BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13512_g1_i1 len=1259 path=[1654:0-393 2048:394-1258]

Length=1259
                                                                      Score     E

gb|AGW81767.1|  EF1 protein                                             447   3e-154   
ref|XP_009795902.1|  PREDICTED: pathogen-related protein-like iso...    375   1e-125   
ref|XP_009795903.1|  PREDICTED: pathogen-related protein-like iso...    373   9e-125   
ref|XP_009626199.1|  PREDICTED: pathogen-related protein-like           371   4e-124   
gb|AGW81769.1|  EF2 protein                                             368   1e-122   
ref|XP_009795904.1|  PREDICTED: pathogen-related protein-like iso...    361   3e-120   
ref|XP_009626198.1|  PREDICTED: pathogen-related protein-like           358   8e-119   
ref|XP_006356272.1|  PREDICTED: pathogen-related protein-like           357   1e-118   
ref|XP_004237745.1|  PREDICTED: pathogen-related protein                358   1e-118   
ref|XP_006356275.1|  PREDICTED: pathogen-related protein-like           355   1e-117   
ref|XP_004237744.1|  PREDICTED: pathogen-related protein                350   1e-115   
emb|CDP18288.1|  unnamed protein product                                339   2e-111   
ref|XP_011069614.1|  PREDICTED: pathogen-related protein-like           332   9e-109   
ref|XP_010062147.1|  PREDICTED: pathogen-related protein-like           316   2e-102   
ref|XP_008785812.1|  PREDICTED: pathogen-related protein-like           314   7e-102   
ref|XP_008785811.1|  PREDICTED: pathogen-related protein-like           310   6e-100   
gb|EYU17419.1|  hypothetical protein MIMGU_mgv1a012483mg                309   1e-99    
ref|XP_011084185.1|  PREDICTED: pathogen-related protein-like           308   2e-99    
ref|XP_010916130.1|  PREDICTED: pathogen-related protein-like           308   2e-99    
ref|XP_002306682.1|  putative pathogenesis-related family protein       305   6e-98    Populus trichocarpa [western balsam poplar]
gb|ABK96224.1|  unknown                                                 303   1e-97    Populus trichocarpa x Populus deltoides
ref|XP_010999816.1|  PREDICTED: pathogen-related protein-like           302   4e-97    
ref|XP_002306681.2|  hypothetical protein POPTR_0005s21070g             302   4e-97    Populus trichocarpa [western balsam poplar]
gb|EYU17420.1|  hypothetical protein MIMGU_mgv1a012039mg                301   2e-96    
ref|XP_010110490.1|  hypothetical protein L484_003537                   300   5e-96    
ref|XP_010244012.1|  PREDICTED: pathogen-related protein-like           298   2e-95    
ref|XP_002262980.1|  PREDICTED: pathogen-related protein                295   4e-94    Vitis vinifera
emb|CDP18287.1|  unnamed protein product                                295   4e-94    
ref|XP_006434416.1|  hypothetical protein CICLE_v10002326mg             294   8e-94    
ref|XP_006472936.1|  PREDICTED: pathogen-related protein-like           293   1e-93    
ref|XP_008237645.1|  PREDICTED: pathogen-related protein-like           290   2e-92    
ref|XP_002263121.1|  PREDICTED: pathogen-related protein isoform X1     289   6e-92    Vitis vinifera
ref|XP_010683153.1|  PREDICTED: pathogen-related protein-like           289   6e-92    
ref|XP_007199060.1|  hypothetical protein PRUPE_ppa018623mg             288   9e-92    
ref|XP_010062148.1|  PREDICTED: pathogen-related protein-like           288   2e-91    
ref|XP_002263092.1|  PREDICTED: pathogen-related protein                287   4e-91    Vitis vinifera
ref|XP_009360747.1|  PREDICTED: pathogen-related protein-like iso...    286   1e-90    
ref|XP_010683154.1|  PREDICTED: pathogen-related protein-like           285   2e-90    
gb|KDP43037.1|  hypothetical protein JCGZ_25223                         285   2e-90    
ref|XP_009348134.1|  PREDICTED: pathogen-related protein-like           284   5e-90    
ref|XP_008373181.1|  PREDICTED: pathogen-related protein-like           284   6e-90    
ref|XP_003526679.1|  PREDICTED: pathogen-related protein-like           284   6e-90    
ref|XP_009404798.1|  PREDICTED: pathogen-related protein-like           283   9e-90    
ref|XP_002526153.1|  conserved hypothetical protein                     283   2e-89    Ricinus communis
ref|XP_008339140.1|  PREDICTED: pathogen-related protein-like           282   3e-89    
emb|CAN77211.1|  hypothetical protein VITISV_035026                     290   3e-89    Vitis vinifera
ref|XP_007019414.1|  Pathogen-related protein isoform 1                 283   3e-89    
ref|XP_007200367.1|  hypothetical protein PRUPE_ppa010660mg             280   1e-88    
ref|XP_007019415.1|  Pathogen-related protein isoform 2                 282   2e-88    
ref|XP_007201250.1|  hypothetical protein PRUPE_ppa010729mg             280   2e-88    
ref|XP_008237647.1|  PREDICTED: pathogen-related protein-like           280   3e-88    
gb|AHF20188.1|  pathogenesis related protein                            278   8e-88    
ref|XP_009348132.1|  PREDICTED: pathogen-related protein-like           278   1e-87    
ref|NP_001241631.1|  uncharacterized protein LOC100805630               278   1e-87    
ref|XP_007019416.1|  Pathogen-related protein                           277   2e-87    
ref|XP_010916129.1|  PREDICTED: pathogen-related protein-like           277   3e-87    
ref|XP_008237640.1|  PREDICTED: pathogen-related protein-like           277   3e-87    
ref|XP_004306661.1|  PREDICTED: pathogen-related protein-like           275   1e-86    
ref|XP_004290556.1|  PREDICTED: pathogen-related protein-like           275   2e-86    
gb|AFK44805.1|  unknown                                                 275   2e-86    
ref|XP_007137546.1|  hypothetical protein PHAVU_009G135800g             274   6e-86    
ref|XP_008237646.1|  PREDICTED: pathogen-related protein-like           273   1e-85    
ref|XP_004139673.1|  PREDICTED: pathogen-related protein-like           273   2e-85    
ref|XP_009421115.1|  PREDICTED: pathogen-related protein-like iso...    271   3e-85    
ref|XP_010244013.1|  PREDICTED: pathogen-related protein-like iso...    271   6e-85    
ref|XP_006858459.1|  hypothetical protein AMTR_s00071p00097550          271   9e-85    
ref|XP_008461497.1|  PREDICTED: pathogen-related protein-like           270   2e-84    
ref|XP_010245805.1|  PREDICTED: pathogen-related protein-like           270   2e-84    
ref|XP_004290558.1|  PREDICTED: pathogen-related protein-like           269   3e-84    
ref|XP_010537720.1|  PREDICTED: pathogen-related protein isoform X1     270   4e-84    
ref|XP_010664892.1|  PREDICTED: pathogen-related protein isoform X2     267   6e-84    
ref|XP_009360748.1|  PREDICTED: pathogen-related protein-like iso...    267   6e-84    
ref|XP_010930622.1|  PREDICTED: pathogen-related protein-like           268   1e-83    
ref|XP_004167281.1|  PREDICTED: LOW QUALITY PROTEIN: pathogen-rel...    266   4e-83    
ref|XP_010245806.1|  PREDICTED: pathogen-related protein-like           266   7e-83    
ref|XP_010110486.1|  hypothetical protein L484_003533                   266   8e-83    
ref|XP_008786540.1|  PREDICTED: pathogen-related protein-like           266   1e-82    
ref|XP_009421116.1|  PREDICTED: pathogen-related protein-like iso...    265   1e-82    
gb|KHN23416.1|  Pathogen-related protein                                265   1e-82    
ref|XP_008352783.1|  PREDICTED: pathogen-related protein-like           263   3e-82    
gb|KHG14121.1|  Pathogen-related                                        261   1e-80    
ref|XP_006302731.1|  hypothetical protein CARUB_v10020845mg             261   1e-80    
ref|XP_010537721.1|  PREDICTED: pathogen-related protein isoform X2     259   2e-80    
ref|XP_002285489.1|  PREDICTED: pathogen-related protein                259   3e-80    Vitis vinifera
ref|XP_009416946.1|  PREDICTED: pathogen-related protein-like           259   4e-80    
gb|KFK42243.1|  hypothetical protein AALP_AA2G230000                    259   5e-80    
ref|XP_004148811.1|  PREDICTED: pathogen-related protein-like           258   6e-80    
ref|XP_003628448.1|  Pathogen-related protein                           258   7e-80    
gb|ACN28048.1|  unknown                                                 258   7e-80    Zea mays [maize]
gb|KGN47479.1|  hypothetical protein Csa_6G338110                       257   1e-79    
ref|NP_001150498.1|  LOC100284129                                       256   3e-79    Zea mays [maize]
ref|XP_003566350.1|  PREDICTED: pathogen-related protein-like           256   3e-79    
ref|XP_010429716.1|  PREDICTED: pathogen-related protein-like iso...    257   3e-79    
gb|AFK34050.1|  unknown                                                 256   6e-79    
gb|EYU45032.1|  hypothetical protein MIMGU_mgv1a012837mg                255   1e-78    
ref|XP_004489016.1|  PREDICTED: pathogen-related protein-like           254   2e-78    
ref|XP_010274425.1|  PREDICTED: pathogen-related protein                255   2e-78    
ref|XP_010417477.1|  PREDICTED: pathogen-related protein-like iso...    254   2e-78    
ref|XP_009416419.1|  PREDICTED: pathogen-related protein                254   2e-78    
ref|XP_008441543.1|  PREDICTED: pathogen-related protein-like iso...    253   6e-78    
ref|XP_008441544.1|  PREDICTED: pathogen-related protein-like iso...    252   9e-78    
gb|EAY73287.1|  hypothetical protein OsI_01161                          252   1e-77    Oryza sativa Indica Group [Indian rice]
ref|XP_010924734.1|  PREDICTED: pathogen-related protein isoform X2     253   2e-77    
ref|XP_003596337.1|  Pathogen-related protein                           251   2e-77    
ref|NP_001042582.1|  Os01g0248300                                       252   2e-77    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003543204.1|  PREDICTED: pathogen-related protein                252   2e-77    
gb|KDP34789.1|  hypothetical protein JCGZ_10569                         251   3e-77    
gb|AFK35332.1|  unknown                                                 250   5e-77    
ref|XP_003596332.1|  Pathogen-related protein                           250   5e-77    
ref|XP_004967874.1|  PREDICTED: pathogen-related protein-like           250   7e-77    
ref|NP_001042584.1|  Os01g0248500                                       250   8e-77    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003566352.1|  PREDICTED: pathogen-related protein-like           249   1e-76    
ref|XP_006643992.1|  PREDICTED: pathogen-related protein-like           249   1e-76    
ref|XP_004967875.1|  PREDICTED: pathogen-related protein-like           249   2e-76    
ref|XP_010924733.1|  PREDICTED: pathogen-related protein isoform X1     250   2e-76    
ref|XP_008792335.1|  PREDICTED: pathogen-related protein                249   4e-76    
ref|XP_010675371.1|  PREDICTED: pathogen-related protein                249   5e-76    
ref|XP_006302730.1|  hypothetical protein CARUB_v10020845mg             248   5e-76    
gb|KDP34790.1|  hypothetical protein JCGZ_10570                         248   6e-76    
ref|XP_007021803.1|  Pathogenesis-related family protein isoform 1      247   1e-75    
ref|XP_006358936.1|  PREDICTED: pathogen-related protein-like           246   2e-75    
ref|XP_006370134.1|  hypothetical protein POPTR_0001s40000g             246   4e-75    
ref|XP_007149571.1|  hypothetical protein PHAVU_005G081500g             246   4e-75    
ref|XP_010675339.1|  PREDICTED: pathogen-related protein-like           246   6e-75    
ref|XP_010060709.1|  PREDICTED: pathogen-related protein                245   6e-75    
emb|CDY10562.1|  BnaC03g70520D                                          248   6e-75    
ref|XP_006477768.1|  PREDICTED: pathogen-related protein-like           245   6e-75    
ref|XP_011044075.1|  PREDICTED: pathogen-related protein                245   7e-75    
ref|XP_007200844.1|  hypothetical protein PRUPE_ppa026378mg             244   7e-75    
sp|P16273.2|PRPX_HORVU  RecName: Full=Pathogen-related protein          245   7e-75    Hordeum vulgare [barley]
emb|CDX87436.1|  BnaA07g34370D                                          247   1e-74    
gb|ABK26765.1|  unknown                                                 245   1e-74    Picea sitchensis
gb|KFK42242.1|  hypothetical protein AALP_AA2G230000                    245   2e-74    
ref|XP_006370137.1|  hypothetical protein POPTR_0001s40030g             244   2e-74    
ref|XP_006442478.1|  hypothetical protein CICLE_v10021966mg             244   2e-74    
gb|EMT24763.1|  hypothetical protein F775_27286                         243   3e-74    
ref|XP_010429717.1|  PREDICTED: pathogen-related protein-like iso...    244   3e-74    
emb|CDX88476.1|  BnaC06g39200D                                          245   3e-74    
ref|XP_006858461.1|  hypothetical protein AMTR_s00071p00098340          243   3e-74    
ref|XP_004251898.1|  PREDICTED: pathogen-related protein-like           243   3e-74    
ref|XP_009106590.1|  PREDICTED: pathogen-related protein                243   4e-74    
ref|NP_565189.1|  pathogenesis-related protein                          243   4e-74    Arabidopsis thaliana [mouse-ear cress]
gb|AAC83032.1|  Similar to gb|X16648 pathogenesis related protein...    244   5e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006389959.1|  hypothetical protein EUTSA_v10019070mg             243   6e-74    
ref|XP_010417478.1|  PREDICTED: pathogen-related protein-like iso...    242   9e-74    
ref|XP_011015673.1|  PREDICTED: pathogen-related protein-like           242   1e-73    
ref|XP_006442479.1|  hypothetical protein CICLE_v10024222mg             241   2e-73    
ref|XP_004231587.1|  PREDICTED: pathogen-related protein-like           242   2e-73    
ref|XP_007137547.1|  hypothetical protein PHAVU_009G135800g             240   2e-73    
ref|XP_006477762.1|  PREDICTED: pathogen-related protein-like iso...    241   2e-73    
ref|XP_011007919.1|  PREDICTED: pathogen-related protein-like iso...    241   2e-73    
emb|CDP06024.1|  unnamed protein product                                241   3e-73    
gb|EAY73295.1|  hypothetical protein OsI_01170                          241   3e-73    Oryza sativa Indica Group [Indian rice]
gb|KHG03872.1|  Pathogen-related                                        240   6e-73    
gb|EMS68049.1|  hypothetical protein TRIUR3_09584                       240   6e-73    
gb|KHG03873.1|  Pathogen-related                                        239   8e-73    
ref|XP_008451756.1|  PREDICTED: pathogen-related protein isoform X1     239   3e-72    
ref|XP_002317453.1|  hypothetical protein POPTR_0011s11020g             238   6e-72    Populus trichocarpa [western balsam poplar]
ref|XP_009587122.1|  PREDICTED: pathogen-related protein                238   7e-72    
ref|XP_002889208.1|  predicted protein                                  238   1e-71    
ref|XP_006367889.1|  PREDICTED: pathogen-related protein-like           237   1e-71    
dbj|BAK07496.1|  predicted protein                                      237   2e-71    
gb|ACF85823.1|  unknown                                                 234   3e-71    Zea mays [maize]
ref|XP_007021804.1|  Pathogenesis-related family protein isoform 2      236   4e-71    
ref|XP_004231588.1|  PREDICTED: pathogen-related protein                234   1e-70    
ref|XP_010246473.1|  PREDICTED: pathogen-related protein-like           234   1e-70    
ref|XP_004167652.1|  PREDICTED: LOW QUALITY PROTEIN: pathogen-rel...    234   2e-70    
gb|EPS67398.1|  hypothetical protein M569_07377                         233   2e-70    
gb|KGN53568.1|  hypothetical protein Csa_4G082450                       234   2e-70    
ref|NP_001077842.1|  pathogenesis-related protein                       233   3e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011083290.1|  PREDICTED: pathogen-related protein-like           233   4e-70    
gb|KDP34788.1|  hypothetical protein JCGZ_10568                         231   1e-69    
gb|EMT20632.1|  hypothetical protein F775_13667                         231   3e-69    
gb|EAZ11244.1|  hypothetical protein OsJ_01098                          230   3e-69    Oryza sativa Japonica Group [Japonica rice]
dbj|BAB63532.1|  putative infection-related protein                     231   3e-69    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009801126.1|  PREDICTED: pathogen-related protein                229   2e-68    
emb|CDM84089.1|  unnamed protein product                                229   2e-68    
gb|KDO46952.1|  hypothetical protein CISIN_1g043189mg                   225   9e-68    
ref|XP_010261152.1|  PREDICTED: pathogen-related protein-like           223   4e-67    
ref|XP_002528474.1|  conserved hypothetical protein                     223   5e-67    Ricinus communis
ref|NP_001044148.1|  Os01g0731100                                       223   5e-66    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011007920.1|  PREDICTED: pathogen-related protein-like iso...    219   2e-65    
gb|EAY75716.1|  hypothetical protein OsI_03627                          221   2e-65    Oryza sativa Indica Group [Indian rice]
gb|AEM42990.1|  pathogen-related protein                                222   3e-65    
ref|XP_010244014.1|  PREDICTED: pathogen-related protein-like iso...    219   4e-65    
ref|XP_010537722.1|  PREDICTED: pathogen-related protein isoform X3     218   8e-65    
ref|XP_003569732.1|  PREDICTED: pathogen-related protein-like           220   9e-65    
ref|XP_006646291.1|  PREDICTED: pathogen-related protein-like           219   2e-64    
emb|CBI19978.3|  unnamed protein product                                213   1e-63    
ref|XP_001770220.1|  predicted protein                                  215   2e-63    
gb|EMS61562.1|  hypothetical protein TRIUR3_07764                       214   3e-63    
ref|XP_006356343.1|  PREDICTED: pathogen-related protein-like           215   5e-63    
gb|EMS45310.1|  hypothetical protein TRIUR3_18487                       215   2e-62    
ref|XP_007021805.1|  Pathogenesis-related family protein isoform 3      211   2e-62    
ref|XP_004137234.1|  PREDICTED: pathogen-related protein-like           212   4e-62    
gb|ABD32938.2|  Pathogen-related protein, related                       210   6e-62    Medicago truncatula
ref|XP_004137235.1|  PREDICTED: pathogen-related protein-like           209   1e-60    
tpg|DAA57773.1|  TPA: pathogen protein                                  209   1e-60    
ref|NP_001151686.1|  pathogen-related protein                           208   3e-60    Zea mays [maize]
ref|XP_004167654.1|  PREDICTED: pathogen-related protein-like           207   4e-60    
gb|KDO38225.1|  hypothetical protein CISIN_1g041144mg                   206   4e-60    
ref|XP_004969846.1|  PREDICTED: pathogen-related protein-like iso...    205   4e-59    
ref|XP_008451759.1|  PREDICTED: pathogen-related protein-like           204   8e-59    
ref|XP_002458446.1|  hypothetical protein SORBIDRAFT_03g033680          203   2e-58    Sorghum bicolor [broomcorn]
dbj|BAJ88417.1|  predicted protein                                      198   4e-57    
ref|XP_004969845.1|  PREDICTED: pathogen-related protein-like iso...    197   4e-56    
gb|EAZ13433.1|  hypothetical protein OsJ_03352                          197   6e-56    Oryza sativa Japonica Group [Japonica rice]
gb|ACU24382.1|  unknown                                                 189   4e-54    Glycine max [soybeans]
ref|XP_002982803.1|  hypothetical protein SELMODRAFT_117244             190   9e-54    
emb|CBI20179.3|  unnamed protein product                                187   2e-53    
ref|XP_002981834.1|  hypothetical protein SELMODRAFT_115305             187   1e-52    
ref|NP_849901.1|  pathogenesis-related protein                          184   4e-52    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002982795.1|  hypothetical protein SELMODRAFT_155441             184   1e-51    
gb|KEH38602.1|  pathogenesis-like protein                               182   1e-51    
gb|EMS46522.1|  hypothetical protein TRIUR3_09224                       187   2e-51    
emb|CAF33484.1|  putative pathogenesis-related protein                  182   2e-51    Cucumis sativus [cucumbers]
gb|KEH38601.1|  pathogenesis-like protein                               179   2e-50    
ref|XP_002981827.1|  hypothetical protein SELMODRAFT_228781             181   3e-50    
gb|EAZ11246.1|  hypothetical protein OsJ_01100                          180   5e-50    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008451757.1|  PREDICTED: pathogen-related protein isoform X2     178   7e-50    
ref|XP_002987051.1|  hypothetical protein SELMODRAFT_125190             178   2e-49    
ref|XP_006442473.1|  hypothetical protein CICLE_v10022574mg             174   2e-48    
ref|XP_010464676.1|  PREDICTED: pathogen-related protein-like           174   4e-48    
ref|WP_016868370.1|  hypothetical protein                               155   2e-40    
ref|XP_004969847.1|  PREDICTED: pathogen-related protein-like iso...    154   3e-40    
ref|WP_002627643.1|  putative pathogenesis related protein              151   2e-39    
ref|WP_017313378.1|  hypothetical protein                               150   9e-39    
ref|WP_016859665.1|  hypothetical protein                               148   4e-38    
ref|WP_011612134.1|  hypothetical protein                               147   8e-38    
gb|EMT15851.1|  hypothetical protein F775_08821                         144   1e-37    
ref|WP_026719539.1|  hypothetical protein                               147   2e-37    
gb|EFX80169.1|  hypothetical protein DAPPUDRAFT_197063                  145   2e-37    
ref|WP_016871229.1|  hypothetical protein                               145   3e-37    
ref|WP_009460309.1|  hypothetical protein                               145   4e-37    
ref|WP_012410130.1|  hypothetical protein                               145   8e-37    
ref|XP_001638532.1|  predicted protein                                  146   1e-36    Nematostella vectensis
ref|WP_008181559.1|  hypothetical protein                               144   1e-36    
gb|EAY73289.1|  hypothetical protein OsI_01163                          141   2e-36    Oryza sativa Indica Group [Indian rice]
ref|WP_036834808.1|  SnoaL-like polyketide cyclase                      143   2e-36    
ref|WP_019045250.1|  hypothetical protein                               143   4e-36    
ref|WP_037224639.1|  SnoaL-like polyketide cyclase                      143   4e-36    
ref|XP_002611467.1|  hypothetical protein BRAFLDRAFT_117209             143   1e-35    Branchiostoma floridae
ref|WP_008232433.1|  putative pathogenesis related protein              141   1e-35    
ref|WP_008230492.1|  putative pathogenesis related protein              141   2e-35    
ref|WP_017323619.1|  hypothetical protein                               140   3e-35    
ref|WP_013190728.1|  hypothetical protein                               140   4e-35    
ref|WP_035148869.1|  SnoaL-like polyketide cyclase                      139   9e-35    
ref|WP_015079171.1|  hypothetical protein                               139   1e-34    
ref|WP_015207129.1|  SnoaL-like polyketide cyclase                      139   1e-34    
ref|XP_002115708.1|  hypothetical protein TRIADDRAFT_29994              137   2e-34    Trichoplax adhaerens
ref|WP_039202578.1|  SnoaL-like polyketide cyclase                      138   4e-34    
dbj|BAP18172.1|  putative pathogenesis-like protein                     137   4e-34    
ref|WP_015128911.1|  pathogenesis related protein                       137   4e-34    
ref|WP_015111581.1|  pathogenesis-like protein                          137   6e-34    
ref|WP_019927317.1|  hypothetical protein                               137   6e-34    
ref|WP_010994394.1|  hypothetical protein                               137   7e-34    
ref|WP_008274129.1|  hypothetical protein                               136   8e-34    
ref|WP_016951498.1|  hypothetical protein                               136   9e-34    
ref|WP_009545711.1|  MULTISPECIES: hypothetical protein                 135   1e-33    
ref|WP_028085280.1|  hypothetical protein                               136   1e-33    
ref|WP_007307195.1|  hypothetical protein                               135   2e-33    
ref|WP_026731897.1|  hypothetical protein                               135   2e-33    
ref|WP_027401930.1|  hypothetical protein                               136   2e-33    
ref|WP_016875707.1|  hypothetical protein                               136   2e-33    
ref|WP_011319464.1|  hypothetical protein                               135   2e-33    
ref|WP_033090898.1|  SnoaL-like polyketide cyclase                      135   2e-33    
ref|WP_015188651.1|  pathogenesis related protein-like protein          135   3e-33    
ref|WP_033358528.1|  SnoaL-like polyketide cyclase                      134   4e-33    
ref|WP_016872891.1|  hypothetical protein                               134   5e-33    
ref|WP_028089048.1|  hypothetical protein                               134   6e-33    
gb|EMT15850.1|  hypothetical protein F775_18788                         132   6e-33    
ref|WP_013324201.1|  hypothetical protein                               133   8e-33    
ref|WP_016862011.1|  hypothetical protein                               133   2e-32    
ref|WP_038090773.1|  SnoaL-like polyketide cyclase                      132   2e-32    
ref|WP_038073468.1|  SnoaL-like polyketide cyclase                      132   2e-32    
ref|WP_017308785.1|  hypothetical protein                               132   2e-32    
ref|WP_004158957.1|  hypothetical protein                               132   3e-32    
ref|WP_024969311.1|  hypothetical protein                               132   3e-32    
ref|WP_006539909.1|  hypothetical protein                               132   4e-32    
ref|WP_015081688.1|  putative pathogenesis-like protein                 132   4e-32    
ref|WP_012593420.1|  MULTISPECIES: hypothetical protein                 131   4e-32    
ref|WP_013423368.1|  hypothetical protein                               131   4e-32    
ref|WP_016514538.1|  putative ester cyclase                             131   5e-32    
ref|XP_006442474.1|  hypothetical protein CICLE_v10023544mg             130   5e-32    
ref|WP_002742903.1|  hypothetical protein                               131   6e-32    
ref|WP_002765229.1|  hypothetical protein                               130   8e-32    
ref|WP_006633643.1|  hypothetical protein                               130   8e-32    
ref|WP_015139945.1|  SnoaL-like polyketide cyclase                      131   1e-31    
ref|WP_016952900.1|  hypothetical protein                               130   1e-31    
ref|WP_015215284.1|  pathogenesis related protein-like protein          130   2e-31    
ref|WP_039810211.1|  SnoaL-like polyketide cyclase                      130   2e-31    
ref|WP_038297652.1|  SnoaL-like polyketide cyclase, partial [           130   2e-31    
ref|WP_027845995.1|  hypothetical protein                               130   2e-31    
ref|WP_017653232.1|  hypothetical protein                               130   3e-31    
ref|WP_029925556.1|  hypothetical protein                               129   3e-31    
ref|WP_013874089.1|  hypothetical protein                               128   6e-31    
emb|CEG82898.1|  hypothetical protein RMATCC62417_16889                 129   6e-31    
ref|WP_011605890.1|  hypothetical protein                               127   7e-31    
ref|WP_019490806.1|  hypothetical protein                               129   8e-31    
ref|WP_017317429.1|  hypothetical protein                               128   8e-31    
ref|WP_026722209.1|  hypothetical protein                               128   1e-30    
ref|WP_006278693.1|  hypothetical protein                               128   1e-30    
ref|WP_017745410.1|  hypothetical protein                               127   2e-30    
ref|WP_007509630.1|  hypothetical protein                               127   2e-30    
ref|WP_015120446.1|  SnoaL-like polyketide cyclase                      127   2e-30    
ref|WP_030248487.1|  hypothetical protein                               126   3e-30    
gb|KHD78144.1|  SnoaL-like polyketide cyclase                           126   3e-30    
emb|CEG63411.1|  hypothetical protein RMATCC62417_00556                 126   4e-30    
ref|WP_009399250.1|  hypothetical protein                               126   5e-30    
ref|WP_037607792.1|  SnoaL-like polyketide cyclase                      125   7e-30    
ref|WP_018640114.1|  hypothetical protein                               125   9e-30    
gb|EMT32838.1|  hypothetical protein F775_43056                         124   1e-29    
ref|XP_008605646.1|  hypothetical protein SDRG_01871                    129   1e-29    
gb|KDO28191.1|  hypothetical protein SPRG_06239                         129   2e-29    
emb|CEI91614.1|  hypothetical protein RMCBS344292_05897                 124   3e-29    
ref|WP_039753060.1|  SnoaL-like polyketide cyclase                      124   4e-29    
gb|KFF41825.1|  hypothetical protein ucyna2_00203                       123   4e-29    
ref|WP_014688009.1|  hypothetical protein                               122   7e-29    
gb|ELT92921.1|  hypothetical protein CAPTEDRAFT_165269                  122   7e-29    
ref|WP_012954319.1|  hypothetical protein                               122   7e-29    
ref|WP_020549828.1|  hypothetical protein                               122   1e-28    
ref|WP_015117415.1|  SnoaL-like polyketide cyclase                      123   1e-28    
ref|WP_026731741.1|  hypothetical protein                               122   2e-28    
ref|XP_010418532.1|  PREDICTED: uncharacterized protein LOC104704093    122   2e-28    
emb|CDP19675.1|  unnamed protein product                                118   3e-28    
ref|WP_018500682.1|  hypothetical protein                               121   3e-28    
ref|WP_012598931.1|  hypothetical protein                               120   4e-28    
ref|WP_015200199.1|  pathogenesis-like protein                          120   6e-28    
ref|WP_006194369.1|  hypothetical protein                               120   9e-28    
ref|XP_008862741.1|  hypothetical protein H310_01418                    124   1e-27    
dbj|GAM29178.1|  hypothetical protein SAMD00019534_123540               119   1e-27    
ref|WP_023065876.1|  snoaL-like polyketide cyclase family protein       119   2e-27    
ref|WP_009785820.1|  hypothetical protein                               119   2e-27    
gb|ACU19664.1|  unknown                                                 115   2e-27    
gb|KDO39244.1|  hypothetical protein CISIN_1g041531mg                   115   2e-27    
ref|WP_020461723.1|  hypothetical protein                               118   2e-27    
ref|XP_009821318.1|  hypothetical protein H257_00365                    122   3e-27    
ref|WP_011318834.1|  hypothetical protein                               119   3e-27    
gb|EIE79829.1|  hypothetical protein RO3G_04534                         118   3e-27    
emb|CDM82396.1|  unnamed protein product                                114   4e-27    
ref|WP_015139023.1|  SnoaL-like polyketide cyclase                      117   2e-26    
ref|WP_027840819.1|  hypothetical protein                               117   2e-26    
ref|WP_010998750.1|  hypothetical protein                               117   2e-26    
ref|WP_039710189.1|  SnoaL-like polyketide cyclase                      113   2e-25    
gb|KFH70954.1|  hypothetical protein MVEG_03800                         110   1e-24    
gb|EEC70313.1|  hypothetical protein OsI_01167                          106   3e-24    
gb|EAY73293.1|  hypothetical protein OsI_01168                          105   6e-24    
gb|EPB86133.1|  hypothetical protein HMPREF1544_07035                   108   7e-24    
ref|XP_002594222.1|  hypothetical protein BRAFLDRAFT_65070              112   8e-24    
ref|XP_003655399.1|  hypothetical protein THITE_2090571                 108   9e-24    
emb|CDS11191.1|  hypothetical protein LRAMOSA03454                      108   1e-23    
gb|EPB88842.1|  hypothetical protein HMPREF1544_04351                   107   2e-23    
ref|XP_007831952.1|  hypothetical protein PFICI_05180                   107   4e-23    
ref|XP_002551532.1|  KLTH0A01628p                                       105   5e-23    
ref|XP_003303761.1|  hypothetical protein PTT_16104                     108   5e-23    
ref|XP_001935970.1|  conserved hypothetical protein                     106   2e-22    
gb|ESZ92053.1|  hypothetical protein SBOR_7553                          105   2e-22    
emb|CDH51364.1|  hypothetical protein RO3G_04534                        103   3e-22    
dbj|GAA90258.1|  hypothetical protein AKAW_08372                        103   4e-22    
gb|EHA28145.1|  hypothetical protein ASPNIDRAFT_203168                  103   4e-22    
gb|KEQ74052.1|  hypothetical protein M436DRAFT_17381                    103   5e-22    
gb|KEQ64591.1|  hypothetical protein M437DRAFT_14706                    103   6e-22    
ref|XP_001547427.1|  hypothetical protein BC1G_14162                    103   1e-21    
ref|XP_001393389.1|  hypothetical protein ANI_1_54084                   102   1e-21    
gb|KFA45568.1|  hypothetical protein S40293_06562                       102   2e-21    
gb|KFZ06033.1|  hypothetical protein V501_07791                         102   2e-21    
gb|KDO46951.1|  hypothetical protein CISIN_1g036843mg                 97.4    4e-21    
gb|EMF16618.1|  hypothetical protein SEPMUDRAFT_32085                   101   4e-21    
ref|XP_001261778.1|  hypothetical protein NFIA_095010                   100   5e-21    
ref|XP_001212979.1|  conserved hypothetical protein                     100   6e-21    
ref|XP_007690156.1|  hypothetical protein COCMIDRAFT_28193              102   6e-21    
gb|ELR02633.1|  hypothetical protein GMDG_05594                         100   6e-21    
gb|KEY73636.1|  hypothetical protein S7711_09677                        100   1e-20    
ref|XP_007710076.1|  hypothetical protein COCCADRAFT_90384              100   1e-20    
gb|EUN23972.1|  hypothetical protein COCVIDRAFT_18549                   100   1e-20    
gb|KDO39894.1|  hypothetical protein CISIN_1g036654mg                 95.5    2e-20    
emb|CCX30407.1|  Similar to Pathogen-related protein; acc. no. P1...  99.4    2e-20    
gb|KFY34901.1|  hypothetical protein V494_06374                       99.8    2e-20    
emb|CCF34340.1|  hypothetical protein CH063_06358                       100   2e-20    
gb|KFA67362.1|  hypothetical protein S40285_07032                     99.8    2e-20    
ref|XP_007694106.1|  hypothetical protein COCSADRAFT_31774              100   2e-20    
ref|XP_007581890.1|  putative pathogen-related protein                  101   3e-20    
ref|XP_001275135.1|  conserved hypothetical protein                   98.6    3e-20    
gb|EMD96269.1|  hypothetical protein COCHEDRAFT_1167336               99.8    3e-20    
ref|WP_036552311.1|  SnoaL-like polyketide cyclase                    96.7    3e-20    
gb|KFA80942.1|  hypothetical protein S40288_09720                     99.0    5e-20    
ref|XP_001591219.1|  hypothetical protein SS1G_07845                  99.4    5e-20    
gb|EFQ36574.1|  hypothetical protein GLRG_11707                       99.0    5e-20    
gb|KFY89767.1|  hypothetical protein V498_06298                       98.2    5e-20    
gb|KFY72343.1|  hypothetical protein V499_07511                       97.8    6e-20    
gb|KFY64100.1|  hypothetical protein V496_03464                       98.2    7e-20    
ref|XP_007920275.1|  hypothetical protein MYCFIDRAFT_63593            97.4    8e-20    
emb|CDH51366.1|  hypothetical protein RO3G_04534                      96.7    8e-20    
ref|XP_001824943.1|  hypothetical protein AOR_1_1150084               97.4    8e-20    
gb|KEQ84408.1|  hypothetical protein M438DRAFT_405636                   100   8e-20    
gb|EMR88120.1|  putative pathogen-related protein                     98.2    1e-19    
gb|KDN66782.1|  hypothetical protein CSUB01_12439                     98.2    1e-19    
ref|XP_747055.1|  conserved hypothetical protein                      97.1    1e-19    
gb|KFY81890.1|  hypothetical protein V500_10996                       97.4    1e-19    
gb|KFY14772.1|  hypothetical protein V492_02425                       97.1    1e-19    
ref|XP_001229947.1|  hypothetical protein CHGG_03431                  96.7    2e-19    
ref|XP_008075917.1|  NTF2-like protein                                99.4    2e-19    
gb|EHK99295.1|  putative Pathogen-related protein                     99.0    3e-19    
gb|EKG18034.1|  hypothetical protein MPH_04724                        99.4    4e-19    
gb|KFZ20153.1|  hypothetical protein V502_03320                       95.9    4e-19    
ref|XP_007589892.1|  hypothetical protein CFIO01_00027                95.9    5e-19    
gb|KFY16936.1|  hypothetical protein V491_05165                       95.5    5e-19    
gb|EKC98941.1|  hypothetical protein A1Q2_06695                       95.9    5e-19    
ref|XP_001248203.1|  hypothetical protein CIMG_01974                  94.7    8e-19    
gb|ELQ40913.1|  hypothetical protein OOU_Y34scaffold00325g43          94.4    9e-19    
gb|KEQ94366.1|  hypothetical protein AUEXF2481DRAFT_270177            93.2    9e-19    
ref|XP_007281105.1|  hypothetical protein CGGC5_9770                  95.1    1e-18    
ref|XP_002383638.1|  conserved hypothetical protein                   94.4    1e-18    
ref|XP_007678434.1|  hypothetical protein BAUCODRAFT_555502           97.1    2e-18    
ref|XP_003711756.1|  hypothetical protein MGG_05927                   94.7    2e-18    
emb|CCC11528.1|  unnamed protein product                              93.2    3e-18    
ref|XP_003065330.1|  hypothetical protein CPC735_045550               93.2    3e-18    
gb|EJT48515.1|  hypothetical protein A1Q1_02423                       94.0    3e-18    
ref|XP_661481.1|  hypothetical protein AN3877.2                       93.2    3e-18    
gb|EME49153.1|  hypothetical protein DOTSEDRAFT_49468                 96.3    4e-18    
ref|XP_001907695.1|  hypothetical protein                             92.4    5e-18    
ref|XP_007784119.1|  hypothetical protein W97_08060                   95.5    5e-18    
emb|CCI44828.1|  unnamed protein product                              95.1    7e-18    
emb|CDM85105.1|  unnamed protein product                              88.6    9e-18    
emb|CCA17548.1|  conserved hypothetical protein                       94.7    1e-17    
ref|XP_006370138.1|  hypothetical protein POPTR_0001s40040g           89.4    1e-17    
ref|XP_003852823.1|  hypothetical protein MYCGRDRAFT_70643            90.1    3e-17    
ref|XP_009225057.1|  hypothetical protein GGTG_08951                  90.1    4e-17    
ref|XP_002583932.1|  conserved hypothetical protein                   89.0    8e-17    
emb|CDM80618.1|  unnamed protein product                              83.6    6e-16    
emb|CCI10657.1|  unnamed protein product                              88.2    2e-15    
ref|XP_007200269.1|  hypothetical protein PRUPE_ppa014896mg           82.4    2e-15    
gb|EKC39429.1|  Pathogen-related protein                              82.0    3e-15    
ref|XP_003345283.1|  hypothetical protein SMAC_04517                  84.7    3e-15    
ref|XP_002846253.1|  conserved hypothetical protein                   84.7    3e-15    
ref|XP_796727.2|  PREDICTED: uncharacterized protein LOC592094        82.4    9e-15    
ref|XP_001185320.1|  PREDICTED: uncharacterized protein LOC754358     81.6    1e-14    
ref|XP_011007921.1|  PREDICTED: pathogen-related protein-like         81.6    1e-14    
gb|EJK58770.1|  hypothetical protein THAOC_21077                      81.6    3e-14    
ref|XP_003177921.1|  hypothetical protein MGYG_01981                  81.6    4e-14    
emb|CCA22111.1|  conserved hypothetical protein                       83.6    5e-14    
emb|CCA23397.1|  conserved hypothetical protein                       83.2    7e-14    
gb|AAM69296.1|  pathogen-related protein                              74.7    3e-13    
ref|XP_003018244.1|  hypothetical protein TRV_07748                   74.7    4e-12    
gb|EZF73073.1|  hypothetical protein H105_04968                       75.5    4e-12    
ref|XP_003235659.1|  hypothetical protein TERG_04715                  75.5    4e-12    
ref|XP_003010018.1|  hypothetical protein ARB_03757                   74.7    5e-12    
gb|EZF29325.1|  hypothetical protein H101_06994                       73.2    1e-11    
ref|XP_003539622.2|  PREDICTED: pathogen-related protein-like         70.1    2e-11    
gb|KDB21535.1|  hypothetical protein H109_06535                       72.8    2e-11    
gb|EGD98804.1|  hypothetical protein TESG_06077                       73.2    3e-11    
gb|KDO25774.1|  hypothetical protein SPRG_09070                       75.1    3e-11    
ref|XP_008611097.1|  hypothetical protein SDRG_07059                  75.1    4e-11    
ref|WP_006196801.1|  pathogenesis related protein-like protein        68.9    3e-10    
emb|CDH51365.1|  hypothetical protein RO3G_04534                      68.6    5e-10    
gb|ETI50903.1|  hypothetical protein F443_05643                       71.2    7e-10    
gb|ETP48609.1|  hypothetical protein F442_05685                       71.2    7e-10    
gb|ETM50517.1|  hypothetical protein L914_05453                       71.2    8e-10    
gb|ETL44205.1|  hypothetical protein L916_05447                       71.2    8e-10    
gb|ETO79665.1|  hypothetical protein F444_05693                       70.9    9e-10    
ref|XP_008903150.1|  hypothetical protein PPTG_10246                  70.1    1e-09    
ref|XP_009514476.1|  hypothetical protein PHYSODRAFT_474254           70.1    2e-09    
gb|ETP20672.1|  hypothetical protein F441_05650                       69.7    2e-09    
gb|ETK90806.1|  hypothetical protein L915_05502                       69.3    3e-09    
ref|XP_002909634.1|  conserved hypothetical protein                   66.2    2e-08    
gb|KEY82183.1|  hypothetical protein BA78_8258                        62.4    4e-08    
ref|XP_009834244.1|  hypothetical protein H257_09653                  63.9    1e-07    
ref|WP_006196802.1|  pathogenesis related protein-like protein        58.5    4e-07    
ref|XP_008875983.1|  hypothetical protein H310_11183                  61.6    6e-07    
ref|XP_001797901.1|  hypothetical protein SNOG_07567                  56.2    7e-06    
ref|XP_003628450.1|  Pathogenesis-related protein-like protein        51.6    1e-04    
gb|KDO34024.1|  hypothetical protein SPRG_01298                       53.9    1e-04    



>gb|AGW81767.1| EF1 protein [Ipomoea batatas]
Length=221

 Score =   447 bits (1150),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 215/220 (98%), Positives = 218/220 (99%), Gaps = 0/220 (0%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLM  439
            MACSGTGGDKYRDYLSEDEVKNTKWRSGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLM
Sbjct  1    MACSGTGGDKYRDYLSEDEVKNTKWRSGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLM  60

Query  440  KTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRV  619
            KTWEME+VHKADPNDYKTLDPTKFRLFVNGRKGLSLE+TAKIGGSYNVFLQTSLPEKYRV
Sbjct  61   KTWEMELVHKADPNDYKTLDPTKFRLFVNGRKGLSLEETAKIGGSYNVFLQTSLPEKYRV  120

Query  620  FNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEI  799
            FNPADETFVSSQA FRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEI
Sbjct  121  FNPADETFVSSQAAFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEI  180

Query  800  AEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSS  919
            AEFFGMG FELDEESNKIVK+ELFFDRGELLGALVKGGSS
Sbjct  181  AEFFGMGTFELDEESNKIVKSELFFDRGELLGALVKGGSS  220



>ref|XP_009795902.1| PREDICTED: pathogen-related protein-like isoform X1 [Nicotiana 
sylvestris]
Length=234

 Score =   375 bits (962),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 177/234 (76%), Positives = 204/234 (87%), Gaps = 1/234 (0%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLM  439
            MA    GGDKYRDYLSE+EVKNTKWR+GPP+YDVVDKLFE+ RTHVWPEGSLEEKVQRL+
Sbjct  1    MASLVGGGDKYRDYLSEEEVKNTKWRNGPPTYDVVDKLFEQERTHVWPEGSLEEKVQRLL  60

Query  440  KTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRV  619
            KTWEMEIVHKADPND+KT+DPTKF++ +NGRKGL+  ++AK+GGSYN+FLQTSLPE  RV
Sbjct  61   KTWEMEIVHKADPNDFKTVDPTKFKISINGRKGLTPVESAKLGGSYNIFLQTSLPESVRV  120

Query  620  FNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEI  799
            +NP +ETF SSQ VFR+ F RGFAIEIL VYSGPP I Y+FRHWG+M+GPFKGH  TGE+
Sbjct  121  YNPDEETFESSQKVFRSIFLRGFAIEILHVYSGPPEIVYKFRHWGHMEGPFKGHAATGEL  180

Query  800  AEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDE-AATSSACPFMK  958
             E FG+G FELD+ESNKIVKAE+FFDRGELLG LVKG S+ E A  +S CPFMK
Sbjct  181  VELFGIGTFELDKESNKIVKAEMFFDRGELLGGLVKGESNGELALAASKCPFMK  234



>ref|XP_009795903.1| PREDICTED: pathogen-related protein-like isoform X2 [Nicotiana 
sylvestris]
Length=234

 Score =   373 bits (957),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 175/228 (77%), Positives = 202/228 (89%), Gaps = 1/228 (0%)
 Frame = +2

Query  278  GGDKYRDYLSEDEVKNTKWRSGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEME  457
            GG+KYRDYLSE+EVKNTKWR+GPP+YDVVDKLFEE RTHVWPEGSLEEKVQRL+KTWEME
Sbjct  7    GGNKYRDYLSEEEVKNTKWRNGPPTYDVVDKLFEEERTHVWPEGSLEEKVQRLLKTWEME  66

Query  458  IVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADE  637
            IVHKADPND+KT+DPTKF++ +NGRKGL+  ++AK+GGSYN+FLQTSLPE  RV+NP +E
Sbjct  67   IVHKADPNDFKTVDPTKFKISINGRKGLTPVESAKLGGSYNIFLQTSLPESVRVYNPDEE  126

Query  638  TFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGM  817
            TF SSQ VFR+ F RGFAIEIL VYSGPP I Y+FRHWG+M+GPFKGH  TGE+ E FG+
Sbjct  127  TFESSQKVFRSIFLRGFAIEILHVYSGPPEIVYKFRHWGHMEGPFKGHAATGELVELFGI  186

Query  818  GIFELDEESNKIVKAELFFDRGELLGALVKGGSSDE-AATSSACPFMK  958
            G FELD+ESNKIVKAE+FFDRGELLG LVKG S+ E A  +S CPFMK
Sbjct  187  GTFELDKESNKIVKAEMFFDRGELLGGLVKGESNGELALAASKCPFMK  234



>ref|XP_009626199.1| PREDICTED: pathogen-related protein-like [Nicotiana tomentosiformis]
Length=234

 Score =   371 bits (953),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 176/234 (75%), Positives = 203/234 (87%), Gaps = 1/234 (0%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLM  439
            MA    GGD+YRDYLSE+EVKNTKWR+GPP+YDVVDKLFEE RTHVWPEGSLEEKVQRL+
Sbjct  1    MASLVGGGDRYRDYLSEEEVKNTKWRNGPPTYDVVDKLFEEERTHVWPEGSLEEKVQRLL  60

Query  440  KTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRV  619
            KTWEMEIVHKADPN++KT+DP KF++ VNGRKGL+  ++AK+GGSYN+FLQTSLPE  RV
Sbjct  61   KTWEMEIVHKADPNEFKTVDPKKFKISVNGRKGLTPVESAKLGGSYNIFLQTSLPENLRV  120

Query  620  FNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEI  799
            +NP +ETF SSQ VFR+ F RGFAIEIL VYSGPP I Y+FRHWGYM+GPFKGH  TG +
Sbjct  121  YNPDEETFESSQKVFRSIFLRGFAIEILHVYSGPPEIVYKFRHWGYMEGPFKGHASTGGL  180

Query  800  AEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDE-AATSSACPFMK  958
             E FG+GIFEL++ESNKIVKAE+FFDRGELLG LVKG S+ E A  +S CPFMK
Sbjct  181  VELFGIGIFELEKESNKIVKAEMFFDRGELLGGLVKGESNGELALAASKCPFMK  234



>gb|AGW81769.1| EF2 protein [Nicotiana tabacum]
Length=242

 Score =   368 bits (944),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 173/228 (76%), Positives = 201/228 (88%), Gaps = 1/228 (0%)
 Frame = +2

Query  278  GGDKYRDYLSEDEVKNTKWRSGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEME  457
            GGD+YRDYLSE+EVKNTKWR+GPP+YDVVDKLFEE RTHVWPEGSLEEKVQRL+KTWEME
Sbjct  15   GGDRYRDYLSEEEVKNTKWRNGPPTYDVVDKLFEEERTHVWPEGSLEEKVQRLLKTWEME  74

Query  458  IVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADE  637
            IVHKADPN++KT+DP KF++ VNGRKGL+  ++AK+GGSYN+FLQTSLPE  R++NP +E
Sbjct  75   IVHKADPNEFKTVDPKKFKISVNGRKGLTPVESAKLGGSYNIFLQTSLPESLRIYNPDEE  134

Query  638  TFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGM  817
            TF SSQ VFR+ F RGFAIEIL VYSGPP I Y+FRHWGYM+GPFKGH  TG + E FG+
Sbjct  135  TFESSQKVFRSIFLRGFAIEILHVYSGPPEIVYKFRHWGYMEGPFKGHASTGGLVELFGI  194

Query  818  GIFELDEESNKIVKAELFFDRGELLGALVKGGSSDE-AATSSACPFMK  958
            GIFEL++ESNKIVKAE+FFDRGELLG LVKG S+ E A  +S CPFMK
Sbjct  195  GIFELEKESNKIVKAEMFFDRGELLGGLVKGESNGELALAASKCPFMK  242



>ref|XP_009795904.1| PREDICTED: pathogen-related protein-like isoform X3 [Nicotiana 
sylvestris]
Length=234

 Score =   361 bits (927),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 171/228 (75%), Positives = 195/228 (86%), Gaps = 1/228 (0%)
 Frame = +2

Query  278  GGDKYRDYLSEDEVKNTKWRSGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEME  457
            GG+KYRDYLSE+EVKNTKWR+GPP+YDVVDKLFEE RTHVWPEGSLEEKVQRL+KTWEME
Sbjct  7    GGNKYRDYLSEEEVKNTKWRNGPPTYDVVDKLFEEERTHVWPEGSLEEKVQRLLKTWEME  66

Query  458  IVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADE  637
            +VHK DPND+KT+DP  +   VNGRKGL+ E+ AK+GG YN FLQTSLPE  RV+NP +E
Sbjct  67   MVHKTDPNDFKTVDPKVYTKSVNGRKGLTPEENAKLGGGYNTFLQTSLPESVRVYNPDEE  126

Query  638  TFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGM  817
            TF SSQ +FR+ F RGFAIEIL VYSGPP I Y+FRHWG+M+GPFKGH  TGE+ E FG+
Sbjct  127  TFESSQKIFRSIFLRGFAIEILHVYSGPPEIVYKFRHWGHMEGPFKGHAATGELVELFGI  186

Query  818  GIFELDEESNKIVKAELFFDRGELLGALVKGGSSDE-AATSSACPFMK  958
            G FELD+ESNKIVKAE+FFDRGELLG LVKG S+ E A  SS CPFMK
Sbjct  187  GTFELDKESNKIVKAEMFFDRGELLGGLVKGESNGELALASSKCPFMK  234



>ref|XP_009626198.1| PREDICTED: pathogen-related protein-like [Nicotiana tomentosiformis]
Length=238

 Score =   358 bits (918),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 170/238 (71%), Positives = 196/238 (82%), Gaps = 5/238 (2%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLM  439
            MA    GG+KYRDYLSE+EVKNTKWR+GPP+YDVVDKLFEE RTHVW EGSLEEKVQRL+
Sbjct  1    MASIVGGGNKYRDYLSEEEVKNTKWRNGPPTYDVVDKLFEEERTHVWSEGSLEEKVQRLL  60

Query  440  KTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRV  619
            KTWEME+VHK +PND+KT+DP KF   VNGRKGL+ E+ AK+GG YN FLQTSLPE  R+
Sbjct  61   KTWEMEMVHKENPNDFKTVDPKKFTKSVNGRKGLTAEENAKLGGGYNTFLQTSLPENLRI  120

