BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13504_g1_i3 len=799 path=[777:0-549 2113:550-550 1328:551-798]

Length=799
                                                                      Score     E

ref|XP_009770018.1|  PREDICTED: uncharacterized protein LOC104220785    124   2e-31   
ref|XP_009588663.1|  PREDICTED: uncharacterized protein LOC104086172    122   2e-30   
emb|CDP02319.1|  unnamed protein product                                110   7e-26   
ref|XP_004233386.1|  PREDICTED: uncharacterized protein LOC101249885    109   1e-25   
gb|KHG29907.1|  Malate synthase G                                       109   2e-25   
ref|XP_006363432.1|  PREDICTED: uncharacterized protein LOC102581...    108   2e-25   
ref|XP_006363433.1|  PREDICTED: uncharacterized protein LOC102581...    108   3e-25   
ref|XP_007032753.1|  Chlororespiratory reduction 7 isoform 1            106   2e-24   
ref|XP_011098749.1|  PREDICTED: uncharacterized protein LOC105177328    104   6e-24   
ref|XP_006845849.1|  hypothetical protein AMTR_s00154p00036570          104   1e-23   
emb|CBI21209.3|  unnamed protein product                                103   1e-23   
ref|XP_002280011.3|  PREDICTED: uncharacterized protein LOC100249838    103   2e-23   Vitis vinifera
ref|XP_004306071.1|  PREDICTED: uncharacterized protein LOC101297367    102   4e-23   
gb|KCW56292.1|  hypothetical protein EUGRSUZ_I02035                     100   2e-22   
gb|KCW56293.1|  hypothetical protein EUGRSUZ_I02035                     100   2e-22   
ref|XP_009365925.1|  PREDICTED: uncharacterized protein LOC103955746    100   2e-22   
ref|XP_008379432.1|  PREDICTED: uncharacterized protein LOC103442427  99.8    2e-22   
ref|XP_009365882.1|  PREDICTED: uncharacterized protein LOC103955703    100   3e-22   
ref|XP_010029388.1|  PREDICTED: uncharacterized protein LOC104419424    100   3e-22   
ref|XP_010258044.1|  PREDICTED: uncharacterized protein LOC104597942    100   3e-22   
ref|NP_001172577.1|  Os01g0763650                                     99.0    9e-22   
dbj|BAJ90441.1|  predicted protein                                    98.6    1e-21   
gb|EYU44199.1|  hypothetical protein MIMGU_mgv1a015898mg              98.2    1e-21   
ref|XP_008230882.1|  PREDICTED: uncharacterized protein LOC103330109  98.6    1e-21   
emb|CDM82438.1|  unnamed protein product                              98.2    2e-21   
ref|XP_007215076.1|  hypothetical protein PRUPE_ppa012522mg           98.6    2e-21   
ref|NP_568563.1|  protein CHLORORESPIRATORY REDUCTION 7               97.4    3e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004970060.1|  PREDICTED: uncharacterized protein LOC101779891  96.7    5e-21   
ref|XP_009407395.1|  PREDICTED: uncharacterized protein LOC103990089  96.7    8e-21   
ref|XP_010670166.1|  PREDICTED: uncharacterized protein LOC104887258  96.3    8e-21   
ref|XP_010089634.1|  hypothetical protein L484_021027                 96.7    9e-21   
ref|XP_006405656.1|  hypothetical protein EUTSA_v10027973mg           96.3    9e-21   
ref|XP_003554915.1|  PREDICTED: uncharacterized protein LOC100801516  95.9    1e-20   
ref|NP_001143831.1|  hypothetical protein                             96.3    1e-20   Zea mays [maize]
ref|XP_006646352.1|  PREDICTED: uncharacterized protein LOC102722269  95.9    1e-20   
ref|XP_004489463.1|  PREDICTED: uncharacterized protein LOC101509461  95.1    2e-20   
gb|AAM62952.1|  unknown                                               94.7    4e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008805134.1|  PREDICTED: uncharacterized protein LOC103718208  94.4    4e-20   
ref|XP_002870799.1|  hypothetical protein ARALYDRAFT_916402           94.7    4e-20   
gb|KDP27244.1|  hypothetical protein JCGZ_19943                       94.0    7e-20   
gb|EMT31311.1|  Glycerophosphoryl diester phosphodiesterase           98.6    9e-20   
ref|XP_009140213.1|  PREDICTED: uncharacterized protein LOC103864210  93.2    1e-19   
gb|EEC71530.1|  hypothetical protein OsI_03844                        98.2    1e-19   Oryza sativa Indica Group [Indian rice]
emb|CDX99667.1|  BnaC04g34240D                                        92.8    1e-19   
gb|KFK33207.1|  hypothetical protein AALP_AA6G344700                  90.9    1e-19   
ref|XP_010552531.1|  PREDICTED: uncharacterized protein LOC104822868  92.4    2e-19   
ref|XP_007151331.1|  hypothetical protein PHAVU_004G037200g           92.0    3e-19   
gb|AFK35111.1|  unknown                                               91.7    3e-19   
ref|XP_010906148.1|  PREDICTED: uncharacterized protein LOC105033162  91.7    3e-19   
ref|XP_006282750.1|  hypothetical protein CARUB_v10005940mg           91.3    5e-19   
ref|XP_010450831.1|  PREDICTED: uncharacterized protein LOC104732926  91.7    5e-19   
ref|XP_010435822.1|  PREDICTED: uncharacterized protein LOC104719576  91.3    5e-19   
ref|XP_010441039.1|  PREDICTED: uncharacterized protein LOC104724276  90.5    1e-18   
ref|XP_011009395.1|  PREDICTED: uncharacterized protein LOC105114530  89.7    2e-18   
ref|XP_003569879.2|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...  94.4    2e-18   
ref|XP_002306021.2|  hypothetical protein POPTR_0004s11950g           89.4    3e-18   Populus trichocarpa [western balsam poplar]
ref|XP_004173511.1|  PREDICTED: uncharacterized LOC101214040          87.8    1e-17   
ref|XP_004151801.1|  PREDICTED: uncharacterized protein LOC101214040  87.4    2e-17   
gb|KDO72767.1|  hypothetical protein CISIN_1g034246mg                 85.1    2e-17   
ref|XP_006482751.1|  PREDICTED: uncharacterized protein LOC102607...  86.7    3e-17   
ref|XP_006431297.1|  hypothetical protein CICLE_v10012981mg           85.9    5e-17   
ref|XP_002456392.1|  hypothetical protein SORBIDRAFT_03g035380        80.5    5e-16   Sorghum bicolor [broomcorn]
ref|XP_008462928.1|  PREDICTED: uncharacterized protein LOC103501190  82.0    2e-15   
ref|XP_001776854.1|  predicted protein                                79.3    3e-15   
ref|XP_002993242.1|  hypothetical protein SELMODRAFT_136743           74.3    1e-13   
ref|XP_002993783.1|  hypothetical protein SELMODRAFT_137591           74.3    1e-13   
tpg|DAA57525.1|  TPA: hypothetical protein ZEAMMB73_105918            71.6    9e-13   
ref|XP_008676272.1|  PREDICTED: uncharacterized protein LOC103652474  72.0    1e-12   
gb|KDO72766.1|  hypothetical protein CISIN_1g034246mg                 71.2    1e-12   
gb|KDO72765.1|  hypothetical protein CISIN_1g034246mg                 71.2    1e-12   
ref|XP_009360629.1|  PREDICTED: uncharacterized protein LOC103951071  72.0    4e-12   
ref|XP_008675018.1|  PREDICTED: uncharacterized protein LOC103651...  67.8    2e-10   
gb|KEH25053.1|  chlororespiratory reduction protein                   57.8    3e-07   
gb|KEH25050.1|  DUF3571 family protein                                56.6    8e-07   
ref|WP_015229464.1|  hypothetical protein                             49.3    2e-04   
ref|WP_015214612.1|  hypothetical protein                             48.9    3e-04   
ref|WP_006196610.1|  hypothetical protein                             48.1    4e-04   
gb|AHJ27361.1|  hypothetical protein NSP_10190                        48.1    5e-04   
ref|WP_029633969.1|  hypothetical protein [                           47.8    6e-04   



>ref|XP_009770018.1| PREDICTED: uncharacterized protein LOC104220785 [Nicotiana sylvestris]
Length=153

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 104/153 (68%), Gaps = 11/153 (7%)
 Frame = -1

Query  727  KNKTKNMLGILNETIKAGL--LCHNPQNKFIGKERATLHPPPPLLGQSVQFMQFHIRNAT  554
            +NKT N +GI    ++  L  L    Q  F         P   L   SV F   H+ NAT
Sbjct  7    RNKTHNCIGIETTRLQNQLPFLHRRWQQPF-------FQPFNSLFFHSVTFRSIHL-NAT  58

Query  553  MICEVrrrrRADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFEN  374
                  RRRRA+I+T+TYVLMEPGK EEFVSEEELRERLKGWL+NWP N LP DLARFE 
Sbjct  59   KTL-ATRRRRANIQTETYVLMEPGKSEEFVSEEELRERLKGWLENWPGNELPKDLARFEE  117

