEGPSMERLYEKGGIFCTSNVT  235

Query  1054  ILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQS  1233
              +L  GS VGGGS +NWSASI+TP  V +EW   H L +F S  Y  AM+ VC+R+ V  
Sbjct  236   TVLFTGSMVGGGSAVNWSASIRTPEEVRQEWAREHGLPVFASPGYVEAMDAVCARLAVTD  295

Query  1234  EVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLV  1413
                +EGFQN  +R+GC  LG   + +PRN+S  H+CG C  GC  G K+GT  TWL D V
Sbjct  296   GCREEGFQNKAVRRGCEALGLRADAVPRNSSEGHFCGSCHLGCPTGDKRGTDTTWLVDSV  355

Query  1414  DSGNGVIFPECEAVKVVHNKKTGR-----EQAAGVMFVYQNNGAKEFCFVKSRVTVIACG  1578
               G  VI   C+A   +    +G       +  G++      G  +   ++++V++ ACG
Sbjct  356   ARG-AVILTGCKAECFILESNSGENARRSRKCVGLVATCMVAGVTKKLRIEAKVSIAACG  414

Query  1579  ALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEP-EKKSYQGGIMTAM  1755
             AL TP LL+NSGL+N +IGRNLHLHPV  AWGYFP+    +  P P   K Y+GGI+T M
Sbjct  415   ALMTPPLLRNSGLKNRHIGRNLHLHPVSMAWGYFPENKQQEPQPPPLTGKCYEGGIITTM  474

Query  1756  SKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTS  1935
              +V           +++TP+L PG F++++PW SG D+K RM+R++RTA  FAL RD+ +
Sbjct  475   HRVTER-------TIVETPALGPGCFASMVPWESGRDMKDRMRRYARTAHAFALVRDRGA  527

Query  1936  GEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASR-DE  2112
             G       + Y+  + D   L+NGL + LRIL AAGA E+GT    G  L+  G  R DE
Sbjct  528   GTVDGEGRVCYSPARDDVDELRNGLRRALRILVAAGAAEVGTHRSDGHRLRCDGGVRDDE  587

Query  2113  IDEFVEKESSRDLGNLS-----TLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLA  2277
             +D F+++ +      L       L+ SAHQMGSCRMG  PR   V+  GE+WE EGL++ 
Sbjct  588   LDAFLDEVTVATGPMLPGSDKWALLCSAHQMGSCRMGSSPRDGAVDGRGESWEAEGLYVC  647

Query  2278  DSSVFPTALGVNPMVTVQAIAYCTAQSVLKFL  2373
             D S+ PTA+GVNPM+T+Q+ AYC ++ + + L
Sbjct  648   DGSLLPTAVGVNPMITIQSTAYCLSEGIAESL  679



>ref|XP_004953134.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Setaria italica]
Length=773

 Score =   459 bits (1180),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 296/802 (37%), Positives = 427/802 (53%), Gaps = 68/802 (8%)
 Frame = +1

Query  52    GDSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVP--------------  189
             G  L   G A R     Y+ G   S + MA +T++    +P++  P              
Sbjct  8     GHPLLRGGGARRER---YTHG--FSSSQMAALTALCGALVPSLPPPVSRNGHHPEEDGGP  62

Query  190   -QHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLML  366
                    +  V+ F   SA+    P  VA ++S R     + L+R  LWLL TR+G L L
Sbjct  63    GGGERGGNKVVEEFLLASAADPPVPDEVAELMSRRCLPEALALVRAVLWLLGTRLGALAL  122

Query  367   CGKASLSSQFPYLQSFPEISPHKRAEIVRSWS-CCYIKILKTFYLGMKVMVLLSFFSQVN  543
             CG   LS +FP+++ F E+ P +R   ++ WS    +  L+ F+L  KV  L  F+S  +
Sbjct  123   CGARCLSWRFPFVRRFAELPPEEREGAMQRWSRQTLLPPLRIFFLITKVFCLYVFYSWTD  182

Query  544   ENNENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLL  723
             EN+EN  W+A  Y  P  D     A +  +   R                          
Sbjct  183   ENSENPHWRATGYSPPLADEEHAAAAEEGRPEKR--------------------------  216

Query  724   GPLHKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggv  903
              PL  GV+    E    +   L   G  V+     + +      +ECD V+VGSG GGGV
Sbjct  217   -PLDDGVVETTNETDASLAASLAAKGLAVT-----EDAARNVCTVECDVVIVGSGCGGGV  270