Query  620  FNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEI  799
            +NP +ETF SSQ VFR+ F RGFAIEIL VYSG P I Y+FRHWG+M+GPFKGH  TGE+
Sbjct  121  YNPDEETFESSQKVFRSIFVRGFAIEILHVYSGTPEIVYKFRHWGHMEGPFKGHAATGEL  180

Query  800  AEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAAT-----SSACPFMK  958
             E FG+GIFELD+ESNKIVKAE FFDRGELLG LVKG  + E+ +     +S CPFMK
Sbjct  181  VELFGIGIFELDKESNKIVKAEFFFDRGELLGPLVKGEKNGESTSRMELAASKCPFMK  238



>ref|XP_006356272.1| PREDICTED: pathogen-related protein-like [Solanum tuberosum]
Length=230

 Score =   357 bits (917),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 165/227 (73%), Positives = 197/227 (87%), Gaps = 4/227 (2%)
 Frame = +2

Query  278  GGDKYRDYLSEDEVKNTKWRSGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEME  457
            GG+K+RDYLS++E+KNTKWR+GPPSYDVVDKLFE+ RT+VW EGS+EE+VQRL+KTWEME
Sbjct  8    GGNKFRDYLSDEELKNTKWRNGPPSYDVVDKLFEQERTNVWAEGSVEEEVQRLLKTWEME  67

Query  458  IVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADE  637
            IVHKADPN+ KT+DP KF + +NGRKGL+  ++AK+GGSYN+FLQTSLPE  R++NP DE
Sbjct  68   IVHKADPNELKTMDPNKFTISINGRKGLTPAESAKLGGSYNIFLQTSLPENVRLYNPDDE  127

Query  638  TFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGM  817
            TF SSQ +FR+ F RGFAIEIL VYSGPP I YRFRHWGYMDGPFKGH PTG++ E FG+
Sbjct  128  TFESSQNLFRSIFLRGFAIEILHVYSGPPGIVYRFRHWGYMDGPFKGHAPTGQLIELFGI  187

Query  818  GIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSSACPFMK  958
            G FELD+ESNKI+KAE+FFDRGELLG LVKG    E+  +S CPFMK
Sbjct  188  GTFELDKESNKIIKAEMFFDRGELLGGLVKG----ESNVASTCPFMK  230



>ref|XP_004237745.1| PREDICTED: pathogen-related protein [Solanum lycopersicum]
Length=257

 Score =   358 bits (919),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 168/238 (71%), Positives = 200/238 (84%), Gaps = 5/238 (2%)
 Frame = +2

Query  248  RTTKMACSGTGG-DKYRDYLSEDEVKNTKWRSGPPSYDVVDKLFEEGRTHVWPEGSLEEK  424
            +  KMA S  GG +K+RDYLS++E+KNTKWR+GPP+YDVVDKLFE+ RT+VW EGS+EEK
Sbjct  24   KLIKMASSIIGGGNKFRDYLSDEELKNTKWRNGPPTYDVVDKLFEQERTNVWAEGSVEEK  83

Query  425  VQRLMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLP  604
            VQRL+KTWEMEIVHKADPN+ KT+DP KF + VNGRK L+  ++AK+GGSYN+FLQTSLP
Sbjct  84   VQRLLKTWEMEIVHKADPNELKTMDPNKFTISVNGRKRLTSAESAKLGGSYNIFLQTSLP  143

Query  605  EKYRVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHP  784
            E  R++NP DETF SSQ +FR+ F RGFAIEIL VYSGPP I Y+FRHWGYMD PFKGH 
Sbjct  144  ENVRIYNPDDETFESSQNLFRSIFLRGFAIEILHVYSGPPGIVYKFRHWGYMDAPFKGHA  203

Query  785  PTGEIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSSACPFMK  958
            PTG++ E FG+G FELD+ESNKIVKAE+FFDRGELLG LVKG    E+  +S CPFMK
Sbjct  204  PTGQLVELFGIGTFELDKESNKIVKAEMFFDRGELLGGLVKG----ESNVASTCPFMK  257



>ref|XP_006356275.1| PREDICTED: pathogen-related protein-like [Solanum tuberosum]
Length=239

 Score =   355 bits (910),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 167/239 (70%), Positives = 198/239 (83%), Gaps = 6/239 (3%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLM  439
            MA    GGDKYRDYLS++E+KNTKWR+GPP+YDVVDKLFE+ RTHVW EGS+E+KVQRL+
Sbjct  1    MASLVGGGDKYRDYLSDEELKNTKWRNGPPTYDVVDKLFEQERTHVWAEGSVEDKVQRLL  60

Query  440  KTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRV  619
            KTWEME+VHK DPND K++DPTKF+  VNGRKGL+ E+  K+GG YN FLQTSLPE  RV
Sbjct  61   KTWEMELVHKIDPNDMKSVDPTKFKKSVNGRKGLTPEEAIKLGGGYNTFLQTSLPENLRV  120

Query  620  FNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEI  799
            +NP DETF SSQ VFR+ F RGFAIE+L VYSGPP I Y+FRHWGYMDGPFKG+  TG++
Sbjct  121  YNPDDETFESSQNVFRSIFIRGFAIEVLHVYSGPPEIVYKFRHWGYMDGPFKGYVATGQL  180

Query  800  AEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAAT------SSACPFMK  958
             E FG+GIFEL++ESNKIVKAE FFDRGELLG L+KGG + E+ +      +S CPFMK
Sbjct  181  VELFGIGIFELEKESNKIVKAEFFFDRGELLGPLMKGGKNGESTSEMALLEASKCPFMK  239



>ref|XP_004237744.1| PREDICTED: pathogen-related protein [Solanum lycopersicum]
Length=240

 Score =   350 bits (897),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 163/233 (70%), Positives = 195/233 (84%), Gaps = 6/233 (3%)
 Frame = +2

Query  278  GGDKYRDYLSEDEVKNTKWRSGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEME  457
            GG+KYRDYLS++E+KNTKWR+GPP+YDVVDKLFE+ RTHVW EGS+E+KVQRL+KTWEME
Sbjct  8    GGNKYRDYLSDEELKNTKWRNGPPTYDVVDKLFEQERTHVWAEGSVEDKVQRLLKTWEME  67

Query  458  IVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADE  637
            +VHK DPN+ K++DPTKF+  VNGRKGL+ E+  K+GG YN FLQTSLPE  RV+NP DE
Sbjct  68   LVHKIDPNEMKSVDPTKFKKSVNGRKGLTPEEAVKLGGGYNTFLQTSLPENLRVYNPEDE  127

Query  638  TFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGM  817
            TF SSQ VFR+ F RGFAIE+L VYSGPP I Y+FRHWGYMDGPFKG+  TG++ E FG+
Sbjct  128  TFESSQNVFRSIFVRGFAIEVLHVYSGPPEIVYKFRHWGYMDGPFKGYVATGQLVELFGI  187

Query  818  GIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAAT------SSACPFMK  958
            GIFEL++ESNKIVKAE FFDRGELLG L+KGG + E+ +       S CPFMK
Sbjct  188  GIFELEKESNKIVKAEFFFDRGELLGPLMKGGKNGESTSEMALLEDSKCPFMK  240



>emb|CDP18288.1| unnamed protein product [Coffea canephora]
Length=234

 Score =   339 bits (869),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/234 (69%), Positives = 190/234 (81%), Gaps = 3/234 (1%)
 Frame = +2

Query  269  SGTGGDKYRDYLSEDEVKNTKWRSGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTW  448
            + + GDKYR YL+E++VKNT WR GPP+YD V+KLFEEGRT +WP GSLEEKVQRL+KTW
Sbjct  2    AASEGDKYRSYLTEEDVKNTTWRFGPPNYDAVNKLFEEGRTKIWPVGSLEEKVQRLVKTW  61

Query  449  EMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNP  628
            EMEIVHK +P++YKTLD  KF L +NGRK L+LE+  K+GGSYNVFLQT LPE +RV+NP
Sbjct  62   EMEIVHKVNPDEYKTLDAKKFTLGINGRKALTLEEAGKLGGSYNVFLQTGLPENFRVYNP  121

Query  629  ADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEF  808
            A+ET  SSQ VF   F RGFA+EILQVYSGPP I Y+FRHWG+M+GPFKGH PTGE+ EF
Sbjct  122  ANETAESSQKVFTTTFARGFAVEILQVYSGPPLIVYKFRHWGFMEGPFKGHAPTGEMVEF  181

Query  809  FGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDE--AATSSACPFMKGA  964
            FG+ IFELDE S K VKAE F+D G+LLG LVKG  S+E  A TSS+CPF   A
Sbjct  182  FGLAIFELDEHS-KAVKAEFFYDPGQLLGGLVKGKMSEEHKAETSSSCPFFTTA  234



>ref|XP_011069614.1| PREDICTED: pathogen-related protein-like [Sesamum indicum]
Length=238

 Score =   332 bits (851),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 155/238 (65%), Positives = 190/238 (80%), Gaps = 7/238 (3%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLM  439
            MA SG GGDKYR YL+E+E+K T+W +GPP+YDVV++LFEEGRT VWP GSLEEKVQ L+
Sbjct  1    MATSGVGGDKYRSYLTEEELKTTQWNAGPPNYDVVNRLFEEGRTKVWPVGSLEEKVQNLV  60

Query  440  KTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRV  619
            KTWEME+VHKA+P+DYKTLD  KF L +NG+K  +LE+  K+GGSYNVFLQTSLP   R 
Sbjct  61   KTWEMELVHKANPDDYKTLDANKFVLGINGKKYFTLEEVGKVGGSYNVFLQTSLPPALRS  120

Query  620  FNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEI  799
            ++P  E++ SSQ+ F+  FPRGFA+EILQVYSGPP I Y+FRHWGYM+GPF+GH PTGE+
Sbjct  121  YDPDQESYESSQSAFKTVFPRGFAVEILQVYSGPPVIAYKFRHWGYMEGPFQGHAPTGEL  180

Query  800  AEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATS------SACPFM  955
             EFFG  IFELDE S K+VK + FFDRGELL  L+KG  + EA+++      S CPFM
Sbjct  181  VEFFGTAIFELDENS-KVVKVDFFFDRGELLADLIKGERTGEASSNAPSGSGSRCPFM  237



>ref|XP_010062147.1| PREDICTED: pathogen-related protein-like [Eucalyptus grandis]
 gb|KCW69217.1| hypothetical protein EUGRSUZ_F02733 [Eucalyptus grandis]
Length=239

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 151/236 (64%), Positives = 180/236 (76%), Gaps = 5/236 (2%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA SG+G DKYR ++S D  KNTKWR  GPP+YDVV+KLFEEGRT +WP GSLEEKVQ L
Sbjct  1    MASSGSGEDKYRSFMSGDGEKNTKWRFGGPPNYDVVNKLFEEGRTQIWPPGSLEEKVQNL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +K+WEME+ HKADP D+KT DP K  L +NGRK  SL D  KIGG YN FLQT+LP+  R
Sbjct  61   VKSWEMEMFHKADPEDFKTADPKKLTLSLNGRKAQSLADVGKIGGGYNFFLQTALPDNLR  120

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
             +NP  E F S+   F   FPRGFA+EI+QVY+GPP I Y+FRHWGYM+GPFKGH PTGE
Sbjct  121  FYNPEGENFNSALVAFTTTFPRGFAVEIIQVYTGPPVIAYKFRHWGYMEGPFKGHAPTGE  180

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGG---SSDEAATSSACPFM  955
              +FFG+GIFELD E+ KIVK E F DRGELLG L++G    SS E ++++ CPFM
Sbjct  181  KVQFFGIGIFELD-ENEKIVKVEFFCDRGELLGGLMRGATLQSSGEESSATGCPFM  235



>ref|XP_008785812.1| PREDICTED: pathogen-related protein-like [Phoenix dactylifera]
Length=236

 Score =   314 bits (805),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 152/234 (65%), Positives = 180/234 (77%), Gaps = 3/234 (1%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA S   GDKYR ++  +  KNT+WRSG PP++DVVDKLFEEGRT VWP GS+EEKVQRL
Sbjct  1    MASSAVEGDKYRSFMYGEGEKNTQWRSGAPPNFDVVDKLFEEGRTQVWPLGSIEEKVQRL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KT+EMEI HK  P DYK ++P KF   VNGRK L+L+D  +IGGSYN FLQTSLPE  R
Sbjct  61   VKTFEMEIAHKIRPEDYKCVNPEKFLFIVNGRKPLTLKDIRQIGGSYNAFLQTSLPEDLR  120

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
            ++NPA ET  SSQ  F  A PRGFA+E+LQVYSGPP I Y+FRHWGYM+GPFKGH PTGE
Sbjct  121  IYNPAQETAESSQKAFTTALPRGFALEVLQVYSGPPTIVYKFRHWGYMEGPFKGHAPTGE  180

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEA-ATSSACPFM  955
             AEFFGM IF +DEE  ++ K E F++RG+ L A +KG  +D A ATSS CPFM
Sbjct  181  KAEFFGMAIFHVDEEM-RLEKVEFFYERGDFLAAFLKGAPTDGAQATSSRCPFM  233



>ref|XP_008785811.1| PREDICTED: pathogen-related protein-like [Phoenix dactylifera]
Length=236

 Score =   310 bits (793),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 149/234 (64%), Positives = 180/234 (77%), Gaps = 3/234 (1%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA S   GDKYR ++  +  KNT+WRSG PP+YDVVDKLFEEGRT VWP GS+EEKV+RL
Sbjct  1    MASSAVEGDKYRSFMYGEGEKNTQWRSGAPPNYDVVDKLFEEGRTQVWPLGSIEEKVERL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEMEIVHK  P D K+++P KF   VNGRK ++ +D  ++GGSYN FLQT+LPE  R
Sbjct  61   VKTWEMEIVHKIRPEDCKSVNPEKFIFSVNGRKPITHQDIVEMGGSYNAFLQTNLPEDRR  120

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
            ++NPA ET  SSQ  F  A PRGFA+E+LQVYSGPP I Y+FRHWGYM+GPFKGH PTGE
Sbjct  121  IYNPAQETAESSQKAFTTALPRGFALEVLQVYSGPPTIVYKFRHWGYMEGPFKGHAPTGE  180

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEA-ATSSACPFM  955
             AEFFGM IF +DEE  +I K E F++RG+ L A +KG  +D A +TSS CPFM
Sbjct  181  KAEFFGMAIFHVDEEM-RIEKVEFFYERGDFLAAFLKGAPTDGASSTSSRCPFM  233



>gb|EYU17419.1| hypothetical protein MIMGU_mgv1a012483mg [Erythranthe guttata]
Length=249

 Score =   309 bits (792),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/233 (65%), Positives = 184/233 (79%), Gaps = 10/233 (4%)
 Frame = +2

Query  284  DKYRDYLSE-DEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEME  457
            +KYR YL+E D+VKN KWR G PP+YDVV+KLFEEGRT +W  GS+EEKVQ L+KTWEME
Sbjct  13   EKYRSYLNEEDDVKNIKWRYGAPPNYDVVNKLFEEGRTKIWSAGSVEEKVQNLVKTWEME  72

Query  458  IVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGS-YNVFLQTSLPEKYRVFNPAD  634
            + HK + ++YKT+DP K+R  +NGRK LSLE+  K+GG  YN  LQTSLPEK+R FNPA+
Sbjct  73   MFHKVNFDEYKTVDPLKYRFSLNGRKALSLEEKRKLGGGGYNSLLQTSLPEKFRCFNPAE  132

Query  635  ETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFG  814
            ET  SS   F  AFPRGFA+EI+QVYSGPP I Y+FRHWG+M+GPFKGH PTGE+ EFFG
Sbjct  133  ETVDSSHLAFTTAFPRGFALEIIQVYSGPPVIVYKFRHWGFMEGPFKGHSPTGEMVEFFG  192

Query  815  MGIFELDEESNKIVKAELFFDRGELLGALVKGGS-SDEAAT-----SSACPFM  955
            M IFE+DE S K+VK E F+DRGELLG LVKG + SD+  T     SS+CPF+
Sbjct  193  MAIFEVDENS-KVVKVEFFYDRGELLGGLVKGAALSDDVVTMSKDVSSSCPFL  244



>ref|XP_011084185.1| PREDICTED: pathogen-related protein-like [Sesamum indicum]
Length=234

 Score =   308 bits (789),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 179/226 (79%), Gaps = 4/226 (2%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWRSGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEIV  463
            DKYR YLSE+E+KNTKWR+GPP+YD+V+KLFEEGRT +W  GSLE++VQ L+KTWEME +
Sbjct  10   DKYRSYLSEEELKNTKWRAGPPNYDLVNKLFEEGRTKIWAAGSLEDQVQNLVKTWEMESI  69

Query  464  HKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADETF  643
            HKA+P+DYKT+D  K+ + +NG++  +LE+  +IGG YNVFLQTSLP   R ++P  ET+
Sbjct  70   HKANPDDYKTVDAKKYVVGINGKRYFTLEEARRIGGGYNVFLQTSLPPALRSYDPDRETY  129

Query  644  VSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMGI  823
             SSQA F+  FPRGFA+E+LQVYSGPP I Y+FRHWGYM+GPF+GH PTGE+ EFFG  I
Sbjct  130  ESSQAAFKTVFPRGFALEVLQVYSGPPVIAYKFRHWGYMEGPFQGHAPTGELVEFFGTSI  189

Query  824  FELDEESNKIVKAELFFDRGELLGALVKGGSSDEAAT--SSACPFM  955
             ++  E +K+VK E FFDRGELL  L+KG    E  +  +SACPFM
Sbjct  190  IQM--EDSKVVKVEFFFDRGELLAQLIKGEKMGECGSNVASACPFM  233



>ref|XP_010916130.1| PREDICTED: pathogen-related protein-like [Elaeis guineensis]
Length=236

 Score =   308 bits (789),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/234 (63%), Positives = 178/234 (76%), Gaps = 3/234 (1%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA S   GDKYR ++  +  KNT+WR G PP+YDVV+KLFEEGRT  WP GS+EEKVQRL
Sbjct  1    MASSAVEGDKYRSFIYGEGEKNTQWRFGAPPNYDVVNKLFEEGRTQEWPVGSIEEKVQRL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEME+VHK  P DYK+++P KF   VNGRK ++L+D  +IGGSYN FLQTSLPE  R
Sbjct  61   VKTWEMELVHKIRPQDYKSVNPEKFLFIVNGRKPITLQDIRQIGGSYNAFLQTSLPEDLR  120

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
            +++PA ET  +SQ  F  AFPRGFA+E+LQVYSGPP I Y FRHWGYM+GPFKGH PTGE
Sbjct  121  IYDPAQETAETSQQAFTTAFPRGFALEVLQVYSGPPTIAYEFRHWGYMEGPFKGHAPTGE  180

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAA-TSSACPFM  955
              EF GM IF +DEE  K+ K E F++RG+ L A +KG  +D A+ TSS CPFM
Sbjct  181  RVEFLGMAIFHVDEEM-KVEKVEFFYERGDFLAAFLKGAPTDGASGTSSRCPFM  233



>ref|XP_002306682.1| putative pathogenesis-related family protein [Populus trichocarpa]
 gb|EEE93678.1| putative pathogenesis-related family protein [Populus trichocarpa]
Length=238

 Score =   305 bits (780),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 146/238 (61%), Positives = 178/238 (75%), Gaps = 4/238 (2%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA SG   DKYR +L  +  KNTKWR G PP+YD+V+KLFEEGRT VWP GSLEEKVQ L
Sbjct  1    MATSGVREDKYRTFLYGEGEKNTKWRFGSPPNYDIVNKLFEEGRTKVWPSGSLEEKVQNL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEME+ HK   +DYK++DP  +   +NGRK ++LE+  K+GG YN FLQT+LPEK+R
Sbjct  61   VKTWEMEMFHKTCFDDYKSVDPKNYTFSLNGRKPVTLEEKRKLGGGYNTFLQTTLPEKFR  120

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
             +NPA+ET  SS   F  AFPRG A+E+LQVYSGPP I Y+FRHWGYM+GPFKGH  TGE
Sbjct  121  AYNPAEETVDSSHVAFTTAFPRGLALEVLQVYSGPPVIVYKFRHWGYMEGPFKGHAATGE  180

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSD--EAATSSACPFMKGA  964
            I E +GM IFE+DE   K+VK E F DRGELLG L+KG + D   A  +S CPF++G 
Sbjct  181  IVELYGMSIFEVDEHM-KVVKVEFFIDRGELLGGLMKGATLDGSTAEAASTCPFLRGT  237



>gb|ABK96224.1| unknown [Populus trichocarpa x Populus deltoides]
Length=238

 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/238 (61%), Positives = 179/238 (75%), Gaps = 4/238 (2%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA SG   DKYR +L  +  KNTKWR G PP+YD V+KLFEEGRT VWP GSLEEKVQ L
Sbjct  1    MATSGVREDKYRTFLYGEGEKNTKWRYGSPPNYDDVNKLFEEGRTKVWPSGSLEEKVQNL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEME+ HK   +D+K++DP  +   +NGRK ++LE+  K+GG YN FLQT+LPEK+R
Sbjct  61   VKTWEMEMFHKTCFDDHKSVDPKNYTFSLNGRKPVTLEEKRKLGGGYNTFLQTTLPEKFR  120

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
             +NPA+ET  S+Q  F  AFPRGFA+E+LQVYSGPP I Y+FRHWGYM+GPFKGH  TGE
Sbjct  121  AYNPAEETVDSAQVAFTTAFPRGFALEVLQVYSGPPVIVYKFRHWGYMEGPFKGHAATGE  180

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSD--EAATSSACPFMKGA  964
            I E +GM IFE+DE   K+VK E F DRGELLG L+KG + D   A  +S CPF++G 
Sbjct  181  IVELYGMSIFEVDEHM-KVVKVEFFIDRGELLGGLMKGATLDGSTAEAASTCPFLRGT  237



>ref|XP_010999816.1| PREDICTED: pathogen-related protein-like [Populus euphratica]
Length=238

 Score =   302 bits (774),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 145/238 (61%), Positives = 179/238 (75%), Gaps = 4/238 (2%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA SG   DKYR +L  +  KNTKWR G PP+YD V+KLFEEGRT VWP GSLEEKVQ L
Sbjct  1    MATSGVREDKYRTFLYGEGEKNTKWRYGSPPNYDDVNKLFEEGRTQVWPSGSLEEKVQNL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEME+ +K   +DYK++DP  +   +NGRK ++LE+  K+GG YN FLQT+LPEK+R
Sbjct  61   VKTWEMEMFNKTCFDDYKSVDPKNYTFSLNGRKPVTLEEKRKLGGGYNTFLQTTLPEKFR  120

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
             +NPA+ET  S+   FR AFPRGFA+E+LQVYSGPP I Y+FRHWGYM+GPFKGH  TGE
Sbjct  121  AYNPAEETVDSAHVAFRTAFPRGFALEVLQVYSGPPVIVYKFRHWGYMEGPFKGHAATGE  180

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSD--EAATSSACPFMKGA  964
            + E +GM IFE+DE   K+VK E F DRGELLG L+KG + D   A  +S CPF++G 
Sbjct  181  LVELYGMSIFEVDEHM-KVVKVEFFIDRGELLGGLMKGATLDGSTAEAASTCPFLRGT  237



>ref|XP_002306681.2| hypothetical protein POPTR_0005s21070g [Populus trichocarpa]
 gb|EEE93677.2| hypothetical protein POPTR_0005s21070g [Populus trichocarpa]
Length=238

 Score =   302 bits (774),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 145/238 (61%), Positives = 178/238 (75%), Gaps = 4/238 (2%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA SG   DKYR +L  +  KNTKWR G PP+YD V+KLFEEGRT VWP GSLEEKVQ L
Sbjct  1    MATSGVREDKYRTFLYGEGEKNTKWRYGSPPNYDDVNKLFEEGRTKVWPSGSLEEKVQNL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEME+ HK   +DYK++DP  +   +NGRK ++LE+T K+GG YN FLQT+LPEK+R
Sbjct  61   VKTWEMEMFHKTCFDDYKSVDPKNYTFSLNGRKPVTLEETRKLGGGYNTFLQTTLPEKFR  120

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
             +NP +ET  S+Q  F   FPRGFA+E+LQVYSGPP I Y+FRHWGYM+GPFKGH  TGE
Sbjct  121  AYNPDEETVDSAQVAFTTVFPRGFALEVLQVYSGPPVIVYKFRHWGYMEGPFKGHAATGE  180

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSD--EAATSSACPFMKGA  964
            + E +GM IFE+DE   K+VK E F DRGELLG L+KG + D   A  +S CPF++G 
Sbjct  181  LVELYGMSIFEVDEHM-KVVKVEFFIDRGELLGGLMKGATLDGSTAEAASTCPFLRGT  237



>gb|EYU17420.1| hypothetical protein MIMGU_mgv1a012039mg [Erythranthe guttata]
Length=263

 Score =   301 bits (771),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/244 (61%), Positives = 179/244 (73%), Gaps = 6/244 (2%)
 Frame = +2

Query  230  GGHCG*RTTKMACSGTGGDKYRDYLSEDEVKNTKWRSGPPSYDVVDKLFEEGRTHVWPEG  409
            G  C   TT  +    GGDKYR YL+ +++ NTKW SG P+YDVV+KLFEEGRTHVW  G
Sbjct  25   GATC---TTPSSAGSEGGDKYRWYLTPEDLANTKWLSGVPNYDVVNKLFEEGRTHVWEAG  81

Query  410  SLEEKVQRLMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFL  589
            SLEE VQ L+KTWE E+V KADPNDYKT+ P  F L +NG+K  +LE   KIGGSYNVFL
Sbjct  82   SLEEYVQSLVKTWEFELVQKADPNDYKTVVP-NFILGINGKKYFTLEQIGKIGGSYNVFL  140

Query  590  QTSLPEKYRVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGP  769
            QTSLP   R +NP +ET+ SSQ VF+  FPRGFA EILQV+SGPP I ++FRHWGY +G 
Sbjct  141  QTSLPPSLRFYNPDEETYNSSQTVFKQVFPRGFAFEILQVFSGPPVIAFKFRHWGYFEGS  200

Query  770  FKGHPPTGEIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAAT-SSAC  946
            +K + PTGE+ EFFG  I+ L+EE  K+   E FFDRGELL  L+KG +SDEAA  S  C
Sbjct  201  YKEYAPTGELIEFFGTAIYTLNEEC-KVTNVEFFFDRGELLAGLLKGKTSDEAAALSGGC  259

Query  947  PFMK  958
            PF++
Sbjct  260  PFVQ  263



>ref|XP_010110490.1| hypothetical protein L484_003537 [Morus notabilis]
 gb|EXC26591.1| hypothetical protein L484_003537 [Morus notabilis]
Length=239

 Score =   300 bits (767),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 146/236 (62%), Positives = 175/236 (74%), Gaps = 5/236 (2%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA SG   DKYR YL  +  KNTKWR G PP+YDVV+KLFEEGRT  WP GS+EE+VQ L
Sbjct  1    MASSGIKEDKYRSYLHGEGEKNTKWRFGAPPNYDVVNKLFEEGRTKEWPAGSVEEQVQNL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEME+ HK    DYKTLDP K+   +NGRK L+LE+  K+GG YN  LQTSLPEK+R
Sbjct  61   VKTWEMEMFHKTCFEDYKTLDPDKYTFSLNGRKALTLEEKRKLGGGYNSLLQTSLPEKFR  120

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
             +NPA+ET  SS   F   FPRGFA+E+++VYSGPP I Y+FRHWGYM+GPFKGH PT E
Sbjct  121  CYNPAEETADSSHQAFTTTFPRGFALEVVRVYSGPPVIVYKFRHWGYMEGPFKGHAPTEE  180

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEA---ATSSACPFM  955
            + + FGM IFELDE+  KIV+ E F+DRGELLG L+KG   D       +S+CPFM
Sbjct  181  MVQLFGMAIFELDEQE-KIVRVEFFYDRGELLGGLMKGVKLDNVPPEEAASSCPFM  235



>ref|XP_010244012.1| PREDICTED: pathogen-related protein-like [Nelumbo nucifera]
Length=238

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 145/236 (61%), Positives = 177/236 (75%), Gaps = 4/236 (2%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA     GDKYR ++  +  KNTKWR G PP+YDVV+KLFEEGRT +WP GSLEEKVQ L
Sbjct  1    MASPTVEGDKYRSHIYGEAEKNTKWRWGAPPNYDVVNKLFEEGRTKIWPPGSLEEKVQNL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEME+ HK   NDYKT+DP K+R  +NGR  +SLE+  ++GG YN  LQTSLPE+YR
Sbjct  61   VKTWEMEMFHKTGFNDYKTVDPEKYRFSLNGRPLISLEEKRRLGGGYNSLLQTSLPEEYR  120

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
             +NP  ET  S+   F  AFPRGFA+EILQVYSGPP I Y+FRHWG+M+GPFKGH PT E
Sbjct  121  CYNPDVETVDSAHQAFTTAFPRGFALEILQVYSGPPVIVYKFRHWGFMEGPFKGHAPTRE  180

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATS--SACPFMK  958
            + E +GM IFELDE+  +IVK E F+DRGELLG L+KG SS  +     S+CPF++
Sbjct  181  MVELYGMAIFELDEQM-RIVKVEFFYDRGELLGGLMKGESSANSIEQGPSSCPFLR  235



>ref|XP_002262980.1| PREDICTED: pathogen-related protein [Vitis vinifera]
Length=237

 Score =   295 bits (754),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 147/237 (62%), Positives = 174/237 (73%), Gaps = 7/237 (3%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSGP-PSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            M  S   GDKYR YL  +  +NT+WR G  P+YDVV+KLFEEGRT +WP GSLEE+VQ +
Sbjct  1    MGASAAQGDKYRSYLYGEGEENTEWRYGAAPNYDVVNKLFEEGRTKIWPPGSLEEQVQNM  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEME+ HK    D+K++DP K+   +NGRK LSLE+  K+GG YN  LQTSLPEK+R
Sbjct  61   VKTWEMEMFHKVKMEDFKSVDPNKYTFSLNGRKPLSLEEKRKLGGGYNPLLQTSLPEKFR  120

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
             +NP  ET +SS   F  AFPRGFA+EILQVYSGPP I Y+FRHWGYM+GPFKGH PTGE
Sbjct  121  AYNPDGETAISSHLAFTTAFPRGFALEILQVYSGPPVILYKFRHWGYMEGPFKGHAPTGE  180

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKG---GSSDEAATSSACPFMK  958
              E FGM IFE DE S KIVK E F+DRGELLG L+K    GS D  AT S CP ++
Sbjct  181  RIEVFGMAIFEQDEHS-KIVKVEFFYDRGELLGGLLKAVSDGSMD--ATPSNCPVLR  234



>emb|CDP18287.1| unnamed protein product [Coffea canephora]
Length=240

 Score =   295 bits (754),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 175/226 (77%), Gaps = 5/226 (2%)
 Frame = +2

Query  287  KYRDYLSEDE-VKNTKWRSGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEIV  463
            KYR YLSE+E VKN  WR GPP+YD+VDKLFEEGRT +WP GSLE+ VQRL+KTWEME+ 
Sbjct  9    KYRSYLSEEEEVKNIHWRYGPPNYDLVDKLFEEGRTKIWPAGSLEDTVQRLVKTWEMEVF  68

Query  464  HKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADETF  643
            HKA+P +YKT+D   + + VNGRK L++E+  K+GG YNV LQT+LPE++R ++PA ET 
Sbjct  69   HKANPAEYKTIDTKNYTVSVNGRKPLTIEEKGKLGGGYNVLLQTALPEEFRAYDPAKETM  128

Query  644  VSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMGI  823
             S+  VFR  FPRGFA+EIL VYSGPP I Y+FRHWG+M+GPFKG+ PTGE+ EFFGM I
Sbjct  129  ESALKVFRTTFPRGFALEILHVYSGPPVIVYKFRHWGFMEGPFKGNSPTGEMVEFFGMAI  188

Query  824  FELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATS--SACPFM  955
            FE+   ++K+VK + F+D G+LL  L+KG  SDE      S CPF+
Sbjct  189  FEVP--NSKVVKVQFFYDPGQLLEGLLKGKPSDEYKIKALSTCPFL  232



>ref|XP_006434416.1| hypothetical protein CICLE_v10002326mg [Citrus clementina]
 gb|ESR47656.1| hypothetical protein CICLE_v10002326mg [Citrus clementina]
 gb|KDO83645.1| hypothetical protein CISIN_1g026494mg [Citrus sinensis]
Length=238

 Score =   294 bits (752),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 143/236 (61%), Positives = 175/236 (74%), Gaps = 4/236 (2%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA     GDKYR YL  +E KNTKWR G  P+YDVVDKLFEEGRT VWP GSLEEKVQ L
Sbjct  1    MASPSFNGDKYRSYLHGEEEKNTKWRFGSAPNYDVVDKLFEEGRTKVWPPGSLEEKVQNL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEME+ HK    DYK++DP  +   +NGRK ++LE+  K+GG YN F+QTSLPEKYR
Sbjct  61   VKTWEMEMFHKTCFEDYKSVDPNNYTFSLNGRKPITLEEKRKLGGGYNSFMQTSLPEKYR  120

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
             +NPA+ET  SS   F  AFPRGFA+E++ VYSGPP I Y+FRHWGYM+GPFK H PTG+
Sbjct  121  GYNPAEETVESSHIAFTKAFPRGFALEVVHVYSGPPVIVYKFRHWGYMEGPFKSHAPTGD  180

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGAL--VKGGSSDEAATSSACPFMK  958
            + E +G+ IFE+DE+  KIVK E F DRGELLG L  +KG +S     + +CPF++
Sbjct  181  LVELYGIAIFEVDEQM-KIVKVEFFLDRGELLGGLMKLKGDNSCGEEEALSCPFLR  235



>ref|XP_006472936.1| PREDICTED: pathogen-related protein-like [Citrus sinensis]
Length=237

 Score =   293 bits (751),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/235 (61%), Positives = 174/235 (74%), Gaps = 3/235 (1%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA     GDKYR YL  +E KNTKWR G  P+YDVVDKLFEEGRT VWP GSLEEKVQ L
Sbjct  1    MASPSFNGDKYRSYLHGEEEKNTKWRFGSAPNYDVVDKLFEEGRTKVWPPGSLEEKVQNL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEME+ HK    DYK++DP  +   +NGRK ++LE+  K+GG YN F+QTSLPEKYR
Sbjct  61   VKTWEMEMFHKTCFEDYKSVDPNNYTFSLNGRKPITLEEKRKLGGGYNSFMQTSLPEKYR  120

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
             +NPA+ET  SS   F  AFPRGFA+E++ VYSGPP I Y+FRHWGYM+GPFK H PTG+
Sbjct  121  GYNPAEETVESSHIAFTKAFPRGFALEVVHVYSGPPVIVYKFRHWGYMEGPFKSHAPTGD  180

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVK-GGSSDEAATSSACPFMK  958
            + E +G+ IFE+DE+  KIVK E F DRGELLG L+K  G S     + +CPF++
Sbjct  181  LVELYGIAIFEVDEQM-KIVKVEFFLDRGELLGGLMKLKGDSCGEEEALSCPFLR  234



>ref|XP_008237645.1| PREDICTED: pathogen-related protein-like [Prunus mume]
Length=239

 Score =   290 bits (743),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/235 (60%), Positives = 175/235 (74%), Gaps = 4/235 (2%)
 Frame = +2

Query  263  ACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLM  439
            A S    DKYR YL  +  KNTKWR G PP+YDVV+KLFEEGRT +WP GSLEE VQ L+
Sbjct  3    ASSADQKDKYRSYLYGEGEKNTKWRFGAPPNYDVVNKLFEEGRTKIWPPGSLEEMVQNLL  62

Query  440  KTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRV  619
            KT+EME+ HKA  +D+K++DP KF L +NGRKGL L+D  K+GG YN  LQ+SLPE++++
Sbjct  63   KTYEMELFHKACVDDFKSIDPKKFTLSLNGRKGLGLDDIKKLGGGYNPLLQSSLPEEFQI  122

Query  620  FNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEI  799
            + P++ET  SS   F   FPRGFA+EILQVYSGPP+I Y+FRHW YM+GPFKGH PTGE+
Sbjct  123  YKPSEETADSSHRAFTTTFPRGFAVEILQVYSGPPQIVYKFRHWAYMEGPFKGHAPTGEL  182

Query  800  AEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAA--TSSACPFMK  958
             EF+GM IF +DE   KIV  E F+D GELLGALVKG   +  A   ++ CP ++
Sbjct  183  VEFYGMAIFGVDEHM-KIVSVEFFYDPGELLGALVKGAKIENYAGEMTTGCPILR  236



>ref|XP_002263121.1| PREDICTED: pathogen-related protein isoform X1 [Vitis vinifera]
 emb|CBI19977.3| unnamed protein product [Vitis vinifera]
Length=238

 Score =   289 bits (740),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 148/236 (63%), Positives = 180/236 (76%), Gaps = 4/236 (2%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA S   GDKYR YLS D+ KNT+WR G PP+YDVV+KLFEEGRT +WP GSLEEKVQ L
Sbjct  1    MASSVVEGDKYRSYLSGDDEKNTEWRYGAPPNYDVVNKLFEEGRTKIWPAGSLEEKVQNL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEMEI HK +PN+YK+LDP K+   +NGRK ++     ++GG YN  + TSLPEK R
Sbjct  61   VKTWEMEIFHKTNPNEYKSLDPKKYTFSLNGRKPINFGQLRQLGGGYNPLMLTSLPEKLR  120

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
            V+NPADET  +S   F  AFPRGFA+EIL VY+GPP I Y+FRHWG+++GPFKGH PTGE
Sbjct  121  VYNPADETAQTSHLAFTTAFPRGFALEILHVYTGPPVIVYKFRHWGFVEGPFKGHAPTGE  180

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAA--TSSACPFMK  958
            + EFFGM +FELDE   KIVK E F+DRGELLG L+KG + D  A   SS+CP ++
Sbjct  181  MVEFFGMAVFELDEHM-KIVKVEFFYDRGELLGGLLKGTAMDGPAIEASSSCPVLR  235



>ref|XP_010683153.1| PREDICTED: pathogen-related protein-like [Beta vulgaris subsp. 
vulgaris]
Length=238

 Score =   289 bits (739),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 137/228 (60%), Positives = 173/228 (76%), Gaps = 4/228 (2%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            DKYR ++  +  KNTKW  G PP+YD+V+KLFEEGRT +WP GSLEEKVQ L+KT EME+
Sbjct  9    DKYRSFIYGEGEKNTKWVYGAPPNYDIVNKLFEEGRTKIWPPGSLEEKVQNLVKTMEMEL  68

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
             HKA+P DYK +D TKF   VNGRK L+LE+ A+ GG YN FLQTSLPE+ R+++PA ET
Sbjct  69   FHKANPQDYKAIDATKFTQSVNGRKPLTLEEIAQKGGGYNAFLQTSLPEEMRLYDPAKET  128

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMG  820
              SS  +F   FPRGFA+E+LQVYSGPP ITY+FRHW YM+GPF+GHPPTGE+ EFFG  
Sbjct  129  SQSSHKLFTTTFPRGFALEVLQVYSGPPVITYKFRHWAYMEGPFQGHPPTGELVEFFGFA  188

Query  821  IFELDEESNKIVKAELFFDRGELLGALVKGGS--SDEAATSSACPFMK  958
            IFE+DE+  +++K E F+DRGELL A++KG    S       +CP ++
Sbjct  189  IFEVDEQM-RVIKTEFFYDRGELLSAIMKGSKLESSFGDMKLSCPVLR  235



>ref|XP_007199060.1| hypothetical protein PRUPE_ppa018623mg [Prunus persica]
 gb|EMJ00259.1| hypothetical protein PRUPE_ppa018623mg [Prunus persica]
Length=239

 Score =   288 bits (738),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 140/235 (60%), Positives = 174/235 (74%), Gaps = 4/235 (2%)
 Frame = +2

Query  263  ACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLM  439
            A S    DKYR YL  +  KNTKWR G PP+YDVV+KLFEEGRT +WP GSLEE VQ L+
Sbjct  3    ASSADQKDKYRSYLYGEGEKNTKWRFGAPPNYDVVNKLFEEGRTKIWPPGSLEEMVQNLL  62

Query  440  KTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRV  619
            KT+EME+ HKA  +D+K++DP KF L +NGR+GLSLE   K+GG YN  LQ+SLPE++++
Sbjct  63   KTYEMELFHKACVDDFKSIDPKKFTLSLNGREGLSLEGIKKLGGGYNSLLQSSLPEEFQI  122

Query  620  FNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEI  799
            + P+ ET  SS   F   FPRGFA+EILQVYSGPP+I Y+FRHW YM+GPFKGH PTGE+
Sbjct  123  YKPSVETADSSHRAFTTTFPRGFAVEILQVYSGPPQIVYKFRHWAYMEGPFKGHAPTGEL  182

Query  800  AEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAA--TSSACPFMK  958
             EF+GM IF +DE   KIV  E F+D GELLGALVKG   +  A   ++ CP ++
Sbjct  183  VEFYGMAIFGVDEHM-KIVSVEFFYDPGELLGALVKGAKIENYAGEMTTGCPILR  236



>ref|XP_010062148.1| PREDICTED: pathogen-related protein-like [Eucalyptus grandis]
 gb|KCW69216.1| hypothetical protein EUGRSUZ_F02732 [Eucalyptus grandis]
Length=241

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/237 (58%), Positives = 175/237 (74%), Gaps = 5/237 (2%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA   T  DKYR YLS +  ++T WR G PP YD V+ LFE+GRT VWP GSLEEKVQ L
Sbjct  1    MASLETCEDKYRSYLSGEGEEHTHWRYGAPPDYDAVNTLFEQGRTKVWPPGSLEEKVQNL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEME+ HK    D K++DP  + + +NGRK L+LE+  K+GGSYN  LQTSLPEKYR
Sbjct  61   VKTWEMEMFHKTRFLDNKSIDPLHYTISLNGRKALNLEEKRKLGGSYNSLLQTSLPEKYR  120

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
             +NPA+ET  ++   F  AFPRGFA+E+LQVYSGPP I Y+FRHWG+M+GPFKGH PTG+
Sbjct  121  CYNPAEETVDTAHHAFTTAFPRGFALEVLQVYSGPPEIVYKFRHWGFMEGPFKGHAPTGD  180

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAAT---SSACPFMK  958
              E +GM +F+L+++  KIVK E F+DRGELLG L KGG  ++ A    +S+CP ++
Sbjct  181  KVELYGMAVFQLNDQE-KIVKVEFFYDRGELLGGLTKGGPMNDKAVEEAASSCPVLR  236



>ref|XP_002263092.1| PREDICTED: pathogen-related protein [Vitis vinifera]
 emb|CBI19976.3| unnamed protein product [Vitis vinifera]
Length=236

 Score =   287 bits (734),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 144/236 (61%), Positives = 174/236 (74%), Gaps = 6/236 (3%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA S   GDKYR +L  +E +NT+WR G PP+Y+VV KLFEEGRT +WP GSLEEKVQ L
Sbjct  1    MASSVGEGDKYRYHLDGEE-ENTEWRYGAPPNYEVVHKLFEEGRTKIWPAGSLEEKVQNL  59

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEME+ HK + +DYKT DP K+   +NGR+ ++ E+  K GG YN  LQTSLPEK R
Sbjct  60   VKTWEMEMFHKVNLDDYKTTDPKKYTFSLNGREPMNYEEIMKNGG-YNPLLQTSLPEKLR  118

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
            V+NPADET  S+   F   FPRGFA+EIL VYSGPP I Y+FRHWG+M+GPFKGH PTGE
Sbjct  119  VYNPADETAQSAHLAFTTTFPRGFALEILHVYSGPPVIVYKFRHWGFMEGPFKGHAPTGE  178

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEA--ATSSACPFMK  958
            + EFFGM +FELDE   KIVK E F+D GELLG LVKG + D      S+ CP ++
Sbjct  179  MVEFFGMAVFELDEHM-KIVKVEFFYDSGELLGGLVKGPTLDSTTYGASAGCPVLR  233



>ref|XP_009360747.1| PREDICTED: pathogen-related protein-like isoform X1 [Pyrus x 
bretschneideri]
Length=238

 Score =   286 bits (731),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/238 (61%), Positives = 176/238 (74%), Gaps = 8/238 (3%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSGP-PSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA  G  GDKYR +L+ D  KNTKW  G  PSYDV +KLFEEGRT +WP GSLEE+VQ L
Sbjct  1    MASLGVEGDKYRSHLTGDGEKNTKWNFGATPSYDVANKLFEEGRTKIWPPGSLEEEVQNL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEME+ HK++P+D+KTLDP K+ + +NGRKG+++E+  KIGG YN FLQTSLPEK R
Sbjct  61   VKTWEMELFHKSNPDDFKTLDPNKYTVSLNGRKGINIEEIGKIGGGYNAFLQTSLPEKLR  120

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
             +NP +ET  SS   F   FPRGFA+E+LQVYSGPP I Y+FRHWGYM+GPFKGH PTGE
Sbjct  121  GYNPDEETAESSLKSFTTTFPRGFALEVLQVYSGPPEILYKFRHWGYMEGPFKGHAPTGE  180

Query  797  IAEFFGMGIFELDEESNKIVKAELFFD----RGELLGALVKGGSSDEAATSSACPFMK  958
            + EFFGM IF +DE   KIVK E FFD     G LL     G SS+E  T+S CP ++
Sbjct  181  MVEFFGMAIFTVDEHK-KIVKVEFFFDPGQLLGGLLKGAKLGNSSEE--TASTCPVLR  235



>ref|XP_010683154.1| PREDICTED: pathogen-related protein-like [Beta vulgaris subsp. 
vulgaris]
Length=238

 Score =   285 bits (730),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/231 (59%), Positives = 173/231 (75%), Gaps = 4/231 (2%)
 Frame = +2

Query  281  GDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEME  457
            GDKYR ++  +  KNTKW  G PP+YD+V+KLFEEGRT +WP GSLEEKVQ L+KT EME
Sbjct  8    GDKYRSFIYGEGEKNTKWLYGAPPNYDIVNKLFEEGRTKIWPPGSLEEKVQNLVKTMEME  67

Query  458  IVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADE  637
            + HK  P DYK +D TKF   VNGRK L+LE+ A+ GG YNVFLQTSLPE+ R+++PA E
Sbjct  68   LFHKVSPQDYKAVDATKFTKSVNGRKPLTLEEAAQKGGGYNVFLQTSLPEEIRLYDPAKE  127

Query  638  TFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGM  817
            T  SS  +F   FPRGFA+E+LQVYSGPP ITY+FRHW YM+GPF+G PPTGE+ EFFG+
Sbjct  128  TRQSSHKLFTTTFPRGFALEVLQVYSGPPVITYKFRHWAYMEGPFQGRPPTGELVEFFGV  187

Query  818  GIFELDEESNKIVKAELFFDRGELLGALVKGGSSDE--AATSSACPFMKGA  964
             IFE+DE+  +++K E F+DRGELL AL+KG   +        +CP ++  
Sbjct  188  AIFEVDEQM-RLIKTEFFYDRGELLSALMKGPKLESYFGDMKLSCPVLRNT  237



>gb|KDP43037.1| hypothetical protein JCGZ_25223 [Jatropha curcas]
Length=240

 Score =   285 bits (730),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/231 (60%), Positives = 172/231 (74%), Gaps = 4/231 (2%)
 Frame = +2

Query  281  GDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEME  457
            GDKYR YL  +  KNTKWR G PP+YDVVDKLFEEGRT VWP GSLEEKVQ L+KTWEME
Sbjct  10   GDKYRSYLHGEGEKNTKWRFGAPPNYDVVDKLFEEGRTKVWPPGSLEEKVQNLLKTWEME  69

Query  458  IVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADE  637
            + HK   +DYK++DP K+   +NG K ++LE   K+GG YN FL+TSLP KYR ++   E
Sbjct  70   VFHKTCFDDYKSIDPKKYTYSLNGMKPVTLEGKMKLGGGYNTFLRTSLPAKYRAYDYEKE  129

Query  638  TFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGM  817
            T  ++   F   FPRGFAIE+LQVYSGPP I ++FRHWGYM+GPFKG+ PTGE+ E +G 
Sbjct  130  TVDTAHVAFITTFPRGFAIEVLQVYSGPPVIAFKFRHWGYMEGPFKGYAPTGELVEIYGT  189

Query  818  GIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAA--TSSACPFMKGA  964
             IFE+DE   KIVK E+F +  ELLG L+KGG+ D++    +S+CPF+KG 
Sbjct  190  AIFEVDEH-EKIVKVEIFMNGFELLGGLMKGGAIDDSTIEAASSCPFLKGT  239



>ref|XP_009348134.1| PREDICTED: pathogen-related protein-like [Pyrus x bretschneideri]
Length=238

 Score =   284 bits (727),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 141/236 (60%), Positives = 169/236 (72%), Gaps = 4/236 (2%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA      D YR  L  +E KNTKWR G PP+Y  V+K+FE+GRT  WP GSLEEKVQ L
Sbjct  1    MASPRVKEDNYRYNLYGEEEKNTKWRYGAPPNYGAVNKIFEQGRTKTWPPGSLEEKVQNL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEME+ HK    D+KT+DP K+   +NGRK +SLE+  K+GG YN  LQTSLP+  R
Sbjct  61   VKTWEMEMFHKVRDEDFKTIDPKKYTFSLNGRKAVSLEEKRKLGGGYNSLLQTSLPDDLR  120

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
             +NP++ET  ++   F  AFPRGFA+EIL VYSGPP I Y+FRHWG M+GPFKGH PTGE
Sbjct  121  GYNPSEETIDTAHMAFVTAFPRGFALEILHVYSGPPVIVYKFRHWGIMEGPFKGHAPTGE  180

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSSA--CPFMK  958
              E FGM IFELD E  KIVK E FFDRGELLG L+KG S   ++T +A  CPF+K
Sbjct  181  QVELFGMAIFELD-EGGKIVKVEFFFDRGELLGGLMKGPSVGSSSTEAALGCPFLK  235



>ref|XP_008373181.1| PREDICTED: pathogen-related protein-like [Malus domestica]
Length=238

 Score =   284 bits (726),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 144/238 (61%), Positives = 176/238 (74%), Gaps = 8/238 (3%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSGP-PSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA  G  GDKYR Y++ +  KNTKW  G  PSYDV +KLFEEGRT +WP GSLEE+VQ L
Sbjct  1    MASLGVEGDKYRSYMTGEGEKNTKWNFGATPSYDVDNKLFEEGRTKIWPPGSLEEEVQNL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEME+ HK++P+D+KTLDP K+ + VNGRKG+++E+  KIGG YN FLQTSLPEK R
Sbjct  61   VKTWEMELFHKSNPDDFKTLDPNKYTVSVNGRKGINIEEIGKIGGGYNSFLQTSLPEKLR  120

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
             +NP +ET  SS   F   FPRGFA+E+LQVYSGPP I Y+FRHWGYM+GPFKGH PTGE
Sbjct  121  GYNPDEETAESSLKAFTTTFPRGFALEVLQVYSGPPEIVYKFRHWGYMEGPFKGHAPTGE  180

Query  797  IAEFFGMGIFELDEESNKIVKAELFFD----RGELLGALVKGGSSDEAATSSACPFMK  958
            + EFFGM +F +DE   KIVK E F+D     G LL     G SS+E  T+S CP ++
Sbjct  181  MVEFFGMAVFTVDEHK-KIVKVEFFYDPGQLLGGLLKGAKLGNSSEE--TASTCPVLR  235



>ref|XP_003526679.1| PREDICTED: pathogen-related protein-like [Glycine max]
 gb|KHN23417.1| Pathogen-related protein [Glycine soja]
Length=237

 Score =   284 bits (726),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 139/239 (58%), Positives = 171/239 (72%), Gaps = 7/239 (3%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA S    D YR YL ED  KNTKWR G PP+YDVV+KL+EEGRT VWP+GSLEE+VQ L
Sbjct  1    MALSNVREDNYRSYLREDTEKNTKWRYGAPPNYDVVNKLYEEGRTKVWPQGSLEEQVQSL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +K WEME+ HK D  D++++DP K+   +NGRK ++LE+  K+GG Y   LQTS+PEK R
Sbjct  61   VKNWEMEMFHKVDLQDFRSIDPKKYTFSLNGRKPMTLEEMMKLGGGYIPMLQTSIPEKMR  120