Query  373  IDDAVEYLVKCVCELEIDGDAGSLQWFEVRLQQ  275
            IDDAV+YLVK VCELEIDGD GS+QW+EVRLQQ
Sbjct  118  IDDAVQYLVKSVCELEIDGDVGSIQWYEVRLQQ  150



>ref|XP_009588663.1| PREDICTED: uncharacterized protein LOC104086172 [Nicotiana tomentosiformis]
Length=153

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 102/152 (67%), Gaps = 11/152 (7%)
 Frame = -1

Query  724  NKTKNMLGILNETIKAGL--LCHNPQNKFIGKERATLHPPPPLLGQSVQFMQFHIRNATM  551
            NKT N +GI    ++  L  L    Q  F         P       SV F   H+ NAT 
Sbjct  8    NKTHNCIGIETTRLQNQLPFLHRRWQQSF-------FQPFNTSFSHSVTFRSIHL-NATK  59

Query  550  ICEVrrrrRADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENI  371
                 RRRRA+I+T+TYVLMEPGK EEFV+EEELR+RLKGWL+NWP N LP DLARFE I
Sbjct  60   TL-ATRRRRANIQTETYVLMEPGKSEEFVTEEELRDRLKGWLENWPGNELPMDLARFEEI  118

Query  370  DDAVEYLVKCVCELEIDGDAGSLQWFEVRLQQ  275
            DDAV+YLVK VCELEIDGD GS+QW+EVRLQQ
Sbjct  119  DDAVQYLVKSVCELEIDGDVGSIQWYEVRLQQ  150



>emb|CDP02319.1| unnamed protein product [Coffea canephora]
Length=158

 Score =   110 bits (274),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 102/151 (68%), Gaps = 21/151 (14%)
 Frame = -1

Query  670  LCHNPQNKFIGKE------RATLHPPPPLLGQSVQFMQ----FH--------IRNAT--M  551
            L  N   + IGK+      +  L+PP  L   S+Q M     FH        +RNA   +
Sbjct  9    LFSNTTQRVIGKKAFQQHNQLILYPPASLGHVSLQAMHSTSIFHGVPSRNKQLRNAPKHL  68

Query  550  ICEVrrrrRADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENI  371
             C +RRRR A+I T+TYVLMEPG++EEFVSEEELR RLKGWL+NWP   LP DLARFE  
Sbjct  69   TCAMRRRR-ANIPTETYVLMEPGEDEEFVSEEELRSRLKGWLENWPGKSLPPDLARFETA  127

Query  370  DDAVEYLVKCVCELEIDGDAGSLQWFEVRLQ  278
            DDAV++LVK VCELEIDGD GS+QW+EVRL+
Sbjct  128  DDAVQFLVKSVCELEIDGDVGSIQWYEVRLE  158



>ref|XP_004233386.1| PREDICTED: uncharacterized protein LOC101249885 [Solanum lycopersicum]
Length=154

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = -1

Query  523  ADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVK  344
            ++I TDTYVLMEPGK EEFV+EEELR++LK WL+NWPA  LP DLARFE+ DDAVEYLVK
Sbjct  69   SNIETDTYVLMEPGKSEEFVTEEELRDKLKSWLENWPAKTLPPDLARFEDSDDAVEYLVK  128

Query  343  CVCELEIDGDAGSLQWFEVRLQQ  275
             VCELEIDGD GSLQW++VRLQQ
Sbjct  129  SVCELEIDGDVGSLQWYQVRLQQ  151



>gb|KHG29907.1| Malate synthase G [Gossypium arboreum]
Length=159

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = -1

Query  562  NATMICEVrrrrRADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLAR  383
            NA  +C  RRRR A  RT+TYVL+EPG++E+FVSEEEL+ +LKGWL+NWP   LP DLAR
Sbjct  65   NAVKVCATRRRRAAYSRTETYVLLEPGEDEKFVSEEELKAKLKGWLENWPGKNLPLDLAR  124

Query  382  FENIDDAVEYLVKCVCELEIDGDAGSLQWFEVRLQ  278
            FE IDDAV YLV+ VCELEIDGD GS+QW+EVRL+
Sbjct  125  FEAIDDAVSYLVRSVCELEIDGDVGSIQWYEVRLE  159



>ref|XP_006363432.1| PREDICTED: uncharacterized protein LOC102581039 isoform X1 [Solanum 
tuberosum]
Length=154

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 97/150 (65%), Gaps = 6/150 (4%)
 Frame = -1

Query  724  NKTKNMLGILNETIKAGLLCHNPQNKFIGKERATLHPPPPLLGQSVQFMQFHIRNATMIC  545
            NKT N +G     ++  L   +  N     ++    P       SV   + H+     + 
Sbjct  8    NKTYNCIGTETWRVQYPLQILHTCNW----QQPIFQPFNSSFSHSVTCRRIHLNGIKTL-  62

Query  544  EVrrrrRADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDD  365
               RRRR++I TDTYVLMEPGK EEFV+EEELR++LK WL+NWP   LP DLARFE+ DD
Sbjct  63   -ATRRRRSNIETDTYVLMEPGKSEEFVTEEELRDKLKSWLENWPGKTLPPDLARFEDTDD  121

Query  364  AVEYLVKCVCELEIDGDAGSLQWFEVRLQQ  275
            AVEYLVK VCELEIDGD GSLQW++VRLQQ
Sbjct  122  AVEYLVKSVCELEIDGDVGSLQWYQVRLQQ  151



>ref|XP_006363433.1| PREDICTED: uncharacterized protein LOC102581039 isoform X2 [Solanum 
tuberosum]
Length=152

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  523  ADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVK  344
            ++I TDTYVLMEPGK EEFV+EEELR++LK WL+NWP   LP DLARFE+ DDAVEYLVK
Sbjct  67   SNIETDTYVLMEPGKSEEFVTEEELRDKLKSWLENWPGKTLPPDLARFEDTDDAVEYLVK  126

Query  343  CVCELEIDGDAGSLQWFEVRLQQ  275
             VCELEIDGD GSLQW++VRLQQ
Sbjct  127  SVCELEIDGDVGSLQWYQVRLQQ  149



>ref|XP_007032753.1| Chlororespiratory reduction 7 isoform 1 [Theobroma cacao]
 gb|EOY03679.1| Chlororespiratory reduction 7 isoform 1 [Theobroma cacao]
Length=149

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -1

Query  565  RNATMICEVrrrrRADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLA  386
            R A  IC  RRRR A  RT+TYVL+EPG+EE+FVS EEL+ +LKGWL+NWP   LP DLA
Sbjct  54   RCAVKICATRRRRAAYSRTETYVLLEPGQEEKFVSVEELKAKLKGWLENWPGKTLPPDLA  113

Query  385  RFENIDDAVEYLVKCVCELEIDGDAGSLQWFEVRLQ  278
            RF  IDDAV YLV+ VCELEIDGD GS+QW+EVRL+
Sbjct  114  RFVTIDDAVSYLVRSVCELEIDGDVGSIQWYEVRLE  149



>ref|XP_011098749.1| PREDICTED: uncharacterized protein LOC105177328 [Sesamum indicum]
Length=149

 Score =   104 bits (260),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = -1

Query  523  ADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVK  344
            A++ +DTYVLMEPGK EEFVSEEELR+RL  WL+NWP N LP DLARF+ IDDAV+YLVK
Sbjct  68   ANVDSDTYVLMEPGKNEEFVSEEELRDRLTSWLENWPGNALPPDLARFDTIDDAVDYLVK  127

Query  343  CVCELEIDGDAGSLQWFEVRLQ  278
             VCELEIDGD GS+QW++VRL+
Sbjct  128  SVCELEIDGDVGSVQWYQVRLE  149



>ref|XP_006845849.1| hypothetical protein AMTR_s00154p00036570 [Amborella trichopoda]
 gb|ERN07524.1| hypothetical protein AMTR_s00154p00036570 [Amborella trichopoda]
Length=168

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 80/99 (81%), Gaps = 2/99 (2%)
 Frame = -1

Query  568  IRNATMICEVrr--rrRADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPA  395
            IRN     +V+   RRRA ++TDTYVLMEPGK EEFVSE+EL+ RLK WL+NWP   LP 
Sbjct  70   IRNGKHFVQVKAIRRRRAYLQTDTYVLMEPGKSEEFVSEDELKTRLKAWLENWPGEELPP  129

Query  394  DLARFENIDDAVEYLVKCVCELEIDGDAGSLQWFEVRLQ  278
            DLARF++IDDAV +LVK VCELEIDGD GS+QW+EVRL+
Sbjct  130  DLARFKDIDDAVSHLVKSVCELEIDGDVGSIQWYEVRLE  168



