BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13481_g2_i1 len=1187 path=[1165:0-1186]

Length=1187
                                                                      Score     E

ref|XP_009769579.1|  PREDICTED: dihydroflavonol-4-reductase-like        430   7e-146   
ref|XP_009598071.1|  PREDICTED: dihydroflavonol-4-reductase-like ...    429   1e-145   
ref|XP_006338284.1|  PREDICTED: tetraketide alpha-pyrone reductas...    429   1e-145   
ref|XP_009598070.1|  PREDICTED: dihydroflavonol-4-reductase-like ...    426   4e-144   
ref|XP_010316191.1|  PREDICTED: dihydroflavonol-4-reductase-like ...    417   9e-141   
ref|XP_004232099.1|  PREDICTED: dihydroflavonol-4-reductase-like ...    414   2e-139   
emb|CDP02392.1|  unnamed protein product                                410   1e-137   
ref|XP_007033396.1|  NAD(P)-binding Rossmann-fold superfamily pro...    408   3e-137   
ref|XP_002283020.3|  PREDICTED: cinnamoyl-CoA reductase 2-like is...    409   3e-137   Vitis vinifera
emb|CBI16870.3|  unnamed protein product                                405   9e-136   
ref|XP_010660512.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...    405   2e-135   
ref|XP_011021181.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...    401   1e-134   
ref|XP_011021184.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...    400   3e-134   
ref|XP_006373476.1|  hypothetical protein POPTR_0017s14130g             399   7e-134   
ref|XP_011021180.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...    396   1e-132   
ref|XP_011021183.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...    395   2e-132   
ref|XP_008230373.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          395   4e-132   
ref|XP_011046780.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...    388   2e-129   
ref|XP_011046779.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    384   9e-128   
ref|XP_002533639.1|  cinnamoyl-CoA reductase, putative                  383   2e-127   Ricinus communis
ref|XP_002305963.2|  hypothetical protein POPTR_0004s10470g             382   3e-127   Populus trichocarpa [western balsam poplar]
ref|XP_009357017.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          381   8e-127   
ref|XP_008379511.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          381   1e-126   
gb|KDP24364.1|  hypothetical protein JCGZ_25660                         373   1e-123   
gb|AIX92150.1|  cinnamoyl-CoA reductase 1                               367   3e-121   
gb|KHG15521.1|  Dihydroflavonol-4-reductase                             365   2e-120   
ref|XP_010262246.1|  PREDICTED: cinnamoyl-CoA reductase 2 isoform X2    362   3e-119   
ref|XP_004306032.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          358   1e-117   
ref|XP_010262240.1|  PREDICTED: cinnamoyl-CoA reductase 2 isoform X1    352   7e-115   
ref|XP_007215828.1|  hypothetical protein PRUPE_ppa010133mg             320   7e-104   
ref|XP_006845002.1|  hypothetical protein AMTR_s00058p00200980          278   1e-86    
ref|XP_010925686.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          262   6e-80    
gb|ABK23555.1|  unknown                                                 261   6e-80    Picea sitchensis
gb|ABK23547.1|  unknown                                                 261   8e-80    Picea sitchensis
gb|AEO45117.1|  cinnamoyl-CoA reductase                                 259   8e-79    
ref|NP_001043674.1|  Os01g0639200                                       258   3e-78    Oryza sativa Japonica Group [Japonica rice]
gb|AIX92146.1|  cinnamoyl-CoA reductase 1                               257   3e-78    
ref|XP_008790508.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          259   3e-78    
gb|KHG12895.1|  Dihydroflavonol-4-reductase                             256   1e-77    
ref|XP_006844944.1|  hypothetical protein AMTR_s00058p00164240          255   1e-77    
ref|XP_010924262.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          256   1e-77    
ref|XP_008801809.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...    255   2e-77    
ref|XP_008801810.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...    254   5e-77    
ref|XP_009400169.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          253   8e-77    
ref|XP_009416556.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          253   2e-76    
ref|XP_011047301.1|  PREDICTED: tetraketide alpha-pyrone reductase 1    252   2e-76    
ref|XP_002300033.2|  hypothetical protein POPTR_0001s34880g             252   4e-76    Populus trichocarpa [western balsam poplar]
ref|XP_009406301.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          249   3e-75    
ref|XP_003567812.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          250   3e-75    
ref|XP_002440306.1|  hypothetical protein SORBIDRAFT_09g029490          249   6e-75    Sorghum bicolor [broomcorn]
ref|XP_007215573.1|  hypothetical protein PRUPE_ppa007494mg             244   3e-73    
ref|XP_007031486.1|  NAD(P)-binding Rossmann-fold superfamily pro...    244   5e-73    
ref|XP_004306348.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          243   9e-73    
ref|XP_004961121.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          243   2e-72    
ref|XP_008656701.1|  PREDICTED: cinnamoyl-CoA reductase 1 isoform X2    242   2e-72    
ref|XP_009595723.1|  PREDICTED: tetraketide alpha-pyrone reductase 1    241   4e-72    
ref|XP_008675300.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          241   4e-72    
ref|XP_006646136.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          240   6e-72    
gb|AFW81232.1|  hypothetical protein ZEAMMB73_472948                    240   9e-72    
gb|KFK25710.1|  hypothetical protein AALP_AA8G149200                    240   1e-71    
ref|XP_004489265.1|  PREDICTED: tetraketide alpha-pyrone reductas...    239   3e-71    
ref|XP_010029161.1|  PREDICTED: cinnamoyl-CoA reductase 2               239   4e-71    
gb|KEH24813.1|  cinnamoyl-CoA reductase                                 238   5e-71    
ref|XP_008458771.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          238   5e-71    
ref|XP_007151024.1|  hypothetical protein PHAVU_004G012500g             238   6e-71    
ref|XP_002458214.1|  hypothetical protein SORBIDRAFT_03g029100          239   6e-71    Sorghum bicolor [broomcorn]
ref|XP_010108781.1|  Anthocyanidin reductase                            238   8e-71    
ref|NP_001146745.1|  uncharacterized protein LOC100280347               238   9e-71    Zea mays [maize]
ref|NP_001288486.1|  cinnamoyl-CoA reductase 1                          238   1e-70    
ref|XP_008341448.1|  PREDICTED: tetraketide alpha-pyrone reductase 1    237   1e-70    
ref|NP_001056413.1|  Os05g0578500                                       238   2e-70    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008230591.1|  PREDICTED: tetraketide alpha-pyrone reductase 1    237   2e-70    
ref|XP_006399984.1|  hypothetical protein EUTSA_v10013866mg             236   5e-70    
ref|XP_003569424.1|  PREDICTED: cinnamoyl-CoA reductase 2               236   5e-70    
gb|KCW56013.1|  hypothetical protein EUGRSUZ_I01783                     239   8e-70    
ref|XP_009375115.1|  PREDICTED: tetraketide alpha-pyrone reductas...    235   9e-70    
ref|XP_002873686.1|  hypothetical protein ARALYDRAFT_488312             235   1e-69    
emb|CDP02106.1|  unnamed protein product                                234   2e-69    
ref|XP_009121639.1|  PREDICTED: cinnamoyl-CoA reductase 2               234   3e-69    
ref|NP_196974.1|  Rossmann-fold NAD(P)-binding domain-containing ...    234   4e-69    Arabidopsis thaliana [mouse-ear cress]
emb|CDX69564.1|  BnaA10g19130D                                          233   7e-69    
gb|AAM62926.1|  cinnamoyl CoA reductase-like protein                    232   1e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004969276.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          233   1e-68    
ref|XP_011098464.1|  PREDICTED: cinnamoyl-CoA reductase 2               232   1e-68    
ref|XP_003553818.1|  PREDICTED: anthocyanidin reductase-like            232   2e-68    
emb|CDY09878.1|  BnaC09g42830D                                          232   2e-68    
ref|XP_004142801.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          231   4e-68    
gb|EYU44756.1|  hypothetical protein MIMGU_mgv1a008662mg                231   5e-68    
ref|XP_008365383.1|  PREDICTED: tetraketide alpha-pyrone reductas...    230   1e-67    
ref|XP_002524651.1|  cinnamoyl-CoA reductase, putative                  230   1e-67    Ricinus communis
dbj|BAJ89981.1|  predicted protein                                      231   1e-67    
ref|XP_006446518.1|  hypothetical protein CICLE_v10015683mg             229   2e-67    
dbj|BAK02570.1|  predicted protein                                      231   2e-67    
dbj|BAJ90135.1|  predicted protein                                      231   2e-67    
gb|ACG37436.1|  dihydroflavonol-4-reductase                             229   2e-67    Zea mays [maize]
ref|XP_006291491.1|  hypothetical protein CARUB_v10017639mg             228   3e-67    
ref|XP_006287978.1|  hypothetical protein CARUB_v10001213mg             229   3e-67    
ref|XP_010453599.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          228   8e-67    
gb|AFW83384.1|  hypothetical protein ZEAMMB73_643711                    223   5e-66    
ref|XP_009405808.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          225   7e-66    
ref|XP_006470314.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...    225   8e-66    
emb|CDX91029.1|  BnaC02g05680D                                          225   1e-65    
ref|XP_009125995.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...    224   1e-65    
emb|CDX85588.1|  BnaA02g02250D                                          224   2e-65    
gb|KDP45331.1|  hypothetical protein JCGZ_09580                         223   3e-65    
ref|XP_010550135.1|  PREDICTED: cinnamoyl-CoA reductase 1               223   6e-65    
ref|XP_006470315.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...    222   8e-65    
ref|XP_002274230.1|  PREDICTED: cinnamoyl-CoA reductase 1               221   2e-64    Vitis vinifera
gb|KHG09510.1|  Dihydroflavonol-4-reductase                             221   3e-64    
ref|XP_009334087.1|  PREDICTED: tetraketide alpha-pyrone reductase 1    219   9e-64    
ref|XP_006338567.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          218   3e-63    
gb|AFK33366.1|  unknown                                                 215   3e-63    
ref|XP_006395395.1|  hypothetical protein EUTSA_v10005604mg             218   3e-63    
gb|KHN23530.1|  Anthocyanidin reductase                                 215   4e-63    
gb|EAY75114.1|  hypothetical protein OsI_03009                          216   6e-63    Oryza sativa Indica Group [Indian rice]
ref|XP_006579765.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          214   1e-62    
ref|XP_010425566.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          215   2e-62    
gb|AFW83385.1|  hypothetical protein ZEAMMB73_643711                    214   2e-62    
gb|EMS50301.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...    215   8e-62    
ref|XP_004232300.1|  PREDICTED: cinnamoyl-CoA reductase 1               210   3e-60    
ref|XP_004141093.1|  PREDICTED: tetraketide alpha-pyrone reductas...    210   7e-60    
gb|EPS68136.1|  hypothetical protein M569_06636                         206   1e-59    
gb|EAZ12850.1|  hypothetical protein OsJ_02770                          207   2e-59    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009125996.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...    199   6e-56    
dbj|BAD68587.1|  cinnamoyl CoA reductase-like                           192   5e-55    Oryza sativa Japonica Group [Japonica rice]
gb|KEH24814.1|  cinnamoyl-CoA reductase                                 190   1e-53    
gb|ABK21355.1|  unknown                                                 186   1e-51    Picea sitchensis
emb|CDP02864.1|  unnamed protein product                                186   2e-51    
ref|XP_008223579.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...    185   2e-51    
ref|XP_010268414.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          185   3e-51    
ref|XP_007222830.1|  hypothetical protein PRUPE_ppa008797mg             184   7e-51    
tpg|DAA58407.1|  TPA: hypothetical protein ZEAMMB73_758171              184   8e-51    
ref|XP_009137924.1|  PREDICTED: cinnamoyl-CoA reductase 2               180   2e-49    
ref|XP_008223578.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...    179   5e-49    
ref|XP_010933456.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...    179   5e-49    
emb|CDY39681.1|  BnaA04g13980D                                          178   1e-48    
ref|XP_007222831.1|  hypothetical protein PRUPE_ppa008797mg             178   1e-48    
ref|XP_011018095.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          177   1e-48    
ref|XP_002324600.2|  hypothetical protein POPTR_0018s10950g             177   1e-48    Populus trichocarpa [western balsam poplar]
gb|KDP38748.1|  hypothetical protein JCGZ_04101                         177   2e-48    
ref|XP_010103123.1|  hypothetical protein L484_022996                   177   2e-48    
ref|XP_010525771.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          177   3e-48    
emb|CDY65186.1|  BnaC04g56240D                                          177   3e-48    
ref|XP_009140504.1|  PREDICTED: cinnamoyl-CoA reductase 2               178   3e-48    
gb|KFK29618.1|  hypothetical protein AALP_AA7G157400                    176   4e-48    
ref|XP_010240887.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          176   6e-48    
ref|XP_006352867.1|  PREDICTED: tetraketide alpha-pyrone reductas...    176   8e-48    
gb|KFK32695.1|  hypothetical protein AALP_AA6G276900                    176   1e-47    
ref|XP_002278778.1|  PREDICTED: tetraketide alpha-pyrone reductas...    174   3e-47    Vitis vinifera
ref|XP_010933457.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...    174   3e-47    
ref|XP_006443240.1|  hypothetical protein CICLE_v10021083mg             175   3e-47    
ref|XP_002325101.1|  cinnamoyl-CoA reductase-related family protein     174   3e-47    Populus trichocarpa [western balsam poplar]
ref|NP_194776.1|  cinnamoyl-CoA reductase like protein                  174   4e-47    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010663392.1|  PREDICTED: tetraketide alpha-pyrone reductas...    174   5e-47    
ref|XP_006412703.1|  hypothetical protein EUTSA_v10025830mg             174   5e-47    
ref|XP_010497202.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          174   6e-47    
ref|XP_002869377.1|  hypothetical protein ARALYDRAFT_491705             173   7e-47    
gb|KDO47229.1|  hypothetical protein CISIN_1g043792mg                   173   8e-47    
ref|XP_008796251.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          173   8e-47    
ref|XP_010438175.1|  PREDICTED: cinnamoyl-CoA reductase 2               173   9e-47    
ref|XP_006294670.1|  hypothetical protein CARUB_v10023711mg             173   1e-46    