Query  904   iagvLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVG  1083
              A VLA AG+KV+V+EKG YF     + +E  S++++Y GGG V++     L+LAGS VG
Sbjct  271   SAAVLAGAGYKVVVIEKGSYFTARDYTAVEAPSMEQLYEGGGFVSTLSGGALILAGSAVG  330

Query  1084  GGSTINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNM  1263
             GG+ +NWSA I+TP  V  EW     + LF + EY  AM+ V  R+GV     +EG QN 
Sbjct  331   GGTAVNWSACIKTPDEVRAEWARDQGIPLFATDEYAAAMDRVFERLGVTHGCNEEGLQNK  390

Query  1264  VLRKGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPE  1443
             VLRKGC +LGY VE++ RN+S  HYCG C FGC+ G K+GT  TWL D V  G  VI   
Sbjct  391   VLRKGCEKLGYKVESVSRNSSEGHYCGSCGFGCRTGDKRGTDTTWLVDAVSHG-AVILTG  449

Query  1444  CEAVKVVHNKKTGR-------EQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLL  1602
             C+A K++  ++ G        ++ AGV+    N        V++R TV ACG+L TP LL
Sbjct  450   CKAEKLLLMERAGTGGADGRAKRCAGVVARSTNPAVTRTLEVRARATVSACGSLLTPVLL  509

Query  1603  KNSGLRNPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEE  1782
             + SGL N +IG+NLHLHP    WGYFP++  + A P+ + K Y+GGI+T++ KV      
Sbjct  510   RGSGLSNRHIGKNLHLHPTALVWGYFPES--TTAEPDLKGKMYEGGIITSLHKVEGPPGA  567

Query  1783  SGYGALIQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSI  1962
                 A+++TP++         PW+SG D+K RM R+ RT  LF+L RD+ SG       +
Sbjct  568   PAR-AILETPAMGLAAAGTQFPWVSGRDMKERMLRYGRTVHLFSLVRDRGSGTVHGERRV  626

Query  1963  SYNMQKTDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK---  2133
             +Y++   D+  ++ GL + LR+LAAAGA EIGT    G+    +GA+   ++EF++    
Sbjct  627   AYHLDAADREDMREGLRRALRVLAAAGAAEIGTHRSDGQRFVCRGATEAALEEFLDGVDV  686

Query  2134  -ESSRDLGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGV  2310
                 +      +L  +AHQMGSCRMG       V+  GE+WE + L++ D SV P+A+GV
Sbjct  687   VRGPKSKAEAWSLFCTAHQMGSCRMGATAADGAVDARGESWEAQRLYVCDGSVLPSAVGV  746

Query  2311  NPMVTVQAIAYCTAQSVLKFLK  2376
             NPMVT+Q++AYC A  + + L+
Sbjct  747   NPMVTIQSVAYCLATGIAESLR  768



>gb|ACN27562.1| unknown [Zea mays]
 gb|AFW63032.1| oxidoreductase [Zea mays]
Length=768

 Score =   457 bits (1175),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 299/796 (38%), Positives = 426/796 (54%), Gaps = 65/796 (8%)
 Frame = +1

Query  52    GDSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVD------------VPQH  195
             G  L   G A+R     Y+ G   S + MA +T++    +P++              P+ 
Sbjct  9     GHPLLRGGSAKRER---YTHG--FSASQMAALTALCGALVPSLPPADRRNGHHHNPQPEE  63

Query  196   AAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGK  375
                    V+ F   SA+    P  VA ++S +     + L+R  LWLL TR+G+L LCG 
Sbjct  64    DGGSSKVVEEFLLASAADPPVPGEVAELMSRKCLPEALALVRAVLWLLGTRLGSLALCGA  123

Query  376   ASLSSQFPYLQSFPEISPHKRAEIVRSWS-CCYIKILKTFYLGMKVMVLLSFFSQVNENN  552
               LS +FP+++ F E+    R   +R WS    +  L+ F+L  KV  L  F+S  +EN+
Sbjct  124   RCLSWRFPFVRRFDELPLEHREAALRRWSRLTLLPPLRMFFLITKVFCLYVFYSWTDENS  183

Query  553   ENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPL  732
             +N  W+AI Y              S      E     SE  +K               PL
Sbjct  184   KNPHWRAIGY--------------SPPPADDEPAPAESERPEKR--------------PL  215

Query  733   HKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviag  912
               G++  N+E    +   L + G  V+       +      +ECD V+VGSG GGGV A 
Sbjct  216   DDGIVETNKENDASLPALLAEKGLRVA-----DDAARNVCRVECDVVIVGSGCGGGVAAA  270