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
             +NP +ET  SS   F   FPRGFA+EIL VYSGPP I Y+FRHWGYM+GPFK H PTGE
Sbjct  121  PYNPYEETADSSHKAFTTTFPRGFALEILHVYSGPPVIVYKFRHWGYMEGPFKRHAPTGE  180

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKG---GSSDEAATSSACPFMKGA  964
              +F+GM IF LDE S K+VK E F+D  ELLG L+KG   GS ++A  S  CP ++  
Sbjct  181  KIQFYGMAIFTLDENS-KVVKVEFFYDPAELLGGLLKGPEDGSVEDAIAS--CPILRNT  236



>ref|XP_009404798.1| PREDICTED: pathogen-related protein-like [Musa acuminata subsp. 
malaccensis]
Length=235

 Score =   283 bits (725),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 134/235 (57%), Positives = 173/235 (74%), Gaps = 3/235 (1%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA S   GDKYRD++  +  K+T WR G PP+YDVV+KLFEEGRT VWP GSLEE+VQRL
Sbjct  1    MASSAEQGDKYRDFMYGEGEKDTVWRFGAPPNYDVVNKLFEEGRTQVWPVGSLEERVQRL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEME+VHK  P DYK+++P KFRL +NG++GL+++    +GGSYN FLQTSLP + R
Sbjct  61   VKTWEMELVHKVRPEDYKSINPQKFRLSLNGKEGLTVQQIRDMGGSYNAFLQTSLPPELR  120

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
            +++P+ ET  SS   F   FPRGFA+EILQV SGPP I Y+FRHWGYM+GPF GH PTGE
Sbjct  121  IYDPSVETAESSGKEFATTFPRGFAVEILQVLSGPPVIVYKFRHWGYMEGPFHGHAPTGE  180

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEA-ATSSACPFMK  958
            + +F G GIF +D +  ++ K E F++RG+ L   +KGG  +   A+ S CP M 
Sbjct  181  VVQFIGTGIFHVD-DGMRVEKVEFFYERGDFLAGFLKGGPLESILASGSRCPIMN  234



>ref|XP_002526153.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36229.1| conserved hypothetical protein [Ricinus communis]
Length=238

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/238 (60%), Positives = 176/238 (74%), Gaps = 4/238 (2%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            M  S    DKYR +L  +E KNTKWR  GPP+YD+V+KLFEEGRT VWP GSLEEKVQ L
Sbjct  1    MTTSAVQVDKYRSHLDGEEEKNTKWRFGGPPNYDIVNKLFEEGRTKVWPSGSLEEKVQNL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEME+ HK   +DYK+LDP ++   +NGRK ++LE+  K+GG YN F+QTSLP K+R
Sbjct  61   VKTWEMEVFHKTCFDDYKSLDPKRYTFSLNGRKPVTLEEKRKLGGGYNTFMQTSLPVKFR  120

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
             ++P  ET  S+   F  AFPRGFA+E+LQVYSGPP I Y+FRHWGYM+GPFKGH PTGE
Sbjct  121  AYDPDKETVDSAHVAFSTAFPRGFALEVLQVYSGPPVIVYKFRHWGYMEGPFKGHSPTGE  180

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSSA--CPFMKGA  964
            + E FGM IFE+D++  KIVK E F + GELLG L+KG + D   T  A  CPF+KG 
Sbjct  181  LVELFGMSIFEVDKDM-KIVKVEFFLNGGELLGGLMKGAALDGTTTDVAPSCPFLKGT  237



>ref|XP_008339140.1| PREDICTED: pathogen-related protein-like [Malus domestica]
Length=238

 Score =   282 bits (722),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 138/236 (58%), Positives = 169/236 (72%), Gaps = 4/236 (2%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA      D YR  L  +E KNTKWR G PP+Y  V+K+FE+GRT  WP GSLEEKVQ L
Sbjct  1    MASPRVKEDNYRYNLYGEEEKNTKWRYGAPPNYGAVNKIFEQGRTKTWPPGSLEEKVQNL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEME+ HK    D+KT+DP K+   +NGRK +SLE+  K+GG YN  LQTSLP++ R
Sbjct  61   VKTWEMEMFHKVRDEDFKTIDPKKYTFSLNGRKAVSLEEKRKLGGGYNSLLQTSLPDELR  120

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
             +NP++ET  ++   F   FPRGFA+EIL VYSGPP I Y+FRHWG+M+GPFKGH PTGE
Sbjct  121  GYNPSEETIDTAHMAFVTTFPRGFALEILHVYSGPPVIVYKFRHWGFMEGPFKGHAPTGE  180

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSSA--CPFMK  958
              E FGM IFELD +  KIVK E FFDRGELLG L+KG S   ++  +A  CPF+K
Sbjct  181  QVELFGMAIFELD-DGGKIVKVEFFFDRGELLGGLMKGASVGSSSKEAALGCPFLK  235



>emb|CAN77211.1| hypothetical protein VITISV_035026 [Vitis vinifera]
Length=485

 Score =   290 bits (743),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 149/238 (63%), Positives = 181/238 (76%), Gaps = 4/238 (2%)
 Frame = +2

Query  254  TKMACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQ  430
             KMA S   GDKYR YLS D+ KNT+WR G PP+YDVV+KLFEEGRT +WP GSLEEKVQ
Sbjct  246  VKMASSVVEGDKYRSYLSGDDEKNTEWRYGAPPNYDVVNKLFEEGRTKIWPAGSLEEKVQ  305

Query  431  RLMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEK  610
             L+KTWEMEI HK +PN+YK+LDP K+   +NGRK ++     ++GG YN  + TSLPEK
Sbjct  306  NLVKTWEMEIFHKTNPNEYKSLDPKKYTFSLNGRKPINFGQLRQLGGGYNPLMLTSLPEK  365

Query  611  YRVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPT  790
             RV+NPADET  +S   F  AFPRGFA+EIL VY+GPP I Y+FRHWG+++GPFKGH PT
Sbjct  366  LRVYNPADETAQTSHLAFTTAFPRGFALEILHVYTGPPVIVYKFRHWGFVEGPFKGHAPT  425

Query  791  GEIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAA--TSSACPFMK  958
            GE+ EFFGM +FELDE   KIVK E F+DRGELLG L+KG + D  A   SS+CP ++
Sbjct  426  GEMVEFFGMAVFELDEHM-KIVKVEFFYDRGELLGGLLKGTAMDGPAIEASSSCPVLR  482


 Score =   286 bits (733),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 144/236 (61%), Positives = 174/236 (74%), Gaps = 6/236 (3%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA S   GDKYR +L  +E +NT+WR G PP+Y+VV KLFEEGRT +WP GSLEEKVQ L
Sbjct  1    MASSVGEGDKYRYHLDGEE-ENTEWRYGAPPNYEVVXKLFEEGRTKIWPAGSLEEKVQNL  59

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEME+ HK + +DYKT DP K+   +NGR+ ++ E+  K GG YN  LQTSLPEK R
Sbjct  60   VKTWEMEMFHKVNLDDYKTTDPKKYTFSLNGREPMNYEEIMKNGG-YNPLLQTSLPEKLR  118

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
            V+NPADET  S+   F   FPRGFA+EIL VYSGPP I Y+FRHWG+M+GPFKGH PTGE
Sbjct  119  VYNPADETAQSAHLAFTTTFPRGFALEILHVYSGPPVIVYKFRHWGFMEGPFKGHAPTGE  178

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAA--TSSACPFMK  958
            + EFFGM +FELDE   KIVK E F+D GELLG LVKG + D      S+ CP ++
Sbjct  179  MVEFFGMAVFELDEHM-KIVKVEFFYDSGELLGGLVKGPTLDSTTYGASAGCPVLR  233



>ref|XP_007019414.1| Pathogen-related protein isoform 1 [Theobroma cacao]
 gb|EOY16639.1| Pathogen-related protein isoform 1 [Theobroma cacao]
Length=254

 Score =   283 bits (723),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 138/238 (58%), Positives = 175/238 (74%), Gaps = 5/238 (2%)
 Frame = +2

Query  257  KMACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQR  433
            KMA S T  DKYR YL  +  KNTKW+ G PP+YDVV+KLFEEGRT +WP GSLEEKVQ 
Sbjct  15   KMASSVTQEDKYRSYLHGEGEKNTKWKFGTPPNYDVVNKLFEEGRTKIWPPGSLEEKVQN  74

Query  434  LMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKY  613
            L+KTWEME+ +K    D+K+++   + + VNGRK L+LE+  K+ G YN F+QTSLPE  
Sbjct  75   LVKTWEMEMFNKISFEDFKSINLENYTVSVNGRKPLTLEEKRKLWGGYNSFMQTSLPENL  134

Query  614  RVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTG  793
            R +NPA+ET  SS   F  AFPRGFA+E++QVYSGPP I Y+FRHWGYM+GPFKGH  TG
Sbjct  135  RGYNPAEETAGSSHVAFTTAFPRGFALEVIQVYSGPPLIVYKFRHWGYMEGPFKGHAATG  194

Query  794  EIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKG---GSSDEAATSSACPFMK  958
            E+ E +G+   E+DE+  KI+K E FFDRGELLG L+KG   GS+     + +CPF++
Sbjct  195  ELVELYGISTVEVDEQM-KILKIEFFFDRGELLGGLMKGAKLGSTGTDQVALSCPFLR  251



>ref|XP_007200367.1| hypothetical protein PRUPE_ppa010660mg [Prunus persica]
 gb|EMJ01566.1| hypothetical protein PRUPE_ppa010660mg [Prunus persica]
Length=241

 Score =   280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 170/237 (72%), Gaps = 5/237 (2%)
 Frame = +2

Query  260  MACSGT-GGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQR  433
            MA SG  G DKYR YLS +  KNTKW+ G PPSYD+V+KLFEEGRT +WP GSLE +VQ 
Sbjct  3    MASSGVEGADKYRSYLSGEGEKNTKWKFGAPPSYDIVNKLFEEGRTKIWPPGSLEHEVQN  62

Query  434  LMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKY  613
            L+KTWEME+ HKA+ +D+KTLDP K+   +NGRKG++LE+  K+GG YN  LQTSLPE  
Sbjct  63   LVKTWEMELFHKANLDDFKTLDPNKYTFSLNGRKGITLEEIGKLGGGYNPLLQTSLPENL  122

Query  614  RVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTG  793
            R +NP  ET  SS   F   FPRGFA+E+LQVYSGPP I Y+FRHWGYM+GPF+GH PTG
Sbjct  123  RGYNPDKETAESSHKAFTTTFPRGFALEVLQVYSGPPEIVYKFRHWGYMEGPFQGHAPTG  182

Query  794  EIAEFFGMGIFELDEESNKIVKAELFFD--RGELLGALVKGGSSDEAATSSACPFMK  958
            E+ E +GM IF +DE  NKIVK E F+D  +        +   +    T+S+CP ++
Sbjct  183  ELVEVYGMSIFTVDEH-NKIVKVEFFYDPGQLLGGLLKGEKLGTSSQETASSCPVLR  238



>ref|XP_007019415.1| Pathogen-related protein isoform 2, partial [Theobroma cacao]
 gb|EOY16640.1| Pathogen-related protein isoform 2, partial [Theobroma cacao]
Length=306

 Score =   282 bits (722),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/238 (58%), Positives = 175/238 (74%), Gaps = 5/238 (2%)
 Frame = +2

Query  257  KMACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQR  433
            KMA S T  DKYR YL  +  KNTKW+ G PP+YDVV+KLFEEGRT +WP GSLEEKVQ 
Sbjct  67   KMASSVTQEDKYRSYLHGEGEKNTKWKFGTPPNYDVVNKLFEEGRTKIWPPGSLEEKVQN  126

Query  434  LMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKY  613
            L+KTWEME+ +K    D+K+++   + + VNGRK L+LE+  K+ G YN F+QTSLPE  
Sbjct  127  LVKTWEMEMFNKISFEDFKSINLENYTVSVNGRKPLTLEEKRKLWGGYNSFMQTSLPENL  186

Query  614  RVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTG  793
            R +NPA+ET  SS   F  AFPRGFA+E++QVYSGPP I Y+FRHWGYM+GPFKGH  TG
Sbjct  187  RGYNPAEETAGSSHVAFTTAFPRGFALEVIQVYSGPPLIVYKFRHWGYMEGPFKGHAATG  246

Query  794  EIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKG---GSSDEAATSSACPFMK  958
            E+ E +G+   E+DE+  KI+K E FFDRGELLG L+KG   GS+     + +CPF++
Sbjct  247  ELVELYGISTVEVDEQM-KILKIEFFFDRGELLGGLMKGAKLGSTGTDQVALSCPFLR  303



>ref|XP_007201250.1| hypothetical protein PRUPE_ppa010729mg [Prunus persica]
 gb|EMJ02449.1| hypothetical protein PRUPE_ppa010729mg [Prunus persica]
Length=238

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 146/236 (62%), Positives = 173/236 (73%), Gaps = 4/236 (2%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA SG  GD YR YL  +  KNTKWR G PP+Y  V+KLFEEGRT +WP GSLEE+VQ L
Sbjct  1    MASSGVKGDSYRCYLHGEGEKNTKWRYGAPPNYGAVNKLFEEGRTKIWPPGSLEEQVQNL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEME+ HK    D+K  DP K+   +NGRK +SLE+  K+GG YN  LQTSLP+++R
Sbjct  61   VKTWEMEMFHKTRDEDFKASDPKKYTFSLNGRKAVSLEEKRKLGGGYNSLLQTSLPDEFR  120

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
             +NPA+ET  S+   F  AFPRGFA+EIL VYSGPP I Y+FRHWGYMDGPFKGH PTGE
Sbjct  121  CYNPAEETVDSAHRAFTTAFPRGFALEILHVYSGPPLIVYKFRHWGYMDGPFKGHAPTGE  180

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSS--ACPFMK  958
              E FGM  FELDE   KIVK E FFDRGELLG L+KG S D ++  +  ACPF++
Sbjct  181  KVELFGMANFELDEHG-KIVKVEFFFDRGELLGGLLKGASFDSSSKEAALACPFLR  235



>ref|XP_008237647.1| PREDICTED: pathogen-related protein-like [Prunus mume]
Length=241

 Score =   280 bits (715),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 172/237 (73%), Gaps = 5/237 (2%)
 Frame = +2

Query  260  MACSGT-GGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQR  433
            MA SG  GGDKYR YLS +  KNTKW+ G PPSYD+V+KLFEEGRT +WP GSLE++VQ 
Sbjct  3    MASSGVEGGDKYRSYLSGEGEKNTKWKFGAPPSYDIVNKLFEEGRTKIWPPGSLEDEVQN  62

Query  434  LMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKY  613
            L+KTWEME+ HKA+ +D+KTLDP K+   +NGRKG++LE+  K+GG YN  LQTSLPE  
Sbjct  63   LVKTWEMELFHKANLDDFKTLDPNKYTFSLNGRKGITLEEIGKLGGGYNPLLQTSLPENL  122

Query  614  RVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTG  793
            R +NP  ET  SS   F   FPRGFA+E+LQVYSGPP I Y+FRHWGYM+GPF+GH PTG
Sbjct  123  RGYNPDKETAESSHKAFTTTFPRGFALEVLQVYSGPPEILYKFRHWGYMEGPFQGHAPTG  182

Query  794  EIAEFFGMGIFELDEESNKIVKAELFFD--RGELLGALVKGGSSDEAATSSACPFMK  958
            E+ E +GM IF +D E+ KIVK E F+D  +        +   +    T+S+CP ++
Sbjct  183  ELVEVYGMSIFTVD-ENKKIVKVEFFYDPGQLLGGLLKGEKLGTSSQETASSCPVLR  238



>gb|AHF20188.1| pathogenesis related protein, partial [Musa acuminata AAA Group]
Length=229

 Score =   278 bits (711),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 132/233 (57%), Positives = 173/233 (74%), Gaps = 6/233 (3%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA S  GGDKYR ++  +  +NT+WR G PP YD+V+KLFEEGRT  WP GSLEEKVQR+
Sbjct  1    MAIS-AGGDKYRSFMHGEGERNTQWRFGAPPDYDLVNKLFEEGRTQEWPVGSLEEKVQRI  59

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +K+ EME+ HK  P D+K+++  KFR  VNGR+G+SL++  ++GG YN FLQT+LP++ R
Sbjct  60   VKSLEMELQHKIRPEDFKSVNREKFRFSVNGRRGISLQELREMGGGYNAFLQTNLPKELR  119

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
            +++P  ET  SS   F   FPRGFA+EILQ YSGPP I ++FRHW YMDGPF+GHPPTGE
Sbjct  120  IYDPEAETMDSSHKAFTTTFPRGFALEILQAYSGPPTIAFKFRHWSYMDGPFQGHPPTGE  179

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSSACPFM  955
            + EFFG+GI+ +D+E  K+ K E FF+RG+ L + VKG     AA+ S CP M
Sbjct  180  LVEFFGIGIYHVDDEM-KVEKVEFFFERGDFLASFVKGAP---AASGSRCPVM  228



>ref|XP_009348132.1| PREDICTED: pathogen-related protein-like [Pyrus x bretschneideri]
Length=237

 Score =   278 bits (711),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 138/237 (58%), Positives = 174/237 (73%), Gaps = 7/237 (3%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLM  439
            MA SG  GDKYR YL+ +  KNT+W+ G P+YDVV+KLFEEGRT +WP GSLEE+VQ L+
Sbjct  1    MASSGVEGDKYRSYLTGEGEKNTQWKFGAPTYDVVNKLFEEGRTKIWPPGSLEEEVQNLV  60

Query  440  KTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRV  619
            KTWEME+ HK++ +D K++DP  +   +NGRKG+++E+  K+GG YN  LQTSLPEK R 
Sbjct  61   KTWEMELFHKSNLDDIKSIDPNTYTFSLNGRKGINIEEIGKLGGGYNPLLQTSLPEKLRG  120

Query  620  FNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEI  799
            +NP +ET  SS   F   FPRGFA+E+LQVYSGPP I Y+FRHWGYM+G FKGH PTGE+
Sbjct  121  YNPDEETAESSHKAFTTTFPRGFALEVLQVYSGPPEIIYKFRHWGYMEGSFKGHAPTGEM  180

Query  800  AEFFGMGIFELDEESNKIVKAELFFD----RGELLGALVKGGSSDEAATSSACPFMK  958
             E FGM IF +DE  NKIVK E F+D     G LL     G SS+E  T+S+CP ++
Sbjct  181  VEVFGMAIFTVDEH-NKIVKVEFFYDPGQLLGGLLKGAKLGTSSEE--TASSCPVLR  234



>ref|NP_001241631.1| uncharacterized protein LOC100805630 [Glycine max]
 gb|ACU17096.1| unknown [Glycine max]
 gb|ACU23077.1| unknown [Glycine max]
 gb|AIU34742.1| pathogenesis-related protein [Glycine max]
Length=238

 Score =   278 bits (710),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 140/240 (58%), Positives = 170/240 (71%), Gaps = 8/240 (3%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA S    DKYR ++ ED  KN KWR G PP+YDVV+KLF+EGRT VWP GSLEEKVQ L
Sbjct  1    MASSSVREDKYRPFMREDSEKNIKWRYGAPPNYDVVNKLFDEGRTKVWPPGSLEEKVQTL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +K WEME+ HK D  D +++DP K+   +NGRK +SLE+  K+GG Y   LQTS+PEK R
Sbjct  61   VKNWEMEMFHKEDFKDNRSVDPEKYTFSLNGRKPISLEEKRKLGGGYIPLLQTSIPEKLR  120

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
             +NP +ET  SS   F   FPRGFA+EIL VYSGPP I Y+FRHWGYM+GPFKGH PTG+
Sbjct  121  PYNPYEETADSSHKAFTTTFPRGFALEILHVYSGPPVIVYKFRHWGYMEGPFKGHAPTGD  180

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKG----GSSDEAATSSACPFMKGA  964
              E +GM IF LDE S KIVK E F+D  ELLG L+KG    GS+++A  S  CP ++  
Sbjct  181  KIEVYGMAIFTLDENS-KIVKVEFFYDPAELLGGLLKGPKFDGSAEDAVAS--CPVLRNT  237



>ref|XP_007019416.1| Pathogen-related protein [Theobroma cacao]
 gb|EOY16641.1| Pathogen-related protein [Theobroma cacao]
Length=238

 Score =   277 bits (709),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/238 (60%), Positives = 177/238 (74%), Gaps = 4/238 (2%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            M  S   GDKYR YL E+E KNTKWR G PP+YDVV+KLFEE RT VWP GSLEEKVQ L
Sbjct  1    MELSNVEGDKYRSYLHEEEEKNTKWRYGAPPNYDVVNKLFEEERTKVWPPGSLEEKVQNL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEMEI HK    D+KT+D  K+   +NG++ L++E   K+GG YN  LQTSLPE++R
Sbjct  61   VKTWEMEIFHKERLEDFKTIDTKKYVFSLNGKEALTMEGIQKLGGGYNPQLQTSLPEEFR  120

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
             ++P  ET  SS   F   FPRGFA+E+L+VY+GPP I Y+FRHWGY +GPFKGH PTGE
Sbjct  121  CYDPDKETSESSHRAFTTTFPRGFALEVLKVYTGPPEIVYKFRHWGYNEGPFKGHAPTGE  180

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAA--TSSACPFMKGA  964
            + EF+GM IFE+DEE  KIV+ E F+DRGELLG L+KG + D +A   +S+CPF++  
Sbjct  181  LVEFYGMAIFEVDEEM-KIVRVEFFYDRGELLGGLLKGAAMDSSALEAASSCPFLRNT  237



>ref|XP_010916129.1| PREDICTED: pathogen-related protein-like [Elaeis guineensis]
Length=235

 Score =   277 bits (708),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/233 (57%), Positives = 170/233 (73%), Gaps = 3/233 (1%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA S   G+KYR ++  +  +NT+WR G PP++D+VDKLFEEGRT  WP GSLEEKVQRL
Sbjct  1    MASSDFEGNKYRSFIYGEGERNTQWRFGAPPNFDLVDKLFEEGRTQEWPVGSLEEKVQRL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KT EME++HK    D+K +D   FR  +NGR+G++ +   ++GGSYN FLQTSLPE  R
Sbjct  61   VKTMEMELMHKIRSEDHKIIDHENFRFSLNGREGITHQGIREMGGSYNAFLQTSLPEDLR  120

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
            +++PA ET  SS   F   FPRGFA+EILQVYSGPP I +RFRHWGYM+GPFKGH PTGE
Sbjct  121  IYDPAQETIESSHKAFTTTFPRGFALEILQVYSGPPTIVFRFRHWGYMEGPFKGHAPTGE  180

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEA-ATSSACPF  952
              EF GM IF +D E  ++ K E F++RG+ L   +KG  +D+A AT+S CPF
Sbjct  181  KVEFQGMAIFHVDVEM-RVKKVEFFYERGDFLAGFLKGAPTDDASATTSRCPF  232



>ref|XP_008237640.1| PREDICTED: pathogen-related protein-like [Prunus mume]
Length=239

 Score =   277 bits (708),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 136/236 (58%), Positives = 165/236 (70%), Gaps = 4/236 (2%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            M  S   GDKYR YL  +  KNT WR G PPSYDVV+KLFEEGRT +WP GSL E+VQ L
Sbjct  3    MGSSDVEGDKYRSYLRGEGEKNTTWRFGAPPSYDVVNKLFEEGRTKIWPPGSLGEEVQNL  62

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEME+ HKA+ +D+KTLDP  +   +NGRKGL+LE+  K+GG YN  LQTSLPE  R
Sbjct  63   VKTWEMEVFHKANLDDFKTLDPNNYTFSLNGRKGLTLEEIGKLGGGYNPLLQTSLPENLR  122

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
             +NP  ET  SS   F   FPRGFA+EILQVYSGPP I Y+FRHWGYM+GPFKGH PTGE
Sbjct  123  GYNPEKETSESSHKAFTTTFPRGFALEILQVYSGPPEIVYKFRHWGYMEGPFKGHAPTGE  182

Query  797  IAEFFGMGIFELDEESNKIVKAELFFD--RGELLGALVKGGSSDEAATSSACPFMK  958
            + E +GM IF +DE  NKIVK E F+D  +        +   +    T+S+CP ++
Sbjct  183  LVEVYGMSIFTVDEH-NKIVKIEFFYDPGQLLGGLLKGEKLGTSSEGTTSSCPVLR  237



>ref|XP_004306661.1| PREDICTED: pathogen-related protein-like [Fragaria vesca subsp. 
vesca]
Length=242

 Score =   275 bits (704),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 172/234 (74%), Gaps = 6/234 (3%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            DKYR ++  D  KNT+W SG PP+YD V+KLFE+GRT +WP GSLEE+VQ L+KT+EMEI
Sbjct  10   DKYRSHVYGDGEKNTQWISGAPPNYDTVNKLFEQGRTKIWPAGSLEERVQNLLKTYEMEI  69

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
             HKA+  D K++DP KF L  NG++ L+++D  K GG YNV L +SLPE+++++ PA+ET
Sbjct  70   SHKANREDIKSIDPNKFTLIQNGKEPLTIDDIKKRGGIYNVDLHSSLPEEFQIYKPAEET  129

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMG  820
              SS  +F   FPRGFAIE+L+VYSGPP I Y+FRHW YM+GPFKG+ PTGE+ +FFG+ 
Sbjct  130  AESSHKIFTTTFPRGFAIEVLEVYSGPPVIVYKFRHWSYMEGPFKGYAPTGELVQFFGIA  189

Query  821  IFELDEESNKIVKAELFFDRGELLGALVKGG----SSDEAATSSACPFMKGA*L  970
            IF +DE+  KIVK E F+D  ELLG L KG      S   AT+S+CP ++   L
Sbjct  190  IFTVDEQM-KIVKVEFFYDPAELLGGLTKGAKIENCSGNDATTSSCPILRNTML  242



>ref|XP_004290556.1| PREDICTED: pathogen-related protein-like [Fragaria vesca subsp. 
vesca]
Length=239

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/239 (59%), Positives = 174/239 (73%), Gaps = 5/239 (2%)
 Frame = +2

Query  260  MACSGTG-GDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQR  433
            MA SG   GD YR YL  +E KNTKWR G PP+Y+VV+ LF EGRT +WP GSLEE+VQ 
Sbjct  1    MASSGIDKGDDYRYYLHGEEEKNTKWRYGSPPNYEVVNNLFHEGRTKIWPPGSLEERVQN  60

Query  434  LMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKY  613
            L+KTWEME+ HK    DYK+LD + +   +NGRKG+SL +  K+GG YN  LQTSLP ++
Sbjct  61   LVKTWEMELFHKTSDADYKSLDSSNYTFSLNGRKGISLAEKRKLGGGYNSLLQTSLPTEF  120

Query  614  RVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTG  793
            R +NPA+ET  SS   F  AFPRGFA+EIL VYSGPP I Y+FRHWGYM+GPFKGH PTG
Sbjct  121  RCYNPAEETVDSSHRAFTTAFPRGFALEILHVYSGPPEIVYKFRHWGYMEGPFKGHAPTG  180

Query  794  EIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSSA--CPFMKGA  964
            E+ E FGM +F+L+ ES K+V  E FFDRGELLG L+KG S D +    A  CP+++  
Sbjct  181  ELVELFGMAVFKLN-ESEKVVSVEFFFDRGELLGGLLKGASLDSSHEEVAPTCPYLRNT  238



>gb|AFK44805.1| unknown [Lotus japonicus]
Length=238

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/236 (58%), Positives = 166/236 (70%), Gaps = 4/236 (2%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA      DKYR YL  DE KNTKWR G PP+Y+ V+KLFEEGRT  WP GSLEE+VQ L
Sbjct  1    MASPSVEKDKYRTYLHGDEEKNTKWRFGAPPNYEAVNKLFEEGRTKEWPPGSLEEQVQTL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +K WEME  HK D N+++++DP KF   +NGRK +SLE+  ++GG Y   LQTSLP+K R
Sbjct  61   VKNWEMEFFHKVDINEFRSIDPKKFTFSLNGRKPMSLEEIGELGGGYIPMLQTSLPQKLR  120

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
             ++P  ET  SS   F    PRGFA+EILQVYSGPP I Y+FRHWGYM+GP KGH PTGE
Sbjct  121  PYDPDKETRYSSHIAFTTTLPRGFALEILQVYSGPPVIVYKFRHWGYMEGPSKGHAPTGE  180

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATS--SACPFMK  958
              EF+GM IF LDE+S KIVK E FFD  EL+G L+KG   D +     S+CP ++
Sbjct  181  KIEFYGMAIFTLDEDS-KIVKVEFFFDANELIGGLLKGPEFDGSTEGGVSSCPILR  235



>ref|XP_007137546.1| hypothetical protein PHAVU_009G135800g [Phaseolus vulgaris]
 gb|ESW09540.1| hypothetical protein PHAVU_009G135800g [Phaseolus vulgaris]
Length=237

 Score =   274 bits (700),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 133/235 (57%), Positives = 166/235 (71%), Gaps = 3/235 (1%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLM  439
            MA S    DKYR +L +D  +NTKWR GPPSY+ V+KLFEEGRT VW  GSLEE+VQ ++
Sbjct  1    MAASSVEEDKYRPFLRQDIEENTKWRYGPPSYEAVNKLFEEGRTKVWAPGSLEERVQTIV  60

Query  440  KTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRV  619
            K WEME+ HK D  + +++DP K+   +NGRK ++LE+  K+GG Y   LQTSLPEK R 
Sbjct  61   KQWEMEMFHKLDFLENRSVDPEKYTFSLNGRKSINLEEKRKLGGGYIPLLQTSLPEKLRP  120

Query  620  FNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEI  799
            +NP  ET  SS   F  AFPRGFA+EIL VYSGPP I Y+FRHWGYM+GPFKGH PTG+ 
Sbjct  121  YNPYAETADSSHKAFTTAFPRGFALEILHVYSGPPEIVYKFRHWGYMEGPFKGHAPTGDK  180

Query  800  AEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAA--TSSACPFMK  958
             E +GM IF LDE S K+VK E F+D  ELL  L+KGG  + +A    + CP ++
Sbjct  181  IELYGMAIFTLDENS-KVVKVEFFYDPAELLAGLLKGGEFEGSAEDAVATCPVLR  234



>ref|XP_008237646.1| PREDICTED: pathogen-related protein-like [Prunus mume]
Length=238

 Score =   273 bits (698),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 143/236 (61%), Positives = 170/236 (72%), Gaps = 4/236 (2%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA SG  GD YR YL  +  KNTKWR G PP+Y  V+KLFEE    +WP GSLEE+VQ L
Sbjct  1    MASSGVKGDSYRSYLHGEGEKNTKWRYGAPPNYGAVNKLFEELSRKIWPPGSLEEQVQNL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEME+ HK    D+K  DP K+   +NGRK +SLE+  K+GG YN  LQTSLP+++R
Sbjct  61   VKTWEMEMFHKTRDEDFKASDPKKYTFSLNGRKAVSLEEKRKLGGGYNSLLQTSLPDEFR  120

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
             +NPA+ET  S+   F  AFPRGFA+EIL VYSGPP I Y+FRHWGYMDGPFKGH PTGE
Sbjct  121  CYNPAEETVDSAHRAFTTAFPRGFALEILHVYSGPPLIVYKFRHWGYMDGPFKGHAPTGE  180

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSS--ACPFMK  958
              E FGM  FELDE   KIVK E FFDRGELLG L+KG S D ++  +  ACPF++
Sbjct  181  KVELFGMANFELDEH-GKIVKVEFFFDRGELLGGLLKGASFDSSSKEAALACPFLR  235



>ref|XP_004139673.1| PREDICTED: pathogen-related protein-like [Cucumis sativus]
 gb|KGN44499.1| hypothetical protein Csa_7G318990 [Cucumis sativus]
Length=240

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 174/238 (73%), Gaps = 6/238 (3%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            M+ SGT  D YR  L+ D  KNT W+ G PP+Y+ V+KLFE+GRT +WP GSLEE+VQ L
Sbjct  1    MSSSGTNEDPYRWILNGDVEKNTTWKFGAPPNYEAVNKLFEQGRTKIWPPGSLEEEVQNL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +K+WE+E ++K  P D+K +DP K    +NGRK ++LE+  K+GG YN  LQTSLP +YR
Sbjct  61   VKSWEVENINKVIPEDFKIMDPNKVTFSLNGRKPITLEEKRKLGGGYNASLQTSLPAEYR  120

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
            +++P  ET  +S  +F + FPRGFA+EI+QVY+GPP I Y+FRHW YM+GP+KGH PTGE
Sbjct  121  LYDPKQETAETSNKLFTSTFPRGFALEIVQVYTGPPLIVYKFRHWAYMEGPYKGHAPTGE  180

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATS----SACPFMK  958
            + E +G+GIFELD E+ KIVK E F+D  +LLG LVKG   D++A      S+CP ++
Sbjct  181  LIELYGIGIFELD-ENKKIVKVEQFYDPAQLLGPLVKGPKLDDSAEKGKELSSCPMLQ  237



>ref|XP_009421115.1| PREDICTED: pathogen-related protein-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=230

 Score =   271 bits (694),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 171/234 (73%), Gaps = 6/234 (3%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA S  GGDKYR ++     +NT+WR G PP YD+V+KLFEEGRT  WP GSLEEKVQR+
Sbjct  1    MAIS-AGGDKYRSFIHGAGERNTQWRFGAPPDYDLVNKLFEEGRTQEWPVGSLEEKVQRI  59

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +K+ EME+ HK  P D K+++  KFR  VNGR+G+SL++  ++GG YN FLQT+LP++ R
Sbjct  60   VKSLEMELQHKIRPEDCKSVNREKFRFSVNGRRGISLQELREMGGGYNAFLQTNLPKELR  119

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
            +++P  ET  SS   F   FPRGFA+EILQVYSGPP I ++FRHW YMDGPF+G+ PTGE
Sbjct  120  IYDPEAETMDSSHEAFTTTFPRGFALEILQVYSGPPTIAFKFRHWSYMDGPFQGYSPTGE  179

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSSACPFMK  958
            + EFFG+GI+ +D E  K+ K E F++RG+ L + VKG     AA+ S CP MK
Sbjct  180  LVEFFGIGIYHVDNEM-KVEKVEFFYERGDFLASFVKGAP---AASGSRCPVMK  229



>ref|XP_010244013.1| PREDICTED: pathogen-related protein-like isoform X1 [Nelumbo 
nucifera]
Length=248

 Score =   271 bits (694),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 136/231 (59%), Positives = 172/231 (74%), Gaps = 9/231 (4%)
 Frame = +2

Query  281  GDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEME  457
            GDKYR ++  +  KNTKWR G PP+YDVV+KLFEEGRT  WP GSLEE+VQ L+KTWEME
Sbjct  13   GDKYRSHIYGEGEKNTKWRFGAPPNYDVVNKLFEEGRTQEWPNGSLEERVQNLVKTWEME  72

Query  458  IVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADE  637
            +VHK DP DYKT++ T F + +NG K L L++  KIG SYN+FLQTSLP+  RVF+P+ E
Sbjct  73   LVHKMDPADYKTVNTTNFTISINGGKPLLLQEVRKIG-SYNLFLQTSLPQNLRVFDPSIE  131

Query  638  TFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGM  817
            T  SS   F   FPRGFA+EILQVYSGPP I Y+FRHW +M+GPFKGH PTGE+A+F G+
Sbjct  132  TPESSHQAFITTFPRGFAVEILQVYSGPPVIAYKFRHWAFMEGPFKGHAPTGEMAQFHGI  191

Query  818  GIFELDEESNKIVKAELFFDRGELLGALVKGGSSDE------AATSSACPF  952
            GIF +DE   ++ K E F+D  ELL +LVK   S++      +++S+ CPF
Sbjct  192  GIFHVDEMM-RVEKVEFFYDPNELLASLVKSPLSNDSEASTNSSSSAGCPF  241



>ref|XP_006858459.1| hypothetical protein AMTR_s00071p00097550 [Amborella trichopoda]
 gb|ERN19926.1| hypothetical protein AMTR_s00071p00097550 [Amborella trichopoda]
Length=241

 Score =   271 bits (692),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 136/228 (60%), Positives = 167/228 (73%), Gaps = 6/228 (3%)
 Frame = +2

Query  281  GDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEME  457
            GDKYR ++ ++  KNT W+ G PP+YDVV+KLFEEGR  VWPEGSLEE VQ L+KTWEME
Sbjct  12   GDKYRKHIHDEGEKNTVWKYGAPPNYDVVNKLFEEGRQKVWPEGSLEEMVQNLVKTWEME  71

Query  458  IVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADE  637
            + +KA P D+KT++  K+   +NGRK L L +  K GG YN FLQTSLPE+++ F P+ E
Sbjct  72   MFNKARPEDFKTVNTEKYTFSLNGRKPLPLMEKLKAGG-YNSFLQTSLPEEFQCFKPSQE  130

Query  638  TFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGM  817
            T  S+   F   FPRGFA+EI++VYSGPP I Y+FRHWGYM+GPF GH PTGE  E+FG+
Sbjct  131  TTESAHQAFLRTFPRGFALEIVEVYSGPPTIVYKFRHWGYMEGPFLGHAPTGEKVEYFGI  190

Query  818  GIFELDEESNKIVKAELFFDRGELLGALVKGGSSDE---AATSSACPF  952
             IF +DEE  K+ K E FFDRGELLG LVKG   D+    AT S CPF
Sbjct  191  AIFGVDEEM-KVEKVEFFFDRGELLGGLVKGPPLDKEGSTATPSICPF  237



>ref|XP_008461497.1| PREDICTED: pathogen-related protein-like [Cucumis melo]
Length=240

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/238 (54%), Positives = 172/238 (72%), Gaps = 6/238 (3%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            M  +GT  D YR  L+ D  KNT W+ G PP+Y+ V+KLFE+GRT +WP GSLEE+VQ L
Sbjct  1    MGSTGTKEDPYRWILNGDVEKNTTWKFGAPPNYEAVNKLFEQGRTKIWPPGSLEEEVQNL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +K WE+E ++K  P D+K +DP K    +NGRK ++LE+  K+GG YN  LQTSLP +YR
Sbjct  61   VKCWEVENINKVLPEDFKIMDPNKVTFSLNGRKPITLEEKRKLGGGYNASLQTSLPAEYR  120

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
            +++P  ET  +S  +F + FPRGFA+EI+QVY+GPP I Y+FRHW YM+GP+KGH PTGE
Sbjct  121  LYDPKQETAETSNKLFTSTFPRGFALEIVQVYTGPPLIVYKFRHWAYMEGPYKGHAPTGE  180

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATS----SACPFMK  958
            + E +G+GIFELD E+ KIVK E F+D  +LLG LVKG   D++A      S+CP ++
Sbjct  181  LIELYGIGIFELD-ENKKIVKVEQFYDPAQLLGPLVKGSKLDDSAEKGKELSSCPMLQ  237



>ref|XP_010245805.1| PREDICTED: pathogen-related protein-like [Nelumbo nucifera]
Length=246

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/228 (58%), Positives = 171/228 (75%), Gaps = 7/228 (3%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            DKYR ++  +  KNTKWR G PP+YD V+KLFEEGRT  WP+GSLEE+VQ L+KTWEME+
Sbjct  14   DKYRSHMYGEGEKNTKWRFGAPPNYDSVNKLFEEGRTQEWPKGSLEERVQNLVKTWEMEL  73

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
            VHK DP DYKT++ T F + +NG K + LE+  +IG SYN+FL+T LP+K RV++P+ ET
Sbjct  74   VHKVDPADYKTVNATNFTISINGGKPVPLEEIGRIG-SYNLFLKTPLPQKLRVYDPSLET  132

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMG  820
              SS   F   FPRGFA+EILQVYSGPP I Y+FRHW +M+GPFKGH PTGE+ EF G+G
Sbjct  133  NQSSTQAFVTTFPRGFAVEILQVYSGPPVIAYKFRHWSFMEGPFKGHAPTGELVEFHGIG  192

Query  821  IFELDEESNKIVKAELFFDRGELLGALVKGGSSD--EAAT--SSACPF  952
            IF +DE   ++ + E F+D  ELL +L+KG S+D  +A+T  S  CPF
Sbjct  193  IFHMDELM-RVKRVEFFYDGNELLASLIKGPSTDGSDASTKASGGCPF  239



>ref|XP_004290558.1| PREDICTED: pathogen-related protein-like [Fragaria vesca subsp. 
vesca]
Length=239

 Score =   269 bits (688),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 168/238 (71%), Gaps = 7/238 (3%)
 Frame = +2

Query  260  MACSGT-GGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQR  433
            MA  G   G+KYR +L  +E KNTKW+ G PP+Y+VV+KLFE+GRT +WP GSLEEKVQ 
Sbjct  1    MASEGVVEGEKYRYFLHGEE-KNTKWKFGAPPNYEVVNKLFEQGRTKIWPAGSLEEKVQN  59

Query  434  LMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKY  613
            L+KTWEME+ HK +  D+KTLDP K+   +NGRKG++LE+  K+GG YN  LQTSLPE  
Sbjct  60   LVKTWEMELFHKVNIEDFKTLDPNKYTFSLNGRKGINLEEIGKLGGGYNPLLQTSLPESL  119

Query  614  RVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTG  793
            R +NP  ET  SS   F   FPRGFA+EILQV SGPP+I Y+FRHWGYM+GPFK H PTG
Sbjct  120  RGYNPDVETSESSHKAFTTTFPRGFALEILQVISGPPQIVYKFRHWGYMEGPFKNHAPTG  179

Query  794  EIAEFFGMGIFELDEESNKIVKAELFFD---RGELLGALVKGGSSDEAATSSACPFMK  958
            E+ E +GM IFELD E+ KIVK E ++D       L    K GSS     +S CP ++
Sbjct  180  ELVEIYGMAIFELD-ENEKIVKVEFYYDPGQLLGGLLKGAKVGSSSSEEIASGCPILR  236



>ref|XP_010537720.1| PREDICTED: pathogen-related protein isoform X1 [Tarenaya hassleriana]
Length=259

 Score =   270 bits (689),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 133/259 (51%), Positives = 179/259 (69%), Gaps = 17/259 (7%)
 Frame = +2

Query  203  QRLDSLFMGGGHCG*RTTKMACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFE  379
            +++ S  M GG+   R T  A      DKYR  L+ +E   T+WR G PP +D V+KLFE
Sbjct  7    EKISSESMEGGNSTTRVTAAA------DKYRSILNGEEAATTQWRHGGPPKFDAVNKLFE  60

Query  380  EGRTHVWPEGSLEEKVQRLMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTA  559
            +GRTHVWPEGSLEE VQ  +K+WEME+ HK    D+KT++P KF+LFVNGR+GLS E+T 
Sbjct  61   QGRTHVWPEGSLEETVQNAIKSWEMELSHKIHLQDFKTINPEKFKLFVNGREGLSAEETL  120

Query  560  KIGGSYNVFLQTSLPEKYRVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYR  739
            ++G SYN  L+ SLP++++ +   +ETF SS  VFR+AFPRGFA E+L VYSGPP I Y+
Sbjct  121  ELG-SYNALLKNSLPKEFQYYKAEEETFESSHDVFRSAFPRGFAWEVLAVYSGPPTIAYK  179

Query  740  FRHWGYMDGPFKGHPPTGEIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSS  919
            FRHWGY +GP+KGH PTGE+ EF G+G+ ++D ES +  + E+++D GEL G L+KG   
Sbjct  180  FRHWGYFEGPYKGHAPTGEMVEFVGLGVLKVD-ESLRAEEVEIYYDPGELFGGLLKGPPL  238

Query  920  DEAATS--------SACPF  952
             E  T+         +CPF
Sbjct  239  PETKTTDSTEYSGKQSCPF  257



>ref|XP_010664892.1| PREDICTED: pathogen-related protein isoform X2 [Vitis vinifera]
Length=194

 Score =   267 bits (682),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 151/193 (78%), Gaps = 1/193 (1%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA S   GDKYR YLS D+ KNT+WR G PP+YDVV+KLFEEGRT +WP GSLEEKVQ L
Sbjct  1    MASSVVEGDKYRSYLSGDDEKNTEWRYGAPPNYDVVNKLFEEGRTKIWPAGSLEEKVQNL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEMEI HK +PN+YK+LDP K+   +NGRK ++     ++GG YN  + TSLPEK R
Sbjct  61   VKTWEMEIFHKTNPNEYKSLDPKKYTFSLNGRKPINFGQLRQLGGGYNPLMLTSLPEKLR  120

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
            V+NPADET  +S   F  AFPRGFA+EIL VY+GPP I Y+FRHWG+++GPFKGH PTGE
Sbjct  121  VYNPADETAQTSHLAFTTAFPRGFALEILHVYTGPPVIVYKFRHWGFVEGPFKGHAPTGE  180

Query  797  IAEFFGMGIFELD  835
            + EFFGM +FE++
Sbjct  181  MVEFFGMAVFEMN  193



>ref|XP_009360748.1| PREDICTED: pathogen-related protein-like isoform X2 [Pyrus x 
bretschneideri]
Length=204

 Score =   267 bits (683),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 151/192 (79%), Gaps = 1/192 (1%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSGP-PSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA  G  GDKYR +L+ D  KNTKW  G  PSYDV +KLFEEGRT +WP GSLEE+VQ L
Sbjct  1    MASLGVEGDKYRSHLTGDGEKNTKWNFGATPSYDVANKLFEEGRTKIWPPGSLEEEVQNL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEME+ HK++P+D+KTLDP K+ + +NGRKG+++E+  KIGG YN FLQTSLPEK R
Sbjct  61   VKTWEMELFHKSNPDDFKTLDPNKYTVSLNGRKGINIEEIGKIGGGYNAFLQTSLPEKLR  120

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
             +NP +ET  SS   F   FPRGFA+E+LQVYSGPP I Y+FRHWGYM+GPFKGH PTGE
Sbjct  121  GYNPDEETAESSLKSFTTTFPRGFALEVLQVYSGPPEILYKFRHWGYMEGPFKGHAPTGE  180

Query  797  IAEFFGMGIFEL  832
            + EFFGM IF +
Sbjct  181  MVEFFGMAIFTV  192



>ref|XP_010930622.1| PREDICTED: pathogen-related protein-like [Elaeis guineensis]
Length=237

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/238 (58%), Positives = 177/238 (74%), Gaps = 4/238 (2%)
 Frame = +2

Query  260  MACSGTG-GDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQR  433
            MA S  G GDKYR ++  +  KNT WR G PP+YDVV+KLFEEGRT  WP GSLEE+VQ 
Sbjct  1    MAGSKGGEGDKYRSHIYGEAEKNTVWRFGAPPNYDVVNKLFEEGRTKEWPSGSLEERVQH  60

Query  434  LMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKY  613
            ++KTWEME+ HK  P D+KT++P  +   +NGRK ++LE+  ++GG YN  LQTSLPE++
Sbjct  61   MVKTWEMEMFHKTRPQDFKTVNPEVYTFSLNGRKPITLEEKRQLGGGYNFLLQTSLPEEF  120

Query  614  RVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTG  793
            R +NPA+ET  SS   F   FPRGFA+EI+ VYSGPP I Y+FRHWG+M+GPFKGH PTG
Sbjct  121  RCYNPAEETAESSHEAFTATFPRGFAMEIIHVYSGPPTIVYKFRHWGFMEGPFKGHAPTG  180

Query  794  EIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATS-SACPFMKGA  964
            ++ E  GM  F++D E+ KI K E F+DRGELLG L+KG  ++++ TS S+CPFMK  
Sbjct  181  QMVELLGMAFFQVD-ETMKIEKVEFFYDRGELLGGLLKGTQTEKSGTSPSSCPFMKNT  237



>ref|XP_004167281.1| PREDICTED: LOW QUALITY PROTEIN: pathogen-related protein-like 
[Cucumis sativus]
Length=239

 Score =   266 bits (681),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/238 (54%), Positives = 173/238 (73%), Gaps = 7/238 (3%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            M+ SGT  D YR  L+ D  KN  W+ G PP+Y+ V+KLFE+GRT +WP GSLEE+VQ L
Sbjct  1    MSSSGTNEDPYRWILNGDVEKNITWKFGAPPNYEAVNKLFEQGRTKIWPPGSLEEEVQNL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +K+WE+E ++K  P D+K +DP K    +NGRK ++LE+  K+GG YN  LQTSLP +YR
Sbjct  61   VKSWEVENINKVIPEDFKIMDPNKVTFSLNGRKPITLEEKRKLGG-YNASLQTSLPAEYR  119

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
            +++P  ET  +S  +F + FPRGFA+EI+QVY+GPP I Y+FRHW YM+GP+KGH PTGE
Sbjct  120  LYDPKQETAETSNKLFTSTFPRGFALEIVQVYTGPPLIVYKFRHWAYMEGPYKGHAPTGE  179

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATS----SACPFMK  958
            + E +G+GIFELD E+ KIVK E F+D  +LLG LVKG   D++A      S+CP ++
Sbjct  180  LIELYGIGIFELD-ENKKIVKVEQFYDPAQLLGPLVKGPKLDDSAEKGKELSSCPMLQ  236



>ref|XP_010245806.1| PREDICTED: pathogen-related protein-like [Nelumbo nucifera]
Length=247

 Score =   266 bits (680),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 132/229 (58%), Positives = 169/229 (74%), Gaps = 7/229 (3%)
 Frame = +2

Query  281  GDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEME  457
            GDKYR ++  +  KNTKWRSG PP++D V+KLFEEGRT  WP+GSLEE+VQ L+KTWEME
Sbjct  14   GDKYRSHMYGEGEKNTKWRSGAPPNFDAVNKLFEEGRTQEWPKGSLEERVQNLVKTWEME  73

Query  458  IVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADE  637
            I  K DP DYK+++ T F + VNG K + LE+  +IG SYN+FLQT LP+  RV++P+ E
Sbjct  74   IAFKVDPADYKSINTTNFTVSVNGGKPVPLEEILRIG-SYNLFLQTPLPQNLRVYDPSLE  132

Query  638  TFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGM  817
            T  S+   F   F RGFA+EILQVYSGPP I Y+FRHW +M+GPFKGH PTGE+ EF G+
Sbjct  133  TSQSASQAFLTTFSRGFAVEILQVYSGPPVIAYKFRHWSFMEGPFKGHAPTGELVEFHGI  192

Query  818  GIFELDEESNKIVKAELFFDRGELLGALVKGGSSD--EAAT--SSACPF  952
            GIF +DE   ++ K E F+D  E+L +L+KG S+D  EA+T  S  CPF
Sbjct  193  GIFHMDELM-RVKKIEFFYDGNEVLASLIKGPSTDGSEASTKASGGCPF  240



>ref|XP_010110486.1| hypothetical protein L484_003533 [Morus notabilis]
 gb|EXC26587.1| hypothetical protein L484_003533 [Morus notabilis]
Length=243

 Score =   266 bits (679),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 131/241 (54%), Positives = 167/241 (69%), Gaps = 9/241 (4%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA    G DKYR  L  D  K+TKW+ + PP+YDVV+KLFEEGRT +WPEGSL E+VQ L
Sbjct  1    MASKDVGNDKYRYLLKGDGEKDTKWKYASPPNYDVVNKLFEEGRTKIWPEGSLGEQVQNL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAK-IGGSYNVFLQTSLPEKY  613
            +KTWEMEI HK D ND+KTLDP K+   +NGRK +++E+  +  GG Y   LQTS+PE+ 
Sbjct  61   VKTWEMEIFHKVDLNDFKTLDPKKYTFSLNGRKPITIEEIGRRFGGGYIPLLQTSMPEEL  120

Query  614  RVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTG  793
            R ++P  ET  S+   F   FPRGFA+EIL VYSGPP I Y+FRHWG+M+GPF+GH PTG
Sbjct  121  RGYDPYKETVDSAHKAFTTTFPRGFALEILDVYSGPPVIVYKFRHWGFMEGPFQGHVPTG  180