ref|XP_010919962.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          173   1e-46    
gb|KDP39532.1|  hypothetical protein JCGZ_02552                         172   1e-46    
ref|XP_011010515.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          172   2e-46    
gb|AAM62641.1|  cinnamoyl-CoA reductase-like protein                    172   2e-46    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009787126.1|  PREDICTED: tetraketide alpha-pyrone reductas...    172   2e-46    
ref|XP_008786341.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          172   2e-46    
ref|NP_565557.1|  Rossmann-fold NAD(P)-binding domain-containing ...    172   3e-46    Arabidopsis thaliana [mouse-ear cress]
gb|AAM62475.1|  putative cinnamoyl CoA reductase                        172   3e-46    Arabidopsis thaliana [mouse-ear cress]
gb|KHG08807.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...    172   3e-46    
ref|XP_006375991.1|  hypothetical protein POPTR_0013s07700g             171   4e-46    
ref|XP_010274271.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          172   4e-46    
ref|XP_009396847.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          171   6e-46    
ref|XP_006443241.1|  hypothetical protein CICLE_v10021083mg             172   6e-46    
ref|XP_006478944.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    171   7e-46    
ref|XP_006367452.1|  PREDICTED: tetraketide alpha-pyrone reductas...    171   7e-46    
ref|XP_006375990.1|  hypothetical protein POPTR_0013s07700g             170   8e-46    
ref|XP_006282680.1|  hypothetical protein CARUB_v10005316mg             170   1e-45    
ref|XP_008443817.1|  PREDICTED: cinnamoyl-CoA reductase 1 isoform X1    170   1e-45    
ref|XP_010047877.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          170   1e-45    
gb|KHG27464.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...    169   2e-45    
ref|XP_004300411.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          170   2e-45    
ref|XP_010417131.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          169   2e-45    
ref|XP_004166068.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          169   2e-45    
ref|XP_010472384.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          169   2e-45    
ref|XP_002308427.1|  cinnamoyl-CoA reductase-related family protein     169   2e-45    Populus trichocarpa [western balsam poplar]
ref|XP_009625955.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          169   2e-45    
gb|AHD25273.1|  dihydroflavonol 4-reductase                             169   3e-45    
ref|XP_010429343.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          169   3e-45    
ref|XP_007013938.1|  NAD(P)-binding Rossmann-fold superfamily pro...    169   3e-45    
ref|XP_006838596.1|  hypothetical protein AMTR_s00002p00222610          169   3e-45    
ref|XP_004241958.1|  PREDICTED: dihydroflavonol-4-reductase-like        169   4e-45    
ref|XP_004245906.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...    169   5e-45    
ref|XP_003534280.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          168   7e-45    
ref|XP_009390701.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...    168   7e-45    
ref|XP_006404875.1|  hypothetical protein EUTSA_v10000263mg             168   7e-45    
ref|XP_003517041.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          167   9e-45    
emb|CBI33869.3|  unnamed protein product                                167   9e-45    
ref|XP_006367444.1|  PREDICTED: tetraketide alpha-pyrone reductas...    168   9e-45    
ref|XP_006453520.1|  hypothetical protein CICLE_v10009021mg             167   9e-45    
ref|XP_009789693.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    168   1e-44    
ref|XP_002272449.1|  PREDICTED: tetraketide alpha-pyrone reductase 1    167   1e-44    Vitis vinifera
ref|XP_010526323.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          167   1e-44    
ref|XP_002520066.1|  cinnamoyl-CoA reductase, putative                  167   1e-44    Ricinus communis
ref|XP_009397665.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...    167   1e-44    
ref|XP_008443819.1|  PREDICTED: cinnamoyl-CoA reductase 1 isoform X2    166   2e-44    
ref|XP_006443242.1|  hypothetical protein CICLE_v10021083mg             167   2e-44    
ref|XP_001765421.1|  predicted protein                                  167   2e-44    
ref|XP_009390702.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...    167   2e-44    
ref|XP_009390703.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...    167   2e-44    
ref|XP_002319253.1|  hypothetical protein POPTR_0013s07700g             167   2e-44    Populus trichocarpa [western balsam poplar]
ref|XP_007209388.1|  hypothetical protein PRUPE_ppa009107mg             166   3e-44    
gb|KHN23531.1|  Anthocyanidin reductase                                 164   3e-44    
gb|AFK39509.1|  unknown                                                 166   5e-44    
ref|XP_011044464.1|  PREDICTED: tetraketide alpha-pyrone reductas...    166   5e-44    
gb|EPS68267.1|  hypothetical protein M569_06505                         166   6e-44    
ref|XP_003553821.1|  PREDICTED: tetraketide alpha-pyrone reductas...    162   9e-44    
ref|XP_009600266.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          165   1e-43    
ref|XP_006385669.1|  hypothetical protein POPTR_0003s09250g             164   1e-43    
ref|XP_002304342.2|  hypothetical protein POPTR_0003s09250g             164   2e-43    Populus trichocarpa [western balsam poplar]
ref|XP_004146663.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          164   2e-43    
ref|XP_008238223.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          164   2e-43    
ref|XP_009399410.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          164   2e-43    
emb|CDP13048.1|  unnamed protein product                                164   3e-43    
ref|XP_004148082.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          163   3e-43    
ref|XP_004245905.1|  PREDICTED: tetraketide alpha-pyrone reductas...    164   3e-43    
gb|AIX92149.1|  cinnamoyl-CoA reductase 1                               167   4e-43    
ref|XP_007158289.1|  hypothetical protein PHAVU_002G140100g             164   4e-43    
ref|XP_007029640.1|  NAD(P)-binding Rossmann-fold superfamily pro...    162   7e-43    
gb|AIX92145.1|  cinnamoyl-CoA reductase 1                               162   1e-42    
ref|XP_010087460.1|  hypothetical protein L484_019664                   162   1e-42    
gb|AIX92148.1|  cinnamoyl-CoA reductase 1                               161   1e-42    
gb|EPS59154.1|  hypothetical protein M569_15655                         161   2e-42    
ref|XP_006474079.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    161   2e-42    
ref|XP_006352866.1|  PREDICTED: tetraketide alpha-pyrone reductas...    162   2e-42    
ref|XP_010695556.1|  PREDICTED: tetraketide alpha-pyrone reductas...    161   2e-42    
ref|XP_009776407.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          162   3e-42    
ref|XP_011028167.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          161   3e-42    
ref|XP_009361150.1|  PREDICTED: tetraketide alpha-pyrone reductas...    162   4e-42    
ref|XP_009361149.1|  PREDICTED: tetraketide alpha-pyrone reductas...    161   5e-42    
ref|XP_009397664.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...    161   5e-42    
gb|AFK48965.1|  unknown                                                 158   5e-42    
ref|XP_010096557.1|  Bifunctional dihydroflavonol 4-reductase/fla...    160   8e-42    
ref|XP_011018544.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          159   1e-41    
ref|XP_004235331.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          160   1e-41    
emb|CAN81853.1|  hypothetical protein VITISV_041264                     159   3e-41    Vitis vinifera
ref|XP_006584553.1|  PREDICTED: uncharacterized protein LOC100783...    158   3e-41    
ref|XP_002878708.1|  hypothetical protein ARALYDRAFT_481248             158   3e-41    
ref|XP_006368386.1|  hypothetical protein POPTR_0001s02320g             158   3e-41    
ref|XP_010325560.1|  PREDICTED: tetraketide alpha-pyrone reductas...    157   4e-41    
gb|EYU45390.1|  hypothetical protein MIMGU_mgv1a010216mg                158   6e-41    
ref|XP_006347591.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          158   6e-41    
ref|XP_010671088.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          158   9e-41    
ref|XP_003612872.1|  Dihydroflavonol-4-reductase                        157   9e-41    
ref|XP_009390700.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...    157   1e-40    
ref|XP_010420119.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          154   1e-40    
ref|XP_008373588.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          156   1e-40    
ref|XP_011079344.1|  PREDICTED: tetraketide alpha-pyrone reductase 1    156   2e-40    
ref|XP_002271549.1|  PREDICTED: cinnamoyl-CoA reductase 1 isoform X2    156   2e-40    Vitis vinifera
ref|XP_001759923.1|  predicted protein                                  156   2e-40    
gb|ACQ59093.1|  cinnamoyl-CoA reductase 1                               155   3e-40    
ref|XP_011075776.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          156   4e-40    
ref|XP_010656648.1|  PREDICTED: cinnamoyl-CoA reductase 2 isoform X1    155   5e-40    
ref|XP_009371209.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          155   6e-40    
dbj|BAK04599.1|  predicted protein                                      155   7e-40    
ref|XP_004512517.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          154   8e-40    
gb|KCW79890.1|  hypothetical protein EUGRSUZ_C01240                     153   1e-39    
ref|XP_007039462.1|  NAD(P)-binding Rossmann-fold superfamily pro...    154   2e-39    
ref|XP_003574385.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          154   2e-39    
ref|XP_009350676.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          150   2e-39    
ref|XP_002533435.1|  cinnamoyl-CoA reductase, putative                  153   2e-39    Ricinus communis
ref|XP_010055308.1|  PREDICTED: tetraketide alpha-pyrone reductas...    153   3e-39    
ref|XP_009351807.1|  PREDICTED: tetraketide alpha-pyrone reductas...    154   4e-39    
ref|XP_008357075.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...    152   5e-39    
ref|XP_009351808.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...    154   5e-39    
ref|XP_008357073.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...    152   7e-39    
ref|XP_010555958.1|  PREDICTED: tetraketide alpha-pyrone reductas...    149   7e-39    
gb|ACG37813.1|  dihydroflavonol-4-reductase                             152   8e-39    Zea mays [maize]
gb|KCW71775.1|  hypothetical protein EUGRSUZ_E00270                     153   8e-39    
ref|XP_009340179.1|  PREDICTED: tetraketide alpha-pyrone reductas...    151   1e-38    
ref|XP_010055307.1|  PREDICTED: tetraketide alpha-pyrone reductas...    151   1e-38    
ref|XP_008382174.1|  PREDICTED: tetraketide alpha-pyrone reductas...    152   2e-38    
ref|XP_008382179.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...    152   2e-38    
ref|XP_008357074.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...    150   3e-38    
gb|KCW71774.1|  hypothetical protein EUGRSUZ_E00270                     152   4e-38    
ref|XP_001776048.1|  predicted protein                                  150   5e-38    
gb|EMS55202.1|  Dihydroflavonol-4-reductase                             148   2e-37    
ref|XP_002467432.1|  hypothetical protein SORBIDRAFT_01g028030          149   2e-37    
ref|NP_001065487.1|  Os10g0576900                                       147   7e-37    
gb|EEE51459.1|  hypothetical protein OsJ_32578                          147   7e-37    
ref|XP_004983544.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          145   3e-36    
ref|XP_008341852.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          140   5e-36    
emb|CAN76090.1|  hypothetical protein VITISV_036512                     151   8e-36    
emb|CBI36598.3|  unnamed protein product                                142   9e-36    
ref|NP_001132159.1|  uncharacterized protein LOC100193580               143   2e-35    
gb|KHG08808.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...    139   4e-35    
gb|AAL67601.1|AC018929_23  putative cinnamoyl-CoA reductase             142   5e-35    
gb|ABK23323.1|  unknown                                                 141   1e-34    
gb|ABK24762.1|  unknown                                                 141   1e-34    
ref|XP_006662102.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          140   1e-34    
ref|XP_010424093.1|  PREDICTED: vestitone reductase-like                136   6e-34    
emb|CAN73634.1|  hypothetical protein VITISV_003434                     137   1e-33    
gb|ABK24297.1|  unknown                                                 137   1e-33    
ref|XP_006849855.1|  hypothetical protein AMTR_s00022p00057010          138   1e-33    
gb|ABK23181.1|  unknown                                                 137   2e-33    
gb|AFW63528.1|  hypothetical protein ZEAMMB73_146413                    142   4e-33    
tpg|DAA58406.1|  TPA: hypothetical protein ZEAMMB73_758171              133   6e-33    
gb|EMT00710.1|  Dihydroflavonol-4-reductase                             134   8e-33    
gb|EYU41199.1|  hypothetical protein MIMGU_mgv1a010141mg                135   1e-32    
gb|EMS58829.1|  Dihydroflavonol-4-reductase                             132   1e-32    
ref|XP_002988276.1|  hypothetical protein SELMODRAFT_271980             132   3e-32    
ref|XP_006385667.1|  hypothetical protein POPTR_0003s09250g             130   4e-32    
gb|KHG07124.1|  Dihydroflavonol-4-reductase                             134   4e-32    
ref|XP_010557405.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          134   5e-32    
ref|XP_002963873.1|  hypothetical protein SELMODRAFT_141996             132   5e-32    
ref|XP_009789694.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    131   1e-31    
gb|EPS73655.1|  hypothetical protein M569_01100                         133   1e-31    
ref|XP_004137660.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          131   2e-31    
gb|AFC38436.1|  cinnamoyl-CoA reductase                                 132   2e-31    
ref|XP_009386710.1|  PREDICTED: tetraketide alpha-pyrone reductase 1    132   2e-31    
ref|XP_009606567.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          129   2e-31    
ref|XP_002889755.1|  cinnamyl-alcohol dehydrogenase family              132   2e-31    
ref|XP_009801930.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          129   3e-31    
ref|XP_002980750.1|  hypothetical protein SELMODRAFT_154000             131   3e-31    
gb|KGN58666.1|  hypothetical protein Csa_3G717370                       132   3e-31    
ref|XP_008461762.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          131   5e-31    
ref|XP_008799152.1|  PREDICTED: tetraketide alpha-pyrone reductase 1    131   5e-31    
ref|XP_010270636.1|  PREDICTED: tetraketide alpha-pyrone reductas...    130   6e-31    
