BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13491_g1_i1 len=688 path=[1:0-496 498:497-687]

Length=688
                                                                      Score     E

ref|XP_003525290.1|  PREDICTED: profilin-like                           186   6e-56   
ref|NP_001233869.1|  profilin-1                                         184   3e-55   
ref|XP_007160274.1|  hypothetical protein PHAVU_002G307500g             184   3e-55   
ref|XP_007152957.1|  hypothetical protein PHAVU_004G174400g             183   9e-55   
ref|XP_006584806.1|  PREDICTED: profilin-like                           183   9e-55   
ref|XP_003516387.1|  PREDICTED: profilin-like                           183   1e-54   
ref|XP_006583560.1|  PREDICTED: profilin-like                           183   1e-54   
ref|XP_003630696.1|  Profilin                                           183   1e-54   
gb|KDP33777.1|  hypothetical protein JCGZ_07348                         182   2e-54   
ref|XP_004503499.1|  PREDICTED: profilin-like                           182   3e-54   
ref|XP_007012985.1|  Profilin 5                                         182   3e-54   
ref|XP_008458981.1|  PREDICTED: profilin-4                              182   3e-54   
sp|Q9XF37.1|PROF_APIGR  RecName: Full=Profilin; AltName: Full=Min...    181   5e-54   Apium graveolens
gb|AAD02560.1|  PGPS/NH20                                               181   6e-54   Petunia x hybrida [garden petunia]
sp|A4KA45.1|PROF4_CORAV  RecName: Full=Profilin-4; AltName: Full=...    181   9e-54   Corylus avellana [European hazelnut]
ref|XP_002515952.1|  profilin, putative                                 180   1e-53   Ricinus communis
ref|XP_004141027.1|  PREDICTED: profilin-like                           180   1e-53   
ref|XP_009591293.1|  PREDICTED: profilin-2                              180   1e-53   
ref|XP_009789538.1|  PREDICTED: profilin-1                              180   1e-53   
ref|XP_010536839.1|  PREDICTED: profilin-4                              179   2e-53   
sp|O24650.1|PROF2_PHLPR  RecName: Full=Profilin-2; AltName: Full=...    179   2e-53   Phleum pratense [timothy]
sp|O49894.1|PROF_MERAN  RecName: Full=Profilin; AltName: Full=Pol...    179   3e-53   Mercurialis annua [annual mercury]
ref|XP_009777310.1|  PREDICTED: profilin-3                              179   3e-53   
sp|Q9LEI8.1|PROF6_HEVBR  RecName: Full=Profilin-6; AltName: Full=...    179   3e-53   Hevea brasiliensis [jebe]
emb|CAB61833.1|  profilin                                               179   4e-53   Nicotiana tabacum [American tobacco]
sp|A4KA44.1|PROF3_CORAV  RecName: Full=Profilin-3; AltName: Full=...    179   5e-53   Corylus avellana [European hazelnut]
gb|KHG15153.1|  Profilin                                                179   5e-53   
gb|AFK47381.1|  unknown                                                 179   5e-53   
pdb|1G5U|A  Chain A, Latex Profilin Hevb8                               179   5e-53   
ref|XP_009622655.1|  PREDICTED: profilin-3                              179   5e-53   
sp|A4KA39.1|PROF1_CORAV  RecName: Full=Profilin-1; AltName: Full=...    178   5e-53   Corylus avellana [European hazelnut]
sp|Q9M7N0.1|PROF3_HEVBR  RecName: Full=Profilin-3; AltName: Full=...    178   5e-53   Hevea brasiliensis [jebe]
sp|Q9ST99.1|PROF2_TOBAC  RecName: Full=Profilin-2; AltName: Full=...    178   6e-53   Nicotiana tabacum [American tobacco]
ref|XP_002514198.1|  profilin, putative                                 178   6e-53   Ricinus communis
gb|KHM99818.1|  Profilin                                                178   7e-53   
sp|A4GFC3.1|PROCG_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    178   7e-53   Olea europaea
gb|AAK01236.1|AF327623_1  minor allergen hazelnut profilin              178   7e-53   Corylus avellana [European hazelnut]
sp|Q84V37.1|PROF_CHEAL  RecName: Full=Profilin; AltName: Full=Min...    178   7e-53   Chenopodium album [lamb's-quarters]
ref|XP_003569765.1|  PREDICTED: profilin-2                              178   8e-53   
sp|Q9ST98.1|PROF3_TOBAC  RecName: Full=Profilin-3                       178   9e-53   Nicotiana tabacum [American tobacco]
sp|P41372.1|PROF1_TOBAC  RecName: Full=Profilin-1                       178   1e-52   Nicotiana tabacum [American tobacco]
ref|XP_004513067.1|  PREDICTED: profilin-like                           177   1e-52   
gb|AAW84276.1|  profilin 2                                              177   1e-52   Petroselinum crispum
sp|P35079.1|PROF1_PHLPR  RecName: Full=Profilin-1; AltName: Full=...    177   1e-52   Phleum pratense [timothy]
gb|AFG16922.1|  profilin                                                177   1e-52   
sp|A4KA40.1|PROF2_CORAV  RecName: Full=Profilin-2; AltName: Full=...    177   2e-52   Corylus avellana [European hazelnut]
gb|AFG16923.1|  profilin                                                177   2e-52   
sp|A4GFC0.1|PROCE_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    177   2e-52   Olea europaea
sp|Q9M7M8.1|PROF5_HEVBR  RecName: Full=Profilin-5; AltName: Full=...    177   2e-52   Hevea brasiliensis [jebe]
gb|AAW84278.1|  profilin 4                                              177   2e-52   Petroselinum crispum
ref|XP_007024334.1|  Profilin 5                                         177   2e-52   
gb|ABC02750.1|  profilin                                                177   2e-52   Litchi chinensis [litchi]
sp|P25816.1|PROF1_BETPN  RecName: Full=Profilin-1; AltName: Full=...    177   2e-52   Betula pendula [white birch]
ref|XP_003568071.1|  PREDICTED: profilin-2-like                         177   2e-52   
sp|Q8SAE6.1|PROF_DAUCA  RecName: Full=Profilin; AltName: Full=Min...    177   3e-52   Daucus carota [carrots]
ref|XP_002441408.1|  hypothetical protein SORBIDRAFT_09g026120          176   3e-52   Sorghum bicolor [broomcorn]
pdb|1CQA|A  Chain A, Birch Pollen Profilin                              176   3e-52   
sp|A4K9Z8.1|PROF2_BETPN  RecName: Full=Profilin-2; AltName: Full=...    176   3e-52   Betula pendula [white birch]
sp|Q941H7.1|PROF_LITCN  RecName: Full=Profilin; AltName: Full=Min...    176   4e-52   Litchi chinensis [litchi]
ref|XP_002514199.1|  profilin, putative                                 176   4e-52   Ricinus communis
ref|XP_002883972.1|  hypothetical protein ARALYDRAFT_480492             176   4e-52   
ref|XP_004961445.1|  PREDICTED: profilin-A-like                         176   4e-52   
ref|XP_011000942.1|  PREDICTED: profilin-3                              176   4e-52   
ref|XP_006356135.1|  PREDICTED: profilin-1-like                         176   5e-52   
gb|AAW84277.1|  profilin 3                                              176   5e-52   Petroselinum crispum
sp|Q9M7M9.1|PROF4_HEVBR  RecName: Full=Profilin-4; AltName: Full=...    176   5e-52   Hevea brasiliensis [jebe]
sp|A4KA32.1|PROF5_PHLPR  RecName: Full=Profilin-5; AltName: Full=...    176   5e-52   Phleum pratense [timothy]
sp|A4KA50.1|PROCJ_OLEEU  RecName: Full=Profilin-5; AltName: Full=...    176   5e-52   Olea europaea
sp|A4GFC2.1|PROCF_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    176   6e-52   Olea europaea
sp|A4KA36.1|PROF8_PHLPR  RecName: Full=Profilin-8; AltName: Full=...    176   6e-52   Phleum pratense [timothy]
gb|AFG16925.1|  profilin                                                176   6e-52   
sp|A4KA33.1|PROF6_PHLPR  RecName: Full=Profilin-6; AltName: Full=...    176   7e-52   Phleum pratense [timothy]
gb|ADB93072.1|  profilin-1                                              176   7e-52   
ref|XP_006451339.1|  hypothetical protein CICLE_v10009871mg             176   7e-52   
ref|NP_179567.1|  profilin 5                                            176   7e-52   Arabidopsis thaliana [mouse-ear cress]
emb|CDM84005.1|  unnamed protein product                                176   8e-52   
ref|XP_002299743.1|  Profilin 3 family protein                          176   8e-52   Populus trichocarpa [western balsam poplar]
gb|AAK01235.1|AF327622_1  minor allergen hazelnut profilin              176   8e-52   Corylus avellana [European hazelnut]
sp|A4GFC4.1|PROCH_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    176   8e-52   Olea europaea
ref|XP_002869439.1|  hypothetical protein ARALYDRAFT_328774             176   8e-52   
ref|XP_006299812.1|  hypothetical protein CARUB_v10016013mg             176   8e-52   
gb|AAW84275.1|  profilin 1                                              175   9e-52   Petroselinum crispum
gb|ABK28500.1|  unknown                                                 175   9e-52   Arabidopsis thaliana [mouse-ear cress]
gb|ABO43717.1|  profilin                                                175   1e-51   Gossypium hirsutum [American cotton]
ref|NP_001106002.1|  profilin-9                                         175   1e-51   Zea mays [maize]
gb|KFK40342.1|  hypothetical protein AALP_AA3G361600                    175   1e-51   
ref|XP_011081736.1|  PREDICTED: profilin                                175   1e-51   
gb|AFG16926.1|  profilin                                                175   1e-51   
gb|ABU97473.1|  profilin                                                175   1e-51   Olea europaea
sp|O24282.1|PROF3_PHLPR  RecName: Full=Profilin-3; AltName: Full=...    175   1e-51   Phleum pratense [timothy]
gb|AFK33983.1|  unknown                                                 175   1e-51   
ref|XP_006426857.1|  hypothetical protein CICLE_v10026756mg             175   1e-51   
gb|AAP15200.1|  profilin-like protein                                   175   1e-51   Humulus scandens
sp|A4KA53.1|PROCM_OLEEU  RecName: Full=Profilin-8; AltName: Full=...    175   1e-51   Olea europaea
ref|XP_008233911.1|  PREDICTED: profilin-like                           175   1e-51   
ref|XP_004302848.1|  PREDICTED: profilin-like                           175   1e-51   
emb|CDX81945.1|  BnaC08g36560D                                          175   1e-51   
gb|KFK29491.1|  hypothetical protein AALP_AA7G141400                    175   1e-51   
sp|A4KA49.1|PROCI_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    175   1e-51   Olea europaea
sp|O65812.1|PROF1_HEVBR  RecName: Full=Profilin-1; AltName: Full=...    175   1e-51   Hevea brasiliensis [jebe]
sp|A4GFB9.1|PROCD_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    175   2e-51   Olea europaea
gb|AEW90957.1|  pollen profilin 3R4-2                                   175   2e-51   
dbj|BAJ86041.1|  predicted protein                                      175   2e-51   
ref|XP_010656249.1|  PREDICTED: profilin-2                              175   2e-51   
gb|KDP40849.1|  hypothetical protein JCGZ_24848                         174   2e-51   
gb|EMT00312.1|  Profilin-2/4                                            174   2e-51   
sp|A4KA52.1|PROCL_OLEEU  RecName: Full=Profilin-7; AltName: Full=...    174   2e-51   Olea europaea
sp|A4KA34.1|PROF7_PHLPR  RecName: Full=Profilin-7; AltName: Full=...    174   2e-51   Phleum pratense [timothy]
ref|XP_009112628.1|  PREDICTED: profilin-4-like                         174   2e-51   
ref|NP_001105451.1|  profilin-2                                         175   2e-51   Zea mays [maize]
ref|NP_194663.1|  profilin 4                                            174   2e-51   Arabidopsis thaliana [mouse-ear cress]
sp|A4GE53.1|PROBX_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    174   2e-51   Olea europaea
emb|CDP03236.1|  unnamed protein product                                174   2e-51   
sp|P35082.2|PROF2_MAIZE  RecName: Full=Profilin-2; AltName: Full=...    174   2e-51   Zea mays [maize]
ref|XP_004290829.1|  PREDICTED: profilin-3-like                         174   2e-51   
sp|O24169.1|PROFA_OLEEU  RecName: Full=Profilin-1; AltName: Full=...    174   2e-51   Olea europaea
ref|XP_009117521.1|  PREDICTED: profilin-4-like                         174   2e-51   
sp|A4GDQ6.1|PROAK_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    174   2e-51   Olea europaea
emb|CDY03342.1|  BnaC09g10060D                                          174   2e-51   
ref|XP_009344483.1|  PREDICTED: profilin                                174   2e-51   
ref|XP_007223916.1|  hypothetical protein PRUPE_ppa013278mg             174   2e-51   
sp|A4GDR7.1|PROAW_OLEEU  RecName: Full=Profilin-1; AltName: Full=...    174   3e-51   Olea europaea
gb|ABQ23999.1|  pollen-specific profilin3                               174   3e-51   Zea mays [maize]
ref|XP_010489131.1|  PREDICTED: profilin-4                              174   3e-51   
sp|A4KA37.1|PROF9_PHLPR  RecName: Full=Profilin-9; AltName: Full=...    174   3e-51   Phleum pratense [timothy]
gb|ACN36779.1|  unknown                                                 174   3e-51   Zea mays [maize]
ref|XP_010438310.1|  PREDICTED: profilin-3-like                         174   3e-51   
sp|O04725.1|PROF_CYNDA  RecName: Full=Profilin; AltName: Full=Pol...    174   3e-51   Cynodon dactylon
ref|XP_006451338.1|  hypothetical protein CICLE_v10009877mg             174   3e-51   
ref|XP_011005518.1|  PREDICTED: profilin-6-like                         174   3e-51   
gb|EMT25354.1|  Profilin-2/4                                            174   3e-51   
sp|A4KA59.1|PRO10_MAIZE  RecName: Full=Profilin-10; AltName: Full...    174   3e-51   Zea mays [maize]
sp|A4GDS0.1|PROAZ_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    174   3e-51   Olea europaea
ref|XP_010541006.1|  PREDICTED: profilin-4                              174   3e-51   
ref|XP_007217879.1|  hypothetical protein PRUPE_ppa013277mg             174   3e-51   
ref|NP_001235025.1|  uncharacterized protein LOC100499717               174   3e-51   
sp|A4GE44.1|PROBR_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    174   4e-51   Olea europaea
ref|XP_010688354.1|  PREDICTED: profilin                                174   4e-51   
ref|NP_001105987.1|  profilin-7                                         174   4e-51   Zea mays [maize]
gb|ABC61055.1|  profilin-like protein                                   174   4e-51   Cinnamomum camphora
ref|XP_002304225.1|  Profilin 3 family protein                          174   4e-51   Populus trichocarpa [western balsam poplar]
ref|NP_001288512.1|  profilin-7                                         174   4e-51   
ref|XP_002283490.1|  PREDICTED: profilin-1                              174   4e-51   Vitis vinifera
gb|EMS66850.1|  Profilin-2/4                                            175   4e-51   
ref|XP_006284736.1|  hypothetical protein CARUB_v10005999mg             174   4e-51   
sp|A4GDS7.1|PROBB_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    174   5e-51   Olea europaea
gb|KHN16653.1|  Profilin-1                                              173   5e-51   
ref|NP_001288607.1|  uncharacterized protein LOC103711216               173   5e-51   
ref|NP_001064348.1|  Os10g0323600                                       173   6e-51   Oryza sativa Japonica Group [Japonica rice]
sp|A4KA60.1|PRO11_MAIZE  RecName: Full=Profilin-11; AltName: Full...    173   6e-51   Zea mays [maize]
ref|XP_008795502.1|  PREDICTED: profilin-1-like                         173   6e-51   
sp|A4GDS6.1|PROBA_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    173   6e-51   Olea europaea
ref|XP_006661691.1|  PREDICTED: profilin-A-like                         173   6e-51   
gb|EMS49855.1|  Profilin-2/4                                            173   6e-51   
gb|AAO41991.1|  putative profilin 3                                     173   6e-51   Arabidopsis thaliana [mouse-ear cress]
sp|O24170.1|PROFB_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    173   7e-51   Olea europaea
sp|P0DKE6.1|PROAB_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    173   7e-51   
sp|A4GDU2.1|PROBK_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    173   7e-51   Olea europaea
sp|P0DKF4.1|PROAM_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    173   7e-51   
sp|A4GCR5.1|PROFE_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    173   7e-51   Olea europaea
gb|AGN33441.1|  profilin                                                173   8e-51   
ref|XP_002456332.1|  hypothetical protein SORBIDRAFT_03g034110          173   8e-51   Sorghum bicolor [broomcorn]
sp|A4GE55.1|PROBZ_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    173   8e-51   Olea europaea
sp|A4GCR6.1|PROFF_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    173   8e-51   Olea europaea
sp|P0DKE4.1|PROFW_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    173   8e-51   
ref|XP_010047296.1|  PREDICTED: profilin                                173   8e-51   
sp|A4KA38.1|PRO10_PHLPR  RecName: Full=Profilin-10; AltName: Full...    173   8e-51   Phleum pratense [timothy]
ref|XP_010541007.1|  PREDICTED: profilin-2                              173   9e-51   
ref|XP_004969894.1|  PREDICTED: profilin-A-like                         173   9e-51   
sp|Q9SNW7.1|PROF1_LILLO  RecName: Full=Profilin-1                       173   9e-51   Lilium longiflorum [Easter lily]
ref|XP_011019559.1|  PREDICTED: profilin                                173   9e-51   
sp|A4GDR1.1|PROAS_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    173   9e-51   Olea europaea
sp|P0DKE3.1|PROFV_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    173   1e-50   
sp|A4GDT1.1|PROBE_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    173   1e-50   Olea europaea
ref|NP_001105450.1|  profilin-1                                         172   1e-50   Zea mays [maize]
ref|XP_010914952.1|  PREDICTED: profilin-1                              172   1e-50   
sp|Q9XF40.1|PROF1_MALDO  RecName: Full=Profilin-1; AltName: Full=...    172   1e-50   Malus domestica [apple tree]
ref|XP_010416663.1|  PREDICTED: profilin-4-like                         172   1e-50   
gb|AHL24660.1|  Fra e 2.01 allergen                                     172   1e-50   
sp|Q9XF38.1|PROF_PYRCO  RecName: Full=Profilin; AltName: Full=All...    172   1e-50   Pyrus communis
gb|ABW17183.1|  profilin                                                172   1e-50   Raphanus sativus
emb|CDP03238.1|  unnamed protein product                                172   1e-50   
sp|A4GD50.1|PROFT_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    172   1e-50   Olea europaea
sp|A4GDT0.1|PROBD_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    172   1e-50   Olea europaea
emb|CAD46559.1|  profilin                                               172   1e-50   Malus domestica [apple tree]
emb|CAT99619.1|  profilin                                               171   2e-50   Malus domestica [apple tree]
gb|EYU30691.1|  hypothetical protein MIMGU_mgv1a016415mg                172   2e-50   
sp|A4GD54.1|PROFY_OLEEU  RecName: Full=Profilin-5; AltName: Full=...    172   2e-50   Olea europaea
ref|XP_010526419.1|  PREDICTED: profilin-4-like                         172   2e-50   
ref|XP_007204757.1|  hypothetical protein PRUPE_ppa013242mg             172   2e-50   
gb|AEW90958.1|  profilin R2-2                                           172   2e-50   
sp|A4GE38.1|PROBO_OLEEU  RecName: Full=Profilin-1; AltName: Full=...    172   2e-50   Olea europaea
sp|A4KA57.1|PROF8_MAIZE  RecName: Full=Profilin-8; AltName: Full=...    172   2e-50   Zea mays [maize]
ref|XP_009137845.1|  PREDICTED: profilin-3-like                         172   2e-50   
gb|KCW79179.1|  hypothetical protein EUGRSUZ_C00615                     174   2e-50   
gb|AAW84279.1|  profilin 5                                              172   2e-50   Petroselinum crispum
sp|A4GDQ8.1|PROAL_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    172   2e-50   Olea europaea
gb|AAO92742.1|  profilin                                                172   2e-50   Gossypium hirsutum [American cotton]
ref|XP_008365251.1|  PREDICTED: profilin                                172   2e-50   
ref|XP_010267106.1|  PREDICTED: profilin-1                              172   2e-50   
ref|XP_010249471.1|  PREDICTED: profilin-like                           172   2e-50   
ref|XP_009796122.1|  PREDICTED: profilin-2                              172   2e-50   
ref|XP_009128846.1|  PREDICTED: profilin-3                              172   2e-50   
sp|A4GE50.1|PROBW_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    172   2e-50   Olea europaea
ref|XP_009400573.1|  PREDICTED: profilin-A                              172   2e-50   
sp|O24171.1|PROFC_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    172   2e-50   Olea europaea
ref|XP_008242467.1|  PREDICTED: profilin-4                              172   2e-50   
sp|A4GE39.1|PROBP_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    172   2e-50   Olea europaea
gb|EYU20403.1|  hypothetical protein MIMGU_mgv1a016186mg                172   2e-50   
ref|XP_004241753.1|  PREDICTED: profilin-1-like                         172   2e-50   
gb|ACV50427.1|  profilin-like protein                                   172   2e-50   Jatropha curcas
ref|XP_011072445.1|  PREDICTED: profilin                                172   2e-50   
emb|CAQ57979.1|  profilin                                               171   3e-50   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003620753.1|  Profilin                                           172   3e-50   
ref|XP_003564682.1|  PREDICTED: profilin-2                              171   3e-50   
gb|AAX19855.1|  profilin 1                                              171   3e-50   Malus domestica [apple tree]
gb|KHF97992.1|  Profilin                                                171   3e-50   
gb|AFK38257.1|  unknown                                                 171   3e-50   
ref|XP_008337608.1|  PREDICTED: profilin-4                              171   3e-50   
gb|AAX19857.1|  profilin 2                                              171   3e-50   Malus domestica [apple tree]
sp|A4GDT5.1|PROBH_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    171   3e-50   Olea europaea
emb|CAK93753.1|  profilin                                               171   3e-50   Malus domestica [apple tree]
dbj|BAK02673.1|  predicted protein                                      171   3e-50   
ref|XP_002308591.1|  profilin 2 family protein                          171   3e-50   Populus trichocarpa [western balsam poplar]
gb|ABP58623.1|  pollen allergen Ole e 2                                 171   3e-50   Olea europaea
sp|A4GE45.1|PROBS_OLEEU  RecName: Full=Profilin-1; AltName: Full=...    171   3e-50   Olea europaea
sp|A4GDR9.1|PROAY_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    171   3e-50   Olea europaea
sp|Q64LH2.1|PROF2_AMBAR  RecName: Full=Profilin-2; AltName: Full=...    171   3e-50   Ambrosia artemisiifolia [annual ragweed]
ref|XP_002324161.1|  profilin 2 family protein                          171   3e-50   Populus trichocarpa [western balsam poplar]
ref|XP_010033829.1|  PREDICTED: profilin                                171   4e-50   
ref|XP_010254422.1|  PREDICTED: profilin-like                           171   4e-50   
ref|XP_004287491.1|  PREDICTED: profilin-like                           171   4e-50   
sp|Q9FUB8.1|PROF_BRANA  RecName: Full=Profilin                          171   4e-50   Brassica napus [oilseed rape]
sp|A4GCR8.1|PROFQ_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    171   4e-50   Olea europaea
ref|XP_009602785.1|  PREDICTED: profilin-2                              171   4e-50   
ref|XP_010526418.1|  PREDICTED: profilin                                171   4e-50   
emb|CAK93713.1|  profilin                                               171   4e-50   Malus domestica [apple tree]
tpg|DAA57720.1|  TPA: profilin                                          171   4e-50   
sp|A4GD56.1|PROAA_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    171   4e-50   Olea europaea
sp|Q9STB6.1|PROF2_HEVBR  RecName: Full=Profilin-2; AltName: Full=...    171   4e-50   Hevea brasiliensis [jebe]
ref|XP_004149180.1|  PREDICTED: profilin-like                           171   4e-50   
gb|ABW17190.1|  profilin                                                171   4e-50   Brassica napus [oilseed rape]
sp|A4GDR3.1|PROAT_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    171   4e-50   Olea europaea
gb|EPS71087.1|  profilin                                                171   4e-50   
sp|A4GE47.1|PROBT_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    171   4e-50   Olea europaea
gb|ABA81885.1|  profilin-like                                           171   4e-50   Solanum tuberosum [potatoes]
gb|AAX19859.1|  profilin 2                                              171   4e-50   Malus domestica [apple tree]
sp|A4GDT3.1|PROBF_OLEEU  RecName: Full=Profilin-1; AltName: Full=...    171   4e-50   Olea europaea
ref|XP_008795503.1|  PREDICTED: profilin-2-like                         171   5e-50   
ref|XP_009352573.1|  PREDICTED: profilin-4                              171   5e-50   
gb|ABP35953.1|  profillin                                               171   5e-50   Brassica rapa
gb|ABW37745.1|  Ama v 1.02 allergen                                     171   5e-50   Amaranthus viridis [bledo]
ref|NP_001235595.1|  profilin                                           171   5e-50   
gb|ABW17187.1|  profilin                                                171   5e-50   Brassica rapa subsp. pekinensis [bai cai]
sp|A4KA51.1|PROCK_OLEEU  RecName: Full=Profilin-6; AltName: Full=...    171   5e-50   Olea europaea
gb|ABP58621.1|  pollen allergen Ole e 2                                 171   5e-50   Olea europaea
gb|ADL18409.1|  profilin                                                171   5e-50   
sp|A4GDR6.1|PROAV_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    171   5e-50   Olea europaea
sp|A4GE48.1|PROBU_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    171   5e-50   Olea europaea
ref|XP_008337609.1|  PREDICTED: profilin-2                              171   5e-50   
ref|XP_009109044.1|  PREDICTED: profilin                                171   6e-50   
dbj|BAK07752.1|  predicted protein                                      171   6e-50   
sp|A4GDT4.1|PROBG_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    171   6e-50   Olea europaea
ref|NP_001149484.1|  profilin A                                         171   6e-50   Zea mays [maize]
emb|CDY62034.1|  BnaC03g77670D                                          171   7e-50   
sp|A4GCR7.1|PROFP_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    171   7e-50   Olea europaea
ref|XP_010548681.1|  PREDICTED: profilin                                170   7e-50   
ref|XP_004964829.1|  PREDICTED: profilin LP04-like                      170   7e-50   
gb|ADB96066.1|  profilin                                                170   7e-50   Arachis hypogaea [goober]
sp|A4KA61.1|PRO12_MAIZE  RecName: Full=Profilin-12; AltName: Full...    170   7e-50   Zea mays [maize]
gb|KHM99817.1|  Profilin-1                                              170   7e-50   
sp|P49233.2|PROF2_WHEAT  RecName: Full=Profilin-2                       170   8e-50   Triticum aestivum [Canadian hard winter wheat]
sp|A4GDT9.1|PROBI_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    171   8e-50   Olea europaea
ref|XP_010668781.1|  PREDICTED: profilin-3-like                         170   8e-50   
gb|ABM53029.1|  profilin                                                170   8e-50   Roystonea regia [Cuban royal palm]
sp|P49234.2|PROF3_WHEAT  RecName: Full=Profilin-3                       170   8e-50   Triticum aestivum [Canadian hard winter wheat]
sp|A4GE42.1|PROBQ_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    170   8e-50   Olea europaea
sp|P0DKE1.1|PROFS_OLEEU  RecName: Full=Profilin-1; AltName: Full=...    170   8e-50   
gb|KHG29269.1|  Profilin-1                                              170   8e-50   
sp|A4GDU5.1|PROBM_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    170   8e-50   
ref|XP_010249472.1|  PREDICTED: profilin-1-like                         170   8e-50   
ref|XP_009367418.1|  PREDICTED: profilin-3-like                         170   8e-50   
ref|XP_006661690.1|  PREDICTED: profilin-A-like                         170   9e-50   
gb|ABW17185.1|  profilin                                                170   9e-50   
sp|Q9XF41.1|PROF2_MALDO  RecName: Full=Profilin-2; AltName: Full=...    170   9e-50   
ref|XP_010668774.1|  PREDICTED: profilin-3                              170   9e-50   
ref|XP_008799778.1|  PREDICTED: profilin-1                              170   9e-50   
sp|A4GDU6.1|PROBN_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    170   1e-49   
sp|Q8GT39.1|PROF_PRUPE  RecName: Full=Profilin; AltName: Allergen...    170   1e-49   
ref|XP_008380843.1|  PREDICTED: profilin                                170   1e-49   
sp|A4GD55.1|PROFZ_OLEEU  RecName: Full=Profilin-1; AltName: Full=...    170   1e-49   
sp|A4GDR4.1|PROAU_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    170   1e-49   
ref|XP_007202751.1|  hypothetical protein PRUPE_ppa013285mg             170   1e-49   
ref|XP_004287490.1|  PREDICTED: profilin-like                           170   1e-49   
sp|P0DKG1.1|PROCC_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    170   1e-49   
gb|AAX19853.1|  profilin 1                                              170   1e-49   
ref|XP_010049601.1|  PREDICTED: profilin-2                              170   1e-49   
ref|NP_001275370.1|  profilin-like protein                              170   1e-49   
gb|ADK35122.1|  profilin                                                170   1e-49   
ref|XP_008447563.1|  PREDICTED: profilin-like                           170   1e-49   
gb|ABM53028.1|  profilin                                                170   1e-49   
gb|ABM53030.1|  profilin                                                169   2e-49   
sp|A4GE54.1|PROBY_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    170   2e-49   
sp|A4KA41.1|PROF5_CORAV  RecName: Full=Profilin-5; AltName: Full=...    169   2e-49   
sp|A4GDS9.1|PROBC_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    169   2e-49   
ref|XP_006340251.1|  PREDICTED: profilin-like                           169   2e-49   
ref|XP_009102137.1|  PREDICTED: profilin-4                              169   2e-49   
ref|XP_003564327.1|  PREDICTED: profilin-1                              169   2e-49   
sp|P0C0Y3.1|PROF_FRAAN  RecName: Full=Profilin; AltName: Allergen...    169   2e-49   
emb|CAT99617.1|  profilin                                               169   2e-49   
ref|XP_009757178.1|  PREDICTED: profilin-3-like                         169   2e-49   
sp|A4KA43.1|PROF6_CORAV  RecName: Full=Profilin-6; AltName: Full=...    169   2e-49   
sp|Q94JN3.1|PROF_MUSAC  RecName: Full=Profilin; AltName: Full=Min...    169   2e-49   
sp|Q9XF42.1|PROF3_MALDO  RecName: Full=Profilin-3; AltName: Full=...    169   2e-49   
ref|NP_001237519.1|  profilin                                           169   2e-49   
emb|CAD46561.1|  profilin                                               169   2e-49   
gb|ACV66156.2|  profilin                                                169   2e-49   
ref|XP_009350242.1|  PREDICTED: profilin                                169   2e-49   
sp|Q64LH1.1|PROF1_AMBAR  RecName: Full=Profilin-1; AltName: Full=...    169   3e-49   
sp|A4GDU3.1|PROBL_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    169   3e-49   
emb|CAD46560.1|  profilin                                               169   3e-49   
ref|NP_001236192.1|  profilin-2                                         169   3e-49   
ref|XP_011078238.1|  PREDICTED: profilin-3-like                         169   3e-49   
ref|XP_009392682.1|  PREDICTED: profilin                                169   3e-49   
ref|XP_009352571.1|  PREDICTED: profilin-2                              169   3e-49   
ref|XP_007160276.1|  hypothetical protein PHAVU_002G307700g             169   3e-49   
gb|AGA84056.1|  profilin                                                169   3e-49   
ref|XP_007012986.1|  Profilin 1 isoform 1                               169   3e-49   
pdb|4ESP|A  Chain A, Crystal Structure Of Peanut Allergen Ara H 5       169   3e-49   
sp|O65809.1|PROF1_SOYBN  RecName: Full=Profilin-1; AltName: Full=...    169   3e-49   
gb|ABW17184.1|  profilin                                                169   3e-49   
sp|A4GD58.1|PROAJ_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    169   3e-49   
emb|CAK93757.1|  profilin                                               169   3e-49   
ref|XP_011078237.1|  PREDICTED: profilin-3                              169   4e-49   
sp|Q93YI9.1|PROF_CAPAN  RecName: Full=Profilin; AltName: Full=Min...    169   4e-49   
ref|XP_011093655.1|  PREDICTED: profilin-3-like                         169   4e-49   
sp|Q9SNW6.1|PROF2_LILLO  RecName: Full=Profilin-2                       169   4e-49   
sp|P49232.2|PROF1_WHEAT  RecName: Full=Profilin-1                       168   4e-49   
gb|ACA49387.1|  putative actin- and phospholipid-binding protein        168   4e-49   
gb|EPS66446.1|  profilin                                                168   4e-49   
sp|A4GE49.1|PROBV_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    168   4e-49   
gb|AAP15198.1|  profilin-like protein                                   168   5e-49   
gb|AET05174.2|  profilin                                                168   5e-49   
sp|A4GFB7.1|PROCA_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    168   5e-49   
ref|XP_010925516.1|  PREDICTED: profilin-1-like                         168   5e-49   
ref|NP_001056833.1|  Os06g0152100                                       168   5e-49   
ref|XP_009586833.1|  PREDICTED: profilin-like                           168   6e-49   
ref|XP_008798583.1|  PREDICTED: profilin-1                              168   7e-49   
sp|A4GDU0.1|PROBJ_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    168   8e-49   
gb|KHG23640.1|  Profilin-3                                              168   8e-49   
ref|XP_010915373.1|  PREDICTED: profilin isoform X2                     167   8e-49   
ref|XP_010925517.1|  PREDICTED: profilin-1-like                         169   9e-49   
ref|XP_010267105.1|  PREDICTED: profilin-2                              167   9e-49   
gb|AAQ63002.1|  oil palm profilin-like allergen PF2                     167   1e-48   
ref|XP_008799779.1|  PREDICTED: profilin-2                              167   1e-48   
gb|AEC10960.1|  profilin 2                                              167   1e-48   
ref|XP_010924448.1|  PREDICTED: profilin-2-like                         167   1e-48   
ref|XP_003546590.1|  PREDICTED: profilin-4-like                         167   1e-48   
ref|NP_001105452.1|  profilin-3                                         167   1e-48   
gb|AFK47285.1|  unknown                                                 167   2e-48   
ref|XP_002283450.1|  PREDICTED: profilin-1                              167   2e-48   
sp|Q9XG85.1|PROF1_PARJU  RecName: Full=Profilin-1; AltName: Full=...    167   2e-48   
gb|EYU21444.1|  hypothetical protein MIMGU_mgv1a016199mg                167   2e-48   
gb|ABB76134.1|  profilin 1                                              167   2e-48   
ref|NP_001104885.1|  profilin-4                                         167   2e-48   
gb|AFW85125.1|  profilin-3                                              167   2e-48   
ref|XP_010047663.1|  PREDICTED: profilin-1-like                         167   2e-48   
gb|AHY24177.1|  profilin                                                167   2e-48   
ref|XP_009405220.1|  PREDICTED: profilin-1                              166   2e-48   
ref|XP_004157894.1|  PREDICTED: profilin-like                           166   2e-48   
sp|A4GDR8.1|PROAX_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    166   2e-48   
ref|XP_004503498.1|  PREDICTED: profilin-1-like                         166   3e-48   
gb|AFK47224.1|  unknown                                                 166   3e-48   
gb|EYU27249.1|  hypothetical protein MIMGU_mgv1a016111mg                166   3e-48   
ref|XP_004968458.1|  PREDICTED: profilin-like                           166   3e-48   
sp|A4KA55.1|PROF6_MAIZE  RecName: Full=Profilin-6; AltName: Full=...    166   3e-48   
ref|NP_001234138.1|  profilin                                           166   3e-48   
gb|ABW37744.1|  Ama v 1.01 allergen                                     166   3e-48   
emb|CAD92666.1|  profilin                                               166   3e-48   
emb|CAN67015.1|  hypothetical protein VITISV_041272                     166   3e-48   
sp|P52184.1|PROF1_HORVU  RecName: Full=Profilin-1                       166   4e-48   
ref|XP_006853720.1|  hypothetical protein AMTR_s00056p00160320          166   4e-48   
ref|XP_010915371.1|  PREDICTED: profilin-like                           166   4e-48   
emb|CAD37201.1|  profilin                                               166   5e-48   
ref|XP_009415731.1|  PREDICTED: profilin-3                              166   5e-48   
gb|KHG22026.1|  Profilin                                                166   5e-48   
ref|XP_008220131.1|  PREDICTED: profilin                                166   5e-48   
ref|XP_009405712.1|  PREDICTED: profilin-1-like                         166   6e-48   
gb|AAQ63001.1|  oil palm profilin-like allergen PF1                     166   6e-48   
ref|XP_006655796.1|  PREDICTED: profilin LP04-like                      166   6e-48   
gb|ACG33212.1|  profilin-2                                              166   6e-48   
ref|XP_004141028.1|  PREDICTED: profilin-like                           165   6e-48   
gb|ACE82291.1|  profilin                                                165   7e-48   
ref|XP_006353502.1|  PREDICTED: profilin-1-like                         165   8e-48   
gb|AAU43733.1|  profilin                                                165   8e-48   
ref|XP_009404548.1|  PREDICTED: profilin-like                           165   9e-48   
gb|AAQ63003.1|  oil palm profilin-like allergen PF3                     165   9e-48   
ref|XP_010914972.1|  PREDICTED: profilin-2                              165   1e-47   
ref|XP_004291152.1|  PREDICTED: profilin-like                           165   1e-47   
ref|XP_010924449.1|  PREDICTED: profilin-1-like                         165   1e-47   
ref|XP_009389903.1|  PREDICTED: profilin-like isoform X4                165   1e-47   
ref|NP_001233973.1|  profilin-2                                         164   1e-47   
ref|XP_007012197.1|  Profilin 5 isoform 2                               166   1e-47   
ref|NP_001105622.1|  profilin-5                                         164   2e-47   
ref|XP_007012196.1|  Profilin 5 isoform 1                               164   2e-47   
ref|XP_004251645.1|  PREDICTED: profilin-1                              164   2e-47   
ref|XP_002274966.2|  PREDICTED: profilin-1                              166   2e-47   
emb|CDP08197.1|  unnamed protein product                                164   2e-47   
ref|XP_009409369.1|  PREDICTED: profilin-like                           164   2e-47   
ref|XP_008794098.1|  PREDICTED: profilin-like                           164   2e-47   
ref|XP_008458990.1|  PREDICTED: profilin                                164   2e-47   
sp|P84177.2|PROF1_CITSI  RecName: Full=Profilin; AltName: Allerge...    164   2e-47   
gb|AFW85126.1|  profilin 3, mRNA                                        164   2e-47   
emb|CDM81724.1|  unnamed protein product                                164   2e-47   
sp|Q94JN2.1|PROF_ANACO  RecName: Full=Profilin; AltName: Full=Min...    164   2e-47   
ref|XP_007223783.1|  hypothetical protein PRUPE_ppa010614mg             167   2e-47   
ref|XP_006298806.1|  hypothetical protein CARUB_v10014910mg             164   2e-47   
ref|XP_009395053.1|  PREDICTED: profilin-1-like                         164   2e-47   
gb|ACP43298.1|  Ama r 2 pollen allergen                                 164   3e-47   
ref|NP_001284474.1|  profilin                                           164   3e-47   
ref|XP_009628677.1|  PREDICTED: profilin-1                              163   4e-47   
gb|AIV43661.1|  profilin                                                164   4e-47   
ref|XP_007160275.1|  hypothetical protein PHAVU_002G307600g             163   4e-47   
gb|AFK40156.1|  unknown                                                 163   4e-47   
dbj|BAK06398.1|  predicted protein                                      163   4e-47   
sp|Q9XF39.1|PROF_PRUAV  RecName: Full=Profilin; AltName: Full=All...    163   4e-47   
gb|EMT03530.1|  Profilin                                                163   4e-47   
gb|AIV43662.1|  profilin                                                163   5e-47   
ref|XP_010110871.1|  Glucan endo-1,3-beta-glucosidase 13                178   6e-47   
ref|XP_003630698.1|  Profilin                                           163   6e-47   
gb|ACR77509.1|  Che a 2 pollen allergen                                 163   6e-47   
ref|XP_010095450.1|  hypothetical protein L484_005874                   162   8e-47   
gb|EPS59245.1|  profilin                                                162   1e-46   
ref|XP_009387128.1|  PREDICTED: profilin-A-like                         162   1e-46   
ref|XP_002436493.1|  hypothetical protein SORBIDRAFT_10g003670          162   1e-46   
gb|ACS34771.1|  Sal k 4 pollen allergen                                 162   2e-46   
gb|AAP42151.3|  profilin                                                162   2e-46   
ref|XP_010489132.1|  PREDICTED: profilin-1-like                         162   2e-46   
ref|XP_009117522.1|  PREDICTED: profilin-1-like                         161   2e-46   
ref|XP_009112626.1|  PREDICTED: profilin-1-like                         161   2e-46   
gb|AAX77687.1|  profilin isoallergen 1                                  161   3e-46   
gb|EYU30692.1|  hypothetical protein MIMGU_mgv1a016198mg                161   3e-46   
ref|XP_006853719.1|  hypothetical protein AMTR_s00056p00159630          161   3e-46   
sp|O81982.1|PROF_HELAN  RecName: Full=Profilin; AltName: Full=Pol...    161   3e-46   
sp|Q64LH0.1|PROF3_AMBAR  RecName: Full=Profilin-3; AltName: Full=...    161   4e-46   
sp|Q9SNW5.1|PROF3_LILLO  RecName: Full=Profilin-3                       160   4e-46   
sp|Q9T0M8.1|PROF2_PARJU  RecName: Full=Profilin-2; AltName: Full=...    160   5e-46   
gb|AFK47485.1|  unknown                                                 160   6e-46   
ref|XP_010688357.1|  PREDICTED: profilin-like                           160   6e-46   
gb|AAU81921.1|  profilin                                                160   7e-46   
gb|ABK22288.1|  unknown                                                 160   9e-46   
gb|ABK27012.1|  unknown                                                 160   9e-46   
gb|ABD62998.1|  profilin 2                                              160   9e-46   
ref|XP_010098156.1|  hypothetical protein L484_026290                   160   9e-46   
sp|Q5EF31.1|PROF_CROSA  RecName: Full=Profilin; AltName: Full=Pol...    160   1e-45   
gb|AHL24658.1|  Sal k 4.03 allergen                                     159   1e-45   
sp|Q9SQI9.1|PROF_ARAHY  RecName: Full=Profilin; AltName: Allergen...    159   1e-45   
gb|ADK22841.1|  Sal k 4.02                                              159   1e-45   
emb|CCP19647.1|  profilin allergen                                      159   2e-45   
emb|CAJ38383.1|  profilin                                               159   2e-45   
gb|KFK40340.1|  hypothetical protein AALP_AA3G361400                    159   3e-45   
ref|XP_008794097.1|  PREDICTED: profilin-like                           159   3e-45   
ref|XP_010536838.1|  PREDICTED: profilin-like                           158   3e-45   
gb|AAD21619.1|  putative profilin                                       158   4e-45   
emb|CDY11912.1|  BnaC03g13380D                                          158   4e-45   
ref|XP_010447864.1|  PREDICTED: profilin-2-like                         158   4e-45   
emb|CDX88579.1|  BnaA03g10700D                                          158   5e-45   
ref|XP_010483134.1|  PREDICTED: profilin-5                              158   5e-45   
ref|XP_009399807.1|  PREDICTED: profilin-like                           158   5e-45   
ref|XP_010495947.1|  PREDICTED: profilin-1-like                         158   5e-45   
ref|XP_006284576.1|  hypothetical protein CARUB_v10005801mg             160   5e-45   
gb|KFK29496.1|  hypothetical protein AALP_AA7G141900                    157   7e-45   
ref|NP_194664.1|  profilin 2                                            157   8e-45   
ref|XP_010416676.1|  PREDICTED: profilin-1-like                         157   9e-45   
ref|XP_010433105.1|  PREDICTED: profilin-2                              157   1e-44   
gb|AAG10088.1|U43591_1  profilin                                        157   1e-44   
gb|AAX77688.1|  profilin isoallergen 2                                  157   1e-44   
sp|Q8H2C9.3|PROF1_ARTVU  RecName: Full=Profilin-1; AltName: Full=...    157   1e-44   
emb|CDY32870.1|  BnaC09g33170D                                          157   1e-44   
ref|XP_009120170.1|  PREDICTED: profilin-5                              157   1e-44   
emb|CDY68825.1|  BnaA01g34880D                                          156   2e-44   
ref|XP_002972472.1|  hypothetical protein SELMODRAFT_148414             156   2e-44   
ref|XP_006281613.1|  hypothetical protein CARUB_v10027731mg             157   2e-44   
ref|XP_002869438.1|  PFN2/PRF2/PRO2                                     156   2e-44   
ref|XP_007204758.1|  hypothetical protein PRUPE_ppa013242mg             156   3e-44   
ref|XP_009413861.1|  PREDICTED: profilin-like                           156   3e-44   
ref|XP_009102139.1|  PREDICTED: profilin-1                              156   3e-44   
emb|CDY64971.1|  BnaAnng19920D                                          155   4e-44   
ref|XP_009628678.1|  PREDICTED: LOW QUALITY PROTEIN: profilin-3-like    155   4e-44   
ref|XP_009128837.1|  PREDICTED: profilin-1                              155   4e-44   
gb|AAM63638.1|  profilin 2                                              155   6e-44   
ref|XP_002883973.1|  PFN1/PRF1                                          155   6e-44   
emb|CDY35886.1|  BnaA07g01010D                                          155   6e-44   
gb|ABU95412.1|  Sin a 4 allergen                                        155   7e-44   
ref|NP_179566.1|  profilin 1                                            155   7e-44   
dbj|BAJ34266.1|  unnamed protein product                                155   8e-44   
ref|XP_009389901.1|  PREDICTED: profilin-like isoform X2                155   1e-43   
gb|KFK27226.1|  hypothetical protein AALP_AA8G353900                    154   1e-43   
ref|XP_009389900.1|  PREDICTED: profilin-like isoform X1                154   2e-43   
ref|XP_006353503.1|  PREDICTED: profilin-like                           154   2e-43   