Query  913   vLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGS  1092
             VLA AGHKV+V+EKG YF     + +E  S++ +Y GGG V++     LLLAGS VGGG+
Sbjct  271   VLAAAGHKVVVIEKGNYFTARDYTAIEAPSMEHLYEGGGFVSTLSASALLLAGSTVGGGT  330

Query  1093  TINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLR  1272
              +NWSA I+TP  V  EW     L LF + EY  AM+ V  R+GV +   +EG QN VLR
Sbjct  331   AVNWSACIKTPDDVRGEWARDRGLPLFATGEYAAAMDKVFERLGVTAGCAEEGLQNKVLR  390

Query  1273  KGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEA  1452
             KGC  LGY VE++ RN+S  HYCG C +GC+ G K+GT  TWL D V  G  VI   C+A
Sbjct  391   KGCERLGYKVESVSRNSSEGHYCGSCGYGCRTGDKRGTDSTWLVDAVSRG-AVILTGCKA  449

Query  1453  VKVV---HNKKTGR-EQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLR  1620
              K++    +   GR ++  GV+    N        V +RVTV ACG+L TP LL+ SGLR
Sbjct  450   EKLLLEPGSAADGRAKRCVGVVARSTNPAITRTLEVTARVTVSACGSLLTPVLLRGSGLR  509

Query  1621  NPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGAL  1800
             N +IG+NLHLHP    WGYFPD       P+   + Y+GGI+T++ KV      +   A+
Sbjct  510   NRHIGKNLHLHPTALVWGYFPDTV-----PDLRGRMYEGGIITSLHKVEGGGPGAPARAI  564

Query  1801  IQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQK  1980
             ++ P++         PW+SG D+K RM R+ RT  LF++ RD+ SG       ++Y++  
Sbjct  565   LEAPAMGLAGAGTQFPWVSGRDMKERMLRYGRTVHLFSMVRDRGSGTVHGERRVAYHLDA  624

Query  1981  TDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRD  2148
             TD+ ++++G+ + LR+LAAAGA EIGT    G+     GA+   ++EF++        + 
Sbjct  625   TDRENMRDGMRRALRVLAAAGAAEIGTHRSDGQRFACGGATEAALEEFLDGVDVVRGPQS  684

Query  2149  LGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTV  2328
                  TL  +AHQMGSCRMG   R   V+  GE+WE   L++ D SV P A+GVNPMVT+
Sbjct  685   KAEAWTLCCTAHQMGSCRMGATARDGAVDARGESWEAGSLYVCDGSVLPGAVGVNPMVTI  744

Query  2329  QAIAYCTAQSVLKFLK  2376
             Q++AYC A  + + L+
Sbjct  745   QSVAYCLATGIAESLR  760



>ref|XP_006418179.1| hypothetical protein EUTSA_v10006882mg [Eutrema salsugineum]
 gb|ESQ36532.1| hypothetical protein EUTSA_v10006882mg [Eutrema salsugineum]
Length=763

 Score =   456 bits (1174),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 277/772 (36%), Positives = 440/772 (57%), Gaps = 65/772 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAV-----DVPQHAAV-DDDSVKLFFQTSASIAGT-PQRVAWM  279
              S + +  +++I +  +P V     D+     V  +D++  FF++S+  +   P  VA +
Sbjct  30    FSRSDLQALSAICEAIMPPVPLLSLDLDMKLKVLRNDALLSFFKSSSDQSHVRPDEVAEV  89

Query  280   ISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQ-FPYLQSFPEISPHKRAEIVRS  456
             ++ +     V ++R+ L LL+ R+GTL+LCG   L  + +P+L  F +IS  KR ++++ 
Sbjct  90    MATKAMPVTVKVVRIVLRLLTFRLGTLLLCGFVCLDKKNWPFLLKFSDISLDKREKVLQK  149

Query  457   WSC-CYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKK  633
             WS   Y  +++  ++ +K + L  +F+  NEN+E  +W AI Y            G+++ 
Sbjct  150   WSTQWYNPLVRIAFMMIKAIFLFYYFTWTNENSETPAWDAIGY--------SVNLGENED  201

Query  634   WITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVS  813
                RE+                         PL KG+I   +E    +  RL   G  V+
Sbjct  202   MEHRER-------------------------PLEKGIIETAKEDEMSIKQRLINKGLIVT  236