gb|AAL47684.1|  cinnamoyl-CoA reductase                                 130   7e-31    
ref|XP_007029628.1|  NAD(P)-binding Rossmann-fold superfamily pro...    130   7e-31    
gb|EYU23972.1|  hypothetical protein MIMGU_mgv1a009951mg                130   7e-31    
gb|KGN58665.1|  hypothetical protein Csa_3G716870                       130   7e-31    
ref|XP_010270635.1|  PREDICTED: tetraketide alpha-pyrone reductas...    131   8e-31    
gb|EAZ06333.1|  hypothetical protein OsI_28567                          130   9e-31    
ref|NP_001061435.1|  Os08g0277200                                       130   1e-30    
ref|XP_002977011.1|  hypothetical protein SELMODRAFT_175949             130   1e-30    
gb|AFX98068.1|  cinnamoyl-CoA reductase                                 129   1e-30    
ref|XP_007029632.1|  NAD(P)-binding Rossmann-fold superfamily pro...    130   1e-30    
ref|XP_008461763.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          128   1e-30    
gb|ACE76870.3|  cinnamoyl-CoA reductase                                 129   2e-30    
ref|XP_002960169.1|  hypothetical protein SELMODRAFT_74610              129   2e-30    
emb|CAK18610.1|  cinnamoyl CoA reductase                                129   2e-30    
ref|XP_008459174.1|  PREDICTED: tetraketide alpha-pyrone reductas...    126   2e-30    
ref|XP_010932167.1|  PREDICTED: tetraketide alpha-pyrone reductase 1    130   2e-30    
ref|XP_008465155.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          129   2e-30    
ref|XP_008680582.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          125   2e-30    
ref|XP_010531309.1|  PREDICTED: tetraketide alpha-pyrone reductas...    129   3e-30    
dbj|BAK01264.1|  predicted protein                                      129   3e-30    
ref|NP_001061909.1|  Os08g0441500                                       129   3e-30    
ref|XP_002983967.1|  hypothetical protein SELMODRAFT_119444             129   3e-30    
gb|EYU41200.1|  hypothetical protein MIMGU_mgv1a010141mg                128   3e-30    
ref|XP_007149031.1|  hypothetical protein PHAVU_005G034700g             128   3e-30    
ref|XP_010548187.1|  PREDICTED: tetraketide alpha-pyrone reductas...    129   4e-30    
gb|AAC33211.1|  Highly similar to cinnamyl alcohol dehydrogenase,...    128   4e-30    
gb|EYU23973.1|  hypothetical protein MIMGU_mgv1a009951mg                128   5e-30    
ref|XP_002300619.2|  cinnamoyl-CoA reductase family protein             128   5e-30    
ref|XP_009599462.1|  PREDICTED: tetraketide alpha-pyrone reductase 1    128   5e-30    
pdb|4R1S|A  Chain A, Crystal Structure Of Petunia Hydrida Cinnamo...    128   7e-30    
gb|AHX56186.1|  cinnamoyl-CoA reductase 1                               127   7e-30    
ref|XP_006386127.1|  hypothetical protein POPTR_0002s00580g             126   8e-30    
gb|AFX98066.1|  cinnamoyl-CoA reductase                                 127   8e-30    
ref|NP_172422.2|  alcohol dehydrogenase-like protein                    127   1e-29    
gb|ACU24500.1|  unknown                                                 125   1e-29    
ref|XP_011100066.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          126   2e-29    
gb|EMT28387.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...    127   2e-29    
gb|AEZ53298.1|  tetraketide alpha-pyrone reductase 1                    127   2e-29    
ref|XP_011091759.1|  PREDICTED: tetraketide alpha-pyrone reductas...    126   2e-29    
ref|XP_004979106.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          127   2e-29    
ref|XP_009776908.1|  PREDICTED: tetraketide alpha-pyrone reductase 1    126   2e-29    
ref|XP_007163919.1|  hypothetical protein PHAVU_L005800g                126   2e-29    
ref|XP_006360850.1|  PREDICTED: tetraketide alpha-pyrone reductas...    126   3e-29    
gb|KHG28629.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...    126   3e-29    
emb|CDO98223.1|  unnamed protein product                                126   3e-29    
ref|XP_003531735.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          126   3e-29    
ref|XP_006486836.1|  PREDICTED: tetraketide alpha-pyrone reductas...    125   5e-29    
ref|XP_006849957.1|  hypothetical protein AMTR_s00022p00142650          125   5e-29    
ref|XP_006422368.1|  hypothetical protein CICLE_v10028834mg             125   5e-29    
ref|XP_004236874.1|  PREDICTED: tetraketide alpha-pyrone reductase 1    125   5e-29    
ref|XP_007052474.1|  NAD(P)-binding Rossmann-fold superfamily pro...    126   6e-29    
ref|XP_011082327.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          125   6e-29    
ref|XP_003578338.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          125   7e-29    
ref|XP_002283345.2|  PREDICTED: tetraketide alpha-pyrone reductase 1    124   1e-28    
ref|XP_010548188.1|  PREDICTED: tetraketide alpha-pyrone reductas...    124   1e-28    
dbj|BAK03739.1|  predicted protein                                      124   1e-28    
ref|XP_011034793.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          124   1e-28    
ref|XP_009109293.1|  PREDICTED: tetraketide alpha-pyrone reductas...    124   1e-28    
ref|XP_003571608.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          124   2e-28    
gb|AFC36879.1|  tetraketide alpha-pyrone reductase 1                    124   2e-28    
ref|XP_007149029.1|  hypothetical protein PHAVU_005G034500g             124   2e-28    
ref|XP_009762377.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          123   2e-28    
ref|XP_002462592.1|  hypothetical protein SORBIDRAFT_02g028700          123   2e-28    
ref|XP_010028888.1|  PREDICTED: tetraketide alpha-pyrone reductase 1    123   3e-28    
ref|XP_009631380.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          123   3e-28    
emb|CDP14491.1|  unnamed protein product                                123   3e-28    
gb|EMS47475.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...    122   3e-28    
gb|EMT28388.1|  Dihydroflavonol-4-reductase                             123   3e-28    
ref|XP_004145235.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          123   3e-28    
ref|XP_004957228.1|  PREDICTED: tetraketide alpha-pyrone reductas...    123   3e-28    
ref|XP_008465156.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          122   4e-28    
ref|XP_006660477.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          122   4e-28    
gb|KCW66063.1|  hypothetical protein EUGRSUZ_G03351                     122   4e-28    
ref|XP_004139985.1|  PREDICTED: tetraketide alpha-pyrone reductas...    122   4e-28    
ref|XP_010092193.1|  Bifunctional dihydroflavonol 4-reductase/fla...    122   5e-28    
gb|KFK35854.1|  hypothetical protein AALP_AA4G045500                    122   6e-28    
emb|CDP19306.1|  unnamed protein product                                122   6e-28    
ref|XP_011078732.1|  PREDICTED: tetraketide alpha-pyrone reductas...    122   6e-28    
gb|AAD24584.3|AF134807_1  putative dihydroflavonol reductase            122   7e-28    
ref|XP_009606417.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          121   8e-28    
ref|XP_002523596.1|  cinnamoyl-CoA reductase, putative                  122   8e-28    
ref|XP_008363567.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          122   8e-28    
ref|XP_001769440.1|  predicted protein                                  122   9e-28    
ref|XP_010673674.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          121   9e-28    
gb|AAD53967.1|  aldehyde reductase                                      121   9e-28    
gb|EEC84809.1|  hypothetical protein OsI_31879                          121   1e-27    
ref|XP_010067832.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          121   1e-27    
gb|EMT23082.1|  Dihydroflavonol-4-reductase                             122   1e-27    
dbj|BAC78578.1|  dihydroflavonol reductase                              121   1e-27    
ref|XP_001751854.1|  predicted protein                                  121   1e-27    
ref|XP_007163918.1|  hypothetical protein PHAVU_L005700g                121   1e-27    
gb|EAY87967.1|  hypothetical protein OsI_09391                          121   1e-27    
ref|XP_011034796.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    121   1e-27    
gb|ABK24169.1|  unknown                                                 120   1e-27    
ref|XP_010690599.1|  PREDICTED: tetraketide alpha-pyrone reductase 1    121   1e-27    
gb|ABK21860.1|  unknown                                                 121   1e-27    
gb|EMT05980.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...    121   1e-27    
gb|AHG93972.1|  dihydroflavonol 4-reductase                             121   1e-27    
ref|NP_175552.2|  putative alcohol dehydrogenase                        121   1e-27    
gb|ABR21214.1|  CCR                                                     122   1e-27    
ref|XP_008382751.1|  PREDICTED: tetraketide alpha-pyrone reductase 1    121   2e-27    
dbj|BAA12161.1|  CPRD14 protein                                         121   2e-27    
ref|XP_009382856.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          121   2e-27    
ref|XP_008363357.1|  PREDICTED: cinnamoyl-CoA reductase 1               120   2e-27    
ref|NP_001242322.1|  uncharacterized protein LOC100809326               120   2e-27    
emb|CAD21520.1|  cinnamoyl CoA reductase                                121   2e-27    
ref|XP_010916354.1|  PREDICTED: tetraketide alpha-pyrone reductas...    120   2e-27    
gb|ACF17647.1|  putative cinnamoyl-CoA reductase                        120   2e-27    
ref|XP_010479624.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          120   2e-27    
emb|CDY24810.1|  BnaA08g15000D                                          120   2e-27    
gb|EMS54677.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...    120   2e-27    
emb|CBI40605.3|  unnamed protein product                                120   2e-27    
ref|NP_001063545.1|  Os09g0493500                                       121   2e-27    
dbj|BAJ88137.1|  predicted protein                                      120   2e-27    
ref|XP_009758397.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          120   2e-27    
ref|XP_008797849.1|  PREDICTED: tetraketide alpha-pyrone reductase 2    120   2e-27    
ref|XP_010323594.1|  PREDICTED: alcohol dehydrogenase-like isofor...    119   2e-27    
ref|XP_002963214.1|  hypothetical protein SELMODRAFT_80798              120   2e-27    
gb|EEC74212.1|  hypothetical protein OsI_09373                          120   2e-27    
ref|XP_002300620.2|  hypothetical protein POPTR_0002s00600g             120   3e-27    
ref|NP_001048460.1|  Os02g0808800                                       120   3e-27    
ref|NP_001234612.1|  cinnamoyl-CoA reductase                            120   3e-27    
gb|KDP22108.1|  hypothetical protein JCGZ_25939                         121   3e-27    
gb|ADU64758.1|  cinnamoyl-CoA reductase                                 120   3e-27    
ref|XP_011080359.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          120   3e-27    
emb|CAN71341.1|  hypothetical protein VITISV_002438                     120   3e-27    
ref|XP_003574536.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          120   4e-27    
ref|XP_009374930.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          120   4e-27    
ref|XP_007149032.1|  hypothetical protein PHAVU_005G034800g             120   4e-27    
ref|XP_009399556.1|  PREDICTED: cinnamoyl-CoA reductase 1               120   4e-27    
ref|XP_002981578.1|  hypothetical protein SELMODRAFT_233749             119   4e-27    
ref|XP_010067838.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    119   4e-27    
gb|ACI14382.1|  cinnamoyl-CoA reductase                                 120   4e-27    
gb|KCW66052.1|  hypothetical protein EUGRSUZ_G03342                     119   4e-27    
gb|EMS66440.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...    120   4e-27    
ref|XP_011091898.1|  PREDICTED: tetraketide alpha-pyrone reductas...    119   4e-27    
ref|NP_001048475.1|  Os02g0811400                                       120   4e-27    
ref|XP_004137661.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          119   4e-27    
ref|XP_006342181.1|  PREDICTED: cinnamoyl-CoA reductase 2               119   4e-27    
emb|CDY41656.1|  BnaC03g62280D                                          119   5e-27    
ref|XP_010500717.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          119   5e-27    
ref|XP_007043128.1|  Dihydroflavonol 4-reductase-like1                  120   5e-27    
ref|XP_008448150.1|  PREDICTED: tetraketide alpha-pyrone reductase 1    119   5e-27    
emb|CAJ43716.1|  cinnamoyl alcohol dehydrogenase                        119   5e-27    
ref|XP_010437474.1|  PREDICTED: tetraketide alpha-pyrone reductase 1    119   5e-27    
ref|NP_001234838.1|  alcohol dehydrogenase-like                         119   5e-27    
ref|XP_009794428.1|  PREDICTED: tetraketide alpha-pyrone reductas...    115   5e-27    
gb|KFK43250.1|  hypothetical protein AALP_AA1G099400                    118   5e-27    
ref|XP_006341347.1|  PREDICTED: cinnamoyl-CoA reductase 1 isoform X2    119   5e-27    
gb|EMT12003.1|  Dihydroflavonol-4-reductase                             119   6e-27    
ref|XP_007149030.1|  hypothetical protein PHAVU_005G034600g             119   6e-27    
ref|XP_003543630.1|  PREDICTED: tetraketide alpha-pyrone reductas...    119   6e-27    
ref|XP_010537872.1|  PREDICTED: cinnamoyl-CoA reductase 1               119   6e-27    
gb|KHN20640.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...    119   6e-27    
ref|XP_002978039.1|  hypothetical protein SELMODRAFT_228519             119   7e-27    
dbj|BAJ95974.1|  predicted protein                                      119   7e-27    
ref|XP_008361199.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          119   7e-27    
ref|XP_011088719.1|  PREDICTED: tetraketide alpha-pyrone reductase 1    119   7e-27    
ref|XP_010932148.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          119   7e-27    
ref|NP_001234297.1|  cinnamoyl-CoA reductase                            119   8e-27    
ref|XP_006393056.1|  hypothetical protein EUTSA_v10011653mg             119   8e-27    
dbj|BAG13450.2|  phenylacetaldehyde reductase                           119   8e-27    
gb|AGJ50590.1|  DFR1                                                    120   8e-27    
ref|XP_008651868.1|  PREDICTED: dihydroflavanoid reductase-like1 ...    119   8e-27    
gb|ACQ59094.1|  cinnamoyl-CoA reductase 4                               119   9e-27    
ref|XP_011088010.1|  PREDICTED: tetraketide alpha-pyrone reductas...    119   9e-27    
ref|XP_006649158.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          119   9e-27    
dbj|BAQ20438.1|  2-phenylethanol                                        119   9e-27    
gb|AIX92155.1|  cinnamoyl-CoA reductase 1                               119   1e-26    
gb|AAC06319.1|  putative cinnamyl alcohol dehydrogenase                 119   1e-26    
ref|XP_010067837.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    119   1e-26    
ref|NP_195268.2|  dihydroflavonol 4-reductase-like1                     118   1e-26    