>ref|XP_003525290.1| PREDICTED: profilin-like [Glycine max]
Length=133

 Score =   186 bits (472),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS +FP ++ +E+TDIMKDFDEPGHLAPTGLHLAG KYMVIQGE GAVIR
Sbjct  27   IIGHDGSVWAQSSSFPQIRPQEITDIMKDFDEPGHLAPTGLHLAGTKYMVIQGESGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKGPGG+TIKKTGQAL+ GVY+EPVTP QCN+VVE++GD+LIDQG+
Sbjct  87   GKKGPGGITIKKTGQALVFGVYEEPVTPGQCNMVVERLGDYLIDQGL  133



>ref|NP_001233869.1| profilin-1 [Solanum lycopersicum]
 sp|Q41344.1|PROF1_SOLLC RecName: Full=Profilin-1 [Solanum lycopersicum]
 gb|AAB03271.1| profilin [Solanum lycopersicum]
Length=133

 Score =   184 bits (467),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+G DG++WAQSP FP  K EE+T+IMKDFDEPGHLAPTGL LAG KYMVIQGEPGAVIR
Sbjct  27   ILGFDGSVWAQSPNFPKFKAEEITNIMKDFDEPGHLAPTGLFLAGTKYMVIQGEPGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQG  369
            GKKGPGG+TIKKT QALI GVY+EPVTP QCN+VVEKIGD+L+DQG
Sbjct  87   GKKGPGGITIKKTAQALIFGVYEEPVTPGQCNMVVEKIGDYLVDQG  132



>ref|XP_007160274.1| hypothetical protein PHAVU_002G307500g [Phaseolus vulgaris]
 gb|ESW32268.1| hypothetical protein PHAVU_002G307500g [Phaseolus vulgaris]
Length=133

 Score =   184 bits (467),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS +FP +K++EV+DIMKDFDEPGHLAPTGLHLAG KYMVIQGE GAVIR
Sbjct  27   IIGHDGSVWAQSTSFPQIKSQEVSDIMKDFDEPGHLAPTGLHLAGVKYMVIQGESGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G Y+EPVTP QCN+VVE++GD+LIDQG+
Sbjct  87   GKKGSGGITIKKTGQALVFGTYEEPVTPGQCNMVVERLGDYLIDQGL  133



>ref|XP_007152957.1| hypothetical protein PHAVU_004G174400g [Phaseolus vulgaris]
 gb|ESW24951.1| hypothetical protein PHAVU_004G174400g [Phaseolus vulgaris]
Length=133

 Score =   183 bits (464),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS  FP VK++E+  IMKDFDEPG+LAPTGLHLAG KYMVIQGEPGAVIR
Sbjct  27   IIGHDGSVWAQSSAFPQVKSDEINGIMKDFDEPGYLAPTGLHLAGTKYMVIQGEPGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+YDEPVTP QCN+VVE++GD+L+DQG+
Sbjct  87   GKKGSGGITIKKTGQALVFGLYDEPVTPGQCNMVVERLGDYLVDQGL  133



>ref|XP_006584806.1| PREDICTED: profilin-like [Glycine max]
 gb|KHN16655.1| Profilin [Glycine soja]
Length=133

 Score =   183 bits (464),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS +FP +K++E+TDIMKDFDEPG+LAPTGLHLAG KYMVIQGE GAVIR
Sbjct  27   IIGHDGSVWAQSSSFPQIKSQEITDIMKDFDEPGYLAPTGLHLAGTKYMVIQGESGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+LI+QG+
Sbjct  87   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIEQGL  133