Query  794  EIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAA------TSSACPFM  955
            E  EF+GM IF +DE   K+V  E F+D GEL+G L+KG   D  +       +S CP +
Sbjct  181  EKVEFYGMAIFHVDEHM-KVVSVEFFYDPGELIGGLLKGEKIDTTSAEQLGGAASRCPVL  239

Query  956  K  958
            +
Sbjct  240  R  240



>ref|XP_008786540.1| PREDICTED: pathogen-related protein-like [Phoenix dactylifera]
Length=262

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 134/237 (57%), Positives = 176/237 (74%), Gaps = 4/237 (2%)
 Frame = +2

Query  257  KMACSGTG-GDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQ  430
            +MA S  G GDKYR ++  +   NT+WR G PPSYD V+KLFEEGRT  W  GSLEE+VQ
Sbjct  25   RMASSKGGEGDKYRSHIYGEAENNTQWRFGAPPSYDAVNKLFEEGRTKEWASGSLEERVQ  84

Query  431  RLMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEK  610
             ++KTWEME+ HK  P DYKT++P  +   +NGRK ++LE+  ++GG YN  LQTSLPE+
Sbjct  85   HMVKTWEMEMFHKRRPQDYKTVNPQVYTFSLNGRKPITLEEKRQLGGGYNALLQTSLPEE  144

Query  611  YRVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPT  790
             R +NPA+ET  SS   F   FPRGFA+EI+ VYSGPP I Y+FRHWG+M+GPFKGH PT
Sbjct  145  LRSYNPAEETEESSHKAFTTTFPRGFALEIIHVYSGPPTIVYKFRHWGFMEGPFKGHAPT  204

Query  791  GEIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAA-TSSACPFMK  958
            G++ E +GM IF++D ++ KI K E F+DRGELLG L+KG  ++++  +SS+CP MK
Sbjct  205  GQMVELYGMAIFQVD-DTMKIEKVEFFYDRGELLGGLLKGTQTEKSGISSSSCPLMK  260



>ref|XP_009421116.1| PREDICTED: pathogen-related protein-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=224

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/234 (55%), Positives = 168/234 (72%), Gaps = 12/234 (5%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA S  GGDKYR ++     +NT+WR G PP YD+V+KLFEEGRT  WP GSLEEKVQR+
Sbjct  1    MAIS-AGGDKYRSFIHGAGERNTQWRFGAPPDYDLVNKLFEEGRTQEWPVGSLEEKVQRI  59

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +K+ EME+ HK  P D K+++  KFR  VNGR+G+SL++  ++GG YN FLQT+LP++ R
Sbjct  60   VKSLEMELQHKIRPEDCKSVNREKFRFSVNGRRGISLQELREMGGGYNAFLQTNLPKELR  119

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
            +++P  ET  SS   F   FPRGFA+EILQVYSGPP I ++FRHW YMDGPF+G+ PTGE
Sbjct  120  IYDPEAETMDSSHEAFTTTFPRGFALEILQVYSGPPTIAFKFRHWSYMDGPFQGYSPTGE  179

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSSACPFMK  958
            + EFFG+GI+ ++       K E F++RG+ L + VKG     AA+ S CP MK
Sbjct  180  LVEFFGIGIYHVE-------KVEFFYERGDFLASFVKGAP---AASGSRCPVMK  223



>gb|KHN23416.1| Pathogen-related protein [Glycine soja]
Length=224

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/226 (59%), Positives = 162/226 (72%), Gaps = 8/226 (4%)
 Frame = +2

Query  302  LSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEIVHKADP  478
            + ED  KN KWR G PP+YDVV+KLF+EGRT VWP GSLEEKVQ L+K WEME+ HK D 
Sbjct  1    MREDSEKNIKWRYGAPPNYDVVNKLFDEGRTKVWPPGSLEEKVQTLVKNWEMEMFHKEDF  60

Query  479  NDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADETFVSSQA  658
             D +++DP K+   +NGRK +SLE+  K+GG Y   LQTS+PEK R +NP +ET  SS  
Sbjct  61   KDNRSVDPEKYTFSLNGRKPISLEEKRKLGGGYIPLLQTSIPEKLRPYNPYEETADSSHK  120

Query  659  VFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMGIFELDE  838
             F   FPRGFA+EIL VYSGPP I Y+FRHWGYM+GPFKGH PTG+  E +GM IF LDE
Sbjct  121  AFTTTFPRGFALEILHVYSGPPVIVYKFRHWGYMEGPFKGHAPTGDKIEVYGMAIFTLDE  180

Query  839  ESNKIVKAELFFDRGELLGALVKG----GSSDEAATSSACPFMKGA  964
             S KIVK E F+D  ELLG L+KG    GS+++A  S  CP ++  
Sbjct  181  NS-KIVKVEFFYDPAELLGGLLKGPKFDGSAEDAVAS--CPVLRNT  223



>ref|XP_008352783.1| PREDICTED: pathogen-related protein-like [Malus domestica]
Length=193

 Score =   263 bits (671),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 149/191 (78%), Gaps = 0/191 (0%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLM  439
            MA SG  GDKYR YL+ +  KNT+W+ GPP+YDVV+KLFEEGRT +WP  SLEE+VQ L+
Sbjct  1    MASSGVEGDKYRSYLTGEGEKNTQWKFGPPTYDVVNKLFEEGRTKIWPPRSLEEEVQNLV  60

Query  440  KTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRV  619
            KTWEME+ HK++ +D K++DP K+   +NGRKG+++E+  K+GG YN  LQTSLPEK R 
Sbjct  61   KTWEMELFHKSNLDDIKSIDPNKYTFSLNGRKGINIEEIGKLGGGYNPLLQTSLPEKLRG  120

Query  620  FNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEI  799
            +NP +ET  SS   F   FPRGFA+E+LQVYSGPP I Y+FRHWGYM+GPFKGH PTGE+
Sbjct  121  YNPDEETAESSHKAFTTTFPRGFALEVLQVYSGPPEIIYKFRHWGYMEGPFKGHAPTGEM  180

Query  800  AEFFGMGIFEL  832
             E FGM IF +
Sbjct  181  VEVFGMAIFTV  191



>gb|KHG14121.1| Pathogen-related [Gossypium arboreum]
Length=268

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/260 (52%), Positives = 169/260 (65%), Gaps = 36/260 (14%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            DKYR YL  +  KNT W+ G PP+YD V+KLFEEGRT +WP  SLEEKVQ L+KTWEME+
Sbjct  11   DKYRSYLHGEGEKNTNWKLGAPPNYDTVNKLFEEGRTKIWPPASLEEKVQNLVKTWEMEM  70

Query  461  VHKADPNDYKTLDPTKFRLFVNG----------------------------RKGLSLEDT  556
             +K    DYK++    + + VNG                            RK LSLE+ 
Sbjct  71   FNKISFPDYKSVKLQNYTVSVNGITISFRLDLVFCPKIKRADFVLVIIFLGRKPLSLEEN  130

Query  557  AKIGGSYNVFLQTSLPEKYRVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITY  736
             K+GG YN F+QTSLPE  R +NPA ET  SS   F  AFPRGFA+E++QVYSGPP I Y
Sbjct  131  RKLGGGYNSFMQTSLPEDLRGYNPAQETEHSSHLAFTTAFPRGFALEVIQVYSGPPSIVY  190

Query  737  RFRHWGYMDGPFKGHPPTGEIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKG--  910
            +FRHWGY +GPFKGH PTGE+ + +G+ IFE+D+E  KI+K E FFDRGELLG L+KG  
Sbjct  191  KFRHWGYKEGPFKGHAPTGELVQLYGISIFEVDDEM-KILKVEFFFDRGELLGGLMKGDK  249

Query  911  --GSSDEAATSSACPFMKGA  964
                +D+AA S  CPF++  
Sbjct  250  LTSGTDQAALS--CPFLRNT  267



>ref|XP_006302731.1| hypothetical protein CARUB_v10020845mg [Capsella rubella]
 gb|EOA35629.1| hypothetical protein CARUB_v10020845mg [Capsella rubella]
Length=252

 Score =   261 bits (666),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/241 (52%), Positives = 168/241 (70%), Gaps = 12/241 (5%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            +A      DKYR  L++++  N +WR  GPP +D V+KLFEE RTHVWPEGSLEE VQ  
Sbjct  12   LASLKLAADKYRSILNDEKTGNIQWRYGGPPIFDTVNKLFEEERTHVWPEGSLEETVQNA  71

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +K+WEME  HK    D+KT++P KF+LFVNGR+GLS E+T ++G SYN  L+ SLPE+++
Sbjct  72   IKSWEMEFSHKIRIQDFKTINPEKFKLFVNGREGLSAEETLRLG-SYNALLKNSLPEEFQ  130

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
             + P +E+F SS   FR+A PRGFA EIL VYSGPP I ++FRHWGY +G FKGH PTGE
Sbjct  131  YYKPEEESFESSHDAFRSALPRGFAWEILSVYSGPPDIAFKFRHWGYFEGTFKGHAPTGE  190

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKG---------GSSDEAATSSACP  949
            + +F G+G+ ++D ES ++ + E+++D GEL G L+KG          S D  A   +CP
Sbjct  191  MVQFLGLGVLKVD-ESLRVEEIEIYYDPGELFGGLLKGPPISETETTHSGDNTAEKQSCP  249

Query  950  F  952
            F
Sbjct  250  F  250



>ref|XP_010537721.1| PREDICTED: pathogen-related protein isoform X2 [Tarenaya hassleriana]
Length=246

 Score =   259 bits (663),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/232 (54%), Positives = 169/232 (73%), Gaps = 11/232 (5%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            DKYR  L+++ V + +WR G PPSYD V++LFE+GRT VWPEGSLEE VQ  +K+WEME+
Sbjct  15   DKYRHVLNDENVGDMQWRHGKPPSYDSVNRLFEQGRTKVWPEGSLEETVQNAIKSWEMEL  74

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
             HK    D+KT++P KF+LFVNGR+GLS E+T ++G SYN  L+ SLP++++ +   +ET
Sbjct  75   SHKIHLQDFKTINPEKFKLFVNGREGLSAEETLELG-SYNALLKNSLPKEFQYYKAEEET  133

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMG  820
            F SS  VFR+AFPRGFA E+L VYSGPP I Y+FRHWGY +GP+KGH PTGE+ EF G+G
Sbjct  134  FESSHDVFRSAFPRGFAWEVLAVYSGPPTIAYKFRHWGYFEGPYKGHAPTGEMVEFVGLG  193

Query  821  IFELDEESNKIVKAELFFDRGELLGALVKG--------GSSDEAATSSACPF  952
            + ++D ES +  + E+++D GEL G L+KG          S E +   +CPF
Sbjct  194  VLKVD-ESLRAEEVEIYYDPGELFGGLLKGPPLPETKTTDSTEYSGKQSCPF  244



>ref|XP_002285489.1| PREDICTED: pathogen-related protein [Vitis vinifera]
 emb|CAN63863.1| hypothetical protein VITISV_026996 [Vitis vinifera]
Length=236

 Score =   259 bits (661),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/237 (54%), Positives = 170/237 (72%), Gaps = 9/237 (4%)
 Frame = +2

Query  260  MACSGTG-----GDKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEE  421
            M   G G      DKYR  L ++  KNT WR  GPP+YD V++LFEEGRT  WP+GSLEE
Sbjct  1    MGSGGEGSVRDAADKYRSLLQDEVEKNTHWRHGGPPTYDSVNQLFEEGRTKEWPKGSLEE  60

Query  422  KVQRLMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSL  601
             VQ  +K+WEME+ HK    D++T++P KF+L VNGR+GLS E+T K+G SYN  L++SL
Sbjct  61   TVQNAVKSWEMELSHKTRLRDFRTINPEKFKLIVNGREGLSGEETLKLG-SYNALLKSSL  119

Query  602  PEKYRVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGH  781
            PE+ + +   +E+F SS   FR+AFPRGFA E++ VYSGPP I Y+FRHWG+ +GPFKGH
Sbjct  120  PEELKYYKAEEESFESSHDAFRSAFPRGFAWEVISVYSGPPEIAYKFRHWGFFEGPFKGH  179

Query  782  PPTGEIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSSACPF  952
             PTGE+A+F+G+GI ++D ES ++ +AE+++D  EL G L+K G    A  S ACPF
Sbjct  180  APTGEMAQFYGLGILKVD-ESLRVEEAEIYYDPAELFGGLLK-GPPISAPPSHACPF  234



>ref|XP_009416946.1| PREDICTED: pathogen-related protein-like [Musa acuminata subsp. 
malaccensis]
Length=236

 Score =   259 bits (661),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 172/235 (73%), Gaps = 3/235 (1%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            M  SG  GD YR ++  D  +NT+WR G PP+YD+V+KLFEEGRT VW  GSLEE+VQ +
Sbjct  1    MDSSGGEGDGYRSHIHGDHERNTEWRFGSPPNYDLVNKLFEEGRTKVWEAGSLEERVQHM  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEME+ HK    DYKT++P  +   +NGR+ ++LE   K+GG YN  LQTSLP+  R
Sbjct  61   VKTWEMEMFHKRRFQDYKTVNPDNYTFSLNGRRPITLEQKRKLGGGYNSLLQTSLPQGLR  120

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
            V++P+ ET  SS A F  AFPRGFA+E++ VYSGPP I Y+FRHWG+M+GPF+GH PTGE
Sbjct  121  VYDPSRETMESSHAAFTTAFPRGFALEVVHVYSGPPGIVYKFRHWGFMEGPFQGHAPTGE  180

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAAT-SSACPFMK  958
            + E +GM IF++D +  KI K E F+DRGELLG L+KG   ++A    S+CPF+K
Sbjct  181  MVELYGMAIFQVDADM-KIEKVEFFYDRGELLGGLLKGAKMEDAGLPDSSCPFLK  234



>gb|KFK42243.1| hypothetical protein AALP_AA2G230000 [Arabis alpina]
Length=253

 Score =   259 bits (661),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 124/236 (53%), Positives = 167/236 (71%), Gaps = 12/236 (5%)
 Frame = +2

Query  278  GGDKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEM  454
              DKYR  L++++  N +WR  GPP +D V+KLFEE RTHVWPEGSLEE VQ  +K+WEM
Sbjct  19   AADKYRSILNDEKTGNIQWRYGGPPIFDTVNKLFEEERTHVWPEGSLEETVQNAIKSWEM  78

Query  455  EIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPAD  634
            E  HK    D+KT++P KF+LFVNGR+GLS E+T K+G SYN  L+ SLP++++ + P +
Sbjct  79   EFSHKIHLQDFKTINPDKFKLFVNGREGLSAEETLKLG-SYNALLKNSLPKEFQYYKPEE  137

Query  635  ETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFG  814
            E+F SS   FR+A PRGFA EIL VYSGPP I ++FRHWGY +G FKGH PTGE+ +F G
Sbjct  138  ESFESSHDAFRSALPRGFAWEILAVYSGPPVIAFKFRHWGYFEGNFKGHAPTGEMVQFLG  197

Query  815  MGIFELDEESNKIVKAELFFDRGELLGALVKGG---------SSDEAATSSACPFM  955
            +G+ ++D ES ++ + E+++D GEL G L+KG          S D  A   +CPF+
Sbjct  198  LGVLKVD-ESLRVEEIEIYYDPGELFGELLKGPPISETKTILSGDNTAEKQSCPFI  252



>ref|XP_004148811.1| PREDICTED: pathogen-related protein-like [Cucumis sativus]
 ref|XP_004168960.1| PREDICTED: pathogen-related protein-like [Cucumis sativus]
Length=243

 Score =   258 bits (660),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 131/239 (55%), Positives = 172/239 (72%), Gaps = 9/239 (4%)
 Frame = +2

Query  278  GGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEM  454
            G +KYR  L+ DE KNTKWR G PP+YD+V+KLFEE RT VWP GSLEE+VQ L+K +EM
Sbjct  4    GDEKYRSLLTGDEEKNTKWRYGVPPNYDIVNKLFEEERTTVWPVGSLEERVQSLVKNFEM  63

Query  455  EIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPAD  634
            E+ HK  P+D+KT+D  K+   +NGRK L++   +K+GG YN FLQTSLP++YR +N   
Sbjct  64   EMFHKISPSDFKTIDVNKYTFSLNGRKPLAVGQVSKLGG-YNPFLQTSLPDEYRYYNAEK  122

Query  635  ETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFG  814
            ET  SS   F   F RGFA+EI+QVYSGPP I ++FRHWGYM+GPFK H PTGEI EF+G
Sbjct  123  ETAESSHRAFTATFLRGFALEIIQVYSGPPNIVFKFRHWGYMEGPFKNHAPTGEIIEFYG  182

Query  815  MGIFELDEESNKIVKAELFFDRGELLGALVKG----GSSDEAATSSACPFMKGA*LSFL  979
            + IF+++E+ +KI   E FFD  EL+G L+KG    GS ++A +S  CP ++   L + 
Sbjct  183  VAIFKVNEK-DKIEGVEFFFDPAELVGKLLKGPDLDGSVEKAMSS--CPVLRNTGLYYC  238



>ref|XP_003628448.1| Pathogen-related protein [Medicago truncatula]
 gb|AET02924.1| pathogenesis-like protein [Medicago truncatula]
Length=237

 Score =   258 bits (659),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 122/229 (53%), Positives = 164/229 (72%), Gaps = 6/229 (3%)
 Frame = +2

Query  281  GDKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEME  457
            GDKYR +L +DE   T+WR  GPP YDVV+KLFE+GRT VWPEGSLEE VQ  +K+WEME
Sbjct  12   GDKYRSFL-DDEAHTTQWRHGGPPIYDVVNKLFEQGRTKVWPEGSLEETVQNAIKSWEME  70

Query  458  IVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADE  637
            + HK    D+KT++P KF+LFVNG +GL+ E+T ++G SYN  ++ SLPE+Y+ +   +E
Sbjct  71   LSHKTRVQDFKTINPEKFKLFVNGTEGLTAEETLRLG-SYNALMKNSLPEEYKYYKAEEE  129

Query  638  TFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGM  817
            TF SS   FR+AFPRGFA E+++VY GPP I Y+FRHWG+ +GP+KGH PTG + EF+G 
Sbjct  130  TFESSHEAFRSAFPRGFAWEVIKVYGGPPEIAYKFRHWGFFEGPYKGHAPTGNMVEFYGF  189

Query  818  GIFELDEESNKIVKAELFFDRGELLGALVKGGSS--DEAATSSACPFMK  958
            G  ++D    K  + E+++D  EL+G L+ G  +  D   TS  CPF K
Sbjct  190  GTLKVD-NLMKAEEVEIYYDPAELMGDLLAGKQTAEDNTKTSQGCPFQK  237



>gb|ACN28048.1| unknown [Zea mays]
 tpg|DAA53934.1| TPA: pathogen protein [Zea mays]
Length=231

 Score =   258 bits (658),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 126/235 (54%), Positives = 164/235 (70%), Gaps = 6/235 (3%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA +  G DKYR ++  +  ++T WR G PP+YDVV+KLFEE RT VWPEGSLEEKVQRL
Sbjct  1    MAGAEVGEDKYRSFIHGEGERDTVWRYGAPPNYDVVNKLFEEERTQVWPEGSLEEKVQRL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +K+WEME+VHKA P D KT++  K+    NG   L+  +   IGG YN FL+T LP ++R
Sbjct  61   LKSWEMELVHKARPEDQKTVNSEKYSASTNGMSALTRAEVMAIGG-YNNFLRTKLPPEHR  119

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
            +++P  ET  S+ A F  AFPRGFAIE+L VYSGPPRI ++FRHWGYM+GPFKGHPP G+
Sbjct  120  IYDPDSETVESAMATFTTAFPRGFAIEVLDVYSGPPRIAFKFRHWGYMEGPFKGHPPHGQ  179

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSSACPFMKG  961
              E FG+ IF +DE+  K+ K+E F++RG  L   +   + D    S  CP M+G
Sbjct  180  RVELFGVCIFHVDEDM-KVDKSEYFYERGNFLAGFLSAPAPD---GSGGCPVMRG  230



>gb|KGN47479.1| hypothetical protein Csa_6G338110 [Cucumis sativus]
Length=234

 Score =   257 bits (657),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/234 (56%), Positives = 170/234 (73%), Gaps = 9/234 (4%)
 Frame = +2

Query  278  GGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEM  454
            G +KYR  L+ DE KNTKWR G PP+YD+V+KLFEE RT VWP GSLEE+VQ L+K +EM
Sbjct  4    GDEKYRSLLTGDEEKNTKWRYGVPPNYDIVNKLFEEERTTVWPVGSLEERVQSLVKNFEM  63

Query  455  EIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPAD  634
            E+ HK  P+D+KT+D  K+   +NGRK L++   +K+GG YN FLQTSLP++YR +N   
Sbjct  64   EMFHKISPSDFKTIDVNKYTFSLNGRKPLAVGQVSKLGG-YNPFLQTSLPDEYRYYNAEK  122

Query  635  ETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFG  814
            ET  SS   F   F RGFA+EI+QVYSGPP I ++FRHWGYM+GPFK H PTGEI EF+G
Sbjct  123  ETAESSHRAFTATFLRGFALEIIQVYSGPPNIVFKFRHWGYMEGPFKNHAPTGEIIEFYG  182

Query  815  MGIFELDEESNKIVKAELFFDRGELLGALVKG----GSSDEAATSSACPFMKGA  964
            + IF+++E+ +KI   E FFD  EL+G L+KG    GS ++A +S  CP ++  
Sbjct  183  VAIFKVNEK-DKIEGVEFFFDPAELVGKLLKGPDLDGSVEKAMSS--CPVLRNT  233



>ref|NP_001150498.1| LOC100284129 [Zea mays]
 gb|ACG39284.1| pathogen-related protein [Zea mays]
Length=231

 Score =   256 bits (654),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/235 (53%), Positives = 163/235 (69%), Gaps = 6/235 (3%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA +  G DKYR ++  +  ++T WR G PP+YDVV+KLFEE RT VWPEGSLEEKVQRL
Sbjct  1    MAGAEVGEDKYRSFIHGEGERDTVWRYGAPPNYDVVNKLFEEERTQVWPEGSLEEKVQRL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +K+WEME+VHK  P D KT++  K+    NG   L+  +   IGG YN FL+T LP ++R
Sbjct  61   LKSWEMELVHKVRPEDQKTVNSEKYSASTNGMSALTRAEVMAIGG-YNNFLRTKLPPEHR  119

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
            +++P  ET  S+ A F  AFPRGFAIE+L VYSGPPRI ++FRHWGYM+GPFKGHPP G+
Sbjct  120  IYDPDSETVESAMATFTTAFPRGFAIEVLDVYSGPPRIAFKFRHWGYMEGPFKGHPPHGQ  179

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSSACPFMKG  961
              E FG+ IF +DE+  K+ K+E F++RG  L   +   + D    S  CP M+G
Sbjct  180  RVELFGVCIFHVDEDM-KVDKSEYFYERGNFLAGFLSAPAPD---GSGGCPVMRG  230



>ref|XP_003566350.1| PREDICTED: pathogen-related protein-like [Brachypodium distachyon]
Length=232

 Score =   256 bits (654),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 127/234 (54%), Positives = 166/234 (71%), Gaps = 6/234 (3%)
 Frame = +2

Query  263  ACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLM  439
            A    GGDKYR ++  +  KNT W+ G PP+YDVV+KLFEE RT VWPEGSLEEKVQR++
Sbjct  3    ATPEAGGDKYRSFMHGEGEKNTVWKLGAPPNYDVVNKLFEEERTKVWPEGSLEEKVQRML  62

Query  440  KTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRV  619
            KTWEME++HK  P D K++    F    NG + L  ++   IGG YN FL T+LP +YR+
Sbjct  63   KTWEMEMIHKPRPEDQKSVHSEGFTASTNGMRPLPRKEWKAIGG-YNAFLATTLPPEYRI  121

Query  620  FNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEI  799
            ++P  ET  S  + F  AFPRGFAIE+L VYSGPP++T++FRHWGYM+GPFK +PP G+ 
Sbjct  122  YDPEKETEESGMSTFLTAFPRGFAIEVLDVYSGPPKVTFKFRHWGYMEGPFKEYPPHGQR  181

Query  800  AEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSSACPFMKG  961
             EFFG+ IF +DE+  KI KAE F++RG  L + +   S+  AAT+S CP M+G
Sbjct  182  IEFFGVCIFHVDEDV-KIQKAEYFYERGNFLSSFL---SAPAAATASGCPVMRG  231



>ref|XP_010429716.1| PREDICTED: pathogen-related protein-like isoform X1 [Camelina 
sativa]
Length=252

 Score =   257 bits (656),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/235 (51%), Positives = 165/235 (70%), Gaps = 12/235 (5%)
 Frame = +2

Query  278  GGDKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEM  454
              DKYR  L+++   N +WR  GPP +D V+KLFEE RTHVWPEGSLEE VQ  +K+WEM
Sbjct  18   AADKYRSILNDERTGNIRWRYGGPPIFDTVNKLFEEERTHVWPEGSLEETVQNAIKSWEM  77

Query  455  EIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPAD  634
            E+ HK    D+KT++P KF+LFVNGR+GLS E+T ++G SYN  L+ SLP++++ + P +
Sbjct  78   ELSHKIRLQDFKTINPEKFKLFVNGREGLSAEETLRLG-SYNALLKNSLPQEFQYYKPEE  136

Query  635  ETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFG  814
            E+F SS   FR+A PRGFA E+L VYSGPP I ++FRHWGY +G FKGH PTGE+ +F G
Sbjct  137  ESFESSHDAFRSALPRGFAWEVLSVYSGPPVIAFKFRHWGYFEGTFKGHAPTGEMVQFLG  196

Query  815  MGIFELDEESNKIVKAELFFDRGELLGALVKG---------GSSDEAATSSACPF  952
            +G+ ++D ES +  + E+++D GEL G L+KG          + D  A   +CPF
Sbjct  197  LGVLKVD-ESLRAEETEIYYDPGELFGGLLKGPPISETKTTDTGDNTADKQSCPF  250



>gb|AFK34050.1| unknown [Lotus japonicus]
Length=242

 Score =   256 bits (653),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 124/234 (53%), Positives = 169/234 (72%), Gaps = 10/234 (4%)
 Frame = +2

Query  278  GGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEM  454
             GDKYR ++ E E   T WR G PP+YDVV+ LFE+GRT  WP+GSLEE VQ  +K+WEM
Sbjct  12   AGDKYRSFIHE-ESDTTHWRHGGPPTYDVVNHLFEQGRTKEWPKGSLEETVQNAIKSWEM  70

Query  455  EIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPAD  634
            E+ HK    D++T++P KF+LFVNGR+GLS E+T  IG SYN  L++SLPE+++ +   +
Sbjct  71   EVSHKTRLQDFRTINPEKFKLFVNGREGLSAEETLSIG-SYNALLKSSLPEEFKYYKSEE  129

Query  635  ETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFG  814
            ETF SS   FR+AFPRGFA E+++VY+GPP I Y+FRHWG+ +GPFKGH PTG++ EF+G
Sbjct  130  ETFESSHEAFRSAFPRGFAWEVIKVYTGPPEIAYKFRHWGFFEGPFKGHAPTGKMVEFYG  189

Query  815  MGIFELDEESNKIVKAELFFDRGELLGALV-KGGSSDE-----AATSSACPFMK  958
            +G  ++D  S K+ + E+++D  ELLG L+   G++ E       TS ACPF K
Sbjct  190  LGTLKVD-NSLKVEEVEIYYDPAELLGDLLPASGTATEDPTKTTPTSQACPFSK  242



>gb|EYU45032.1| hypothetical protein MIMGU_mgv1a012837mg [Erythranthe guttata]
Length=238

 Score =   255 bits (651),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/227 (53%), Positives = 165/227 (73%), Gaps = 7/227 (3%)
 Frame = +2

Query  275  TGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWE  451
            T  DKYR +L  DE +NT+WR G PP+Y  V++LFE+GRT  W +GSLEE VQ  +K+WE
Sbjct  16   TAADKYRSFLHGDEEQNTQWRHGAPPTYHSVNRLFEQGRTKEWAKGSLEEVVQNAIKSWE  75

Query  452  MEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPA  631
            ME+ HK    D+KT+ P KF+L VNGR+GLS E+T K+G SYN  L++S+PE+++ +   
Sbjct  76   MELSHKTRIQDFKTISPDKFKLIVNGREGLSAEETLKVG-SYNALLKSSMPEEFKYYKAD  134

Query  632  DETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFF  811
            +E+F SS  VFR+A PRGFA E+L VYSGPP I+++FRHWGY +GPFKGH PTG++ EFF
Sbjct  135  EESFESSHDVFRSALPRGFAWEVLAVYSGPPVISFKFRHWGYFEGPFKGHAPTGDLVEFF  194

Query  812  GMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSSACPF  952
            G+GI ++D ES +    E+++D  EL G L+KG S     ++  CPF
Sbjct  195  GVGILKVD-ESLRAEDVEIYYDPAELFGGLLKGPS----VSAQKCPF  236



>ref|XP_004489016.1| PREDICTED: pathogen-related protein-like [Cicer arietinum]
Length=224

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/224 (55%), Positives = 166/224 (74%), Gaps = 7/224 (3%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            D YR  L E EV+N  WR  GPP+YD+V+KLFEEGRT  WPEGSLEE VQ  +K+WEME+
Sbjct  5    DNYRSILHE-EVENIHWRHGGPPTYDLVNKLFEEGRTKEWPEGSLEETVQNAIKSWEMEL  63

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
             HK    D+KT+ P KF+LFVNGR+GLS E+T  +G SYN  L++SLP+ Y  +N  +ET
Sbjct  64   SHKIRLQDFKTIVPEKFKLFVNGREGLSAEETLSVG-SYNALLKSSLPKDYMPYNANEET  122

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMG  820
            F SS  VF++AFPRGFA E+++VY+GPP I ++FRHWG+ +GPFKGH PTG++ +FFG+G
Sbjct  123  FESSHEVFKSAFPRGFAWEVIKVYTGPPEIAFKFRHWGFFEGPFKGHAPTGKMVQFFGLG  182

Query  821  IFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSSACPF  952
              ++D ++ K+ + E+++D  ELLG L+   SS +    SACPF
Sbjct  183  TLKVD-DTLKVEEVEIYYDPSELLGGLL---SSGDNTNVSACPF  222



>ref|XP_010274425.1| PREDICTED: pathogen-related protein [Nelumbo nucifera]
Length=253

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/242 (52%), Positives = 172/242 (71%), Gaps = 15/242 (6%)
 Frame = +2

Query  275  TGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWE  451
            T  DKYR ++  +  K TKWR G PP+YD+V+++FE+GRT  WP+GSLEE VQ  +KTWE
Sbjct  11   TIADKYRSHMHGEAEKKTKWRHGSPPTYDLVNQVFEQGRTKEWPKGSLEETVQNAIKTWE  70

Query  452  MEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPA  631
            ME+ HK    D+KT++P KF+LFVNGR+G+S E+T ++G SYN  L+TSLPE+ + +   
Sbjct  71   MELSHKTQLQDFKTINPEKFKLFVNGREGISGEETLRLG-SYNALLKTSLPEELQYYKAD  129

Query  632  DETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFF  811
             E+F SS  VFR AFPRGFA E+L VYSGPP I ++FRHWG+M+GPF+G+ PTG   EF+
Sbjct  130  VESFESSHDVFRTAFPRGFAWEVLNVYSGPPVIAFKFRHWGFMEGPFRGYAPTGNKVEFY  189

Query  812  GMGIFELDEESNKIVKAELFFDRGELLGALVKG----GSSD--------EAATSSACPFM  955
            GMG+ ++D E+ +  + E++FD GEL G L+KG    GS +         +++S  CPF 
Sbjct  190  GMGVLKVD-ETLRAEEVEIYFDPGELFGGLMKGPVASGSQEPQHNHPPLNSSSSQGCPFS  248

Query  956  KG  961
            KG
Sbjct  249  KG  250



>ref|XP_010417477.1| PREDICTED: pathogen-related protein-like isoform X1 [Camelina 
sativa]
Length=252

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/235 (52%), Positives = 164/235 (70%), Gaps = 12/235 (5%)
 Frame = +2

Query  278  GGDKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEM  454
              DKYR  L++++  N +WR  GPP ++ V+KLFEE RTHVWPEGSLEE VQ  +K+WEM
Sbjct  18   AADKYRSILNDEKTGNIRWRYGGPPIFNTVNKLFEEERTHVWPEGSLEETVQNAIKSWEM  77

Query  455  EIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPAD  634
            E  HK    D+KT +P KF+LFVNGR+GLS E+T ++G SYN  L+ SLP++++ + P +
Sbjct  78   EFSHKIRLQDFKTTNPEKFKLFVNGREGLSAEETLRLG-SYNALLKNSLPQEFQYYKPEE  136

Query  635  ETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFG  814
            E+F SS   FR+A PRGFA EIL VYSGPP I ++FRHWGY +G FKGH PTGE+ +F G
Sbjct  137  ESFESSHDAFRSALPRGFAWEILSVYSGPPVIAFKFRHWGYFEGTFKGHAPTGEMVQFLG  196

Query  815  MGIFELDEESNKIVKAELFFDRGELLGALVKG---------GSSDEAATSSACPF  952
            +G+ ++D ES +  + E+++D GEL G L+KG          S D  A   +CPF
Sbjct  197  LGVLKVD-ESLRAEEIEIYYDPGELFGGLLKGPPISETKTTDSGDNTAEKQSCPF  250



>ref|XP_009416419.1| PREDICTED: pathogen-related protein [Musa acuminata subsp. malaccensis]
Length=239

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/235 (53%), Positives = 168/235 (71%), Gaps = 10/235 (4%)
 Frame = +2

Query  281  GDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEME  457
            GDKYR YL  +  K+T WR G PP+YD+V+KLFEEGRT  WP+GSLEE VQ  +KTWEME
Sbjct  5    GDKYRSYLVGEGEKDTHWRHGAPPTYDLVNKLFEEGRTTEWPKGSLEETVQNAIKTWEME  64

Query  458  IVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADE  637
            + HK    D+K++ P KF+ FVNGRKGL+ E+T  +G SYN  LQTSLP +++ +    E
Sbjct  65   LSHKTRLGDFKSISPAKFKFFVNGRKGLTGEETLALG-SYNALLQTSLPPEFQYYKADAE  123

Query  638  TFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGM  817
            TF SS  VF+ AFPRGFA E+L+VYSGPP I +++RHWGYM+GP+KGH PTGE+ EF G+
Sbjct  124  TFESSHDVFQMAFPRGFAWEVLRVYSGPPAIAFKYRHWGYMEGPYKGHAPTGELVEFTGV  183

Query  818  GIFELDEESNKIVKAELFFDRGELLGALVKG---GSSDEAATSSA----CPFMKG  961
             + ++DE+  +  + E+++D GEL   L+KG      D   T+++    CPF+KG
Sbjct  184  AVLKVDEQL-RAEEVEIYYDPGELFAGLLKGEVISGVDSVDTTASKLQPCPFLKG  237



>ref|XP_008441543.1| PREDICTED: pathogen-related protein-like isoform X1 [Cucumis 
melo]
Length=243

 Score =   253 bits (646),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 128/239 (54%), Positives = 172/239 (72%), Gaps = 9/239 (4%)
 Frame = +2

Query  278  GGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEM  454
            G +KYR  LS DE KNTKWR G PP+YD+V+KLFEE RT+VWP GSLEE+VQ L+K +EM
Sbjct  4    GDEKYRSLLSGDEEKNTKWRYGVPPNYDIVNKLFEEERTNVWPVGSLEERVQSLVKNFEM  63

Query  455  EIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPAD  634
            E+ HK  P+D+KT+D  K+   +NGRK L++ + +K+GG YN FLQT+LP++YR +N   
Sbjct  64   EMFHKISPSDFKTIDVNKYTFCLNGRKPLAIGEVSKLGG-YNPFLQTALPDEYRYYNAEK  122

Query  635  ETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFG  814
            ET  SS   F   F RGFA+EI+QVYSGPP I ++FRHWGYM+GPF+ H  TGE  EF+G
Sbjct  123  ETAESSHRAFTATFLRGFALEIIQVYSGPPNIVFKFRHWGYMEGPFRNHAATGERIEFYG  182

Query  815  MGIFELDEESNKIVKAELFFDRGELLGALVKG----GSSDEAATSSACPFMKGA*LSFL  979
            + IF+++E+ +KI   E FFD  EL+G L+KG    GS ++A +S  CP ++   L + 
Sbjct  183  VAIFKVNEK-DKIEGVEFFFDPAELVGKLLKGPGLDGSVEKAISS--CPVLRNTGLYYC  238



>ref|XP_008441544.1| PREDICTED: pathogen-related protein-like isoform X2 [Cucumis 
melo]
 ref|XP_008441545.1| PREDICTED: pathogen-related protein-like isoform X2 [Cucumis 
melo]
 ref|XP_008441546.1| PREDICTED: pathogen-related protein-like isoform X2 [Cucumis 
melo]
 ref|XP_008441547.1| PREDICTED: pathogen-related protein-like isoform X2 [Cucumis 
melo]
 ref|XP_008441548.1| PREDICTED: pathogen-related protein-like isoform X2 [Cucumis 
melo]
 ref|XP_008441549.1| PREDICTED: pathogen-related protein-like isoform X2 [Cucumis 
melo]
 ref|XP_008441550.1| PREDICTED: pathogen-related protein-like isoform X3 [Cucumis 
melo]
Length=234

 Score =   252 bits (644),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 127/232 (55%), Positives = 170/232 (73%), Gaps = 9/232 (4%)
 Frame = +2

Query  278  GGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEM  454
            G +KYR  LS DE KNTKWR G PP+YD+V+KLFEE RT+VWP GSLEE+VQ L+K +EM
Sbjct  4    GDEKYRSLLSGDEEKNTKWRYGVPPNYDIVNKLFEEERTNVWPVGSLEERVQSLVKNFEM  63

Query  455  EIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPAD  634
            E+ HK  P+D+KT+D  K+   +NGRK L++ + +K+GG YN FLQT+LP++YR +N   
Sbjct  64   EMFHKISPSDFKTIDVNKYTFCLNGRKPLAIGEVSKLGG-YNPFLQTALPDEYRYYNAEK  122

Query  635  ETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFG  814
            ET  SS   F   F RGFA+EI+QVYSGPP I ++FRHWGYM+GPF+ H  TGE  EF+G
Sbjct  123  ETAESSHRAFTATFLRGFALEIIQVYSGPPNIVFKFRHWGYMEGPFRNHAATGERIEFYG  182

Query  815  MGIFELDEESNKIVKAELFFDRGELLGALVKG----GSSDEAATSSACPFMK  958
            + IF+++E+ +KI   E FFD  EL+G L+KG    GS ++A +S  CP ++
Sbjct  183  VAIFKVNEK-DKIEGVEFFFDPAELVGKLLKGPGLDGSVEKAISS--CPVLR  231



>gb|EAY73287.1| hypothetical protein OsI_01161 [Oryza sativa Indica Group]
Length=240

 Score =   252 bits (644),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 130/241 (54%), Positives = 165/241 (68%), Gaps = 9/241 (4%)
 Frame = +2

Query  260  MACSGT----GGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEK  424
            MA +G     G DKYR ++  +  K+T WR G PP+YDVV+KLFEE RT  WPEGSLEEK
Sbjct  1    MAAAGEEASGGRDKYRSFMYGEGEKDTVWRLGSPPNYDVVNKLFEEERTKEWPEGSLEEK  60

Query  425  VQRLMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLP  604
            VQRL+KTWEME+VHK  P D K++   KF    NG + L+ +D   IG SYN FLQT LP
Sbjct  61   VQRLLKTWEMELVHKVRPEDQKSVHSQKFCSSTNGMRFLNRKDLMAIG-SYNAFLQTKLP  119

Query  605  EKYRVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHP  784
             ++R+++P  ET  S  A F  AFPRGFAIE+L VYSGPPRI ++FRHWG+M+GPF  HP
Sbjct  120  PEHRIYDPDKETLESGMATFLTAFPRGFAIEVLDVYSGPPRIVFKFRHWGHMEGPFMEHP  179

Query  785  PTGEIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVK--GGSSDEAATSSACPFMK  958
            P GE  EFFG+ IF +DEE  K+ KAE F++RG  L + +     ++ + A+ S CP M 
Sbjct  180  PHGERVEFFGICIFHVDEEM-KVEKAEFFYERGNFLASFLSAPAAAATDVASGSGCPVMG  238

Query  959  G  961
            G
Sbjct  239  G  239



>ref|XP_010924734.1| PREDICTED: pathogen-related protein isoform X2 [Elaeis guineensis]
Length=253

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/243 (51%), Positives = 163/243 (67%), Gaps = 18/243 (7%)
 Frame = +2

Query  281  GDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEME  457
            GDKYR YL   E  +T WR G PP+YD+V+KLFEEGRT +WP+GSLEE VQ  +KTWEME
Sbjct  13   GDKYRSYLG-GEGDDTHWRHGSPPTYDLVNKLFEEGRTKIWPKGSLEETVQNAIKTWEME  71

Query  458  IVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADE  637
            + HK    D KT++P KF+  VNGR+ LS E+T K+G +YN  LQ+SLPE  + +    E
Sbjct  72   LSHKTRLEDLKTINPDKFKFAVNGRQALSGEETLKLG-TYNALLQSSLPEDLQYYKAGSE  130

Query  638  TFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGM  817
            TF SS  +FR  FPRGFA E+++VYSGPP I +++RHWGYM+GP+KGH PTGE  EF+G 
Sbjct  131  TFESSHELFRTTFPRGFAWEVMEVYSGPPVIAFKYRHWGYMEGPYKGHAPTGEKVEFYGT  190

Query  818  GIFELDEESNKIVKAELFFDRGELLGALVKG--------------GSSDEAATSSACPFM  955
             I ++DE+  +  + E+++D  EL G L+KG               +    ATS ACPF 
Sbjct  191  AILKVDEQL-RAEEVEIYYDPAELFGGLLKGPLLATSGEITAADSSTGGTTATSRACPFF  249

Query  956  KGA  964
            KG 
Sbjct  250  KGG  252



>ref|XP_003596337.1| Pathogen-related protein [Medicago truncatula]
 gb|ABD32948.1| Pathogen-related protein, related [Medicago truncatula]
 gb|AES66588.1| pathogenesis-like protein [Medicago truncatula]
 gb|AFK39845.1| unknown [Medicago truncatula]
Length=227

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/224 (54%), Positives = 166/224 (74%), Gaps = 7/224 (3%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            DKYR  L  DE +N +WR  GPP+Y +V++LFEEGRT  WPEGSLEE VQ  +K+WEME+
Sbjct  8    DKYRSIL-HDEAENIQWRHGGPPTYGLVNQLFEEGRTKEWPEGSLEETVQNAIKSWEMEL  66

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
             HK    D+KT+ P KF+ FVNGR+GL+ E+T  IG SYN  L++SLPE ++ +   +ET
Sbjct  67   THKIRLQDFKTIVPEKFKFFVNGREGLTAEETLSIG-SYNALLKSSLPEDFKPYKSNEET  125

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMG  820
            F SS  VF++AFPRGFA EI++VY+GPP I ++FRHWG+ +GPFKGH PTG++ +F G+G
Sbjct  126  FESSHEVFKSAFPRGFAWEIIKVYTGPPEIAFKFRHWGFFEGPFKGHAPTGKMVQFSGLG  185

Query  821  IFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSSACPF  952
              ++D ++ K+ + E+++D GEL G L+   SS E+  +SACPF
Sbjct  186  TLKVD-DTLKVEEVEIYYDPGELFGGLI---SSGESTKTSACPF  225



>ref|NP_001042582.1| Os01g0248300 [Oryza sativa Japonica Group]
 gb|AAD38290.1|AC007789_16 putative pathogenesis related protein [Oryza sativa Japonica 
Group]
 dbj|BAB18330.1| putative pathogenesis related protein [Oryza sativa Japonica 
Group]
 dbj|BAF04496.1| Os01g0248300 [Oryza sativa Japonica Group]
Length=240

 Score =   252 bits (643),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 132/241 (55%), Positives = 167/241 (69%), Gaps = 9/241 (4%)
 Frame = +2

Query  260  MACSGT----GGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEK  424
            MA +G     GGDKYR ++  +  K+T WR G PP+YDVV+KLFEE RT  WPEGSLEEK
Sbjct  1    MAAAGEEASGGGDKYRSFMYGEGEKDTVWRLGSPPNYDVVNKLFEEERTKEWPEGSLEEK  60

Query  425  VQRLMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLP  604
            VQRL+KTWEME+VHK  P D K++   KF    NG + L+ +D   IG SYN FLQT LP
Sbjct  61   VQRLLKTWEMELVHKVRPEDQKSVHSQKFCSSTNGMRFLNRKDLMAIG-SYNAFLQTKLP  119

Query  605  EKYRVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHP  784
             ++R+++P  ET  S  A F  AFPRGFAIE+L VYSGPPRI ++FRHWG+M+GPF  HP
Sbjct  120  PEHRIYDPDKETLESGMATFLTAFPRGFAIEVLDVYSGPPRIVFKFRHWGHMEGPFMEHP  179

Query  785  PTGEIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVK--GGSSDEAATSSACPFMK  958
            P GE  EFFG+ IF +DEE  K+ KAE F++RG  L + +     ++ +AA+ S CP M 
Sbjct  180  PHGERVEFFGICIFHVDEEM-KVEKAEFFYERGNFLASFLSAPAAAATDAASGSGCPVMG  238

Query  959  G  961
            G
Sbjct  239  G  239



>ref|XP_003543204.1| PREDICTED: pathogen-related protein [Glycine max]
 gb|KHN36895.1| Pathogen-related protein [Glycine soja]
Length=235

 Score =   252 bits (643),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/235 (53%), Positives = 166/235 (71%), Gaps = 13/235 (6%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            DKYR +L  DE  N +WR  GPP+YD V+KLFEEGRT  W EGSLEE VQ  +K+WEME+
Sbjct  4    DKYRSFL-HDEPDNVQWRHGGPPTYDAVNKLFEEGRTKEWTEGSLEEIVQNAIKSWEMEL  62

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
             HK    D+KT++P KF+LFVNGR+GLS EDT  +G SYN  LQ+SLPE  + +   +ET
Sbjct  63   SHKTRLQDFKTINPEKFKLFVNGREGLSGEDTLSLG-SYNALLQSSLPEDLKPYKADEET  121

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMG  820
            F SS   F++AFPRGFA E+++VYSGPP I ++FRHWG+ +GPFKGH PTG++A+F+G+G
Sbjct  122  FESSHEAFKSAFPRGFAWEVIKVYSGPPEIAFKFRHWGFFEGPFKGHAPTGKMAQFYGLG  181

Query  821  IFELDEESNKIVKAELFFDRGELLGALVKGG---------SSDEAATSSACPFMK  958
              ++D +S K+ + E+++D  ELLG L+ G           +  +A S  CPF K
Sbjct  182  TVKVD-DSLKVEEVEIYYDPAELLGGLLSGNHINHPIEEDGTKTSAPSQGCPFSK  235



>gb|KDP34789.1| hypothetical protein JCGZ_10569 [Jatropha curcas]
Length=242

 Score =   251 bits (642),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/230 (54%), Positives = 166/230 (72%), Gaps = 10/230 (4%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            DKYR +L  DE + T+WR  GPPSYD V++LFEEGRT  WP+GS+EE VQ  +K+WEME+
Sbjct  14   DKYRSFL-HDEAETTEWRHGGPPSYDSVNQLFEEGRTKEWPKGSVEEIVQNAIKSWEMEL  72

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
             HK    D+KT++P KF+L VNGR+GLS EDT +IG SYN  L++SLP++ + +   +ET
Sbjct  73   SHKTRLQDFKTINPQKFKLIVNGREGLSAEDTLRIG-SYNALLKSSLPDELKYYKAEEET  131

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMG  820
            F SS   FR+AFPRGFA E+L VYSGPP IT++FRHWG+ +GPFKGH PTG+  EFFG+G
Sbjct  132  FESSHEAFRSAFPRGFAWEVLNVYSGPPVITFKFRHWGFFEGPFKGHAPTGQKVEFFGVG  191

Query  821  IFELDEESNKIVKAELFFDRGELLGALVKG-----GSSDEAATSS-ACPF  952
            + ++D ES +    E++++  EL   L+KG       S +  TSS ACPF
Sbjct  192  VLKVD-ESLRAEDVEVYYEPAELFSGLLKGELISESQSQQIHTSSHACPF  240



>gb|AFK35332.1| unknown [Medicago truncatula]
 gb|AES66583.2| pathogenesis-like protein [Medicago truncatula]
Length=227

 Score =   250 bits (639),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/224 (53%), Positives = 164/224 (73%), Gaps = 7/224 (3%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            DKYR  L  DE +N  WR  GPP+Y +V++LFEEGRT VWPEGSLEE VQ  +K+WEME+
Sbjct  8    DKYRSIL-HDEAENIHWRHGGPPTYGLVNQLFEEGRTKVWPEGSLEETVQNAIKSWEMEL  66

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
             HK    D+KT+ P KF+LFVNGR GL+ E+T  +G SYN  L++SLPE ++ +   +ET
Sbjct  67   SHKIRLQDFKTIVPEKFKLFVNGRDGLTAEETLSLG-SYNALLKSSLPENFKPYKSNEET  125

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMG  820
            F SS  VF++AFPRGFA E+++VY+GPP I ++FRHWG+ +GPFKGH PTG++ +FFG+G
Sbjct  126  FESSHEVFKSAFPRGFAWEVIKVYTGPPEIAFKFRHWGFFEGPFKGHSPTGKMVQFFGLG  185

Query  821  IFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSSACPF  952
              ++D ++ K+ + E+++D  ELLG L+  G   +    SACPF
Sbjct  186  TLKVD-DALKVEEVEIYYDPAELLGGLLTSGDGTQI---SACPF  225



>ref|XP_003596332.1| Pathogen-related protein [Medicago truncatula]
Length=224

 Score =   250 bits (638),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/224 (53%), Positives = 164/224 (73%), Gaps = 7/224 (3%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            DKYR  L  DE +N  WR  GPP+Y +V++LFEEGRT VWPEGSLEE VQ  +K+WEME+
Sbjct  5    DKYRSIL-HDEAENIHWRHGGPPTYGLVNQLFEEGRTKVWPEGSLEETVQNAIKSWEMEL  63

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
             HK    D+KT+ P KF+LFVNGR GL+ E+T  +G SYN  L++SLPE ++ +   +ET
Sbjct  64   SHKIRLQDFKTIVPEKFKLFVNGRDGLTAEETLSLG-SYNALLKSSLPENFKPYKSNEET  122

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMG  820
            F SS  VF++AFPRGFA E+++VY+GPP I ++FRHWG+ +GPFKGH PTG++ +FFG+G
Sbjct  123  FESSHEVFKSAFPRGFAWEVIKVYTGPPEIAFKFRHWGFFEGPFKGHSPTGKMVQFFGLG  182

Query  821  IFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSSACPF  952
              ++D ++ K+ + E+++D  ELLG L+  G   +    SACPF
Sbjct  183  TLKVD-DALKVEEVEIYYDPAELLGGLLTSGDGTQI---SACPF  222



>ref|XP_004967874.1| PREDICTED: pathogen-related protein-like [Setaria italica]
Length=240

 Score =   250 bits (639),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 128/237 (54%), Positives = 162/237 (68%), Gaps = 7/237 (3%)
 Frame = +2

Query  263  ACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLM  439
            A     GDKYR ++  +  K+T WR G PP+YDVV+KLFE  RT VWPEGSLEEKVQRL+
Sbjct  4    AAEVGAGDKYRSFIHGESEKDTVWRYGAPPNYDVVNKLFEAERTRVWPEGSLEEKVQRLL  63

Query  440  KTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRV  619
            KTWEME+VHK  P D KT++  K+    NG K LS  +   IGG YN FL+T LP ++R+
Sbjct  64   KTWEMELVHKVRPEDQKTVNSEKYSASNNGMKALSRAEVMAIGG-YNHFLRTKLPPEHRI  122

Query  620  FNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEI  799
            F+P  ET  S+ A F  AFPRGFAIE+L VYSGPP+I ++FRHWGYM+GPFKGHPP G+ 
Sbjct  123  FDPDQETLDSAMATFLTAFPRGFAIEVLDVYSGPPKIAFKFRHWGYMEGPFKGHPPHGQR  182