>emb|CBI21209.3| unnamed protein product [Vitis vinifera]
Length=151

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = -1

Query  514  RTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVKCVC  335
            +T+TYVLMEPGK+EEFVS+EEL+ RLKGWL+NWP   LP DLA+F+ IDDAV YLVK VC
Sbjct  73   QTETYVLMEPGKDEEFVSQEELKARLKGWLENWPGKALPPDLAKFQTIDDAVMYLVKAVC  132

Query  334  ELEIDGDAGSLQWFEVRLQ  278
            ELEIDGD GS+QW+E+RL+
Sbjct  133  ELEIDGDVGSIQWYEIRLE  151



>ref|XP_002280011.3| PREDICTED: uncharacterized protein LOC100249838 [Vitis vinifera]
Length=158

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = -1

Query  514  RTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVKCVC  335
            +T+TYVLMEPGK+EEFVS+EEL+ RLKGWL+NWP   LP DLA+F+ IDDAV YLVK VC
Sbjct  80   QTETYVLMEPGKDEEFVSQEELKARLKGWLENWPGKALPPDLAKFQTIDDAVMYLVKAVC  139

Query  334  ELEIDGDAGSLQWFEVRLQ  278
            ELEIDGD GS+QW+E+RL+
Sbjct  140  ELEIDGDVGSIQWYEIRLE  158



>ref|XP_004306071.1| PREDICTED: uncharacterized protein LOC101297367 [Fragaria vesca 
subsp. vesca]
Length=147

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 80/98 (82%), Gaps = 1/98 (1%)
 Frame = -1

Query  571  HIRNATMICEVrrrrRADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPAD  392
            H RN   +C   RRRR    ++TYVL+EPG++E+FV+EEELR +LKGWL+NWPA  LP+D
Sbjct  51   HQRNMVKVC-AARRRRVHTDSETYVLLEPGEDEKFVTEEELRVKLKGWLENWPAKNLPSD  109

Query  391  LARFENIDDAVEYLVKCVCELEIDGDAGSLQWFEVRLQ  278
            LAR+E+IDDAV YLV+ VCELEI GD GS+QW+EVRL+
Sbjct  110  LARYESIDDAVTYLVRSVCELEIHGDVGSVQWYEVRLE  147



>gb|KCW56292.1| hypothetical protein EUGRSUZ_I02035 [Eucalyptus grandis]
Length=138

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 78/98 (80%), Gaps = 1/98 (1%)
 Frame = -1

Query  571  HIRNATMICEVrrrrRADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPAD  392
            H++N   I    RRRRA+ RT+TYVL+EPG+EE FVSEEEL+ +LK WL+NWP   LP D
Sbjct  42   HLKNIEKI-RAFRRRRANQRTETYVLLEPGQEETFVSEEELKAKLKDWLENWPRKPLPPD  100

Query  391  LARFENIDDAVEYLVKCVCELEIDGDAGSLQWFEVRLQ  278
            LAR+E +DDAV YLV  VCELEIDGD GS+QW+EVRL+
Sbjct  101  LARYETLDDAVSYLVSSVCELEIDGDVGSIQWYEVRLE  138



>gb|KCW56293.1| hypothetical protein EUGRSUZ_I02035 [Eucalyptus grandis]
Length=131

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 78/98 (80%), Gaps = 1/98 (1%)
 Frame = -1

Query  571  HIRNATMICEVrrrrRADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPAD  392
            H++N   I    RRRRA+ RT+TYVL+EPG+EE FVSEEEL+ +LK WL+NWP   LP D
Sbjct  35   HLKNIEKI-RAFRRRRANQRTETYVLLEPGQEETFVSEEELKAKLKDWLENWPRKPLPPD  93

Query  391  LARFENIDDAVEYLVKCVCELEIDGDAGSLQWFEVRLQ  278
            LAR+E +DDAV YLV  VCELEIDGD GS+QW+EVRL+
Sbjct  94   LARYETLDDAVSYLVSSVCELEIDGDVGSIQWYEVRLE  131



>ref|XP_009365925.1| PREDICTED: uncharacterized protein LOC103955746 [Pyrus x bretschneideri]
Length=159

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 81/96 (84%), Gaps = 1/96 (1%)
 Frame = -1

Query  565  RNATMICEVrrrrRADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLA  386
            R+A  +C VRRRR     ++TYVL+EPG++E+FVSE+ELR++LKGWL+NWPA  LP DLA
Sbjct  65   RDAVKVCAVRRRRIYH-NSETYVLLEPGEDEKFVSEDELRDKLKGWLENWPAKNLPPDLA  123

Query  385  RFENIDDAVEYLVKCVCELEIDGDAGSLQWFEVRLQ  278
            RFE+IDDAV YLV+ VCELEI GD GS+QW+EVR++
Sbjct  124  RFESIDDAVSYLVRSVCELEIHGDVGSVQWYEVRME  159



>ref|XP_008379432.1| PREDICTED: uncharacterized protein LOC103442427 [Malus domestica]
Length=119

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 81/96 (84%), Gaps = 1/96 (1%)
 Frame = -1

Query  565  RNATMICEVrrrrRADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLA  386
            R+A  +C VRRRR     ++TYVL+EPG++E+FVSE+ELR++LKGWL+NWPA  LP DLA
Sbjct  25   RDAVKVCAVRRRRIYH-NSETYVLLEPGEDEKFVSEDELRDKLKGWLENWPAKKLPPDLA  83

Query  385  RFENIDDAVEYLVKCVCELEIDGDAGSLQWFEVRLQ  278
            RFE+IDDAV YLV+ VCELEI GD GS+QW+EVR++
Sbjct  84   RFESIDDAVSYLVRSVCELEIHGDVGSVQWYEVRME  119



>ref|XP_009365882.1| PREDICTED: uncharacterized protein LOC103955703 [Pyrus x bretschneideri]
Length=159

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 81/96 (84%), Gaps = 1/96 (1%)
 Frame = -1

Query  565  RNATMICEVrrrrRADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLA  386
            R+A  +C VRRRR     ++TYVL+EPG++E+FVSE+ELR++LKGWL+NWPA  LP DLA
Sbjct  65   RDAVKVCAVRRRRIYH-NSETYVLLEPGEDEKFVSEDELRDKLKGWLENWPAKNLPPDLA  123

Query  385  RFENIDDAVEYLVKCVCELEIDGDAGSLQWFEVRLQ  278
            RFE+IDDAV YLV+ VCELEI GD GS+QW+EVR++
Sbjct  124  RFESIDDAVSYLVRSVCELEIHGDVGSVQWYEVRME  159



>ref|XP_010029388.1| PREDICTED: uncharacterized protein LOC104419424 [Eucalyptus grandis]
 gb|KCW56291.1| hypothetical protein EUGRSUZ_I02035 [Eucalyptus grandis]
Length=156

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 78/98 (80%), Gaps = 1/98 (1%)
 Frame = -1

Query  571  HIRNATMICEVrrrrRADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPAD  392
            H++N   I    RRRRA+ RT+TYVL+EPG+EE FVSEEEL+ +LK WL+NWP   LP D
Sbjct  60   HLKNIEKI-RAFRRRRANQRTETYVLLEPGQEETFVSEEELKAKLKDWLENWPRKPLPPD  118

Query  391  LARFENIDDAVEYLVKCVCELEIDGDAGSLQWFEVRLQ  278
            LAR+E +DDAV YLV  VCELEIDGD GS+QW+EVRL+
Sbjct  119  LARYETLDDAVSYLVSSVCELEIDGDVGSIQWYEVRLE  156



>ref|XP_010258044.1| PREDICTED: uncharacterized protein LOC104597942 [Nelumbo nucifera]
Length=161

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 99/157 (63%), Gaps = 17/157 (11%)
 Frame = -1

Query  730  EKNKTKNMLGILNETIKAGLLCHNPQNKFIGKERATLHPPP------PLLGQSVQFMQFH  569
            EKN+  N L   N        C      FI    A   P         L+  +++ M+  
Sbjct  16   EKNRLNNGLHSFN--------CKQLSGCFIQSSFARSRPVAKSDKMGSLIYSTLRTME--  65

Query  568  IRNATMICEVrrrrRADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADL  389
             R+  +IC +RRRR A ++TDTYVL+EPGK EEFVSEEEL+ RLK WL+NWP N LP DL
Sbjct  66   KRDKFLICAMRRRR-AYLQTDTYVLLEPGKGEEFVSEEELKARLKYWLENWPGNALPPDL  124

Query  388  ARFENIDDAVEYLVKCVCELEIDGDAGSLQWFEVRLQ  278
            A F+ IDDAV +LVK VCELEIDG+ GS+QW+EVRL+
Sbjct  125  ASFKTIDDAVSHLVKSVCELEIDGEVGSVQWYEVRLE  161



>ref|NP_001172577.1| Os01g0763650 [Oryza sativa Japonica Group]
 dbj|BAD87136.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD87356.1| unknown protein [Oryza sativa Japonica Group]
 gb|EEE55425.1| hypothetical protein OsJ_03554 [Oryza sativa Japonica Group]
 dbj|BAH91307.1| Os01g0763650 [Oryza sativa Japonica Group]
Length=151