>ref|XP_003516387.1| PREDICTED: profilin-like [Glycine max]
 gb|KHN39950.1| Profilin [Glycine soja]
Length=133

 Score =   183 bits (464),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS +FP +K++E+  IMKDFDEPGHLAPTGLHL G KYMVIQGEPGAVIR
Sbjct  27   IIGHDGSVWAQSSSFPQIKSDEINGIMKDFDEPGHLAPTGLHLGGTKYMVIQGEPGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+YDEPVTP QCN++VE++GD+L+DQG+
Sbjct  87   GKKGSGGITIKKTGQALVFGIYDEPVTPGQCNMIVERLGDYLVDQGL  133



>ref|XP_006583560.1| PREDICTED: profilin-like [Glycine max]
 gb|KHN40366.1| Profilin [Glycine soja]
Length=133

 Score =   183 bits (464),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIG DG++WAQS +FP +K++E+  IMKDFDEPGHLAPTGLHLAG KYMVIQGEPGAVIR
Sbjct  27   IIGQDGSVWAQSSSFPQIKSDEINGIMKDFDEPGHLAPTGLHLAGTKYMVIQGEPGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+YDEPVTP QCN+VVE++GD+L+DQG+
Sbjct  87   GKKGSGGITIKKTGQALVFGIYDEPVTPGQCNMVVERLGDYLVDQGL  133



>ref|XP_003630696.1| Profilin [Medicago truncatula]
Length=133

 Score =   183 bits (464),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS +FP +K +E TDIMKDFDEPGHLAPTGLHLAG KYMVIQGE GAVIR
Sbjct  27   IIGHDGSVWAQSSSFPQIKPQENTDIMKDFDEPGHLAPTGLHLAGVKYMVIQGESGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ GVY+EPVTP QCN+VVE++GD+LIDQG+
Sbjct  87   GKKGSGGITIKKTGQALVFGVYEEPVTPGQCNMVVERLGDYLIDQGL  133



>gb|KDP33777.1| hypothetical protein JCGZ_07348 [Jatropha curcas]
Length=133

 Score =   182 bits (463),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS +FP  K EEVTDIMKDF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  27   IIGHDGSVWAQSTSFPQFKPEEVTDIMKDFEEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+YDEPVTP QCN++VE++GD+LIDQG+
Sbjct  87   GKKGSGGITIKKTGQALVFGIYDEPVTPGQCNMIVERLGDYLIDQGL  133



>ref|XP_004503499.1| PREDICTED: profilin-like [Cicer arietinum]
Length=133

 Score =   182 bits (461),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS +FP +K++E+T IMKDFDEPG LAPTGLHLAG KYMVIQGEPGAVIR
Sbjct  27   IIGHDGSVWAQSSSFPQIKSQEITGIMKDFDEPGTLAPTGLHLAGVKYMVIQGEPGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ GVY+EPVTP QCN+VVE++GD+L+DQG+
Sbjct  87   GKKGSGGITIKKTGQALVFGVYEEPVTPGQCNMVVERLGDYLVDQGL  133



>ref|XP_007012985.1| Profilin 5 [Theobroma cacao]
 gb|EOY30604.1| Profilin 5 [Theobroma cacao]
Length=133

 Score =   182 bits (461),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS TFP  K  E+TDIMKDFDEPGHLAPTGLHL G KYMVIQGEPGAVIR
Sbjct  27   IIGHDGSVWAQSSTFPQFKPNEITDIMKDFDEPGHLAPTGLHLGGTKYMVIQGEPGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L DQG+
Sbjct  87   GKKGSGGITVKKTGQALVFGLYEEPVTPGQCNMVVERLGDYLADQGL  133



>ref|XP_008458981.1| PREDICTED: profilin-4 [Cucumis melo]
Length=133

 Score =   182 bits (461),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS +FP  K+EE+  IMKDFDEPGHLAPTGLHL G KYMVIQGEPGAVIR
Sbjct  27   IVGHDGSVWAQSASFPQFKSEEINGIMKDFDEPGHLAPTGLHLGGTKYMVIQGEPGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L+DQG+
Sbjct  87   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLVDQGL  133



>sp|Q9XF37.1|PROF_APIGR RecName: Full=Profilin; AltName: Full=Minor pollen allergen Api 
g 4; AltName: Allergen=Api g 4 [Apium graveolens]
 gb|AAD29409.1| profilin [Apium graveolens]
Length=134

 Score =   181 bits (460),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS TFP +K EE+  IMKDFDEPGHLAPTGL+L G KYMVIQGEP AVIR
Sbjct  28   IIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEPGHLAPTGLYLGGAKYMVIQGEPNAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ GVYDEPVTP QCN++VE++GD+LIDQG+
Sbjct  88   GKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNVIVERLGDYLIDQGL  134



>gb|AAD02560.1| PGPS/NH20 [Petunia x hybrida]
Length=124

 Score =   181 bits (458),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQSP+FP  K EE+T+IMKDFDEPG LAPTGL LAG KYMVIQGEPGAVIR
Sbjct  18   ILGHDGSVWAQSPSFPKFKPEEITNIMKDFDEPGFLAPTGLFLAGAKYMVIQGEPGAVIR  77

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQG  369
            GKKG GG+TIKKT QALI G+Y+EPVTP QCN+VVEKIGD+L+DQG
Sbjct  78   GKKGSGGITIKKTNQALIFGLYEEPVTPGQCNMVVEKIGDYLVDQG  123



>sp|A4KA45.1|PROF4_CORAV RecName: Full=Profilin-4; AltName: Full=Allergen Cor a 2; AltName: 
Full=Pollen allergen Cor a 2; AltName: Allergen=Cor a 
2 [Corylus avellana]
 gb|ABG81302.1| pollen profilin variant 7 [Corylus avellana]
 gb|ABG81303.1| pollen profilin variant 8 [Corylus avellana]
 gb|ABG81304.1| pollen profilin variant 9 [Corylus avellana]
 gb|ABG81305.1| pollen profilin variant 10 [Corylus avellana]
Length=133

 Score =   181 bits (458),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS +FP +K EE+T IMKDFDEPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  27   IVGHDGSVWAQSSSFPQLKPEEITGIMKDFDEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+LIDQG+
Sbjct  87   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIDQGL  133



>ref|XP_002515952.1| profilin, putative [Ricinus communis]
 gb|EEF46372.1| profilin, putative [Ricinus communis]
Length=132

 Score =   180 bits (457),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS TFP +K EEVT IMKDFDEPG LAPTGLHL G KYMVIQGEPGAVIR
Sbjct  26   IIGHDGSVWAQSATFPQLKPEEVTAIMKDFDEPGSLAPTGLHLGGTKYMVIQGEPGAVIR  85

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG T+KKTGQA+++G+YDEP+TP QCN+VVE++GD+LIDQG+
Sbjct  86   GKKGSGGATLKKTGQAIVIGIYDEPLTPGQCNMVVERLGDYLIDQGL  132



>ref|XP_004141027.1| PREDICTED: profilin-like [Cucumis sativus]
 ref|XP_004157896.1| PREDICTED: profilin-like [Cucumis sativus]
 gb|KGN60568.1| hypothetical protein Csa_2G000760 [Cucumis sativus]
Length=133

 Score =   180 bits (457),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS +FP  K++E+  IMKDFDEPGHLAPTGLHL G KYMVIQGEPGAVIR
Sbjct  27   IVGHDGSVWAQSASFPQFKSDEINGIMKDFDEPGHLAPTGLHLGGTKYMVIQGEPGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L+DQG+
Sbjct  87   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLVDQGL  133



>ref|XP_009591293.1| PREDICTED: profilin-2 [Nicotiana tomentosiformis]
Length=134

 Score =   180 bits (457),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+G+DG++WAQS TFP  K EE+T+IMKDFDEPGHLAPTGL LAG KYMVIQGEPGAVIR
Sbjct  28   ILGNDGSVWAQSTTFPKFKPEEITNIMKDFDEPGHLAPTGLFLAGAKYMVIQGEPGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQG  369
            GKKG GG+TIKKT QALI G+Y+EPVTP QCN+VVEKIGD+L+DQG
Sbjct  88   GKKGSGGITIKKTNQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQG  133



>ref|XP_009789538.1| PREDICTED: profilin-1 [Nicotiana sylvestris]
Length=134

 Score =   180 bits (457),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+T+IMKDFDEPGHLAPTGL L G KYMVIQGEPGAVIR
Sbjct  28   ILGHDGSVWAQSSTFPKFKPEEITNIMKDFDEPGHLAPTGLFLGGAKYMVIQGEPGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQG  369
            GKKG GG+TIKKT QALI G+Y+EPVTP QCN+VVEKIGD+L+DQG
Sbjct  88   GKKGSGGITIKKTNQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQG  133



>ref|XP_010536839.1| PREDICTED: profilin-4 [Tarenaya hassleriana]
Length=133

 Score =   179 bits (455),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS  FP VK +E+TDIMKDFD+PGHLAPTGLHL G KYMVIQGEPGAVIR
Sbjct  27   IVGHDGSVWAQSSNFPQVKPQEITDIMKDFDDPGHLAPTGLHLGGAKYMVIQGEPGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+LIDQ +
Sbjct  87   GKKGSGGATIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIDQDL  133



>sp|O24650.1|PROF2_PHLPR RecName: Full=Profilin-2; AltName: Full=Allergen Phl p 11; AltName: 
Full=Pollen allergen Phl p 12; AltName: Full=Profilin 
4; AltName: Allergen=Phl p 12 [Phleum pratense]
 emb|CAA70608.1| profilin 2 [Phleum pratense]
 emb|CAA70610.1| profilin 4 [Phleum pratense]
Length=131

 Score =   179 bits (455),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDGT+WAQS  FP  K EE+T IMKDFDEPGHLAPTG+ +AG KYMVIQGEPGAVIR
Sbjct  25   ILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHLAPTGMFVAGAKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+VG+YDEP+TP QCN+VVE++GD+L++QGM
Sbjct  85   GKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLVEQGM  131



>sp|O49894.1|PROF_MERAN RecName: Full=Profilin; AltName: Full=Pollen allergen Mer a 1; 
AltName: Allergen=Mer a 1 [Mercurialis annua]
 emb|CAA73720.1| Profilin [Mercurialis annua]
Length=133

 Score =   179 bits (455),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG+IWAQS +FP +K EE+T IMKDFDEPGHLAPTGL++AG KYMVIQGE GAVIR
Sbjct  27   IVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPGHLAPTGLYIAGTKYMVIQGESGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+LI+QGM
Sbjct  87   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIEQGM  133



>ref|XP_009777310.1| PREDICTED: profilin-3 [Nicotiana sylvestris]
Length=133

 Score =   179 bits (454),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQSP FP  K EE+T+IMKDFDEPG LAPTGL LAG KYMVIQGEPGAVIR
Sbjct  27   ILGHDGSVWAQSPAFPKFKPEEITNIMKDFDEPGFLAPTGLFLAGIKYMVIQGEPGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQG  369
            GKKG GG+TIKKT QALI G+Y+EPVTP QCN+VVEKIGD+L+DQG
Sbjct  87   GKKGSGGITIKKTNQALIFGLYEEPVTPGQCNMVVEKIGDYLVDQG  132



>sp|Q9LEI8.1|PROF6_HEVBR RecName: Full=Profilin-6; AltName: Full=Pollen allergen Hev b 
8.0204; AltName: Allergen=Hev b 8.0204 [Hevea brasiliensis]
 emb|CAB96215.1| profilin [Hevea brasiliensis]
Length=131

 Score =   179 bits (454),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS +FP  K++EV  +MKDFDEPG LAPTGLHL G KYMVIQGEPGAVIR
Sbjct  25   IIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSLAPTGLHLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQALI+G+YDEP+TP QCN++VE++GD+L+DQG+
Sbjct  85   GKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVERLGDYLLDQGL  131



>emb|CAB61833.1| profilin [Nicotiana tabacum]
Length=134

 Score =   179 bits (454),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS  FP  K EE+T+IMKDFDEPGHLAPTGL L G KYMVIQGEPGAVIR
Sbjct  28   ILGHDGSVWAQSSAFPKFKPEEITNIMKDFDEPGHLAPTGLFLGGAKYMVIQGEPGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQG  369
            GKKG GG+TIKKT QALI G+Y+EPVTP QCN+VVEKIGD+L+DQG
Sbjct  88   GKKGSGGITIKKTNQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQG  133



>sp|A4KA44.1|PROF3_CORAV RecName: Full=Profilin-3; AltName: Full=Allergen Cor a 2; AltName: 
Full=Pollen allergen Cor a 2; AltName: Allergen=Cor a 
2 [Corylus avellana]
 gb|ABG81301.1| pollen profilin variant 6 [Corylus avellana]
Length=133

 Score =   179 bits (453),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS +FP +K EE+T IMKDFDEPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  27   IVGHDGSVWAQSSSFPQLKPEEITGIMKDFDEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L++QG+
Sbjct  87   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLVEQGL  133



>gb|KHG15153.1| Profilin [Gossypium arboreum]
Length=132

 Score =   179 bits (453),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+G DG++WAQS  FPT K EE+T IMKDFDEPG LAPTGLHL G KYMVIQGEPGAV+R
Sbjct  26   ILGLDGSVWAQSSAFPTFKPEEITAIMKDFDEPGSLAPTGLHLGGAKYMVIQGEPGAVVR  85

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQALI G+YDEPVTP QCN+VVE++GD+L+DQGM
Sbjct  86   GKKGTGGVTVKKTGQALIFGIYDEPVTPGQCNMVVERLGDYLVDQGM  132



>gb|AFK47381.1| unknown [Lotus japonicus]
Length=133

 Score =   179 bits (453),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG+IWAQS  FP  K  E+  IMKDFDEPGHLAPTGLHL G KYMVIQGEPGAVIR
Sbjct  27   IVGHDGSIWAQSANFPQFKAGEIPGIMKDFDEPGHLAPTGLHLGGTKYMVIQGEPGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+YDEPVTP QCN++VE++GD+LIDQG+
Sbjct  87   GKKGSGGITIKKTGQALVFGIYDEPVTPGQCNMIVERLGDYLIDQGL  133



>pdb|1G5U|A Chain A, Latex Profilin Hevb8
 pdb|1G5U|B Chain B, Latex Profilin Hevb8
Length=131

 Score =   179 bits (453),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS +FP  K++EV  +MKDFDEPG LAPTGLHL G KYMVIQGEPGAVIR
Sbjct  25   IIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSLAPTGLHLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+K+TGQALI+G+YDEP+TP QCN++VE++GD+L+DQG+
Sbjct  85   GKKGSGGITVKRTGQALIIGIYDEPLTPGQCNMIVERLGDYLLDQGL  131



>ref|XP_009622655.1| PREDICTED: profilin-3 [Nicotiana tomentosiformis]
Length=133

 Score =   179 bits (453),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQSP FP  K EE+T+IMKDFDEPG LAPTGL L G KYMVIQGEPGAVIR
Sbjct  27   ILGHDGSVWAQSPAFPEFKPEEITNIMKDFDEPGFLAPTGLFLCGTKYMVIQGEPGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQG  369
            GKKG GG+TIKKT QALI G+Y+EPVTP QCN+VVEKIGD+L+DQG
Sbjct  87   GKKGSGGITIKKTNQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQG  132



>sp|A4KA39.1|PROF1_CORAV RecName: Full=Profilin-1; AltName: Full=Allergen Cor a 2; AltName: 
Full=Pollen allergen Cor a 2; AltName: Allergen=Cor a 
2 [Corylus avellana]
 gb|ABG81296.1| pollen profilin variant 1 [Corylus avellana]
 gb|ABG81299.1| pollen profilin variant 4 [Corylus avellana]
Length=133

 Score =   178 bits (452),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS +FP +K EE+T IMKDFDEPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  27   IVGHDGSVWAQSSSFPQLKPEEITGIMKDFDEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L++QG+
Sbjct  87   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLLEQGL  133



>sp|Q9M7N0.1|PROF3_HEVBR RecName: Full=Profilin-3; AltName: Full=Pollen allergen Hev b 
8.0201; AltName: Allergen=Hev b 8.0201 [Hevea brasiliensis]
 gb|AAF34341.1|AF119365_1 latex profilin Hev b 8 [Hevea brasiliensis]
Length=131

 Score =   178 bits (452),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS +FP  K EEV  IMKDFDEPG LAPTGLHL G KYMVIQGEPGAVIR
Sbjct  25   IIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPGSLAPTGLHLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQALI+G+YDEP+TP QCN++VE++GD+L++QGM
Sbjct  85   GKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVERLGDYLLEQGM  131



>sp|Q9ST99.1|PROF2_TOBAC RecName: Full=Profilin-2; AltName: Full=Pollen allergen Nic t 
8; AltName: Allergen=Nic t 8 [Nicotiana tabacum]
 emb|CAA63751.1| profilin [Nicotiana tabacum]
Length=134

 Score =   178 bits (452),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+G+DG++WAQS TFP  K EE+T+IMKDFDEPGHLAPTGL L G KYMVIQGEPGAVIR
Sbjct  28   ILGNDGSVWAQSTTFPKFKPEEITNIMKDFDEPGHLAPTGLFLGGAKYMVIQGEPGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQG  369
            GKKG GG+TIKKT QALI G+Y+EPVTP QCN+VVEKIGD+L+DQG
Sbjct  88   GKKGSGGITIKKTNQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQG  133



>ref|XP_002514198.1| profilin, putative [Ricinus communis]
 gb|EEF48152.1| profilin, putative [Ricinus communis]
Length=133

 Score =   178 bits (452),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG+IWAQS +FP +K EE+T IMKDF+EPGHLAPTGLH+ G KYMVIQGEPGAVIR
Sbjct  27   IVGHDGSIWAQSSSFPQLKPEEITGIMKDFEEPGHLAPTGLHIGGTKYMVIQGEPGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+LIDQ +
Sbjct  87   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIDQAL  133



>gb|KHM99818.1| Profilin [Glycine soja]
Length=130

 Score =   178 bits (452),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 97/107 (91%), Gaps = 3/107 (3%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS +FP     ++TDIMKDFDEPGHLAPTGLHLAG KYMVIQGE GAVIR
Sbjct  27   IIGHDGSVWAQSSSFPQA---QITDIMKDFDEPGHLAPTGLHLAGTKYMVIQGESGAVIR  83

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKGPGG+TIKKTGQAL+ GVY+EPVTP QCN+VVE++GD+LIDQG+
Sbjct  84   GKKGPGGITIKKTGQALVFGVYEEPVTPGQCNMVVERLGDYLIDQGL  130



>sp|A4GFC3.1|PROCG_OLEEU RecName: Full=Profilin-3; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|ABG33905.1| Ole e 2 allergen [Olea europaea]
Length=131

 Score =   178 bits (452),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDGT+WAQS  FP  K EE+T IMKDFDEPGHLAPTG+ +AG KYMVIQGEPGAVIR
Sbjct  25   ILGHDGTVWAQSTAFPQFKPEEITGIMKDFDEPGHLAPTGMFVAGAKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQG  369
            GKKG GG+TIKKTGQAL+VG+YDEP+TP QCN+VVE++GD+L++QG
Sbjct  85   GKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLLEQG  130



>gb|AAK01236.1|AF327623_1 minor allergen hazelnut profilin [Corylus avellana]
Length=131

 Score =   178 bits (452),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS TFP +K EE+T +M DF+EPG LAPTGL+L G KYMVIQGEPGAVIR
Sbjct  25   IIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKGPGG+T+KKT QALI+G+YDEP+TP QCN++VE++GD+LIDQG+
Sbjct  85   GKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL  131



>sp|Q84V37.1|PROF_CHEAL RecName: Full=Profilin; AltName: Full=Minor pollen allergen Che 
a 2; AltName: Allergen=Che a 2 [Chenopodium album]
 gb|AAL92870.1| pollen allergen Che a 2 [Chenopodium album]
Length=131

 Score =   178 bits (451),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDGT+WAQSP+FP +K EEV+ IMKDF+EPG LAPTGLHL G KYMVIQGEPG VIR
Sbjct  25   ILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSLAPTGLHLGGTKYMVIQGEPGDVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKGPGG+TIKKT QALI+G+Y EP+TP QCN+VVE+IGD+L++QGM
Sbjct  85   GKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVERIGDYLVEQGM  131



>ref|XP_003569765.1| PREDICTED: profilin-2 [Brachypodium distachyon]
Length=131

 Score =   178 bits (451),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDGT+WAQS  FP+ K EE+T+IMKDFDEPG LAPTGL LA  KYMVIQGEPGAVIR
Sbjct  25   ILGHDGTVWAQSADFPSFKPEEMTNIMKDFDEPGTLAPTGLFLASAKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQAL+VG+YDEP+TP QCN+VVE++GD+L++QGM
Sbjct  85   GKKGSGGITLKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLVEQGM  131



>sp|Q9ST98.1|PROF3_TOBAC RecName: Full=Profilin-3 [Nicotiana tabacum]
 emb|CAA63752.1| profilin [Nicotiana tabacum]
Length=133

 Score =   178 bits (451),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQSP FP  K EE+T+IMKDFDEPG LAPTGL LAG KYMVIQGEPGAVIR
Sbjct  27   ILGHDGSVWAQSPHFPKFKPEEITNIMKDFDEPGFLAPTGLFLAGIKYMVIQGEPGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQG  369
            GKKG GG+TIKKT QALI G+Y+EPVTP QCN+VVEKIGD+L+DQG
Sbjct  87   GKKGSGGITIKKTNQALIFGLYEEPVTPGQCNMVVEKIGDYLVDQG  132



>sp|P41372.1|PROF1_TOBAC RecName: Full=Profilin-1 [Nicotiana tabacum]
 emb|CAA57632.1| profilin [Nicotiana tabacum]
Length=134

 Score =   178 bits (451),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+T+IMKDFDEPGHLAPTGL L G KYMVIQGEPGAVIR
Sbjct  28   ILGHDGSVWAQSSTFPKFKPEEITNIMKDFDEPGHLAPTGLFLGGAKYMVIQGEPGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQG  369
            GKKG GG+TIKKT QALI G+Y+EPVTP QCN+VVEKI D+L+DQG
Sbjct  88   GKKGSGGITIKKTNQALIFGIYEEPVTPGQCNMVVEKIRDYLVDQG  133



>ref|XP_004513067.1| PREDICTED: profilin-like [Cicer arietinum]
Length=133

 Score =   177 bits (450),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS +FP  K+ E+  IMKDFDEPGHLAPTGL++ G KYMVIQGEPGAVIR
Sbjct  27   IVGHDGSVWAQSNSFPQFKSNEINGIMKDFDEPGHLAPTGLYIGGTKYMVIQGEPGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ GVY+EPVTP QCN+VVE++GD+L+DQG+
Sbjct  87   GKKGSGGITIKKTGQALVFGVYEEPVTPGQCNMVVERLGDYLVDQGL  133



>gb|AAW84276.1| profilin 2 [Petroselinum crispum]
Length=134

 Score =   177 bits (450),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS TFP VK EE++ IMKDFDEPG+LAPTGL+L G KYMVIQGEP AVIR
Sbjct  28   IIGHDGSVWAQSSTFPQVKPEEISGIMKDFDEPGYLAPTGLYLGGAKYMVIQGEPNAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTG AL+ GVYDEPVTP QCN++VE++GD+LI+QGM
Sbjct  88   GKKGSGGVTIKKTGLALVFGVYDEPVTPGQCNMIVERLGDYLIEQGM  134



>sp|P35079.1|PROF1_PHLPR RecName: Full=Profilin-1; AltName: Full=Allergen Phl p 11; AltName: 
Full=Pollen allergen Phl p 12; AltName: Allergen=Phl 
p 12 [Phleum pratense]
 emb|CAA54686.1| profilin [Phleum pratense]
Length=131

 Score =   177 bits (450),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDGT+WAQS  FP  K EE+T IMKDFDEPGHLAPTG+ +AG KYMVIQGEPG VIR
Sbjct  25   ILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHLAPTGMFVAGAKYMVIQGEPGRVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+VG+YDEP+TP QCN+VVE++GD+L++QGM
Sbjct  85   GKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLVEQGM  131



>gb|AFG16922.1| profilin [Quercus suber]
 gb|AFG16924.1| profilin [Quercus suber]
Length=131

 Score =   177 bits (449),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS TFP  K EEV  I+KDFDEPG LAPTGLHL G KYMVIQGEPGAVIR
Sbjct  25   IIGHDGSVWAQSATFPQFKPEEVAAIIKDFDEPGSLAPTGLHLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQALI G+YDEP+TP QCNI+VE++GD+LI+QG+
Sbjct  85   GKKGAGGITVKKTGQALIFGIYDEPLTPGQCNIIVERLGDYLIEQGL  131



>sp|A4KA40.1|PROF2_CORAV RecName: Full=Profilin-2; AltName: Full=Allergen Cor a 2; AltName: 
Full=Pollen allergen Cor a 2; AltName: Allergen=Cor a 
2 [Corylus avellana]
 gb|ABG81297.1| pollen profilin variant 2 [Corylus avellana]
Length=133