Query  800  AEFFGMGIFELDEESNKIVKAELFFDRGELLGALVK----GGSSDEAATSSACPFMK  958
             EF G+ IF +DEE  K+ K+E F++RG  L + +        S  A + S CP M+
Sbjct  183  VEFIGVCIFHVDEEM-KVEKSEYFYERGNFLASFLSPPDAAPGSGSAGSGSGCPVMR  238



>ref|NP_001042584.1| Os01g0248500 [Oryza sativa Japonica Group]
 gb|AAD38293.1|AC007789_19 putative pathogenesis related protein [Oryza sativa Japonica 
Group]
 dbj|BAB18332.1| putative pathogenesis related protein [Oryza sativa Japonica 
Group]
 dbj|BAF04498.1| Os01g0248500 [Oryza sativa Japonica Group]
 dbj|BAG87196.1| unnamed protein product [Oryza sativa Japonica Group]
Length=240

 Score =   250 bits (639),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 131/241 (54%), Positives = 167/241 (69%), Gaps = 9/241 (4%)
 Frame = +2

Query  260  MACSGT---GGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKV  427
            MA +G    G DKYR ++  +  K+T WR G PP+YDVV+KLFEE RT  WPEGSLEEKV
Sbjct  1    MAAAGEASGGRDKYRSFMYGEGEKDTVWRLGSPPNYDVVNKLFEEERTKEWPEGSLEEKV  60

Query  428  QRLMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPE  607
            QRL+KTWEME++HK  P D K++   KF    NG + LS ++   IGG YN FLQT LP 
Sbjct  61   QRLLKTWEMELIHKVRPEDQKSVHSQKFCASTNGMRFLSRKEVMAIGG-YNAFLQTKLPP  119

Query  608  KYRVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPP  787
            ++R+++P +ET  S  A F  AFPRGFAIE+L VYSGPPRI ++FRHWGYM+GPFK HPP
Sbjct  120  EHRIYDPDNETLESGMATFLTAFPRGFAIEVLDVYSGPPRIVFKFRHWGYMEGPFKEHPP  179

Query  788  TGEIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVK---GGSSDEAATSSACPFMK  958
             G+  EFFG+ IF +DEE  K+ K E F++RG  L + +      ++ EAA+ S CP M 
Sbjct  180  HGKRVEFFGICIFHVDEEM-KVEKTEYFYERGNFLASFLSTPAAAAAAEAASGSGCPVMG  238

Query  959  G  961
            G
Sbjct  239  G  239



>ref|XP_003566352.1| PREDICTED: pathogen-related protein-like [Brachypodium distachyon]
Length=232

 Score =   249 bits (637),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/235 (53%), Positives = 167/235 (71%), Gaps = 5/235 (2%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA +  GGDKYR +L  +  KNT WR G PP+YD+V+KLFEE RT  WPEGSLEEKVQRL
Sbjct  1    MASAEAGGDKYRSFLHGEGEKNTVWRLGAPPNYDMVNKLFEEERTKEWPEGSLEEKVQRL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEME+VHK  P D K++    +    NG K L+ ++ + IGG YN FL T+LP ++R
Sbjct  61   LKTWEMELVHKLRPEDQKSVHYQGYSASTNGMKPLTRKELSAIGG-YNAFLATTLPPEHR  119

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
            +++P  ET  SS + F  AFPRGFAIE+L+VYSGPP++ ++FRHWG+M+GPFK HPP G+
Sbjct  120  IYDPEKETLESSMSTFLTAFPRGFAIEVLEVYSGPPKVAFKFRHWGHMEGPFKEHPPHGQ  179

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSSACPFMKG  961
              EFFG+ IF +DEE  K+ K E F++RG  L + +   +   AA++S CP + G
Sbjct  180  RVEFFGVCIFHVDEEM-KVQKTEYFYERGNFLASFL--STPASAASASGCPVIGG  231



>ref|XP_006643992.1| PREDICTED: pathogen-related protein-like [Oryza brachyantha]
Length=235

 Score =   249 bits (637),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 159/227 (70%), Gaps = 5/227 (2%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            DKYR +L  +  K+T WR G PP+YDVV+KLFEE RT  W EGSLEEKVQR +KTWEME+
Sbjct  12   DKYRSFLHGEGEKDTVWRHGAPPNYDVVNKLFEEERTKEWAEGSLEEKVQRPLKTWEMEL  71

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
            VHK  P D K++   KF    NG   LS ++   IGG YN FL+T+LP ++R+++P  ET
Sbjct  72   VHKVRPEDQKSVHSQKFCASTNGMGFLSRKEVMAIGG-YNAFLRTTLPPEHRIYDPDRET  130

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMG  820
              S  A F  AFPRGFAIE+L VYSGPPRI ++FRHWGYM+GPFK HPP G+  EFFG+ 
Sbjct  131  LESGMATFLAAFPRGFAIEVLDVYSGPPRIAFKFRHWGYMEGPFKEHPPHGKRVEFFGVC  190

Query  821  IFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSSACPFMKG  961
            IF +DEE  K+ KAE F++RG  L + +   +  EAA+ S CP M G
Sbjct  191  IFHVDEEM-KVEKAEYFYERGNFLASFLSAPA--EAASGSGCPVMGG  234



>ref|XP_004967875.1| PREDICTED: pathogen-related protein-like [Setaria italica]
Length=240

 Score =   249 bits (637),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/233 (55%), Positives = 161/233 (69%), Gaps = 7/233 (3%)
 Frame = +2

Query  278  GGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEM  454
             GDKYR ++  +  K+T WR G PP+YDVV+KLFE  RT VWPEGSLEEKVQRL+KTWEM
Sbjct  9    AGDKYRSFIHGESEKDTVWRYGAPPNYDVVNKLFEAERTRVWPEGSLEEKVQRLLKTWEM  68

Query  455  EIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPAD  634
            E+VHK  P D KT++  K+    NG K  S  +   IG SYN FL+T LP ++R+F+P  
Sbjct  69   ELVHKVRPEDQKTVNSEKYSASNNGMKAQSRAELMAIG-SYNHFLRTKLPPEHRIFDPDQ  127

Query  635  ETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFG  814
            ET  S+ A F  AFPRGFAIE+L VYSGPP+I ++FRHWGYM+GPFKGHPP G+  EF G
Sbjct  128  ETLDSAMATFLTAFPRGFAIEVLDVYSGPPKIAFKFRHWGYMEGPFKGHPPHGQRVEFIG  187

Query  815  MGIFELDEESNKIVKAELFFDRGELLGALVK----GGSSDEAATSSACPFMKG  961
            + IF +DEE  K+ K+E F++RG  L + +        S  A + S CP M+G
Sbjct  188  VCIFHVDEEM-KVEKSEYFYERGNFLASFLSPPDAAPGSGSAGSGSGCPVMRG  239



>ref|XP_010924733.1| PREDICTED: pathogen-related protein isoform X1 [Elaeis guineensis]
Length=260

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/250 (51%), Positives = 165/250 (66%), Gaps = 26/250 (10%)
 Frame = +2

Query  281  GDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEME  457
            GDKYR YL   E  +T WR G PP+YD+V+KLFEEGRT +WP+GSLEE VQ  +KTWEME
Sbjct  13   GDKYRSYLG-GEGDDTHWRHGSPPTYDLVNKLFEEGRTKIWPKGSLEETVQNAIKTWEME  71

Query  458  IVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADE  637
            + HK    D KT++P KF+  VNGR+ LS E+T K+G +YN  LQ+SLPE  + +    E
Sbjct  72   LSHKTRLEDLKTINPDKFKFAVNGRQALSGEETLKLG-TYNALLQSSLPEDLQYYKAGSE  130

Query  638  TFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGM  817
            TF SS  +FR  FPRGFA E+++VYSGPP I +++RHWGYM+GP+KGH PTGE  EF+G 
Sbjct  131  TFESSHELFRTTFPRGFAWEVMEVYSGPPVIAFKYRHWGYMEGPYKGHAPTGEKVEFYGT  190

Query  818  GIFELDEESNKIVKAELFFDRGELLGALVKGG--SSDE--------------------AA  931
             I ++DE+  +  + E+++D  EL G L+KG   SS E                     A
Sbjct  191  AILKVDEQL-RAEEVEIYYDPAELFGGLLKGPLLSSSEHHREATSGEITAADSSAGGTTA  249

Query  932  TSSACPFMKG  961
            TS ACPF KG
Sbjct  250  TSRACPFFKG  259



>ref|XP_008792335.1| PREDICTED: pathogen-related protein [Phoenix dactylifera]
Length=251

 Score =   249 bits (635),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 130/249 (52%), Positives = 163/249 (65%), Gaps = 30/249 (12%)
 Frame = +2

Query  281  GDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEME  457
            GD+YR YL  +E  +T WR G PP+YD+V+KLFEEGRT VWP+GSLEEKVQ  +KTWEME
Sbjct  11   GDQYRSYLVGEEGDDTHWRLGSPPTYDLVNKLFEEGRTKVWPKGSLEEKVQNAIKTWEME  70

Query  458  IVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADE  637
              HK    D+KT++  KF+  VNGR+ LS E+T K+ GSYN  LQ S PE+        E
Sbjct  71   FSHKTRLEDFKTINREKFKFIVNGRQALSAEETLKL-GSYNALLQNSQPEE------DLE  123

Query  638  TFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGM  817
            +F SS  +FR AFPRGFA E+L VYSGPP I  +FRHWGYM+GP+KGH PTGE  EF+GM
Sbjct  124  SFESSHELFRTAFPRGFAWEVLHVYSGPPVIVLKFRHWGYMEGPYKGHAPTGEKVEFYGM  183

Query  818  GIFELDEESNKIVKAELFFDRGELLGALVKG---------------------GSSDEAAT  934
             I ++DE   +  + E+++D  EL+G  +KG                     GSS  AAT
Sbjct  184  AILKVDEHL-RAEELEIYYDPAELIGGFLKGPLLSPSEHLQVAATSGEVAATGSSSGAAT  242

Query  935  SSACPFMKG  961
            S ACP+ KG
Sbjct  243  SRACPYFKG  251



>ref|XP_010675371.1| PREDICTED: pathogen-related protein [Beta vulgaris subsp. vulgaris]
Length=255

 Score =   249 bits (635),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 127/248 (51%), Positives = 170/248 (69%), Gaps = 13/248 (5%)
 Frame = +2

Query  254  TKMACSGTGGDKYRDYLSED-EVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKV  427
             K   +   GDKYR  L+E+ E K+  WR  GPP +D V+KLFEEGRT  WP+GSLEE V
Sbjct  7    NKDIATKIAGDKYRSILTEEAENKDIHWRHGGPPIFDAVNKLFEEGRTKEWPKGSLEEAV  66

Query  428  QRLMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPE  607
            Q  +K+WEME+ HK    D+KT+ P KF+LFVNGR+GL+ E+  K+G SYN  L+TSLPE
Sbjct  67   QNAIKSWEMELSHKTHLRDFKTISPDKFKLFVNGREGLTGEEVLKLG-SYNALLKTSLPE  125

Query  608  KYR-VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHP  784
            +Y+  +N  +E+F SS   F++AFPRGFA E++ VYSGPP I ++FRHWGY +GP+K H 
Sbjct  126  EYQPYYNAKEESFESSHDAFQSAFPRGFAWEVISVYSGPPVIAFKFRHWGYFEGPYKDHA  185

Query  785  PTGEIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGG-SSDEAATSSA------  943
            PTGE+ +FFG+GI ++D ES ++ + E+++D GEL   L+KG    D A T S       
Sbjct  186  PTGEMVQFFGLGILKVD-ESMRVEEVEIYYDPGELFAGLLKGTRHQDTAGTKSVDPKNTL  244

Query  944  -CPFMKGA  964
             CP  K A
Sbjct  245  KCPLTKMA  252



>ref|XP_006302730.1| hypothetical protein CARUB_v10020845mg [Capsella rubella]
 gb|EOA35628.1| hypothetical protein CARUB_v10020845mg [Capsella rubella]
Length=238

 Score =   248 bits (633),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 120/233 (52%), Positives = 164/233 (70%), Gaps = 14/233 (6%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            DKYR  L  ++ +  +WR G PP ++ V++LFEEG+T VWPEGSLEE VQ  +K+WEME 
Sbjct  8    DKYRSVL--EDARQVQWRYGHPPDFNSVNQLFEEGQTKVWPEGSLEETVQNAIKSWEMEF  65

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
             HK    D+KT++P KF+LFVNGR+GLS E+T ++G SYN  L+ SLPE+++ + P +E+
Sbjct  66   SHKIRIQDFKTINPEKFKLFVNGREGLSAEETLRLG-SYNALLKNSLPEEFQYYKPEEES  124

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMG  820
            F SS   FR+A PRGFA EIL VYSGPP I ++FRHWGY +G FKGH PTGE+ +F G+G
Sbjct  125  FESSHDAFRSALPRGFAWEILSVYSGPPDIAFKFRHWGYFEGTFKGHAPTGEMVQFLGLG  184

Query  821  IFELDEESNKIVKAELFFDRGELLGALVKG---------GSSDEAATSSACPF  952
            + ++D ES ++ + E+++D GEL G L+KG          S D  A   +CPF
Sbjct  185  VLKVD-ESLRVEEIEIYYDPGELFGGLLKGPPISETETTHSGDNTAEKQSCPF  236



>gb|KDP34790.1| hypothetical protein JCGZ_10570 [Jatropha curcas]
Length=251

 Score =   248 bits (634),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 124/238 (52%), Positives = 169/238 (71%), Gaps = 14/238 (6%)
 Frame = +2

Query  278  GGDKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEM  454
              DKYR  L+E E + T+WR  GPP +D V+KLFEEGRT  WP+GS+EE VQ  +K+WEM
Sbjct  14   AADKYRSILNE-EAETTQWRHGGPPIFDSVNKLFEEGRTKEWPKGSVEEAVQNAVKSWEM  72

Query  455  EIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPAD  634
            E+ HK    D+KT++P KF L VNGR+GL+ E+T ++G SYN  L++SLPE+++ +   +
Sbjct  73   ELSHKTRLQDFKTINPEKFNLIVNGREGLTAEETLRLG-SYNALLKSSLPEEFKYYKVDE  131

Query  635  ETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFG  814
            ETF SS   FR+AFPRGFA E++ VYSGPP ITY+FRHWGY +GPFKGH PTGE+ +F+G
Sbjct  132  ETFESSHDAFRSAFPRGFAWEVIAVYSGPPEITYKFRHWGYFEGPFKGHAPTGEMVQFYG  191

Query  815  MGIFELDEESNKIVKAELFFDRGELLGALVKG--------GSSDEAATS--SACPFMK  958
            +G+ ++D ES +    E+++D  EL G L+KG          S+  ATS  ++CPF K
Sbjct  192  IGVMKVD-ESLRAEDVEIYYDPAELFGGLLKGLPTFDSHKEDSNILATSTPTSCPFSK  248



>ref|XP_007021803.1| Pathogenesis-related family protein isoform 1 [Theobroma cacao]
 gb|EOY13328.1| Pathogenesis-related family protein isoform 1 [Theobroma cacao]
Length=241

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/243 (52%), Positives = 165/243 (68%), Gaps = 15/243 (6%)
 Frame = +2

Query  266  CSGTGGDKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMK  442
             S  G DKYR +L  D+  + +WR  GPP+YD V++LFEEGRT  WPEGSLEE VQ  +K
Sbjct  2    ASVPGRDKYRSFL-HDDADSVQWRHGGPPTYDAVNQLFEEGRTKEWPEGSLEETVQNAIK  60

Query  443  TWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVF  622
            TWEMEI HK    D K+++P KF+L VNGR+GL+ E+T K+G +YN  L+ SLP++++ +
Sbjct  61   TWEMEISHKVRLQDIKSINPEKFKLIVNGREGLTGEETLKLG-TYNALLKNSLPKEFQYY  119

Query  623  NPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIA  802
               +ETF SS  VFR+AFPRGFA E++ VYSGPP I ++FRHWG   GPFKGH PTGE  
Sbjct  120  KVDEETFESSHEVFRSAFPRGFAWEVISVYSGPPLIAFKFRHWGIFQGPFKGHAPTGEKV  179

Query  803  EFFGMGIFELDEESNKIVKAELFFDRGELLGALVKG--------GSSDEAATSS---ACP  949
            EFFG+G  ++D ES K+   E+++D GEL   L+KG        G  D A  S+    CP
Sbjct  180  EFFGLGTLKVD-ESLKVEDVEIYYDPGELFAGLLKGPPISESQTGDEDIAQCSAKTHGCP  238

Query  950  FMK  958
            F K
Sbjct  239  FQK  241



>ref|XP_006358936.1| PREDICTED: pathogen-related protein-like [Solanum tuberosum]
Length=234

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 162/219 (74%), Gaps = 6/219 (3%)
 Frame = +2

Query  284  DKYRDYLSEDEVK---NTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWE  451
            DKYR +L ED+       +WR G PPSY+ V+KLFE+GRT VWPEGSLEE VQ  +K+WE
Sbjct  13   DKYRLFLHEDQAAAAGTIQWRHGDPPSYESVNKLFEQGRTKVWPEGSLEETVQNAIKSWE  72

Query  452  MEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPA  631
            ME+ HK    D++T++P KF+LFVNGR GLS E+T K+G SYN  L++S+P++++ +   
Sbjct  73   MELSHKTRIKDFRTINPEKFKLFVNGRDGLSAEETLKVG-SYNALLKSSMPDEFKYYKAD  131

Query  632  DETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFF  811
             ETF SS   FR+AFPRGFA E++ VY+GPP +TY+FRHWG+ +GPFKGH PTG++ +F+
Sbjct  132  KETFESSHNAFRSAFPRGFAWEVINVYTGPPVVTYKFRHWGFFEGPFKGHAPTGQMVQFY  191

Query  812  GMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEA  928
            G+GI ++D ES +    E+++D  EL G L+KG +  E+
Sbjct  192  GLGILKVD-ESLRAEDVEVYYDPTELFGELLKGPTISES  229



>ref|XP_006370134.1| hypothetical protein POPTR_0001s40000g [Populus trichocarpa]
 gb|ERP66703.1| hypothetical protein POPTR_0001s40000g [Populus trichocarpa]
Length=247

 Score =   246 bits (628),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 123/247 (50%), Positives = 167/247 (68%), Gaps = 14/247 (6%)
 Frame = +2

Query  254  TKMACSGTG-GDKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKV  427
            T+ AC+    GDKYR +L ED    T+WR  GPP++D V++LFEEGRT  WP+GSLEE V
Sbjct  3    TEEACTIIKVGDKYRSFLHEDTENTTQWRHGGPPNFDTVNQLFEEGRTKEWPKGSLEEVV  62

Query  428  QRLMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPE  607
            Q  +KTW+MEI HK    D KT++P  F+L VNGR+GL+ E+T +IG SYN  L++SLP+
Sbjct  63   QNAIKTWDMEIEHKTRVQDIKTINPDTFKLIVNGREGLAAEETLRIG-SYNALLKSSLPK  121

Query  608  KYRVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPP  787
            +++ +   +ETF SS   FR+A PRGFA E+L VYSGPP I+++FRHWG+ +GPFKGH P
Sbjct  122  EFQYYKADEETFESSHDAFRSALPRGFAWEVLSVYSGPPVISFKFRHWGFFEGPFKGHAP  181

Query  788  TGEIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGG----------SSDEAATS  937
            T E  EF+G GI ++D ES +    E+++D  EL G L+KG           + + A  +
Sbjct  182  TEEKVEFYGFGILKVD-ESLRAEDVEVYYDPAELFGGLLKGALISPCQSEDNTVNTATAT  240

Query  938  SACPFMK  958
              CPF K
Sbjct  241  RGCPFSK  247



>ref|XP_007149571.1| hypothetical protein PHAVU_005G081500g [Phaseolus vulgaris]
 gb|ESW21565.1| hypothetical protein PHAVU_005G081500g [Phaseolus vulgaris]
Length=234

 Score =   246 bits (627),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 120/234 (51%), Positives = 167/234 (71%), Gaps = 12/234 (5%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            D+YR +L  DE  N +WR  GPP+YD V+KLFE+GRT  WPEGSLEE VQ  +K+WEME+
Sbjct  4    DRYRSFL-HDEPANIQWRHGGPPTYDAVNKLFEQGRTKEWPEGSLEEIVQNAIKSWEMEL  62

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
             HK    D+KT++P KF+LFVNGR+GLS E+T K+G SYN  LQ+SLPE  + +   +ET
Sbjct  63   SHKIRLQDFKTINPEKFKLFVNGREGLSGEETLKLG-SYNALLQSSLPEDLKPYKADEET  121

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMG  820
            F SS  VFR+AFPRGFA E+++VYSGPP I Y+FRHWG+ +GP+K + PTG++ +F+G G
Sbjct  122  FESSHEVFRSAFPRGFAWEVIKVYSGPPEIAYKFRHWGFFEGPYKEYAPTGKMVQFYGFG  181

Query  821  IFELDEESNKIVKAELFFDRGELLGALVKGGS--------SDEAATSSACPFMK  958
              ++D +S K+ + E+++D  E+LG L+ G +        ++ +  S  CPF K
Sbjct  182  TVKVD-DSLKVEEVEIYYDPAEMLGGLISGKNPNHPMEDGTEASPPSQECPFSK  234



>ref|XP_010675339.1| PREDICTED: pathogen-related protein-like [Beta vulgaris subsp. 
vulgaris]
Length=245

 Score =   246 bits (627),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 121/234 (52%), Positives = 163/234 (70%), Gaps = 13/234 (6%)
 Frame = +2

Query  284  DKYRDYLSED-EVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEME  457
            DKYR +L ED +  N  WR G PP YD V+KLFEEGR   WP+GSLEE VQ  +K+WEME
Sbjct  12   DKYRSFLHEDAKNDNIVWRHGAPPEYDAVNKLFEEGRKKEWPKGSLEETVQNAIKSWEME  71

Query  458  IVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADE  637
            + HK    D++T++P KF+LFVNGR+GLS E+  K+G SYN  L+TSLPE ++ +   +E
Sbjct  72   LSHKPRLQDFRTINPDKFKLFVNGREGLSGEEALKVG-SYNALLKTSLPENFQYYKADEE  130

Query  638  TFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGM  817
            +F SS  VFR+AFPRGFA E++ VYSGPP I ++FRHWG+ +GPFKGH PT E+ EF+G+
Sbjct  131  SFESSHEVFRSAFPRGFAWEVICVYSGPPNIAFKFRHWGFFEGPFKGHTPTTEMVEFYGL  190

Query  818  GIFELDEESNKIVKAELFFDRGELLGALVKGGSS---------DEAATSSACPF  952
            G  ++D ES ++   E+++D GEL G L+KG ++         D  +  S CP 
Sbjct  191  GTLKVD-ESLRVEDVEIYYDPGELFGGLLKGQATIGLDHKNVDDSISYGSGCPL  243



>ref|XP_010060709.1| PREDICTED: pathogen-related protein [Eucalyptus grandis]
 gb|KCW67519.1| hypothetical protein EUGRSUZ_F01247 [Eucalyptus grandis]
 gb|KCW67520.1| hypothetical protein EUGRSUZ_F01247 [Eucalyptus grandis]
Length=244

 Score =   245 bits (626),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 118/232 (51%), Positives = 165/232 (71%), Gaps = 12/232 (5%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            DKYR +L +D  +NT WR  GPPSY+ V+ LFE+GRT  WP+GSLEE VQ  +K+WEME+
Sbjct  13   DKYRSFLYDD-AENTHWRHGGPPSYEDVNSLFEQGRTKEWPKGSLEETVQNAIKSWEMEV  71

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
             HK    D +T+ P KF+L +NGR+GLS E+T K+G +YN  L+TSLPE+++ +    ET
Sbjct  72   SHKTRVQDIRTISPEKFKLIINGREGLSAEETLKLG-TYNALLKTSLPEEFQYYKAEKET  130

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMG  820
            F SS   FR+AFPRGFA E+L+VYSGPP I ++FRHWG+ +GPFKGH PTGE+ EF G+ 
Sbjct  131  FESSHDTFRSAFPRGFAWEVLEVYSGPPVIAFKFRHWGFFEGPFKGHAPTGEMVEFHGLA  190

Query  821  IFELDEESNKIVKAELFFDRGELLGALVKGG--------SSDEAATSSACPF  952
              ++D ES +  + E+++D G+L G L+KG          +++ + ++ACPF
Sbjct  191  TLKVD-ESLRAEEVEIYYDPGQLFGGLLKGSIIPESHNKDTNDFSEAAACPF  241



>emb|CDY10562.1| BnaC03g70520D [Brassica napus]
Length=334

 Score =   248 bits (634),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 123/236 (52%), Positives = 166/236 (70%), Gaps = 20/236 (8%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            DKYR  L  ++V   +WR G PP++D+V++LFEEG+T VWPEGSLEE VQ  +K+WEME 
Sbjct  104  DKYRSVL--NDVGEVQWRYGHPPAFDLVNQLFEEGQTKVWPEGSLEETVQNAIKSWEMEF  161

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
             HK    D+KT++P KF+LFVNGR+GLS E+T ++G SYN  L+TSLP +++ + P +E+
Sbjct  162  SHKIRLQDFKTINPDKFKLFVNGREGLSAEETLRLG-SYNALLKTSLPGEFQYYKPEEES  220

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMG  820
            F SS   FR+A PRGFA EIL VYSGPP I ++FRHWGY +G FKGH PTGEI +F G+G
Sbjct  221  FESSHDAFRSALPRGFAFEILSVYSGPPNIAFKFRHWGYFEGDFKGHAPTGEIVQFLGLG  280

Query  821  IFELDEESNKIVKA---ELFFDRGELLGALVKG---------GSSDEAATSSACPF  952
            + ++DE    +++A   E+++D GEL G L+KG          S D  A   +CPF
Sbjct  281  VLKVDE----LLRAEEIEIYYDPGELFGGLLKGPPILETKTTDSGDNTAEKHSCPF  332



>ref|XP_006477768.1| PREDICTED: pathogen-related protein-like [Citrus sinensis]
Length=239

 Score =   245 bits (626),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 120/238 (50%), Positives = 165/238 (69%), Gaps = 15/238 (6%)
 Frame = +2

Query  275  TGGDKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWE  451
              GDKYR  L+E E K+T+WR  GPP +D V+KLFEEGRT  WP+GS+EE VQ  +K+WE
Sbjct  3    VAGDKYRSILNE-EAKSTQWRHGGPPIFDKVNKLFEEGRTKEWPKGSIEETVQNAVKSWE  61

Query  452  MEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPA  631
            ME+ HK   ND+KT++P KF+L VNGRK LS E+T ++G SYN  L+ SLP++++ +   
Sbjct  62   MELSHKTSLNDFKTINPEKFKLIVNGRKDLSGEETLQLG-SYNALLKNSLPKEFQYYRAD  120

Query  632  DETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFF  811
            +ETF SS   FR+AFPRGFA E++ V+SGPP + Y+FRHWGY +GPF+GH PTGE+ EF+
Sbjct  121  EETFKSSHDAFRSAFPRGFAWEVISVFSGPPVVAYKFRHWGYFEGPFQGHAPTGEMVEFY  180

Query  812  GMGIFELDEESNKIVKAELFFDRGELLGALVKG-----------GSSDEAATSSACPF  952
            G+GI ++D E  +    E+++D  EL   L+KG             S + ++S  CPF
Sbjct  181  GIGIMKVD-EFMRAEDVEIYYDPAELFAGLLKGPVLNAIAETQQNKSADTSSSHHCPF  237



>ref|XP_011044075.1| PREDICTED: pathogen-related protein [Populus euphratica]
Length=249

 Score =   245 bits (626),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 121/249 (49%), Positives = 165/249 (66%), Gaps = 15/249 (6%)
 Frame = +2

Query  251  TTKMACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKV  427
            T + A      D YR  L ++    T+WR G PP YD V++LFEEGRT  WP+GSLEE V
Sbjct  3    TAEAALIKKSRDIYRSILHDEAENTTQWRHGGPPVYDSVNQLFEEGRTKEWPKGSLEEVV  62

Query  428  QRLMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPE  607
            Q  +K+WEME+ HK    D+KT++P KF+L VNGR+GLS E+T ++G SYN  L+ SLP+
Sbjct  63   QNAIKSWEMELSHKTRLQDFKTINPDKFKLIVNGREGLSGEETLRLG-SYNALLKNSLPK  121

Query  608  KYRVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPP  787
            +++ +   +ETF SS   FR+AFPRGFA E+L VYSGPP I+++FRHWG+ +GPFKGH P
Sbjct  122  EFQYYKADEETFESSHDAFRSAFPRGFAWEVLNVYSGPPVISFKFRHWGFFEGPFKGHAP  181

Query  788  TGEIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKG------------GSSDEAA  931
            TGE  EF G+G+ ++D ES +    E+++D  EL G L+KG             ++  AA
Sbjct  182  TGEKVEFHGLGVLKID-ESQRAEDVEIYYDPAELFGGLLKGPLISPSQSESEDNTASVAA  240

Query  932  TSSACPFMK  958
             +  CPF K
Sbjct  241  ATHGCPFSK  249



>ref|XP_007200844.1| hypothetical protein PRUPE_ppa026378mg [Prunus persica]
 gb|EMJ02043.1| hypothetical protein PRUPE_ppa026378mg [Prunus persica]
Length=219

 Score =   244 bits (623),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 126/236 (53%), Positives = 153/236 (65%), Gaps = 22/236 (9%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            M  S   GDKYR YLS +  KNT WR G PPSYDVV+KLFEEGRT +WP GSL E+VQ L
Sbjct  1    MRSSDVEGDKYRSYLSGEGEKNTTWRFGAPPSYDVVNKLFEEGRTKIWPPGSLGEEVQNL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEME+ HK+                   RKG++LE+  K+GG YN  LQTSLPE  R
Sbjct  61   VKTWEMEVFHKSR------------------RKGITLEEMGKLGGGYNPLLQTSLPEHLR  102

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
             +NP  ET  SS   F   FPRGFA+EILQVYSGPP I Y+FRHWGY++GPFKGH PTGE
Sbjct  103  GYNPEKETSESSHKAFTTTFPRGFALEILQVYSGPPEIVYKFRHWGYVEGPFKGHAPTGE  162

Query  797  IAEFFGMGIFELDEESNKIVKAELFFD--RGELLGALVKGGSSDEAATSSACPFMK  958
            + E +GM IF +DE  NKIVK E F+D  +        +   +    T+S+CP ++
Sbjct  163  LVEVYGMSIFTVDEH-NKIVKIEFFYDPGQLLGGLLKGEKLGTSSEGTTSSCPVLR  217



>sp|P16273.2|PRPX_HORVU RecName: Full=Pathogen-related protein [Hordeum vulgare]
 emb|CAA34641.1| pathogenesis related protein [Hordeum vulgare subsp. vulgare]
Length=235

 Score =   245 bits (625),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 124/238 (52%), Positives = 167/238 (70%), Gaps = 7/238 (3%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA +  GGDKYR +L  D  K T WR G PP+YD+V+KLFEE RT  W EGS+EEKVQRL
Sbjct  1    MASAEGGGDKYRSFLHGDGEKKTVWRHGAPPNYDLVNKLFEEERTKEWAEGSVEEKVQRL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEME+VHK  P D K+++   +    NG K L+ E+   +GG YN FL T+LP ++R
Sbjct  61   LKTWEMEMVHKVRPEDQKSVNLKNYSASTNGLKPLTREEVMAMGG-YNAFLATTLPPEHR  119

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGP--PRITYRFRHWGYMDGPFKGHPPT  790
            +++P  E+  S+ + F  AFPRGFAIE+L VYS P  PRI ++FRHWGYM+GPFKGHPP 
Sbjct  120  IYDPEAESVESATSTFLTAFPRGFAIEVLDVYSSPSAPRIAFKFRHWGYMEGPFKGHPPH  179

Query  791  GEIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSSACPFMKGA  964
            G   EFFG+ +F +DE++ K+ KAE F++RG  L + +   +   +A++S CP M+GA
Sbjct  180  GGRVEFFGVCVFHVDEDT-KVEKAEFFYERGNFLASFLT--APAASASASGCPVMRGA  234



>emb|CDX87436.1| BnaA07g34370D [Brassica napus]
Length=309

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/236 (51%), Positives = 166/236 (70%), Gaps = 20/236 (8%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            DKYR  L  ++V   +WR G PP++D+V++LFEEG+T VWPEGSLEE VQ  +K+WEME 
Sbjct  79   DKYRSVL--NDVGEVQWRYGHPPAFDLVNQLFEEGQTKVWPEGSLEETVQNAIKSWEMEF  136

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
             HK    D+KT++P KF+LFVNGR+GLS E+T ++G SYN  L+TSLP +++ + P +E+
Sbjct  137  SHKIRLQDFKTINPDKFKLFVNGREGLSAEETLRLG-SYNALLKTSLPGEFQYYKPEEES  195

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMG  820
            F SS   FR+A PRGFA EIL VYSGPP I ++FRHWGY +G FKGH PTGE+ +F G+G
Sbjct  196  FESSHDAFRSALPRGFAFEILSVYSGPPNIAFKFRHWGYFEGDFKGHAPTGEMVQFLGLG  255

Query  821  IFELDEESNKIVKA---ELFFDRGELLGALVKG---------GSSDEAATSSACPF  952
            + ++DE    +++A   E+++D GEL G L+KG          + D  A   +CPF
Sbjct  256  VLKVDE----LLRAEEIEIYYDPGELFGGLLKGPPVLETKTTDTGDNTAEKHSCPF  307



>gb|ABK26765.1| unknown [Picea sitchensis]
Length=253

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/231 (51%), Positives = 163/231 (71%), Gaps = 7/231 (3%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            D YR ++  +  K+T WR G PPSY+ V+KLFEEGRT VWP+GSLEE V++L+KTWEME+
Sbjct  19   DPYRLHMYGEAEKHTAWRHGAPPSYNQVNKLFEEGRTKVWPKGSLEETVEKLVKTWEMEL  78

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
             HK +  D+KT+DP  F + VNGR  LS ++T  +G SYN  LQTSLPE+ + +  + ET
Sbjct  79   SHKTNIQDFKTIDPRSFSMRVNGRPALSGKETLDMG-SYNALLQTSLPEELQYYKTSMET  137

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMG  820
            F SS  +FR +FPRGFA E++QVY+GPP +T++FRHWG M+GPFKGH PTGE  +F G+ 
Sbjct  138  FESSHDIFRTSFPRGFAWEVVQVYTGPPLVTFKFRHWGVMEGPFKGHKPTGETVQFIGIA  197

Query  821  IFELDEESNKIVKAELFFDRGELLGALVKG----GSSDEAATSSACPFMKG  961
            I +++EE  +IV+ E+++D  EL G L++G       +    +  CPF  G
Sbjct  198  IAKVNEEM-RIVEVEVYYDPAELCGGLLRGLVEKSYGEYKKGTEGCPFYAG  247



>gb|KFK42242.1| hypothetical protein AALP_AA2G230000 [Arabis alpina]
Length=277

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/260 (48%), Positives = 167/260 (64%), Gaps = 36/260 (14%)
 Frame = +2

Query  278  GGDKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHV-------------------  397
              DKYR  L++++  N +WR  GPP +D V+KLFEE RTHV                   
Sbjct  19   AADKYRSILNDEKTGNIQWRYGGPPIFDTVNKLFEEERTHVQWRYGHPPDFNSVNQLFEE  78

Query  398  -----WPEGSLEEKVQRLMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAK  562
                 WPEGSLEE VQ  +K+WEME  HK    D+KT++P KF+LFVNGR+GLS E+T K
Sbjct  79   GQTKVWPEGSLEETVQNAIKSWEMEFSHKIHLQDFKTINPDKFKLFVNGREGLSAEETLK  138

Query  563  IGGSYNVFLQTSLPEKYRVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRF  742
            +G SYN  L+ SLP++++ + P +E+F SS   FR+A PRGFA EIL VYSGPP I ++F
Sbjct  139  LG-SYNALLKNSLPKEFQYYKPEEESFESSHDAFRSALPRGFAWEILAVYSGPPVIAFKF  197

Query  743  RHWGYMDGPFKGHPPTGEIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGG---  913
            RHWGY +G FKGH PTGE+ +F G+G+ ++D ES ++ + E+++D GEL G L+KG    
Sbjct  198  RHWGYFEGNFKGHAPTGEMVQFLGLGVLKVD-ESLRVEEIEIYYDPGELFGELLKGPPIS  256

Query  914  ------SSDEAATSSACPFM  955
                  S D  A   +CPF+
Sbjct  257  ETKTILSGDNTAEKQSCPFI  276



>ref|XP_006370137.1| hypothetical protein POPTR_0001s40030g [Populus trichocarpa]
 gb|ERP66706.1| hypothetical protein POPTR_0001s40030g [Populus trichocarpa]
Length=245

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/238 (50%), Positives = 163/238 (68%), Gaps = 13/238 (5%)
 Frame = +2

Query  278  GGDKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEM  454
             GDKYR +L ++    T+WR  GPP YD V++LFEEGRT  WP+GSLEE VQ  +K+WEM
Sbjct  10   AGDKYRSFLHDEAENTTQWRHGGPPIYDSVNQLFEEGRTKEWPKGSLEEVVQNAVKSWEM  69

Query  455  EIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPAD  634
            E+ HK    D+KT++P KF+L VNGR+GLS E+T +IG SYN  L++SLP++++ +   +
Sbjct  70   ELSHKTRLQDFKTINPDKFKLIVNGREGLSGEETLRIG-SYNALLKSSLPKEFQYYKADE  128

Query  635  ETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFG  814
            ETF SS   FR+A PRGFA E+L VYSGPP I+++FRHWG+ +GPFKGH PT E  EF+G
Sbjct  129  ETFESSHDAFRSALPRGFAWEVLSVYSGPPVISFKFRHWGFFEGPFKGHAPTEEKVEFYG  188

Query  815  MGIFELDEESNKIVKAELFFDRGELLGALVKGG----------SSDEAATSSACPFMK  958
             G+ ++D ES +    E+++D  EL G L+KG           + + A  +  CPF K
Sbjct  189  FGVLKVD-ESLRAEDVEVYYDPAELFGGLLKGALISPCQSEDNTVNTATATRGCPFSK  245



>ref|XP_006442478.1| hypothetical protein CICLE_v10021966mg [Citrus clementina]
 gb|ESR55718.1| hypothetical protein CICLE_v10021966mg [Citrus clementina]
Length=240

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/226 (53%), Positives = 161/226 (71%), Gaps = 4/226 (2%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            DKYR +L  DE +  +WR G PP+YD V++LFEEGRT  WP+GSLEE VQ  +K+WEME+
Sbjct  16   DKYRSFL-HDEAEKIQWRHGKPPTYDTVNQLFEEGRTKEWPKGSLEETVQNAIKSWEMEL  74

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
             HK    D K+++P KF+L VNGR+GLS E+T K  GSYN  L+ SLPE+++ +   +E+
Sbjct  75   THKTRLQDVKSINPDKFKLIVNGREGLSAEETLK-AGSYNALLKNSLPEEFKFYKAEEES  133

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMG  820
            F SS   FR+AFPRGFA E+L VYSGPP I ++FRHWG+ +GPFKGH PTGE  EF G+G
Sbjct  134  FESSHEAFRSAFPRGFAWEVLSVYSGPPLIAFKFRHWGFFEGPFKGHAPTGEKVEFCGLG  193

Query  821  IFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSSACPFMK  958
              ++D ES +    E+++D  EL G L+KG S +++  +  CPF K
Sbjct  194  TLKVD-ESLRAEDVEIYYDPAELFGGLLKGSSIEDSTAAQGCPFSK  238



>gb|EMT24763.1| hypothetical protein F775_27286 [Aegilops tauschii]
Length=233

 Score =   243 bits (621),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 126/236 (53%), Positives = 164/236 (69%), Gaps = 6/236 (3%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA + TGGDKYR ++  +  KNT WR G PP++DVV+KLFEE RT  W EGS+EEKVQRL
Sbjct  1    MASAETGGDKYRSFMDGEGEKNTVWRHGVPPNFDVVNKLFEEERTKEWAEGSVEEKVQRL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEME+ HK  P D K++    F    NG K L+ ++   IGG YN FL T LP ++R
Sbjct  61   LKTWEMEMFHKLRPEDQKSVHSQGFTSSTNGMKPLTRKEWTAIGG-YNAFLATKLPLEHR  119

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVY-SGPPRITYRFRHWGYMDGPFKGHPPTG  793
            +++P  ETF S    F  AFPRGFAIE+L VY +GPPR+ ++FRHWGYM+GPFKGHPP G
Sbjct  120  IYDPDTETFDSGMETFLTAFPRGFAIEVLDVYCTGPPRVAFKFRHWGYMEGPFKGHPPHG  179

Query  794  EIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSSACPFMKG  961
            +  E FG+ IF +DEE  K+ KAE F++RG  L + +   +   AA++S CP M+G
Sbjct  180  QRVELFGICIFHVDEEM-KVEKAEYFYERGNFLASFLS--TPAAAASASGCPVMRG  232



>ref|XP_010429717.1| PREDICTED: pathogen-related protein-like isoform X2 [Camelina 
sativa]
Length=240

 Score =   244 bits (622),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/233 (50%), Positives = 162/233 (70%), Gaps = 12/233 (5%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            DKYR     ++    +WR G PP ++ V++LFEEG+T VWPEGSLEE VQ  +K+WEME+
Sbjct  8    DKYRSVSVLEDAGKVQWRYGRPPDFNSVNQLFEEGQTKVWPEGSLEETVQNAIKSWEMEL  67

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
             HK    D+KT++P KF+LFVNGR+GLS E+T ++G SYN  L+ SLP++++ + P +E+
Sbjct  68   SHKIRLQDFKTINPEKFKLFVNGREGLSAEETLRLG-SYNALLKNSLPQEFQYYKPEEES  126

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMG  820
            F SS   FR+A PRGFA E+L VYSGPP I ++FRHWGY +G FKGH PTGE+ +F G+G
Sbjct  127  FESSHDAFRSALPRGFAWEVLSVYSGPPVIAFKFRHWGYFEGTFKGHAPTGEMVQFLGLG  186

Query  821  IFELDEESNKIVKAELFFDRGELLGALVKG---------GSSDEAATSSACPF  952
            + ++D ES +  + E+++D GEL G L+KG          + D  A   +CPF
Sbjct  187  VLKVD-ESLRAEETEIYYDPGELFGGLLKGPPISETKTTDTGDNTADKQSCPF  238



>emb|CDX88476.1| BnaC06g39200D [Brassica napus]
Length=285

 Score =   245 bits (626),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/236 (51%), Positives = 164/236 (69%), Gaps = 20/236 (8%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            DKYR  L  ++V   +WR G PP++D+V++LFEEG+T VWPEGSLEE VQ  +K+WEME 
Sbjct  55   DKYRSVL--NDVGEVQWRYGHPPAFDLVNQLFEEGQTKVWPEGSLEETVQNAIKSWEMEF  112

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
             HK    D+KT++P KF+LFVNGR+GLS E+T ++G SYN  L+TSLP +++ + P +E+
Sbjct  113  SHKIRLQDFKTINPDKFKLFVNGREGLSAEETLRLG-SYNALLKTSLPGEFQYYKPEEES  171

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMG  820
            F SS   FR+A PRGFA EIL VYSGPP I ++FRHWGY +G FK H PTGE+ +F G+G
Sbjct  172  FESSHDAFRSALPRGFAFEILSVYSGPPNIAFKFRHWGYFEGDFKSHAPTGEMVQFLGLG  231

Query  821  IFELDEESNKIVKA---ELFFDRGELLGALVKG---------GSSDEAATSSACPF  952
            + ++DE    +++A   E+++D GEL G L+KG          S D  A    CPF
Sbjct  232  VLKVDE----LLRAEEIEIYYDPGELFGGLLKGPPILETKTTDSGDNTAEKHGCPF  283



>ref|XP_006858461.1| hypothetical protein AMTR_s00071p00098340 [Amborella trichopoda]
 gb|ERN19928.1| hypothetical protein AMTR_s00071p00098340 [Amborella trichopoda]
Length=216

 Score =   243 bits (619),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 124/216 (57%), Positives = 152/216 (70%), Gaps = 10/216 (5%)
 Frame = +2

Query  320  KNTKWRSGP-PSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEIVHKADPNDYKTL  496
            KNT WR G  P+YD+V+KLFEE R  VWPEGSLEEKVQ L+KTWEMEI HKA   D+KTL
Sbjct  4    KNTVWRHGALPNYDIVNKLFEEERQTVWPEGSLEEKVQNLVKTWEMEIFHKARLEDFKTL  63

Query  497  DPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADETFVSSQAVFRNAF  676
            DP KF   +NGRK LSL + AK+GG YN  LQTSLPE+++ +NP   +  +S   F   F
Sbjct  64   DPNKFTFSLNGRKELSLPEVAKMGG-YNPLLQTSLPEEFQCYNPKTLSGDASHEAFLRTF  122

Query  677  PRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMGIFELDEESNKIV  856
            PRGFA+EI++VY GPP I ++FRHWGY +GPF GH  TGE  E FG+GIF++     KI 
Sbjct  123  PRGFALEIVRVYLGPPTIVFKFRHWGYNEGPFLGHASTGERVELFGIGIFQI-----KIE  177

Query  857  KAELFFDRGELLGALVKGGSSD---EAATSSACPFM  955
              ELF+DRGELLG L+KG   +     A  S+CP +
Sbjct  178  NIELFYDRGELLGGLMKGSPQERDGNKAIPSSCPAL  213



>ref|XP_004251898.1| PREDICTED: pathogen-related protein-like [Solanum lycopersicum]
Length=234

 Score =   243 bits (621),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 158/219 (72%), Gaps = 6/219 (3%)
 Frame = +2

Query  284  DKYRDYLSEDEVK---NTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWE  451
            DKYR +L ED+       +WR G  PSY  V+KLFEEGRT VWPEGSLEE VQ  +K+WE
Sbjct  13   DKYRLFLHEDQAAAEGTIQWRHGDAPSYGSVNKLFEEGRTKVWPEGSLEETVQNAIKSWE  72

Query  452  MEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPA  631
            ME+ HK    D++T++P KF+LFVNGR GLS E+T K+G SYN  L++S+P +++ +   
Sbjct  73   MELSHKTRVKDFRTINPQKFKLFVNGRDGLSAEETLKVG-SYNALLKSSMPNEFKYYKAD  131

Query  632  DETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFF  811
            +ETF SS   FR+AFPRGFA E++ VY+GPP ITY+FRHWG+ +GPFKGH PTG + +F+
Sbjct  132  EETFESSHNAFRSAFPRGFAWEVISVYTGPPIITYKFRHWGFFEGPFKGHAPTGNMVQFY  191

Query  812  GMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEA  928
            G+GI ++D ES +    E+++D  EL G L+KG    E+
Sbjct  192  GLGILKVD-ESLRAEDVEVYYDPTELFGELLKGPKISES  229



>ref|XP_009106590.1| PREDICTED: pathogen-related protein [Brassica rapa]
Length=238

 Score =   243 bits (621),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/233 (51%), Positives = 163/233 (70%), Gaps = 14/233 (6%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            DKYR  L  ++V   +WR G PP++ +V++LFEEG+T VWPEGSLEE VQ  +K+WEME 
Sbjct  8    DKYRSVL--NDVGEVQWRYGHPPAFALVNQLFEEGQTKVWPEGSLEETVQNAIKSWEMEF  65

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
             HK    D+KT++P KF+LFVNGR+GLS E+T ++G SYN  L+TSLP +++ + P +E+
Sbjct  66   SHKIRLQDFKTINPDKFKLFVNGREGLSAEETLRLG-SYNALLKTSLPGEFQYYKPEEES  124

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMG  820
            F SS   FR+A PRGFA EIL VYSGPP I ++FRHWGY +G FKGH PTGE+ +F G+G
Sbjct  125  FESSHDAFRSALPRGFAFEILSVYSGPPNIAFKFRHWGYFEGDFKGHAPTGEMVQFLGLG  184

Query  821  IFELDEESNKIVKAELFFDRGELLGALVKG---------GSSDEAATSSACPF  952
            + ++D E  +  + E+++D GEL G L+KG          + D  A   +CPF
Sbjct  185  VLKVD-ELLRAEEIEIYYDPGELFGGLLKGPPVLETKTTDTGDNTAEKHSCPF  236



>ref|NP_565189.1| pathogenesis-related protein [Arabidopsis thaliana]
 gb|AAM66077.1| pathogenesis-related protein-like protein [Arabidopsis thaliana]
 gb|AEE36150.1| pathogenesis-related protein [Arabidopsis thaliana]
Length=238

 Score =   243 bits (620),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/233 (51%), Positives = 161/233 (69%), Gaps = 14/233 (6%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            DKYR  L  ++    +WR   PP ++ V++LFEEG+T VWPEGSLEE VQ  +K+WEME 
Sbjct  8    DKYRSVL--EDAGQVQWRYDNPPDFNSVNQLFEEGQTKVWPEGSLEETVQNAIKSWEMEF  65

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
             HK    D+KT++P KF+LFVNGR+GLS E+T ++G SYN  L+ SLPE+++ + P +E+
Sbjct  66   SHKIRLQDFKTINPEKFKLFVNGREGLSAEETLRLG-SYNALLKNSLPEEFQYYKPEEES  124

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMG  820
            F SS   FR+A PRGFA EIL VYSGPP I ++FRHWGY +G FKGH PTGE+ +F G+G
Sbjct  125  FESSHDAFRSALPRGFAWEILSVYSGPPVIAFKFRHWGYFEGTFKGHAPTGEMVQFLGLG  184

Query  821  IFELDEESNKIVKAELFFDRGELLGALVKG---------GSSDEAATSSACPF  952
            + ++D ES +  + E+++D GEL G L+KG          S D  A   +CPF
Sbjct  185  VLKVD-ESLRAEEIEIYYDPGELFGGLLKGPPISETKTTDSGDNTAEKQSCPF  236



>gb|AAC83032.1| Similar to gb|X16648 pathogenesis related protein from Hordeum 
vulgare. EST gb|Z18206 comes from this gene [Arabidopsis thaliana]
Length=276

 Score =   244 bits (623),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 124/259 (48%), Positives = 165/259 (64%), Gaps = 36/259 (14%)
 Frame = +2

Query  278  GGDKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHV-------------------  397
              DKYR  L++++  N +WR  GPP +D V+KLFEE RTHV                   
Sbjct  18   AADKYRSILNDEKTGNIRWRYGGPPIFDTVNKLFEEERTHVQWRYDNPPDFNSVNQLFEE  77

Query  398  -----WPEGSLEEKVQRLMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAK  562
                 WPEGSLEE VQ  +K+WEME  HK    D+KT++P KF+LFVNGR+GLS E+T +
Sbjct  78   GQTKVWPEGSLEETVQNAIKSWEMEFSHKIRLQDFKTINPEKFKLFVNGREGLSAEETLR  137

Query  563  IGGSYNVFLQTSLPEKYRVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRF  742
            +G SYN  L+ SLPE+++ + P +E+F SS   FR+A PRGFA EIL VYSGPP I ++F
Sbjct  138  LG-SYNALLKNSLPEEFQYYKPEEESFESSHDAFRSALPRGFAWEILSVYSGPPVIAFKF  196

Query  743  RHWGYMDGPFKGHPPTGEIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKG----  910
            RHWGY +G FKGH PTGE+ +F G+G+ ++D ES +  + E+++D GEL G L+KG    
Sbjct  197  RHWGYFEGTFKGHAPTGEMVQFLGLGVLKVD-ESLRAEEIEIYYDPGELFGGLLKGPPIS  255

Query  911  -----GSSDEAATSSACPF  952
                  S D  A   +CPF
Sbjct  256  ETKTTDSGDNTAEKQSCPF  274



>ref|XP_006389959.1| hypothetical protein EUTSA_v10019070mg [Eutrema salsugineum]
 gb|ESQ27245.1| hypothetical protein EUTSA_v10019070mg [Eutrema salsugineum]
Length=237