Query  814   PCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslslle  993
                  +   + S+ IECDAVVVGSG GGGV A  LA +G +V++LEKG YF     S LE
Sbjct  237   -----EDKESDSYKIECDAVVVGSGCGGGVAAANLAKSGLRVVILEKGNYFVPRDYSALE  291

Query  994   gsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELF  1173
             G S  E++    L+ + D     +AGS VGGGS +NW+AS++TP  ++ EW     + +F
Sbjct  292   GPSTFELFEAHSLLMTHDGRFRFMAGSTVGGGSVVNWAASLKTPDAIINEWSVDRGIAIF  351

Query  1174  GSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCS  1353
               +EY  AME VC R+GV  ++  EGFQN +LRKGC +LG  V  +PRN+S  HYCG CS
Sbjct  352   AREEYTAAMERVCKRIGVTEKIIKEGFQNQILRKGCEKLGLDVTVVPRNSSEKHYCGSCS  411

Query  1354  FGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVV-------HNKKTGREQAAGVMFV  1512
             FGC+ G K+GT  TWL D V++ N VI  +C A K++         K++GR++    +  
Sbjct  412   FGCRTGDKRGTDSTWLVDAVNN-NAVILTQCRAEKLILADNDAQTRKQSGRKKICLGVTA  470

Query  1513  YQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAP  1692
               +N  ++   + ++VTV+ACG+L TP LL +SGLRNPNIGR LH+HP++  WGYFP+  
Sbjct  471   CPSNRTRKKLQINAKVTVVACGSLMTPGLLASSGLRNPNIGRGLHIHPILMVWGYFPEKN  530

Query  1693  GSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIK  1872
                   +    +++G I+T++  V      +     ++TP++ PG F+A++PW+SG+D+K
Sbjct  531   S-----DFNGAAHEGEIVTSLHYVFEIDSTTTPNITLETPAIGPGTFAALIPWVSGSDMK  585

Query  1873  TRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEE  2052
              R+ +++RT+ +FA+ RD+  GE      + Y + K D+ +L  GL++ LRIL AAGAEE
Sbjct  586   NRLAKYARTSHIFAMIRDEGVGEVKGGL-VKYRLTKADEENLAIGLKQALRILVAAGAEE  644

Query  2053  IGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLIGSAHQMGSCRMGVDPR  2220
             +GT    G+ +K KG   ++++ F+        +  +    T   +AHQMG CRMG   +
Sbjct  645   VGTYRSDGQRIKCKGIKEEDLEAFLRTVNVPAGAVSMSKHWTHSFTAHQMGCCRMGATEK  704

Query  2221  SSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
                ++  GE+WE + L++ D+SV PTALGVNPM+T+Q+ AYC +  +   ++
Sbjct  705   EGAIDGYGESWEAQDLYVCDASVLPTALGVNPMITIQSTAYCISNRIAMLME  756



>ref|XP_006306477.1| hypothetical protein CARUB_v10012453mg [Capsella rubella]
 gb|EOA39375.1| hypothetical protein CARUB_v10012453mg [Capsella rubella]
Length=752

 Score =   456 bits (1172),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 275/771 (36%), Positives = 443/771 (57%), Gaps = 65/771 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVP------QHAAVDDDSVKLFFQTSASIAGTPQRVAWMI  282
              S + +  +++I +  LP V +       +   +  D++  FF++S      P  VA ++
Sbjct  23    FSQSDLQALSAICEAILPPVPLQSLDLDMKLKVLRSDALLSFFKSSPGSHIRPDEVAELL  82

Query  283   SERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQ-FPYLQSFPEISPHKRAEIVRSW  459
             + +     V ++R+ L +L+ R+GTL+LCG  SL  + +P+L  F +IS  KR ++++ W
Sbjct  83    ATKAIPVTVKVVRVVLRILTFRLGTLLLCGLVSLDKENWPFLLKFSDISLEKREKVLQRW  142

Query  460   SC-CYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKW  636
             +   Y  + +  ++ +K + L  +F+  NEN EN +W AI Y        +   G+++  
Sbjct  143   NTQWYNPLARLGFMMIKAIFLFYYFTWTNENTENPAWDAIGY--------RVDMGENEGM  194

Query  637   ITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSP  816
               +E+                         PL KG+I   +     +  R+   G  V+ 
Sbjct  195   EHKER-------------------------PLEKGIIETAEVDEMTIKQRMINKGLKVT-  228

Query  817   CIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslslleg  996
                 +   + ++ IECDAV+VGSG GGGV A  LA +G KV+VLEKG YF     S LEG
Sbjct  229   ----EDRESDTYKIECDAVIVGSGCGGGVAAANLAKSGLKVVVLEKGNYFVPRDYSALEG  284