 Score =   177 bits (449),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS +FP +K EE+T IMKDFDEPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  27   IVGHDGSVWAQSSSFPQLKPEEITGIMKDFDEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L +QG+
Sbjct  87   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLAEQGL  133



>gb|AFG16923.1| profilin [Quercus suber]
Length=131

 Score =   177 bits (449),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS TFP  K EEV  I+KDFDEPG LAPTGLHL G KYMVIQGEPGAVIR
Sbjct  25   IIGHDGSVWAQSATFPQFKPEEVAAIIKDFDEPGSLAPTGLHLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQALI G+YDEP+TP QCNI+VE++GD+LI+QG+
Sbjct  85   GKKGAGGITVKKTGQALIFGIYDEPLTPGQCNIIVERLGDYLIEQGL  131



>sp|A4GFC0.1|PROCE_OLEEU RecName: Full=Profilin-3; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|ABG33902.1| Ole e 2 allergen [Olea europaea]
Length=131

 Score =   177 bits (449),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGH GT+WAQS  FP  K EE+T IMKDFDEPGHLAPTG+ +AG KYMVIQGEPGAVIR
Sbjct  25   IIGHAGTVWAQSTAFPQFKPEEITGIMKDFDEPGHLAPTGMFVAGAKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+VG+YDEP+TP QCN+VVE++GD+L++QG+
Sbjct  85   GKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLLEQGL  131



>sp|Q9M7M8.1|PROF5_HEVBR RecName: Full=Profilin-5; AltName: Full=Pollen allergen Hev b 
8.0203; AltName: Allergen=Hev b 8.0203 [Hevea brasiliensis]
 gb|AAF34343.1|AF119367_1 latex profilin Hev b 8 [Hevea brasiliensis]
Length=131

 Score =   177 bits (449),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS  FP  K++EV  +MKDFDEPG LAPTGLHL G KYMVIQGEPGAVIR
Sbjct  25   IIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPGSLAPTGLHLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQALI+G+YDEP+TP QCN++VE++GD+L++QGM
Sbjct  85   GKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVERLGDYLLEQGM  131



>gb|AAW84278.1| profilin 4 [Petroselinum crispum]
Length=134

 Score =   177 bits (449),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS TFP VK EE+  IMKDFDEPG+LAPTGL+L G KYMVIQGEP AVIR
Sbjct  28   IIGHDGSVWAQSSTFPQVKPEEIAGIMKDFDEPGYLAPTGLYLGGAKYMVIQGEPNAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTG AL+ GVYDEPVTP QCN++VE++GD+LI+QGM
Sbjct  88   GKKGSGGVTIKKTGLALVFGVYDEPVTPGQCNMIVERLGDYLIEQGM  134



>ref|XP_007024334.1| Profilin 5 [Theobroma cacao]
 gb|EOY26956.1| Profilin 5 [Theobroma cacao]
Length=132

 Score =   177 bits (448),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS +FP  K EE+  IMKDFDEPG LAP+GLHL G KYMVIQGEPGAVIR
Sbjct  26   IIGHDGSVWAQSTSFPQFKPEEIIAIMKDFDEPGSLAPSGLHLGGTKYMVIQGEPGAVIR  85

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQALI G+YDEPVTP QCN+VVE++GD+L+DQG+
Sbjct  86   GKKGAGGITVKKTGQALIFGLYDEPVTPGQCNMVVERLGDYLVDQGL  132



>gb|ABC02750.1| profilin [Litchi chinensis]
Length=131

 Score =   177 bits (448),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS  FP  K  E+T IMKDFDEPG LAPTGLHL G KYMVIQGEPGAVIR
Sbjct  25   IIGHDGSVWAQSANFPQFKPVEITAIMKDFDEPGSLAPTGLHLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKGPGG+T+KKT QALI+G+YDEP+TP QCN+VVE++GD+L+DQG+
Sbjct  85   GKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVERLGDYLVDQGL  131



>sp|P25816.1|PROF1_BETPN RecName: Full=Profilin-1; AltName: Full=Allergen Bet v II; AltName: 
Full=Pollen allergen Bet v 2; AltName: Allergen=Bet v 
2 [Betula pendula]
 gb|AAA16522.1| profilin [Betula pendula]
Length=133

 Score =   177 bits (448),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS +FP  K +E+T IMKDF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  27   IVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPGHLAPTGLHLGGIKYMVIQGEAGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+LIDQG+
Sbjct  87   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIDQGL  133



>ref|XP_003568071.1| PREDICTED: profilin-2-like [Brachypodium distachyon]
Length=131

 Score =   177 bits (448),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDGT+WAQS  FP  + +E+TDIMKDFDEPGHLAPTG+ L G KYMVI GEPGAVIR
Sbjct  25   ILGHDGTVWAQSAAFPAFEPKEMTDIMKDFDEPGHLAPTGMFLGGAKYMVIAGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL++G+YDEP+TP QCN+VVE++GD+L++QGM
Sbjct  85   GKKGSGGITIKKTGQALVIGIYDEPMTPGQCNMVVERLGDYLVEQGM  131



>sp|Q8SAE6.1|PROF_DAUCA RecName: Full=Profilin; AltName: Full=Minor pollen allergen Dau 
c 4; AltName: Allergen=Dau c 4 [Daucus carota]
 gb|AAL76933.1|AF456482_1 minor allergen Dau c 4 profilin [Daucus carota]
Length=134

 Score =   177 bits (448),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS TFP  K EE+T IMK+FDEPGHLAPTGL+L G KYMVIQGEP AVIR
Sbjct  28   IIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEPGHLAPTGLYLGGTKYMVIQGEPIAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ GVYDEPVTP QCN++VE++GD+LI+QG+
Sbjct  88   GKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNLIVERLGDYLIEQGL  134



>ref|XP_002441408.1| hypothetical protein SORBIDRAFT_09g026120 [Sorghum bicolor]
 gb|EES19838.1| hypothetical protein SORBIDRAFT_09g026120 [Sorghum bicolor]
Length=131

 Score =   176 bits (447),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I GHDG +WAQS TFP  K E++T+IMKDFDEPGHLAPTGL L   KYMVIQGEPGAVIR
Sbjct  25   IAGHDGAVWAQSATFPEFKPEDMTNIMKDFDEPGHLAPTGLFLGATKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQALI+G+YDEP+TP QCN+VVE++GD+L++QGM
Sbjct  85   GKKGSGGITVKKTGQALIIGIYDEPMTPGQCNMVVERLGDYLVEQGM  131



>pdb|1CQA|A Chain A, Birch Pollen Profilin
Length=133

 Score =   176 bits (447),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS +FP  K +E+T IMKDF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  27   IVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPGHLAPTGLHLGGIKYMVIQGEAGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+LIDQG+
Sbjct  87   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIDQGL  133



>sp|A4K9Z8.1|PROF2_BETPN RecName: Full=Profilin-2; AltName: Full=Allergen Bet v II; AltName: 
Full=Pollen allergen Bet v 2; AltName: Allergen=Bet v 
2 [Betula pendula]
 gb|ABG48509.1| pollen profilin [Betula pendula]
Length=133

 Score =   176 bits (447),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS +FP  K +E+T IMKDF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  27   IVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPGHLAPTGLHLGGIKYMVIQGEAGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+LIDQG+
Sbjct  87   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIDQGL  133



>sp|Q941H7.1|PROF_LITCN RecName: Full=Profilin; AltName: Full=Minor allergen Lit c 1; 
AltName: Allergen=Lit c 1 [Litchi chinensis]
 gb|AAL07320.1| profilin [Litchi chinensis]
Length=131

 Score =   176 bits (447),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS  FP  K  E+  IMKDFDEPG LAPTGLHL G KYMVIQGEPGAVIR
Sbjct  25   IIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSLAPTGLHLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKGPGG+T+KKT QALI+G+YDEP+TP QCN+VVE++GD+L+DQG+
Sbjct  85   GKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVERLGDYLVDQGL  131



>ref|XP_002514199.1| profilin, putative [Ricinus communis]
 sp|O82572.1|PROF1_RICCO RecName: Full=Profilin-1 [Ricinus communis]
 gb|AAC62482.1| profilin [Ricinus communis]
 gb|EEF48153.1| profilin, putative [Ricinus communis]
Length=131

 Score =   176 bits (447),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIG DG++WAQS TFP  K EE+T IM DF+EPG LAPTGL+L+G KYMVIQGEPGAVIR
Sbjct  25   IIGQDGSVWAQSSTFPQFKPEEITAIMNDFNEPGSLAPTGLYLSGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKGPGG+T+KKT QALI+G+YDEP+TP QCN++VE++GD+LIDQG+
Sbjct  85   GKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL  131



>ref|XP_002883972.1| hypothetical protein ARALYDRAFT_480492 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60231.1| hypothetical protein ARALYDRAFT_480492 [Arabidopsis lyrata subsp. 
lyrata]
Length=134

 Score =   176 bits (447),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS  FP  K +E+TDIMKDFDEPGHLAPTGL LAG KYMVIQGEP AVIR
Sbjct  28   IIGHDGSVWAQSANFPQFKPQEITDIMKDFDEPGHLAPTGLFLAGLKYMVIQGEPNAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQ+++ G+Y+EPVTP QCN+VVE++GD+LI+QG+
Sbjct  88   GKKGAGGITIKKTGQSMVFGLYEEPVTPGQCNMVVERLGDYLIEQGL  134



>ref|XP_004961445.1| PREDICTED: profilin-A-like [Setaria italica]
Length=131

 Score =   176 bits (447),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG +WAQS  FP  K EE+ DIMKDFDEPGHLAPTG+ L   KYMVIQGEPGAVIR
Sbjct  25   IVGHDGAVWAQSAAFPQFKAEEMADIMKDFDEPGHLAPTGMFLGTTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQALI+G+YDEP+TP QCN+VVE++GD+LI+Q M
Sbjct  85   GKKGSGGVTVKKTGQALIIGIYDEPMTPGQCNLVVERLGDYLIEQAM  131



>ref|XP_011000942.1| PREDICTED: profilin-3 [Populus euphratica]
Length=131

 Score =   176 bits (446),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS TFP  K EE++ IMKDFDEPG LAPTGLHL G KYMVIQGEPGAVIR
Sbjct  25   IIGHDGSVWAQSATFPQFKPEEISAIMKDFDEPGSLAPTGLHLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKT QAL++G+YDEP+TP QCN++VE++GD+L DQG+
Sbjct  85   GKKGSGGVTVKKTSQALVIGLYDEPLTPGQCNMIVERLGDYLTDQGL  131



>ref|XP_006356135.1| PREDICTED: profilin-1-like [Solanum tuberosum]
Length=131

 Score =   176 bits (446),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+G DG++WAQSP FP  K EE+ +IMKDFDEPG LAPTGL L+G KYMVIQGEPGAVIR
Sbjct  25   ILGFDGSVWAQSPAFPKFKPEEIINIMKDFDEPGFLAPTGLFLSGAKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQG  369
            GKKG GG+TIKKTGQ+LI G+Y+EPVTP QCN+VVEKIGD+LIDQG
Sbjct  85   GKKGSGGITIKKTGQSLIFGIYEEPVTPGQCNMVVEKIGDYLIDQG  130



>gb|AAW84277.1| profilin 3 [Petroselinum crispum]
Length=134

 Score =   176 bits (446),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS +FP  K EE+  IMKDFDEPGHLAPTGL+L G KYMVIQGEP AVIR
Sbjct  28   IIGHDGSVWAQSSSFPKFKPEEIAGIMKDFDEPGHLAPTGLYLGGTKYMVIQGEPNAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTG AL+ GVYDEPVTP QCN++VE++GD+LI+QGM
Sbjct  88   GKKGSGGVTIKKTGLALVFGVYDEPVTPGQCNLIVERLGDYLIEQGM  134



>sp|Q9M7M9.1|PROF4_HEVBR RecName: Full=Profilin-4; AltName: Full=Pollen allergen Hev b 
8.0202; AltName: Allergen=Hev b 8.0202 [Hevea brasiliensis]
 gb|AAF34342.1|AF119366_1 latex profilin Hev b 8 [Hevea brasiliensis]
Length=131

 Score =   176 bits (446),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS +FP  K++EV  IMKDFDEPG LAPTGLHL   KYMVIQGEPGAVIR
Sbjct  25   IIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSLAPTGLHLGSTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKT QALI+G+YDEP+TP QCN++VE++GD+L++QGM
Sbjct  85   GKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVERLGDYLLEQGM  131



>sp|A4KA32.1|PROF5_PHLPR RecName: Full=Profilin-5; AltName: Full=Pollen allergen Phl p 
12; AltName: Full=pollen profilin variant 2; AltName: Allergen=Phl 
p 12 [Phleum pratense]
 gb|ABG81289.1| pollen profilin variant 2 [Phleum pratense]
Length=131

 Score =   176 bits (446),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDGT+WAQS  FP  K EE+T IMKDFDEPGHLAPTG+ +A  KYMVIQGEPGAVIR
Sbjct  25   ILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHLAPTGMFVAAAKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+VG+YDEP+TP QCN+VVE++GD+L+ QG+
Sbjct  85   GKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLVKQGL  131



>sp|A4KA50.1|PROCJ_OLEEU RecName: Full=Profilin-5; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|ABG81307.1| pollen profilin [Olea europaea]
Length=131

 Score =   176 bits (446),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDGT+WAQS  FP  K EE+T IMKDFDEPGHLAPTG+ +A  KYMVIQGEPGAVIR
Sbjct  25   ILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHLAPTGMFVATAKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+VG+YDEP+TP QCN+VVE++GD+L+ QGM
Sbjct  85   GKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLMKQGM  131



>sp|A4GFC2.1|PROCF_OLEEU RecName: Full=Profilin-4; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|ABG33904.1| Ole e 2 allergen [Olea europaea]
Length=131

 Score =   176 bits (446),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            +IGHDG++WAQS TFP  K EEV  I+KDFDEPG LAPTGLHL G KYMVIQGEPGAVIR
Sbjct  25   VIGHDGSVWAQSATFPQFKPEEVAAIIKDFDEPGSLAPTGLHLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQALI G+YDEP+TP QCNI+VE++GD+L++QG+
Sbjct  85   GKKGAGGITVKKTGQALIFGIYDEPLTPGQCNIIVERLGDYLLEQGL  131



>sp|A4KA36.1|PROF8_PHLPR RecName: Full=Profilin-8; AltName: Full=Pollen allergen Phl p 
12; AltName: Full=pollen profilin variant 6; AltName: Allergen=Phl 
p 12 [Phleum pratense]
 gb|ABG81293.1| pollen profilin variant 6 [Phleum pratense]
Length=131

 Score =   176 bits (445),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDGT+WAQS  FP  K EE+T IMKDFDEPGHLAPTG+ +A  KYMVIQGEPGAVIR
Sbjct  25   ILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHLAPTGMFVAAAKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+VG+YDEP+TP QCN+VVE++GD+L+ QG+
Sbjct  85   GKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLLKQGL  131



>gb|AFG16925.1| profilin [Quercus suber]
Length=131

 Score =   176 bits (445),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS TFP  K EEV  I+KDFDEPG LAPTGLHL G KYMVIQGEPGAVIR
Sbjct  25   IIGHDGSVWAQSATFPQFKPEEVVAIIKDFDEPGSLAPTGLHLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQALI G+YDEP+TP +CNI+VE++GD+LI+QG+
Sbjct  85   GKKGAGGITVKKTGQALIFGIYDEPLTPGRCNIIVERLGDYLIEQGL  131



>sp|A4KA33.1|PROF6_PHLPR RecName: Full=Profilin-6; AltName: Full=Pollen allergen Phl p 
12; AltName: Full=pollen profilin variant 3; AltName: Allergen=Phl 
p 12 [Phleum pratense]
 gb|ABG81290.1| pollen profilin variant 3 [Phleum pratense]
Length=131

 Score =   176 bits (445),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDGT+WAQS  FP  K EE+T IMKDFDEPGHLAPTG+ +A  KYMVIQGEPGAVIR
Sbjct  25   ILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHLAPTGMFVAAAKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+VG+YDEP+TP QCN+VVE++GD+L+ QG+
Sbjct  85   GKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLLKQGL  131



>gb|ADB93072.1| profilin-1 [Jatropha curcas]
 gb|KDP33778.1| hypothetical protein JCGZ_07349 [Jatropha curcas]
Length=131

 Score =   176 bits (445),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIG DG++WAQS TFP  K EE+T IM DF+EPG LAPTGL+L G KYMVIQGEPGAVIR
Sbjct  25   IIGQDGSVWAQSSTFPQFKPEEITAIMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKGPGG+T+KKT QALI+G+YDEP+TP QCN++VE++GD+LIDQG+
Sbjct  85   GKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL  131



>ref|XP_006451339.1| hypothetical protein CICLE_v10009871mg [Citrus clementina]
 ref|XP_006475347.1| PREDICTED: profilin-like [Citrus sinensis]
 gb|ESR64579.1| hypothetical protein CICLE_v10009871mg [Citrus clementina]
 gb|KDO55855.1| hypothetical protein CISIN_1g032811mg [Citrus sinensis]
Length=133

 Score =   176 bits (445),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS  FP  K EE+  IMKDFD+PGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  27   IVGHDGSVWAQSANFPKFKPEEIAGIMKDFDQPGHLAPTGLHLGGTKYMVIQGEAGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN++VE++GD+LIDQG+
Sbjct  87   GKKGSGGVTIKKTGQALVFGIYEEPVTPGQCNMIVERLGDYLIDQGL  133



>ref|NP_179567.1| profilin 5 [Arabidopsis thaliana]
 sp|Q38905.1|PROF4_ARATH RecName: Full=Profilin-4 [Arabidopsis thaliana]
 gb|AAB39479.1| profilin 4 [Arabidopsis thaliana]
 gb|AAC62139.1| profilin 4 [Arabidopsis thaliana]
 gb|AAM62866.1| profilin 4 [Arabidopsis thaliana]
 gb|ABE65830.1| profilin 4 [Arabidopsis thaliana]
 gb|AEC06924.1| profilin 5 [Arabidopsis thaliana]
Length=134

 Score =   176 bits (445),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS  FP  K +E+TDIMKDFDEPGHLAPTG+ LAG KYMVIQGEP AVIR
Sbjct  28   IIGHDGSVWAQSANFPQFKPQEITDIMKDFDEPGHLAPTGMFLAGLKYMVIQGEPNAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQ+++ G+Y+EPVTP QCN+VVE++GD+LI+QG+
Sbjct  88   GKKGAGGITIKKTGQSMVFGLYEEPVTPGQCNMVVERLGDYLIEQGL  134



>emb|CDM84005.1| unnamed protein product [Triticum aestivum]
Length=131

 Score =   176 bits (445),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDGT+WAQS  FP+ K EE+T+IMKDFDEPG LAPTGL L   KYMVIQGEPGAVIR
Sbjct  25   ILGHDGTVWAQSADFPSFKPEEMTNIMKDFDEPGTLAPTGLLLGAAKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQAL+VG+YDEP+TP QCN+VVE++GD+L++QGM
Sbjct  85   GKKGAGGITLKKTGQALVVGIYDEPMTPGQCNLVVERLGDYLVEQGM  131



>ref|XP_002299743.1| Profilin 3 family protein [Populus trichocarpa]
 gb|ABK95977.1| unknown [Populus trichocarpa]
 gb|EEE84548.1| Profilin 3 family protein [Populus trichocarpa]
Length=131

 Score =   176 bits (445),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS TFP  K EE++ IMKDFDEPG LAPTGLHL G KYMVIQGEPGAVIR
Sbjct  25   IIGHDGSVWAQSATFPQFKPEEISAIMKDFDEPGSLAPTGLHLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKT QAL++G+YDEP+TP QCN++VE++GD+LIDQ +
Sbjct  85   GKKGSGGVTVKKTSQALVIGLYDEPLTPGQCNMIVERLGDYLIDQDL  131



>gb|AAK01235.1|AF327622_1 minor allergen hazelnut profilin [Corylus avellana]
Length=131

 Score =   176 bits (445),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS TFP +K EE+T +M DF+EPG LAPTGL+L G KYMVIQGEPGAVIR
Sbjct  25   IIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
             KKGPGG+T+KKT QALI+G+YDEP+TP QCN++VE++GD+LIDQG+
Sbjct  85   RKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL  131



>sp|A4GFC4.1|PROCH_OLEEU RecName: Full=Profilin-4; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|ABG33906.1| Ole e 2 allergen [Olea europaea]
Length=131

 Score =   176 bits (445),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS TFP  K EEV  I+KDFDEPG LAPTGLHL G KYMVIQGEPGAVIR
Sbjct  25   IIGHDGSVWAQSATFPQFKPEEVAAIIKDFDEPGSLAPTGLHLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQG  369
            GKKG GG+T+KKTGQALI G+YDEP+TP QCNI+VE++GD+L++QG
Sbjct  85   GKKGAGGITVKKTGQALIFGIYDEPLTPGQCNIIVERLGDYLLEQG  130



>ref|XP_002869439.1| hypothetical protein ARALYDRAFT_328774 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45698.1| hypothetical protein ARALYDRAFT_328774 [Arabidopsis lyrata subsp. 
lyrata]
Length=134

 Score =   176 bits (445),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS  FP  K +E +DIMKDFDEPGHLAPTGL LAG KYMVIQGEPGAVIR
Sbjct  28   IVGHDGSVWAQSSNFPQFKGQEFSDIMKDFDEPGHLAPTGLFLAGAKYMVIQGEPGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQ+ + G+Y+EPVTP QCN+VVE++GD+L++QG+
Sbjct  88   GKKGAGGITIKKTGQSCVFGIYEEPVTPGQCNMVVERLGDYLLEQGL  134



>ref|XP_006299812.1| hypothetical protein CARUB_v10016013mg [Capsella rubella]
 gb|EOA32710.1| hypothetical protein CARUB_v10016013mg [Capsella rubella]
Length=134

 Score =   176 bits (445),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS  FP  K +E+TDIMKDFDEPGHLAPTGL LAG KYMVIQGEP AVIR
Sbjct  28   IIGHDGSVWAQSANFPQFKPQEMTDIMKDFDEPGHLAPTGLFLAGLKYMVIQGEPNAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQ+++ G+Y+EPVTP QCN+VVE++GD+LI+QG+
Sbjct  88   GKKGAGGITIKKTGQSIVFGLYEEPVTPGQCNMVVERLGDYLIEQGL  134



>gb|AAW84275.1| profilin 1 [Petroselinum crispum]
Length=134

 Score =   175 bits (444),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS +FP  K EE+  IMKDFDEPGHLAPTGL+L G KYMVIQGEP AVIR
Sbjct  28   IIGHDGSVWAQSSSFPNFKPEEIAGIMKDFDEPGHLAPTGLYLGGTKYMVIQGEPNAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTG AL+ GVYDEPVTP QCN++VE++GD+LI+QG+
Sbjct  88   GKKGSGGVTIKKTGLALVFGVYDEPVTPGQCNLIVERLGDYLIEQGL  134



>gb|ABK28500.1| unknown [Arabidopsis thaliana]
Length=135

 Score =   175 bits (444),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS  FP  K +E+TDIMKDFDEPGHLAPTG+ LAG KYMVIQGEP AVIR
Sbjct  28   IIGHDGSVWAQSANFPQFKPQEITDIMKDFDEPGHLAPTGMFLAGLKYMVIQGEPNAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQ+++ G+Y+EPVTP QCN+VVE++GD+LI+QG+
Sbjct  88   GKKGAGGITIKKTGQSMVFGLYEEPVTPGQCNMVVERLGDYLIEQGL  134



>gb|ABO43717.1| profilin [Gossypium hirsutum]
 gb|ABO43718.1| profilin [Gossypium hirsutum]
 gb|ABO43719.1| profilin [Gossypium hirsutum]
 gb|ACX53268.1| profilin [Gossypium raimondii]
 gb|ACX53269.1| profilin [Gossypium arboreum]
Length=133

 Score =   175 bits (444),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG+IWAQS  FP  + +E+TDIMKDFDEPGHLAPTGLHL G K+MVIQGEPGAVIR
Sbjct  27   IVGHDGSIWAQSSNFPKCQPKEITDIMKDFDEPGHLAPTGLHLGGAKFMVIQGEPGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKT QAL+ G+Y+EPVTP QCN+VVE++GD+L +QG+
Sbjct  87   GKKGSGGVTIKKTAQALVFGIYEEPVTPGQCNMVVERLGDYLAEQGL  133



>ref|NP_001106002.1| profilin-9 [Zea mays]
 sp|A4KA58.1|PROF9_MAIZE RecName: Full=Profilin-9; AltName: Full=Pollen allergen Zea m 
12; AltName: Full=Pollen profilin variant 4; AltName: Allergen=Zea 
m 12 [Zea mays]
 gb|ABG81315.1| pollen profilin variant 4 [Zea mays]
Length=131