 Score = 99.0 bits (245),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 80/98 (82%), Gaps = 1/98 (1%)
 Frame = -1

Query  571  HIRNATMICEVrrrrRADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPAD  392
            H+    ++C   RRRRADI+++TYVLMEPG+EEEFVS+EEL  RL+GWL+ WP   LP D
Sbjct  55   HVIQVVVVC-AARRRRADIQSETYVLMEPGEEEEFVSKEELEGRLRGWLERWPGGELPPD  113

Query  391  LARFENIDDAVEYLVKCVCELEIDGDAGSLQWFEVRLQ  278
            LARF+ +DDAV YLV+ VCELEIDG+ GS+QW++V+L+
Sbjct  114  LARFDTVDDAVSYLVRSVCELEIDGEVGSVQWYQVQLE  151



>dbj|BAJ90441.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92847.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=151

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = -1

Query  523  ADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVK  344
            ADI++DTYVL+EPG EEEFVS+EEL ERL+GWL+ WP   LP DLARF+ +DDAV YLV+
Sbjct  70   ADIQSDTYVLLEPGMEEEFVSKEELEERLRGWLERWPGGALPPDLARFDTVDDAVSYLVR  129

Query  343  CVCELEIDGDAGSLQWFEVRLQ  278
             VCELE+DG+ GS+QW++V+++
Sbjct  130  SVCELEVDGEVGSVQWYQVQIE  151



>gb|EYU44199.1| hypothetical protein MIMGU_mgv1a015898mg [Erythranthe guttata]
Length=141

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  520  DIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVKC  341
            +  +DTYVLMEPGK EEFV+EEEL E+L+ WL+NWP + LP DLARF++IDDAV YLVK 
Sbjct  61   NTESDTYVLMEPGKNEEFVTEEELSEKLRNWLENWPGDDLPTDLARFDSIDDAVLYLVKS  120

Query  340  VCELEIDGDAGSLQWFEVRL  281
            VCELEIDGD GS+QW++VRL
Sbjct  121  VCELEIDGDVGSIQWYQVRL  140



>ref|XP_008230882.1| PREDICTED: uncharacterized protein LOC103330109 [Prunus mume]
Length=156

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 83/112 (74%), Gaps = 5/112 (4%)
 Frame = -1

Query  601  LGQSVQFMQFHIR----NATMICEVrrrrRADIRTDTYVLMepgkeeefvseeelrERLK  434
            L  SV    F  R    +A  +C VRRRR     ++TYVL+EPG++E+FVSEEELR +LK
Sbjct  46   LSSSVHLKLFKTRSEQRDAVKVCAVRRRRIYH-NSETYVLLEPGEDEKFVSEEELRAKLK  104

Query  433  GWLQNWPANGLPADLARFENIDDAVEYLVKCVCELEIDGDAGSLQWFEVRLQ  278
            G L+NWPA  LP DLARFE+IDDAV YLV+ VCELEI GD GS+QW+EVRL+
Sbjct  105  GRLENWPAKNLPPDLARFESIDDAVSYLVRSVCELEIHGDVGSVQWYEVRLE  156



>emb|CDM82438.1| unnamed protein product [Triticum aestivum]
Length=151

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = -1

Query  523  ADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVK  344
            ADI++DTYVL+EPG +EEFVS+EEL ERL+GWL+ WP   LP DLARF+ +DDAV YLV+
Sbjct  70   ADIQSDTYVLLEPGMDEEFVSKEELEERLRGWLERWPGGALPPDLARFDTVDDAVSYLVR  129

Query  343  CVCELEIDGDAGSLQWFEVRLQ  278
             VCELE+DG+ GS+QW++V+++
Sbjct  130  SVCELEVDGEVGSVQWYQVQIE  151



>ref|XP_007215076.1| hypothetical protein PRUPE_ppa012522mg [Prunus persica]
 gb|EMJ16275.1| hypothetical protein PRUPE_ppa012522mg [Prunus persica]
Length=166

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 79/96 (82%), Gaps = 1/96 (1%)
 Frame = -1

Query  565  RNATMICEVrrrrRADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLA  386
            R+A  +C VRRRR     ++TYVL+EPG++E+FVSEEELR +LKG L+NWPA  LP DLA
Sbjct  72   RDAVKVCAVRRRRIYH-NSETYVLLEPGEDEKFVSEEELRAKLKGRLENWPAKNLPPDLA  130

Query  385  RFENIDDAVEYLVKCVCELEIDGDAGSLQWFEVRLQ  278
            RFE+IDDAV YLV+ VCELEI GD GS+QW+EVRL+
Sbjct  131  RFESIDDAVSYLVRSVCELEIHGDVGSVQWYEVRLE  166



>ref|NP_568563.1| protein CHLORORESPIRATORY REDUCTION 7 [Arabidopsis thaliana]
 dbj|BAB09375.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL38808.1| unknown protein [Arabidopsis thaliana]
 gb|AAM45076.1| unknown protein [Arabidopsis thaliana]
 gb|AED94408.1| chlororespiratory reduction 7 [Arabidopsis thaliana]
Length=156

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = -1

Query  511  TDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVKCVCE  332
            +DTYVL+E G++E+FV+E+EL+ +L+GWL+NWP N LP DLARF+++D+AV++LVK VCE
Sbjct  79   SDTYVLLEAGQDEQFVTEDELKAKLRGWLENWPVNSLPPDLARFDDLDEAVDFLVKAVCE  138

Query  331  LEIDGDAGSLQWFEVRLQ  278
            LEIDG+ GS+QW++VRL+
Sbjct  139  LEIDGEVGSVQWYQVRLE  156



>ref|XP_004970060.1| PREDICTED: uncharacterized protein LOC101779891 [Setaria italica]
Length=146

 Score = 96.7 bits (239),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 90/135 (67%), Gaps = 13/135 (10%)
 Frame = -1

Query  682  KAGLLCHNPQNKFIGKERATLHPPPPLLGQSVQFMQFHIRNATMICEVrrrrRADIRTDT  503
            +  LL H  ++  +    A+L  PP         +Q H    + +C V RRRRADI++DT
Sbjct  25   RRSLLPHR-RSGAVSFSTASLKRPP--------RIQHH---GSQVC-VARRRRADIQSDT  71

Query  502  YVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVKCVCELEI  323
            YVL+EPG EEEFVS EEL  RLKGWL+ WP + LP DLA+F  +DDAV YLV+ VC LEI
Sbjct  72   YVLIEPGMEEEFVSREELEARLKGWLEKWPRDALPPDLAKFNTVDDAVSYLVRAVCVLEI  131

Query  322  DGDAGSLQWFEVRLQ  278
            DG+ GS+QW++V L+
Sbjct  132  DGEVGSVQWYQVELE  146



>ref|XP_009407395.1| PREDICTED: uncharacterized protein LOC103990089 [Musa acuminata 
subsp. malaccensis]
Length=156

 Score = 96.7 bits (239),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -1

Query  523  ADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVK  344
            A +++DTYVL+EPGK EEFV+EEELR RLKGWL+NWPAN LP DLA F  +DDAV +LV+
Sbjct  75   AYLQSDTYVLLEPGKSEEFVTEEELRLRLKGWLENWPANALPPDLAEFNTVDDAVSHLVR  134

Query  343  CVCELEIDGDAGSLQWFEVRLQ  278
             VCELEIDG  GS+QW++V+L+
Sbjct  135  SVCELEIDGQLGSIQWYQVQLE  156



>ref|XP_010670166.1| PREDICTED: uncharacterized protein LOC104887258 [Beta vulgaris 
subsp. vulgaris]
Length=153

 Score = 96.3 bits (238),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -1

Query  511  TDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVKCVCE  332
            TDTYV +EPGK EEFVSEEEL+ +LK WL+NWP   LP DLARFE +DDAV +LVK VCE
Sbjct  76   TDTYVYLEPGKSEEFVSEEELKMKLKVWLENWPNKVLPPDLARFETLDDAVSFLVKSVCE  135

Query  331  LEIDGDAGSLQWFEVRLQ  278
            LEIDGD GS+QW+EVRL+
Sbjct  136  LEIDGDVGSIQWYEVRLE  153



>ref|XP_010089634.1| hypothetical protein L484_021027 [Morus notabilis]
 gb|EXB38105.1| hypothetical protein L484_021027 [Morus notabilis]
Length=163

 Score = 96.7 bits (239),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = -1

Query  514  RTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVKCVC  335
            RT+TYVL+EPG++E FVSEEELR  LKGWL+ WP   LP DLARFE+IDDAV +LV  VC
Sbjct  85   RTETYVLLEPGQDERFVSEEELRATLKGWLEKWPGKSLPPDLARFESIDDAVSFLVNSVC  144

Query  334  ELEIDGDAGSLQWFEVRLQ  278
            ELEI GD GS+QW+EVRL+
Sbjct  145  ELEIQGDVGSVQWYEVRLE  163



>ref|XP_006405656.1| hypothetical protein EUTSA_v10027973mg [Eutrema salsugineum]
 gb|ESQ47109.1| hypothetical protein EUTSA_v10027973mg [Eutrema salsugineum]
Length=156