Query  997   sslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFG  1176
              S  E++    L+ + D     +AGS VGGGS +NW+AS+ TP  +++EW     + +F 
Sbjct  285   PSTFELFESNSLLMTHDGRFRFMAGSTVGGGSVVNWAASLNTPDAIIEEWSVQRGIAIFS  344

Query  1177  SKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSF  1356
             S++Y+ AM+ VC R+GV  ++  EGFQN +LRKGC +LG  V T+PRN++  HYCG CSF
Sbjct  345   SEKYKAAMDRVCKRIGVTEKIIREGFQNTILRKGCEKLGLDVTTVPRNSTDKHYCGSCSF  404

Query  1357  GCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVV-------HNKKTGREQAAGVMFVY  1515
             GC  G+K+GT  TWL D V++ N VI   C+A KV+         K++GR++    +   
Sbjct  405   GCPTGEKRGTDSTWLVDAVNN-NAVILTRCKAEKVILADNDAHKRKESGRKKRCLGVTAS  463

Query  1516  QNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPG  1695
              +N  ++   + ++VT+IACG+L TP LL +SGL+NPNIGR LH+HP++ AWGYFP+   
Sbjct  464   LSNRTRKKLEINAKVTIIACGSLKTPGLLASSGLKNPNIGRGLHIHPILMAWGYFPERNS  523

Query  1696  SKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKT  1875
                  + +  +++G IMT++   V   + +     ++TP++ PG F++++PW+SG+DIK 
Sbjct  524   -----DFKGAAHEGEIMTSL-HYVHPMDSTTPNITLETPAIGPGTFASLIPWVSGSDIKE  577

Query  1876  RMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEI  2055
             R+ +++RT+ +F + RD+  GE      + Y + K D+ +L  GL++ L+IL AAGA E+
Sbjct  578   RLAKYTRTSHIFVMVRDEGVGEVKGDI-VKYRLTKADEENLTIGLKQALQILVAAGATEV  636

Query  2056  GTCHRAGKILKPKGASRDEIDEFVEKESS----RDLGNLSTLIGSAHQMGSCRMGVDPRS  2223
             GT    G+ +K  G  R+E++ F+   ++      +    T   +AHQMG CRMG   + 
Sbjct  637   GTYRSDGQRIKCDGIKREELEAFLHTVNAPAGVVSMSKHWTHSFTAHQMGCCRMGASEKE  696

Query  2224  SVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
               ++  GE+WE E L++ D+SV PTALGVNPM+TVQ+ AYC +  + + +K
Sbjct  697   GAIDGKGESWEAEDLYVCDASVLPTALGVNPMITVQSTAYCISNRIAELMK  747



>ref|NP_001148058.1| oxidoreductase [Zea mays]
 gb|ACG29606.1| oxidoreductase [Zea mays]
Length=768

 Score =   455 bits (1170),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 298/796 (37%), Positives = 425/796 (53%), Gaps = 65/796 (8%)
 Frame = +1

Query  52    GDSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVD------------VPQH  195
             G  L   G A+R     Y+ G   S + MA +T++    +P++              P+ 
Sbjct  9     GHPLLRGGSAKRER---YTHG--FSASQMAALTALCGALVPSLPPADRRNGHHHNPQPEE  63

Query  196   AAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGK  375
                    V+ F   SA+    P  VA ++S +     + L+R  LWLL TR+G+L LCG 
Sbjct  64    DGGSSKVVEEFLLASAADPPVPGEVAELMSRKCLPEALALVRAVLWLLGTRLGSLALCGA  123

Query  376   ASLSSQFPYLQSFPEISPHKRAEIVRSWS-CCYIKILKTFYLGMKVMVLLSFFSQVNENN  552
               LS +FP+++ F E+    R   +R WS    +  L+ F+L  KV  L  F+S  +EN+
Sbjct  124   RCLSWRFPFVRRFDELPLEHREAALRRWSRQTLLPPLRMFFLITKVFCLYVFYSWTDENS  183

Query  553   ENISWKAIDYCGPDPDSNKKPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPL  732
             +N  W+AI Y              S      E     SE  +K               PL
Sbjct  184   KNPHWRAIGY--------------SPPPADDEPAPAESERPEKR--------------PL  215

Query  733   HKGVINLNQEPRRQVFDRLQKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviag  912
               G++  N+E    +   L + G  V+       +      +ECD V+VGSG GGGV A 
Sbjct  216   DDGIVETNKENDASLPALLAEKGLTVA-----DDAARNVCRVECDVVIVGSGCGGGVAAA  270