 Score =   175 bits (444),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG +WAQS  FP  KTEE+T+IMKDFDEPG LAPTGL L   KYMVIQGEPGAVIR
Sbjct  25   IVGHDGAVWAQSTAFPQFKTEEMTNIMKDFDEPGFLAPTGLFLGPTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQAL++G+YDEP+TP QCN+VVE++GD+L++QGM
Sbjct  85   GKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVERLGDYLLEQGM  131



>gb|KFK40342.1| hypothetical protein AALP_AA3G361600 [Arabis alpina]
Length=134

 Score =   175 bits (444),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS  FP  K +E+TDIMKDFDEPGHLAPTGL LAG KYMVIQGEP AVIR
Sbjct  28   IIGHDGSVWAQSANFPQFKPQEMTDIMKDFDEPGHLAPTGLFLAGLKYMVIQGEPNAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQ+++ G+Y+EPVTP QCN+VVE++GD+L++QG+
Sbjct  88   GKKGAGGITIKKTGQSMVFGLYEEPVTPGQCNMVVERLGDYLVEQGL  134



>ref|XP_011081736.1| PREDICTED: profilin [Sesamum indicum]
Length=131

 Score =   175 bits (444),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG +WAQS  FP  K EE+  IM DF+EPG LAPTGLHL G KYMVIQGEPGAVIR
Sbjct  25   IIGHDGAVWAQSANFPQFKAEEIAAIMDDFEEPGKLAPTGLHLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKGPGG+T+KKT QAL++G+YDEP+TP QCN+VVE+IGD+LI+QG+
Sbjct  85   GKKGPGGITVKKTNQALLIGIYDEPMTPGQCNMVVERIGDYLIEQGL  131



>gb|AFG16926.1| profilin [Quercus suber]
Length=131

 Score =   175 bits (444),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS TFP  K EEV  I+KDFDEPG LAPTGLHL G KYMVIQGEPGAVIR
Sbjct  25   IIGHDGSVWAQSATFPQFKPEEVAAIIKDFDEPGSLAPTGLHLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQALI G+YDEP+TP +CNI+VE++GD+L++QG+
Sbjct  85   GKKGAGGITVKKTGQALIFGIYDEPLTPGRCNIIVERLGDYLLEQGL  131



>gb|ABU97473.1| profilin [Olea europaea]
Length=132

 Score =   175 bits (444),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I G+DG +WAQS  FP +K  EVTDIMKDFDEPG+LAP GLHL G KYMVIQGEPGAVIR
Sbjct  26   ITGNDGAVWAQSSAFPQLKPGEVTDIMKDFDEPGYLAPKGLHLGGNKYMVIQGEPGAVIR  85

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG TIKKTGQALI G+Y+EPVTP QCNIVVE++GD+LI+QG+
Sbjct  86   GKKGSGGATIKKTGQALIFGIYEEPVTPGQCNIVVERLGDYLIEQGL  132



>sp|O24282.1|PROF3_PHLPR RecName: Full=Profilin-3; AltName: Full=Allergen Phl p 11; AltName: 
Full=Pollen allergen Phl p 12; AltName: Allergen=Phl 
p 12 [Phleum pratense]
 emb|CAA70609.1| profilin 3 [Phleum pratense]
Length=131

 Score =   175 bits (444),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I GHDGT+WAQS  FP  K EE+T IMKD DEPGHLAPTG+ +A  KYMVIQGEPGAVIR
Sbjct  25   IFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPGHLAPTGMFVAAAKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+VG+YDEP+TP QCN+VVE++GD+L++QGM
Sbjct  85   GKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLVEQGM  131



>gb|AFK33983.1| unknown [Lotus japonicus]
Length=133

 Score =   175 bits (444),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS +FP +K +E+T IMKDFDEPG LAPTGLHL G KYMVIQGE GAVIR
Sbjct  27   IVGHDGSVWAQSTSFPQLKPQEITGIMKDFDEPGFLAPTGLHLGGTKYMVIQGESGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+LIDQG+
Sbjct  87   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIDQGL  133



>ref|XP_006426857.1| hypothetical protein CICLE_v10026756mg [Citrus clementina]
 ref|XP_006465706.1| PREDICTED: profilin-3-like [Citrus sinensis]
 gb|ESR40097.1| hypothetical protein CICLE_v10026756mg [Citrus clementina]
 gb|KDO51829.1| hypothetical protein CISIN_1g032890mg [Citrus sinensis]
Length=131

 Score =   175 bits (443),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS  FP  K EE+  IMKDF+EPG LAPTGLHL G KYMVIQGEPGAVIR
Sbjct  25   IVGHDGSVWAQSSNFPQFKPEEIAAIMKDFEEPGSLAPTGLHLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQALI G+YDEP+TP QCN++VE++GD+LIDQG+
Sbjct  85   GKKGSGGVTVKKTGQALIFGIYDEPLTPGQCNMIVERLGDYLIDQGL  131



>gb|AAP15200.1| profilin-like protein [Humulus scandens]
Length=131

 Score =   175 bits (443),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS  FP +K EEVT IM DF+EPG LAPTGL+L G KYMVIQGEPGAVIR
Sbjct  25   IIGHDGSVWAQSAAFPQLKPEEVTGIMNDFNEPGTLAPTGLYLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKT QALI+GVYDEP+TP QCN++VE++GD+LIDQG+
Sbjct  85   GKKGAGGVTIKKTSQALIIGVYDEPMTPGQCNMIVERLGDYLIDQGL  131



>sp|A4KA53.1|PROCM_OLEEU RecName: Full=Profilin-8; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|ABG81310.1| pollen profilin [Olea europaea]
Length=131

 Score =   175 bits (443),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDGT+WAQS  FP  K EE+T IMKDFDEPGHLAPTG+ +A  KYMVIQGEPGAVIR
Sbjct  25   ILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHLAPTGMFVATAKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+VG+YDEP+TP QCN+VVE++GD+L+ QG+
Sbjct  85   GKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLVKQGL  131



>ref|XP_008233911.1| PREDICTED: profilin-like [Prunus mume]
Length=131

 Score =   175 bits (443),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS +FP  K EE+  IMKDFDEPG LAPTGLHLAG KYMVIQGE GAVIR
Sbjct  25   IVGHDGSVWAQSSSFPKFKPEEIAAIMKDFDEPGSLAPTGLHLAGTKYMVIQGEGGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQA+I G+Y+EP+TP QCNI+VE++GD+LIDQG+
Sbjct  85   GKKGSGGITVKKTGQAMIFGIYEEPLTPGQCNIIVERLGDYLIDQGL  131



>ref|XP_004302848.1| PREDICTED: profilin-like [Fragaria vesca subsp. vesca]
Length=131

 Score =   175 bits (443),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS  FP  K EE+T IMKDFDEPG LAPTGLHLAG KYMVIQGE GAVIR
Sbjct  25   IVGHDGSVWAQSSNFPKFKPEEITAIMKDFDEPGTLAPTGLHLAGTKYMVIQGEGGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQAL+ G+Y+EP+TP QCN++VE++GD+LIDQG+
Sbjct  85   GKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVERLGDYLIDQGL  131



>emb|CDX81945.1| BnaC08g36560D [Brassica napus]
Length=134

 Score =   175 bits (443),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS  FP  K +E+TDIMKDFDEPGHLAPTGL LAG KYMVIQGEPGAVIR
Sbjct  28   IIGHDGSVWAQSANFPQFKPQEMTDIMKDFDEPGHLAPTGLFLAGLKYMVIQGEPGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQ+++ G+Y+EPVTP QCN+VVE++GD+LI+Q +
Sbjct  88   GKKGAGGITIKKTGQSMVFGLYEEPVTPGQCNMVVERLGDYLIEQDL  134



>gb|KFK29491.1| hypothetical protein AALP_AA7G141400 [Arabis alpina]
Length=134

 Score =   175 bits (443),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS  FP  K EE T IMKDFDEPG+LAPTGL LAG KYMVIQGEPGAVIR
Sbjct  28   IVGHDGSVWAQSANFPQFKAEEFTGIMKDFDEPGNLAPTGLFLAGAKYMVIQGEPGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GGLTIKKTGQ+ + G+Y+EPVTP QCN+VVE++GD+L++QG+
Sbjct  88   GKKGAGGLTIKKTGQSCVFGIYEEPVTPGQCNMVVERLGDYLVEQGL  134



>sp|A4KA49.1|PROCI_OLEEU RecName: Full=Profilin-4; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 sp|A4KA31.1|PROF4_PHLPR RecName: Full=Profilin-4; AltName: Full=Pollen allergen Phl p 
12; AltName: Full=pollen profilin variant 1; AltName: Full=pollen 
profilin variant 5; AltName: Allergen=Phl p 12 [Phleum 
pratense]
 gb|ABG81288.1| pollen profilin variant 1 [Phleum pratense]
 gb|ABG81292.1| pollen profilin variant 5 [Phleum pratense]
 gb|ABG81306.1| pollen profilin [Olea europaea]
Length=131

 Score =   175 bits (443),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDGT+WAQS  FP  K EE+T IMKDFDEPGHLAPTG+ +A  KYMVIQGEPGAVIR
Sbjct  25   ILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHLAPTGMFVATAKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+VG+YDEP+TP QCN+VVE++GD+L+ QG+
Sbjct  85   GKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLLKQGL  131



>sp|O65812.1|PROF1_HEVBR RecName: Full=Profilin-1; AltName: Full=Pollen allergen Hev b 
8.0101; AltName: Allergen=Hev b 8.0101 [Hevea brasiliensis]
 emb|CAA75312.1| profilin [Hevea brasiliensis]
Length=131

 Score =   175 bits (443),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIG DG++WAQS  FP  K+EE+T IM DFDEPG LAPTGLHL G KYMVIQGE GAVIR
Sbjct  25   IIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPGTLAPTGLHLGGTKYMVIQGEAGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKGPGG+T++KT QALI+G+YDEP+TP QCN++VE++GD+L++QGM
Sbjct  85   GKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMIVERLGDYLLEQGM  131



>sp|A4GFB9.1|PROCD_OLEEU RecName: Full=Profilin-4; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|ABG33901.1| Ole e 2 allergen [Olea europaea]
Length=131

 Score =   175 bits (443),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS TFP  K EEV  I+KDFDEPG LAPTGLHL G KYMVI+GEPGAVIR
Sbjct  25   IIGHDGSVWAQSATFPQFKPEEVAAIIKDFDEPGSLAPTGLHLGGTKYMVIRGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQALI G+YDEP+TP QCNI+VE++GD+L++QG+
Sbjct  85   GKKGAGGITVKKTGQALIFGIYDEPLTPGQCNIIVERLGDYLLEQGL  131



>gb|AEW90957.1| pollen profilin 3R4-2 [Secale cereale x Triticum turgidum subsp. 
durum]
Length=131

 Score =   175 bits (443),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDGT+WAQS  FP     E+T IMKDFDEPGHLAPTG+ +AG KYMVIQGEPGAVIR
Sbjct  25   ILGHDGTVWAQSADFPQFAPAEITGIMKDFDEPGHLAPTGMFVAGAKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+VGVY+EP+TP QCN+VVE++GD+L++QGM
Sbjct  85   GKKGAGGITIKKTGQALVVGVYEEPMTPGQCNMVVERLGDYLVEQGM  131



>dbj|BAJ86041.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=131

 Score =   175 bits (443),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDGT+WAQS  FP+ K EE+T+IMKDFDEPG LAPTGL L   KYMVIQGEPGAVIR
Sbjct  25   ILGHDGTVWAQSADFPSFKPEEMTNIMKDFDEPGTLAPTGLLLGSAKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQAL++G+YDEP+TP QCN+VVE++GD+L++QGM
Sbjct  85   GKKGSGGITLKKTGQALVIGIYDEPMTPGQCNMVVERLGDYLVEQGM  131



>ref|XP_010656249.1| PREDICTED: profilin-2 [Vitis vinifera]
 emb|CAN70308.1| hypothetical protein VITISV_026400 [Vitis vinifera]
 emb|CBI27981.3| unnamed protein product [Vitis vinifera]
Length=133

 Score =   175 bits (443),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS +FP  KT E+T IM DF EPGHLAPTGL+L G KYMVIQGEPGAVIR
Sbjct  27   IVGHDGSVWAQSTSFPEFKTPEITGIMNDFAEPGHLAPTGLYLGGTKYMVIQGEPGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L+DQG+
Sbjct  87   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLVDQGL  133



>gb|KDP40849.1| hypothetical protein JCGZ_24848 [Jatropha curcas]
Length=131

 Score =   174 bits (442),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS +FP  K EE+  IMKDFDEPG LAPTGLHL G KYMVIQGE GAVIR
Sbjct  25   IIGHDGSVWAQSTSFPQFKPEEIAAIMKDFDEPGSLAPTGLHLGGTKYMVIQGESGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKT QALI+G+YDEP+TP QCN++VE++GD+L+DQG+
Sbjct  85   GKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVERLGDYLLDQGL  131



>gb|EMT00312.1| Profilin-2/4 [Aegilops tauschii]
Length=131

 Score =   174 bits (442),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDGT+WAQS  FP+ K EE+T+IMKDFDEPG LAPTGL L   KYMVIQGEPGAVIR
Sbjct  25   ILGHDGTVWAQSADFPSFKPEEMTNIMKDFDEPGTLAPTGLLLGDAKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQAL+VG+YDEP+TP QCN+VVE++GD+L++QGM
Sbjct  85   GKKGAGGITLKKTGQALVVGIYDEPMTPGQCNLVVERLGDYLVEQGM  131



>sp|A4KA52.1|PROCL_OLEEU RecName: Full=Profilin-7; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|ABG81309.1| pollen profilin [Olea europaea]
Length=131

 Score =   174 bits (442),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDGT+WAQS  FP  K EE+T IMKDFDEPGHLAPTG+ +A  KYMVIQGEPGAVIR
Sbjct  25   ILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHLAPTGMFVATAKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+VG+YDEP+TP QCN+VVE++GD+L+ QG+
Sbjct  85   GKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLMKQGL  131



>sp|A4KA34.1|PROF7_PHLPR RecName: Full=Profilin-7; AltName: Full=Pollen allergen Phl p 
12; AltName: Full=pollen profilin variant 4; AltName: Allergen=Phl 
p 12 [Phleum pratense]
 gb|ABG81291.1| pollen profilin variant 4 [Phleum pratense]
Length=131

 Score =   174 bits (442),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDGT+WAQS  FP  K EE+T IMKDFDEPGHLAPTG+ +A  KYMVIQGEPGAVIR
Sbjct  25   ILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHLAPTGMFVATAKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+VG+YDEP+TP QCN+VVE++GD+L+ QG+
Sbjct  85   GKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLLKQGL  131



>ref|XP_009112628.1| PREDICTED: profilin-4-like [Brassica rapa]
Length=134

 Score =   174 bits (442),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS  FP  K +E+TDIMKDFDEPGHLAPTGL LAG KYMVIQGEPGAVIR
Sbjct  28   IIGHDGSVWAQSANFPQFKPQEMTDIMKDFDEPGHLAPTGLFLAGLKYMVIQGEPGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQ+++ G+Y+EPVTP QCN+VVE++GD+L++Q +
Sbjct  88   GKKGAGGITIKKTGQSMVFGLYEEPVTPGQCNMVVERLGDYLVEQDL  134



>ref|NP_001105451.1| profilin-2 [Zea mays]
 emb|CAA51719.1| profilin 2 [Zea mays]
 gb|ACG32868.1| profilin A [Zea mays]
 gb|AFW82532.1| profilin-2 [Zea mays]
Length=137

 Score =   175 bits (443),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG  WAQS  FP  KTE++ +IMKDFDEPGHLAPTGL L   KYMVIQGEPGAVIR
Sbjct  31   IVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHLAPTGLFLGPTKYMVIQGEPGAVIR  90

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQAL+VG+YDEP+TP QCN+VVE++GD+L++QGM
Sbjct  91   GKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLLEQGM  137



>ref|NP_194663.1| profilin 4 [Arabidopsis thaliana]
 sp|Q38904.1|PROF3_ARATH RecName: Full=Profilin-3 [Arabidopsis thaliana]
 gb|AAG10091.1|U43594_1 profilin [Arabidopsis thaliana]
 gb|AAB39477.1| profilin 3 [Arabidopsis thaliana]
 emb|CAB79692.1| profilin 3 [Arabidopsis thaliana]
 gb|AAM61730.1| profilin 3 [Arabidopsis thaliana]
 gb|ABD60699.1| At4g29340 [Arabidopsis thaliana]
 gb|AEE85619.1| profilin 4 [Arabidopsis thaliana]
Length=134

 Score =   174 bits (442),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS  FP  K +E +DIMKDFDEPGHLAPTGL +AG KYMVIQGEPGAVIR
Sbjct  28   IVGHDGSVWAQSANFPQFKGQEFSDIMKDFDEPGHLAPTGLFMAGAKYMVIQGEPGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQ+ + G+Y+EPVTP QCN+VVE++GD+L++QG+
Sbjct  88   GKKGAGGITIKKTGQSCVFGIYEEPVTPGQCNMVVERLGDYLLEQGL  134



>sp|A4GE53.1|PROBX_OLEEU RecName: Full=Profilin-2; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|ABC47421.1| profilin pollen [Olea europaea]
Length=134

 Score =   174 bits (442),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+  IM DF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  28   IVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L++QGM
Sbjct  88   GKKGSGGITIKKTGQALVCGIYEEPVTPGQCNMVVERLGDYLLEQGM  134



>emb|CDP03236.1| unnamed protein product [Coffea canephora]
Length=133

 Score =   174 bits (442),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG +WAQS  FP +K +E+  IM DFDEPGHLAPTGLHL G KYMVIQGEPGAVIR
Sbjct  27   ILGHDGAVWAQSSNFPQIKPDEIKGIMTDFDEPGHLAPTGLHLGGTKYMVIQGEPGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKGPGG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L +QG+
Sbjct  87   GKKGPGGVTIKKTGQALVFGIYEEPVTPGQCNLVVERLGDYLAEQGL  133



>sp|P35082.2|PROF2_MAIZE RecName: Full=Profilin-2; AltName: Full=Pollen allergen Zea m 
12; AltName: Full=ZmPRO2; AltName: Allergen=Zea m 12 [Zea mays]
Length=131

 Score =   174 bits (442),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG  WAQS  FP  KTE++ +IMKDFDEPGHLAPTGL L   KYMVIQGEPGAVIR
Sbjct  25   IVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHLAPTGLFLGPTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQAL+VG+YDEP+TP QCN+VVE++GD+L++QGM
Sbjct  85   GKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLLEQGM  131



>ref|XP_004290829.1| PREDICTED: profilin-3-like [Fragaria vesca subsp. vesca]
Length=131

 Score =   174 bits (442),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHD ++WAQS +FP  K EEV  IMKDFDEPG LAPTGLHL G KYMVIQGE GAVIR
Sbjct  25   IVGHDSSVWAQSSSFPQFKPEEVAAIMKDFDEPGSLAPTGLHLGGTKYMVIQGESGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQA+I+G+YDEP+TP QCN++VE++GD+LIDQG+
Sbjct  85   GKKGSGGITVKKTGQAMILGIYDEPITPGQCNMIVERLGDYLIDQGL  131



>sp|O24169.1|PROFA_OLEEU RecName: Full=Profilin-1; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 emb|CAA73035.1| profilin 1 [Olea europaea]
Length=134

 Score =   174 bits (442),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+  IM DF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  28   IVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L++QGM
Sbjct  88   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLVEQGM  134



>ref|XP_009117521.1| PREDICTED: profilin-4-like [Brassica rapa]
Length=134

 Score =   174 bits (442),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS  FP  K +E+TDIMKDFDEPGHLAPTGL LAG KYMVIQGEPGAVIR
Sbjct  28   IIGHDGSVWAQSANFPQFKPQEMTDIMKDFDEPGHLAPTGLFLAGLKYMVIQGEPGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQ+++ G+Y+EPVTP QCN+VVE++GD+LI+Q +
Sbjct  88   GKKGAGGITIKKTGQSMVFGLYEEPVTPGQCNMVVERLGDYLIEQDL  134



>sp|A4GDQ6.1|PROAK_OLEEU RecName: Full=Profilin-3; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|AAZ30402.1| pollen profilin [Olea europaea]
Length=134

 Score =   174 bits (442),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+  IM DF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  28   IVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L++QGM
Sbjct  88   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLLEQGM  134



>emb|CDY03342.1| BnaC09g10060D [Brassica napus]
Length=134

 Score =   174 bits (442),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS  FP  K +E+TDIMKDFDEPGHLAPTGL LAG KYMVIQGEPGAVIR
Sbjct  28   IIGHDGSVWAQSANFPQFKPQEMTDIMKDFDEPGHLAPTGLFLAGLKYMVIQGEPGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQ+++ G+Y+EPVTP QCN+VVE++GD+L++Q +
Sbjct  88   GKKGAGGITIKKTGQSMVFGLYEEPVTPGQCNMVVERLGDYLVEQDL  134



>ref|XP_009344483.1| PREDICTED: profilin [Pyrus x bretschneideri]
Length=131

 Score =   174 bits (441),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+T IMKDFDEPG LAPTGLHL G KYMVIQGE GAVIR
Sbjct  25   ILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSLAPTGLHLGGTKYMVIQGEGGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQAL+ G+Y+EP+TP QCN++VE++GD+LIDQG+
Sbjct  85   GKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVERLGDYLIDQGL  131



>ref|XP_007223916.1| hypothetical protein PRUPE_ppa013278mg [Prunus persica]
 gb|EMJ25115.1| hypothetical protein PRUPE_ppa013278mg [Prunus persica]
Length=131

 Score =   174 bits (441),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS +FP  K EE+  IMKDFDEPG LAPTGLHLAG KYMVIQGE GAVIR
Sbjct  25   IVGHDGSVWAQSSSFPKFKPEEIAAIMKDFDEPGSLAPTGLHLAGTKYMVIQGEGGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQA+I G+Y+EP+TP QCN++VE++GD+LIDQG+
Sbjct  85   GKKGSGGITVKKTGQAMIFGIYEEPLTPGQCNMIVERLGDYLIDQGL  131



>sp|A4GDR7.1|PROAW_OLEEU RecName: Full=Profilin-1; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|AAZ30413.1| pollen profilin [Olea europaea]
Length=134

 Score =   174 bits (441),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+  IM DF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  28   IVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L++QGM
Sbjct  88   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLLEQGM  134



>gb|ABQ23999.1| pollen-specific profilin3 [Zea mays]
Length=131

 Score =   174 bits (441),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG +WAQS  FP  KTEE+T+IMKDFDEPG LAPTGL L   KYMVIQGEPGAVIR
Sbjct  25   IVGHDGAVWAQSTAFPQFKTEEMTNIMKDFDEPGFLAPTGLFLGPTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQA++VG+YDEP+TP QCN+VVE++GD+L++QG+
Sbjct  85   GKKGSGGITVKKTGQAMVVGIYDEPMTPGQCNMVVERLGDYLVEQGL  131



>ref|XP_010489131.1| PREDICTED: profilin-4 [Camelina sativa]
 ref|XP_010495948.1| PREDICTED: profilin-4 [Camelina sativa]
Length=134

 Score =   174 bits (441),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS  FP +K EE+T IMKDFDEPGHLAPTG+ LAG KYMVIQGEP AVIR
Sbjct  28   IIGHDGSVWAQSANFPQLKPEEITGIMKDFDEPGHLAPTGMFLAGLKYMVIQGEPNAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQ+++ G+Y+EPVTP QCN+VVE++GD+LI+QG+
Sbjct  88   GKKGAGGITIKKTGQSMVFGLYEEPVTPGQCNMVVERLGDYLIEQGL  134



>sp|A4KA37.1|PROF9_PHLPR RecName: Full=Profilin-9; AltName: Full=Pollen allergen Phl p 
12; AltName: Full=pollen profilin variant 7; AltName: Allergen=Phl 
p 12 [Phleum pratense]
 gb|ABG81294.1| pollen profilin variant 7 [Phleum pratense]
Length=131

 Score =   174 bits (441),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDGT+WAQS  FP  K EE+T IMKDFDEPGHLAPTG+ +A  KYMVIQGEPGAV R
Sbjct  25   ILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHLAPTGMFVAAAKYMVIQGEPGAVTR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+VG+YDEP+TP QCN+VVE++GD+L+ QG+
Sbjct  85   GKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLVKQGL  131



>gb|ACN36779.1| unknown [Zea mays]
 gb|AFW78818.1| profilin-like protein [Zea mays]
Length=131

 Score =   174 bits (441),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG  WAQS  FP  K EE+  IMKDFDEPGHLAPTGL L G KYMVIQGEPGAVIR
Sbjct  25   IVGHDGATWAQSTAFPEFKAEEMAAIMKDFDEPGHLAPTGLILGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQ+LI+G+YDEP+TP QCN+VVE++GD+L++QGM
Sbjct  85   GKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVERLGDYLLEQGM  131



>ref|XP_010438310.1| PREDICTED: profilin-3-like [Camelina sativa]
 ref|XP_010447865.1| PREDICTED: profilin-3-like [Camelina sativa]
Length=134