 Score = 96.3 bits (238),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 80/96 (83%), Gaps = 1/96 (1%)
 Frame = -1

Query  565  RNATMICEVrrrrRADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLA  386
            +N T +C +RRRR     +DTYVL+E G++E+FVSE+EL+ +LKGWL+NWPA  LP DLA
Sbjct  62   KNHTRVCAIRRRRVHS-NSDTYVLLEAGQDEQFVSEDELKAKLKGWLENWPAESLPPDLA  120

Query  385  RFENIDDAVEYLVKCVCELEIDGDAGSLQWFEVRLQ  278
            RF+++D+AV++LVK VCELEI G+ GS+QW++VRL+
Sbjct  121  RFDDLDEAVDFLVKAVCELEIYGEVGSVQWYQVRLE  156



>ref|XP_003554915.1| PREDICTED: uncharacterized protein LOC100801516 [Glycine max]
 gb|KHN48825.1| hypothetical protein glysoja_030595 [Glycine soja]
Length=152

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = -1

Query  565  RNATMICEVrrrrRADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLA  386
            R+ T +  +RRRRRA+ RT+TYVL+EPG++E FVSEEEL+  LK  L+NWP   LP DL+
Sbjct  57   RSKTKVFALRRRRRANERTETYVLLEPGQDERFVSEEELKATLKELLENWPGKVLPPDLS  116

Query  385  RFENIDDAVEYLVKCVCELEIDGDAGSLQWFEVRLQ  278
            R+ENIDDAV +LV+ VCELEIDGD GS+QW+EVRL+
Sbjct  117  RYENIDDAVSFLVRSVCELEIDGDVGSIQWYEVRLE  152



>ref|NP_001143831.1| hypothetical protein [Zea mays]
 gb|ACG35793.1| hypothetical protein [Zea mays]
 gb|ACN28269.1| unknown [Zea mays]
 tpg|DAA57527.1| TPA: hypothetical protein ZEAMMB73_956194 [Zea mays]
Length=171

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -1

Query  523  ADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVK  344
            ADI++DTYVLMEPG +E FVS EEL ERLKGWL+NWP + LP DLARF  +D+AV YLV+
Sbjct  90   ADIQSDTYVLMEPGMDEAFVSREELEERLKGWLKNWPRDTLPPDLARFGTVDEAVSYLVR  149

Query  343  CVCELEIDGDAGSLQWFEVRL  281
             VC LEIDGD GS++W++V+L
Sbjct  150  SVCVLEIDGDVGSVEWYQVQL  170



>ref|XP_006646352.1| PREDICTED: uncharacterized protein LOC102722269 [Oryza brachyantha]
Length=153

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -1

Query  520  DIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVKC  341
            DIR++TYVLMEPG+EEEFVS+EEL +RL+ WL+ WP   LP DLARF+ +DDAV YLV+ 
Sbjct  73   DIRSETYVLMEPGEEEEFVSKEELEDRLRAWLERWPGGELPPDLARFDTVDDAVSYLVRS  132

Query  340  VCELEIDGDAGSLQWFEVRLQ  278
            VCELEIDG+ GS+QW++V+L+
Sbjct  133  VCELEIDGEVGSVQWYQVQLE  153



>ref|XP_004489463.1| PREDICTED: uncharacterized protein LOC101509461 [Cicer arietinum]
Length=152

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -1

Query  523  ADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVK  344
            A+ RTDTYVL+EPGK+E FVSEEEL+  LK WL N P N LP DLARFE IDDAV +L K
Sbjct  71   ANERTDTYVLLEPGKDERFVSEEELKATLKDWLTNRPGNSLPPDLARFETIDDAVSFLAK  130

Query  343  CVCELEIDGDAGSLQWFEVRLQ  278
              CELEIDG+ GS+QW+EVRL+
Sbjct  131  SFCELEIDGEVGSIQWYEVRLE  152



>gb|AAM62952.1| unknown [Arabidopsis thaliana]
Length=156

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -1

Query  511  TDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVKCVCE  332
            +DTYVL+E G++E+FV+E+EL+ +L+ WL+NWP N LP DLARF+++D+AV++LVK VCE
Sbjct  79   SDTYVLLEAGQDEQFVTEDELKAKLREWLENWPVNSLPPDLARFDDLDEAVDFLVKAVCE  138

Query  331  LEIDGDAGSLQWFEVRLQ  278
            LEIDG+ GS+QW++VRL+
Sbjct  139  LEIDGEVGSVQWYQVRLE  156



>ref|XP_008805134.1| PREDICTED: uncharacterized protein LOC103718208 [Phoenix dactylifera]
Length=152

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = -1

Query  523  ADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVK  344
            A +++DTYVL+EPGK EEFVSEEELR RLKGWL+NWP N LP DLAR ++ID AV +LV+
Sbjct  71   AYLQSDTYVLLEPGKSEEFVSEEELRVRLKGWLENWPGNVLPPDLARLDSIDAAVSHLVR  130

Query  343  CVCELEIDGDAGSLQWFEVRLQ  278
             VCELEIDG+AGS+QW++V+L+
Sbjct  131  SVCELEIDGEAGSIQWYKVQLE  152



>ref|XP_002870799.1| hypothetical protein ARALYDRAFT_916402 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47058.1| hypothetical protein ARALYDRAFT_916402 [Arabidopsis lyrata subsp. 
lyrata]
Length=157

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -1

Query  511  TDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVKCVCE  332
            +DTYVL+E G++E+FVSE+EL+ +L+GWL+NWP N LP DLARF ++D+AV++LVK VCE
Sbjct  80   SDTYVLLEAGQDEQFVSEDELKAKLRGWLENWPVNSLPPDLARFNDLDEAVDFLVKAVCE  139

Query  331  LEIDGDAGSLQWFEVRLQ  278
            LEI G+ GS+QW++VRL+
Sbjct  140  LEIHGEVGSVQWYQVRLE  157



>gb|KDP27244.1| hypothetical protein JCGZ_19943 [Jatropha curcas]
Length=159

 Score = 94.0 bits (232),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = -1

Query  514  RTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVKCVC  335
            RT+TYVL+EPG++E+FVSEEEL+ +LK +L+NWP   LP DLARF+ IDDAV +LV  VC
Sbjct  81   RTETYVLLEPGQDEKFVSEEELKVKLKHYLENWPKKSLPPDLARFDTIDDAVSFLVSSVC  140

Query  334  ELEIDGDAGSLQWFEVRLQ  278
            ELEIDGD G++QW+EVRL+
Sbjct  141  ELEIDGDVGTVQWYEVRLE  159



>gb|EMT31311.1| Glycerophosphoryl diester phosphodiesterase [Aegilops tauschii]
Length=571

 Score = 98.6 bits (244),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -1

Query  523  ADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVK  344
            ADI++DTYVL+EPG +EEFVS+EEL  RL+GWL+ WP   LP DLARF+ +DDAV YLV+
Sbjct  490  ADIQSDTYVLLEPGMDEEFVSKEELEVRLRGWLERWPGGALPPDLARFDTVDDAVSYLVR  549

Query  343  CVCELEIDGDAGSLQWFEVRLQ  278
             VCELE+DG+ GS+QW++V+++
Sbjct  550  SVCELEVDGEVGSVQWYQVQIE  571



>ref|XP_009140213.1| PREDICTED: uncharacterized protein LOC103864210 [Brassica rapa]
 emb|CDY15954.1| BnaA04g11570D [Brassica napus]
Length=156

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -1

Query  511  TDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVKCVCE  332
            +DTYVL+E G++E+FVSE+EL+ +LKGWL+NWP   LP DLARF+N+D+AV++LVK VCE
Sbjct  79   SDTYVLLEAGQDEQFVSEDELKAKLKGWLENWPVESLPPDLARFDNLDEAVDFLVKAVCE  138

Query  331  LEIDGDAGSLQWFEVRLQ  278
            LE+ G+ GS+QW++VRL+
Sbjct  139  LEVYGEVGSVQWYQVRLE  156



>gb|EEC71530.1| hypothetical protein OsI_03844 [Oryza sativa Indica Group]
Length=540

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 80/98 (82%), Gaps = 1/98 (1%)
 Frame = -1

Query  571  HIRNATMICEVrrrrRADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPAD  392
            H+    ++C   RRRRADI+++TYVLMEPG+EEEFVS+EEL  RL+GWL+ WP   LP D
Sbjct  444  HVIQVVVVC-AARRRRADIQSETYVLMEPGEEEEFVSKEELEGRLRGWLERWPGGELPPD  502

Query  391  LARFENIDDAVEYLVKCVCELEIDGDAGSLQWFEVRLQ  278
            LARF+ +DDAV YLV+ VCELE+DG+ GS+QW++V+L+
Sbjct  503  LARFDTVDDAVSYLVRSVCELEVDGEVGSVQWYQVQLE  540