>ref|XP_009769579.1| PREDICTED: dihydroflavonol-4-reductase-like [Nicotiana sylvestris]
Length=343

 Score =   430 bits (1105),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 222/344 (65%), Positives = 264/344 (77%), Gaps = 16/344 (5%)
 Frame = -1

Query  1118  ELSFALPVEPPRR------CASNVFSSHLWCRERKLVCVTSGNSYFGAHLIRKLLVRGYL  957
             E++ +LP+E  ++      C S+  S  L  R+RK+VCVTSGNSY G+HLI+KLL  GYL
Sbjct  2     EVTMSLPIELLKQRNDHGMCFSSDLSCSLNARDRKIVCVTSGNSYLGSHLIKKLLAYGYL  61

Query  956   VRATIQNQVDFeemkellreeemkqlESVVVARMTDLDCLCEAFRGCHAVFHTSSFIDPH  777
             VR TIQNQ + E+MKEL+RE   +   SVVVARM DLD LC AFRGCHA+FHTSSFIDPH
Sbjct  62    VRVTIQNQANLEDMKELMREGMEQLE-SVVVARMGDLDSLCSAFRGCHAIFHTSSFIDPH  120

Query  776   GISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTSSLLASIWKGNNHEHDDLDESSWT  597
             GISGYTER AFLETEAA NVIEAC + AY +RCIFTSSLLA IWKGN+   + +DES W+
Sbjct  121   GISGYTERTAFLETEAAKNVIEACGRAAYIKRCIFTSSLLACIWKGNDLP-NLIDESFWS  179

Query  596   DEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLK  417
             DE FCRENKLW ALAKTRAEK AW KA E KVKLV++CP L+MAPSFP+A  E+S+PYLK
Sbjct  180   DETFCRENKLWLALAKTRAEKTAWNKAREMKVKLVSLCPGLLMAPSFPNAHLETSIPYLK  239

Query  416   GGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLKM  237
             GG  MLRQG+LATEDV K AEAH++VYE+MDYGACGRY+CFG+ I T + A+ LEN L M
Sbjct  240   GGHFMLRQGLLATEDVSKVAEAHIYVYEDMDYGACGRYICFGKIIGTMQKAIQLENGLNM  299

Query  236   QGLLSAYE--------SGEIPARLCKSKLTRLLFHTARRLSCKH  129
              G LS  E        + EIP R+ KSKL+RLLF +++R SCK 
Sbjct  300   HGQLSGDENLLSVEVDNDEIPPRITKSKLSRLLFRSSQRRSCKQ  343



>ref|XP_009598071.1| PREDICTED: dihydroflavonol-4-reductase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=345

 Score =   429 bits (1104),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 224/346 (65%), Positives = 269/346 (78%), Gaps = 18/346 (5%)
 Frame = -1

Query  1118  ELSFALPVEPPRR------CASNVFSSHLWCRERKLVCVTSGNSYFGAHLIRKLLVRGYL  957
             E++ +LP+E P++      C +N FS  L  R+RK+VCVTSGNSYFG+HLI+KLLV GYL
Sbjct  2     EVAMSLPIELPKQRNDYGMCFANSFSCSLNARDRKIVCVTSGNSYFGSHLIKKLLVCGYL  61

Query  956   VRATIQNQVDFeemkellreeemkqlESVVVARMTDLDCLCEAFRGCHAVFHTSSFIDPH  777
             VR TIQNQ + E+MKEL+REE  +   SVVVA+M DL+ LC AFRGCHA+FHTSSFIDPH
Sbjct  62    VRVTIQNQANLEDMKELMREEMEQLE-SVVVAKMGDLESLCSAFRGCHAIFHTSSFIDPH  120

Query  776   GISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTSSLLASIWKGNNHEHDDLDESSWT  597
             GISGYTERMAFLETEAA NVIEAC + A  +RCIFTSSLLA IWKGN+   + +DESSW+
Sbjct  121   GISGYTERMAFLETEAAKNVIEACGRAACIKRCIFTSSLLACIWKGNDLP-NLIDESSWS  179

Query  596   DEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLK  417
             DE FCRENKLW ALAKTRAEK AW KA E KVKLV++CP L+MAPSFP+A  E+S+PYLK
Sbjct  180   DEAFCRENKLWLALAKTRAEKAAWNKAREMKVKLVSLCPGLLMAPSFPNAHLETSIPYLK  239

Query  416   GGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLKM  237
             GG  MLRQG+LATEDV K AEAH++VYE+MDYGACGRY+CFG+ I T E A+ LEN L M
Sbjct  240   GGHFMLRQGLLATEDVSKVAEAHIYVYEDMDYGACGRYICFGKIIGTLEKAIQLENGLNM  299

Query  236   QGLLSA--------YESGEIP--ARLCKSKLTRLLFHTARRLSCKH  129
              G LS          ++ EI    R+ KSKL+RL+F +++R SCK 
Sbjct  300   HGQLSGNQNLLAVEVDNDEIHPRTRITKSKLSRLIFRSSQRRSCKQ  345



>ref|XP_006338284.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Solanum 
tuberosum]
Length=343

 Score =   429 bits (1104),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 223/345 (65%), Positives = 265/345 (77%), Gaps = 18/345 (5%)
 Frame = -1

Query  1118  ELSFALPVEPPRRC-------ASNVFSSHLWCRERKLVCVTSGNSYFGAHLIRKLLVRGY  960
             +++ +L +EP ++        +S  F   L  R+RK+VCVTSGNSYFG+HLI+KLL  GY
Sbjct  2     DVAISLELEPLKQMNDHGMFFSSGNFICSLNARDRKIVCVTSGNSYFGSHLIKKLLAYGY  61

Query  959   LVRATIQNQVDFeemkellreeemkqlESVVVARMTDLDCLCEAFRGCHAVFHTSSFIDP  780
             LVR  IQNQ + E+MKEL+REE  +   SVVVARM DLD LC AFRGCH VFHTSSF+DP
Sbjct  62    LVRVIIQNQANLEDMKELMREEVKQLE-SVVVARMDDLDSLCNAFRGCHVVFHTSSFVDP  120

Query  779   HGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTSSLLASIWKGNNHEHDDLDESSW  600
              GISGYTERMAF+E EAA NVIEAC + AY +RCIFTSSLLA IWK  N   + +DESSW
Sbjct  121   RGISGYTERMAFIEAEAAKNVIEACGRAAYVKRCIFTSSLLACIWK--NDLPNLIDESSW  178

Query  599   TDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYL  420
             +DE FCRE+KLW ALAKTRAEKVAWRKA E KVKLVT+CP L+MAPSFP+A  E+SLPYL
Sbjct  179   SDETFCREHKLWLALAKTRAEKVAWRKAREMKVKLVTLCPGLLMAPSFPNAHLETSLPYL  238

Query  419   KGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLK  240
             KGG  MLRQG+LATEDV K AEAH++VYE+MDYGACGRY+CFG  + T E+A+ LEN L 
Sbjct  239   KGGYFMLRQGILATEDVSKVAEAHIYVYEDMDYGACGRYICFGNIVGTLEEAIQLENGLN  298

Query  239   MQGLLS--------AYESGEIPARLCKSKLTRLLFHTARRLSCKH  129
             + G LS        A E+ EIP R+ KSKL+RLLFH ++RL CKH
Sbjct  299   ISGHLSGDQSPLAVAVENNEIPPRITKSKLSRLLFHASQRLPCKH  343



>ref|XP_009598070.1| PREDICTED: dihydroflavonol-4-reductase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=346

 Score =   426 bits (1094),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 224/347 (65%), Positives = 269/347 (78%), Gaps = 19/347 (5%)
 Frame = -1

Query  1118  ELSFALPVEPPRR------CASNVFSSHLWCRERKLVCVTSGNSYFGAHLIRKLLVRGYL  957
             E++ +LP+E P++      C +N FS  L  R+RK+VCVTSGNSYFG+HLI+KLLV GYL
Sbjct  2     EVAMSLPIELPKQRNDYGMCFANSFSCSLNARDRKIVCVTSGNSYFGSHLIKKLLVCGYL  61

Query  956   VRATIQNQVDFeemkellreeemkqlESVVVARMTDLDCLCEAFRGCHAVFHTSSFIDPH  777
             VR TIQNQ + E+MKEL+REE  +   SVVVA+M DL+ LC AFRGCHA+FHTSSFIDPH
Sbjct  62    VRVTIQNQANLEDMKELMREEMEQLE-SVVVAKMGDLESLCSAFRGCHAIFHTSSFIDPH  120

Query  776   GISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTSSLLASIWKGNNHEHDDLDESSWT  597
             GISGYTERMAFLETEAA NVIEAC + A  +RCIFTSSLLA IWKGN+   + +DESSW+
Sbjct  121   GISGYTERMAFLETEAAKNVIEACGRAACIKRCIFTSSLLACIWKGNDLP-NLIDESSWS  179

Query  596   DEDFCRENK-LWFALAKTRAEKVAWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYL  420
             DE FCRENK LW ALAKTRAEK AW KA E KVKLV++CP L+MAPSFP+A  E+S+PYL
Sbjct  180   DEAFCRENKQLWLALAKTRAEKAAWNKAREMKVKLVSLCPGLLMAPSFPNAHLETSIPYL  239

Query  419   KGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLK  240
             KGG  MLRQG+LATEDV K AEAH++VYE+MDYGACGRY+CFG+ I T E A+ LEN L 
Sbjct  240   KGGHFMLRQGLLATEDVSKVAEAHIYVYEDMDYGACGRYICFGKIIGTLEKAIQLENGLN  299

Query  239   MQGLLSA--------YESGEIP--ARLCKSKLTRLLFHTARRLSCKH  129
             M G LS          ++ EI    R+ KSKL+RL+F +++R SCK 
Sbjct  300   MHGQLSGNQNLLAVEVDNDEIHPRTRITKSKLSRLIFRSSQRRSCKQ  346



>ref|XP_010316191.1| PREDICTED: dihydroflavonol-4-reductase-like isoform X1 [Solanum 
lycopersicum]
Length=344

 Score =   417 bits (1071),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 217/345 (63%), Positives = 258/345 (75%), Gaps = 17/345 (5%)
 Frame = -1

Query  1118  ELSFALPVEPPRR-------CASNVFSSHLWCRERKLVCVTSGNSYFGAHLIRKLLVRGY  960
             +++ +L +EP ++        +S  F   L  R+RK+VCVT GNSYFG+HLI+KLL  GY
Sbjct  2     DVAISLELEPLKQRNDHGMFFSSGNFICSLNARDRKIVCVTGGNSYFGSHLIKKLLAYGY  61

Query  959   LVRATIQNQVDFeemkellreeemkqlESVVVARMTDLDCLCEAFRGCHAVFHTSSFIDP  780
             LVR  IQNQV   E  + L  EEMKQLESVVVARM DLD LC AFRGCH VFHTSSFIDP
Sbjct  62    LVRVIIQNQVANLEDMKELMREEMKQLESVVVARMDDLDSLCNAFRGCHVVFHTSSFIDP  121

Query  779   HGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTSSLLASIWKGNNHEHDDLDESSW  600
              GISGYTERMAF+E EAA NVIEAC + A+ +RC+FTSSLLA IWK  N   + +DESSW
Sbjct  122   RGISGYTERMAFIEAEAAKNVIEACGRAAHVKRCVFTSSLLACIWK--NDLPNLIDESSW  179

Query  599   TDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYL  420
             +DE FCRE+KLW ALAKTRAEK AW KA E KVKLVTVCP L+MAPSFP+A  E+S+PYL
Sbjct  180   SDETFCREHKLWVALAKTRAEKAAWWKAREMKVKLVTVCPGLLMAPSFPNAHLETSVPYL  239

Query  419   KGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLK  240
             KGG  MLRQG LATED  K AEAH++VYE+MDYG CGRY+CFG+ + T E+A+ LEN L 
Sbjct  240   KGGDFMLRQGTLATEDASKVAEAHIYVYEDMDYGGCGRYICFGKIVGTLEEAIQLENGLN  299

Query  239   MQGLLSAYES--------GEIPARLCKSKLTRLLFHTARRLSCKH  129
             + G LS Y+S         EIP ++ KSKL+RLLFH ++RL CK 
Sbjct  300   IGGHLSGYQSPLAVAVDNNEIPPKITKSKLSRLLFHASQRLPCKQ  344



>ref|XP_004232099.1| PREDICTED: dihydroflavonol-4-reductase-like isoform X2 [Solanum 
lycopersicum]
Length=343

 Score =   414 bits (1063),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 215/345 (62%), Positives = 259/345 (75%), Gaps = 18/345 (5%)
 Frame = -1

Query  1118  ELSFALPVEPPRR-------CASNVFSSHLWCRERKLVCVTSGNSYFGAHLIRKLLVRGY  960
             +++ +L +EP ++        +S  F   L  R+RK+VCVT GNSYFG+HLI+KLL  GY
Sbjct  2     DVAISLELEPLKQRNDHGMFFSSGNFICSLNARDRKIVCVTGGNSYFGSHLIKKLLAYGY  61

Query  959   LVRATIQNQVDFeemkellreeemkqlESVVVARMTDLDCLCEAFRGCHAVFHTSSFIDP  780
             LVR  IQNQ + E+MKEL+REE  +   SVVVARM DLD LC AFRGCH VFHTSSFIDP
Sbjct  62    LVRVIIQNQANLEDMKELMREEMKQLE-SVVVARMDDLDSLCNAFRGCHVVFHTSSFIDP  120

Query  779   HGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTSSLLASIWKGNNHEHDDLDESSW  600
              GISGYTERMAF+E EAA NVIEAC + A+ +RC+FTSSLLA IWK  N   + +DESSW
Sbjct  121   RGISGYTERMAFIEAEAAKNVIEACGRAAHVKRCVFTSSLLACIWK--NDLPNLIDESSW  178

Query  599   TDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYL  420
             +DE FCRE+KLW ALAKTRAEK AW KA E KVKLVTVCP L+MAPSFP+A  E+S+PYL
Sbjct  179   SDETFCREHKLWVALAKTRAEKAAWWKAREMKVKLVTVCPGLLMAPSFPNAHLETSVPYL  238

Query  419   KGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLK  240
             KGG  MLRQG LATED  K AEAH++VYE+MDYG CGRY+CFG+ + T E+A+ LEN L 
Sbjct  239   KGGDFMLRQGTLATEDASKVAEAHIYVYEDMDYGGCGRYICFGKIVGTLEEAIQLENGLN  298

Query  239   MQGLLSAYES--------GEIPARLCKSKLTRLLFHTARRLSCKH  129
             + G LS Y+S         EIP ++ KSKL+RLLFH ++RL CK 
Sbjct  299   IGGHLSGYQSPLAVAVDNNEIPPKITKSKLSRLLFHASQRLPCKQ  343



>emb|CDP02392.1| unnamed protein product [Coffea canephora]
Length=365

 Score =   410 bits (1053),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 212/346 (61%), Positives = 261/346 (75%), Gaps = 19/346 (5%)
 Frame = -1

Query  1115  LSFALPVEP---------PRRCASNVFSSHLWCRERKLVCVTSGNSYFGAHLIRKLLVRG  963
             L+ + P EP          R+   + F+ + +  ER++VCVTS NS  GAHL +KLL RG
Sbjct  11    LAMSFPKEPLVLLNGEKADRKSVGSAFACYSYSPERRIVCVTSANSCLGAHLAKKLLARG  70