 Score =   243 bits (619),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 119/232 (51%), Positives = 161/232 (69%), Gaps = 13/232 (6%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            DKYR  L  +     +WR G PP++D V++LFEEG+T VWPEGSLEE VQ  +K+WEME 
Sbjct  8    DKYRSVL--EHSGQVQWRYGHPPAFDTVNQLFEEGQTKVWPEGSLEETVQNAIKSWEMEF  65

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
             HK    D+KT++P KF+LFVNGR+GLS E+T ++G SYN  L+ SLPE+++ + P DET
Sbjct  66   SHKIRLQDFKTINPDKFKLFVNGREGLSAEETLRLG-SYNALLKNSLPEEFQYYKPEDET  124

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMG  820
            F SS   FR+A PRGFA EIL VYSGPP I ++FRHWGY +G F+GH PTG++ +F G+G
Sbjct  125  FESSHDAFRSALPRGFAWEILSVYSGPPVIAFKFRHWGYFEGNFRGHAPTGDLVQFLGLG  184

Query  821  IFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSSA--------CPF  952
            + ++D E  +  + E+++D GEL G L+KG    E  T+ +        CPF
Sbjct  185  VLKVD-EFLRAEEIEIYYDPGELFGGLLKGNPISETKTTDSGDKAEKQICPF  235



>ref|XP_010417478.1| PREDICTED: pathogen-related protein-like isoform X2 [Camelina 
sativa]
Length=240

 Score =   242 bits (618),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 159/233 (68%), Gaps = 12/233 (5%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            DKYR     ++    +WR G PP +  V++LFEEG+T VWPEGSLEE VQ  +K+WEME 
Sbjct  8    DKYRSVSVLEDAGKVQWRYGHPPDFSSVNQLFEEGQTKVWPEGSLEETVQNAIKSWEMEF  67

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
             HK    D+KT +P KF+LFVNGR+GLS E+T ++G SYN  L+ SLP++++ + P +E+
Sbjct  68   SHKIRLQDFKTTNPEKFKLFVNGREGLSAEETLRLG-SYNALLKNSLPQEFQYYKPEEES  126

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMG  820
            F SS   FR+A PRGFA EIL VYSGPP I ++FRHWGY +G FKGH PTGE+ +F G+G
Sbjct  127  FESSHDAFRSALPRGFAWEILSVYSGPPVIAFKFRHWGYFEGTFKGHAPTGEMVQFLGLG  186

Query  821  IFELDEESNKIVKAELFFDRGELLGALVKG---------GSSDEAATSSACPF  952
            + ++D ES +  + E+++D GEL G L+KG          S D  A   +CPF
Sbjct  187  VLKVD-ESLRAEEIEIYYDPGELFGGLLKGPPISETKTTDSGDNTAEKQSCPF  238



>ref|XP_011015673.1| PREDICTED: pathogen-related protein-like [Populus euphratica]
Length=245

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/243 (50%), Positives = 164/243 (67%), Gaps = 13/243 (5%)
 Frame = +2

Query  263  ACSGTGGDKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLM  439
            A     GDKYR +L ++    T+WR  GPP YD V++LFEEGRT  WP+GSLEE VQ  +
Sbjct  5    ALVKKAGDKYRSFLHDEAENITQWRHGGPPIYDSVNQLFEEGRTKEWPKGSLEEVVQNAI  64

Query  440  KTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRV  619
            K+WEME+ HK    D+KT++P KF+L VNGR+GLS E+T +IG SYN  L+ SLP++++ 
Sbjct  65   KSWEMELSHKTRLQDFKTINPDKFKLIVNGREGLSGEETLRIG-SYNALLKNSLPKEFQY  123

Query  620  FNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEI  799
            +   +ETF SS   FR+A PRGFA E+L VYSGPP I+++FRHWG+ +GPFKGH PT E 
Sbjct  124  YKADEETFESSHDAFRSALPRGFAWEVLSVYSGPPVISFKFRHWGFFEGPFKGHAPTEEK  183

Query  800  AEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGG------SSDEAATSSA----CP  949
             EF+G G+ ++D ES +    E+++D   L G L+KG       S D   T++A    CP
Sbjct  184  VEFYGFGVLKVD-ESLRAEDVEVYYDPAALFGGLLKGALISPCQSEDNTVTTAAATRGCP  242

Query  950  FMK  958
            F K
Sbjct  243  FSK  245



>ref|XP_006442479.1| hypothetical protein CICLE_v10024222mg [Citrus clementina]
 gb|ESR55719.1| hypothetical protein CICLE_v10024222mg [Citrus clementina]
Length=238

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/238 (50%), Positives = 162/238 (68%), Gaps = 15/238 (6%)
 Frame = +2

Query  275  TGGDKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWE  451
              GDKYR  L+E E K+T+WR  GPP +D V+KLFEEGRT  WP+GS+EE VQ  +K+WE
Sbjct  3    VAGDKYRSILNE-EAKSTQWRHGGPPIFDKVNKLFEEGRTKEWPKGSIEETVQNAVKSWE  61

Query  452  MEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPA  631
            ME+  K   ND+KT++P KF+L VNGRKGLS E+T ++G SYN  L+ SLP +++     
Sbjct  62   MELSQKTSSNDFKTINPEKFKLIVNGRKGLSGEETLQLG-SYNALLKNSLPMEFQYCRAD  120

Query  632  DETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFF  811
            +ETF SS   FR+AFPRGFA E++ VYSGP  + Y+FRHWGY +GPF+GH PTGE+ EF+
Sbjct  121  EETFKSSHDAFRSAFPRGFAWEVISVYSGPLVVAYKFRHWGYFEGPFQGHAPTGEMVEFY  180

Query  812  GMGIFELDEESNKIVKAELFFDRGELLGALVKG-----------GSSDEAATSSACPF  952
            G+GI ++D E  +    E+++D  EL   L+KG             S + ++S  CPF
Sbjct  181  GIGIMKVD-EFMRAEDVEIYYDPAELFAGLLKGPVLNAIAETQQNKSADTSSSHHCPF  237



>ref|XP_004231587.1| PREDICTED: pathogen-related protein-like [Solanum lycopersicum]
Length=250

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/247 (49%), Positives = 169/247 (68%), Gaps = 20/247 (8%)
 Frame = +2

Query  251  TTKMACSGTGGDKYRDYLSEDEV---KNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLE  418
            TTK+A      DKYR +L ED V   +  +WR G PP YD V+ +FE+GRT VWP+GSLE
Sbjct  7    TTKVAI-----DKYRRFLHEDHVAAAETMEWRHGSPPIYDSVNNVFEQGRTKVWPKGSLE  61

Query  419  EKVQRLMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTS  598
            E +Q  +KTWEMEI +K   ND +T++  KF+LFVNGR+GLS E+T K+GG YN  L+TS
Sbjct  62   ETIQNSIKTWEMEIKYKTCVNDIRTINLEKFKLFVNGREGLSAEETLKVGG-YNALLKTS  120

Query  599  LPEKYRVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKG  778
            +P +++     +ETF SS   FR+AFPRGFA E++ VY+GPP +TY+FRHWG+ +GPFKG
Sbjct  121  MPNEFKYHKEDEETFESSHTNFRSAFPRGFAWEVINVYTGPPVVTYKFRHWGFFEGPFKG  180

Query  779  HPPTGEIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKG---------GSSDEAA  931
            H PTGE+ +F+G+GI ++D+   ++ + EL++D  +L G L+KG            D+  
Sbjct  181  HAPTGEMIQFYGIGIMKVDKYL-RMEELELYYDPAKLFGGLLKGPKISESNIEQGHDDNT  239

Query  932  TSSACPF  952
            T+  CP 
Sbjct  240  TTHQCPL  246



>ref|XP_007137547.1| hypothetical protein PHAVU_009G135800g [Phaseolus vulgaris]
 gb|ESW09541.1| hypothetical protein PHAVU_009G135800g [Phaseolus vulgaris]
Length=192

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 139/192 (72%), Gaps = 0/192 (0%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLM  439
            MA S    DKYR +L +D  +NTKWR GPPSY+ V+KLFEEGRT VW  GSLEE+VQ ++
Sbjct  1    MAASSVEEDKYRPFLRQDIEENTKWRYGPPSYEAVNKLFEEGRTKVWAPGSLEERVQTIV  60

Query  440  KTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRV  619
            K WEME+ HK D  + +++DP K+   +NGRK ++LE+  K+GG Y   LQTSLPEK R 
Sbjct  61   KQWEMEMFHKLDFLENRSVDPEKYTFSLNGRKSINLEEKRKLGGGYIPLLQTSLPEKLRP  120

Query  620  FNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEI  799
            +NP  ET  SS   F  AFPRGFA+EIL VYSGPP I Y+FRHWGYM+GPFKGH PTG+ 
Sbjct  121  YNPYAETADSSHKAFTTAFPRGFALEILHVYSGPPEIVYKFRHWGYMEGPFKGHAPTGDK  180

Query  800  AEFFGMGIFELD  835
             E +GM IF + 
Sbjct  181  IELYGMAIFTVS  192



>ref|XP_006477762.1| PREDICTED: pathogen-related protein-like isoform X1 [Citrus sinensis]
 ref|XP_006477763.1| PREDICTED: pathogen-related protein-like isoform X2 [Citrus sinensis]
Length=240

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/226 (53%), Positives = 161/226 (71%), Gaps = 4/226 (2%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            DKYR +L  DE +  +WR G PP+YD V++LFEEGRT  WP+GSLEE VQ  +K+WEME+
Sbjct  16   DKYRSFL-HDEAEKIQWRHGKPPTYDTVNQLFEEGRTKEWPKGSLEETVQNAIKSWEMEL  74

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
             HK    D K+++P KF+L VNGR+GLS E+T K  GSYN  L+ SLPE+++ +   +E+
Sbjct  75   THKTRLQDVKSINPDKFKLIVNGREGLSAEETLK-AGSYNALLKNSLPEEFKFYKAEEES  133

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMG  820
            F SS   FR+AFPRGF+ E+L VYSGPP I ++FRHWG+ +GPFKGH PTGE  EF G+G
Sbjct  134  FESSHEAFRSAFPRGFSWEVLSVYSGPPLIAFKFRHWGFFEGPFKGHAPTGEKVEFCGLG  193

Query  821  IFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSSACPFMK  958
              ++D ES +    E+++D  EL G L+KG S +++  +  CPF K
Sbjct  194  TLKVD-ESLRAEDVEIYYDPAELFGGLLKGSSIEDSTAAQGCPFPK  238



>ref|XP_011007919.1| PREDICTED: pathogen-related protein-like isoform X1 [Populus 
euphratica]
Length=245

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/243 (50%), Positives = 164/243 (67%), Gaps = 13/243 (5%)
 Frame = +2

Query  263  ACSGTGGDKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLM  439
            A     GDKYR +L ++    T+WR  GPP YD V++LFEEGRT  WP+GSLEE VQ  +
Sbjct  5    ALVKKAGDKYRSFLHDEGENITQWRHGGPPIYDSVNQLFEEGRTKEWPKGSLEEVVQNAI  64

Query  440  KTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRV  619
            K+WEME+ HK    D+KT++P KF+L VNGR+GLS E+T +IG SYN  L+ SLP++++ 
Sbjct  65   KSWEMELSHKTRLQDFKTINPDKFKLIVNGREGLSGEETLRIG-SYNALLKNSLPKEFQY  123

Query  620  FNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEI  799
            +   +ETF SS   FR+A PRGFA E+L VYSGPP I+++FRHWG+ +GPFKGH PT E 
Sbjct  124  YKADEETFESSHDAFRSALPRGFAWEVLSVYSGPPVISFKFRHWGFFEGPFKGHAPTEEK  183

Query  800  AEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGG------SSDEAATSSA----CP  949
             EF+G G+ ++D ES +    E+++D   L G L+KG       S D   T++A    CP
Sbjct  184  VEFYGFGVLKVD-ESLRAEDVEVYYDPAALFGGLLKGALISPCQSEDNTVTTAAATRGCP  242

Query  950  FMK  958
            F K
Sbjct  243  FSK  245



>emb|CDP06024.1| unnamed protein product [Coffea canephora]
Length=237

 Score =   241 bits (615),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/233 (50%), Positives = 164/233 (70%), Gaps = 9/233 (4%)
 Frame = +2

Query  272  GTGGDKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTW  448
                DKYR +L E E +N +WR  GPP YD V+K+FEEGRT  WP+GSLEE VQ  +K+W
Sbjct  6    AVAADKYRSFLHE-EGQNFEWRHGGPPIYDSVNKVFEEGRTKEWPKGSLEEVVQNAVKSW  64

Query  449  EMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNP  628
            EME+ HK    D++T++P KF+L VNG++GLS E+T K+G SYN  L++S+PE+++ +  
Sbjct  65   EMELSHKTRIQDFRTINPDKFKLIVNGKEGLSGEETLKLG-SYNALLKSSMPEEFKYYKA  123

Query  629  ADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEF  808
             +E+F SS   FR+AFPRGFA E++ VYSGPP +T++FRHWGY +GPFKGH PTGE+ +F
Sbjct  124  EEESFESSHDAFRSAFPRGFAWEVISVYSGPPVVTFKFRHWGYFEGPFKGHAPTGEMVQF  183

Query  809  FGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSSA-----CPF  952
            +G+ + ++D ES +    E+++D  EL   L+K     ++A  SA     CPF
Sbjct  184  YGLAVMKVD-ESLRAEDVEVYYDPAELFAGLLKRSDVSDSANISASSGHGCPF  235



>gb|EAY73295.1| hypothetical protein OsI_01170 [Oryza sativa Indica Group]
Length=239

 Score =   241 bits (615),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 130/240 (54%), Positives = 163/240 (68%), Gaps = 8/240 (3%)
 Frame = +2

Query  260  MACSGT---GGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKV  427
            MA +G    G DKYR ++  +  K+T WR G PP+YDVV+KLFEE RT  WPEGSLEEKV
Sbjct  1    MAAAGEASGGRDKYRSFMYGEGEKDTVWRLGSPPNYDVVNKLFEEERTKEWPEGSLEEKV  60

Query  428  QRLMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPE  607
            QRL+KTWEME++HK  P D K++   KF    NG + LS ++   IGG YN FLQT LP 
Sbjct  61   QRLLKTWEMELIHKVRPEDQKSVHSQKFCASTNGMRFLSRKEVMAIGG-YNAFLQTKLPP  119

Query  608  KYRVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPP  787
            ++R+++P  ET  S  A F  AFPRGFAIE+L VYSGPPRI ++FRHWGYM+G FK HPP
Sbjct  120  EHRIYDPDKETLESGMATFLTAFPRGFAIEVLDVYSGPPRIVFKFRHWGYMEGTFKEHPP  179

Query  788  TGEIAEFFGMGIFELDEESNKIVKAELFFDRGELL--GALVKGGSSDEAATSSACPFMKG  961
             G+  EFFG+ IF +DEE  K+ K E F++RG  L         ++ EAA+ S CP M G
Sbjct  180  HGKRVEFFGICIFHVDEEM-KVEKTEYFYERGNFLASFLSAPAAAAAEAASGSGCPVMGG  238



>gb|KHG03872.1| Pathogen-related [Gossypium arboreum]
Length=237

 Score =   240 bits (612),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 119/236 (50%), Positives = 163/236 (69%), Gaps = 8/236 (3%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA    G DKYR +L +DE  N +WR G PP+YDVV++LFE+GRT  W +GSLEE VQ  
Sbjct  1    MATVPAGRDKYRSFL-DDESDNVQWRHGGPPTYDVVNQLFEQGRTKEWEKGSLEEIVQNA  59

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEME+ HK    D+K+++  KF L VNGR+GL  E+  K+G SYN  L+ SLP++++
Sbjct  60   IKTWEMELSHKVRLQDFKSINHEKFNLIVNGREGLKGEEALKMG-SYNALLKNSLPKEFQ  118

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
             +   +E+F SS   FR+AFPRGFA E++ VYSGPP I+++FRHWG  +GPFKGH PTGE
Sbjct  119  YYKADEESFESSHEAFRSAFPRGFAWEVIHVYSGPPLISFKFRHWGIFEGPFKGHAPTGE  178

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGG----SSDEAATSSACPF  952
              EF+G+   ++D E  K+ + E+++D  +L G L+KG     SS     +SACPF
Sbjct  179  KVEFYGIATVKVD-EGLKVEEVEVYYDPAQLFGGLLKGAPISISSSPTHHASACPF  233



>gb|EMS68049.1| hypothetical protein TRIUR3_09584 [Triticum urartu]
Length=236

 Score =   240 bits (612),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 127/237 (54%), Positives = 163/237 (69%), Gaps = 5/237 (2%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA + TGGDKYR ++  +  KNT WR G PP++DVV+KLFEE RT  W EGS+EEKVQRL
Sbjct  1    MASAETGGDKYRSFMDGEGEKNTVWRHGVPPNFDVVNKLFEEERTKEWAEGSVEEKVQRL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEME+ HK  P D K++    F    NG K L+ ++   IGG YN FL T LP ++R
Sbjct  61   LKTWEMEMFHKLRPEDQKSVHSQGFTSSTNGMKPLTRKEWTAIGG-YNAFLATKLPLEHR  119

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYS-GPPRITYRFRHWGYMDGPFKGHPPTG  793
            +++P  ETF S    F  AFPRGFAIE+L VY  GPPR+ ++FRHWGYM+GPFK HPP G
Sbjct  120  IYDPDTETFDSGMETFLTAFPRGFAIEVLDVYCDGPPRVAFKFRHWGYMEGPFKAHPPHG  179

Query  794  EIAEFFGMGIFELDEESNKIVKAELFFDRGELLGA-LVKGGSSDEAATSSACPFMKG  961
            +  E FG+ IF +DEE  K+ KAE F++RG  L + L    S+  AA++S CP M+G
Sbjct  180  QRVELFGVCIFHVDEEM-KVEKAEYFYERGNFLASFLSAPASAPTAASASGCPVMRG  235



>gb|KHG03873.1| Pathogen-related [Gossypium arboreum]
Length=237

 Score =   239 bits (611),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 118/236 (50%), Positives = 160/236 (68%), Gaps = 8/236 (3%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA      DKYR +L +DE  N +WR G PP+YDVV++LFE+GRT  W EGSLEE VQ  
Sbjct  1    MATVPAAKDKYRSFL-DDEADNVQWRHGGPPTYDVVNQLFEQGRTKEWEEGSLEEIVQNA  59

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +KTWEME+ HK    D+K+++  KF L VNGR+GL  E+  K+G SYN  L+ SLP++++
Sbjct  60   IKTWEMELSHKVRLQDFKSINHEKFNLIVNGREGLKGEEALKMG-SYNALLKNSLPKEFQ  118

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
             +   +E+F SS   FR+AFPRGFA E++ VY GPP I ++FRHWG  +GPFKGH PTGE
Sbjct  119  YYKADEESFESSHEAFRSAFPRGFAWEVIHVYCGPPLIAFKFRHWGIFEGPFKGHAPTGE  178

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGG----SSDEAATSSACPF  952
              EF+G+   ++D E  K+ + E+++D  +L G L+KG     SS     +SACPF
Sbjct  179  TVEFYGIATVKVD-EGLKVEEVEVYYDPAQLFGGLLKGAPISISSSPTHHASACPF  233



>ref|XP_008451756.1| PREDICTED: pathogen-related protein isoform X1 [Cucumis melo]
Length=252

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 121/252 (48%), Positives = 167/252 (66%), Gaps = 22/252 (9%)
 Frame = +2

Query  260  MACSGTGG-------DKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSL  415
            MA  GT         DKYR +L   E  +  WR G PP+Y +V++LFEEGRT  WP+GSL
Sbjct  1    MAAEGTSTTTLLDLPDKYRVFL-HLEPPSISWRHGKPPTYGIVNQLFEEGRTKEWPKGSL  59

Query  416  EEKVQRLMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQT  595
            EE VQ  +K+WEME+ HK    D+ T++P KF+LFVNGR+GLS E+T +IG SYN FL++
Sbjct  60   EETVQNAVKSWEMELSHKIKLQDFNTINPRKFKLFVNGREGLSGEETLRIG-SYNAFLKS  118

Query  596  SLPEKYRVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFK  775
             LPE+++ +   +ETF SS   FR+ FPRGFA E+++VYS PP I ++FRHWG+ +GPFK
Sbjct  119  PLPEEFQYYKAEEETFESSHEAFRSCFPRGFAWEVIEVYSPPPLIAFKFRHWGFFEGPFK  178

Query  776  GHPPTGEIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKG-----------GSSD  922
             H PTGE+ EF+G+   ++D E+ K+ +AE+++D  EL G L+KG              +
Sbjct  179  SHSPTGELVEFYGLATLKVD-EALKVEEAEVYYDPAELFGGLLKGKITASESQSKENVKE  237

Query  923  EAATSSACPFMK  958
            + A S  CPF K
Sbjct  238  DLAASVGCPFFK  249



>ref|XP_002317453.1| hypothetical protein POPTR_0011s11020g [Populus trichocarpa]
 gb|EEE98065.1| hypothetical protein POPTR_0011s11020g [Populus trichocarpa]
Length=267

 Score =   238 bits (608),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 126/267 (47%), Positives = 168/267 (63%), Gaps = 33/267 (12%)
 Frame = +2

Query  251  TTKMACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHV----------  397
            T + A     GD YR  L ++    T+WR G PP YD V++LFEEGRT V          
Sbjct  3    TAEEALIKKSGDIYRSILHDEAENTTQWRHGGPPVYDSVNQLFEEGRTKVLDPFSSSPLC  62

Query  398  --------WPEGSLEEKVQRLMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLED  553
                    WP+GSLEE VQ  +K+WEME+ HK    D+KT++P KF+L VNGR+GLS E+
Sbjct  63   LYMSKLCEWPKGSLEEVVQNAIKSWEMELSHKTRLQDFKTINPDKFKLIVNGREGLSGEE  122

Query  554  TAKIGGSYNVFLQTSLPEKYRVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRIT  733
            T ++G SYN  L+ SLP++++ +   +ETF SS   FR+AFPRGFA E+L VYSGPP I+
Sbjct  123  TLRLG-SYNALLKNSLPKEFQYYKADEETFESSHDAFRSAFPRGFAWEVLNVYSGPPVIS  181

Query  734  YRFRHWGYMDGPFKGHPPTGEIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKG-  910
            ++FRHWG+ +GPFKGH PTGE  EF G+G+ ++D ES +    E+++D  EL G L+KG 
Sbjct  182  FKFRHWGFFEGPFKGHAPTGEKVEFHGLGVLKID-ESQRAEDVEIYYDPAELFGGLLKGP  240

Query  911  -------GSSDEAATSSA----CPFMK  958
                    S D  AT +A    CPF K
Sbjct  241  LISPSQSESEDNTATVAAATHGCPFSK  267



>ref|XP_009587122.1| PREDICTED: pathogen-related protein [Nicotiana tomentosiformis]
 gb|AGW81768.1| EF1 protein [Nicotiana tabacum]
Length=249

 Score =   238 bits (606),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 112/240 (47%), Positives = 164/240 (68%), Gaps = 16/240 (7%)
 Frame = +2

Query  278  GGDKYRDYLSEDEVK---NTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKT  445
              DKYR +L E++     +  WR  GPP YD V+ LFE+GRT VW EGSLEE VQ  +K+
Sbjct  11   ASDKYRKFLHEEQAATAGSIHWRHGGPPIYDAVNHLFEQGRTKVWAEGSLEETVQNAIKS  70

Query  446  WEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFN  625
            WEME+ HK    D++T++P KF+LFVNGR+GLS E+T K+G SYN  L++S+PE+++ + 
Sbjct  71   WEMELSHKTRVKDFRTINPEKFKLFVNGREGLSAEETLKVG-SYNALLKSSVPEEFKYYK  129

Query  626  PADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAE  805
              +E+F SS   FR+AFPRGFA E++ VY+GPP +T++FRHWG+ +GPFKGH PT E+ +
Sbjct  130  ADEESFESSHDAFRSAFPRGFAWEVINVYTGPPVVTFKFRHWGFFEGPFKGHAPTREMVQ  189

Query  806  FFGMGIFELDEESNKIVKAELFFDRGELLGALVKG----------GSSDEAATSSACPFM  955
            F+G+GI ++D ES +    E+++D  +L   L+KG            +++  T+  CP+ 
Sbjct  190  FYGVGIMKVD-ESLRAEDVEIYYDPAQLFAGLLKGPPISESNIEQQGNNDKTTTQHCPYQ  248



>ref|XP_002889208.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65467.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=276

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/227 (51%), Positives = 158/227 (70%), Gaps = 12/227 (5%)
 Frame = +2

Query  302  LSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEIVHKADP  478
            L E+E    +WR G PP ++ V++LFEEG+T VWP+GSLEE VQ  +K+WEME  HK   
Sbjct  50   LFEEERTQVQWRYGLPPDFNSVNQLFEEGQTKVWPQGSLEETVQNAIKSWEMEFSHKIRL  109

Query  479  NDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADETFVSSQA  658
             D+KT++P KF+LFVNGR+GLS E+T ++G SYN  L+ SLPE+++ + P +E+F SS  
Sbjct  110  QDFKTINPEKFKLFVNGREGLSAEETLRLG-SYNALLKNSLPEEFQYYKPEEESFESSHD  168

Query  659  VFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMGIFELDE  838
             FR+A PRGFA EIL VYSGPP I ++FRHWGY +G FKGH PTGE+ +F G+G+ ++D 
Sbjct  169  AFRSALPRGFAWEILSVYSGPPVIAFKFRHWGYFEGTFKGHAPTGEMVQFMGLGVLKVD-  227

Query  839  ESNKIVKAELFFDRGELLGALVKG---------GSSDEAATSSACPF  952
            E+ +  + E+++D GEL G L+KG            D  A   +CPF
Sbjct  228  ETLRAEEIEIYYDPGELFGELLKGRPISETKTTDRGDNTADKQSCPF  274



>ref|XP_006367889.1| PREDICTED: pathogen-related protein-like [Solanum tuberosum]
Length=250

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/248 (48%), Positives = 165/248 (67%), Gaps = 21/248 (8%)
 Frame = +2

Query  251  TTKMACSGTGGDKYRDYLSEDEVK---NTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLE  418
            TTK+A      DKYR +L ED V       WR G PP YD V+ +F++GRT VWPEG LE
Sbjct  7    TTKVAI-----DKYRRFLHEDHVAGAGTMGWRHGSPPIYDSVNNVFDQGRTKVWPEGCLE  61

Query  419  EKVQRLMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTS  598
            E +Q  +KT+EME+ +K    D++T++P KF+LFVNGR+GLS E+T K+GG YN  L+ S
Sbjct  62   ETIQNSIKTFEMELKYKTCIKDFRTINPEKFKLFVNGREGLSAEETLKVGG-YNALLKNS  120

Query  599  LPEKYRVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKG  778
            LP +++      ETF SS   FR+AF RGFA E++ VY+GPP +TY+FRHWG+ +GPFKG
Sbjct  121  LPNEFKYHKEDQETFESSHTAFRSAFSRGFAWEVINVYTGPPVVTYKFRHWGFFEGPFKG  180

Query  779  HPPTGEIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKG----------GSSDEA  928
            H PT E+ +F+G+GI ++D +S ++ + EL++D  EL G L+KG             D+ 
Sbjct  181  HAPTAEMIQFYGIGIMKVD-KSLRVEELELYYDPAELFGGLLKGPKISESNTEHQGQDDN  239

Query  929  ATSSACPF  952
             T+  CPF
Sbjct  240  TTTQHCPF  247



>dbj|BAK07496.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=260

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/248 (49%), Positives = 163/248 (66%), Gaps = 23/248 (9%)
 Frame = +2

Query  275  TGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWE  451
            +GGDKYR +L+ +  KNT WR G PP+YD V+ LFE GRT  WPEGSLEE VQ  +KTWE
Sbjct  9    SGGDKYRSHLAGEGEKNTVWRHGAPPTYDAVNSLFEAGRTQEWPEGSLEETVQNAIKTWE  68

Query  452  MEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPA  631
            ME+ HKA   D+K++ P +F L VNG + L+ E+T  +G SYN  L + +      ++ A
Sbjct  69   MELSHKARIEDFKSVSPGRFTLSVNGGRALTGEETLAMG-SYNALLASPILPGAGAYDAA  127

Query  632  DETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFF  811
             ETF SS  +FR+AFPRGFA E+++VYSGPP I ++FRHWG+M+GP+KGH PTG+  EF+
Sbjct  128  AETFESSHDLFRSAFPRGFAWEVVKVYSGPPVIAFKFRHWGHMEGPYKGHAPTGDKVEFY  187

Query  812  GMGIFELDEESNKIVKAELFFDRGELLGALVKG-----------GSSDEAATSS------  940
            G+ + ++DE+  +    E+F+D GELL  L+KG           G   EAAT S      
Sbjct  188  GVAVLKVDEQL-RAEDVEVFYDPGELLAGLIKGPKEGDEEAALAGKLREAATVSASGADA  246

Query  941  ---ACPFM  955
               ACPF+
Sbjct  247  QPQACPFL  254



>gb|ACF85823.1| unknown [Zea mays]
 tpg|DAA53933.1| TPA: hypothetical protein ZEAMMB73_188626 [Zea mays]
Length=203

 Score =   234 bits (598),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 141/192 (73%), Gaps = 2/192 (1%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA +  G DKYR ++  +  ++T WR G PP+YDVV+KLFEE RT VWPEGSLEEKVQRL
Sbjct  1    MAGAEVGEDKYRSFIHGEGERDTVWRYGAPPNYDVVNKLFEEERTQVWPEGSLEEKVQRL  60

Query  437  MKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYR  616
            +K+WEME+VHKA P D KT++  K+    NG   L+  +   IGG YN FL+T LP ++R
Sbjct  61   LKSWEMELVHKARPEDQKTVNSEKYSASTNGMSALTRAEVMAIGG-YNNFLRTKLPPEHR  119

Query  617  VFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
            +++P  ET  S+ A F  AFPRGFAIE+L VYSGPPRI ++FRHWGYM+GPFKGHPP G+
Sbjct  120  IYDPDSETVESAMATFTTAFPRGFAIEVLDVYSGPPRIAFKFRHWGYMEGPFKGHPPHGQ  179

Query  797  IAEFFGMGIFEL  832
              E FG+ IF +
Sbjct  180  RVELFGVCIFHV  191



>ref|XP_007021804.1| Pathogenesis-related family protein isoform 2 [Theobroma cacao]
 gb|EOY13329.1| Pathogenesis-related family protein isoform 2 [Theobroma cacao]
Length=267

 Score =   236 bits (603),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 127/268 (47%), Positives = 165/268 (62%), Gaps = 39/268 (15%)
 Frame = +2

Query  266  CSGTGGDKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMK  442
             S  G DKYR +L  D+  + +WR  GPP+YD V++LFEEGRT  WPEGSLEE VQ  +K
Sbjct  2    ASVPGRDKYRSFL-HDDADSVQWRHGGPPTYDAVNQLFEEGRTKEWPEGSLEETVQNAIK  60

Query  443  TWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVF  622
            TWEMEI HK    D K+++P KF+L VNGR+GL+ E+T K+G +YN  L+ SLP++++ +
Sbjct  61   TWEMEISHKVRLQDIKSINPEKFKLIVNGREGLTGEETLKLG-TYNALLKNSLPKEFQYY  119

Query  623  NPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIA  802
               +ETF SS  VFR+AFPRGFA E++ VYSGPP I ++FRHWG   GPFKGH PTGE  
Sbjct  120  KVDEETFESSHEVFRSAFPRGFAWEVISVYSGPPLIAFKFRHWGIFQGPFKGHAPTGEKV  179

Query  803  EFFGMGIFE-------------------------LDEESNKIVKAELFFDRGELLGALVK  907
            EFFG+G  +                         L +ES K+   E+++D GEL   L+K
Sbjct  180  EFFGLGTLKVTCSSLLYFSLEKQNKRRKKPWIVFLVDESLKVEDVEIYYDPGELFAGLLK  239

Query  908  G--------GSSDEAATSS---ACPFMK  958
            G        G  D A  S+    CPF K
Sbjct  240  GPPISESQTGDEDIAQCSAKTHGCPFQK  267



>ref|XP_004231588.1| PREDICTED: pathogen-related protein [Solanum lycopersicum]
Length=250

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/248 (48%), Positives = 165/248 (67%), Gaps = 20/248 (8%)
 Frame = +2

Query  251  TTKMACSGTGGDKYRDYLSEDEV---KNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLE  418
            TTK+A      DKYR +L ED V   +  +W+ G PP YD V+ +FE+GRT VWP+GSLE
Sbjct  7    TTKVAI-----DKYRRFLHEDHVAAAETIEWKHGSPPIYDSVNNVFEQGRTKVWPKGSLE  61

Query  419  EKVQRLMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTS  598
            E  Q  +KTWEMEI +K   ND +T++  KF+LFVNGR+GLS E+T K+G  YN  L+ S
Sbjct  62   ETTQNSIKTWEMEIKYKTCVNDIRTINLEKFKLFVNGREGLSAEETLKVG-CYNALLKNS  120

Query  599  LPEKYRVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKG  778
            +P +++     +ETF SS   F +AFPRGFA E++ VY+GPP +TY+FRHWG+ +GPFKG
Sbjct  121  MPNEFKYHKEDEETFESSHNAFWSAFPRGFAWEVINVYTGPPVVTYKFRHWGFFEGPFKG  180

Query  779  HPPTGEIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKG---------GSSDEAA  931
            H PTGE+ +F+G+GI ++D+   ++ + EL++D  EL G L+KG            D+  
Sbjct  181  HAPTGEMIQFYGIGIMKVDKYL-RMEELELYYDPAELFGGLLKGPKISESNIEQGQDDNT  239

Query  932  TSSACPFM  955
            T+  CP  
Sbjct  240  TTQQCPLF  247



>ref|XP_010246473.1| PREDICTED: pathogen-related protein-like [Nelumbo nucifera]
Length=239

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 152/198 (77%), Gaps = 3/198 (2%)
 Frame = +2

Query  320  KNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEIVHKADPNDYKTL  496
            KNTKWR  GPP Y++V+++FE+GRT  WP+GSLEE VQ  +KTWEME+ HK    D+KT+
Sbjct  7    KNTKWRHGGPPIYNLVNQVFEQGRTKEWPKGSLEETVQNAVKTWEMELSHKTQLQDFKTI  66

Query  497  DPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADETFVSSQAVFRNAF  676
            +P KF+LFVNGR+G+S E+T ++G SYN  L+TSL EK++ +   +E+F SS  VF+ AF
Sbjct  67   NPEKFKLFVNGREGISGEETLRLG-SYNALLKTSLLEKFQYYKANEESFESSHDVFQTAF  125

Query  677  PRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMGIFELDEESNKIV  856
            PRGFA E+L VYSGPP I ++FRHWG+M+G FK H PTGE  EF+GMG+ ++D ES +  
Sbjct  126  PRGFAWEVLSVYSGPPVIAFKFRHWGFMEGSFKEHAPTGEKVEFYGMGVLKVD-ESLRAE  184

Query  857  KAELFFDRGELLGALVKG  910
            + E+++D GEL G L+KG
Sbjct  185  EVEIYYDPGELFGGLMKG  202



>ref|XP_004167652.1| PREDICTED: LOW QUALITY PROTEIN: pathogen-related protein-like 
[Cucumis sativus]
Length=251

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/251 (48%), Positives = 166/251 (66%), Gaps = 21/251 (8%)
 Frame = +2

Query  260  MACSGTGG-------DKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSL  415
            MA  GT         DKYR +L   E  +  WR G PP+Y +V++LFEEGRT  WP+GSL
Sbjct  1    MATEGTSTTILPDLPDKYRVFL-HLEPPSISWRHGKPPTYGIVNQLFEEGRTKEWPKGSL  59

Query  416  EEKVQRLMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQT  595
            EE VQ  +K+WEME+ HK    D+ T++P KF+LFVNGR+GLS E+T +IG SYN FL++
Sbjct  60   EEIVQNAVKSWEMELSHKIKLQDFNTINPHKFKLFVNGREGLSGEETLRIG-SYNAFLKS  118

Query  596  SLPEKYRVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFK  775
             LPE+++ +   +ETF SS   FR+ FPRGFA E+++VYS PP I ++FRHWG+ +GPFK
Sbjct  119  PLPEEFQYYKAEEETFESSHDAFRSCFPRGFAWEVIEVYSPPPLIAFKFRHWGFFEGPFK  178

Query  776  GHPPTGEIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEA---------  928
             H PTGE+ +F G+   ++D ES ++ +AE+++D  EL G L+KG    E+         
Sbjct  179  SHSPTGELVQFSGLATLKVD-ESLRVEEAEVYYDPAELFGGLLKGKLLSESQTKDNVKED  237

Query  929  -ATSSACPFMK  958
             A S  CPF K
Sbjct  238  LAASVGCPFFK  248



>gb|EPS67398.1| hypothetical protein M569_07377, partial [Genlisea aurea]
Length=211

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 154/213 (72%), Gaps = 6/213 (3%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWRSGP-PSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            DKYR Y + +   N  WRSG  P+Y +V+ LFE+GR +VWP+GSLE++V++L+KTWEME+
Sbjct  1    DKYRLYTAPEIHNNRGWRSGSIPNYALVNSLFEQGRKNVWPDGSLEQRVEKLVKTWEMEM  60

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
            VH+  P ++KT+DP +F + +NG K   LE+   +GGSYN+  QTSLP + R+++P   +
Sbjct  61   VHQ--PLEFKTIDPNRFVVVINGTKSFKLEEIVAVGGSYNMLFQTSLPPEQRIYDPDRVS  118

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMG  820
               S A+F   FPRGFA+E+++VYS  P I Y+FRH+GY +G F GHP TGE+AEF+GM 
Sbjct  119  GDESNAIFSTVFPRGFALEVVKVYSDRPVIAYQFRHFGYFEGEFMGHPATGELAEFYGMA  178

Query  821  IFELD---EESNKIVKAELFFDRGELLGALVKG  910
            +F LD   E+S+ I+K E FFDRGE L AL KG
Sbjct  179  VFTLDPEIEDSDVILKIEFFFDRGEFLAALTKG  211



>gb|KGN53568.1| hypothetical protein Csa_4G082450 [Cucumis sativus]
Length=252

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/252 (48%), Positives = 166/252 (66%), Gaps = 22/252 (9%)
 Frame = +2

Query  260  MACSGTGG-------DKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSL  415
            MA  GT         DKYR +L   E  +  WR G PP+Y +V++LFEEGRT  WP+GSL
Sbjct  1    MATEGTSTTILPDLPDKYRVFL-HLEPPSISWRHGKPPTYGIVNQLFEEGRTKEWPKGSL  59

Query  416  EEKVQRLMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQT  595
            EE VQ  +K+WEME+ HK    D+ T++P KF+LFVNGR+GLS E+T +IG SYN FL++
Sbjct  60   EEIVQNAVKSWEMELSHKIKLQDFNTINPHKFKLFVNGREGLSGEETLRIG-SYNAFLKS  118

Query  596  SLPEKYRVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFK  775
             LPE+++ +   +ETF SS   FR+ FPRGFA E+++VYS PP I ++FRHWG+ +GPFK
Sbjct  119  PLPEEFQYYKAEEETFESSHDAFRSCFPRGFAWEVIEVYSPPPLIAFKFRHWGFFEGPFK  178

Query  776  GHPPTGEIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKG-----------GSSD  922
             H PTGE+ +F G+   ++D ES ++ +AE+++D  EL G L+KG              +
Sbjct  179  SHSPTGELVQFSGLATLKVD-ESLRVEEAEVYYDPAELFGGLLKGKITASESQTKDNVKE  237

Query  923  EAATSSACPFMK  958
            + A S  CPF K
Sbjct  238  DLAASVGCPFFK  249



>ref|NP_001077842.1| pathogenesis-related protein [Arabidopsis thaliana]
 gb|AEE36152.1| pathogenesis-related protein [Arabidopsis thaliana]
Length=235

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 158/233 (68%), Gaps = 17/233 (7%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            DKYR  L  ++    +WR   PP ++ V++LFEEG+T VWPEGSLEE VQ  +K+WEME 
Sbjct  8    DKYRSVL--EDAGQVQWRYDNPPDFNSVNQLFEEGQTKVWPEGSLEETVQNAIKSWEMEF  65

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
             HK    D+KT++P KF+LFVNG   LS E+T ++G SYN  L+ SLPE+++ + P +E+
Sbjct  66   SHKIRLQDFKTINPEKFKLFVNG---LSAEETLRLG-SYNALLKNSLPEEFQYYKPEEES  121

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMG  820
            F SS   FR+A PRGFA EIL VYSGPP I ++FRHWGY +G FKGH PTGE+ +F G+G
Sbjct  122  FESSHDAFRSALPRGFAWEILSVYSGPPVIAFKFRHWGYFEGTFKGHAPTGEMVQFLGLG  181

Query  821  IFELDEESNKIVKAELFFDRGELLGALVKG---------GSSDEAATSSACPF  952
            + ++D ES +  + E+++D GEL G L+KG          S D  A   +CPF
Sbjct  182  VLKVD-ESLRAEEIEIYYDPGELFGGLLKGPPISETKTTDSGDNTAEKQSCPF  233



>ref|XP_011083290.1| PREDICTED: pathogen-related protein-like [Sesamum indicum]
Length=248

 Score =   233 bits (594),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/237 (47%), Positives = 155/237 (65%), Gaps = 13/237 (5%)
 Frame = +2

Query  275  TGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWE  451
            T  DKYR +L  ++  NT WR G PP+Y  V+KLFEEGRT  W EGSLEE VQ +MK+W+
Sbjct  12   TAKDKYRSFLHHEDAHNTVWRRGAPPTYHNVNKLFEEGRTKEWAEGSLEETVQNMMKSWQ  71

Query  452  MEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPA  631
             E  HK    D++ + P KF+L VNGR+ LS E+T  +G SYN  L++S+P++++ +   
Sbjct  72   TEFTHKTRTQDFRIMHPEKFKLIVNGREALSAEETISLG-SYNSVLKSSMPDEFKYYKAH  130

Query  632  DETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFF  811
            +ETF S+   FRNA PRGFA E++ VYS PP IT++FRHWGY +GPFKGH PTGE+ + F
Sbjct  131  EETFDSADDAFRNALPRGFACEVVAVYSSPPVITFKFRHWGYFEGPFKGHAPTGEMVQLF  190

Query  812  GMGIFELDEESNKIVKAELFFDRGELLGALVKG------GSSDEAATSSA----CPF  952
            G+ I ++D E  +  + E+++D  EL   L+K        +  + A SS     CPF
Sbjct  191  GLVILKVD-ELMRAEEVEIYYDPAELFAPLLKAPLISGPNTEQQGAASSTSPQKCPF  246



>gb|KDP34788.1| hypothetical protein JCGZ_10568 [Jatropha curcas]
Length=203

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 142/184 (77%), Gaps = 3/184 (2%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            DKYR +L  DE + T+WR  GPPSYD V++LFEEGRT  WP+GS+EE VQ  +K+WEME+
Sbjct  14   DKYRSFL-HDEAETTEWRHGGPPSYDSVNQLFEEGRTKEWPKGSVEEIVQNAIKSWEMEL  72

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
             HK    D+KT++P KF+L VNGR+GLS EDT +IG SYN  L++SLP++ + +   +ET
Sbjct  73   SHKTRLQDFKTINPQKFKLIVNGREGLSAEDTLRIG-SYNALLKSSLPDELKYYKAEEET  131

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMG  820
            F SS   FR+AFPRGFA E+L VYSGPP IT++FRHWG+ +GPFKGH PTG+  EFFG+G
Sbjct  132  FESSHEAFRSAFPRGFAWEVLNVYSGPPVITFKFRHWGFFEGPFKGHAPTGQKVEFFGVG  191

Query  821  IFEL  832
            + ++
Sbjct  192  VLKV  195



>gb|EMT20632.1| hypothetical protein F775_13667 [Aegilops tauschii]
Length=261

 Score =   231 bits (590),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 120/253 (47%), Positives = 163/253 (64%), Gaps = 24/253 (9%)
 Frame = +2

Query  263  ACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLM  439
            A   +GGDKYR +L+ +  KNT WR G PP+YD V+ LFE GRT  W +GSLEE VQ  +
Sbjct  5    AGDSSGGDKYRSHLAGEGEKNTVWRHGAPPTYDAVNSLFEAGRTQEWAKGSLEETVQNAI  64

Query  440  KTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRV  619
            KTWEME+ HKA   D+K++ P +F L VNG + L+ E+T  +G SYN  L + +      
Sbjct  65   KTWEMELSHKARIGDFKSVSPGRFTLSVNGGRALTGEETLAMG-SYNALLASPILPGTGA  123

Query  620  FNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEI  799
            ++ A ETF SS  +FR+AFPRGFA E+++VYSGPP I ++FRHWG+M+GP+KGH PTG+ 
Sbjct  124  YDAAAETFESSHDLFRSAFPRGFAWEVVKVYSGPPVIAFKFRHWGHMEGPYKGHAPTGDK  183

Query  800  AEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKG------------GSSDEAATSS-  940
             EF+G+ + ++DE+  +    E+F+D GELL  L+KG            G   EAAT S 
Sbjct  184  VEFYGVAVLKVDEQL-RAEDVEVFYDPGELLAGLIKGPKEEDEEAAALAGRLREAATVSA  242

Query  941  --------ACPFM  955
                    ACPF+
Sbjct  243  SGADAQPQACPFL  255



>gb|EAZ11244.1| hypothetical protein OsJ_01098 [Oryza sativa Japonica Group]
Length=221

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 126/241 (52%), Positives = 159/241 (66%), Gaps = 28/241 (12%)
 Frame = +2

Query  260  MACSGT----GGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEK  424
            MA +G     GGDKYR ++  +  K+T WR G PP+YDVV+KLFEE RT  WPEGSLEEK
Sbjct  1    MAAAGEEASGGGDKYRSFMYGEGEKDTVWRLGSPPNYDVVNKLFEEERTKEWPEGSLEEK  60

Query  425  VQRLMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLP  604
            VQRL+KTWEME+VHK                   G + L+ +D   IG SYN FLQT LP
Sbjct  61   VQRLLKTWEMELVHK-------------------GMRFLNRKDLMAIG-SYNAFLQTKLP  100

Query  605  EKYRVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHP  784
             ++R+++P  ET  S  A F  AFPRGFAIE+L VYSGPPRI ++FRHWG+M+GPF  HP
Sbjct  101  PEHRIYDPDKETLESGMATFLTAFPRGFAIEVLDVYSGPPRIVFKFRHWGHMEGPFMEHP  160

Query  785  PTGEIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVK--GGSSDEAATSSACPFMK  958
            P GE  EFFG+ IF +DEE  K+ KAE F++RG  L + +     ++ +AA+ S CP M 
Sbjct  161  PHGERVEFFGICIFHVDEEM-KVEKAEFFYERGNFLASFLSAPAAAATDAASGSGCPVMG  219

Query  959  G  961
            G
Sbjct  220  G  220



>dbj|BAB63532.1| putative infection-related protein [Oryza sativa Japonica Group]
 gb|EAY75718.1| hypothetical protein OsI_03629 [Oryza sativa Indica Group]
Length=264

 Score =   231 bits (590),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 113/217 (52%), Positives = 152/217 (70%), Gaps = 3/217 (1%)
 Frame = +2

Query  263  ACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLM  439
            A   +GGDKYR +L+ D  KNT WR G PP++D V+ LFE  RT  WP GSLEE VQ  +
Sbjct  3    AADSSGGDKYRSHLAGDGEKNTVWRHGAPPTFDTVNSLFESERTQEWPAGSLEETVQNAI  62

Query  440  KTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRV  619
            KTWEME+ HKA   D+K++ P  FRL VNG + L+ E+T  +G SYN  L + +      
Sbjct  63   KTWEMELSHKARLQDFKSVSPGLFRLSVNGGRPLTGEETLAVG-SYNALLASPILPGAGA  121

Query  620  FNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEI  799
            ++ A ETF SS  +FR AFPRGFA E+++VYSGPP IT++FRHWG+MDGP+KGH PTG+ 
Sbjct  122  YDAAAETFESSHDLFRAAFPRGFAWEVIRVYSGPPVITFKFRHWGHMDGPYKGHAPTGDK  181

Query  800  AEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKG  910
             EF+G+ + ++DE+  +    E+++D GELLG L+KG
Sbjct  182  VEFYGVAVLKVDEQL-RAEDVEVYYDPGELLGDLLKG  217



>ref|XP_009801126.1| PREDICTED: pathogen-related protein [Nicotiana sylvestris]
Length=249

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/243 (47%), Positives = 164/243 (67%), Gaps = 20/243 (8%)
 Frame = +2

Query  275  TGGDKYRDYLSEDEVK---NTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMK  442
               DKYR +L E++     + +WR  GPP YD V+ LFE+GRT V  EGSLEE VQ  +K
Sbjct  10   VASDKYRKFLHEEQAAAAGSIQWRHGGPPIYDAVNNLFEQGRTKV-SEGSLEETVQNAIK  68

Query  443  TWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVF  622
            +WEME+ HK    D++T++P KF+LFVNGR+ LS E+T K+G SYN  L++S+PE+++ +
Sbjct  69   SWEMELSHKTRVKDFRTINPEKFKLFVNGREALSAEETLKLG-SYNALLKSSVPEEFKYY  127

Query  623  NPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIA  802
               +E+F SS   FR+AFPRGFA E++ VY+GPP +T++FRHWG+ +GPFKGH PTG++ 
Sbjct  128  KADEESFESSHDAFRSAFPRGFAWEVINVYTGPPVVTFKFRHWGFFEGPFKGHAPTGDMV  187

Query  803  EFFGMGIFELDEESNKIVKAELFFDRGELLGALVKG------------GSSDEAATSSAC  946
            +F+G+G+ ++D ES +    E+++D  EL   L+KG             S+D  AT   C
Sbjct  188  QFYGVGLMKVD-ESLRAEDVEIYYDPAELFSGLLKGPPISESNIQQQEHSNDNTATQQ-C  245

Query  947  PFM  955
            P+ 
Sbjct  246  PYQ  248



>emb|CDM84089.1| unnamed protein product [Triticum aestivum]
Length=261

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/253 (47%), Positives = 162/253 (64%), Gaps = 24/253 (9%)
 Frame = +2

Query  263  ACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLM  439
            A   +GGDKYR +L+ +  KNT WR G PP+YD V+ LFE GRT  W +GSLEE VQ  +
Sbjct  5    AGDSSGGDKYRSHLAGEGEKNTVWRHGAPPTYDAVNSLFEAGRTQEWAKGSLEEVVQNAI  64

Query  440  KTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRV  619
            KTWEME+ HKA   D+K++ P +F L VNG + L+ E+T  +G SYN  L + +      
Sbjct  65   KTWEMELSHKARIEDFKSVSPGRFTLSVNGGRALTGEETLAMG-SYNALLASPILPGTGA  123

Query  620  FNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEI  799
            ++   ETF SS  +FR+AFPRGFA E+++VYSGPP I ++FRHWG+M+GP+KGH PTG+ 
Sbjct  124  YDATAETFESSHDLFRSAFPRGFAWEVVKVYSGPPVIAFKFRHWGHMEGPYKGHAPTGDK  183

Query  800  AEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKG------------GSSDEAATSS-  940
             EF+G+ + ++DE+  +    E+F+D GELL  L+KG            G   EAAT S 
Sbjct  184  VEFYGVAVLKVDEQL-RAEDVEVFYDPGELLAGLIKGPKEEDEAAAALAGRLREAATVSA  242

Query  941  --------ACPFM  955
                    ACPF+
Sbjct  243  SGADAQPQACPFL  255



>gb|KDO46952.1| hypothetical protein CISIN_1g043189mg, partial [Citrus sinensis]
Length=182

 Score =   225 bits (573),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 142/184 (77%), Gaps = 3/184 (2%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            DKYR  L+E E K+T+WR  GPP +D V+KLFEEGRT  WP+GS+EE VQ  +K+WEME+
Sbjct  1    DKYRSILNE-EAKSTQWRHGGPPIFDKVNKLFEEGRTKEWPKGSIEETVQNAVKSWEMEL  59

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
             HK   ND+KT++P KF+L VNGRK LS E+T ++G SYN  L+ SLP++++ +   +ET
Sbjct  60   SHKTSLNDFKTINPEKFKLIVNGRKDLSGEETLQLG-SYNALLKNSLPKEFQYYRADEET  118