>emb|CDX99667.1| BnaC04g34240D [Brassica napus]
Length=156

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -1

Query  511  TDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVKCVCE  332
            +DTYVL+E G++E+FVSE+EL+ +LKGWL+NWP   LP DLARF+N+D+AV++LVK VCE
Sbjct  79   SDTYVLLEAGQDEQFVSEDELKAKLKGWLENWPVESLPPDLARFDNLDEAVDFLVKAVCE  138

Query  331  LEIDGDAGSLQWFEVRLQ  278
            LE+ G+ GS+QW++VRL+
Sbjct  139  LEVYGEVGSVQWYQVRLE  156



>gb|KFK33207.1| hypothetical protein AALP_AA6G344700, partial [Arabis alpina]
Length=90

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -1

Query  511  TDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVKCVCE  332
            +DTYVL+E G++E+FVSE+EL+E+LKGWL+NWP   LP DLARF+++D+AV++LVK VCE
Sbjct  13   SDTYVLLEAGQDEQFVSEDELKEKLKGWLENWPEKSLPPDLARFDDLDEAVDFLVKAVCE  72

Query  331  LEIDGDAGSLQWFEVRLQ  278
            LEI G+ GS+QW++VRL+
Sbjct  73   LEIYGEVGSVQWYQVRLE  90



>ref|XP_010552531.1| PREDICTED: uncharacterized protein LOC104822868 [Tarenaya hassleriana]
Length=158

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -1

Query  511  TDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVKCVCE  332
            ++TYVL+E G+EE+FVSE+EL+E+L+GWL++WP   LP DLARF +IDDAVEYLV+ VCE
Sbjct  81   SETYVLLEAGQEEQFVSEDELKEKLRGWLESWPEGSLPPDLARFRDIDDAVEYLVRSVCE  140

Query  331  LEIDGDAGSLQWFEVRLQ  278
            LEI G+ GS+QW++VRL+
Sbjct  141  LEIHGEVGSVQWYQVRLE  158



>ref|XP_007151331.1| hypothetical protein PHAVU_004G037200g [Phaseolus vulgaris]
 gb|ACZ74666.1| hypothetical protein [Phaseolus vulgaris]
 gb|ESW23325.1| hypothetical protein PHAVU_004G037200g [Phaseolus vulgaris]
Length=152

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -1

Query  565  RNATMICEVrrrrRADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLA  386
            R+ T +   RRR+RA+ RT+TYVL+EPGK+E FVSEEEL+  LK  L+NWP   LP DL+
Sbjct  57   RSKTKVFAARRRKRANERTETYVLLEPGKDERFVSEEELKATLKELLENWPGKVLPPDLS  116

Query  385  RFENIDDAVEYLVKCVCELEIDGDAGSLQWFEVRLQ  278
            R+E+ID+AV +LV+ VCELEIDGD GS+QW+EVRL+
Sbjct  117  RYEDIDEAVSFLVRYVCELEIDGDVGSVQWYEVRLE  152



>gb|AFK35111.1| unknown [Lotus japonicus]
Length=151

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = -1

Query  523  ADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVK  344
            A+ RT+TYVL+EPG++E+FVSEEEL+  LK  L NWP   LP DLAR+E ID+AV +LV+
Sbjct  70   ANERTETYVLLEPGEDEKFVSEEELKATLKERLTNWPGKALPPDLARYETIDEAVSFLVR  129

Query  343  CVCELEIDGDAGSLQWFEVRLQ  278
             VCELEIDGD GS+QW+EVRL+
Sbjct  130  SVCELEIDGDVGSVQWYEVRLE  151



>ref|XP_010906148.1| PREDICTED: uncharacterized protein LOC105033162 [Elaeis guineensis]
Length=152

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 82/100 (82%), Gaps = 5/100 (5%)
 Frame = -1

Query  577  QFHIRNATMICEVrrrrRADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLP  398
            +FH++ + +     RRRRA +++DTYVL+EPGK EEFVSE+ELR RLKGWL+N P N LP
Sbjct  58   KFHVKVSAV-----RRRRAYLQSDTYVLLEPGKSEEFVSEDELRVRLKGWLENSPGNVLP  112

Query  397  ADLARFENIDDAVEYLVKCVCELEIDGDAGSLQWFEVRLQ  278
             DLARF++ID AV +LV+ VCELEIDG+ GS+QW++V+L+
Sbjct  113  PDLARFDSIDAAVSHLVRSVCELEIDGEVGSIQWYQVQLE  152



>ref|XP_006282750.1| hypothetical protein CARUB_v10005940mg [Capsella rubella]
 gb|EOA15648.1| hypothetical protein CARUB_v10005940mg [Capsella rubella]
Length=153

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -1

Query  511  TDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVKCVCE  332
            +DTYVL+E G++E+FVSE+EL+ +L+GWL+NWP   LP DLARF+++D+AV++LVK VCE
Sbjct  76   SDTYVLLEAGQDEQFVSEDELKAKLRGWLENWPVEHLPPDLARFDDLDEAVDFLVKAVCE  135

Query  331  LEIDGDAGSLQWFEVRLQ  278
            LEI G+ GS+QW++VRL+
Sbjct  136  LEIHGEVGSVQWYQVRLE  153



>ref|XP_010450831.1| PREDICTED: uncharacterized protein LOC104732926 [Camelina sativa]
Length=160

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 90/134 (67%), Gaps = 11/134 (8%)
 Frame = -1

Query  655  QNKFIGKERATLHPPPPLLGQSVQFMQF--------HIRNATMICEVrrrrRADIRTDTY  500
            QN+++  E+        LL  S+    +          +N + +C   RRRR    ++TY
Sbjct  30   QNRWVSIEQ--FRVTESLLSNSINMFHYSCPILSTRRSKNHSRVC-ATRRRRVHSNSETY  86

Query  499  VLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVKCVCELEID  320
            VL+E G++E+FVSE+EL+ +L+GWL+NWP   LP DLARF+++DDAV++LVK VCELEI 
Sbjct  87   VLLEAGQDEQFVSEDELKAKLRGWLENWPVEFLPPDLARFDDLDDAVDFLVKAVCELEIH  146

Query  319  GDAGSLQWFEVRLQ  278
            G+ GS+QW++VRL+
Sbjct  147  GEVGSVQWYQVRLE  160



>ref|XP_010435822.1| PREDICTED: uncharacterized protein LOC104719576 [Camelina sativa]
Length=153

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -1

Query  511  TDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVKCVCE  332
            ++TYVL+E G++E+FVSE+EL+ +L+GWL+NWP   LP DLARF+++DDAV++LVK VCE
Sbjct  76   SETYVLLEAGQDEQFVSEDELKAKLRGWLENWPVEFLPPDLARFDDLDDAVDFLVKAVCE  135

Query  331  LEIDGDAGSLQWFEVRLQ  278
            LEI G+ GS+QW++VRL+
Sbjct  136  LEIHGEVGSVQWYQVRLE  153



>ref|XP_010441039.1| PREDICTED: uncharacterized protein LOC104724276 [Camelina sativa]
Length=153

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -1

Query  511  TDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVKCVCE  332
            ++TYVL+E G++E+FVSE+EL+ +L+GWL+NWP   LP DLARF+++DDAV++LVK VCE
Sbjct  76   SETYVLLEAGQDEQFVSEDELKAKLRGWLENWPVEFLPPDLARFDDLDDAVDFLVKAVCE  135

Query  331  LEIDGDAGSLQWFEVRLQ  278
            LEI G+ GS+QW++VRL+
Sbjct  136  LEIHGEVGSVQWYQVRLE  153



>ref|XP_011009395.1| PREDICTED: uncharacterized protein LOC105114530 [Populus euphratica]
Length=161

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = -1

Query  514  RTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVKCVC  335
            +T TYVL+EPG++E+FVSEEEL+  LKG+L+NWP   LP DLA+FE +DDA  +LV  VC
Sbjct  83   KTGTYVLLEPGEDEKFVSEEELKAVLKGYLENWPRPTLPLDLAKFETVDDAASFLVSSVC  142

Query  334  ELEIDGDAGSLQWFEVRLQ  278
            ELEIDGD GS+QW+EVRL+
Sbjct  143  ELEIDGDVGSVQWYEVRLE  161



>ref|XP_003569879.2| PREDICTED: LOW QUALITY PROTEIN: glycerophosphodiester phosphodiesterase 
GDPD6-like [Brachypodium distachyon]
Length=564

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  559  ATMICEVrrrrRADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARF  380
             T +    RRRRADI++DTYVL+EPG EEEFVS+EEL  RL+GWL+ WP + LP DLA F
Sbjct  471  TTKVVAAARRRRADIQSDTYVLLEPGMEEEFVSKEELEARLRGWLERWPGDELPPDLAVF  530

Query  379  ENIDDAVEYLVKCVCELEIDGDAGSLQWFEVRLQ  278
            + +DDAV YLV+ VCELEIDG+ GS+QW++V+L+
Sbjct  531  DTLDDAVSYLVRSVCELEIDGEVGSVQWYQVQLE  564