Query  913   vLANAGHKVLVLEKGKYFARsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGS  1092
             VLA AGHKV+V+EKG YF     + +E  S++ +Y GGG V++     LLLAGS VGGG+
Sbjct  271   VLAAAGHKVVVIEKGDYFTARDYTAIEAPSMEHLYEGGGFVSTLSASALLLAGSTVGGGT  330

Query  1093  TINWSASIQTPPHVLKEWDETHKLELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLR  1272
              +NWSA I+TP  V  EW     L LF + EY  AM+ V  R+GV +   +EG QN VLR
Sbjct  331   AVNWSACIKTPDDVRGEWARDRGLPLFATGEYAAAMDKVFERLGVTAGCAEEGLQNKVLR  390

Query  1273  KGCLELGYPVETIPRNASRDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEA  1452
             KGC  LGY VE++ RN+S  HYCG C +GC+ G K+GT  TWL D V  G  VI   C+A
Sbjct  391   KGCERLGYKVESVSRNSSEGHYCGSCGYGCRTGDKRGTDSTWLVDAVSRG-AVILTGCKA  449

Query  1453  VKVV---HNKKTGR-EQAAGVMFVYQNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLR  1620
              K++        GR ++  GV+    N        V +RVTV +CG+L TP LL+ SGLR
Sbjct  450   EKLLLEPGRAADGRAKRCVGVVARSTNPAITRTLEVTARVTVSSCGSLLTPVLLRGSGLR  509

Query  1621  NPNIGRNLHLHPVVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGAL  1800
             N +IG+NLHLHP    WGYFPD       P+   + Y+GGI+T++ KV      +   A+
Sbjct  510   NRHIGKNLHLHPTALVWGYFPDTV-----PDLRGRMYEGGIITSLHKVEGGGPGAPARAI  564

Query  1801  IQTPSLHPGMFSAIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQK  1980
             ++ P++         PW+SG D+K RM R+ RT  LF++ RD+ SG       ++Y++  
Sbjct  565   LEAPAMGLAGAGTQFPWVSGRDMKERMLRYGRTVHLFSMVRDRGSGTVQGERRVAYHLDA  624

Query  1981  TDKVSLKNGLEKVLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRD  2148
             TD+ ++++G+ + LR+LAAAGA EIGT    G+     GA+   ++EF++        + 
Sbjct  625   TDRENMRDGMRRALRVLAAAGAAEIGTHRSDGQRFACGGATEAALEEFLDGVDVVRGPQS  684

Query  2149  LGNLSTLIGSAHQMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTV  2328
                  TL  +AHQMGSCRMG   R   V+  GE+WE   L++ D SV P A+GVNPMVT+
Sbjct  685   KAEAWTLCCTAHQMGSCRMGATARDGAVDARGESWEAGSLYVCDGSVLPGAVGVNPMVTI  744

Query  2329  QAIAYCTAQSVLKFLK  2376
             Q++AYC A  + + L+
Sbjct  745   QSVAYCFATDIAESLR  760



>ref|XP_010475034.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Camelina sativa]
Length=752

 Score =   454 bits (1168),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 275/771 (36%), Positives = 443/771 (57%), Gaps = 65/771 (8%)
 Frame = +1

Query  121   LSPAVMATVTSISDTFLPAVDVP------QHAAVDDDSVKLFFQTSASIAGTPQRVAWMI  282
              S + +  +++I +  LP V +       +   + +D++  FF++S      P  VA ++
Sbjct  23    FSASDLQALSAICEAILPPVPLQSLDLEMKLKVLRNDALLSFFKSSPGPHVRPDEVAEVL  82

Query  283   SERLQHPKVIllrlalwllSTRIGTLMLCGKASLS-SQFPYLQSFPEISPHKRAEIVRSW  459
             + +     VI++R+ L +L+ R+GTL+LCG  +L  + +P+L  F EIS  KR ++++ W
Sbjct  83    ATKAIPVTVIVVRIVLRILTFRLGTLLLCGLVNLDKASWPFLLKFSEISLEKREKVLQRW  142

Query  460   SC-CYIKILKTFYLGMKVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNKKPAGKSKKW  636
             +   Y  + +  ++ +K + L  +F+  +EN EN +W AI Y     D N+    K +  
Sbjct  143   NTQWYNPLARIGFMMIKAIFLFYYFTWTDENTENPAWDAIGY-SVGIDENEGMEHKER--  199