 Score =   174 bits (441),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS  FP  K +E +DIMKDFDEPGHLAPTGL LAG KYMVIQGEP AVIR
Sbjct  28   IVGHDGSVWAQSANFPQFKGQEFSDIMKDFDEPGHLAPTGLFLAGAKYMVIQGEPNAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQ+ + GVY+EPVTP QCN+VVE++GD+L++QG+
Sbjct  88   GKKGAGGITIKKTGQSCVFGVYEEPVTPGQCNMVVERLGDYLLEQGL  134



>sp|O04725.1|PROF_CYNDA RecName: Full=Profilin; AltName: Full=Pollen allergen Cyn d 12; 
AltName: Allergen=Cyn d 12 [Cynodon dactylon]
 emb|CAA69669.1| profilin 2 [Cynodon dactylon]
 emb|CAA69670.1| profilin 1 [Cynodon dactylon]
Length=131

 Score =   174 bits (441),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDGT+WAQS  FP  K EE+ +IMKDFDEPG LAPTGL L   KYMVIQGEPGAVIR
Sbjct  25   IIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFLAPTGLFLGPTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQAL++G+YDEP+TP QCN+V+EK+GD+LI+QGM
Sbjct  85   GKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIEKLGDYLIEQGM  131



>ref|XP_006451338.1| hypothetical protein CICLE_v10009877mg [Citrus clementina]
 ref|XP_006475346.1| PREDICTED: profilin-like [Citrus sinensis]
 gb|ESR64578.1| hypothetical protein CICLE_v10009877mg [Citrus clementina]
 gb|KDO55853.1| hypothetical protein CISIN_1g032871mg [Citrus sinensis]
Length=131

 Score =   174 bits (441),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS  FP +K EE+T IM DF+EPG LAPTGL+L G KYMVIQGEPGAVIR
Sbjct  25   IIGHDGSVWAQSENFPQLKPEEITGIMNDFNEPGTLAPTGLYLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKGPGG+TIKKT  ALI+G+YDEP+TP QCN++VE++GD+LIDQG+
Sbjct  85   GKKGPGGVTIKKTSAALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL  131



>ref|XP_011005518.1| PREDICTED: profilin-6-like [Populus euphratica]
Length=131

 Score =   174 bits (441),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS +FP    EEV+ IMKDF+EPG LAPTGL L G KYMVIQGEPGAVIR
Sbjct  25   IIGHDGSVWAQSASFPQFTQEEVSAIMKDFEEPGSLAPTGLFLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKT QALI+GVYDEP+TP QCN++VE++GD+LIDQG+
Sbjct  85   GKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMIVERLGDYLIDQGL  131



>gb|EMT25354.1| Profilin-2/4 [Aegilops tauschii]
Length=131

 Score =   174 bits (441),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDGT+WAQS  FP     E+T IMKDFDEPGHLAPTG+ +AG KYMVIQGEPGAVIR
Sbjct  25   ILGHDGTVWAQSADFPQFAPAEITAIMKDFDEPGHLAPTGMFVAGAKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+VG Y+EP+TP QCN+VVE++GD+L++QGM
Sbjct  85   GKKGAGGITIKKTGQALVVGAYEEPMTPGQCNMVVERLGDYLVEQGM  131



>sp|A4KA59.1|PRO10_MAIZE RecName: Full=Profilin-10; AltName: Full=Pollen allergen Zea 
m 12; AltName: Full=Pollen profilin variant 5; AltName: Allergen=Zea 
m 12 [Zea mays]
 gb|ABG81316.1| pollen profilin variant 5 [Zea mays]
Length=131

 Score =   174 bits (440),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG +WAQS  FP  KTEE+T+IMKDFDEPG LAPTGL L   KYMVIQGEPGAVIR
Sbjct  25   IVGHDGAVWAQSTAFPQFKTEEMTNIMKDFDEPGFLAPTGLFLGPTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQAL++G+YDEP+TP QCN+VVE++GD+L++QG+
Sbjct  85   GKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVERLGDYLLEQGL  131



>sp|A4GDS0.1|PROAZ_OLEEU RecName: Full=Profilin-4; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|AAZ30416.1| pollen profilin [Olea europaea]
Length=134

 Score =   174 bits (441),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+  IM DF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  28   IVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+LI+QG+
Sbjct  88   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIEQGL  134



>ref|XP_010541006.1| PREDICTED: profilin-4 [Tarenaya hassleriana]
Length=134

 Score =   174 bits (441),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS  FP +K +E+T IMKDFDEPG+LAPTGLHL G KYMVIQGEPGAVIR
Sbjct  28   IVGHDGSVWAQSANFPQLKPDEITGIMKDFDEPGYLAPTGLHLGGAKYMVIQGEPGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+LI+Q +
Sbjct  88   GKKGSGGVTIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIEQDL  134



>ref|XP_007217879.1| hypothetical protein PRUPE_ppa013277mg [Prunus persica]
 ref|XP_008228405.1| PREDICTED: profilin [Prunus mume]
 gb|EMJ19078.1| hypothetical protein PRUPE_ppa013277mg [Prunus persica]
Length=131

 Score =   174 bits (440),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS  FP  K EE+T IMKDFDEPG LAPTGLHL G KYMVIQGE GAVIR
Sbjct  25   IVGHDGSVWAQSSAFPKFKPEEITAIMKDFDEPGSLAPTGLHLGGTKYMVIQGEGGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG  G+T+KKTGQAL+ G+YDEP+TP QCNI+VE++GD+LIDQG+
Sbjct  85   GKKGSSGITVKKTGQALVFGIYDEPLTPGQCNIIVERLGDYLIDQGL  131



>ref|NP_001235025.1| uncharacterized protein LOC100499717 [Glycine max]
 gb|ACU13355.1| unknown [Glycine max]
Length=131

 Score =   174 bits (440),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS  FP  K EE+T IM DF+EPG LAPTGL LA  KYMVIQGEPGAVIR
Sbjct  25   IIGHDGSVWAQSANFPQFKAEEITAIMNDFNEPGSLAPTGLFLAATKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKGPGG+T+KKTG ALI+G+YDEP+ P QCN+VVE++GD+LI+QG+
Sbjct  85   GKKGPGGVTVKKTGAALIIGIYDEPMAPGQCNMVVERLGDYLIEQGL  131



>sp|A4GE44.1|PROBR_OLEEU RecName: Full=Profilin-2; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|ABC47412.1| profilin pollen [Olea europaea]
Length=134

 Score =   174 bits (440),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+  IM DF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  28   IVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+LI+QG+
Sbjct  88   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIEQGL  134



>ref|XP_010688354.1| PREDICTED: profilin [Beta vulgaris subsp. vulgaris]
 ref|XP_010688355.1| PREDICTED: profilin [Beta vulgaris subsp. vulgaris]
Length=131

 Score =   174 bits (440),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG +WAQSP+FP +K  EV  IMKDF+EPG LAPTGLHL G KYMVIQGEPG+VIR
Sbjct  25   IVGHDGNVWAQSPSFPQLKPGEVAAIMKDFEEPGTLAPTGLHLGGTKYMVIQGEPGSVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKGPGG+T+ KT QALI+G+YDEP+TP QCN+VVE+IGD+L++QG+
Sbjct  85   GKKGPGGVTVNKTNQALIIGIYDEPMTPGQCNMVVERIGDYLVEQGL  131



>ref|NP_001105987.1| profilin-7 [Zea mays]
 sp|A4KA56.1|PROF7_MAIZE RecName: Full=Profilin-7; AltName: Full=Pollen allergen Zea m 
12; AltName: Full=Pollen profilin variant 2; AltName: Allergen=Zea 
m 12 [Zea mays]
 gb|ABG81313.1| pollen profilin variant 2 [Zea mays]
Length=131

 Score =   174 bits (440),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG +WAQS  FP  KTEE+T+IMKDFDEPG LAPTGL L   KYMVIQGEPGAVIR
Sbjct  25   IVGHDGAVWAQSTAFPQFKTEEMTNIMKDFDEPGFLAPTGLFLGPTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQA++VG+YDEP+TP QCN+VVE++GD+L++QG+
Sbjct  85   GKKGSGGITVKKTGQAMVVGIYDEPMTPGQCNMVVERLGDYLLEQGL  131



>gb|ABC61055.1| profilin-like protein [Cinnamomum camphora]
Length=131

 Score =   174 bits (440),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS +FP  K EE+  IM DF+EPG+LAPTGL+L G KYMVIQGEPGAVIR
Sbjct  25   IVGHDGSVWAQSDSFPQFKPEEINGIMNDFNEPGYLAPTGLYLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQALI G+YDEP+TP QCN++VE++GD+LI+QGM
Sbjct  85   GKKGSGGITIKKTGQALIFGIYDEPLTPGQCNMIVERLGDYLIEQGM  131



>ref|XP_002304225.1| Profilin 3 family protein [Populus trichocarpa]
 ref|XP_011011002.1| PREDICTED: profilin-4 [Populus euphratica]
 ref|XP_011015508.1| PREDICTED: profilin-4 [Populus euphratica]
 gb|ABK93735.1| unknown [Populus trichocarpa]
 gb|EEE79204.1| Profilin 3 family protein [Populus trichocarpa]
Length=131

 Score =   174 bits (440),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIG DG++WAQS TFP  K EE++ IMKDFDEPG LAPTGLH+ G KYMVIQGEPGAVIR
Sbjct  25   IIGQDGSVWAQSATFPQYKPEEISAIMKDFDEPGSLAPTGLHIGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKT QALI G+YDEP+TP QCN++VE++GD+L+DQG+
Sbjct  85   GKKGSGGITVKKTAQALIFGIYDEPLTPGQCNMIVERLGDYLLDQGL  131



>ref|NP_001288512.1| profilin-7 [Zea mays]
 gb|ACF79883.1| unknown [Zea mays]
 gb|ACG31620.1| profilin A [Zea mays]
 gb|AFW85124.1| profilin [Zea mays]
Length=131

 Score =   174 bits (440),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG +WAQS  FP  KTEE+T+IMKDFDEPG LAPTGL L   KYMVIQGEPGAVIR
Sbjct  25   IVGHDGAVWAQSTAFPQFKTEEMTNIMKDFDEPGFLAPTGLFLGPTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQA++VG+YDEP+TP QCN+VVE++GD+L++QG+
Sbjct  85   GKKGSGGITVKKTGQAMVVGIYDEPMTPGQCNMVVERLGDYLVEQGL  131



>ref|XP_002283490.1| PREDICTED: profilin-1 [Vitis vinifera]
 emb|CAN80411.1| hypothetical protein VITISV_018934 [Vitis vinifera]
 emb|CBI36040.3| unnamed protein product [Vitis vinifera]
Length=131

 Score =   174 bits (440),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS TFP  K EE+T IM DF+EPG LAPTGL+L G KYMVIQGEPGAVIR
Sbjct  25   IIGHDGSVWAQSETFPQFKPEEITGIMNDFNEPGFLAPTGLYLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQALI G+Y+EP+TP QCN++VE++GD+L+DQG+
Sbjct  85   GKKGSGGVTIKKTGQALIFGIYEEPLTPGQCNMIVERMGDYLVDQGL  131



>gb|EMS66850.1| Profilin-2/4 [Triticum urartu]
Length=167

 Score =   175 bits (443),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDGT+WAQS  FP     E+T IMKDFDEPGHLAPTG+ +AG KYMVIQGEPGAVIR
Sbjct  61   ILGHDGTVWAQSADFPQFAPAEITAIMKDFDEPGHLAPTGMFVAGAKYMVIQGEPGAVIR  120

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+VG Y+EP+TP QCN+VVE++GD+L++QGM
Sbjct  121  GKKGAGGITIKKTGQALVVGAYEEPMTPGQCNMVVERLGDYLVEQGM  167



>ref|XP_006284736.1| hypothetical protein CARUB_v10005999mg [Capsella rubella]
 ref|XP_010433106.1| PREDICTED: profilin-3 [Camelina sativa]
 gb|EOA17634.1| hypothetical protein CARUB_v10005999mg [Capsella rubella]
Length=134

 Score =   174 bits (440),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS  FP  K +E +DIMKDFDEPGHLAPTGL LAG KYMVIQGEP AVIR
Sbjct  28   IVGHDGSVWAQSANFPQFKGQEFSDIMKDFDEPGHLAPTGLFLAGAKYMVIQGEPNAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQ+ + G+Y+EPVTP QCN+VVE++GD+L++QG+
Sbjct  88   GKKGAGGITIKKTGQSCVFGIYEEPVTPGQCNMVVERLGDYLLEQGL  134



>sp|A4GDS7.1|PROBB_OLEEU RecName: Full=Profilin-2; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|AAZ30423.1| pollen profilin [Olea europaea]
Length=134

 Score =   174 bits (440),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS TFP  K EE+  IM DF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  28   IIGHDGSVWAQSATFPQFKPEEMNGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L++QG+
Sbjct  88   GKKGSGGITIKKTGQALVCGIYEEPVTPGQCNMVVERLGDYLLEQGL  134



>gb|KHN16653.1| Profilin-1 [Glycine soja]
Length=131

 Score =   173 bits (439),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS  FP  K EE+T IM DF+EPG LAPTGL LA  KYMVIQGEPGAVIR
Sbjct  25   IIGHDGSVWAQSANFPQFKAEEITAIMNDFNEPGSLAPTGLFLAATKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKGPGG+T+KKTG ALI+G+YDEP+ P QCN+VVE++GD+L++QG+
Sbjct  85   GKKGPGGVTVKKTGAALIIGIYDEPMAPGQCNMVVERLGDYLVEQGL  131



>ref|NP_001288607.1| uncharacterized protein LOC103711216 [Phoenix dactylifera]
 emb|CAD10390.1| profilin [Phoenix dactylifera]
Length=131

 Score =   173 bits (439),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS +FP  K+EE+T+IM DF+EPG LAPTGL+L   KYMVIQGEPGAVIR
Sbjct  25   ILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSLAPTGLYLGSTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKT QALI G+Y+EP+TP QCN+VVE++GD+LI+QGM
Sbjct  85   GKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVERLGDYLIEQGM  131



>ref|NP_001064348.1| Os10g0323600 [Oryza sativa Japonica Group]
 ref|NP_001064349.1| Os10g0323900 [Oryza sativa Japonica Group]
 sp|Q9FUD1.1|PROFA_ORYSJ RecName: Full=Profilin-A [Oryza sativa Japonica Group]
 gb|AAG32056.1|AF310253_1 profilin A [Oryza sativa]
 gb|AAK92577.1|AC074354_11 Profilin A [Oryza sativa Japonica Group]
 gb|AAK92580.1|AC074354_14 Profilin A [Oryza sativa Japonica Group]
 gb|AAP52954.1| Profilin A, putative, expressed [Oryza sativa Japonica Group]
 gb|AAP52957.1| Profilin A, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF26262.1| Os10g0323600 [Oryza sativa Japonica Group]
 dbj|BAF26263.1| Os10g0323900 [Oryza sativa Japonica Group]
 gb|EAY78023.1| hypothetical protein OsI_33063 [Oryza sativa Indica Group]
 gb|EAZ15648.1| hypothetical protein OsJ_31061 [Oryza sativa Japonica Group]
 gb|EAZ15650.1| hypothetical protein OsJ_31062 [Oryza sativa Japonica Group]
 dbj|BAG94438.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AFI71845.1| profilin A protein [Oryza sativa]
Length=131

 Score =   173 bits (439),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDGT+WAQS  FP  K EE+T+IMKDFDEPG LAPTGL L   KYMVIQGEPGAVIR
Sbjct  25   IVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFLAPTGLFLGPTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQAL+VG+YDEP+TP QCN+VVE++GD+L++QG+
Sbjct  85   GKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLVEQGL  131



>sp|A4KA60.1|PRO11_MAIZE RecName: Full=Profilin-11; AltName: Full=Pollen allergen Zea 
m 12; AltName: Full=Pollen profilin variant 6; AltName: Allergen=Zea 
m 12 [Zea mays]
 gb|ABG81317.1| pollen profilin variant 6 [Zea mays]
Length=131

 Score =   173 bits (439),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG +WAQS  FP  KTEE+T+IMKDFDEPG LAPTGL L   KYMVIQGEPGAVIR
Sbjct  25   IVGHDGAVWAQSTAFPQSKTEEMTNIMKDFDEPGFLAPTGLFLGPTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQA++VG+YDEP+TP QCN+VVE++GD+L++QG+
Sbjct  85   GKKGSGGITVKKTGQAMVVGIYDEPMTPGQCNMVVERLGDYLLEQGL  131



>ref|XP_008795502.1| PREDICTED: profilin-1-like [Phoenix dactylifera]
Length=131

 Score =   173 bits (439),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS +FP  K+EE+T+IM DF+EPG LAPTGL+L   KYMVIQGEPGAVIR
Sbjct  25   ILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSLAPTGLYLGSTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKT QALI G+Y+EP+TP QCN+VVE++GD+LIDQG+
Sbjct  85   GKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVERLGDYLIDQGL  131



>sp|A4GDS6.1|PROBA_OLEEU RecName: Full=Profilin-2; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|AAZ30422.1| pollen profilin [Olea europaea]
Length=134

 Score =   173 bits (439),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+  IM DF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  28   IVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L++QG+
Sbjct  88   GKKGSGGITIKKTGQALVCGIYEEPVTPGQCNMVVERLGDYLVEQGL  134



>ref|XP_006661691.1| PREDICTED: profilin-A-like [Oryza brachyantha]
Length=131

 Score =   173 bits (439),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDGT+WAQS  FP  K EE+T+IMKDFDEPG LAPTGL L   KYMVIQGEPGAVIR
Sbjct  25   IVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFLAPTGLFLGPTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQAL+VG+YDEP+TP QCN+VVE++GD+L++QG+
Sbjct  85   GKKGSGGVTVKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLVEQGL  131



>gb|EMS49855.1| Profilin-2/4 [Triticum urartu]
Length=131

 Score =   173 bits (438),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDGT+WAQS  FP+ K  E+ +IMKDFDEPG LAPTGL LA  KYMVIQGEPGAVIR
Sbjct  25   ILGHDGTVWAQSADFPSFKPAEMANIMKDFDEPGTLAPTGLLLADAKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQAL+VG+YDEP+TP QCN+VVE++GD+L++QGM
Sbjct  85   GKKGAGGITLKKTGQALVVGIYDEPMTPGQCNLVVERLGDYLVEQGM  131



>gb|AAO41991.1| putative profilin 3 [Arabidopsis thaliana]
Length=134

 Score =   173 bits (439),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS  FP  K +E +DIMKDFDEPGHLAPTGL +AG KYMVIQGEPGAVIR
Sbjct  28   IVGHDGSVWAQSANFPQFKGQEFSDIMKDFDEPGHLAPTGLFMAGAKYMVIQGEPGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQ+ + G+Y+EPVTP QCN+VVE++GD+L+++G+
Sbjct  88   GKKGAGGITIKKTGQSCVFGIYEEPVTPGQCNMVVERLGDYLLERGL  134



>sp|O24170.1|PROFB_OLEEU RecName: Full=Profilin-2; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 sp|P0DKD1.1|PROFG_OLEEU RecName: Full=Profilin-1; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 sp|P0DKD5.1|PROFK_OLEEU RecName: Full=Profilin-1; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 sp|P0DKD9.1|PROFO_OLEEU RecName: Full=Profilin-1; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 sp|P0DKD4.1|PROFJ_OLEEU RecName: Full=Profilin-1; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 sp|P0DKD8.1|PROFN_OLEEU RecName: Full=Profilin-1; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 sp|P0DKD3.1|PROFI_OLEEU RecName: Full=Profilin-1; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 sp|P0DKD7.1|PROFM_OLEEU RecName: Full=Profilin-1; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 sp|P0DKD0.1|PROFD_OLEEU RecName: Full=Profilin-1; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 sp|P0DKD2.1|PROFH_OLEEU RecName: Full=Profilin-1; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 sp|P0DKD6.1|PROFL_OLEEU RecName: Full=Profilin-1; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 emb|CAA73039.1| profilin 2 [Olea europaea]
 gb|AAY88883.1| profilin [Olea europaea]
 gb|AAZ08568.1| profilin [Olea europaea]
 gb|AAZ08569.1| profilin [Olea europaea]
 gb|AAZ30393.1| pollen profilin [Olea europaea]
 gb|AAZ30403.1| pollen profilin [Olea europaea]
 gb|AAZ30408.1| pollen profilin [Olea europaea]
 gb|AAZ30420.1| pollen profilin [Olea europaea]
 gb|AAZ30421.1| pollen profilin [Olea europaea]
 gb|AAZ30437.1| pollen profilin [Olea europaea]
 gb|AAZ30440.1| pollen profilin [Olea europaea]
 gb|AAZ30443.1| pollen profilin [Olea europaea]
 gb|ABC47408.1| profilin pollen [Olea europaea]
 gb|ABC47414.1| profilin pollen [Olea europaea]
Length=134

 Score =   173 bits (438),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+  IM DF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  28   IVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L++QG+
Sbjct  88   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLLEQGL  134



>sp|P0DKE6.1|PROAB_OLEEU RecName: Full=Profilin-3; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 sp|P0DKE7.1|PROAC_OLEEU RecName: Full=Profilin-2; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 sp|P0DKE8.1|PROAD_OLEEU RecName: Full=Profilin-1; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 sp|P0DKE9.1|PROAE_OLEEU RecName: Full=Profilin-1; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 sp|P0DKF0.1|PROAF_OLEEU RecName: Full=Profilin-1; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 sp|P0DKF1.1|PROAG_OLEEU RecName: Full=Profilin-2; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 sp|P0DKF2.1|PROAH_OLEEU RecName: Full=Profilin-1; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 sp|P0DKF3.1|PROAI_OLEEU RecName: Full=Profilin-1; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|AAZ30399.1| pollen profilin [Olea europaea]
 gb|AAZ30406.1| pollen profilin [Olea europaea]
 gb|AAZ30411.1| pollen profilin [Olea europaea]
 gb|AAZ30428.1| pollen profilin [Olea europaea]
 gb|AAZ30433.1| pollen profilin [Olea europaea]
 gb|AAZ30434.1| pollen profilin [Olea europaea]
 gb|ABC47409.1| profilin pollen [Olea europaea]
 gb|ABC47420.1| profilin pollen [Olea europaea]
 gb|ABP58624.1| pollen allergen Ole e 2 [Olea europaea]
Length=134

 Score =   173 bits (438),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+  IM DF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  28   IVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L++QG+
Sbjct  88   GKKGSGGITIKKTGQALVCGIYEEPVTPGQCNMVVERLGDYLLEQGL  134



>sp|A4GDU2.1|PROBK_OLEEU RecName: Full=Profilin-3; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|AAZ30438.1| pollen profilin [Olea europaea]
Length=134

 Score =   173 bits (438),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+  IM DF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  28   IVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L++QG+
Sbjct  88   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLLEQGL  134



>sp|P0DKF4.1|PROAM_OLEEU RecName: Full=Profilin-3; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 sp|P0DKF5.1|PROAN_OLEEU RecName: Full=Profilin-1; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 sp|P0DKF6.1|PROAO_OLEEU RecName: Full=Profilin-1; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 sp|P0DKF7.1|PROAP_OLEEU RecName: Full=Profilin-1; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 sp|P0DKF8.1|PROAQ_OLEEU RecName: Full=Profilin-2; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 sp|P0DKF9.1|PROAR_OLEEU RecName: Full=Profilin-2; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|AAZ30405.1| pollen profilin [Olea europaea]
 gb|AAZ30424.1| pollen profilin [Olea europaea]
 gb|ABC47411.1| profilin pollen [Olea europaea]
 gb|ABC47424.1| profilin pollen [Olea europaea]
 gb|ABC47425.1| profilin pollen [Olea europaea]
 gb|ABP58620.1| pollen allergen Ole e 2 [Olea europaea]
 gb|ABP58622.1| pollen allergen Ole e 2 [Olea europaea]
 gb|ABP58625.1| pollen allergen Ole e 2 [Olea europaea]
Length=134

 Score =   173 bits (438),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+  IM DF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  28   IVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L++QG+
Sbjct  88   GKKGSGGITIKKTGQALVCGIYEEPVTPGQCNMVVERLGDYLLEQGL  134



>sp|A4GCR5.1|PROFE_OLEEU RecName: Full=Profilin-2; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|AAZ08564.1| profilin [Olea europaea]
Length=134

 Score =   173 bits (438),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+  IM DF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  28   IVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L++QG+
Sbjct  88   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLLEQGL  134



>gb|AGN33441.1| profilin [Cenchrus americanus]
Length=131

 Score =   173 bits (438),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDGT+WAQS  FP  K EE+T+IMKDFDEPG LAPTGL L   KYMVIQGEPGAVIR
Sbjct  25   IIGHDGTVWAQSAAFPPFKPEEMTNIMKDFDEPGFLAPTGLFLGPTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQAL+VG+YDEP+TP QCN+VVE++GD+L++QG+
Sbjct  85   GKKGSGGVTLKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLVEQGL  131