Query  962   YLVRATIQNQVDFeemkellreeemkqlESVVVARMTDLDCLCEAFRGCHAVFHTSSFID  783
             YLVR TIQN  ++E+MKELL EEE+ QLESVVVA+M D++ LC+AFRGCH +FHTSSFID
Sbjct  71    YLVRVTIQNPGNYEDMKELLNEEEISQLESVVVAKMGDVESLCDAFRGCHGIFHTSSFID  130

Query  782   PHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTSSLLASIWKGNNHE--HDDLDE  609
             P GISGYTERMAFLE E A NVIEAC + AY++RCIFTSSLLA+ WKG+ ++     +DE
Sbjct  131   PRGISGYTERMAFLEAEGARNVIEACGRAAYSKRCIFTSSLLATFWKGDENDIGQVKVDE  190

Query  608   SSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTVCPALVMAPSFPHADTESSL  429
               W+DEDFCRENKLW AL KTRAEKVAWRKA E KV LVT+CP+L+MAPSFP+A  E+S+
Sbjct  191   GCWSDEDFCRENKLWLALGKTRAEKVAWRKARELKVNLVTLCPSLLMAPSFPNAHVETSI  250

Query  428   PYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGRYLCFGRTITTPEDAVLLEN  249
             PYLKGGQ+M R+GVLATEDV++ AEAHV VY++MDYGACGRY+ +G+ IT  E+A+ LE 
Sbjct  251   PYLKGGQIMFRRGVLATEDVNEMAEAHVGVYQDMDYGACGRYISYGKIITILEEAIQLET  310

Query  248   RLKMQGLLSAYESG--------EIPARLCKSKLTRLLFHTARRLSC  135
              LKM GLLS   +G        EIP  L  SKLT+LL   +RR+SC
Sbjct  311   SLKMHGLLSGETAGQLVSGEADEIPPNLSNSKLTKLLDRASRRVSC  356



>ref|XP_007033396.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY04322.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=344

 Score =   408 bits (1048),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 205/335 (61%), Positives = 256/335 (76%), Gaps = 10/335 (3%)
 Frame = -1

Query  1109  FALPV-EPPRRCASNVFSSHLWCRERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQ  933
             F +PV    ++C  N+FSS L  RE+KL+CVTSGNSY G+ ++++LL R YLVR TIQ++
Sbjct  10    FLVPVLGKEQKCVGNIFSSSLSAREKKLICVTSGNSYLGSCIVKELLARSYLVRVTIQHE  69

Query  932   VDFeemkellreeemkqlESVVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTER  753
              +FE++K+L+  EE+  LESVVVA++ D + LC+AFRGCHAVFHTSSFIDPHGISGY+E+
Sbjct  70    AEFEDVKDLMGVEELNLLESVVVAKIEDSESLCDAFRGCHAVFHTSSFIDPHGISGYSEQ  129

Query  752   MAFLETEAAGNVIEACSKTAYARRCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCREN  573
             MAFLETE A NV++AC+K AY +RCIFTSSLLASIW+ +N +   +DES W+ E+FCREN
Sbjct  130   MAFLETEGARNVMKACAKAAYIKRCIFTSSLLASIWRNDNIDRT-IDESCWSSEEFCREN  188

Query  572   KLWFALAKTRAEKVAWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQ  393
             KLW AL  T+AEKVAW KA E KVKLVT+CP L+MAP+FP A  E+S+PYLKGGQ+ML+Q
Sbjct  189   KLWLALGNTKAEKVAWMKAGELKVKLVTLCPGLLMAPTFPTAHKETSIPYLKGGQIMLQQ  248

Query  392   GVLATEDVDKAAEAHVFVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYE  213
             G LA  DV K AEAHV VYE MDYGA GRY CF R +    +A+ LEN LKMQGLLS   
Sbjct  249   GYLAISDVKKVAEAHVHVYEAMDYGASGRYFCFERVVKRLNEAIELENGLKMQGLLSGER  308

Query  212   SG--------EIPARLCKSKLTRLLFHTARRLSCK  132
              G        EIP+++  SKL  LLF  ++RLSCK
Sbjct  309   HGLLSEDEGEEIPSKISNSKLATLLFQASQRLSCK  343



>ref|XP_002283020.3| PREDICTED: cinnamoyl-CoA reductase 2-like isoform X2 [Vitis vinifera]
Length=388

 Score =   409 bits (1052),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 216/354 (61%), Positives = 259/354 (73%), Gaps = 18/354 (5%)
 Frame = -1

Query  1139  MAME-CRNELSFALPV-------EPPRRCASNVFSSHLWCRERKLVCVTSGNSYFGAHLI  984
             M ME CR E+  + P+       E  R+C  N F S L  RERKLVCVTSGNSY  +H++
Sbjct  30    MIMENCREEVVLSKPLLLPSFKEEQQRKCVGNAFGSSLNARERKLVCVTSGNSYLSSHIV  89

Query  983   RKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTDLDCLCEAFRGCHAVF  804
             R+LL  GYLVR TIQ +VDF  M ELLR+EEM QLESVVVA+M DLD LC+AFRGCHAVF
Sbjct  90    RELLAGGYLVRVTIQKEVDFGVMNELLRDEEMNQLESVVVAKMGDLDSLCDAFRGCHAVF  149

Query  803   HTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTSSLLASIWKGNNHEH  624
             HTSSFID HG+SGY+E MAFLETEAA NVIEAC + AY +RC+FTSSLLASIW  ++   
Sbjct  150   HTSSFIDIHGVSGYSEWMAFLETEAARNVIEACCRAAYVKRCVFTSSLLASIWTDDDRT-  208

Query  623   DDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTVCPALVMAPSFPHAD  444
               +DES W+DE+FCR+ KLW A+ KT AEKVAW K+ E KVKLVTVCP L+MAPSFP+A 
Sbjct  209   GIIDESCWSDEEFCRDRKLWLAMGKTAAEKVAWSKSQEMKVKLVTVCPGLLMAPSFPNAH  268

Query  443   TESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGRYLCFGRTITTPEDA  264
             TE+S+PYLKGG++ML++GVLAT D+ K A+AHV VYEEMDYGACGRY CF R +   ++A
Sbjct  269   TETSVPYLKGGRMMLQRGVLATNDISKVAKAHVHVYEEMDYGACGRYFCFERVVRRLDEA  328

Query  263   VLLENRLKMQGLLSA---------YESGEIPARLCKSKLTRLLFHTARRLSCKH  129
             + LEN LKM G LS             GEI   L  SKL +L+   ++R SCK 
Sbjct  329   IQLENNLKMHGQLSGGGNLPSSTQETDGEIQISLSNSKLAKLMLRASQRSSCKQ  382



>emb|CBI16870.3| unnamed protein product [Vitis vinifera]
Length=370

 Score =   405 bits (1041),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 215/353 (61%), Positives = 258/353 (73%), Gaps = 18/353 (5%)
 Frame = -1

Query  1139  MAME-CRNELSFALPV-------EPPRRCASNVFSSHLWCRERKLVCVTSGNSYFGAHLI  984
             M ME CR E+  + P+       E  R+C  N F S L  RERKLVCVTSGNSY  +H++
Sbjct  1     MIMENCREEVVLSKPLLLPSFKEEQQRKCVGNAFGSSLNARERKLVCVTSGNSYLSSHIV  60

Query  983   RKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTDLDCLCEAFRGCHAVF  804
             R+LL  GYLVR TIQ +VDF  M ELLR+EEM QLESVVVA+M DLD LC+AFRGCHAVF
Sbjct  61    RELLAGGYLVRVTIQKEVDFGVMNELLRDEEMNQLESVVVAKMGDLDSLCDAFRGCHAVF  120

Query  803   HTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTSSLLASIWKGNNHEH  624
             HTSSFID HG+SGY+E MAFLETEAA NVIEAC + AY +RC+FTSSLLASIW  ++   
Sbjct  121   HTSSFIDIHGVSGYSEWMAFLETEAARNVIEACCRAAYVKRCVFTSSLLASIWTDDDRT-  179

Query  623   DDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTVCPALVMAPSFPHAD  444
               +DES W+DE+FCR+ KLW A+ KT AEKVAW K+ E KVKLVTVCP L+MAPSFP+A 
Sbjct  180   GIIDESCWSDEEFCRDRKLWLAMGKTAAEKVAWSKSQEMKVKLVTVCPGLLMAPSFPNAH  239

Query  443   TESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGRYLCFGRTITTPEDA  264
             TE+S+PYLKGG++ML++GVLAT D+ K A+AHV VYEEMDYGACGRY CF R +   ++A
Sbjct  240   TETSVPYLKGGRMMLQRGVLATNDISKVAKAHVHVYEEMDYGACGRYFCFERVVRRLDEA  299

Query  263   VLLENRLKMQGLLSA---------YESGEIPARLCKSKLTRLLFHTARRLSCK  132
             + LEN LKM G LS             GEI   L  SKL +L+   ++R S K
Sbjct  300   IQLENNLKMHGQLSGGGNLPSSTQETDGEIQISLSNSKLAKLMLRASQRSSWK  352



>ref|XP_010660512.1| PREDICTED: cinnamoyl-CoA reductase 2-like isoform X1 [Vitis vinifera]
Length=389

 Score =   405 bits (1041),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 216/355 (61%), Positives = 259/355 (73%), Gaps = 19/355 (5%)
 Frame = -1

Query  1139  MAME-CRNELSFALPV-------EPPRRCASNVFSSHLWCRERKLVCVTSGNSYFGAHLI  984
             M ME CR E+  + P+       E  R+C  N F S L  RERKLVCVTSGNSY  +H++
Sbjct  30    MIMENCREEVVLSKPLLLPSFKEEQQRKCVGNAFGSSLNARERKLVCVTSGNSYLSSHIV  89

Query  983   RKLLVRGYLVRATIQNQ-VDFeemkellreeemkqlESVVVARMTDLDCLCEAFRGCHAV  807
             R+LL  GYLVR TIQ + VDF  M ELLR+EEM QLESVVVA+M DLD LC+AFRGCHAV
Sbjct  90    RELLAGGYLVRVTIQKEAVDFGVMNELLRDEEMNQLESVVVAKMGDLDSLCDAFRGCHAV  149

Query  806   FHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTSSLLASIWKGNNHE  627
             FHTSSFID HG+SGY+E MAFLETEAA NVIEAC + AY +RC+FTSSLLASIW  ++  
Sbjct  150   FHTSSFIDIHGVSGYSEWMAFLETEAARNVIEACCRAAYVKRCVFTSSLLASIWTDDDRT  209

Query  626   HDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTVCPALVMAPSFPHA  447
                +DES W+DE+FCR+ KLW A+ KT AEKVAW K+ E KVKLVTVCP L+MAPSFP+A
Sbjct  210   -GIIDESCWSDEEFCRDRKLWLAMGKTAAEKVAWSKSQEMKVKLVTVCPGLLMAPSFPNA  268

Query  446   DTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGRYLCFGRTITTPED  267
              TE+S+PYLKGG++ML++GVLAT D+ K A+AHV VYEEMDYGACGRY CF R +   ++
Sbjct  269   HTETSVPYLKGGRMMLQRGVLATNDISKVAKAHVHVYEEMDYGACGRYFCFERVVRRLDE  328

Query  266   AVLLENRLKMQGLLSA---------YESGEIPARLCKSKLTRLLFHTARRLSCKH  129
             A+ LEN LKM G LS             GEI   L  SKL +L+   ++R SCK 
Sbjct  329   AIQLENNLKMHGQLSGGGNLPSSTQETDGEIQISLSNSKLAKLMLRASQRSSCKQ  383



>ref|XP_011021181.1| PREDICTED: cinnamoyl-CoA reductase 2-like isoform X2 [Populus 
euphratica]
Length=344

 Score =   401 bits (1031),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/316 (64%), Positives = 248/316 (78%), Gaps = 6/316 (2%)
 Frame = -1

Query  1064  FSSHLWCRERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemk  885
             FSS L  RE KLVCVT GNS+ G+H++++LL RGYLVR TIQNQVDFE++K  ++E++M 
Sbjct  31    FSSCLNARENKLVCVTDGNSFLGSHIVKELLSRGYLVRVTIQNQVDFEDLKGQMKEDDMN  90

Query  884   qlESVVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEAC  705
             +LESVVVA+M DL+ LC+AFRGCHAVFHTSSF+DPHGISGY+E+MAFLETE A NVIEAC
Sbjct  91    KLESVVVAKMKDLESLCDAFRGCHAVFHTSSFVDPHGISGYSEQMAFLETEGARNVIEAC  150

Query  704   SKTAYARRCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAW  525
             S+ AY RRCIFTSSLLASIW  +N +   +DES W+ E+FCRENKLW AL K RAE++AW
Sbjct  151   SRAAYIRRCIFTSSLLASIWTSSNLDRV-VDESCWSSEEFCRENKLWLALGKVRAEEIAW  209

Query  524   RKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHV  345
             RK+ E KV+LVTVCP L++A SFPHA  E+S+PYLKGG +MLRQG+L   DV K AEAHV
Sbjct  210   RKSKELKVRLVTVCPGLLIATSFPHAHKETSIPYLKGGPIMLRQGLLGLSDVRKVAEAHV  269

Query  344   FVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESG----EIPARLCKSK  177
              VYE MD GACGRY+CF R +   ++A+ LEN L +QGL+S   SG    EI + L  SK
Sbjct  270   HVYEAMDNGACGRYICFERVVQRLDEAIQLENELNIQGLVSGGRSGILSEEIHSNLSNSK  329

Query  176   LTRLLFHTARRLSCKH  129
             L RLL H A ++SC  
Sbjct  330   LARLL-HQASQISCNQ  344



>ref|XP_011021184.1| PREDICTED: cinnamoyl-CoA reductase 2-like isoform X2 [Populus 
euphratica]
Length=344

 Score =   400 bits (1029),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 202/316 (64%), Positives = 248/316 (78%), Gaps = 6/316 (2%)
 Frame = -1

Query  1064  FSSHLWCRERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemk  885
             FSS L  RE KLVCVT GNS+ G+H++++LL RGYLVR TIQNQVDFE++K  ++E++M 
Sbjct  31    FSSCLNARENKLVCVTDGNSFLGSHIVKELLSRGYLVRVTIQNQVDFEDLKGQMKEDDMN  90