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMG  820
            F SS   FR+AFPRGFA E++ V+SGPP + Y+FRHWGY +GPF+GH PTGE+ EF+G+G
Sbjct  119  FKSSHDAFRSAFPRGFAWEVISVFSGPPVVAYKFRHWGYFEGPFQGHAPTGEMVEFYGIG  178

Query  821  IFEL  832
            I ++
Sbjct  179  IMKV  182



>ref|XP_010261152.1| PREDICTED: pathogen-related protein-like [Nelumbo nucifera]
Length=190

 Score =   223 bits (569),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 135/178 (76%), Gaps = 2/178 (1%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            DKYR ++  +  K TKWR G PP+YD+VD+LFEEGRT  W +GSLEEKVQ L+KTWEMEI
Sbjct  14   DKYRSHMYGEGEKYTKWRFGAPPNYDLVDRLFEEGRTQEWSKGSLEEKVQNLVKTWEMEI  73

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
            +HK  P DYK+++  KF   VNG K +S  +T+K+G SYN+FLQTS+P+    ++P+ E 
Sbjct  74   IHKISPEDYKSINVEKFTFSVNGGKPMSRSETSKLG-SYNLFLQTSMPKHLLEYDPSVEM  132

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFG  814
              SSQ VF   FPRGFA+EILQVYSGPP I Y+FRHW +M+GPFKGH PTGE  EFFG
Sbjct  133  PESSQQVFVATFPRGFALEILQVYSGPPAIVYKFRHWAFMEGPFKGHAPTGEKVEFFG  190



>ref|XP_002528474.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33891.1| conserved hypothetical protein [Ricinus communis]
Length=195

 Score =   223 bits (569),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 142/187 (76%), Gaps = 3/187 (2%)
 Frame = +2

Query  275  TGGDKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWE  451
            T GDKYR +L  DE + T+WR  GPP+YD V++LFEEGR+  WP+GSLEE VQ  +K+WE
Sbjct  11   TTGDKYRSFLY-DEAETTQWRDGGPPNYDSVNQLFEEGRSEEWPKGSLEEIVQNAIKSWE  69

Query  452  MEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPA  631
            ME+ HK    D+KT++P KF+L VNGRKGLS E+T +I GSYN  L++S+P++ + +   
Sbjct  70   MELSHKTCLQDFKTINPDKFKLIVNGRKGLSAEETLRI-GSYNALLKSSMPKELQYYKAD  128

Query  632  DETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFF  811
            +E+F SS   FR A PRGFA E++ VYSGPP IT++FRHWG+ +GPFKGH PTGE  +F+
Sbjct  129  EESFESSHEAFRLALPRGFAWEVISVYSGPPVITFKFRHWGFFEGPFKGHAPTGEKVQFY  188

Query  812  GMGIFEL  832
            G+G+ ++
Sbjct  189  GLGVLKV  195



>ref|NP_001044148.1| Os01g0731100 [Oryza sativa Japonica Group]
 dbj|BAB63531.1| putative infection-related protein [Oryza sativa Japonica Group]
 dbj|BAF06062.1| Os01g0731100 [Oryza sativa Japonica Group]
 gb|EAZ13431.1| hypothetical protein OsJ_03350 [Oryza sativa Japonica Group]
 dbj|BAG87951.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97522.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG98724.1| unnamed protein product [Oryza sativa Japonica Group]
Length=266

 Score =   223 bits (568),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 116/260 (45%), Positives = 158/260 (61%), Gaps = 28/260 (11%)
 Frame = +2

Query  263  ACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLM  439
            A   +GGD+YR +L+ D  KNT WR G PP+YD V+ LFE  RT  WP GSLEE VQ  +
Sbjct  5    AADSSGGDRYRSHLTGDGEKNTVWRHGAPPTYDAVNSLFEAERTQEWPAGSLEETVQNAI  64

Query  440  KTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRV  619
            KTWEME+ +KA   D+K++ P +FRL VNG + L+ E+T  +G SYN  L + +      
Sbjct  65   KTWEMELSYKAKLEDFKSVSPGRFRLSVNGGRPLTGEETLAVG-SYNALLTSPILPGAGA  123

Query  620  FNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEI  799
            ++ A ETF SS  +FR AFPRGFA E+++VYSGPP IT++FRHWG+MDGP+KGH PTG+ 
Sbjct  124  YDAAAETFESSHDLFRAAFPRGFAWEVIRVYSGPPVITFKFRHWGHMDGPYKGHAPTGDK  183

Query  800  AEFFGMGIFELDEESNKIVKAELFFD-------------------------RGELLGALV  904
             EF+G+ + ++DE+  +    E+++D                          GE LG   
Sbjct  184  VEFYGVAVLKVDEQL-RAEDVEVYYDPGELLGGLLKGPLLVPSAEEEDARQLGERLGEAA  242

Query  905  KGGSSDEAATSSACPFMKGA  964
               +S  A  S ACPF+  A
Sbjct  243  IVSASGAAPQSQACPFLASA  262



>ref|XP_011007920.1| PREDICTED: pathogen-related protein-like isoform X2 [Populus 
euphratica]
Length=197

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 139/191 (73%), Gaps = 2/191 (1%)
 Frame = +2

Query  263  ACSGTGGDKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLM  439
            A     GDKYR +L ++    T+WR  GPP YD V++LFEEGRT  WP+GSLEE VQ  +
Sbjct  5    ALVKKAGDKYRSFLHDEGENITQWRHGGPPIYDSVNQLFEEGRTKEWPKGSLEEVVQNAI  64

Query  440  KTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRV  619
            K+WEME+ HK    D+KT++P KF+L VNGR+GLS E+T +IG SYN  L+ SLP++++ 
Sbjct  65   KSWEMELSHKTRLQDFKTINPDKFKLIVNGREGLSGEETLRIG-SYNALLKNSLPKEFQY  123

Query  620  FNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEI  799
            +   +ETF SS   FR+A PRGFA E+L VYSGPP I+++FRHWG+ +GPFKGH PT E 
Sbjct  124  YKADEETFESSHDAFRSALPRGFAWEVLSVYSGPPVISFKFRHWGFFEGPFKGHAPTEEK  183

Query  800  AEFFGMGIFEL  832
             EF+G G+ ++
Sbjct  184  VEFYGFGVLKV  194



>gb|EAY75716.1| hypothetical protein OsI_03627 [Oryza sativa Indica Group]
Length=266

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/260 (45%), Positives = 158/260 (61%), Gaps = 28/260 (11%)
 Frame = +2

Query  263  ACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLM  439
            A   +GGD+YR +L+ D  KNT WR G PP+YD V+ LFE  RT  WP GSLEE VQ  +
Sbjct  5    AADSSGGDRYRSHLTGDGEKNTVWRHGAPPTYDAVNSLFEAERTQEWPAGSLEETVQNAI  64

Query  440  KTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRV  619
            KTWEME+ HKA   D+K++ P +FRL VNG + L+ E+T  +G SYN  L + +      
Sbjct  65   KTWEMELSHKAKLEDFKSVSPGRFRLSVNGGRPLTGEETLAVG-SYNALLTSPILPGAGA  123

Query  620  FNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEI  799
            ++ A ETF SS  +FR AFPRGFA E+++VYSGPP IT++FRHWG+MDGP+KGH PTG+ 
Sbjct  124  YDAAAETFESSHDLFRAAFPRGFAWEVIRVYSGPPVITFKFRHWGHMDGPYKGHAPTGDK  183

Query  800  AEFFGMGIFELDEESNKIVKAELFFD-------------------------RGELLGALV  904
             EF+G+ + ++DE+  +    E+++D                          GE LG   
Sbjct  184  VEFYGVAVLKVDEQL-RAEDVEVYYDPGELLGGLLKGPLLVPSAEEEDARQLGERLGEAA  242

Query  905  KGGSSDEAATSSACPFMKGA  964
               +S  A  S ACPF+  A
Sbjct  243  VVSASGAAPQSQACPFLASA  262



>gb|AEM42990.1| pathogen-related protein [Siraitia grosvenorii]
Length=284

 Score =   222 bits (565),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 114/236 (48%), Positives = 157/236 (67%), Gaps = 16/236 (7%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            DKYR  L   E     WR G PP+Y  V++LFEEGRT  W +GSLEE VQ  +K W+ME 
Sbjct  47   DKYRSSL-HLEHPTVHWRHGKPPTYHSVNQLFEEGRTKEWAKGSLEETVQNAVKLWQMEF  105

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
             +KA   D+KT++  KF++ VNGR+GLS E+T K+G S+N  L++SLPE+++ F    ET
Sbjct  106  NNKARLQDFKTINHEKFKIHVNGREGLSGEETVKLG-SFNALLKSSLPEEFQFFKAEKET  164

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMG  820
            F SS A F + FPRGF  E++QVYSGPP I ++FRHWG+ +GP+KGH PTGE+ +FFG+ 
Sbjct  165  FESSHADFGSCFPRGFPWEVIQVYSGPPLIIFKFRHWGFFEGPYKGHQPTGELIQFFGLV  224

Query  821  IFELDEESNKIVKAELFFDRGELLGALVKGGSSD------------EAATSSACPF  952
            I ++D ES ++ + E+++D  EL G L+KG  +D            + A S  CPF
Sbjct  225  ILKVD-ESLRVEEVEIYYDPAELFGKLLKGKKTDSESKTKTKDNEKDEAPSVGCPF  279



>ref|XP_010244014.1| PREDICTED: pathogen-related protein-like isoform X2 [Nelumbo 
nucifera]
Length=214

 Score =   219 bits (557),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 116/231 (50%), Positives = 146/231 (63%), Gaps = 43/231 (19%)
 Frame = +2

Query  281  GDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEME  457
            GDKYR ++  +  KNTKWR G PP+YDVV+KLFEEGRT  WP GSLEE+VQ L+KTWEME
Sbjct  13   GDKYRSHIYGEGEKNTKWRFGAPPNYDVVNKLFEEGRTQEWPNGSLEERVQNLVKTWEME  72

Query  458  IVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADE  637
            +VHK DP DYKT++ T F + +NG K L L                              
Sbjct  73   LVHKMDPADYKTVNTTNFTISINGGKPLLL------------------------------  102

Query  638  TFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGM  817
                 Q  F   FPRGFA+EILQVYSGPP I Y+FRHW +M+GPFKGH PTGE+A+F G+
Sbjct  103  -----QEAFITTFPRGFAVEILQVYSGPPVIAYKFRHWAFMEGPFKGHAPTGEMAQFHGI  157

Query  818  GIFELDEESNKIVKAELFFDRGELLGALVKGGSSDE------AATSSACPF  952
            GIF +DE   ++ K E F+D  ELL +LVK   S++      +++S+ CPF
Sbjct  158  GIFHVDEMM-RVEKVEFFYDPNELLASLVKSPLSNDSEASTNSSSSAGCPF  207



>ref|XP_010537722.1| PREDICTED: pathogen-related protein isoform X3 [Tarenaya hassleriana]
Length=195

 Score =   218 bits (554),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 140/194 (72%), Gaps = 10/194 (5%)
 Frame = +2

Query  395  VWPEGSLEEKVQRLMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGS  574
            VWPEGSLEE VQ  +K+WEME+ HK    D+KT++P KF+LFVNGR+GLS E+T ++G S
Sbjct  2    VWPEGSLEETVQNAIKSWEMELSHKIHLQDFKTINPEKFKLFVNGREGLSAEETLELG-S  60

Query  575  YNVFLQTSLPEKYRVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWG  754
            YN  L+ SLP++++ +   +ETF SS  VFR+AFPRGFA E+L VYSGPP I Y+FRHWG
Sbjct  61   YNALLKNSLPKEFQYYKAEEETFESSHDVFRSAFPRGFAWEVLAVYSGPPTIAYKFRHWG  120

Query  755  YMDGPFKGHPPTGEIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKG--------  910
            Y +GP+KGH PTGE+ EF G+G+ ++D ES +  + E+++D GEL G L+KG        
Sbjct  121  YFEGPYKGHAPTGEMVEFVGLGVLKVD-ESLRAEEVEIYYDPGELFGGLLKGPPLPETKT  179

Query  911  GSSDEAATSSACPF  952
              S E +   +CPF
Sbjct  180  TDSTEYSGKQSCPF  193



>ref|XP_003569732.1| PREDICTED: pathogen-related protein-like [Brachypodium distachyon]
Length=264

 Score =   220 bits (560),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 113/255 (44%), Positives = 160/255 (63%), Gaps = 26/255 (10%)
 Frame = +2

Query  263  ACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLM  439
            A   +GGD+YR +L+ +  KNT WR G PP+YD V+ LFE  RT  W +GSLEE VQ  +
Sbjct  6    AGDSSGGDRYRSHLAGEGEKNTLWRHGAPPTYDAVNSLFEAERTQEWAKGSLEETVQNAI  65

Query  440  KTWEMEIVHKADPNDYKTLDPT--KFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKY  613
            KTWEME+ HKA   D+K++ P   +FRL VNG + L+ E+T  +G SYN  L   +    
Sbjct  66   KTWEMELSHKARLGDFKSVSPAPGRFRLSVNGGRALTGEETLAMG-SYNALLSGPILPGA  124

Query  614  RVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTG  793
              ++ A ETF SS  +FR+AFPRGFA E+++VYSGPP I ++FRHWG+M+GPFKGH PTG
Sbjct  125  GAYDAAAETFESSHELFRSAFPRGFAWEVVKVYSGPPVIAFKFRHWGHMEGPFKGHAPTG  184

Query  794  EIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKG---------------------  910
            +  EF G+ + ++DE+  +    E+++D GELL  L+KG                     
Sbjct  185  DKVEFSGVAVLKVDEQL-RAEDVEVYYDPGELLAGLLKGPKEEAEVAALAARLGEAAAVS  243

Query  911  GSSDEAATSSACPFM  955
            GS  +  + ++CP++
Sbjct  244  GSGADGQSPASCPYL  258



>ref|XP_006646291.1| PREDICTED: pathogen-related protein-like [Oryza brachyantha]
Length=265

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/253 (45%), Positives = 154/253 (61%), Gaps = 28/253 (11%)
 Frame = +2

Query  275  TGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWE  451
            + GDKYR +L+ D  KNT WR G PP+++ V+ LFE  RT  WP GSLEE VQ  +KTWE
Sbjct  7    SAGDKYRSHLAGDGEKNTVWRHGAPPTFEAVNSLFEAERTQEWPAGSLEETVQNAIKTWE  66

Query  452  MEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPA  631
            ME+ HKA   D+K++ P  FRL VNG + L+ E+T  +G SYN  L + +      ++ A
Sbjct  67   MELSHKARLEDFKSVSPGLFRLSVNGGRALTGEETLAVG-SYNALLTSPILPGAGAYDAA  125

Query  632  DETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFF  811
             ETF SS  +FR AFPRGFA E+++VYSGPP IT++FRHWG+MDGP+KGH PTG+  EF+
Sbjct  126  AETFESSHDLFRAAFPRGFAWEVIRVYSGPPVITFKFRHWGHMDGPYKGHAPTGDKVEFY  185

Query  812  GMGIFELDEESNKIVKAELFFD-------------------------RGELLGALVKGGS  916
            G+ + ++DE+  +    E+++D                           E LGA     +
Sbjct  186  GVAVLKVDEQL-RAEDVEVYYDPGELLGGLLKGPLLAPSAEEGATRQLAERLGAATVQSA  244

Query  917  SDEAATSSACPFM  955
            S  A  S ACPF+
Sbjct  245  SGTAPKSQACPFL  257



>emb|CBI19978.3| unnamed protein product [Vitis vinifera]
Length=172

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 125/172 (73%), Gaps = 6/172 (3%)
 Frame = +2

Query  452  MEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPA  631
            ME+ HK    D+K++DP K+   +NGRK LSLE+  K+GG YN  LQTSLPEK+R +NP 
Sbjct  1    MEMFHKVKMEDFKSVDPNKYTFSLNGRKPLSLEEKRKLGGGYNPLLQTSLPEKFRAYNPD  60

Query  632  DETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFF  811
             ET +SS   F  AFPRGFA+EILQVYSGPP I Y+FRHWGYM+GPFKGH PTGE  E F
Sbjct  61   GETAISSHLAFTTAFPRGFALEILQVYSGPPVILYKFRHWGYMEGPFKGHAPTGERIEVF  120

Query  812  GMGIFELDEESNKIVKAELFFDRGELLGALVKG---GSSDEAATSSACPFMK  958
            GM IFE DE S KIVK E F+DRGELLG L+K    GS D  AT S CP ++
Sbjct  121  GMAIFEQDEHS-KIVKVEFFYDRGELLGGLLKAVSDGSMD--ATPSNCPVLR  169



>ref|XP_001770220.1| predicted protein [Physcomitrella patens]
 gb|EDQ64895.1| predicted protein [Physcomitrella patens]
Length=246

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/233 (47%), Positives = 149/233 (64%), Gaps = 8/233 (3%)
 Frame = +2

Query  275  TGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWE  451
            T GD+YRD+L     + T WR G  P YDVV+ LFE+GRT VWP+GSLEE VQ L+KTWE
Sbjct  10   TAGDRYRDHLCGAGEERTAWRHGSAPQYDVVNALFEKGRTQVWPKGSLEEVVQNLVKTWE  69

Query  452  MEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTS-LPEKYRVFNP  628
            ME+ HK   +D+KT+D  KFR+ VNG   LS  +T ++G SYN  L TS +      +  
Sbjct  70   MELSHKIKVSDFKTIDQEKFRISVNGGPKLSAAETLQVG-SYNALLATSSVNGDDATYQA  128

Query  629  ADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEF  808
            + ETF SS  +FR AFP GFA E+  VYS PP +  +FRHWG M+GPFKGH PTG + + 
Sbjct  129  SKETFESSHDIFRTAFPGGFAWEVQAVYSPPPVVVMKFRHWGVMEGPFKGHAPTGAVVDS  188

Query  809  FGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAAT----SSACPFM  955
             G+ + ++D E+ KIV+ E+++D    LG L KG  ++        +  CP++
Sbjct  189  IGICVAKVD-ENLKIVELEVYYDSAAFLGGLTKGPKAESYTVYQKGTEGCPYL  240



>gb|EMS61562.1| hypothetical protein TRIUR3_07764 [Triticum urartu]
Length=207

 Score =   214 bits (545),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 116/235 (49%), Positives = 151/235 (64%), Gaps = 33/235 (14%)
 Frame = +2

Query  266  CSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMK  442
             S  GGDKYR +L  +  KNT WR G PP+YD+V+KLFE+ RT  W EGS+EE+VQRL+K
Sbjct  2    ASAEGGDKYRSFLHGEGEKNTVWRHGAPPNYDLVNKLFEDERTKEWAEGSVEERVQRLLK  61

Query  443  TWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVF  622
            TWEME+VHK                 V G             G YN FL T+LP ++R++
Sbjct  62   TWEMELVHKE----------------VRGM------------GGYNAFLATTLPPEHRIY  93

Query  623  NPADETFVSSQAVFRNAFPRGFAIEILQVYSGP--PRITYRFRHWGYMDGPFKGHPPTGE  796
            +P  ET  S+ A F  AFPRGFAIE+L VYSGP  PRI ++FRHWG+M+GPFKGHPP G 
Sbjct  94   DPDAETVESATATFLTAFPRGFAIEVLDVYSGPPNPRIAFKFRHWGHMEGPFKGHPPHGR  153

Query  797  IAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSSACPFMKG  961
              EFFG+ +F +DE++ K+ KAE F++RG  L + +       AA++S CP M+G
Sbjct  154  RVEFFGVCVFHVDEDT-KVEKAEFFYERGNFLASFLS-APPAAAASASGCPVMRG  206



>ref|XP_006356343.1| PREDICTED: pathogen-related protein-like [Solanum tuberosum]
Length=262

 Score =   215 bits (548),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 118/144 (82%), Gaps = 4/144 (3%)
 Frame = +2

Query  527  GRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADETFVSSQAVFRNAFPRGFAIEILQ  706
            GRKGL+  ++AK+GGSYN+FLQTSLPE  R +NP D+TF SSQ +FR+ F RGFAIEIL 
Sbjct  123  GRKGLTPAESAKLGGSYNIFLQTSLPENVRFYNPDDQTFESSQNLFRSIFLRGFAIEILH  182

Query  707  VYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMGIFELDEESNKIVKAELFFDRGE  886
            VYSGPP I Y+FRHWGYMD PFKGH PTG++ E FG+G FELD+ESNKI+KA++FFDRGE
Sbjct  183  VYSGPPGIVYKFRHWGYMDAPFKGHAPTGQLVELFGIGTFELDKESNKIIKADMFFDRGE  242

Query  887  LLGALVKGGSSDEAATSSACPFMK  958
            LLG LVKG    E+  +S CPFMK
Sbjct  243  LLGGLVKG----ESNVASTCPFMK  262



>gb|EMS45310.1| hypothetical protein TRIUR3_18487 [Triticum urartu]
Length=291

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 120/291 (41%), Positives = 167/291 (57%), Gaps = 58/291 (20%)
 Frame = +2

Query  260  MACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRL  436
            MA + TGGDKYR ++  +  KNT WR G PP+YD+V+KLFEE RT  WP+GSLEEKVQRL
Sbjct  1    MASTETGGDKYRSFMHGEGEKNTVWRHGAPPNYDIVNKLFEEERTKEWPDGSLEEKVQRL  60

Query  437  MKTWEMEIVHKADPND-----------------------------------------YKT  493
            +KTWEME++HK  P+D                                         ++ 
Sbjct  61   LKTWEMEMIHKVRPDDQRSVHSQGFTASTNGMKPLTRKEWTAIGGYNAFLATKLPPEHRI  120

Query  494  LDPTK------FRLFVNG-RKGLSLEDTAKIGGSYNV--------FLQTSLPEKYRVFNP  628
             DP K         F+    +G ++E      G   V        +++ +LP ++R+++P
Sbjct  121  YDPDKETVDSGMSTFLTAFPRGFAIEVLDVYSGPPRVAFKFRHWGYMEGALPPEHRIYDP  180

Query  629  ADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEF  808
              ET  S  + F  AFPRGFAIE+L VY GPPR+ ++FRHWGYM+GPFKGHPP G+  EF
Sbjct  181  DKETVDSGMSTFLTAFPRGFAIEVLDVYGGPPRVAFKFRHWGYMEGPFKGHPPHGQRVEF  240

Query  809  FGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSSACPFMKG  961
            FG+ +F +DEE  K+ KAE F++RG  L + +   ++  AA++S CP M+G
Sbjct  241  FGVCVFHVDEEM-KVEKAEYFYERGNFLASFLSAPATAAAASASGCPVMRG  290



>ref|XP_007021805.1| Pathogenesis-related family protein isoform 3, partial [Theobroma 
cacao]
 gb|EOY13330.1| Pathogenesis-related family protein isoform 3, partial [Theobroma 
cacao]
Length=187

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 131/178 (74%), Gaps = 3/178 (2%)
 Frame = +2

Query  266  CSGTGGDKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMK  442
             S  G DKYR +L  D+  + +WR  GPP+YD V++LFEEGRT  WPEGSLEE VQ  +K
Sbjct  2    ASVPGRDKYRSFL-HDDADSVQWRHGGPPTYDAVNQLFEEGRTKEWPEGSLEETVQNAIK  60

Query  443  TWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVF  622
            TWEMEI HK    D K+++P KF+L VNGR+GL+ E+T K+ G+YN  L+ SLP++++ +
Sbjct  61   TWEMEISHKVRLQDIKSINPEKFKLIVNGREGLTGEETLKL-GTYNALLKNSLPKEFQYY  119

Query  623  NPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGE  796
               +ETF SS  VFR+AFPRGFA E++ VYSGPP I ++FRHWG   GPFKGH PTGE
Sbjct  120  KVDEETFESSHEVFRSAFPRGFAWEVISVYSGPPLIAFKFRHWGIFQGPFKGHAPTGE  177



>ref|XP_004137234.1| PREDICTED: pathogen-related protein-like [Cucumis sativus]
Length=247

 Score =   212 bits (540),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 112/252 (44%), Positives = 158/252 (63%), Gaps = 27/252 (11%)
 Frame = +2

Query  260  MACSGTGG-------DKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSL  415
            MA  GT         DKYR +L   E  +  WR G PP+Y +V++LFEEGRT  WP+GSL
Sbjct  1    MATEGTSTTILPDLPDKYRVFL-HLEPPSISWRHGKPPTYGIVNQLFEEGRTKEWPKGSL  59

Query  416  EEKVQRLMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQT  595
            EE VQ  +K+WEME+ HK    D+         +++ GR+GLS E+T +IG SYN FL++
Sbjct  60   EEIVQNAVKSWEMELSHKIKLQDFNNT-----HIYIAGREGLSGEETLRIG-SYNAFLKS  113

Query  596  SLPEKYRVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFK  775
             LPE+++ +   +ETF SS   FR+ FPRGFA E+++VYS PP I ++FRHWG+ +GPFK
Sbjct  114  PLPEEFQYYKAEEETFESSHDAFRSCFPRGFAWEVIEVYSPPPLIAFKFRHWGFFEGPFK  173

Query  776  GHPPTGEIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKG-----------GSSD  922
             H PTGE+ +F G+   ++D ES ++ +AE+++D  EL G L+KG              +
Sbjct  174  SHSPTGELVQFSGLATLKVD-ESLRVEEAEVYYDPAELFGGLLKGKITASESQTKDNVKE  232

Query  923  EAATSSACPFMK  958
            + A S  CPF K
Sbjct  233  DLAASVGCPFFK  244



>gb|ABD32938.2| Pathogen-related protein, related [Medicago truncatula]
Length=202

 Score =   210 bits (535),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 105/224 (47%), Positives = 145/224 (65%), Gaps = 32/224 (14%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            DKYR  L  DE +N  WR  GPP+Y +V++LFEEGRT VWPEGSLEE VQ  +K+WEME+
Sbjct  8    DKYRSIL-HDEAENIHWRHGGPPTYGLVNQLFEEGRTKVWPEGSLEETVQNAIKSWEMEL  66

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
             HK    D+KT+ P KF+LFVN                          E ++ +   +ET
Sbjct  67   SHKIRLQDFKTIVPEKFKLFVN--------------------------ENFKPYKSNEET  100

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMG  820
            F SS  VF++AFPRGFA E+++VY+GPP I ++FRHWG+ +GPFKGH PTG++ +FFG+G
Sbjct  101  FESSHEVFKSAFPRGFAWEVIKVYTGPPEIAFKFRHWGFFEGPFKGHSPTGKMVQFFGLG  160

Query  821  IFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSSACPF  952
              ++D ++ K+ + E+++D  ELLG L+  G   +    SACPF
Sbjct  161  TLKVD-DALKVEEVEIYYDPAELLGGLLTSGDGTQI---SACPF  200



>ref|XP_004137235.1| PREDICTED: pathogen-related protein-like [Cucumis sativus]
 gb|KGN53567.1| hypothetical protein Csa_4G082440 [Cucumis sativus]
Length=254

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 150/214 (70%), Gaps = 4/214 (2%)
 Frame = +2

Query  281  GDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEME  457
            GD++R  L   E  + +WR G PP+Y   ++LFE+GRT  WPEGSLEE VQ  +K+W+ME
Sbjct  19   GDRFRKSL-HLEHPSVEWRYGKPPTYASANQLFEQGRTKEWPEGSLEETVQNAVKSWQME  77

Query  458  IVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADE  637
            I +KA   D+ T++P KF+LFVNGR+GL+ E+  +IG S+N  L++SLP++++ +   +E
Sbjct  78   INNKARLQDFNTINPHKFKLFVNGREGLAGEEVLRIG-SFNAMLKSSLPKEFQFYKAEEE  136

Query  638  TFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGM  817
            T  S+   F+  FPRGFA E+++VYS PP I ++FRHWG+ +GP+K + PTGE+ +F+GM
Sbjct  137  THESAHNDFKTCFPRGFAWEVIEVYSPPPLIAFKFRHWGFFEGPYKSYSPTGELVQFYGM  196

Query  818  GIFELDEESNKIVKAELFFDRGELLGALVKGGSS  919
               ++D  S K+ +  +F+D  EL G ++KG  S
Sbjct  197  ATLKVD-SSMKVEEVHIFYDPTELFGGILKGKKS  229



>tpg|DAA57773.1| TPA: pathogen protein [Zea mays]
Length=256

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 142/206 (69%), Gaps = 3/206 (1%)
 Frame = +2

Query  263  ACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLM  439
            A   +GGD+YR +L+ +  K+T WR G PPSYD V+ LFE  RT  WP GSLEE VQ  +
Sbjct  5    AADSSGGDRYRSHLAGEGEKHTVWRHGAPPSYDAVNALFEAERTQEWPAGSLEEIVQNAI  64

Query  440  KTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRV  619
            KTWEME+ HKA  +D+K++ P +FRL VNG +  S E+T  +G SYN  L + L  +   
Sbjct  65   KTWEMELSHKARLSDFKSVSPGRFRLSVNGGRARSGEETLAVG-SYNALLDSPLLARAGA  123

Query  620  FNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEI  799
            ++ + ETF SS  +FR AFPRGFA E+L+VYSGPP + ++FRHWG+ +GP+KGH  TG+ 
Sbjct  124  YDASAETFRSSHDLFRAAFPRGFAWEVLKVYSGPPLLAFKFRHWGHKEGPYKGHAATGDK  183

Query  800  AEFFGMGIFELDEESNKIVKAELFFD  877
             EFFG+ + ++D+E  +    E+++D
Sbjct  184  VEFFGVAVLKVDDEL-RAEDVEVYYD  208



>ref|NP_001151686.1| pathogen-related protein [Zea mays]
 gb|ACG43888.1| pathogen-related protein [Zea mays]
Length=256

 Score =   208 bits (529),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 142/206 (69%), Gaps = 3/206 (1%)
 Frame = +2

Query  263  ACSGTGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLM  439
            A   +GGD+YR +L+ +  K+T WR G PPSYD V+ LFE  RT  WP GSLEE VQ  +
Sbjct  5    AADSSGGDRYRSHLAGEGEKHTVWRHGAPPSYDAVNALFEAERTQEWPAGSLEEIVQNAI  64

Query  440  KTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRV  619
            KTWEME+ HKA  +D+K++ P +FRL VNG +  S E+T  +G SYN  L + L  +   
Sbjct  65   KTWEMELSHKARLSDFKSVSPGRFRLSVNGGRARSGEETLAVG-SYNALLDSPLLARAGA  123

Query  620  FNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEI  799
            ++ + ETF SS  +FR AFPRGFA E+L+VYSGPP + ++FRHWG+ +GP+KGH  TG+ 
Sbjct  124  YDASAETFRSSHDLFRAAFPRGFAWEVLKVYSGPPLLAFKFRHWGHKEGPYKGHAXTGDK  183

Query  800  AEFFGMGIFELDEESNKIVKAELFFD  877
             +FFG+ + ++D+E  +    E+++D
Sbjct  184  VZFFGVAVLKVDDEL-RAEDVEVYYD  208



>ref|XP_004167654.1| PREDICTED: pathogen-related protein-like [Cucumis sativus]
Length=237

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/211 (46%), Positives = 149/211 (71%), Gaps = 4/211 (2%)
 Frame = +2

Query  281  GDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEME  457
            GD++R  L   E  + +WR G PP+Y   ++LFE+GRT  WPEGSLEE VQ  +K+W+ME
Sbjct  19   GDRFRKSL-HLEHPSVEWRYGKPPTYASANQLFEQGRTKEWPEGSLEETVQNAVKSWQME  77

Query  458  IVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADE  637
            I +KA   D+ T++P KF+LFVNGR+GL+ E+  +IG S+N  L++SLP++++ +   +E
Sbjct  78   INNKARLQDFNTINPHKFKLFVNGREGLAGEEVLRIG-SFNAMLKSSLPKEFQFYKAEEE  136

Query  638  TFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGM  817
            T  S+   F+  FPRGFA E+++VYS PP I ++FRHWG+ +GP+K + PTGE+ +F+GM
Sbjct  137  THESAHNDFKTCFPRGFAWEVIEVYSPPPLIAFKFRHWGFFEGPYKSYSPTGELVQFYGM  196

Query  818  GIFELDEESNKIVKAELFFDRGELLGALVKG  910
               ++D  S K+ +  +F+D  EL G ++KG
Sbjct  197  ATLKVD-SSMKVEEVHIFYDPTELFGGILKG  226



>gb|KDO38225.1| hypothetical protein CISIN_1g041144mg, partial [Citrus sinensis]
Length=201

 Score =   206 bits (523),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 107/219 (49%), Positives = 141/219 (64%), Gaps = 32/219 (15%)
 Frame = +2

Query  332  WR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEIVHKADPNDYKTLDPTK  508
            WR SGPP +D V+KLFEEGRT  WP+GS+EE VQ  +K+WEME+ HK   ND+KT++P K
Sbjct  1    WRHSGPPIFDKVNKLFEEGRTKEWPKGSIEETVQNAVKSWEMELSHKTSLNDFKTINPEK  60

Query  509  FRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADETFVSSQAVFRNAFPRGF  688
            F+L VNGRKGLS E++ ++ GSYN  L  S+          +ETF SS   FR+AFPRGF
Sbjct  61   FKLIVNGRKGLSREESLQL-GSYNALLNNSM----------EETFKSSHDAFRSAFPRGF  109

Query  689  AIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMGIFELDEESNKIVKAEL  868
            A E++ VYSGPP + Y+F+HWGY +GPF+GH PTGE+ EF    +++ D E       E+
Sbjct  110  AWELISVYSGPPMVAYKFKHWGYFEGPFQGHAPTGEMVEF----LWDWDYED-----VEI  160

Query  869  FFDRGELLGALVKG-----------GSSDEAATSSACPF  952
            ++   EL   L KG             S +A+TS  CPF
Sbjct  161  YYHPAELFAGLFKGPVLTPIAETQQNKSADASTSHYCPF  199



>ref|XP_004969846.1| PREDICTED: pathogen-related protein-like isoform X2 [Setaria 
italica]
Length=260

 Score =   205 bits (521),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 115/254 (45%), Positives = 153/254 (60%), Gaps = 28/254 (11%)
 Frame = +2

Query  275  TGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWE  451
            +GGD+YR +L+ +  KNT WR G PP+YD V+ LFE  RT  WP GSLEE VQ  +KTWE
Sbjct  4    SGGDRYRSHLAGEGEKNTVWRHGAPPTYDAVNALFEAERTQEWPAGSLEEVVQNAIKTWE  63

Query  452  MEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPA  631
            ME+ HKA  +D+K++ P +F L VNG +  S E+T  +G SYN  L + L      ++ A
Sbjct  64   MELSHKARLSDFKSVSPGRFTLSVNGGRARSGEETLAVG-SYNALLDSPLLASAGAYDAA  122

Query  632  DETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFF  811
             ETF SS  +FR AFPRGFA E+L VYSGPP I ++FRHWG+M+GP+KGH  TGE  EF 
Sbjct  123  AETFASSHDLFRAAFPRGFAWEVLGVYSGPPVIAFKFRHWGHMEGPYKGHAATGEKVEFR  182

Query  812  GMGIFELDEESNKIVKAELFFDRG----------------ELLGALVKGGSSDEAATSS-  940
            G+ + ++DE+  +    E+++D G                E  G +V      EAAT S 
Sbjct  183  GVAVLKVDEQL-RAEDVEVYYDPGELLGGLLKGPKVASSEEERGEVVLAERLSEAATVSA  241

Query  941  --------ACPFMK  958
                    ACPF+ 
Sbjct  242  SGADPPPRACPFLS  255



>ref|XP_008451759.1| PREDICTED: pathogen-related protein-like [Cucumis melo]
Length=254

 Score =   204 bits (518),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 149/214 (70%), Gaps = 10/214 (5%)
 Frame = +2

Query  281  GDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEME  457
            GDK+R  L   E    +WR G PP Y+  ++LFE+GRT  WPEGSLEE VQ  +K+W+ME
Sbjct  19   GDKFRKSL-HLEHPTVEWRYGKPPIYESANQLFEQGRTKEWPEGSLEETVQNAVKSWQME  77

Query  458  IVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADE  637
            I +KA   D+ T+DP KF+LFVNGR+GLS E+  +IG S+N  L+++LP++++ +   +E
Sbjct  78   INNKARLQDFNTIDPHKFKLFVNGREGLSGEEVLRIG-SFNSLLKSALPKEFQFYKAEEE  136

Query  638  TFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGM  817
            T  S+   F+  FPRGFA E+++VYS PP I  +FRHWG+ +GP+K + PTGE+ +F+GM
Sbjct  137  THESAHNDFKTCFPRGFAWEVIEVYSPPPLIALKFRHWGFFEGPYKSYSPTGELVQFYGM  196

Query  818  GIFELDEESNKIVKAE---LFFDRGELLGALVKG  910
               ++D     ++KAE   +++D  EL G+++KG
Sbjct  197  ATLKVD----SLMKAEEVHIYYDPTELFGSILKG  226



>ref|XP_002458446.1| hypothetical protein SORBIDRAFT_03g033680 [Sorghum bicolor]
 gb|EES03566.1| hypothetical protein SORBIDRAFT_03g033680 [Sorghum bicolor]
Length=270

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 137/202 (68%), Gaps = 3/202 (1%)
 Frame = +2

Query  275  TGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWE  451
            +GGD+YR +L+ D  K+T WR G PPSYD V+ LFE  RT  WP GSLEE VQ  +KTWE
Sbjct  12   SGGDRYRSHLAGDGEKHTVWRHGAPPSYDAVNALFEAERTQEWPAGSLEEVVQNAIKTWE  71

Query  452  MEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPA  631
            ME+ HKA  +D+K++ P KFRL VNG +  + E+T  +G SYN  L   L      ++ A
Sbjct  72   MELSHKARLSDFKSVSPGKFRLSVNGGRPRTGEETLAMG-SYNALLDGPLLPSAGAYDAA  130

Query  632  DETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFF  811
             ETF SS  +FR A PRGFA E+L+VYSGPP I ++FRHWG+ +GP+KGH  TG+  EF 
Sbjct  131  AETFQSSHDLFRAALPRGFAWEVLRVYSGPPLIAFKFRHWGHKEGPYKGHAATGDKVEFH  190

Query  812  GMGIFELDEESNKIVKAELFFD  877
            G+ + ++DE+  +    E+++D
Sbjct  191  GVAVLKVDEQL-RAEDVEVYYD  211



>dbj|BAJ88417.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=212

 Score =   198 bits (504),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 135/191 (71%), Gaps = 6/191 (3%)
 Frame = +2

Query  398  WPEGSLEEKVQRLMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSY  577
            W EGS+EEKVQRL+KTWEME+VHK  P D K+++   +    NG K L+ E+   +GG Y
Sbjct  25   WAEGSVEEKVQRLLKTWEMEMVHKVRPEDQKSVNLKNYSASTNGLKPLTREEVMAMGG-Y  83

Query  578  NVFLQTSLPEKYRVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPP--RITYRFRHW  751
            N FL T+LP ++R+++P  E+  S+ + F  AFPRGFAIE+L VYSGPP  RI ++FRHW
Sbjct  84   NAFLATTLPPEHRIYDPEAESVESATSTFLTAFPRGFAIEVLDVYSGPPAPRIAFKFRHW  143

Query  752  GYMDGPFKGHPPTGEIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAA  931
            GYM+GPFKGHPP G   EFFG+ +F +DE+  K+ KAE F++RG  L + +   +   +A
Sbjct  144  GYMEGPFKGHPPHGGRVEFFGVCVFHVDEDI-KVEKAEFFYERGNFLASFLT--APAASA  200

Query  932  TSSACPFMKGA  964
            ++S CP M+GA
Sbjct  201  SASGCPVMRGA  211



>ref|XP_004969845.1| PREDICTED: pathogen-related protein-like isoform X1 [Setaria 
italica]
Length=271

 Score =   197 bits (502),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 129/187 (69%), Gaps = 2/187 (1%)
 Frame = +2

Query  275  TGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWE  451
            +GGD+YR +L+ +  KNT WR G PP+YD V+ LFE  RT  WP GSLEE VQ  +KTWE
Sbjct  4    SGGDRYRSHLAGEGEKNTVWRHGAPPTYDAVNALFEAERTQEWPAGSLEEVVQNAIKTWE  63

Query  452  MEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPA  631
            ME+ HKA  +D+K++ P +F L VNG +  S E+T  +G SYN  L + L      ++ A
Sbjct  64   MELSHKARLSDFKSVSPGRFTLSVNGGRARSGEETLAVG-SYNALLDSPLLASAGAYDAA  122

Query  632  DETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFF  811
             ETF SS  +FR AFPRGFA E+L VYSGPP I ++FRHWG+M+GP+KGH  TGE  EF 
Sbjct  123  AETFASSHDLFRAAFPRGFAWEVLGVYSGPPVIAFKFRHWGHMEGPYKGHAATGEKVEFR  182

Query  812  GMGIFEL  832
            G+ + ++
Sbjct  183  GVAVLKV  189



>gb|EAZ13433.1| hypothetical protein OsJ_03352 [Oryza sativa Japonica Group]
Length=277

 Score =   197 bits (501),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 106/230 (46%), Positives = 144/230 (63%), Gaps = 16/230 (7%)
 Frame = +2

Query  263  ACSGTGGDKYRDYLSEDEVKNT----------KWRSGPPSY--DVVDKL--FEEGRTHVW  400
            A   +GGDKYR +L+ D  KNT          + R  P     D V  +      R   W
Sbjct  3    AADSSGGDKYRSHLAGDGEKNTVLPPRGATHVRHREQPLRVREDAVICMHGVRRQRAQEW  62

Query  401  PEGSLEEKVQRLMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYN  580
            P GSLEE VQ  +KTWEME+ HKA   D+K++ P  FRL VNG + L+ E+T  +G SYN
Sbjct  63   PAGSLEETVQNAIKTWEMELSHKARLQDFKSVSPGLFRLSVNGGRPLTGEETLAVG-SYN  121

Query  581  VFLQTSLPEKYRVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYM  760
              L + +      ++ A ETF SS  +FR AFPRGFA E+++VYSGPP IT++FRHWG+M
Sbjct  122  ALLASPILPGAGAYDAAAETFESSHDLFRAAFPRGFAWEVIRVYSGPPVITFKFRHWGHM  181

Query  761  DGPFKGHPPTGEIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVKG  910
            DGP+KGH PTG+  EF+G+ + ++DE+  +    E+++D GELLG L+KG
Sbjct  182  DGPYKGHAPTGDKVEFYGVAVLKVDEQL-RAEDVEVYYDPGELLGDLLKG  230



>gb|ACU24382.1| unknown [Glycine max]
Length=182

 Score =   189 bits (480),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 111/153 (73%), Gaps = 1/153 (1%)
 Frame = +2

Query  452  MEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPA  631
            ME+ HK D  D++++DP K+   +NGRK ++LE+  K+GG Y   LQTS+PEK R +NP 
Sbjct  1    MEMFHKVDLQDFRSIDPKKYTFSLNGRKPMTLEEMMKLGGGYIPMLQTSIPEKMRPYNPY  60

Query  632  DETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFF  811
            +ET  SS   F   FPRGFA+EIL VYSGPP I Y+FRHWGYM+GPFK H PTGE  +F+
Sbjct  61   EETADSSHKAFTTTFPRGFALEILHVYSGPPVIVYKFRHWGYMEGPFKRHAPTGEKIQFY  120

Query  812  GMGIFELDEESNKIVKAELFFDRGELLGALVKG  910
            GM IF LDE S K+VK E F+D  ELLG L+KG
Sbjct  121  GMAIFTLDENS-KVVKVEFFYDPAELLGGLLKG  152



>ref|XP_002982803.1| hypothetical protein SELMODRAFT_117244 [Selaginella moellendorffii]
 gb|EFJ16048.1| hypothetical protein SELMODRAFT_117244 [Selaginella moellendorffii]
Length=223

 Score =   190 bits (482),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 96/214 (45%), Positives = 130/214 (61%), Gaps = 7/214 (3%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            D YR ++  D  K T WR G PP YD  +  FEEGR+ VWP GSLEE VQ L+KTWEME+
Sbjct  5    DPYRSHIRGDAEKTTYWRHGEPPCYD--NSAFEEGRSKVWPSGSLEEIVQNLVKTWEMEM  62

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
             HK    D KT+D   F L VNGR   S+++  +  G+YN+ LQ+  P  Y  ++ + E 
Sbjct  63   SHKCHVEDVKTVDHQLFTLAVNGRTSKSVDEVVRT-GTYNILLQSEAPCAY--YDSSKEN  119

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMG  820
            F SS   F +AF   F  E+LQVYSGPP + +++RHWG M G F+GH  TGE+ E  G+ 
Sbjct  120  FESSHHTFHHAFNNKFPWEVLQVYSGPPVVVFKWRHWGRMKGEFRGHAATGELVEIIGVA  179

Query  821  IFELDEESNKIVKAELFFDRGELLGALVKGGSSD  922
            +  ++ E  K+   E++FD+ + L  L KG  S 
Sbjct  180  VATVNSEL-KLTSVEVYFDQEQFLKKLCKGKKSS  212



>emb|CBI20179.3| unnamed protein product [Vitis vinifera]
Length=166

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 124/167 (74%), Gaps = 3/167 (2%)
 Frame = +2

Query  452  MEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPA  631
            ME+ HK    D++T++P KF+L VNGR+GLS E+T K+G SYN  L++SLPE+ + +   
Sbjct  1    MELSHKTRLRDFRTINPEKFKLIVNGREGLSGEETLKLG-SYNALLKSSLPEELKYYKAE  59

Query  632  DETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFF  811
            +E+F SS   FR+AFPRGFA E++ VYSGPP I Y+FRHWG+ +GPFKGH PTGE+A+F+
Sbjct  60   EESFESSHDAFRSAFPRGFAWEVISVYSGPPEIAYKFRHWGFFEGPFKGHAPTGEMAQFY  119

Query  812  GMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSSACPF  952
            G+GI ++D ES ++ +AE+++D  EL G L+K G    A  S ACPF
Sbjct  120  GLGILKVD-ESLRVEEAEIYYDPAELFGGLLK-GPPISAPPSHACPF  164



>ref|XP_002981834.1| hypothetical protein SELMODRAFT_115305 [Selaginella moellendorffii]
 gb|EFJ16927.1| hypothetical protein SELMODRAFT_115305 [Selaginella moellendorffii]
Length=222

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 129/213 (61%), Gaps = 7/213 (3%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            D YR ++  D  K T WR G PP YD  ++ FEEGR  VWP GSLEE VQ L+KTWEME+
Sbjct  5    DPYRSHIHGDAEKTTYWRHGEPPCYD--NRAFEEGRRKVWPSGSLEEIVQNLVKTWEMEM  62

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
             HK    D KT+D   F L VNGR    +++  + G +YN+ LQ+  P  Y  ++ + E 
Sbjct  63   SHKCHVEDVKTVDHQLFTLAVNGRTSKPVDEVVRTG-TYNILLQSEAPCAY--YDSSKEN  119

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMG  820
            F SS   F +AF   F  E+LQVYSGPP + +++RHWG M G F+GH  TGE+ E  G+ 
Sbjct  120  FESSHHTFHHAFNNKFPWEVLQVYSGPPVVVFKWRHWGRMKGEFRGHAATGELVEIIGVA  179

Query  821  IFELDEESNKIVKAELFFDRGELLGALVKGGSS  919
            +  ++ E  K+   E++FD+ + L  L KG  S
Sbjct  180  VATVNSEL-KLTSVEVYFDQEQFLKKLCKGKKS  211



>ref|NP_849901.1| pathogenesis-related protein [Arabidopsis thaliana]
 ref|NP_001077841.1| pathogenesis-related protein [Arabidopsis thaliana]
 gb|AEE36149.1| pathogenesis-related protein [Arabidopsis thaliana]
 gb|AEE36151.1| pathogenesis-related protein [Arabidopsis thaliana]
Length=176

 Score =   184 bits (466),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 121/176 (69%), Gaps = 11/176 (6%)
 Frame = +2

Query  452  MEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPA  631
            ME  HK    D+KT++P KF+LFVNGR+GLS E+T ++G SYN  L+ SLPE+++ + P 
Sbjct  1    MEFSHKIRLQDFKTINPEKFKLFVNGREGLSAEETLRLG-SYNALLKNSLPEEFQYYKPE  59

Query  632  DETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFF  811
            +E+F SS   FR+A PRGFA EIL VYSGPP I ++FRHWGY +G FKGH PTGE+ +F 
Sbjct  60   EESFESSHDAFRSALPRGFAWEILSVYSGPPVIAFKFRHWGYFEGTFKGHAPTGEMVQFL  119

Query  812  GMGIFELDEESNKIVKAELFFDRGELLGALVKG---------GSSDEAATSSACPF  952
            G+G+ ++D ES +  + E+++D GEL G L+KG          S D  A   +CPF
Sbjct  120  GLGVLKVD-ESLRAEEIEIYYDPGELFGGLLKGPPISETKTTDSGDNTAEKQSCPF  174



>ref|XP_002982795.1| hypothetical protein SELMODRAFT_155441 [Selaginella moellendorffii]
 gb|EFJ16040.1| hypothetical protein SELMODRAFT_155441 [Selaginella moellendorffii]
Length=232

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 132/212 (62%), Gaps = 6/212 (3%)
 Frame = +2

Query  281  GDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEME  457
            GD+YR +L  D  K+T WR G  P YD+V++ F  GRT  W  GSLEE VQ L+KTWEME
Sbjct  16   GDEYRSFLHGDTEKDTVWRLGEAPEYDLVNRTFRSGRTKDWKPGSLEETVQNLVKTWEME  75

Query  458  IVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQT---SLPEKYRVFNP  628
            + HK    D+K++D   F   VNG K ++ E+  +  GSYN  L +          ++  
Sbjct  76   LTHKTRIKDFKSIDAENFSFSVNGGKTMTGEELLR-AGSYNALLASLEHGGANNPPLYKS  134

Query  629  ADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEF  808
            + ETF SS  +FR  FP GFA E+L+V+SGPP + +++RHWG M+G FK H P G+ AE 
Sbjct  135  SQETFESSHEIFRGVFPNGFAWEVLEVFSGPPTVAFKWRHWGKMEGSFKEHNPNGKTAEM  194

Query  809  FGMGIFELDEESNKIVKAELFFDRGELLGALV  904
            FGM I E+++E  KI + E+F+D  +LL  L 
Sbjct  195  FGMAIAEVNDEL-KIGRLEVFYDPSQLLTQLT  225



>gb|KEH38602.1| pathogenesis-like protein [Medicago truncatula]
Length=164

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 123/167 (74%), Gaps = 5/167 (3%)
 Frame = +2

Query  452  MEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPA  631
            ME+ HK    D+KT+ P KF+ FVNGR+GL+ E+T  IG SYN  L++SLPE ++ +   
Sbjct  1    MELTHKIRLQDFKTIVPEKFKFFVNGREGLTAEETLSIG-SYNALLKSSLPEDFKPYKSN  59

Query  632  DETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFF  811
            +ETF SS  VF++AFPRGFA EI++VY+GPP I ++FRHWG+ +GPFKGH PTG++ +F 
Sbjct  60   EETFESSHEVFKSAFPRGFAWEIIKVYTGPPEIAFKFRHWGFFEGPFKGHAPTGKMVQFS  119

Query  812  GMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSSACPF  952
            G+G  ++D ++ K+ + E+++D GEL G L+   SS E+  +SACPF
Sbjct  120  GLGTLKVD-DTLKVEEVEIYYDPGELFGGLI---SSGESTKTSACPF  162



>gb|EMS46522.1| hypothetical protein TRIUR3_09224 [Triticum urartu]
Length=341

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 136/223 (61%), Gaps = 27/223 (12%)
 Frame = +2

Query  275  TGGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWE  451
            +GGDKYR +L+ +  KNT WR G PP+YD V+ LFE GRT  W +GSLEE VQ  +KTWE
Sbjct  9    SGGDKYRSHLAGEGEKNTVWRHGAPPTYDAVNSLFEAGRTQEWAKGSLEETVQNAIKTWE  68

Query  452  MEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPA  631
            ME+ HKA   D+K++ P                      G YN  L + +      ++ A
Sbjct  69   MELSHKARIGDFKSVRP----------------------GRYNALLASPILPATGAYDAA  106