>ref|XP_002456332.1| hypothetical protein SORBIDRAFT_03g034110 [Sorghum bicolor]
 gb|EES01452.1| hypothetical protein SORBIDRAFT_03g034110 [Sorghum bicolor]
 gb|AGN33439.1| profilin [Sorghum bicolor]
Length=131

 Score =   173 bits (438),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDGT+WAQS  FP  K EE+T+IMKDFDEPG LAPTGL L   KYMVIQGEPGAVIR
Sbjct  25   IIGHDGTVWAQSTAFPQFKPEEMTNIMKDFDEPGFLAPTGLFLGPTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQAL++G+YDEP+TP QCN+VVE++GD+L++QG+
Sbjct  85   GKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVERLGDYLVEQGL  131



>sp|A4GE55.1|PROBZ_OLEEU RecName: Full=Profilin-2; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|ABC47423.1| profilin pollen [Olea europaea]
Length=134

 Score =   173 bits (438),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+  IM DF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  28   IVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L++QG+
Sbjct  88   GKKGSGGITIKKTGQALVCGIYEEPVTPGQCNMVVERLGDYLLEQGL  134



>sp|A4GCR6.1|PROFF_OLEEU RecName: Full=Profilin-3; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|AAZ08565.1| profilin [Olea europaea]
Length=134

 Score =   173 bits (438),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+  IM DF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  28   IVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L++QG+
Sbjct  88   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLLEQGL  134



>sp|P0DKE4.1|PROFW_OLEEU RecName: Full=Profilin-4; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 sp|P0DKE5.1|PROFX_OLEEU RecName: Full=Profilin-2; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|AAZ30395.1| pollen profilin [Olea europaea]
 gb|AAZ30417.1| pollen profilin [Olea europaea]
 gb|AAZ30418.1| pollen profilin [Olea europaea]
 gb|AAZ30419.1| pollen profilin [Olea europaea]
Length=134

 Score =   173 bits (438),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+  IM DF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  28   IVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L++QG+
Sbjct  88   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLLEQGL  134



>ref|XP_010047296.1| PREDICTED: profilin [Eucalyptus grandis]
Length=131

 Score =   173 bits (438),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS +FP  K EE+T IM+DFDEPG LAPTGL+L G KYMVIQGEP AVIR
Sbjct  25   IIGHDGSVWAQSSSFPQFKPEEITGIMRDFDEPGTLAPTGLYLGGTKYMVIQGEPNAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKGPGG+TIKKT  ALI+G+YDEP+TP QCN++VE++GD+L+DQG 
Sbjct  85   GKKGPGGVTIKKTTMALIIGIYDEPMTPGQCNMIVERLGDYLVDQGF  131



>sp|A4KA38.1|PRO10_PHLPR RecName: Full=Profilin-10; AltName: Full=Pollen allergen Phl 
p 12; AltName: Full=pollen profilin variant 8; AltName: Allergen=Phl 
p 12 [Phleum pratense]
 gb|ABG81295.1| pollen profilin variant 8 [Phleum pratense]
Length=131

 Score =   173 bits (438),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDGT+WAQS  FP  K EE+T IMKDFDEPGHLAPTG+ +A  KYMVIQGEPGAVIR
Sbjct  25   ILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHLAPTGMFVATAKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+VG+YDEP+TP QC++VVE++GD+L+ QG+
Sbjct  85   GKKGAGGITIKKTGQALVVGIYDEPMTPGQCSMVVERLGDYLVKQGL  131



>ref|XP_010541007.1| PREDICTED: profilin-2 [Tarenaya hassleriana]
Length=131

 Score =   173 bits (438),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+G DG++WAQS  FP  K+EE+T IMKDFDEPG LAPTGL L G KYMVIQGEPGAVIR
Sbjct  25   ILGQDGSVWAQSSGFPQFKSEEITAIMKDFDEPGTLAPTGLFLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKGPGG+TIKKT QAL++G+YDEP+TP QCN+VVE++GD+LI+ G+
Sbjct  85   GKKGPGGVTIKKTNQALVIGIYDEPMTPGQCNMVVERLGDYLIESGL  131



>ref|XP_004969894.1| PREDICTED: profilin-A-like [Setaria italica]
Length=131

 Score =   173 bits (438),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDGT+WAQS  FP+ K EE+ +IMKDFDEPG LAPTGL L   KYMVIQGEPGAVIR
Sbjct  25   IIGHDGTVWAQSAAFPSFKPEEMANIMKDFDEPGFLAPTGLFLGPTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQAL++G+YDEP+TP QCN+VVE++GD+L++QG+
Sbjct  85   GKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVVERLGDYLVEQGL  131



>sp|Q9SNW7.1|PROF1_LILLO RecName: Full=Profilin-1 [Lilium longiflorum]
 gb|AAF08302.1|AF200184_1 profilin 1 [Lilium longiflorum]
Length=131

 Score =   173 bits (438),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG+IWAQS  FP  K EE+T IM DF EPG LAPTGL+LAG KYMVIQGEPGAVIR
Sbjct  25   IVGHDGSIWAQSAGFPQFKPEEITGIMNDFAEPGSLAPTGLYLAGMKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQALI G+Y+EP+TP QCN+VVE++GD+L+DQG+
Sbjct  85   GKKGSGGVTIKKTGQALIFGIYEEPMTPGQCNMVVERMGDYLVDQGL  131



>ref|XP_011019559.1| PREDICTED: profilin [Populus euphratica]
Length=131

 Score =   173 bits (438),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS TFP   TEEV  IMKDFDEPG LAPTGL L G KYMVIQGE GAVIR
Sbjct  25   IIGHDGSVWAQSATFPQFTTEEVAAIMKDFDEPGSLAPTGLFLGGTKYMVIQGEAGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKT QAL++GVYDEP+ P QCN++VE++GD+L DQG+
Sbjct  85   GKKGSGGVTIKKTNQALVIGVYDEPLAPGQCNMIVERLGDYLYDQGL  131



>sp|A4GDR1.1|PROAS_OLEEU RecName: Full=Profilin-4; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|AAZ30407.1| pollen profilin [Olea europaea]
Length=134

 Score =   173 bits (438),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+  IM DF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  28   IVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L++QG+
Sbjct  88   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLLEQGL  134



>sp|P0DKE3.1|PROFV_OLEEU RecName: Full=Profilin-2; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 sp|P0DKE2.1|PROFU_OLEEU RecName: Full=Profilin-3; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|AAZ30394.1| pollen profilin [Olea europaea]
 gb|AAZ30401.1| pollen profilin [Olea europaea]
Length=134

 Score =   173 bits (438),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+  IM DF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  28   IVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L++QG+
Sbjct  88   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLLEQGL  134



>sp|A4GDT1.1|PROBE_OLEEU RecName: Full=Profilin-3; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|AAZ30427.1| pollen profilin [Olea europaea]
Length=134

 Score =   173 bits (438),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+  IM DF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  28   IVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L++QG+
Sbjct  88   GKKGSGGITIKKTGQALVCGIYEEPVTPGQCNMVVERLGDYLLEQGL  134



>ref|NP_001105450.1| profilin-1 [Zea mays]
 sp|P35081.1|PROF1_MAIZE RecName: Full=Profilin-1; AltName: Full=Pollen allergen Zea m 
12; AltName: Full=ZmPRO1; AltName: Allergen=Zea m 12 [Zea mays]
 emb|CAA51718.1| profilin 1 [Zea mays]
Length=131

 Score =   172 bits (437),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG  WAQS  FP  K EE+  IMKDFDEPGHLAPTGL L G KYMVIQGEPGAVIR
Sbjct  25   IVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHLAPTGLILGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQ+LI+G+YDEP+TP QCN+VVE++GD+L++QGM
Sbjct  85   GKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVERLGDYLLEQGM  131



>ref|XP_010914952.1| PREDICTED: profilin-1 [Elaeis guineensis]
Length=131

 Score =   172 bits (437),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS +FP  K EE+T+IM DF EPG LAPTGL+L   KYMVIQGEPGAVIR
Sbjct  25   IVGHDGSVWAQSSSFPQFKPEEITNIMNDFAEPGSLAPTGLYLGSTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKT QALI G+YDEP+TP QCN+VVE++GD+LIDQG+
Sbjct  85   GKKGSGGITIKKTNQALIFGIYDEPMTPGQCNMVVERLGDYLIDQGL  131



>sp|Q9XF40.1|PROF1_MALDO RecName: Full=Profilin-1; AltName: Full=GD4-1; AltName: Full=Pollen 
allergen Mal d 4.0301; AltName: Allergen=Mal d 4.0301 
[Malus domestica]
 gb|AAD29412.1|AF129426_1 profilin [Malus domestica]
Length=131

 Score =   172 bits (437),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WA S TFP  K EE+T IMKDFDEPG LAPTGLHL G KYMVIQGE GAVIR
Sbjct  25   ILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSLAPTGLHLGGTKYMVIQGEGGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQAL+ G+Y+EP+TP QCN++VE++GD+LIDQG+
Sbjct  85   GKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVERLGDYLIDQGL  131



>ref|XP_010416663.1| PREDICTED: profilin-4-like [Camelina sativa]
Length=134

 Score =   172 bits (437),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS  FP +K EE+T IMKDFDEPG+LAPTG+ LAG KYMVIQGEP AVIR
Sbjct  28   IIGHDGSVWAQSANFPQLKPEEITGIMKDFDEPGYLAPTGMFLAGLKYMVIQGEPNAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQ+++ G+Y+EPVTP QCN+VVE++GD+LI+QG+
Sbjct  88   GKKGAGGITIKKTGQSMVFGLYEEPVTPGQCNMVVERLGDYLIEQGL  134



>gb|AHL24660.1| Fra e 2.01 allergen [Fraxinus excelsior]
Length=134

 Score =   172 bits (437),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+  I  DF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  28   IVGHDGSVWAQSATFPQFKPEEINGITTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EP+TP QCN+VVE++GD+LIDQG+
Sbjct  88   GKKGSGGITIKKTGQALVFGIYEEPITPGQCNMVVERLGDYLIDQGL  134



>sp|Q9XF38.1|PROF_PYRCO RecName: Full=Profilin; AltName: Full=Allergen Pyr c 3; AltName: 
Allergen=Pyr c 4 [Pyrus communis]
 gb|AAD29410.1| profilin [Pyrus communis]
Length=131

 Score =   172 bits (437),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+T IMKDFDEPG LAPTGLHL G KYMVIQGE GAVIR
Sbjct  25   ILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSLAPTGLHLGGTKYMVIQGEGGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKT QAL+ G+Y+EP+TP QCN++VE++GD+LIDQG+
Sbjct  85   GKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMIVERLGDYLIDQGL  131



>gb|ABW17183.1| profilin [Raphanus sativus]
 gb|ABW17189.1| profilin [Brassica juncea var. multiceps]
Length=134

 Score =   172 bits (437),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS  FP  K +E T IMKDFDEPGHLAPTGL LAG KYMVIQGEPGAVIR
Sbjct  28   IVGHDGSVWAQSANFPQFKAQEFTGIMKDFDEPGHLAPTGLFLAGAKYMVIQGEPGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQ+ + G+Y+EPVTP QCN+VVE++GD+LI+Q +
Sbjct  88   GKKGAGGITIKKTGQSCVFGIYEEPVTPGQCNMVVERLGDYLIEQDL  134



>emb|CDP03238.1| unnamed protein product [Coffea canephora]
Length=132

 Score =   172 bits (437),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS +FP +K EEV+ IM DF EPG LAPTGL LAG KYMVIQGEPGA IR
Sbjct  26   IIGHDGSVWAQSASFPQLKPEEVSGIMNDFAEPGSLAPTGLFLAGTKYMVIQGEPGAAIR  85

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG  G TIK+TGQALI+G YDEP+T SQCN+VVE++GD+LIDQG+
Sbjct  86   GKKGSAGATIKRTGQALIIGTYDEPLTASQCNMVVERLGDYLIDQGL  132



>sp|A4GD50.1|PROFT_OLEEU RecName: Full=Profilin-2; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|AAZ30392.1| pollen profilin [Olea europaea]
Length=134

 Score =   172 bits (437),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+  +M DF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  28   IVGHDGSVWAQSATFPQFKPEEMNGVMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L++QG+
Sbjct  88   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLLEQGL  134



>sp|A4GDT0.1|PROBD_OLEEU RecName: Full=Profilin-2; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|AAZ30426.1| pollen profilin [Olea europaea]
Length=134

 Score =   172 bits (437),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+  IM DF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  28   IVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQA++ G+Y+EPVTP QCN+VVE++GD+LI+QG+
Sbjct  88   GKKGSGGITIKKTGQAVVCGIYEEPVTPGQCNMVVERLGDYLIEQGL  134



>emb|CAD46559.1| profilin [Malus domestica]
 gb|AAX19852.1| profilin 1 [Malus domestica]
Length=131

 Score =   172 bits (436),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WA S TFP  K EE+T IMKDFDEPG LAPTGLHL G KYMVIQGE GAVIR
Sbjct  25   ILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSLAPTGLHLGGTKYMVIQGEGGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQAL+ G+Y+EP+TP QCN++VE++GD+LIDQG+
Sbjct  85   GKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVERLGDYLIDQGL  131



>emb|CAT99619.1| profilin [Malus domestica]
Length=115

 Score =   171 bits (434),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+G DG++WAQS TFP  K EE+  I+KDFD+PG LAPTGL L G KYMVIQGEPGAVIR
Sbjct  9    ILGQDGSVWAQSATFPAFKPEEIAAILKDFDQPGTLAPTGLFLGGTKYMVIQGEPGAVIR  68

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKT QAL++G+YDEP+TP QCNIVVE++GD+LI+QG+
Sbjct  69   GKKGSGGITIKKTSQALLIGIYDEPLTPGQCNIVVERLGDYLIEQGL  115



>gb|EYU30691.1| hypothetical protein MIMGU_mgv1a016415mg [Erythranthe guttata]
Length=123

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG +WAQS TFP  K EE+  I+ DF+EPGHLAPTGL L G KYMVIQGEPGAVIR
Sbjct  17   ILGHDGAVWAQSSTFPQFKPEEINGILTDFNEPGHLAPTGLFLGGAKYMVIQGEPGAVIR  76

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQ+L+ G+Y+EPVTP QCN+VVE++ D+L+DQGM
Sbjct  77   GKKGSGGITIKKTGQSLVFGLYEEPVTPGQCNMVVERLADYLLDQGM  123



>sp|A4GD54.1|PROFY_OLEEU RecName: Full=Profilin-5; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|AAZ30396.1| pollen profilin [Olea europaea]
Length=134

 Score =   172 bits (436),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  + EE+  IM DF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  28   IVGHDGSVWAQSATFPQFRPEEMNGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L++QG+
Sbjct  88   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLLEQGL  134



>ref|XP_010526419.1| PREDICTED: profilin-4-like [Tarenaya hassleriana]
Length=134

 Score =   172 bits (436),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS  FP  K +E+T I KDFDEPGHLAP+GL L G KYMVIQGEPGAVIR
Sbjct  28   IVGHDGSVWAQSANFPQFKADEITGITKDFDEPGHLAPSGLFLGGTKYMVIQGEPGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ GVY+EPVTP QCN+VVE++GD+LI+QG+
Sbjct  88   GKKGSGGITIKKTGQALVFGVYEEPVTPGQCNMVVERLGDYLIEQGL  134



>ref|XP_007204757.1| hypothetical protein PRUPE_ppa013242mg [Prunus persica]
 gb|EMJ05956.1| hypothetical protein PRUPE_ppa013242mg [Prunus persica]
Length=133

 Score =   172 bits (436),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIG DG++WA+S +FP  K EE+T I KDF+EPGHLAPTGLHL G KYMVIQGEPGAVIR
Sbjct  27   IIGLDGSVWAKSASFPQFKPEEMTGINKDFEEPGHLAPTGLHLGGAKYMVIQGEPGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+LIDQG+
Sbjct  87   GKKGSGGITIKKTGQALVFGLYEEPVTPGQCNMVVERLGDYLIDQGL  133



>gb|AEW90958.1| profilin R2-2 [Secale cereale x Triticum turgidum subsp. durum]
Length=131

 Score =   172 bits (436),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQSP FP  K EEV  I+KDFDEPGHLAPTGL L G KYMVIQGEPG VIR
Sbjct  25   ILGHDGSVWAQSPNFPQFKPEEVAGIIKDFDEPGHLAPTGLFLGGTKYMVIQGEPGVVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTG ALI+G+YDEP+TP QCN+VVE++GD+L++QG 
Sbjct  85   GKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVERLGDYLVEQGF  131



>sp|A4GE38.1|PROBO_OLEEU RecName: Full=Profilin-1; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|ABC47406.1| profilin pollen [Olea europaea]
Length=134

 Score =   172 bits (436),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+  IM DF+EPGHLAPTGLHL G KYMVIQGE GAV+R
Sbjct  28   IVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVVR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L++QG+
Sbjct  88   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLLEQGL  134



>sp|A4KA57.1|PROF8_MAIZE RecName: Full=Profilin-8; AltName: Full=Pollen allergen Zea m 
12; AltName: Full=Pollen profilin variant 3; AltName: Allergen=Zea 
m 12 [Zea mays]
 gb|ABG81314.1| pollen profilin variant 3 [Zea mays]
Length=131

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG  WAQS  FP  KTE++ +IMKDFDEPGHLAPTGL L   KYMVIQGEPGAVIR
Sbjct  25   IVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHLAPTGLFLGPTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQAL+VG+YDEP+TP QCN+VVE++GD+L+ QG+
Sbjct  85   GKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLLKQGL  131



>ref|XP_009137845.1| PREDICTED: profilin-3-like [Brassica rapa]
Length=134

 Score =   172 bits (436),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS  FP  K +E T IMKDFDEPGHLAPTGL LAG KYMVIQGEPGAVIR
Sbjct  28   IVGHDGSVWAQSANFPQFKAQEFTGIMKDFDEPGHLAPTGLFLAGAKYMVIQGEPGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQ+ + G+Y+EPVTP QCN+VVE++GD+L++Q +
Sbjct  88   GKKGAGGITIKKTGQSCVFGIYEEPVTPGQCNMVVERLGDYLLEQDL  134



>gb|KCW79179.1| hypothetical protein EUGRSUZ_C00615, partial [Eucalyptus grandis]
Length=193

 Score =   174 bits (441),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS +FP  K EE+T IM+DFDEPG LAPTGL+L G KYMVIQGEP AVIR
Sbjct  87   IIGHDGSVWAQSSSFPQFKPEEITGIMRDFDEPGTLAPTGLYLGGTKYMVIQGEPNAVIR  146

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKGPGG+TIKKT  ALI+G+YDEP+TP QCN++VE++GD+L+DQG 
Sbjct  147  GKKGPGGVTIKKTTMALIIGIYDEPMTPGQCNMIVERLGDYLVDQGF  193



>gb|AAW84279.1| profilin 5 [Petroselinum crispum]
Length=132

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS TFP  K EE+T IMKDFDEPG LAPTGL+L G KYMVIQGEP AVIR
Sbjct  26   IIGHDGSVWAQSDTFPQFKPEEITAIMKDFDEPGSLAPTGLYLGGTKYMVIQGEPNAVIR  85

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKK+ QAL++G+Y+EP+ P QCN+VVE++GD+LIDQG+
Sbjct  86   GKKGSGGVTIKKSNQALLIGIYEEPMPPGQCNVVVERLGDYLIDQGL  132



>sp|A4GDQ8.1|PROAL_OLEEU RecName: Full=Profilin-4; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|AAZ30404.1| pollen profilin [Olea europaea]
Length=134

 Score =   172 bits (436),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+  IM DF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  28   IVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y EPVTP QCN+VVE++GD+L++QG+
Sbjct  88   GKKGSGGITIKKTGQALVFGIYKEPVTPGQCNMVVERLGDYLLEQGL  134



>gb|AAO92742.1| profilin [Gossypium hirsutum]
Length=139

 Score =   172 bits (436),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  680  GHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIRGK  501
            GHDG+IWAQS  FP  + +E+TDIMKDFDEPGHLAPTGLHL G K+MVIQGEPGAVIRGK
Sbjct  35   GHDGSIWAQSSNFPKCQPKEITDIMKDFDEPGHLAPTGLHLGGAKFMVIQGEPGAVIRGK  94

Query  500  KGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            KG GG+TIKKT QAL+ G+Y+EPVTP QCN+VVE++GD+L +QG+
Sbjct  95   KGSGGVTIKKTAQALVFGIYEEPVTPGQCNMVVERLGDYLAEQGL  139



>ref|XP_008365251.1| PREDICTED: profilin [Malus domestica]
Length=131

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WA S TFP  K EE+T IMKDFDEPG LAPTGLHL G KYMVIQGE GAVIR
Sbjct  25   ILGHDGSVWAXSSTFPKFKPEEITAIMKDFDEPGSLAPTGLHLGGTKYMVIQGEGGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQAL+ G+Y+EP+TP QCN++VE++GD+LIDQG+
Sbjct  85   GKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVERLGDYLIDQGL  131



>ref|XP_010267106.1| PREDICTED: profilin-1 [Nelumbo nucifera]
 ref|XP_010267107.1| PREDICTED: profilin-1 [Nelumbo nucifera]
Length=131

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIG DG++WAQS TFP  K EEVT IM DF+EPG LAPTGLHL G KYMVIQGEPGAVIR
Sbjct  25   IIGQDGSVWAQSATFPQFKPEEVTAIMNDFNEPGSLAPTGLHLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKT QALI GVYDEP+ P QCN++VE++GD+LI+QG+
Sbjct  85   GKKGAGGITVKKTNQALIFGVYDEPLAPGQCNMIVERLGDYLIEQGL  131



>ref|XP_010249471.1| PREDICTED: profilin-like [Nelumbo nucifera]
Length=131

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS +FP  +TEE+  IMKDF EPG+LAPTGL L G KYMVIQGE GAVIR
Sbjct  25   IIGHDGSVWAQSSSFPKFETEEINSIMKDFAEPGYLAPTGLFLGGTKYMVIQGEQGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKT QALI GVY+EPVTP QCN+VVE++GD+LI+QG+
Sbjct  85   GKKGSGGITIKKTNQALIFGVYEEPVTPGQCNMVVERLGDYLIEQGL  131



>ref|XP_009796122.1| PREDICTED: profilin-2 [Nicotiana sylvestris]
Length=131

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIG DGT+WAQS  FP  K EE+T IMKDF EPG LAPTGL+L G KYMVIQGEPGAVIR
Sbjct  25   IIGQDGTVWAQSANFPQFKPEEITGIMKDFVEPGTLAPTGLYLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKGPGG+TIKKT QALI+G+YDEP+TP QCN++VE++GD+L++QG+
Sbjct  85   GKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVERLGDYLVEQGL  131



>ref|XP_009128846.1| PREDICTED: profilin-3 [Brassica rapa]
 emb|CDY48612.1| BnaA01g07530D [Brassica napus]
 emb|CDY47769.1| BnaC07g41910D [Brassica napus]
 emb|CDY30218.1| BnaA03g49520D [Brassica napus]
 emb|CDY06821.1| BnaC01g09200D [Brassica napus]
Length=134

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS  FP  K +E T IMKDFDEPGHLAPTGL LAG KYMVIQGEPGAVIR
Sbjct  28   IVGHDGSVWAQSANFPQFKAQEFTGIMKDFDEPGHLAPTGLFLAGAKYMVIQGEPGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQ+ + G+Y+EPVTP QCN+VVE++GD+L++Q +
Sbjct  88   GKKGAGGITIKKTGQSCVFGIYEEPVTPGQCNMVVERLGDYLLEQDL  134



>sp|A4GE50.1|PROBW_OLEEU RecName: Full=Profilin-4; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|ABC47418.1| profilin pollen [Olea europaea]
Length=134

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+  IM DF+EPGHLAPTGLH  G KYMVIQGE GAVIR
Sbjct  28   IVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEPGHLAPTGLHFGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L++QG+
Sbjct  88   GKKGSGGITIKKTGQALVCGIYEEPVTPGQCNMVVERLGDYLLEQGL  134



>ref|XP_009400573.1| PREDICTED: profilin-A [Musa acuminata subsp. malaccensis]
Length=131

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS +FP  K EE T+IM DF+EPG LAP GL +   KYMVIQGEPGAVIR
Sbjct  25   IIGHDGSVWAQSASFPKFKPEEFTNIMNDFNEPGTLAPVGLFIGSTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQALIVG+YDEP+TP QCN+VVE++GD+L+DQGM
Sbjct  85   GKKGSGGITIKKTGQALIVGLYDEPMTPGQCNMVVERLGDYLLDQGM  131



>sp|O24171.1|PROFC_OLEEU RecName: Full=Profilin-3; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 emb|CAA73040.1| profilin 3 [Olea europaea]
Length=134

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+  IM DF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  28   IVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+V E++GD+L++QG+
Sbjct  88   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVAERLGDYLLEQGL  134



>ref|XP_008242467.1| PREDICTED: profilin-4 [Prunus mume]
Length=133

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIG DG++WA+S +FP  K EE+T I KDF+EPGHLAPTGLHL G KYMVIQGEPGAVIR
Sbjct  27   IIGLDGSVWAKSASFPQFKPEEMTGINKDFEEPGHLAPTGLHLGGTKYMVIQGEPGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+LIDQG+
Sbjct  87   GKKGSGGITIKKTGQALVFGLYEEPVTPGQCNMVVERLGDYLIDQGL  133