>ref|XP_002306021.2| hypothetical protein POPTR_0004s11950g [Populus trichocarpa]
 gb|ABK96413.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE86532.2| hypothetical protein POPTR_0004s11950g [Populus trichocarpa]
Length=162

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = -1

Query  514  RTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVKCVC  335
            +T TYVL+EPG++E+FVSEEEL+  LKG+L+NWP   LP DLA+FE +DDA  +LV  VC
Sbjct  84   KTGTYVLLEPGEDEKFVSEEELKAVLKGYLENWPRPTLPLDLAKFETVDDAASFLVSSVC  143

Query  334  ELEIDGDAGSLQWFEVRLQ  278
            ELEIDGD GS+QW+EVRL+
Sbjct  144  ELEIDGDVGSVQWYEVRLE  162



>ref|XP_004173511.1| PREDICTED: uncharacterized LOC101214040 [Cucumis sativus]
Length=161

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 67/77 (87%), Gaps = 1/77 (1%)
 Frame = -1

Query  511  TDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVKCVCE  332
            +DTYVL+EPG+EE+FVS++EL   LKGWL+NWP   LP DL+RF++I++AV +LVK VCE
Sbjct  85   SDTYVLLEPGEEEKFVSKQELETILKGWLENWPT-PLPPDLSRFQSIEEAVSFLVKSVCE  143

Query  331  LEIDGDAGSLQWFEVRL  281
            LEIDGD GS+QW+EVR+
Sbjct  144  LEIDGDVGSIQWYEVRI  160



>ref|XP_004151801.1| PREDICTED: uncharacterized protein LOC101214040 [Cucumis sativus]
 gb|KGN53677.1| hypothetical protein Csa_4G101280 [Cucumis sativus]
Length=162

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 67/77 (87%), Gaps = 1/77 (1%)
 Frame = -1

Query  511  TDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVKCVCE  332
            +DTYVL+EPG+EE+FVS++EL   LKGWL+NWP   LP DL+RF++I++AV +LVK VCE
Sbjct  86   SDTYVLLEPGEEEKFVSKQELETILKGWLENWPT-PLPPDLSRFQSIEEAVTFLVKSVCE  144

Query  331  LEIDGDAGSLQWFEVRL  281
            LEIDGD GS+QW+EVR+
Sbjct  145  LEIDGDVGSIQWYEVRI  161



>gb|KDO72767.1| hypothetical protein CISIN_1g034246mg [Citrus sinensis]
 gb|KDO72768.1| hypothetical protein CISIN_1g034246mg [Citrus sinensis]
 gb|KDO72769.1| hypothetical protein CISIN_1g034246mg [Citrus sinensis]
Length=100

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 72/95 (76%), Gaps = 4/95 (4%)
 Frame = -1

Query  550  ICEVrrrrRADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPA----NGLPADLAR  383
            IC  RRRR A  RT+TYVL+EPG EE+FV+EEEL+ RLK WL+NW       GLP DLA+
Sbjct  6    ICATRRRRMAYSRTETYVLLEPGVEEKFVTEEELKARLKYWLENWAGQVGKGGLPPDLAK  65

Query  382  FENIDDAVEYLVKCVCELEIDGDAGSLQWFEVRLQ  278
            F  ID+AV +L+  VCELE+ GD GS+QW+EVRL+
Sbjct  66   FATIDEAVAFLITNVCELELQGDVGSIQWYEVRLE  100



>ref|XP_006482751.1| PREDICTED: uncharacterized protein LOC102607169 isoform X1 [Citrus 
sinensis]
Length=158

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 73/98 (74%), Gaps = 4/98 (4%)
 Frame = -1

Query  559  ATMICEVrrrrRADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPAN----GLPAD  392
            A  IC  RRRR A  RT+TYVL+EPG EE+FV+EEEL+ RLK WL+NW       GLP D
Sbjct  61   AAKICATRRRRMAYSRTETYVLLEPGVEEKFVTEEELKARLKYWLENWAGQVGKGGLPPD  120

Query  391  LARFENIDDAVEYLVKCVCELEIDGDAGSLQWFEVRLQ  278
            LA+F  ID+AV +L+  VCELE+ GD GS+QW+EVRL+
Sbjct  121  LAKFATIDEAVAFLITNVCELELQGDVGSIQWYEVRLE  158



>ref|XP_006431297.1| hypothetical protein CICLE_v10012981mg [Citrus clementina]
 gb|ESR44537.1| hypothetical protein CICLE_v10012981mg [Citrus clementina]
Length=158

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 74/98 (76%), Gaps = 4/98 (4%)
 Frame = -1

Query  559  ATMICEVrrrrRADIRTDTYVLMepgkeeefvseeelrERLKGWLQNWPA----NGLPAD  392
            A  IC  RRRR A  RT+TYVL+EPG+EE+FV+EEEL+ RLK WL+NW       GLP D
Sbjct  61   AAKICATRRRRMAYSRTETYVLLEPGEEEKFVTEEELKARLKYWLENWAGQVGKGGLPPD  120

Query  391  LARFENIDDAVEYLVKCVCELEIDGDAGSLQWFEVRLQ  278
            LA+F  ID+AV +L+  VCELE+ GD GS+QW+EVRL+
Sbjct  121  LAKFATIDEAVAFLITNVCELELQGDVGSIQWYEVRLE  158



>ref|XP_002456392.1| hypothetical protein SORBIDRAFT_03g035380 [Sorghum bicolor]
 gb|EES01512.1| hypothetical protein SORBIDRAFT_03g035380 [Sorghum bicolor]
Length=72

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 33/55 (60%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -1

Query  442  RLKGWLQNWPANGLPADLARFENIDDAVEYLVKCVCELEIDGDAGSLQWFEVRLQ  278
            RLK WL+NWP + LP DLARF+ +D AV YLV+ VC LEIDG+ GS++W++V L+
Sbjct  18   RLKRWLENWPGDALPPDLARFDTVDAAVSYLVRSVCVLEIDGEVGSVEWYQVELE  72



>ref|XP_008462928.1| PREDICTED: uncharacterized protein LOC103501190 [Cucumis melo]
Length=194

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = -1

Query  511  TDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVKCVCE  332
            +DTYVL+EPG+EE+FVS++EL   LK WL+NWP + LP DL+RF++I++AV +LVK VCE
Sbjct  86   SDTYVLLEPGEEEKFVSKQELETILKVWLENWPTS-LPPDLSRFQSIEEAVSFLVKSVCE  144

Query  331  LEIDGDAGSLQWFEV  287
            LEIDGD GS+QW+++
Sbjct  145  LEIDGDVGSIQWYQM  159



>ref|XP_001776854.1| predicted protein [Physcomitrella patens]
 gb|EDQ58404.1| predicted protein [Physcomitrella patens]
Length=95

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = -1

Query  511  TDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVKCVCE  332
             +TYVLMEPG++E+FV+ EEL+ERLK WLQ WP   LP DLA+F  +D+AV+YL+  VCE
Sbjct  18   AETYVLMEPGEDEQFVTAEELQERLKNWLQEWPGEELPVDLAKFPTLDEAVQYLLNAVCE  77

Query  331  LEIDGDAGSLQWFEVRL  281
            L++    GS+QWFEVRL
Sbjct  78   LDLGDGQGSIQWFEVRL  94



>ref|XP_002993242.1| hypothetical protein SELMODRAFT_136743 [Selaginella moellendorffii]
 gb|EFJ05663.1| hypothetical protein SELMODRAFT_136743 [Selaginella moellendorffii]
Length=84

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 42/79 (53%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = -1

Query  508  DTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVKCVCEL  329
            DT+VL+EPG++E FVS E+L+ R+K WL+ WP+  LP DL  F+ +D+A  +LV   CEL
Sbjct  6    DTFVLLEPGEDEVFVSMEQLQSRIKSWLERWPSGSLPFDLQNFKTLDEAASHLVSNSCEL  65

Query  328  EIDGDAGSLQWFEVRLQQQ  272
            EI G  GS+QWF+VRL+++
Sbjct  66   EIGGGFGSIQWFQVRLEER  84



>ref|XP_002993783.1| hypothetical protein SELMODRAFT_137591 [Selaginella moellendorffii]
 gb|EFJ05149.1| hypothetical protein SELMODRAFT_137591 [Selaginella moellendorffii]
Length=84

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 42/79 (53%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = -1

Query  508  DTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVKCVCEL  329
            DT+VL+EPG++E FVS E+L+ R+K WL+ WP+  LP DL  F+ +D+A  +LV   CEL
Sbjct  6    DTFVLLEPGEDEVFVSMEQLQSRIKSWLERWPSGSLPFDLQNFKTLDEAASHLVTNSCEL  65