Query  632  DETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFF  811
             ETF SS  +FR+AFPRGFA E+++VYSGPP I ++FRHWG+M+GP+KG+ PTG+  EF+
Sbjct  107  AETFESSHDLFRSAFPRGFAWEVVKVYSGPPVIAFKFRHWGHMEGPYKGNAPTGDKVEFY  166

Query  812  GMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSS  940
            G+ + ++DE+  +    E+  DR  L    V G   D  A+++
Sbjct  167  GVAVLKVDEQL-RAEDVEIRIDRDRL---AVGGVDHDSMASTT  205



>emb|CAF33484.1| putative pathogenesis-related protein [Cucumis sativus]
Length=181

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 125/180 (69%), Gaps = 8/180 (4%)
 Frame = +2

Query  452  MEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPA  631
            ME+ HK  P+D+KT+D  K+   +NGRK L++   +K+GG YN FLQTSLP++YR +N  
Sbjct  1    MEMFHKISPSDFKTIDVNKYTFSLNGRKPLAVGQVSKLGG-YNPFLQTSLPDEYRYYNAE  59

Query  632  DETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFF  811
             ET  SS   F   F RGFA+EI+QVYSGPP I ++FRHWGYM+GPFK H PTGEI EF+
Sbjct  60   KETAESSHRAFTATFLRGFALEIIQVYSGPPNIVFKFRHWGYMEGPFKNHAPTGEIIEFY  119

Query  812  GMGIFELDEESNKIVKAELFFDRGELLGALVKG----GSSDEAATSSACPFMKGA*LSFL  979
            G+ IF+++E+ +KI   E FFD  EL+G L+KG    GS ++A +S  CP ++   L + 
Sbjct  120  GVAIFKVNEK-DKIEGVEFFFDPAELVGKLLKGPDLDGSVEKAMSS--CPVLRNTGLYYC  176



>gb|KEH38601.1| pathogenesis-like protein [Medicago truncatula]
Length=164

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 121/167 (72%), Gaps = 5/167 (3%)
 Frame = +2

Query  452  MEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPA  631
            ME+ HK    D+KT+ P KF+LFVNGR GL+ E+T  +G SYN  L++SLPE ++ +   
Sbjct  1    MELSHKIRLQDFKTIVPEKFKLFVNGRDGLTAEETLSLG-SYNALLKSSLPENFKPYKSN  59

Query  632  DETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFF  811
            +ETF SS  VF++AFPRGFA E+++VY+GPP I ++FRHWG+ +GPFKGH PTG++ +FF
Sbjct  60   EETFESSHEVFKSAFPRGFAWEVIKVYTGPPEIAFKFRHWGFFEGPFKGHSPTGKMVQFF  119

Query  812  GMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSSACPF  952
            G+G  ++D ++ K+ + E+++D  ELLG L+  G   +    SACPF
Sbjct  120  GLGTLKVD-DALKVEEVEIYYDPAELLGGLLTSGDGTQI---SACPF  162



>ref|XP_002981827.1| hypothetical protein SELMODRAFT_228781 [Selaginella moellendorffii]
 gb|EFJ16920.1| hypothetical protein SELMODRAFT_228781 [Selaginella moellendorffii]
Length=232

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 94/212 (44%), Positives = 131/212 (62%), Gaps = 6/212 (3%)
 Frame = +2

Query  281  GDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEME  457
            G +YR +L  D  K+T WR G  P YD+V++ F  GRT  W  GSLEE VQ L+KTWEME
Sbjct  16   GGEYRSFLHGDTEKDTVWRLGEAPEYDLVNRTFRSGRTKDWKPGSLEETVQNLVKTWEME  75

Query  458  IVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQT---SLPEKYRVFNP  628
            + HK    D+K++D   F   VNG K ++ E+  +  GSYN  L +          ++  
Sbjct  76   LTHKTRIKDFKSIDAENFSFSVNGGKTMTGEELLR-AGSYNALLASLEHGGANNPPLYKS  134

Query  629  ADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEF  808
            + ETF SS  +FR  FP GFA E+L+V+SGPP + +++RHWG M+G FK H P G+ AE 
Sbjct  135  SQETFESSHEIFRGVFPNGFAWEVLEVFSGPPTVAFKWRHWGKMEGSFKEHNPNGKTAEM  194

Query  809  FGMGIFELDEESNKIVKAELFFDRGELLGALV  904
            FGM I E++++  KI + E+F+D  +LL  L 
Sbjct  195  FGMAIAEVNDQL-KIGRLEVFYDPSQLLTQLT  225



>gb|EAZ11246.1| hypothetical protein OsJ_01100 [Oryza sativa Japonica Group]
Length=235

 Score =   180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 113/246 (46%), Positives = 147/246 (60%), Gaps = 24/246 (10%)
 Frame = +2

Query  260  MACSGT---GGDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKV  427
            MA +G    G DKYR ++  +  K+T WR G PP+YDVV+KLFEE RT  WPEGSLEEKV
Sbjct  1    MAAAGEASGGRDKYRSFMYGEGEKDTVWRLGSPPNYDVVNKLFEEERTKEWPEGSLEEKV  60

Query  428  QRLMKTWEMEIVHKADPNDYKTLDPTKFRLFVNG-RKGLS----LEDTAKIGGSYNVFLQ  592
            QRL+KTWEME++HK  P D K++   KF    NG  +G+S     E    +G   +    
Sbjct  61   QRLLKTWEMELIHKVRPEDQKSVHSQKFCASTNGMARGVSGGEGPEVAEDLGDGAHPQGA  120

Query  593  TSLPEKYRVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPF  772
            T  PE+     P  E     Q   R+      +  +L VYSGPPRI ++FRHWGYM+GPF
Sbjct  121  TRGPEE----RPLAEILREHQ---RDE----ISEPVLDVYSGPPRIVFKFRHWGYMEGPF  169

Query  773  KGHPPTGEIAEFFGMGIFELDEESNKIVKAELFFDRGELLGALVK---GGSSDEAATSSA  943
            K HPP G+  EFFG+ IF +DEE  K+ K E F++RG  L + +      ++ EAA+ S 
Sbjct  170  KEHPPHGKRVEFFGICIFHVDEEM-KVEKTEYFYERGNFLASFLSTPAAAAAAEAASGSG  228

Query  944  CPFMKG  961
            CP M G
Sbjct  229  CPVMGG  234



>ref|XP_008451757.1| PREDICTED: pathogen-related protein isoform X2 [Cucumis melo]
 ref|XP_008451758.1| PREDICTED: pathogen-related protein isoform X2 [Cucumis melo]
Length=181

 Score =   178 bits (451),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 122/180 (68%), Gaps = 13/180 (7%)
 Frame = +2

Query  452  MEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPA  631
            ME+ HK    D+ T++P KF+LFVNGR+GLS E+T +IG SYN FL++ LPE+++ +   
Sbjct  1    MELSHKIKLQDFNTINPRKFKLFVNGREGLSGEETLRIG-SYNAFLKSPLPEEFQYYKAE  59

Query  632  DETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFF  811
            +ETF SS   FR+ FPRGFA E+++VYS PP I ++FRHWG+ +GPFK H PTGE+ EF+
Sbjct  60   EETFESSHEAFRSCFPRGFAWEVIEVYSPPPLIAFKFRHWGFFEGPFKSHSPTGELVEFY  119

Query  812  GMGIFELDEESNKIVKAELFFDRGELLGALVKG-----------GSSDEAATSSACPFMK  958
            G+   ++D E+ K+ +AE+++D  EL G L+KG              ++ A S  CPF K
Sbjct  120  GLATLKVD-EALKVEEAEVYYDPAELFGGLLKGKITASESQSKENVKEDLAASVGCPFFK  178



>ref|XP_002987051.1| hypothetical protein SELMODRAFT_125190 [Selaginella moellendorffii]
 gb|EFJ11894.1| hypothetical protein SELMODRAFT_125190 [Selaginella moellendorffii]
Length=232

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/212 (44%), Positives = 130/212 (61%), Gaps = 6/212 (3%)
 Frame = +2

Query  281  GDKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEME  457
            GD+YR +L  D  K+T WR G  P YD+V++ F  GRT  W  GSLEE VQ L+KTWEME
Sbjct  16   GDEYRSFLHGDTEKDTVWRLGEAPEYDLVNRTFRSGRTKDWKPGSLEETVQHLVKTWEME  75

Query  458  IVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQT---SLPEKYRVFNP  628
            + HK    D+K++D   F   VNG   ++ E+  + G SYN  L +          ++  
Sbjct  76   LTHKTRIKDFKSIDAENFSFSVNGNHSMTGEELLRTG-SYNALLASLEHGGANNPPLYKS  134

Query  629  ADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEF  808
            + ETF SS  +FR  FP GFA E+L+V+SGPP + +++RHWG M+G FK H   G+ AE 
Sbjct  135  SQETFESSHEIFRGVFPNGFAWEVLEVFSGPPTVAFKWRHWGKMEGSFKEHNLNGKTAEM  194

Query  809  FGMGIFELDEESNKIVKAELFFDRGELLGALV  904
            FG+ I E+++E  KI + E+F+D  +LL  L 
Sbjct  195  FGIAIAEVNDEL-KIGRLEVFYDPSQLLTQLT  225



>ref|XP_006442473.1| hypothetical protein CICLE_v10022574mg [Citrus clementina]
 gb|ESR55713.1| hypothetical protein CICLE_v10022574mg [Citrus clementina]
Length=169

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 119/169 (70%), Gaps = 2/169 (1%)
 Frame = +2

Query  452  MEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPA  631
            ME+ HK    D+K+++P KF+L VNGR+GLS E+T K  GSYN  L+ SLPE+++ +   
Sbjct  1    MELTHKTRLQDFKSINPDKFKLIVNGREGLSAEETLK-AGSYNALLKNSLPEEFKFYKAE  59

Query  632  DETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFF  811
            +E+F SS   FR+AFPRGFA E+L VYSGPP I ++FRHWG+ +GPFKGH PTGE  EF 
Sbjct  60   EESFESSHEGFRSAFPRGFAWEVLSVYSGPPLIAFKFRHWGFFEGPFKGHAPTGEKVEFC  119

Query  812  GMGIFELDEESNKIVKAELFFDRGELLGALVKGGSSDEAATSSACPFMK  958
            G+G  ++D ES +    E+++D  EL G L+KG S +++  +  CPF K
Sbjct  120  GLGTLKVD-ESLRAEDVEIYYDPAELFGGLLKGSSIEDSTAAQGCPFSK  167



>ref|XP_010464676.1| PREDICTED: pathogen-related protein-like [Camelina sativa]
Length=199

 Score =   174 bits (441),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/235 (40%), Positives = 128/235 (54%), Gaps = 59/235 (25%)
 Frame = +2

Query  284  DKYRDYLSEDEVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEI  460
            DKYR  L  ++ +  +WR G PP ++ V++LFEEG+T VWPEGSLEE VQ  +K+WEME 
Sbjct  14   DKYRSVL--EDARKVQWRYGYPPDFNSVNQLFEEGQTKVWPEGSLEETVQNAIKSWEMEF  71

Query  461  VHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADET  640
             HK    D+KT++P KF+LFVNG   L                                 
Sbjct  72   SHKVRLQDFKTINPEKFKLFVNGNYSLC--------------------------------  99

Query  641  FVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMG  820
                          GFA E+L VYSGPP I ++FRHWGY +G FKGH PTGE+ +F G+G
Sbjct  100  --------------GFAWEVLSVYSGPPVIAFKFRHWGYFEGTFKGHAPTGEMVQFLGLG  145

Query  821  IFELDEESNKIVKAELFFDRGELLGALVKG---------GSSDEAATSSACPFMK  958
            + ++D ES +  + E+++D GEL G L+KG          + D  A   +CPF +
Sbjct  146  VLKVD-ESLRAEEIEIYYDPGELFGGLLKGPPISETKTTDTGDNTAEKQSCPFTQ  199



>ref|WP_016868370.1| hypothetical protein [Fischerella muscicola]
Length=230

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/216 (39%), Positives = 128/216 (59%), Gaps = 12/216 (6%)
 Frame = +2

Query  314  EVKNTKWRSG-PPSY-DVVDKLFEEGRT-HVWPEGSLEEKVQRLMKTWEMEIVHKADPND  484
            + KN +WR G PP Y D    L +E +  H+  EGSLE  VQ L++T+EME+  K++P +
Sbjct  22   QSKNAQWRYGAPPDYSDSKAGLAQESKCRHL--EGSLEVIVQNLVRTFEMEVSFKSNPQE  79

Query  485  YKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADETFVSSQAVF  664
            + ++   KFR+  NG +  + ED     G+YN+F+          +  ++ETF SS  +F
Sbjct  80   WLSVVQDKFRMSSNGGQTYTAEDVFA-SGTYNLFIG-----DIDNYKASEETFESSGQLF  133

Query  665  RNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMGIFELDEES  844
            + AFP+GF  E+L+VYSGPP++T+++RHWG   GP+K H PTGE  E  GM +  + ++ 
Sbjct  134  KTAFPKGFLWEVLEVYSGPPKVTFKWRHWGTFSGPYKDHAPTGETVEIVGMSVARVTDDL  193

Query  845  NKIVKAELFFDRGELLGALVKGGSSDEAATSSACPF  952
             KI+  E +FD  E    L  GG      +++ CPF
Sbjct  194  -KILSVEHYFDNSEFFNKLTSGGKQANEQSANGCPF  228



>ref|XP_004969847.1| PREDICTED: pathogen-related protein-like isoform X3 [Setaria 
italica]
Length=229

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 100/145 (69%), Gaps = 1/145 (1%)
 Frame = +2

Query  398  WPEGSLEEKVQRLMKTWEMEIVHKADPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSY  577
            WP GSLEE VQ  +KTWEME+ HKA  +D+K++ P +F L VNG +  S E+T  +G SY
Sbjct  4    WPAGSLEEVVQNAIKTWEMELSHKARLSDFKSVSPGRFTLSVNGGRARSGEETLAVG-SY  62

Query  578  NVFLQTSLPEKYRVFNPADETFVSSQAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGY  757
            N  L + L      ++ A ETF SS  +FR AFPRGFA E+L VYSGPP I ++FRHWG+
Sbjct  63   NALLDSPLLASAGAYDAAAETFASSHDLFRAAFPRGFAWEVLGVYSGPPVIAFKFRHWGH  122

Query  758  MDGPFKGHPPTGEIAEFFGMGIFEL  832
            M+GP+KGH  TGE  EF G+ + ++
Sbjct  123  MEGPYKGHAATGEKVEFRGVAVLKV  147



>ref|WP_002627643.1| putative pathogenesis related protein [Cystobacter fuscus]
 gb|EPX56066.1| putative pathogenesis related protein [Cystobacter fuscus DSM 
2262]
Length=222

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 123/206 (60%), Gaps = 8/206 (4%)
 Frame = +2

Query  293  RDYLSEDEVKNTKWRSGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEIVHKA  472
            RD + E++ ++ KWR G P Y + +    + RT  +P GSLE  V+ L++ +EME+ HKA
Sbjct  16   RDAVVEND-EDVKWRHGRPDYHLTNITVHKERTRQFPTGSLEMVVENLVRVFEMEVSHKA  74

Query  473  DPNDYKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADETFVSS  652
            DP  + ++   +FR  VNG    S +D A   GSYNVFL  +     + +  ++ETF SS
Sbjct  75   DPAQWVSVVRDRFRTNVNGGTWASADDIAA-RGSYNVFLGDT-----QYYKASEETFESS  128

Query  653  QAVFRNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMGIFEL  832
              VF  AFP GF  E+L+VYS PP +++++RHWG   GP+KG  P G+  E FGM +  +
Sbjct  129  HDVFHTAFPEGFFWEVLEVYSAPPSVSFKWRHWGNFTGPYKGQAPNGQRVEIFGMSVARV  188

Query  833  DEESNKIVKAELFFDRGELLGALVKG  910
             E+  +I++ E ++D  + L  +  G
Sbjct  189  AEDL-RILEVEHYYDNSQFLRQIATG  213



>ref|WP_017313378.1| hypothetical protein [Fischerella sp. PCC 9339]
Length=239

 Score =   150 bits (379),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 83/215 (39%), Positives = 125/215 (58%), Gaps = 9/215 (4%)
 Frame = +2

Query  314  EVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEIVHKADPNDYK  490
            + K+ +WR G PP Y        E       EGSLE  VQ L++T+EME+  K++P  + 
Sbjct  22   QSKDAQWRYGVPPDYSESKAGLAEESKCCHLEGSLEAIVQNLVRTFEMEVSFKSNPQQWL  81

Query  491  TLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADETFVSSQAVFRN  670
            ++   KFR+  NG    + ED     G+YNVF+     E Y+    ++ETF SS  +FR 
Sbjct  82   SVVQDKFRMSSNGGSLYTAEDVYA-SGTYNVFIGDV--ENYKA---SEETFESSGKLFRT  135

Query  671  AFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMGIFELDEESNK  850
            AFP+GF  E+L+VYSGPP +T+++RHWG  +GP+K + PTG+  E  GM +  + ++  K
Sbjct  136  AFPKGFLWEVLEVYSGPPNVTFKWRHWGTFNGPYKDYAPTGQTVEIVGMSVARVTDDL-K  194

Query  851  IVKAELFFDRGELLGALVKGG-SSDEAATSSACPF  952
            I+  E +FD  E L  L  G   +++   ++ACPF
Sbjct  195  ILAVEHYFDNSEFLNKLTSGNKQANDQQPANACPF  229



>ref|WP_016859665.1| hypothetical protein [Fischerella muscicola]
Length=239

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 81/215 (38%), Positives = 125/215 (58%), Gaps = 9/215 (4%)
 Frame = +2

Query  314  EVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEIVHKADPNDYK  490
            + K+ +WR G PP Y        +       EGSLE  VQ L++T+EME+  K++P  + 
Sbjct  22   QSKDAQWRYGVPPDYSESKAGLAQESKCCHIEGSLEAIVQNLVRTFEMEVSFKSNPQQWL  81

Query  491  TLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADETFVSSQAVFRN  670
            ++   KFR+  NG    + +D     G+YNVF+     E Y+    ++ETF SS  +FR 
Sbjct  82   SVVQDKFRMSSNGGPLYAAQDV-HTSGTYNVFIGDV--ENYKA---SEETFESSGRLFRT  135

Query  671  AFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMGIFELDEESNK  850
            AFP+GF  E+L+VYSGPP +T+++RHWG  +GP+K + PTG+  E  GM +  + ++  K
Sbjct  136  AFPKGFLWEVLEVYSGPPNVTFKWRHWGTFNGPYKDYAPTGQTVEIVGMSLARVTDDL-K  194

Query  851  IVKAELFFDRGELLGALVKGG-SSDEAATSSACPF  952
            I+  E +FD  E L  L  G   ++E  +++ CPF
Sbjct  195  ILAVEHYFDNSEFLNKLTSGNKQANEQQSANVCPF  229



>ref|WP_011612134.1| hypothetical protein [Trichodesmium erythraeum]
 ref|YP_722245.1| hypothetical protein Tery_2575 [Trichodesmium erythraeum IMS101]
 gb|ABG51772.1| protein of unknown function DUF1486 [Trichodesmium erythraeum 
IMS101]
Length=226

 Score =   147 bits (372),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 79/209 (38%), Positives = 121/209 (58%), Gaps = 18/209 (9%)
 Frame = +2

Query  329  KWRSGP-PSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEIVHKADPNDYKTLDPT  505
            +WR G  P Y   D++F++   H   +GSLE  V  L++T+EME+ +K DP  + ++   
Sbjct  31   EWRKGKRPDYSHNDRVFQQESKHDHQKGSLEAIVHNLVRTFEMEVSNKIDPQQWLSVVAD  90

Query  506  KFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADETFVSSQAVFRNAFPRG  685
            KFR+  NG K  + ++TA+  G+YN+F+  +     + +NP +ETF SS  VF  AFP G
Sbjct  91   KFRMSSNGGKEYTAQETAE-QGTYNLFMSQN-----QYYNPKEETFESSSEVFNTAFPEG  144

Query  686  FAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMGIFELDEESNKIVKAE  865
            F  E+++V SGPP +T+++RHWG   G FK H PTG+  E  G+ +  L E+  KI+  E
Sbjct  145  FLWEVIEVLSGPPNVTFKWRHWGTFKGNFKEHKPTGKTIEIIGISLARLTEDL-KILSIE  203

Query  866  LFFDRGELLGALVKGGSSDEAATSSACPF  952
             +FD  + +  L  G          +CPF
Sbjct  204  HYFDNSKFIKDLTAG----------SCPF  222



>gb|EMT15851.1| hypothetical protein F775_08821 [Aegilops tauschii]
Length=140

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 102/143 (71%), Gaps = 5/143 (3%)
 Frame = +2

Query  533  KGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADETFVSSQAVFRNAFPRGFAIEILQVY  712
            K L+ ++   IGG YN FL T LP ++R+++P  ET  S  + F  AFPRGFAIE+L VY
Sbjct  2    KPLTRKEWTAIGG-YNAFLATKLPPEHRIYDPDKETVDSGMSTFLTAFPRGFAIEVLDVY  60

Query  713  SGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMGIFELDEESNKIVKAELFFDRGELL  892
            SGPPR+ ++FRHWGYM+GPFKGHPP G+  EFFG+ IF +DEE  K+ KAE F++RG  L
Sbjct  61   SGPPRVAFKFRHWGYMEGPFKGHPPHGQRIEFFGVCIFHVDEEM-KVEKAEYFYERGNFL  119

Query  893  GALVKGGSSDEAATSSACPFMKG  961
             + +   S+  AA++S CP M+G
Sbjct  120  ASFL---SAPAAASASGCPVMRG  139



>ref|WP_026719539.1| hypothetical protein [Fischerella sp. PCC 9431]
Length=243

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/219 (37%), Positives = 128/219 (58%), Gaps = 13/219 (6%)
 Frame = +2

Query  314  EVKNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEIVHKADPNDYK  490
            + K+ +WR G PP Y        +       EGSLE  VQ L++T+EME+  K++P  + 
Sbjct  22   QSKDAQWRYGAPPDYSESKAGLAQESKCCHLEGSLEAIVQNLVRTFEMEVSFKSNPQQWL  81

Query  491  TLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADETFVSSQAVFRN  670
            ++   KFR+  NG    + +D     G+YNVF+     E Y+    ++ETF SS  +FR 
Sbjct  82   SVVQNKFRMSSNGGALYTAQDVYA-SGTYNVFIGDV--ENYKA---SEETFESSGKLFRT  135

Query  671  AFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMGIFELDEESNK  850
            AFP+GF  E+L+VYSGPP +T+++RHWG  +GP+K + PTG+  E  GM +  + ++  K
Sbjct  136  AFPKGFLWEVLEVYSGPPNVTFKWRHWGTFNGPYKDYAPTGQTVEIVGMSLARVTDDL-K  194

Query  851  IVKAELFFDRGELLGALVKGG--SSDEAAT---SSACPF  952
            I+  E +FD  E L  L  G   ++++ +T   ++ACPF
Sbjct  195  IIAVEHYFDNSEFLNKLTSGNKQANEQPSTQQSANACPF  233



>gb|EFX80169.1| hypothetical protein DAPPUDRAFT_197063 [Daphnia pulex]
Length=212

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 122/211 (58%), Gaps = 10/211 (5%)
 Frame = +2

Query  329  KWRSGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEIVHKADPNDYKTLDPTK  508
            +WR+  P+Y VV+  +   R+      SLE+ V+ L+KTWEME  HK    D+ T+DP +
Sbjct  7    EWRTVKPNYSVVNAKYLAERSKFHKADSLEKLVENLVKTWEMESTHKIKVKDWGTVDPER  66

Query  509  FRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADETFVSSQAVFRNAFPRGF  688
            +    NG     LE+  +  G+YN+ +  S      +F+ + ET  SS A+F+  FP GF
Sbjct  67   YIFRTNGGAPKDLENNIQ-NGNYNMMMDNS-----PLFDVSKETNASSHALFKECFPDGF  120

Query  689  AIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMGIFELDEESNKIVKAEL  868
            A E+L + SGPP++++ +RHW +  GP++ +PPTGE+ E  G  + E+DE   KI+  ++
Sbjct  121  AWELLDLLSGPPKVSFTWRHWAHWTGPYRNNPPTGELMELVGSSVVEVDENL-KIIDLQV  179

Query  869  FFDRGELLGALVKGGS--SDEAATS-SACPF  952
            FFD   +LG L+K      D A    + CPF
Sbjct  180  FFDPHPMLGRLMKRKDIEVDPAGDGPTRCPF  210



>ref|WP_016871229.1| hypothetical protein [Fischerella thermalis]
Length=216

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 124/203 (61%), Gaps = 12/203 (6%)
 Frame = +2

Query  314  EVKNTKWRSG-PPSY-DVVDKLFEEGRT-HVWPEGSLEEKVQRLMKTWEMEIVHKADPND  484
            + KN +WR G PP Y D    L +E +  H+  EGSLE  VQ L++T+EME+  K++P +
Sbjct  22   QSKNAQWRYGAPPDYSDSKAGLAQESKCRHI--EGSLEAIVQNLVRTFEMEVSFKSNPQE  79

Query  485  YKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADETFVSSQAVF  664
            + ++   KFR+  NG +  + ED     G+YN+F+     + Y+    ++E+F SS  +F
Sbjct  80   WLSVVQYKFRMSSNGGQSYTAEDVFA-SGTYNLFIGD--IDNYKA---SEESFESSGQLF  133

Query  665  RNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMGIFELDEES  844
            + AFP+GF  E+L+VYSGPP +T+++RHWG  +GP+K H PTGE  E  GM +  + ++ 
Sbjct  134  KTAFPKGFLWEVLEVYSGPPNVTFKWRHWGTFNGPYKDHAPTGETVEIVGMSVARVTDDL  193

Query  845  NKIVKAELFFDRGELLGALVKGG  913
             KI+  E +FD  +    L  GG
Sbjct  194  -KILSVEHYFDNSQFFNKLTSGG  215



>ref|WP_009460309.1| hypothetical protein [Fischerella sp. JSC-11]
 gb|EHC08444.1| pathogenesis related protein-like protein [Fischerella sp. JSC-11]
Length=216

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 79/203 (39%), Positives = 122/203 (60%), Gaps = 12/203 (6%)
 Frame = +2

Query  314  EVKNTKWRSG-PPSY-DVVDKLFEEGRT-HVWPEGSLEEKVQRLMKTWEMEIVHKADPND  484
            + KN +WR G PP Y D    L +E +  H+  EGSLE  VQ L++T+EME+  K++P +
Sbjct  22   QSKNAQWRYGAPPDYSDSKAGLAQESKCRHI--EGSLEAIVQNLVRTFEMEVSFKSNPQE  79

Query  485  YKTLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADETFVSSQAVF  664
            + ++   KFR+  NG +  + ED     G+YN+F+          +  ++E+F SS  +F
Sbjct  80   WLSVVQYKFRMSSNGGQSYTAEDVFA-SGTYNLFIG-----DIDNYKASEESFESSGQLF  133

Query  665  RNAFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMGIFELDEES  844
            + AFP+GF  E+L+VYSGPP +T+++RHWG  +GP+K H PTGE  E  GM +  + ++ 
Sbjct  134  KTAFPKGFLWEVLEVYSGPPNVTFKWRHWGTFNGPYKDHAPTGETVEIVGMSVARVTDDL  193

Query  845  NKIVKAELFFDRGELLGALVKGG  913
             KI+  E +FD  +    L  GG
Sbjct  194  -KILSIEHYFDNSQFFNKLTSGG  215



>ref|WP_012410130.1| hypothetical protein [Nostoc punctiforme]
 ref|YP_001867102.1| pathogenesis-like protein [Nostoc punctiforme PCC 73102]
 gb|ACC82159.1| pathogenesis related protein-like protein [Nostoc punctiforme 
PCC 73102]
Length=239

 Score =   145 bits (365),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 81/215 (38%), Positives = 123/215 (57%), Gaps = 9/215 (4%)
 Frame = +2

Query  314  EVKNTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEIVHKADPNDYK  490
            E  + +WR   PP Y    +   +   H   EG+LE  VQ L++T+EME+  KA+P  + 
Sbjct  22   ESTDVEWRYQTPPDYSRSKENLAKESIHNHLEGTLEAIVQNLVRTFEMEVSFKANPQQWL  81

Query  491  TLDPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADETFVSSQAVFRN  670
            ++   +FR+  NG    +  D +   G+YN+F+  S  E Y+    ++E+F SS  VF  
Sbjct  82   SIVNEQFRVSTNGGVEYTAADLSA-QGTYNLFMADS--EHYKA---SEESFESSAKVFHT  135

Query  671  AFPRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMGIFELDEESNK  850
             FP+GF  E+L+V+SGPP +T+++RHWG+ +G +KGH PTGE  E  GM I ++ ++  K
Sbjct  136  TFPQGFPWEVLEVFSGPPNVTFKWRHWGHFNGEYKGHAPTGETIEIIGMSIAKVTDDL-K  194

Query  851  IVKAELFFDRGELLGALVKGGSSDEAAT-SSACPF  952
            ++  E +FD    L  L  GG    A    SACPF
Sbjct  195  VISLEHYFDNNLFLEKLTFGGKQTNAQKPGSACPF  229



>ref|XP_001638532.1| predicted protein [Nematostella vectensis]
 gb|EDO46469.1| predicted protein [Nematostella vectensis]
Length=295

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 114/193 (59%), Gaps = 7/193 (4%)
 Frame = +2

Query  323  NTKWRSGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEIVHKADPNDYKTLDP  502
            N KWR+  P Y   DK F  G T   P+GSLE  V+ L+KTWEME  HK D  D+ ++D 
Sbjct  14   NIKWRTQKPDYTKADKEFLSGVTKRHPKGSLERTVEDLVKTWEMEASHKVDLKDWGSVDQ  73

Query  503  TKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADETFVSSQAVFRNAFPR  682
              F + VN +   +  D A+  GSYN+ + T+ P    +++ + ET  SS  +F+ AF  
Sbjct  74   NCFTMGVNNQVHYTGHDVAQ-RGSYNLLI-TNTP----LYDASSETLESSHKLFKTAFNN  127

Query  683  GFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMGIFELDEESNKIVKA  862
            GF+ E+L+V+S PPR+ + +RHW    GP++ HPP+GE+ + FG  + E+D    KI   
Sbjct  128  GFSWEVLEVFSDPPRMAFTWRHWARWTGPYRDHPPSGELLQMFGSAVVEVDGNL-KIKSI  186

Query  863  ELFFDRGELLGAL  901
             L++D  ++L  L
Sbjct  187  NLYYDPNQILAKL  199



>ref|WP_008181559.1| hypothetical protein [Moorea producens]
 gb|EGJ33678.1| SnoaL-like polyketide cyclase [Moorea producens 3L]
Length=219

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 115/209 (55%), Gaps = 19/209 (9%)
 Frame = +2

Query  329  KWRSGP-PSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEIVHKADPNDYKTLDPT  505
            +WR G  P Y   ++  ++G     PEGSLE   Q L++T+EME  +KA+P  + ++   
Sbjct  27   EWREGKRPDYAQTNQFLKKGSKFNHPEGSLEAIAQNLVRTFEMEASYKANPEQWLSIVAD  86

Query  506  KFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADETFVSSQAVFRNAFPRG  685
            +FR+  NG    + +  A IG +YNVFL  +  E YR     +ETF SS  +F  AFP G
Sbjct  87   QFRMSTNGGPKYNAQTVADIG-TYNVFLGDT--EHYR---STEETFESSIEIFHKAFPNG  140

Query  686  FAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMGIFELDEESNKIVKAE  865
            F  E+++V S PP +T+++RHWG   G FKGH PTGE  E FG+ I  + E+  KIV  E
Sbjct  141  FLWELMEVLSAPPNVTFKWRHWGTFSGSFKGHEPTGETIEVFGISIARVTEDL-KIVSLE  199

Query  866  LFFDRGELLGALVKGGSSDEAATSSACPF  952
             FFD    L  L  G           CPF
Sbjct  200  HFFDNSLFLKQLTSG-----------CPF  217



>gb|EAY73289.1| hypothetical protein OsI_01163 [Oryza sativa Indica Group]
Length=149

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 98/147 (67%), Gaps = 4/147 (3%)
 Frame = +2

Query  527  GRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADETFVSSQAVFRNAFPRGFAIEILQ  706
            G + LS ++   IGG YN FLQT LP ++R+++P  ET  S  A F  AFPRGFAIE+L 
Sbjct  4    GMRFLSRKEVMAIGG-YNAFLQTKLPPEHRIYDPDKETLESGMATFLTAFPRGFAIEVLD  62

Query  707  VYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMGIFELDEESNKIVKAELFFDRGE  886
            VYSGPPRI ++FRHWGYM+G FK HPP G+  EFFG+ IF +DEE  K+ K E F++RG 
Sbjct  63   VYSGPPRIVFKFRHWGYMEGTFKEHPPHGKRVEFFGICIFHVDEEM-KVEKTEYFYERGN  121

Query  887  LL--GALVKGGSSDEAATSSACPFMKG  961
             L         ++ EAA+ S CP M G
Sbjct  122  FLASFLSAPAAAAAEAASGSGCPVMGG  148



>ref|WP_036834808.1| SnoaL-like polyketide cyclase [Pilimelia anulata]
Length=212

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 121/213 (57%), Gaps = 18/213 (8%)
 Frame = +2

Query  326  TKWRSGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEIVHKADPNDYKTLDPT  505
            T+WR   P Y++  ++    R+     GSLE  V+ L+K +EME+ HK DP  + ++   
Sbjct  16   TEWRGNVPDYELSHEVIPRERSTEHAPGSLEAIVEDLVKVFEMEVSHKGDPATWLSVVAE  75

Query  506  KFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADETFVSSQAVFRNAFPRG  685
            ++R  VNG +    E+ A+IG SYN+ +  +       +  A+ETF SS  VF  AFP G
Sbjct  76   QYRGRVNGGEWQDAEEFARIG-SYNILIGDN-----PYYEAANETFESSHKVFHTAFPGG  129

Query  686  FAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMGIFELDEESNKIVKAE  865
            F  E+++V SGPP +++R+RHWG  +G +KGH PTGE  E FG+ I  + E+  +I++ E
Sbjct  130  FFWEVIEVLSGPPTVSFRWRHWGRYEGEYKGHQPTGEQIEMFGVTIARVSEDL-RILELE  188

Query  866  LFFDRGELLGALVKGGSSDEAATSSACPFMKGA  964
             F+D  +LLG L  G           CP   GA
Sbjct  189  HFYDNNKLLGPLAHG-----------CPVQHGA  210



>ref|WP_019045250.1| hypothetical protein [Nocardia asteroides]
 dbj|GAD87728.1| hypothetical protein NCAST_37_00350 [Nocardia asteroides NBRC 
15531]
Length=231

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 121/213 (57%), Gaps = 18/213 (8%)
 Frame = +2

Query  326  TKWRSGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEIVHKADPNDYKTLDPT  505
            T+WR   P Y++  ++    R+     GSLE  V+ L+K +EME+ HK DP  + ++   
Sbjct  35   TEWRGNVPDYELSHEVIPRERSTEHAPGSLEAIVEDLVKVFEMEVSHKGDPATWLSVVAE  94

Query  506  KFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADETFVSSQAVFRNAFPRG  685
            ++R  VNG +    E+ A+IG SYN+ +  +       +  A+ETF SS  VF  AFP G
Sbjct  95   QYRGRVNGGEWQDAEEFARIG-SYNILIGDN-----PYYEAANETFESSHKVFHTAFPGG  148

Query  686  FAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMGIFELDEESNKIVKAE  865
            F  E+++V SGPP +++R+RHWG  +G +KGH PTGE  E FG+ I  + E+  +I++ E
Sbjct  149  FFWEVIEVLSGPPTVSFRWRHWGRYEGEYKGHQPTGEQIEMFGVTIARVSEDL-RILELE  207

Query  866  LFFDRGELLGALVKGGSSDEAATSSACPFMKGA  964
             F+D  +LLG L  G           CP   GA
Sbjct  208  HFYDNNKLLGPLAHG-----------CPVQHGA  229



>ref|WP_037224639.1| SnoaL-like polyketide cyclase [Richelia intracellularis]
 emb|CDN17179.1| putative pathogenesis related protein [Richelia intracellularis]
Length=241

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/212 (37%), Positives = 122/212 (58%), Gaps = 9/212 (4%)
 Frame = +2

Query  323  NTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEIVHKADPNDYKTLD  499
            N +WR+G PP Y    +   +   +   EGSLE  VQ L++T+EME+  K +P  + ++ 
Sbjct  27   NIEWRNGTPPDYSRSKQNLVQESLYNHVEGSLEAIVQNLVRTFEMEVSFKTNPQQWLSVI  86

Query  500  PTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADETFVSSQAVFRNAFP  679
              +FR+  NG +  + E+     G+YNVF+  S  E Y+    ++ETF SS  +F + FP
Sbjct  87   NEQFRVSTNGGREFTAEELGA-QGTYNVFMADS--EHYK---SSEETFESSHQIFHSTFP  140

Query  680  RGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMGIFELDEESNKIVK  859
            +GF  E+++VYSGPP++T+++RHWG+  G ++G  PTGE  E  GM +  +  +  KI+ 
Sbjct  141  QGFPWEVIEVYSGPPKVTFKWRHWGHFQGEYRGFAPTGETVEIVGMTVARVAGDL-KIIS  199

Query  860  AELFFDRGELLGALVKGGS-SDEAATSSACPF  952
             E +FD    L  L  GG   D +   S CPF
Sbjct  200  MEHYFDNSLFLEKLTAGGKVEDSSNLLSRCPF  231



>ref|XP_002611467.1| hypothetical protein BRAFLDRAFT_117209 [Branchiostoma floridae]
 gb|EEN67477.1| hypothetical protein BRAFLDRAFT_117209 [Branchiostoma floridae]
Length=292

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 118/217 (54%), Gaps = 10/217 (5%)
 Frame = +2

Query  323  NTKWRSGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEIVHKADPNDYKTLDP  502
            N KWR   P Y   +  + +G+T   P GSLE  V+ L+K WEME  H  D + + T++ 
Sbjct  75   NIKWRFSKPDYTQANLEYMKGKTKNHPAGSLELVVENLVKRWEMEASHFKDLDQWTTINK  134

Query  503  TKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADETFVSSQAVFRNAFPR  682
             ++R   NG KG S E+  KIG +YN  +      K  +++   E F SS   FR AFP 
Sbjct  135  ERYRAQANGGKGFSAEEVYKIG-NYNWLMAGC---KKELYDAEKEDFESSHRHFRGAFPA  190

Query  683  GFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMGIFELDEESNKIVKA  862
            GF  E+L+V+SGPP + + +RHW +  G + G    GE+ E +G G+ ELDE + K+V  
Sbjct  191  GFPWEVLEVFSGPPTVAFSWRHWAHYTGQYMGSQGAGELLELYGFGVVELDENT-KLVSV  249

Query  863  ELFFDRGELLGALVKGGSSDE-----AATSSACPFMK  958
             +++   + + AL    + D+     A   S CPF+K
Sbjct  250  NIYYKPDQFVEALKGDITPDQMSKGKALVGSGCPFVK  286



>ref|WP_008232433.1| putative pathogenesis related protein [Richelia intracellularis]
 emb|CCH66676.1| putative pathogenesis related protein [Richelia intracellularis 
HH01]
Length=223

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/212 (37%), Positives = 122/212 (58%), Gaps = 9/212 (4%)
 Frame = +2

Query  323  NTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEIVHKADPNDYKTLD  499
            N +WR+G PP Y    +       +   EGSLE  VQ L++T+EME+  K++P  + ++ 
Sbjct  9    NIEWRNGTPPDYSRSKENLAHESLYNHVEGSLEAIVQNLVRTFEMEVSFKSNPQQWLSVI  68

Query  500  PTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADETFVSSQAVFRNAFP  679
              +FR+  NG +  + E+ A   G+YN F+  S  E Y+    ++ETF SS  +F +AFP
Sbjct  69   NEQFRVSTNGGREFTAEELAA-KGTYNAFMPNS--EHYQ---SSEETFESSHQIFHSAFP  122

Query  680  RGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMGIFELDEESNKIVK  859
            +GF  E+++VYSGPP++T+++RHWG+  G +KG  PTGE  E  G+ +  +  +  KI+ 
Sbjct  123  QGFPWEVIEVYSGPPKVTFKWRHWGHFRGEYKGFAPTGETIEMVGITVVRVAGDL-KIIS  181

Query  860  AELFFDRGELLGALVKGGS-SDEAATSSACPF  952
             E +FD    L  L  GG   D +     CPF
Sbjct  182  MENYFDNSLFLSQLTAGGKLEDISNLPGRCPF  213



>ref|WP_008230492.1| putative pathogenesis related protein [Richelia intracellularis]
 emb|CCH65931.1| putative pathogenesis related protein [Richelia intracellularis 
HM01]
Length=241

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/212 (37%), Positives = 122/212 (58%), Gaps = 9/212 (4%)
 Frame = +2

Query  323  NTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEIVHKADPNDYKTLD  499
            N +WR+G PP Y    +       +   EGSLE  VQ L++T+EME+  K++P  + ++ 
Sbjct  27   NIEWRNGTPPDYSRSKENLAHESLYNHVEGSLEAIVQNLVRTFEMEVSFKSNPQQWLSVI  86

Query  500  PTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADETFVSSQAVFRNAFP  679
              +FR+  NG +  + E+ A   G+YN F+  S  E Y+    ++ETF SS  +F +AFP
Sbjct  87   NEQFRVSTNGGREFTAEELAA-KGTYNTFMPNS--EHYQ---SSEETFESSHQIFHSAFP  140

Query  680  RGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMGIFELDEESNKIVK  859
            +GF  E+++VYSGPP++T+++RHWG+  G +KG  PTGE  E  G+ +  +  +  KI+ 
Sbjct  141  QGFPWEVIEVYSGPPKVTFKWRHWGHFRGEYKGFAPTGETIEMVGITVVRVAGDL-KIIS  199

Query  860  AELFFDRGELLGALVKGGS-SDEAATSSACPF  952
             E +FD    L  L  GG   D +     CPF
Sbjct  200  MENYFDNSLFLSQLTAGGKLEDISNLPGRCPF  231



>ref|WP_017323619.1| hypothetical protein [cyanobacterium PCC 7702]
Length=233

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 83/212 (39%), Positives = 120/212 (57%), Gaps = 15/212 (7%)
 Frame = +2

Query  323  NTKWRSG-PPSYDVVDK-LFEEGRTHVWPEGSLEEKVQRLMKTWEMEIVHKADPNDYKTL  496
            +  WR G PP Y +  + L  E + H   EGSLE   Q L++T+EME   KADP+ + ++
Sbjct  25   DVNWRYGSPPDYSLSKQGLARESKCHH-LEGSLEAIAQNLIRTFEMEASFKADPSQWLSI  83

Query  497  DPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADETFVSSQAVFRNAF  676
               KFR   NG    S +D +   G+YN+F+  + P+    +  + ETF S+  +FR AF
Sbjct  84   VNDKFRTSSNGGPVYSAKDVSA-SGTYNLFIGDT-PD----YQASRETFESAGKLFRTAF  137

Query  677  PRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMGIFELDEESNKIV  856
            P+GF  E+L+VYSGPP + +++RHWG   GP+K + PTGE  E  GM I  L E+  KI+
Sbjct  138  PQGFLWEVLEVYSGPPNVIFKWRHWGTFSGPYKDYAPTGETIEIVGMSIARLTEDL-KII  196

Query  857  KAELFFDRGELLGALVKGGSSDEAATSSACPF  952
              E +FD    L  L   G       ++ACP+
Sbjct  197  SVEHYFDNSSFLAKLTSKGKQ-----TTACPW  223



>ref|WP_013190728.1| hypothetical protein [Trichormus azollae]
 ref|YP_003720833.1| pathogenesis-like protein ['Nostoc azollae' 0708]
 gb|ADI63710.1| pathogenesis related protein-like protein ['Nostoc azollae' 0708]
Length=241

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/214 (36%), Positives = 122/214 (57%), Gaps = 11/214 (5%)
 Frame = +2

Query  323  NTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEIVHKADPNDYKTLD  499
            + +WR   PP Y    +   +  T    EG+LE  VQ L++T+EME+ +K++P  + ++ 
Sbjct  25   HAEWRYQTPPDYTRSKENLAKESTCNHLEGTLEAIVQNLVRTFEMEVSYKSNPQQWLSVV  84

Query  500  PTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADETFVSSQAVFRNAFP  679
              KFR+  NG K  +  D +   GSYN+F+  S     + +  ++E+F SS  +F + FP
Sbjct  85   GEKFRVSTNGGKEYTAADLSA-QGSYNLFMADS-----QHYKASEESFESSAKIFHSTFP  138

Query  680  RGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMGIFELDEESNKIVK  859
            +GF  E+LQVYSGPP +T+++RHWG+  G +K   PTGE  E  G+ +  + ++  KI+ 
Sbjct  139  QGFPWEVLQVYSGPPNVTFKWRHWGHFQGAYKDFAPTGETVELIGISVAHVTDDL-KILS  197

Query  860  AELFFDRGELLGALVKGGS---SDEAATSSACPF  952
             E +FD    L  L  GG+   S+    +S CPF
Sbjct  198  VEHYFDNNLFLEKLTAGGTLVNSENEKKASGCPF  231



>ref|WP_035148869.1| SnoaL-like polyketide cyclase [Calothrix sp. 336/3]
 gb|KFB81499.1| hypothetical protein IJ00_00055 [Calothrix sp. 336/3]
Length=241

 Score =   139 bits (351),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 117/213 (55%), Gaps = 9/213 (4%)
 Frame = +2

Query  320  KNTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEIVHKADPNDYKTL  496
            +  +WR G  P Y                EGSLE  VQ L++T EME+  K +P ++ ++
Sbjct  26   QGVQWRGGKAPDYSRSKHNLATESVCNHLEGSLEAIVQNLVRTLEMEVSCKPNPQEWLSI  85

Query  497  DPTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADETFVSSQAVFRNAF  676
               KFR+  NG K  + E+     G+YN+F+  S  E Y+    ++ETF SS  +F   F
Sbjct  86   VADKFRVTTNGGKEFTAEELGA-KGTYNIFMGDS--EHYK---SSEETFESSHDLFHTCF  139

Query  677  PRGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMGIFELDEESNKIV  856
            P+GF  E+L+VYSGPPR+T+++RHWG+  G +KG  PTGE+ E  G+ +  + E+  +I+
Sbjct  140  PQGFPWEVLEVYSGPPRVTFKWRHWGHFRGSYKGFTPTGELIEIIGISVANVTEDL-RIL  198

Query  857  KAELFFDRGELLGALVKGGSSDEAATS-SACPF  952
              E +FD    L  L  GG      T   +CPF
Sbjct  199  STEHYFDNTLFLNKLTGGGKESHGQTQGGSCPF  231



>ref|WP_015079171.1| hypothetical protein [Anabaena sp. 90]
 ref|YP_006995820.1| hypothetical protein ANA_C11227 [Anabaena sp. 90]
 gb|AFW94007.1| hypothetical protein ANA_C11227 [Anabaena sp. 90]
Length=239

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/212 (36%), Positives = 121/212 (57%), Gaps = 9/212 (4%)
 Frame = +2

Query  323  NTKWRSG-PPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEIVHKADPNDYKTLD  499
            + +WR+  PP Y    +   +   H   EG+LE  V+ L++T+EME+  K +P  + ++ 
Sbjct  25   DAQWRNQKPPDYSRSQQNLAKESIHHHLEGTLEAIVENLVRTFEMEVSWKTNPQQWLSIV  84

Query  500  PTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADETFVSSQAVFRNAFP  679
              KFR+  NG +  +  +  K  G+YN+F+  S  E Y+    ++E+F SS  +F + FP
Sbjct  85   NDKFRVTSNGGQEYTAAELGK-SGTYNLFMADS--EHYKA---SEESFESSHDIFHSTFP  138

Query  680  RGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMGIFELDEESNKIVK  859
            +GF  E+L VYSGPP +T+++RHWG+  G +K + PTG+  E  GM +  + E+  KIV 
Sbjct  139  QGFPWEVLAVYSGPPNVTFKWRHWGHFQGKYKDYAPTGKTVEIIGMSVAHVTEDL-KIVS  197

Query  860  AELFFDRGELLGALVKGGSSDEAATSS-ACPF  952
             E +FD    L +L  GG  + +   S  CPF
Sbjct  198  LEHYFDNALFLESLTAGGKLENSENKSGGCPF  229



>ref|WP_015207129.1| SnoaL-like polyketide cyclase [Cylindrospermum stagnale]
 ref|YP_007146553.1| SnoaL-like polyketide cyclase [Cylindrospermum stagnale PCC 7417]
 gb|AFZ23873.1| SnoaL-like polyketide cyclase [Cylindrospermum stagnale PCC 7417]
Length=231

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 117/212 (55%), Gaps = 9/212 (4%)
 Frame = +2

Query  323  NTKWR-SGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEIVHKADPNDYKTLD  499
            + +WR   PP Y    +   +  T    EG+LE  VQ L++T+EME+  K +P  + ++ 
Sbjct  25   DAQWRYQAPPDYSRSKENLAQESTQNHLEGTLEAIVQNLVRTFEMEVSFKTNPQQWLSVV  84

Query  500  PTKFRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADETFVSSQAVFRNAFP  679
              +FR+  NG    +  D +   G+YN+F+  S  E Y+    ++E F SS  +F++ FP
Sbjct  85   NDQFRVSTNGGVEYTAADVSA-QGTYNLFMADS--EHYKA---SEEDFESSSKIFQSTFP  138

Query  680  RGFAIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMGIFELDEESNKIVK  859
            +GF  E+L+VYSGPP +T+++RHWG+  G +K H PTGE  E  GM +  + ++  KIV 
Sbjct  139  QGFPWEVLEVYSGPPNVTFKWRHWGHFQGAYKDHAPTGETVEIIGMTVARVTDDL-KIVS  197

Query  860  AELFFDRGELLGALVKGGSSDEAATS-SACPF  952
             E +FD    L  L  GG         S CPF
Sbjct  198  LEHYFDNTLFLDKLTAGGKQVNGENQGSPCPF  229



>ref|XP_002115708.1| hypothetical protein TRIADDRAFT_29994 [Trichoplax adhaerens]
 gb|EDV21560.1| hypothetical protein TRIADDRAFT_29994 [Trichoplax adhaerens]
Length=200

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/202 (37%), Positives = 116/202 (57%), Gaps = 9/202 (4%)
 Frame = +2

Query  329  KWRSGPPSYDVVDKLFEEGRTHVWPEGSLEEKVQRLMKTWEMEIVHKADPNDYKTLDPTK  508
            KWR+  P +  +D+LF   +T    E SLE  V+ L+KTWEME  HK    D+K++D  K
Sbjct  6    KWRTSKPDFSELDRLFMNEKTRNHKEDSLEITVENLVKTWEMEASHKVLVKDWKSVDTQK  65

Query  509  FRLFVNGRKGLSLEDTAKIGGSYNVFLQTSLPEKYRVFNPADETFVSSQAVFRNAFPRGF  688
            F L  N  K  S+E+  K+G SYN  +Q        +++    TF SS   FR AF  GF
Sbjct  66   FCLRTNKGKKFSVENLIKLG-SYNCLMQGQ-----PLYDANTHTFQSSHENFRGAFRDGF  119

Query  689  AIEILQVYSGPPRITYRFRHWGYMDGPFKGHPPTGEIAEFFGMGIFELDEESNKIVKAEL  868
            + E+L VYSGPP + + +RHW   +G +KG+PP+G+  E FG  +  ++++  +I   ++
Sbjct  120  SWEVLDVYSGPPVVAFTWRHWAKWNGSYKGNPPSGKTLEMFGAAVVRVNQKM-QIEDLDV  178

Query  869  FFDRGELLGAL--VKGGSSDEA  928
            ++D  ++L  L  +KG  +  +
Sbjct  179  YYDPNQILVPLNNLKGSCNTSS  200



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3189754985028