>sp|A4GE39.1|PROBP_OLEEU RecName: Full=Profilin-2; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|ABC47407.1| profilin pollen [Olea europaea]
Length=134

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+  IM DF EPGHLAPTGLHL G KYMV+QGE GAVIR
Sbjct  28   IVGHDGSVWAQSATFPQFKPEEMNGIMTDFSEPGHLAPTGLHLGGTKYMVVQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L++QG+
Sbjct  88   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLLEQGL  134



>gb|EYU20403.1| hypothetical protein MIMGU_mgv1a016186mg [Erythranthe guttata]
Length=131

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG +WAQ+P FP  K EE+  IM+DF+EPG LAPTGL+L G KYMVIQGEPGAVIR
Sbjct  25   ILGHDGVVWAQTPNFPQFKAEEIAGIMEDFEEPGKLAPTGLYLGGVKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKT QAL+VG+YDEP+TP QCN+VVE+I D+LI+QGM
Sbjct  85   GKKGSGGITVKKTNQALLVGIYDEPMTPGQCNVVVERIADYLIEQGM  131



>ref|XP_004241753.1| PREDICTED: profilin-1-like [Solanum lycopersicum]
Length=131

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+G DG++WAQS  FP  K EE+ +IMKDFDEPG LAPTGL L G KYMVIQGEPGAVIR
Sbjct  25   ILGFDGSVWAQSSAFPKFKQEEIINIMKDFDEPGFLAPTGLFLGGAKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQG  369
            GKKG GG+TIKKT QALI G+Y+EPVTP QCN+VVEKIGD+LIDQG
Sbjct  85   GKKGAGGITIKKTVQALIFGIYEEPVTPGQCNMVVEKIGDYLIDQG  130



>gb|ACV50427.1| profilin-like protein [Jatropha curcas]
 gb|KDP34181.1| hypothetical protein JCGZ_07752 [Jatropha curcas]
Length=131

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIG DGT+WAQS TFP    EEVT IM DF EPG LAPTGL L G KYMVIQGEPGAVIR
Sbjct  25   IIGQDGTVWAQSSTFPQFTAEEVTGIMNDFAEPGTLAPTGLFLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKT QALI+GVYDEP+TP QCN++VE++GD+LIDQG+
Sbjct  85   GKKGSGGVTIKKTNQALIIGVYDEPLTPGQCNMIVERLGDYLIDQGL  131



>ref|XP_011072445.1| PREDICTED: profilin [Sesamum indicum]
Length=131

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIG DG++WAQS  FP  K EEV++I+KDFDEPG LAPTGL L G KYMVIQGEPGAVIR
Sbjct  25   IIGLDGSVWAQSTAFPAFKPEEVSNIVKDFDEPGFLAPTGLFLGGAKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQALI G+Y+EP+TP QCN+VVEK+GD+LIDQG+
Sbjct  85   GKKGSGGITVKKTGQALIFGLYEEPMTPGQCNMVVEKMGDYLIDQGL  131



>emb|CAQ57979.1| profilin [Triticum aestivum]
Length=131

 Score =   171 bits (434),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQSP FP  K EE+  I+KDF+EPGHLAPTGL L G KYMVIQGEPG VIR
Sbjct  25   ILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPGHLAPTGLFLGGTKYMVIQGEPGVVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQG  369
            GKKG GG+TIKKTG ALI+G+YDEP+TP QCN+VVE++GD+LIDQG
Sbjct  85   GKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVERLGDYLIDQG  130



>ref|XP_003620753.1| Profilin [Medicago truncatula]
 gb|AES76971.1| profilin [Medicago truncatula]
Length=133

 Score =   172 bits (435),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS +FP  K +E+T IMKDFDEPGHLAPTG+HL   KYMVIQGEPGAVIR
Sbjct  27   ILGHDGSVWAQSTSFPQFKPDEITGIMKDFDEPGHLAPTGMHLGEIKYMVIQGEPGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L +QG+
Sbjct  87   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLAEQGL  133



>ref|XP_003564682.1| PREDICTED: profilin-2 [Brachypodium distachyon]
Length=131

 Score =   171 bits (434),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS +FP VK EEVT +M DF+EPG LAPTGL+LAG KYMVIQGEPGAVIR
Sbjct  25   ILGHDGSVWAQSESFPQVKPEEVTAVMNDFNEPGSLAPTGLYLAGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKGPGG+TIKKT  A+I+G+Y+EP+TP QCN+VVE++GD+L++QG 
Sbjct  85   GKKGPGGVTIKKTTLAIIIGIYEEPMTPGQCNMVVERLGDYLLEQGF  131



>gb|AAX19855.1| profilin 1 [Malus domestica]
 gb|AAX19856.1| profilin 1 [Malus domestica]
Length=131

 Score =   171 bits (434),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+T IMKDFDEPG LAPTGLHL G KYMVIQGE GAVIR
Sbjct  25   ILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSLAPTGLHLGGTKYMVIQGEGGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQ L+ G+Y+EP+TP QCN++VE++GD+LIDQG+
Sbjct  85   GKKGSGGVTVKKTGQDLVFGIYEEPLTPGQCNMIVERLGDYLIDQGL  131



>gb|KHF97992.1| Profilin [Gossypium arboreum]
Length=131

 Score =   171 bits (434),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIG DG++WAQS +FP +K EE++ IM DF+EPG LAPTGLHL G KYMVIQGEPGAVIR
Sbjct  25   IIGQDGSVWAQSASFPQLKPEEISAIMNDFNEPGSLAPTGLHLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKGPGG+T+KKT  ALI+G+YDEP+TP QCN++VE++GD+L++QG+
Sbjct  85   GKKGPGGVTVKKTNMALIIGIYDEPMTPGQCNMIVERLGDYLLEQGL  131



>gb|AFK38257.1| unknown [Lotus japonicus]
 gb|AFK44821.1| unknown [Lotus japonicus]
Length=131

 Score =   171 bits (434),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+G DG++WAQS  FP  K EE+T IM DF EPG LAPTGL+L G KYMVIQGEPGAVIR
Sbjct  25   ILGQDGSVWAQSANFPQFKPEEITGIMNDFAEPGSLAPTGLYLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKGPGG+T+KKT QALI+G+YDEP+TP QCN++VE++GD+LIDQG+
Sbjct  85   GKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL  131



>ref|XP_008337608.1| PREDICTED: profilin-4 [Malus domestica]
Length=133

 Score =   171 bits (434),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIG DG++WA+S +FP  K EE+T I KDF+EPGHLAPTGLHL G KYMVIQGEPGAVIR
Sbjct  27   IIGLDGSVWAKSSSFPQFKPEEMTGINKDFEEPGHLAPTGLHLGGTKYMVIQGEPGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L+DQG+
Sbjct  87   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLVDQGL  133



>gb|AAX19857.1| profilin 2 [Malus domestica]
 gb|AAX19858.1| profilin 2 [Malus domestica]
Length=131

 Score =   171 bits (434),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS TFP +K EEVT IM DF+EPG LAPTGL+L G KYMVIQGEPG VIR
Sbjct  25   IIGHDGSVWAQSATFPQLKPEEVTGIMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGVVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKGPGG+T+KK+  AL++G+YDEP+TP QCN+VVE++GD+LI+QG+
Sbjct  85   GKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVERLGDYLIEQGL  131



>sp|A4GDT5.1|PROBH_OLEEU RecName: Full=Profilin-3; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|AAZ30431.1| pollen profilin [Olea europaea]
Length=134

 Score =   171 bits (434),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+  IM DF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  28   IVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPV P QCN+VVE++GD+L++QG+
Sbjct  88   GKKGSGGITIKKTGQALVFGIYEEPVAPGQCNMVVERLGDYLLEQGL  134



>emb|CAK93753.1| profilin [Malus domestica]
 emb|CAK93761.1| profilin [Malus domestica]
 emb|CAK93762.1| profilin [Malus domestica]
Length=131

 Score =   171 bits (434),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+G DG++WAQS TFP  K EE+  I+KDFD+PG LAPTGL L G KYMVIQGEPGAVIR
Sbjct  25   ILGQDGSVWAQSATFPAFKPEEIAAILKDFDQPGTLAPTGLFLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKT QAL++G+YDEPVTP QCNIVVE++GD+LI+QG+
Sbjct  85   GKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVERLGDYLIEQGL  131



>dbj|BAK02673.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=131

 Score =   171 bits (434),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQSP FP  K EE+  I+KDFDEPGHLAPTGL L G KYMVIQGEPG VIR
Sbjct  25   ILGHDGSVWAQSPNFPQFKPEEIAGIIKDFDEPGHLAPTGLFLGGTKYMVIQGEPGVVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTG ALI+G+YDEP+TP QCN+VVE++GD+L++QG 
Sbjct  85   GKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVERLGDYLVEQGF  131



>ref|XP_002308591.1| profilin 2 family protein [Populus trichocarpa]
 ref|XP_006382037.1| hypothetical protein POPTR_0006s25180g [Populus trichocarpa]
 gb|ABK92737.1| unknown [Populus trichocarpa]
 gb|EEE92114.1| profilin 2 family protein [Populus trichocarpa]
 gb|ERP59834.1| hypothetical protein POPTR_0006s25180g [Populus trichocarpa]
Length=131

 Score =   171 bits (434),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS TFP    EEV  IMKDFDEPG LAPTGL L G KYMVIQGE GAVIR
Sbjct  25   IIGHDGSVWAQSATFPQFTAEEVAAIMKDFDEPGSLAPTGLFLGGAKYMVIQGEAGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKT QAL++GVYDEP+ P QCN++VE++GD+L DQG+
Sbjct  85   GKKGSGGVTIKKTNQALVIGVYDEPLAPGQCNMIVERLGDYLYDQGL  131



>gb|ABP58623.1| pollen allergen Ole e 2 [Olea europaea]
Length=134

 Score =   171 bits (434),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+G DG++WAQS TFP  K EE+  IM DFDEPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  28   IVGQDGSVWAQSATFPQFKPEEMNGIMTDFDEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L++QG+
Sbjct  88   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLLEQGL  134



>sp|A4GE45.1|PROBS_OLEEU RecName: Full=Profilin-1; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|ABC47413.1| profilin pollen [Olea europaea]
Length=134

 Score =   171 bits (434),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+  IM DF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  28   IVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T KKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L++QG+
Sbjct  88   GKKGSGGITTKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLLEQGL  134



>sp|A4GDR9.1|PROAY_OLEEU RecName: Full=Profilin-3; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|AAZ30415.1| pollen profilin [Olea europaea]
Length=134

 Score =   171 bits (434),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+   M DF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  28   IVGHDGSVWAQSATFPQFKPEEMNGTMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L++QG+
Sbjct  88   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLLEQGL  134



>sp|Q64LH2.1|PROF2_AMBAR RecName: Full=Profilin-2; AltName: Full=Pollen allergen A0418; 
AltName: Allergen=Amb a 8 [Ambrosia artemisiifolia]
 gb|AAP15201.1| profilin-like protein [Ambrosia artemisiifolia]
Length=131

 Score =   171 bits (434),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG +WAQS TFP VK EE+T IM DF+EPG LAPTGL+L G KYMVIQGEPGAVIR
Sbjct  25   IIGHDGVVWAQSATFPQVKPEEITGIMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKGPGG+TIKKT  ALI+G+YDEP+ P QCN++VE++GD+L++QG 
Sbjct  85   GKKGPGGVTIKKTTMALIIGIYDEPMAPGQCNMIVERLGDYLLEQGF  131



>ref|XP_002324161.1| profilin 2 family protein [Populus trichocarpa]
 ref|XP_006371869.1| hypothetical protein POPTR_0018s04840g [Populus trichocarpa]
 ref|XP_006371870.1| hypothetical protein POPTR_0018s04840g [Populus trichocarpa]
 gb|ABK92706.1| unknown [Populus trichocarpa]
 gb|ABK92792.1| unknown [Populus trichocarpa]
 gb|ABK94118.1| unknown [Populus trichocarpa]
 gb|EEF02726.1| profilin 2 family protein [Populus trichocarpa]
 gb|ERP49666.1| hypothetical protein POPTR_0018s04840g [Populus trichocarpa]
 gb|ERP49667.1| hypothetical protein POPTR_0018s04840g [Populus trichocarpa]
Length=131

 Score =   171 bits (434),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WA S +FP    EEV+ IMKDF+EPG LAPTGL L G KYMVIQGEPGAVIR
Sbjct  25   IIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPGSLAPTGLFLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKT QALI+GVYDEP+TP QCN++VE++GD+LIDQG+
Sbjct  85   GKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMIVERLGDYLIDQGL  131



>ref|XP_010033829.1| PREDICTED: profilin [Eucalyptus grandis]
 gb|KCW53663.1| hypothetical protein EUGRSUZ_J02930 [Eucalyptus grandis]
Length=131

 Score =   171 bits (434),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS  FP  K +E+  IMKDFDEPG LAPTGLHLAG KYMVIQGE GAVIR
Sbjct  25   IVGHDGSVWAQSSAFPQFKPQEIAAIMKDFDEPGSLAPTGLHLAGAKYMVIQGEDGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKT QALI G+Y+EP+TP QCN+VVE++GD+LIDQG+
Sbjct  85   GKKGAGGVTVKKTTQALIFGIYEEPLTPGQCNMVVERMGDYLIDQGL  131



>ref|XP_010254422.1| PREDICTED: profilin-like [Nelumbo nucifera]
Length=131

 Score =   171 bits (433),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS +FP  +TEE+  IMKDF EPG+LAPTGL L G KYMVIQGE GAVIR
Sbjct  25   IIGHDGSVWAQSSSFPKFETEEINSIMKDFAEPGYLAPTGLFLGGTKYMVIQGEHGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKT QALI GVY+EPVTP QCN+VVE++GD+LI+QG+
Sbjct  85   GKKGSGGITIKKTNQALIFGVYEEPVTPGQCNMVVERLGDYLIEQGL  131



>ref|XP_004287491.1| PREDICTED: profilin-like [Fragaria vesca subsp. vesca]
Length=133

 Score =   171 bits (434),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG+ WA+S +FP  K EE+  IMKDFDEPGHLAPTGLHL G KYMVI GE GAVIR
Sbjct  27   IVGHDGSPWAKSASFPQFKAEEIAGIMKDFDEPGHLAPTGLHLGGVKYMVIAGEAGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L DQG+
Sbjct  87   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLADQGL  133



>sp|Q9FUB8.1|PROF_BRANA RecName: Full=Profilin [Brassica napus]
 gb|AAG33237.1|AF315326_1 profilin [Brassica napus]
Length=134

 Score =   171 bits (434),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I GHDG++WAQS  FP  K +E  +IMKDFDEPGHLAPTGL LAG KYMVIQGEPGAVIR
Sbjct  28   IFGHDGSVWAQSANFPQFKGQEFANIMKDFDEPGHLAPTGLFLAGAKYMVIQGEPGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQ+ + G+Y+EPVTP QCN+VVE++GD+LI+Q +
Sbjct  88   GKKGAGGITIKKTGQSCVFGIYEEPVTPGQCNMVVERLGDYLIEQDL  134



>sp|A4GCR8.1|PROFQ_OLEEU RecName: Full=Profilin-2; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|AAZ08567.1| profilin [Olea europaea]
Length=134

 Score =   171 bits (434),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+  IM DF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  28   IVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VV+++GD+L++QG+
Sbjct  88   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVKRLGDYLLEQGL  134



>ref|XP_009602785.1| PREDICTED: profilin-2 [Nicotiana tomentosiformis]
Length=131

 Score =   171 bits (433),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIG DGT+WAQS  FP  K EE+T IM DF EPG LAPTGL+L G KYMVIQGEPGAVIR
Sbjct  25   IIGQDGTVWAQSANFPQFKPEEITGIMNDFAEPGTLAPTGLYLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKGPGG+TIKKT QALI+G+YDEP+TP QCN++VE++GD+L++QG+
Sbjct  85   GKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVERLGDYLVEQGL  131



>ref|XP_010526418.1| PREDICTED: profilin [Tarenaya hassleriana]
Length=131

 Score =   171 bits (433),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+G DG++WAQS  FP  K EE+T IMKDFDEPG LAPTGL L G KYMVIQGEPGAVIR
Sbjct  25   ILGQDGSVWAQSSNFPQFKPEEITAIMKDFDEPGTLAPTGLFLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKGPGG+TIKKT QAL++G+YDEP+TP QCN+VVE++GD+LI+ G+
Sbjct  85   GKKGPGGVTIKKTTQALVIGIYDEPMTPGQCNMVVERLGDYLIESGL  131



>emb|CAK93713.1| profilin [Malus domestica]
 emb|CAK93718.1| profilin [Malus domestica]
 emb|CAK93723.1| profilin [Malus domestica]
 emb|CAK93731.1| profilin [Malus domestica]
 emb|CAK93736.1| profilin [Malus domestica]
 emb|CAK93739.1| profilin [Malus domestica]
Length=131

 Score =   171 bits (433),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS TFP +K EEVT IM DF+EPG LAPTGL+L G KYMVIQGEPG VIR
Sbjct  25   IIGHDGSVWAQSATFPQLKPEEVTGIMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGVVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKGPGG+T+KK+  AL++G+YDEP+TP QCN+VVE++GD+LI+QG+
Sbjct  85   GKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVERLGDYLIEQGL  131



>tpg|DAA57720.1| TPA: profilin [Zea mays]
Length=132

 Score =   171 bits (433),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDGT+WAQS  FP  K EE+ +IMKDFDEPG LAPTGL L   KYMVIQGEPGAVIR
Sbjct  26   IIGHDGTVWAQSAAFPLFKPEEMANIMKDFDEPGFLAPTGLFLGPTKYMVIQGEPGAVIR  85

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTG+AL+VG+YDEP+TP QCN+VVE++GD+L++QG+
Sbjct  86   GKKGSGGITVKKTGEALVVGIYDEPMTPGQCNMVVERLGDYLVEQGL  132



>sp|A4GD56.1|PROAA_OLEEU RecName: Full=Profilin-2; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|AAZ30398.1| pollen profilin [Olea europaea]
Length=134

 Score =   171 bits (433),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+G DG++WAQS TFP  K EE+  IM DF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  28   IVGQDGSVWAQSATFPQFKPEEMNGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+LI+QG+
Sbjct  88   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIEQGL  134



>sp|Q9STB6.1|PROF2_HEVBR RecName: Full=Profilin-2; AltName: Full=Pollen allergen Hev b 
8.0102; AltName: Allergen=Hev b 8.0102 [Hevea brasiliensis]
 emb|CAB51914.1| profilin Hev b 8 [Hevea brasiliensis]
Length=131

 Score =   171 bits (433),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIG DG++WAQS  FP  K+EE+T IM DF EPG LAPTGL++ G KYMVIQGEPGAVIR
Sbjct  25   IIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTLAPTGLYIGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQG  369
            GKKGPGG+T+KKT QALI+G+YDEP+TP QCN++VE++GD+LIDQG
Sbjct  85   GKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVERLGDYLIDQG  130



>ref|XP_004149180.1| PREDICTED: profilin-like [Cucumis sativus]
 ref|XP_004158480.1| PREDICTED: profilin-like [Cucumis sativus]
 gb|KGN58022.1| hypothetical protein Csa_3G435030 [Cucumis sativus]
Length=131

 Score =   171 bits (433),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIG+DG++WAQS  FP  K EE++ IMKDFDEPG LAPTGLHL G KYMVIQGE GAVIR
Sbjct  25   IIGNDGSVWAQSSAFPQYKPEEISAIMKDFDEPGSLAPTGLHLGGSKYMVIQGESGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG  G+T+KKT QALI G+YDEP+TP QCN++VEK+GD+LIDQG+
Sbjct  85   GKKGTSGITVKKTTQALIFGLYDEPMTPGQCNVIVEKLGDYLIDQGL  131



>gb|ABW17190.1| profilin [Brassica napus]
Length=134

 Score =   171 bits (433),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I GHDG++WAQS  FP  K +E  +IMKDFDEPGHLAPTGL LAG KYMVIQGEPGAVIR
Sbjct  28   IFGHDGSVWAQSANFPQFKGQEFANIMKDFDEPGHLAPTGLFLAGAKYMVIQGEPGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQ+ + G+Y+EPVTP QCN+VVE++GD+LI+Q +
Sbjct  88   GKKGAGGITIKKTGQSCVFGIYEEPVTPGQCNMVVERLGDYLIEQDL  134



>sp|A4GDR3.1|PROAT_OLEEU RecName: Full=Profilin-2; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|AAZ30409.1| pollen profilin [Olea europaea]
Length=134

 Score =   171 bits (433),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHD ++WAQS TFP  K EE+  IM DF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  28   IVGHDSSVWAQSATFPQFKPEEMNGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L++QG+
Sbjct  88   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLLEQGL  134



>gb|EPS71087.1| profilin [Genlisea aurea]
Length=131

 Score =   171 bits (433),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIG DG +WAQS TFP  K E++++++KDFDEPG LAP GL+L G KYMVIQGEPGAVIR
Sbjct  25   IIGLDGNVWAQSATFPQFKGEDISNMVKDFDEPGFLAPNGLYLGGAKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+T+KKTGQALI+G+Y+EP+TP QCN+VVEK+GD+LIDQG+
Sbjct  85   GKKGSGGITVKKTGQALIIGIYEEPMTPGQCNMVVEKLGDYLIDQGL  131



>sp|A4GE47.1|PROBT_OLEEU RecName: Full=Profilin-2; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|ABC47415.1| profilin pollen [Olea europaea]
Length=134

 Score =   171 bits (433),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+  IM DF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  28   IVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE +GD+L++QG+
Sbjct  88   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVEGLGDYLLEQGL  134



>gb|ABA81885.1| profilin-like [Solanum tuberosum]
Length=131

 Score =   171 bits (433),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIG DGT+WAQS  FP  K EE+T +M DF EPG LAPTGL+L G KYMVIQGEPGAVIR
Sbjct  25   IIGQDGTVWAQSANFPQFKPEEITGVMNDFAEPGTLAPTGLYLGGTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKGPGG+TIKKT QALI+G+YDEP+TP QCN++VE++GD+L++QG+
Sbjct  85   GKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVERLGDYLVEQGL  131



>gb|AAX19859.1| profilin 2 [Malus domestica]
 gb|AAX19860.1| profilin 2 [Malus domestica]
Length=131

 Score =   171 bits (433),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            IIGHDG++WAQS TFP +K EEVT +M DF+EPG LAPTGL+L G KYMVIQGEPG VIR
Sbjct  25   IIGHDGSVWAQSATFPQLKPEEVTGVMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGVVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKGPGG+T+KK+  AL++G+YDEP+TP QCN+VVE++GD+LI+QG+
Sbjct  85   GKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVERLGDYLIEQGL  131



>sp|A4GDT3.1|PROBF_OLEEU RecName: Full=Profilin-1; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|AAZ30429.1| pollen profilin [Olea europaea]
Length=134

 Score =   171 bits (433),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP  K EE+  IM DF+EPGHLAPTGLHL G KYMVIQGE GAVIR
Sbjct  28   IVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIR  87

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+E VTP QCN+VVE++GD+L++QG+
Sbjct  88   GKKGSGGITIKKTGQALVFGIYEESVTPGQCNMVVERLGDYLLEQGL  134



>ref|XP_008795503.1| PREDICTED: profilin-2-like [Phoenix dactylifera]
Length=131

 Score =   171 bits (433),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+GHDG++WAQS TFP VK EE++ IM DF EPGHLAPTGL+L   KYMVIQGEPGAVIR
Sbjct  25   ILGHDGSVWAQSETFPQVKPEEISGIMNDFAEPGHLAPTGLYLGNTKYMVIQGEPGAVIR  84

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKT  ALI+G+YDEP+TP QCN+++E++GD+L+DQG 
Sbjct  85   GKKGSGGVTIKKTNMALIIGIYDEPMTPGQCNMIIERLGDYLVDQGF  131



>ref|XP_009352573.1| PREDICTED: profilin-4 [Pyrus x bretschneideri]
Length=133

 Score =   171 bits (433),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  686  IIGHDGTIWAQSPTFPTVKTEEVTDIMKDFDEPGHLAPTGLHLAGQKYMVIQGEPGAVIR  507
            I+G DG++WA+S +FP  K EE+T I KDF+EPGHLAPTGLHL G KYMVIQGEPGAVIR
Sbjct  27   IVGLDGSVWAKSSSFPQFKPEEMTGINKDFEEPGHLAPTGLHLGGTKYMVIQGEPGAVIR  86

Query  506  GKKGPGGLTIKKTGQALIVGVYDEPVTPSQCNIVVEKIGDHLIDQGM  366
            GKKG GG+TIKKTGQAL+ G+Y+EPVTP QCN+VVE++GD+L+DQG+
Sbjct  87   GKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLVDQGL  133



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1054803784140