Query  884   qlESVVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEAC  705
             +LESVVVA+M D++ LC+AFRGCHAVFHTSSF+DPHGISGY+E+MAFLETE A NVIEAC
Sbjct  91    KLESVVVAKMKDMESLCDAFRGCHAVFHTSSFVDPHGISGYSEQMAFLETEGARNVIEAC  150

Query  704   SKTAYARRCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAW  525
             S+ AY RRCIFTSSLLASIW  +N +   +DES W+ E+FCRENKLW AL K RAE++AW
Sbjct  151   SRAAYIRRCIFTSSLLASIWTSSNLDRV-VDESCWSSEEFCRENKLWLALGKVRAEEIAW  209

Query  524   RKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHV  345
             RK+ E KV+LVTVCP L++A SFPHA  E+S+PYLKGG +MLRQG+L   DV K AEAHV
Sbjct  210   RKSKELKVRLVTVCPGLLIATSFPHAHKETSIPYLKGGPIMLRQGLLGLSDVRKVAEAHV  269

Query  344   FVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESG----EIPARLCKSK  177
              VYE MD GACGRY+CF R +   ++A+ LEN L +QGL+S   SG    EI + L  SK
Sbjct  270   HVYEAMDNGACGRYICFERVVQRLDEAIQLENELNIQGLVSGGRSGILSEEIHSNLSNSK  329

Query  176   LTRLLFHTARRLSCKH  129
             L RLL H A ++SC  
Sbjct  330   LARLL-HQASQISCNQ  344



>ref|XP_006373476.1| hypothetical protein POPTR_0017s14130g [Populus trichocarpa]
 gb|ERP51273.1| hypothetical protein POPTR_0017s14130g [Populus trichocarpa]
Length=344

 Score =   399 bits (1026),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 201/316 (64%), Positives = 248/316 (78%), Gaps = 6/316 (2%)
 Frame = -1

Query  1064  FSSHLWCRERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemk  885
             FSS L  RE KLVCVT GNS+ G+H++++LL RGYLVR TIQNQVDFE++K  ++E++M 
Sbjct  31    FSSCLNARENKLVCVTDGNSFLGSHIVKELLSRGYLVRVTIQNQVDFEDLKGQMKEDDMN  90

Query  884   qlESVVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEAC  705
             +LESVVVA+M DL+ LC+AFRGCHAVFHTSSF+DPHGISGY+E+MAFLETE A NVIEAC
Sbjct  91    KLESVVVAKMKDLESLCDAFRGCHAVFHTSSFVDPHGISGYSEQMAFLETEGARNVIEAC  150

Query  704   SKTAYARRCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAW  525
             S+ AY RRCIFTSSLLASIW  +N +   +DES W+ E+FCRENKLW AL K RAE++AW
Sbjct  151   SRAAYIRRCIFTSSLLASIWTSSNLDRV-VDESCWSSEEFCRENKLWLALGKVRAEEIAW  209

Query  524   RKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHV  345
             RK+ E KV+LVTVCP L++A SFPHA  E+S+PYLKGG +MLRQG+L   DV K AEAHV
Sbjct  210   RKSKELKVRLVTVCPGLLIATSFPHAHKETSIPYLKGGPIMLRQGLLGISDVRKVAEAHV  269

Query  344   FVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESG----EIPARLCKSK  177
              VYE MD GACGRY+C+ R +   ++A+ LEN L +QGL+S   SG    EI + L  SK
Sbjct  270   HVYEAMDNGACGRYICYERVVQRLDEAIQLENELNIQGLVSGGRSGILSEEIHSNLSNSK  329

Query  176   LTRLLFHTARRLSCKH  129
             L RLL+  A ++SC  
Sbjct  330   LARLLYQ-ASQMSCNQ  344



>ref|XP_011021180.1| PREDICTED: cinnamoyl-CoA reductase 2-like isoform X1 [Populus 
euphratica]
Length=345

 Score =   396 bits (1018),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 203/317 (64%), Positives = 248/317 (78%), Gaps = 7/317 (2%)
 Frame = -1

Query  1064  FSSHLWCRERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQ-VDFeemkellreeem  888
             FSS L  RE KLVCVT GNS+ G+H++++LL RGYLVR TIQNQ VDFE++K  ++E++M
Sbjct  31    FSSCLNARENKLVCVTDGNSFLGSHIVKELLSRGYLVRVTIQNQAVDFEDLKGQMKEDDM  90

Query  887   kqlESVVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEA  708
              +LESVVVA+M DL+ LC+AFRGCHAVFHTSSF+DPHGISGY+E+MAFLETE A NVIEA
Sbjct  91    NKLESVVVAKMKDLESLCDAFRGCHAVFHTSSFVDPHGISGYSEQMAFLETEGARNVIEA  150

Query  707   CSKTAYARRCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVA  528
             CS+ AY RRCIFTSSLLASIW  +N +   +DES W+ E+FCRENKLW AL K RAE++A
Sbjct  151   CSRAAYIRRCIFTSSLLASIWTSSNLDRV-VDESCWSSEEFCRENKLWLALGKVRAEEIA  209

Query  527   WRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAH  348
             WRK+ E KV+LVTVCP L++A SFPHA  E+S+PYLKGG +MLRQG+L   DV K AEAH
Sbjct  210   WRKSKELKVRLVTVCPGLLIATSFPHAHKETSIPYLKGGPIMLRQGLLGLSDVRKVAEAH  269

Query  347   VFVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESG----EIPARLCKS  180
             V VYE MD GACGRY+CF R +   ++A+ LEN L +QGL+S   SG    EI + L  S
Sbjct  270   VHVYEAMDNGACGRYICFERVVQRLDEAIQLENELNIQGLVSGGRSGILSEEIHSNLSNS  329

Query  179   KLTRLLFHTARRLSCKH  129
             KL RLL H A ++SC  
Sbjct  330   KLARLL-HQASQISCNQ  345



>ref|XP_011021183.1| PREDICTED: cinnamoyl-CoA reductase 2-like isoform X1 [Populus 
euphratica]
Length=345

 Score =   395 bits (1016),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 202/317 (64%), Positives = 248/317 (78%), Gaps = 7/317 (2%)
 Frame = -1

Query  1064  FSSHLWCRERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQ-VDFeemkellreeem  888
             FSS L  RE KLVCVT GNS+ G+H++++LL RGYLVR TIQNQ VDFE++K  ++E++M
Sbjct  31    FSSCLNARENKLVCVTDGNSFLGSHIVKELLSRGYLVRVTIQNQAVDFEDLKGQMKEDDM  90

Query  887   kqlESVVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEA  708
              +LESVVVA+M D++ LC+AFRGCHAVFHTSSF+DPHGISGY+E+MAFLETE A NVIEA
Sbjct  91    NKLESVVVAKMKDMESLCDAFRGCHAVFHTSSFVDPHGISGYSEQMAFLETEGARNVIEA  150

Query  707   CSKTAYARRCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVA  528
             CS+ AY RRCIFTSSLLASIW  +N +   +DES W+ E+FCRENKLW AL K RAE++A
Sbjct  151   CSRAAYIRRCIFTSSLLASIWTSSNLDRV-VDESCWSSEEFCRENKLWLALGKVRAEEIA  209

Query  527   WRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAH  348
             WRK+ E KV+LVTVCP L++A SFPHA  E+S+PYLKGG +MLRQG+L   DV K AEAH
Sbjct  210   WRKSKELKVRLVTVCPGLLIATSFPHAHKETSIPYLKGGPIMLRQGLLGLSDVRKVAEAH  269

Query  347   VFVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESG----EIPARLCKS  180
             V VYE MD GACGRY+CF R +   ++A+ LEN L +QGL+S   SG    EI + L  S
Sbjct  270   VHVYEAMDNGACGRYICFERVVQRLDEAIQLENELNIQGLVSGGRSGILSEEIHSNLSNS  329

Query  179   KLTRLLFHTARRLSCKH  129
             KL RLL H A ++SC  
Sbjct  330   KLARLL-HQASQISCNQ  345



>ref|XP_008230373.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Prunus mume]
Length=342

 Score =   395 bits (1014),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 208/328 (63%), Positives = 255/328 (78%), Gaps = 8/328 (2%)
 Frame = -1

Query  1103  LPVEPPRRCASNVFSSHLWCRERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDF  924
             L  E  + C +N FS     RERKLVCVTSGNS  G+H+++ LL RGYLVR TIQNQVD+
Sbjct  19    LREEEQKVCVNNAFSCGSDARERKLVCVTSGNSNLGSHIVKALLARGYLVRVTIQNQVDY  78

Query  923   eemkellreeemkqlESVVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAF  744
             E+MK+L+R+EE+ QLE VVVA+M  LD LCEAFRGCHA+FHTSSFIDPHGISGY+E+MAF
Sbjct  79    EDMKKLMRDEEINQLEGVVVAKMGTLDSLCEAFRGCHAIFHTSSFIDPHGISGYSEQMAF  138

Query  743   LETEAAGNVIEACSKTAYARRCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLW  564
             LE EAA NVIEAC + AYA+RCIFTSSLLA+IW G+N E+  +DE SWT+E+FCRENKLW
Sbjct  139   LEAEAARNVIEACGRAAYAKRCIFTSSLLAAIWTGDN-ENKIIDEFSWTNEEFCRENKLW  197

Query  563   FALAKTRAEKVAWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVL  384
              AL KT AE   WRK+ E KV LVTVCP L+M  SFP+A+  +S+PYLKGG+VML+ G L
Sbjct  198   LALGKTTAEMTCWRKSKEMKVNLVTVCPGLLMDASFPNAN--NSVPYLKGGKVMLKHGHL  255

Query  383   ATEDVDKAAEAHVFVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSA--YES  210
             A ED  KAAEAHV+VYE MDYGACGRYLC+G+ +    +A+ LEN LK+ GLLS   +E+
Sbjct  256   AVEDAKKAAEAHVYVYEAMDYGACGRYLCYGKVVRKMSEAIELENGLKIHGLLSGGRHEA  315

Query  209   --GEIPARLCKSKLTRLLFHTARRLSCK  132
                EI + L  +KL RL+   +++LSCK
Sbjct  316   LDEEIHSMLSNAKLVRLI-RGSQKLSCK  342



>ref|XP_011046780.1| PREDICTED: cinnamoyl-CoA reductase 2-like isoform X2 [Populus 
euphratica]
Length=340

 Score =   388 bits (997),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 204/326 (63%), Positives = 243/326 (75%), Gaps = 7/326 (2%)
 Frame = -1

Query  1094  EPPRRCASNVFSSHLWCRERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeem  915
             E  + C      S L   E KLVCVT GNS+ G+H++++LL RG+LVR T+ NQVDFE++
Sbjct  18    EEGKPCIGKKIISSLKAGENKLVCVTDGNSFLGSHIVKELLSRGHLVRVTVHNQVDFEDL  77

Query  914   kellreeemkqlESVVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLET  735
             K L++EE+M +LESVVVA+M DLD LC+AF GCHAVFHTSSF+DPHGISGY+E+MAFLET
Sbjct  78    KGLIKEEDMNKLESVVVAKMKDLDSLCDAFSGCHAVFHTSSFVDPHGISGYSEQMAFLET  137

Query  734   EAAGNVIEACSKTAYARRCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFAL  555
             E A NVIEAC + AY RRCIFTSSLLASIW  +N +   +DES W+ E+FCRENKLW AL
Sbjct  138   EGARNVIEACGRAAYRRRCIFTSSLLASIWTSSNLDRV-IDESCWSSEEFCRENKLWLAL  196

Query  554   AKTRAEKVAWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATE  375
              K RAEK+AWRK+ E KVKLVTVCP L++    PH   ESS PYLKGG +MLRQG+LA  
Sbjct  197   GKMRAEKIAWRKSKEMKVKLVTVCPGLLIDSLIPHDHKESSFPYLKGGSIMLRQGLLALA  256

Query  374   DVDKAAEAHVFVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYE----SG  207
             DV K AEAHV VYE+MD GA GRYLCF R +   ++A+ LEN LKMQGLLSA      S 
Sbjct  257   DVGKVAEAHVRVYEDMDNGAHGRYLCFERVVQRLDEAIQLENELKMQGLLSAGTSRIISE  316

Query  206   EIPARLCKSKLTRLLFHTARRLSCKH  129
             EI + L  SKL RLLF  A R+SC  
Sbjct  317   EIQSNLSNSKLNRLLF--APRMSCNQ  340



>ref|XP_011046779.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Populus 
euphratica]
Length=341

 Score =   384 bits (985),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 204/327 (62%), Positives = 243/327 (74%), Gaps = 8/327 (2%)
 Frame = -1

Query  1094  EPPRRCASNVFSSHLWCRERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQ-VDFee  918
             E  + C      S L   E KLVCVT GNS+ G+H++++LL RG+LVR T+ NQ VDFE+
Sbjct  18    EEGKPCIGKKIISSLKAGENKLVCVTDGNSFLGSHIVKELLSRGHLVRVTVHNQAVDFED  77

Query  917   mkellreeemkqlESVVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLE  738
             +K L++EE+M +LESVVVA+M DLD LC+AF GCHAVFHTSSF+DPHGISGY+E+MAFLE
Sbjct  78    LKGLIKEEDMNKLESVVVAKMKDLDSLCDAFSGCHAVFHTSSFVDPHGISGYSEQMAFLE  137

Query  737   TEAAGNVIEACSKTAYARRCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFA  558
             TE A NVIEAC + AY RRCIFTSSLLASIW  +N +   +DES W+ E+FCRENKLW A
Sbjct  138   TEGARNVIEACGRAAYRRRCIFTSSLLASIWTSSNLDRV-IDESCWSSEEFCRENKLWLA  196

Query  557   LAKTRAEKVAWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLAT  378
             L K RAEK+AWRK+ E KVKLVTVCP L++    PH   ESS PYLKGG +MLRQG+LA 
Sbjct  197   LGKMRAEKIAWRKSKEMKVKLVTVCPGLLIDSLIPHDHKESSFPYLKGGSIMLRQGLLAL  256

Query  377   EDVDKAAEAHVFVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYE----S  210
              DV K AEAHV VYE+MD GA GRYLCF R +   ++A+ LEN LKMQGLLSA      S
Sbjct  257   ADVGKVAEAHVRVYEDMDNGAHGRYLCFERVVQRLDEAIQLENELKMQGLLSAGTSRIIS  316

Query  209   GEIPARLCKSKLTRLLFHTARRLSCKH  129
              EI + L  SKL RLLF  A R+SC  
Sbjct  317   EEIQSNLSNSKLNRLLF--APRMSCNQ  341