Query  328  EIDGDAGSLQWFEVRLQQQ  272
            EI G  GS+QWF+VRL+++
Sbjct  66   EIGGGFGSIQWFQVRLEER  84



>tpg|DAA57525.1| TPA: hypothetical protein ZEAMMB73_105918 [Zea mays]
Length=76

 Score = 71.6 bits (174),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -1

Query  436  KGWLQNWPANGLPADLARFENIDDAVEYLVKCVCELEIDGDAGSLQWFEVRL  281
            KGWL+NWP + L  D ARF  +D+ V YLV+ VC LEID D GS++W++V+L
Sbjct  24   KGWLKNWPGDTLSPDHARFGTVDEVVSYLVRSVCVLEIDRDVGSVEWYQVQL  75



>ref|XP_008676272.1| PREDICTED: uncharacterized protein LOC103652474 [Zea mays]
Length=85

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -1

Query  436  KGWLQNWPANGLPADLARFENIDDAVEYLVKCVCELEIDGDAGSLQWFEVRL  281
            KGWL+NWP + L  D ARF  +D+ V YLV+ VC LEID D GS++W++V+L
Sbjct  33   KGWLKNWPGDTLSPDHARFGTVDEVVSYLVRSVCVLEIDRDVGSVEWYQVQL  84



>gb|KDO72766.1| hypothetical protein CISIN_1g034246mg [Citrus sinensis]
Length=80

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 46/76 (61%), Positives = 58/76 (76%), Gaps = 4/76 (5%)
 Frame = -1

Query  514  RTDTYVLMepgkeeefvseeelrERLKGWLQNWPAN----GLPADLARFENIDDAVEYLV  347
            RT+TYVL+EPG EE+FV+EEEL+ RLK WL+NW       GLP DLA+F  ID+AV +L+
Sbjct  5    RTETYVLLEPGVEEKFVTEEELKARLKYWLENWAGQVGKGGLPPDLAKFATIDEAVAFLI  64

Query  346  KCVCELEIDGDAGSLQ  299
              VCELE+ GD GS+Q
Sbjct  65   TNVCELELQGDVGSIQ  80



>gb|KDO72765.1| hypothetical protein CISIN_1g034246mg [Citrus sinensis]
Length=82

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 46/76 (61%), Positives = 58/76 (76%), Gaps = 4/76 (5%)
 Frame = -1

Query  514  RTDTYVLMepgkeeefvseeelrERLKGWLQNWPAN----GLPADLARFENIDDAVEYLV  347
            RT+TYVL+EPG EE+FV+EEEL+ RLK WL+NW       GLP DLA+F  ID+AV +L+
Sbjct  5    RTETYVLLEPGVEEKFVTEEELKARLKYWLENWAGQVGKGGLPPDLAKFATIDEAVAFLI  64

Query  346  KCVCELEIDGDAGSLQ  299
              VCELE+ GD GS+Q
Sbjct  65   TNVCELELQGDVGSIQ  80



>ref|XP_009360629.1| PREDICTED: uncharacterized protein LOC103951071 [Pyrus x bretschneideri]
Length=155

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 60/78 (77%), Gaps = 10/78 (13%)
 Frame = -1

Query  511  TDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVKCVCE  332
            ++TYVL+EPG++E+FVSE++LR +LK WL+NWPA  LP DLARFE+IDDAV Y       
Sbjct  88   SETYVLLEPGEDEKFVSEDKLRAKLKVWLENWPAKNLPLDLARFESIDDAVSY-------  140

Query  331  LEIDGDAGSLQWFEVRLQ  278
                GD GS+QW+EVR++
Sbjct  141  ---HGDVGSIQWYEVRME  155



>ref|XP_008675018.1| PREDICTED: uncharacterized protein LOC103651179 isoform X2 [Zea 
mays]
 tpg|DAA57502.1| TPA: hypothetical protein ZEAMMB73_612711 [Zea mays]
Length=175

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -1

Query  424  QNWPANGLPADLARFENIDDAVEYLVKCVCELEIDGDAGSLQWFEVRL  281
            +NWP + L  DLARF  +D+AV YLV+ VC LEIDGD GS++W++V+L
Sbjct  127  KNWPVDTLSLDLARFGMVDEAVSYLVRSVCVLEIDGDVGSVEWYQVQL  174



>gb|KEH25053.1| chlororespiratory reduction protein [Medicago truncatula]
Length=128

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 64/111 (58%), Gaps = 9/111 (8%)
 Frame = -1

Query  652  NKFIGKERATLHPPPPLLGQSVQFMQFHIRNATMICEVrrrrR--------ADIRTDTYV  497
             K    + A +H   P L Q       H R + + C+ R + +        A+ RTDTYV
Sbjct  17   TKIYHVQNAAIHITSPCLIQCFS-SSIHQRPSQVACDCRSKTKVFAMRRRRANERTDTYV  75

Query  496  LMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVK  344
            L+EPGK+E FVSEEEL++ LK WL NWP   LP DLAR+E IDD V +L K
Sbjct  76   LLEPGKDERFVSEEELKDTLKEWLTNWPGKTLPPDLARYETIDDDVSFLAK  126



>gb|KEH25050.1| DUF3571 family protein [Medicago truncatula]
Length=129

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -1

Query  514  RTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVKCVC  335
            RT TYVL+EPGK+E FVSEEEL++ LK WL NWP   LP DLAR+E IDD V +L K  C
Sbjct  70   RTYTYVLLEPGKDERFVSEEELKDTLKEWLTNWPGKTLPPDLARYETIDDVVSFLAKSFC  129



>ref|WP_015229464.1| hypothetical protein [Dactylococcopsis salina]
 ref|YP_007171824.1| hypothetical protein Dacsa_1810 [Dactylococcopsis salina PCC 
8305]
 gb|AFZ50467.1| Protein of unknown function (DUF3571) [Dactylococcopsis salina 
PCC 8305]
Length=85

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 53/80 (66%), Gaps = 2/80 (3%)
 Frame = -1

Query  514  RTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVKCVC  335
            + D YV++E  + EE +S EEL E+LKG LQN P + LP DL +FE ++   ++L++  C
Sbjct  8    QEDAYVVLETNQPEEIMSPEELLEKLKGILQNHP-DELPRDLTKFETVEAQAKHLMETSC  66

Query  334  ELEIDGDAGSLQWFEVRLQQ  275
            E ++ G+   LQW+ +RL +
Sbjct  67   EFDV-GEGEYLQWYVIRLDK  85



>ref|WP_015214612.1| hypothetical protein [Anabaena cylindrica]
 ref|YP_007156887.1| hypothetical protein Anacy_2532 [Anabaena cylindrica PCC 7122]
 gb|AFZ57977.1| hypothetical protein Anacy_2532 [Anabaena cylindrica PCC 7122]
Length=86

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = -1

Query  514  RTDTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVKCVC  335
            + D +V++E  + E+F++  EL E+L   LQ  P + LP D+ +F+ + D  +YL+   C
Sbjct  8    QQDNFVVLETNQPEQFLTTSELLEKLANTLQQLPFDDLPPDVQKFKLVSDQAQYLIDTSC  67

Query  334  ELEIDGDAGSLQWFEVRLQQ  275
            EL+I G    LQW+ VRL++
Sbjct  68   ELDI-GPGKYLQWYAVRLEK  86



>ref|WP_006196610.1| hypothetical protein [Nodularia spumigena]
 gb|EAW45222.1| hypothetical protein N9414_09926 [Nodularia spumigena CCY9414]
Length=86

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = -1

Query  442  RLKGWLQNWPANGLPADLARFENIDDAVEYLVKCVCELEIDGDAGSLQWFEVRLQQ  275
            +LK  LQ      LP DL RF+++D   +YL+   CEL++ G    LQW+ +RL++
Sbjct  32   KLKLVLQKMSNQELPTDLQRFDSVDAQAQYLINTSCELDV-GPGKYLQWYAIRLEK  86



>gb|AHJ27361.1| hypothetical protein NSP_10190 [Nodularia spumigena CCY9414]
Length=81

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = -1

Query  442  RLKGWLQNWPANGLPADLARFENIDDAVEYLVKCVCELEIDGDAGSLQWFEVRLQQ  275
            +LK  LQ      LP DL RF+++D   +YL+   CEL++ G    LQW+ +RL++
Sbjct  27   KLKLVLQKMSNQELPTDLQRFDSVDAQAQYLINTSCELDV-GPGKYLQWYAIRLEK  81



>ref|WP_029633969.1| hypothetical protein [[Scytonema hofmanni] UTEX B 1581]
Length=86

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = -1

Query  508  DTYVLMepgkeeefvseeelrERLKGWLQNWPANGLPADLARFENIDDAVEYLVKCVCEL  329
            D +V++E  + E+F++  EL E+LK  LQN+    LP DL +F +++   +YL+   CEL
Sbjct  10   DNFVVLETNQPEQFMTASELLEKLKKVLQNFNFQDLPKDLQKFNSVEAQAQYLLDTSCEL  69

Query  328  EIDGDAGSLQWFEVRLQQ  275
            +I G    LQW+ VRL++
Sbjct  70   DI-GVGQYLQWYAVRLEK  86



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1475250502080