Query  637   ITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRLQKLGFPVSP  816
                                           PL KG+I  ++     +  R+   G  V+ 
Sbjct  200   ------------------------------PLEKGIIETDKVNEMTIKQRMINKGLKVT-  228

Query  817   CIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFARsslslleg  996
                 +   + ++ IECDAVVVGSG GGGV A  LA +G +V+VLEKG YF     S LEG
Sbjct  229   ----EDRESDTYKIECDAVVVGSGCGGGVAAANLAKSGLRVVVLEKGNYFVSRDYSALEG  284

Query  997   sslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWDETHKLELFG  1176
              S  E++    L+ + D     +AGS VGGGS +NW+AS++TP  +++EW     + +F 
Sbjct  285   PSTFELFESNSLLMTHDGRFRFMAGSTVGGGSVVNWAASLKTPDAIIEEWSVQRGISIFS  344

Query  1177  SKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNASRDHYCGWCSF  1356
             S++Y+ AM+ VC R+GV   V  EGFQN +LRKGC +LG  V T+PRN++  HYCG CSF
Sbjct  345   SEKYKAAMDRVCKRIGVTERVIREGFQNQILRKGCEKLGLDVTTVPRNSTDGHYCGSCSF  404

Query  1357  GCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVV-------HNKKTGREQAAGVMFVY  1515
             GC  G+K+GT  TWL D V++ N VI  +C+A KV+         K++GR++    +   
Sbjct  405   GCPTGEKRGTDLTWLVDAVNN-NAVILTQCKAEKVILAENDAHKRKESGRKKRCLGVAAS  463

Query  1516  QNNGAKEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHPVVFAWGYFPDAPG  1695
              +N  ++   + ++VT++ACG+L TP LL +SGL+NPNIGR LH+HP++  WGYFP+   
Sbjct  464   LSNRTRKKLQINAKVTIVACGSLKTPELLASSGLKNPNIGRGLHIHPILMTWGYFPEKKS  523

Query  1696  SKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFSAIMPWLSGTDIKT  1875
                  + +  +++G I+T +   V   + +     ++TP++ PG F+A++PW+SG+DIK 
Sbjct  524   -----DFKGAAHEGEILTTL-HYVHPMDSTTANITLETPAIGPGTFAALVPWVSGSDIKE  577

Query  1876  RMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEKVLRILAAAGAEEI  2055
             R+ ++SRT+ +F   RD+  GE      + Y + K D+ +L  GL++ L+IL AAGA E+
Sbjct  578   RLAKYSRTSHIFVTVRDEGVGEVKGGI-VKYRLTKADEENLTIGLKQALQILVAAGAAEV  636

Query  2056  GTCHRAGKILKPKGASRDEIDEFVEK-ESSRDLGNLS---TLIGSAHQMGSCRMGVDPRS  2223
             GT    G+ +K  G    +++ F+E  ++   + ++S   T   +AHQMG CRMG   + 
Sbjct  637   GTYRSDGQRIKCDGIKHKDLEAFLETVDAPAGVVSMSKHWTHSITAHQMGCCRMGATEKE  696

Query  2224  SVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVLKFLK  2376
               ++  GE+WE E L++ D+SV PTALGVNPM+T+Q+ AYC +  + + +K
Sbjct  697   GAIDGKGESWEAEDLYVCDASVLPTALGVNPMITIQSTAYCISNRIAELMK  747



>ref|XP_003575383.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Brachypodium 
distachyon]
Length=766

 Score =   454 bits (1167),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 300/784 (38%), Positives = 431/784 (55%), Gaps = 62/784 (8%)
 Frame = +1

Query  85    RGNDGV----YSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIA  252
             RG  GV    Y+ G   S   M  +T+     +P++  P  A     +V+ FF  SA+  
Sbjct  17    RGGGGVSRSSYTHG--FSATQMLALTAACGALVPSLP-PDDAG--SKAVREFFLASAADP  71

Query  253   GTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPH  432
               P  VA ++S       + L+R  LWLL TR+GTL LCG   LS Q P+++ F E+   
Sbjct  72    PVPDEVAQLMSAMCLREALALIRTLLWLLGTRLGTLALCGSRCLSWQAPFVRRFAEMPVE  131

Query  433   KRAEIVRSWSCCYIKILKTFYLGM-KVMVLLSFFSQVNENNENISWKAIDYCGPDPDSNK  609
             +R + +R WS   +      +  + KV  L  F+S+++EN+EN  W AI Y  P  D   
Sbjct  132   RREDALRRWSRETVLPPLRLFFLLLKVFCLYVFYSRIDENSENPHWGAIGYT-PATDEAS  190

Query  610   KPAGKSKKWITREQHMTLSEEQKKGEEDVIPMNPELLLGPLHKGVINLNQEPRRQVFDRL  789
                 + K+  T ++                         PL  GV+         +   L
Sbjct  191   AEEEEEKEQPTTKR-------------------------PLDDGVVETIHHTDASLPACL  225

Query  790   QKLGFPVSPCIQQKGSGNPSFVIECDavvvgsgsgggviagvLANAGHKVLVLEKGKYFA  969
                G  V+     + +    F +ECD  +VGSG GGGV A VLA AGHKV+V+EKG YF 
Sbjct  226   ADKGLTVT-----EDAARNLFRVECDVAIVGSGCGGGVTAAVLAAAGHKVVVIEKGSYFT  280

Query  970   RsslsllegsslDEMYLGGGLVASKDMDILLLAGSNVGGGSTINWSASIQTPPHVLKEWD  1149
                 + +EG S+ ++Y  GG V++     L+LAGS VGGGS +NWSA I+TP  V  EW 
Sbjct  281   SKDYTSIEGPSMRQLYESGGFVSTLSGSGLILAGSTVGGGSAVNWSACIKTPESVRGEWA  340

Query  1150  ETHK-LELFGSKEYRHAMETVCSRMGVQSEVEDEGFQNMVLRKGCLELGYPVETIPRNAS  1326
               H  L LF S EY  AM+ V  R+GV S  ++EG QN VLRKGC +LGY VE + RN+S
Sbjct  341   GAHGGLPLFASPEYTAAMDAVFRRLGVTSGCQEEGLQNKVLRKGCEKLGYKVEPVSRNSS  400

Query  1327  RDHYCGWCSFGCKDGKKKGTSETWLADLVDSGNGVIFPECEAVKVVHN---------KKT  1479
               H+CG C +GC+ G K+GT  TWL D V  G  VI   C+A K++ +         +K 
Sbjct  401   EGHFCGSCGYGCRTGDKRGTDTTWLVDAVRRG-AVILTGCKAEKLLFSDYATAMTSAEKK  459

Query  1480  GREQAAGVMFVYQNNGA-KEFCFVKSRVTVIACGALCTPSLLKNSGLRNPNIGRNLHLHP  1656
              +++  GV+    +N A      V+++VTV ACG+L TP LL++SGL NP+IG+NLHLHP
Sbjct  460   KKKRCVGVVVATSSNPAITRKVEVRAKVTVSACGSLLTPVLLRDSGLANPHIGKNLHLHP  519

Query  1657  VVFAWGYFPDAPGSKAWPEPEKKSYQGGIMTAMSKVVANFEESGYGALIQTPSLHPGMFS  1836
                AWGYFP+       P+ + K Y+GGI+T++ K V   +     A+++TP +      
Sbjct  520   TAMAWGYFPE----DTRPDLKGKMYEGGIITSIHK-VEGVDGVPPRAILETPLMGVAAAG  574

Query  1837  AIMPWLSGTDIKTRMQRFSRTAILFALARDKTSGEAPSPFSISYNMQKTDKVSLKNGLEK  2016
                PW+SG D+K RM ++ R+  +F+L RD+ SG       I+Y+M   D+ + + GL +
Sbjct  575   TQFPWVSGRDMKERMLKYGRSVHIFSLVRDRGSGTVHGERRIAYHMDPADRENQREGLRR  634

Query  2017  VLRILAAAGAEEIGTCHRAGKILKPKGASRDEIDEFVEK----ESSRDLGNLSTLIGSAH  2184
              LR+L AAGA EIGT    G+ +K KGA+ +E++EF++        +      +L  +AH
Sbjct  635   ALRVLVAAGATEIGTHRSDGQRMKCKGATEEEVEEFLDGVTVLRGPQSKSENWSLCCTAH  694

Query  2185  QMGSCRMGVDPRSSVVNPMGETWEVEGLFLADSSVFPTALGVNPMVTVQAIAYCTAQSVL  2364
             QMGSCRM        V+  GE+WE E L++ D+SV P+A+GVNPM+T+QA+AYC A  + 
Sbjct  695   QMGSCRMAATALDGAVDARGESWEAERLYVCDASVLPSAVGVNPMITIQAVAYCLANGIA  754

Query  2365  KFLK  2376
             + LK
Sbjct  755   EQLK  758



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8084880484048