>ref|XP_002533639.1| cinnamoyl-CoA reductase, putative [Ricinus communis]
 gb|EEF28742.1| cinnamoyl-CoA reductase, putative [Ricinus communis]
Length=341

 Score =   383 bits (983),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 197/327 (60%), Positives = 239/327 (73%), Gaps = 8/327 (2%)
 Frame = -1

Query  1088  PRRCASN--VFSSHLWCRERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeem  915
             P  C  N   F S L   + KLVCVTSGNSY GA++++KLL  G LVR TIQNQVD E+M
Sbjct  16    PSHCFGNGGAFGSSLIAGDNKLVCVTSGNSYLGANIVKKLLANGSLVRVTIQNQVDLEDM  75

Query  914   kellreeemkqlESVVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLET  735
             + L+ +EE+ +LESV+VA+M DLD LC  F GCHA+FHTSSFIDPHGISGY+E+MA+LET
Sbjct  76    RCLISDEELNKLESVMVAKMQDLDSLCAVFSGCHAIFHTSSFIDPHGISGYSEQMAYLET  135

Query  734   EAAGNVIEACSKTAYARRCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFAL  555
             E A NVIEACS+ AY RRCIFTSSLLAS+W G+N  +  +DES W+ E+FCRENKLW AL
Sbjct  136   EVAKNVIEACSRAAYIRRCIFTSSLLASVWIGDNL-NTAIDESCWSSEEFCRENKLWLAL  194

Query  554   AKTRAEKVAWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATE  375
              KTRAE+ AW+K+ E KVKLVT+CP L+MAP FPHA  E S PY+KGG  MLRQG+LAT 
Sbjct  195   GKTRAEQAAWKKSKELKVKLVTLCPGLLMAPLFPHAHKEVSFPYIKGGSHMLRQGILATA  254

Query  374   DVDKAAEAHVFVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAY-----ES  210
             DV K AEAHV VYE MD GACGRYLCF + I   ++A+ LE  LK  GL         ++
Sbjct  255   DVSKVAEAHVHVYEAMDDGACGRYLCFDKIIKRLDEAIQLETELKKHGLQPGSLVLPEDT  314

Query  209   GEIPARLCKSKLTRLLFHTARRLSCKH  129
              EI + +  SKL +LLF   +  SC+ 
Sbjct  315   EEIHSNVSNSKLAKLLFQVCQGKSCRQ  341



>ref|XP_002305963.2| hypothetical protein POPTR_0004s10470g [Populus trichocarpa]
 gb|EEE86474.2| hypothetical protein POPTR_0004s10470g [Populus trichocarpa]
Length=337

 Score =   382 bits (982),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 201/326 (62%), Positives = 243/326 (75%), Gaps = 7/326 (2%)
 Frame = -1

Query  1094  EPPRRCASNVFSSHLWCRERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeem  915
             E  + C   + SS L   E KLVCVT GNS+ G+H++++LL RG+LVR T+ NQVDFE++
Sbjct  15    EEGKPCGKKIISS-LKAGENKLVCVTDGNSFLGSHIVKELLSRGHLVRVTVHNQVDFEDL  73

Query  914   kellreeemkqlESVVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLET  735
             K L++EE+M +LESVVVA+M DLD LC+AF GCHAVFHTSSF+DPHGI+GY+E+MAFLET
Sbjct  74    KGLIKEEDMNKLESVVVAKMKDLDSLCDAFSGCHAVFHTSSFLDPHGITGYSEQMAFLET  133

Query  734   EAAGNVIEACSKTAYARRCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFAL  555
             E A NVIEAC + AY RRCIFTSSLLAS W  +N +   +DES W+ E+FCRENKLW AL
Sbjct  134   EGARNVIEACGRAAYRRRCIFTSSLLASTWTSSNLDRV-IDESCWSSEEFCRENKLWLAL  192

Query  554   AKTRAEKVAWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATE  375
              K RAEK+AWRK+ E KVKLVTVCP L++  SFPH   E+S PYLKGG +MLRQG+LA  
Sbjct  193   GKMRAEKIAWRKSKEMKVKLVTVCPGLLIDSSFPHDHKETSFPYLKGGSIMLRQGLLALA  252

Query  374   DVDKAAEAHVFVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYE----SG  207
             DV K AEAHV VYE MD GA GRYLCF R +   ++A+ LEN LK+QGLLS       S 
Sbjct  253   DVGKVAEAHVRVYEAMDNGAYGRYLCFERVVQRLDEAIQLENELKIQGLLSEGTSRIISE  312

Query  206   EIPARLCKSKLTRLLFHTARRLSCKH  129
             EI + L  SKL RLLF  A  +SC  
Sbjct  313   EIQSNLSNSKLNRLLF-AAPHMSCNQ  337



>ref|XP_009357017.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Pyrus x bretschneideri]
Length=346

 Score =   381 bits (979),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 199/330 (60%), Positives = 245/330 (74%), Gaps = 10/330 (3%)
 Frame = -1

Query  1094  EPPRRCASNVFSSHLWCRERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeem  915
             E  + C  N FS  L  R+R+LVCVTSGNS+ G+H++R LL RGYLVR TIQN+VDFE+M
Sbjct  18    EEHKICVKNAFSCSLDARDRRLVCVTSGNSHLGSHIVRALLARGYLVRVTIQNEVDFEDM  77

Query  914   kellreeemkqlESVVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLET  735
             K+L+R EE+ QLE VVVA+M DLD LC+AFRGCHA+FHTSSFIDPHG SGY+E+MAFLET
Sbjct  78    KKLMRGEEISQLECVVVAKMGDLDNLCDAFRGCHAIFHTSSFIDPHGTSGYSEKMAFLET  137

Query  734   EAAGNVIEACSKTAYARRCIFTSSLLASIWKGNNHEHDDL-DESSWTDEDFCRENKLWFA  558
             E A NVIEAC + AYA+RCIFTSSLLA+IW G N+E   + DE SWT+ +FCRENKLW A
Sbjct  138   EGARNVIEACGRAAYAKRCIFTSSLLAAIWTGENYEEKKIIDEHSWTNVEFCRENKLWLA  197

Query  557   LAKTRAEKVAWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLAT  378
             L KT AE   WRK+ E KV LVTVCP L+M  S P+A   +S+PYLKGG+ ML+ G LA 
Sbjct  198   LGKTTAEMACWRKSKEMKVNLVTVCPGLLMDASHPNAPISTSIPYLKGGKTMLKHGRLAV  257

Query  377   EDVDKAAEAHVFVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSA-------  219
             +DV KAA+AHV VYE MD+GA GRYL FG+ +T   +A+ LEN LK+ GLLS        
Sbjct  258   DDVKKAAKAHVCVYEAMDHGASGRYLSFGKVVTKMAEAIELENGLKIHGLLSGEGLEDLG  317

Query  218   -YESGEIPARLCKSKLTRLLFHTARRLSCK  132
                  E+ + L  +KL RL+   +++LSCK
Sbjct  318   EETDEELQSMLSNAKLARLI-GASQKLSCK  346



>ref|XP_008379511.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Malus domestica]
Length=346

 Score =   381 bits (979),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 199/330 (60%), Positives = 244/330 (74%), Gaps = 10/330 (3%)
 Frame = -1

Query  1094  EPPRRCASNVFSSHLWCRERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeem  915
             E  + C  N FS  L  R+R+LVCVTSGNS+ G++++R LL RGYLVR TIQN+VDFE+M
Sbjct  18    EEHKICVKNAFSCSLDARDRRLVCVTSGNSHLGSNIVRALLARGYLVRVTIQNEVDFEDM  77

Query  914   kellreeemkqlESVVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLET  735
             K+L+R EE+ QLE VVVA+M DL+ LC+AFRGCHA+FHTSSFIDPHGISGY+E+MAFLET
Sbjct  78    KKLMRGEEISQLECVVVAKMGDLNSLCDAFRGCHAIFHTSSFIDPHGISGYSEKMAFLET  137

Query  734   EAAGNVIEACSKTAYARRCIFTSSLLASIWKGNNHEHDDL-DESSWTDEDFCRENKLWFA  558
             E A NVIEAC + AYA+RCIFTSSLLA+IW G N+E   + DE SWT+ DFCRENKLW A
Sbjct  138   EGARNVIEACGRAAYAKRCIFTSSLLAAIWTGENYEEKKIIDEYSWTNVDFCRENKLWLA  197

Query  557   LAKTRAEKVAWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLAT  378
             L KT AE   WRK+ E KV LVTVCP L+M  S P+A   +S+PYLKGG+ M + G LA 
Sbjct  198   LGKTTAEMACWRKSKEMKVNLVTVCPGLLMDASHPNAHISTSIPYLKGGKAMFKHGRLAV  257

Query  377   EDVDKAAEAHVFVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSA-------  219
             EDV KAAE HV VYE MD+GA GRYL FG+ +T   +A+ LEN LK+ GLLS        
Sbjct  258   EDVKKAAEXHVCVYEAMDHGAGGRYLSFGKVVTKMAEAIELENGLKIHGLLSGEGLEDLG  317

Query  218   -YESGEIPARLCKSKLTRLLFHTARRLSCK  132
                  E+ + L  +KL RL+   +++LSCK
Sbjct  318   EETDEEVQSMLSNAKLARLI-GASQKLSCK  346



>gb|KDP24364.1| hypothetical protein JCGZ_25660 [Jatropha curcas]
Length=340

 Score =   373 bits (958),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 195/325 (60%), Positives = 243/325 (75%), Gaps = 4/325 (1%)
 Frame = -1

Query  1094  EPPRRCASNVFS-SHLWCRERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFee  918
             E    C    F+ S+L  RE KLVCVTSGNS+ G+H+++KLL  GYLVR TIQNQVDFE+
Sbjct  17    EEEIHCIGRAFNGSNLLARENKLVCVTSGNSFLGSHIVKKLLADGYLVRVTIQNQVDFED  76

Query  917   mkellreeemkqlESVVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLE  738
             M+ L+++EE+ +LE+VVVA+M DL  LC+AFRGCHA+FHTSSFID HG+SGY+E+MAFLE
Sbjct  77    MRALMKDEEITKLENVVVAKMQDLGSLCDAFRGCHAIFHTSSFIDLHGVSGYSEQMAFLE  136

Query  737   TEAAGNVIEACSKTAYARRCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFA  558
             TEAA NVIEACS++AY +RCIFTSSLLASIW  N+     +DES W+ E+FC ENKLW A
Sbjct  137   TEAAKNVIEACSRSAYVKRCIFTSSLLASIWI-NDKLEGTIDESCWSSEEFCIENKLWLA  195

Query  557   LAKTRAEKVAWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLAT  378
             L K +AEK AWRK+ E KVKLVT+CPAL+M PSFP A   SSLPYLKG   ML++G+LAT
Sbjct  196   LGKMKAEKAAWRKSKELKVKLVTICPALLMDPSFPSAHRNSSLPYLKGFSKMLQRGILAT  255

Query  377   EDVDKAAEAHVFVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQG--LLSAYESGE  204
              DV+K AEAHV VYE +D GA GRYLCF + +   ++A+ LE+ LK  G  L+   E  E
Sbjct  256   GDVNKVAEAHVRVYEAIDGGAYGRYLCFDKVVQRLDEALQLEDELKRHGLSLVLPQEIEE  315

Query  203   IPARLCKSKLTRLLFHTARRLSCKH  129
             I + L   KL RLL   ++  SC+ 
Sbjct  316   IHSNLSNFKLPRLLLQASQSKSCRQ  340



>gb|AIX92150.1| cinnamoyl-CoA reductase 1 [Betula platyphylla]
Length=344

 Score =   367 bits (942),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 185/311 (59%), Positives = 237/311 (76%), Gaps = 7/311 (2%)
 Frame = -1

Query  1043  RERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVV  864
             R R+LVCVTSGNSY G+H++++LL  GY VR T+Q QVDF++M+EL+R+EE+ QLESVVV
Sbjct  28    RRRELVCVTSGNSYLGSHIVKELLAHGYPVRVTVQYQVDFDDMRELMRDEEINQLESVVV  87

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
             A M D+D L +AFRGCHA+FHTSS+IDPHGISGY+E MAF+E E A NVIEAC + AY +
Sbjct  88    ANMGDVDSLSDAFRGCHAIFHTSSYIDPHGISGYSEGMAFVEAEGAKNVIEACGRAAYIK  147

Query  683   RCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETK  504
             RCIFTSSLLASIWKG+N +   +DE+ W+DE+FCREN+LW AL KT AEK AW K+ E  
Sbjct  148   RCIFTSSLLASIWKGDNVDRV-VDETCWSDEEFCRENRLWLALGKTMAEKAAWSKSKEMI  206

Query  503   VKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMD  324
             V+LVT+CP L+MAPSFP+A  ++++PYLKGGQ+ML++GVLA  D  K A AHV VYE MD
Sbjct  207   VELVTMCPGLLMAPSFPNAHIQTAIPYLKGGQIMLQRGVLAIVDAKKVAAAHVQVYEAMD  266

Query  323   YGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAY------ESGEIPARLCKSKLTRLL  162
              GACGRY+CF R +   ++A+ LEN +   GLLS        E G     +  SKL++L+
Sbjct  267   CGACGRYICFERVVRRLDEAIELENGINKHGLLSGGGQLVLPEEGNDHQEIDNSKLSKLI  326

Query  161   FHTARRLSCKH  129
                ++RLSCK 
Sbjct  327   LQASQRLSCKQ  337



>gb|KHG15521.1| Dihydroflavonol-4-reductase [Gossypium arboreum]
Length=344

 Score =   365 bits (937),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 185/326 (57%), Positives = 237/326 (73%), Gaps = 9/326 (3%)
 Frame = -1

Query  1085  RRCASNVFSSHLWCRERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkel  906
             ++C  N+FS     RE+KL+CVTSGNSY G+ ++++LL  GYLVR TIQ+  +FE++K+L
Sbjct  19    QKCVGNIFSCSFNAREKKLICVTSGNSYLGSFIVKELLAHGYLVRVTIQHPAEFEDVKDL  78

Query  905   lreeemkqlESVVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAA  726
             L  E++  LESVVV +M  L  LC+AFRGCHAVFHTSSFIDPHGISGY+E+  FLETE A
Sbjct  79    LGVEDLNLLESVVVTKMEKLQSLCDAFRGCHAVFHTSSFIDPHGISGYSEQKVFLETEVA  138

Query  725   GNVIEACSKTAYARRCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKT  546
               V+EAC+K AY +RC+FTSSLLASIW+  N +   +D+S W+ E+FCRE KLW AL KT
Sbjct  139   RTVMEACAKAAYIKRCVFTSSLLASIWRNENID-GIIDDSCWSSEEFCREKKLWLALGKT  197

Query  545   RAEKVAWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVD  366
             +AEKVAW KA E KV LVTVCP L+MAP+FP+   ++S+PYLKGGQ+ML+QG LA  +V+
Sbjct  198   KAEKVAWMKAKELKVNLVTVCPGLLMAPTFPNPHIQTSIPYLKGGQMMLQQGCLAIAEVE  257

Query  365   KAAEAHVFVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQG--------LLSAYES  210
             K A+AHV VYE M YGA GRYLCF   +   ++A+ LE  LKM G        +LS  + 
Sbjct  258   KVAKAHVSVYEGMKYGASGRYLCFDGVVRRQQEAIELEKGLKMTGFLLGERHVVLSEEDE  317

Query  209   GEIPARLCKSKLTRLLFHTARRLSCK  132
              EIP ++  SKL  LL    +RL CK
Sbjct  318   EEIPIKIRNSKLAALLNKINQRLPCK  343



>ref|XP_010262246.1| PREDICTED: cinnamoyl-CoA reductase 2 isoform X2 [Nelumbo nucifera]
Length=353

 Score =   362 bits (929),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 200/354 (56%), Positives = 248/354 (70%), Gaps = 18/354 (5%)
 Frame = -1

Query  1139  MAMECRNELSFA---LPVEPPRR---CA--SNVFSSHLWCRERKLVCVTSGNSYFGAHLI  984
             M   CR E+       P+  P R   CA  +  FS  L   ERKL+CVTS NS+  + ++
Sbjct  1     MDRGCRGEIVIPEAEAPLFTPFRQKPCALTATWFSCTLSTSERKLICVTSANSFLASLIL  60

Query  983   RKLLVRGYLVRATIQNQVDFeemkellreeemkql-ESVVVARMTDLDCLCEAFRGCHAV  807
             ++LL RGYLVRAT+QNQV+ EE++E ++EEEM +  ESVVV +M DL  LCEAFRGCHAV
Sbjct  61    KQLLARGYLVRATVQNQVEVEEVREQIKEEEMMRGLESVVVVKMGDLQSLCEAFRGCHAV  120

Query  806   FHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTSSLLASIWKGNNHE  627
             FHTSSFIDP G+SGY++RMAFLETE A NVIEAC + AY +RCIFTSSLLASIW G+  +
Sbjct  121   FHTSSFIDPAGVSGYSDRMAFLETEGAKNVIEACGRAAYVKRCIFTSSLLASIWLGDGAQ  180

Query  626   HDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTVCPALVMAPSFPHA  447
                +DES W++E+FCRENKLW AL KT AEKVAWRK+ E KV LV VCP L+M P+FP+A
Sbjct  181   -GPVDESCWSNEEFCRENKLWLALGKTTAEKVAWRKSKELKVNLVAVCPGLLMDPTFPNA  239

Query  446   DTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGRYLCFGRTITTPED  267
               E+S+PYLKGG +M +QG+LAT D  K AEAH+ VYE MD GA GRYLCF R I   ++
Sbjct  240   HMETSVPYLKGGSIMWQQGILATIDAQKVAEAHIHVYEAMDNGAGGRYLCFERVIRRLDE  299

Query  266   AVLLENRLKMQGLLS--------AYESGEIPARLCKSKLTRLLFHTARRLSCKH  129
              + LE++LKM G LS          ++ E    L  SKLT L+   A+R SCK 
Sbjct  300   VIDLEDKLKMHGSLSRGRNEESQEDDNDETRFTLTNSKLTELMSRAAQRPSCKQ  353



>ref|XP_004306032.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Fragaria vesca subsp. 
vesca]
Length=347

 Score =   358 bits (918),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 204/350 (58%), Positives = 254/350 (73%), Gaps = 20/350 (6%)
 Frame = -1

Query  1139  MAME---CRNELSFALPVEPPRRCASNVFS-SHLWCRERKLVCVTSGNSYFGAHLIRKLL  972
             MAME     N L  +L  E  + C +  F  S    RE+ LVCVTSGNSY G+H++R LL
Sbjct  1     MAMEEVVVPNPLMISLK-EENKSCVNYAFRCSWDISREKNLVCVTSGNSYLGSHIVRALL  59

Query  971   VRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTDLDCLCEAFRGCHAVFHTSS  792
               GYLVR TIQNQ D+E+MK+L+R+EE+ QLESVVVA+M +LD LC+AFRGCHA+FH+SS
Sbjct  60    AHGYLVRVTIQNQEDYEDMKKLMRDEEIHQLESVVVAKMGNLDMLCDAFRGCHAIFHSSS  119

Query  791   FIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTSSLLASIWKGNNHEHDDLD  612
             FIDPHG++GY+ +MAFLETE A NVIEAC +  YA+RCIFTSSLLA IW G++ E+  +D
Sbjct  120   FIDPHGVTGYSGQMAFLETEGAKNVIEACGRATYAKRCIFTSSLLACIWAGDS-ENKVID  178

Query  611   ESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTVCPALVMAPSFPHADTESS  432
             E SW++ +FCRENKLW AL KT AE  +WRK+ E KV LVTVCP L M P    A  ++ 
Sbjct  179   EFSWSNVEFCRENKLWLALGKTTAEIASWRKSKEMKVNLVTVCPGLHMDPC---AHQDNY  235

Query  431   LPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGRYLCFGRTITTPEDAVLLE  252
             +PYLKGG+ ML+ G LA EDV KAAEAHV+VYE MD GACGRYLCFG+ I T  +A+ LE
Sbjct  236   IPYLKGGKDMLKNGHLAIEDVKKAAEAHVYVYEAMDNGACGRYLCFGKVIRTRSEAIELE  295

Query  251   NRLKMQGL---------LSAYES-GEIPARLCKSKLTRLLFHTARRLSCK  132
             N LK+QGL         +S  E+  EI + L  +KL RL+  T++RLSCK
Sbjct  296   NSLKVQGLLSGGGGSHEVSDEEADAEINSMLSNAKLVRLI-QTSKRLSCK  344



>ref|XP_010262240.1| PREDICTED: cinnamoyl-CoA reductase 2 isoform X1 [Nelumbo nucifera]
Length=370

 Score =   352 bits (902),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 200/371 (54%), Positives = 248/371 (67%), Gaps = 35/371 (9%)
 Frame = -1

Query  1139  MAMECRNELSFA---LPVEPPRR---CA--SNVFSSHLWCRERKLVCVTSGNSYFGAHLI  984
             M   CR E+       P+  P R   CA  +  FS  L   ERKL+CVTS NS+  + ++
Sbjct  1     MDRGCRGEIVIPEAEAPLFTPFRQKPCALTATWFSCTLSTSERKLICVTSANSFLASLIL  60

Query  983   RKLLVRGYLVRATIQNQVDFeemkellreeemkql-ESVVVARMTDLDCLCEAFRGCHAV  807
             ++LL RGYLVRAT+QNQV+ EE++E ++EEEM +  ESVVV +M DL  LCEAFRGCHAV
Sbjct  61    KQLLARGYLVRATVQNQVEVEEVREQIKEEEMMRGLESVVVVKMGDLQSLCEAFRGCHAV  120

Query  806   FHTSSFIDPHGISGYT-----------------ERMAFLETEAAGNVIEACSKTAYARRC  678
             FHTSSFIDP G+SGY+                 +RMAFLETE A NVIEAC + AY +RC
Sbjct  121   FHTSSFIDPAGVSGYSLNEVAYISERSVWSQLQDRMAFLETEGAKNVIEACGRAAYVKRC  180

Query  677   IFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVK  498
             IFTSSLLASIW G+  +   +DES W++E+FCRENKLW AL KT AEKVAWRK+ E KV 
Sbjct  181   IFTSSLLASIWLGDGAQ-GPVDESCWSNEEFCRENKLWLALGKTTAEKVAWRKSKELKVN  239

Query  497   LVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYG  318
             LV VCP L+M P+FP+A  E+S+PYLKGG +M +QG+LAT D  K AEAH+ VYE MD G
Sbjct  240   LVAVCPGLLMDPTFPNAHMETSVPYLKGGSIMWQQGILATIDAQKVAEAHIHVYEAMDNG  299

Query  317   ACGRYLCFGRTITTPEDAVLLENRLKMQGLLS--------AYESGEIPARLCKSKLTRLL  162
             A GRYLCF R I   ++ + LE++LKM G LS          ++ E    L  SKLT L+
Sbjct  300   AGGRYLCFERVIRRLDEVIDLEDKLKMHGSLSRGRNEESQEDDNDETRFTLTNSKLTELM  359

Query  161   FHTARRLSCKH  129
                A+R SCK 
Sbjct  360   SRAAQRPSCKQ  370



>ref|XP_007215828.1| hypothetical protein PRUPE_ppa010133mg [Prunus persica]
 gb|EMJ17027.1| hypothetical protein PRUPE_ppa010133mg [Prunus persica]
Length=262

 Score =   320 bits (819),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 160/252 (63%), Positives = 192/252 (76%), Gaps = 8/252 (3%)
 Frame = -1

Query  875  SVVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKT  696
             VVVA+M  LD LCEAFRGCHA+FHTSSFIDPHGISGY+E MAFLE EAA NVIEAC + 
Sbjct  15   GVVVAKMGSLDSLCEAFRGCHAIFHTSSFIDPHGISGYSEHMAFLEAEAARNVIEACGRA  74

Query  695  AYARRCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKA  516
            AYA+RCIFTSSLLA+IW G+N E+  +DE SWT+E+FCRENKLW AL KT AE   WRK+
Sbjct  75   AYAKRCIFTSSLLAAIWTGDN-ENKIIDEFSWTNEEFCRENKLWLALGKTTAEMTCWRKS  133

Query  515  METKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVY  336
             E KV LVTVCP L+M  SFP+A   + +PYLKGG+VML  G LA ED  KAA+AHV+VY
Sbjct  134  KEMKVNLVTVCPGLLMDASFPNA--HNYVPYLKGGKVMLEHGHLAIEDARKAAKAHVYVY  191

Query  335  EEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSA--YES--GEIPARLCKSKLTR  168
            E MDYGACGRYLC+G+ +    +A+ LEN LK+ GLLS   +E+   EI   L  +KL R
Sbjct  192  EAMDYGACGRYLCYGKVVRKMSEAIELENGLKIHGLLSGGRHEALDEEIHIMLSNAKLVR  251

Query  167  LLFHTARRLSCK  132
            L+   +++LSCK
Sbjct  252  LI-QGSQKLSCK  262



>ref|XP_006845002.1| hypothetical protein AMTR_s00058p00200980 [Amborella trichopoda]
 gb|ERN06677.1| hypothetical protein AMTR_s00058p00200980 [Amborella trichopoda]
Length=345

 Score =   278 bits (712),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/302 (46%), Positives = 196/302 (65%), Gaps = 1/302 (0%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVA  861
             E K+VC+TSG S+ G  +  +LLV+GY VR  ++N+ D  +++E+      +     V+A
Sbjct  38    EDKVVCITSGISFLGLWIANELLVKGYSVRLAVENEEDLLKLREMEVFTGTRSDVVAVMA  97

Query  860   RMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARR  681
              + ++D LCEAF GC  VFHTS+F+DP GISGY++ M  LE +AA NVIEAC++T   R+
Sbjct  98    NVMEIDSLCEAFNGCRGVFHTSAFVDPGGISGYSKHMVNLEAKAAENVIEACARTPSVRK  157

Query  680   CIFTSSLLASIWKG-NNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETK  504
             C+FTSSLLA +W+  +      LDE  W++E  C+E KLWFAL KT  EK  WRKA E +
Sbjct  158   CVFTSSLLACVWREVSGPSGSVLDEKCWSEERVCQEKKLWFALGKTMGEKAGWRKARERE  217

Query  503   VKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMD  324
             V +V++CP L+  PSF   ++  S+ YLKG + M  +GVLA+ DV  AAEAHV++YE M+
Sbjct  218   VNMVSICPGLITGPSFHLRNSTWSMAYLKGAREMYEKGVLASVDVSMAAEAHVYLYENME  277

Query  323   YGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGEIPARLCKSKLTRLLFHTARR  144
             YGACGRY+CF R I   E+A+ L+ ++ +  L            L  SKL+RL+  + +R
Sbjct  278   YGACGRYICFDRVIIRAEEAIDLQEKMAVTILREGEGDSLALPVLSNSKLSRLMSSSFQR  337

Query  143   LS  138
              S
Sbjct  338   CS  339



>ref|XP_010925686.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Elaeis guineensis]
Length=367

 Score =   262 bits (669),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 139/297 (47%), Positives = 190/297 (64%), Gaps = 7/297 (2%)
 Frame = -1

Query  1031  LVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlES-VVVARM  855
             +VCVTS  S+ G  ++ +LL  GY VR  ++NQ D ++++++    EM +  +  V+A +
Sbjct  55    MVCVTSAVSFLGFAIVNRLLSLGYCVRLALENQEDLDKLRDMEMFGEMGRDGAWAVMANV  114

Query  854   TDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCI  675
              DLD LC AF GC  VFHTS+F+DP G+SGY++ MA +E  AA  VIEAC +T   R+C+
Sbjct  115   MDLDSLCRAFDGCTGVFHTSAFVDPGGVSGYSKHMADMEARAAERVIEACVRTQSVRKCV  174

Query  674   FTSSLLASIWKGNNHEHDDL----DESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMET  507
             FTSSLLA +W+ N+  +  L    DE+ W+DE  CR+ KLWFAL KT AEK AWR A   
Sbjct  175   FTSSLLACVWRQNSPRNHRLATIVDENCWSDESLCRDKKLWFALGKTMAEKAAWRAARGR  234

Query  506   KVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEM  327
              +KLVTVCPALV  P F   ++  S+ YLKG + M  +G+LAT DV K AEAHV VYE M
Sbjct  235   DLKLVTVCPALVTGPGFRRRNSTGSVAYLKGAREMFAEGLLATVDVSKVAEAHVSVYEAM  294

Query  326   DYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGEIPA--RLCKSKLTRLL  162
                ACGRY+C+ R I   E+A+ LE +L +   +      + P    LC  K++RL+
Sbjct  295   GSTACGRYICYDRIIQRKEEALELERQLGIPNRIYTETPTDHPTWFDLCNRKISRLM  351



>gb|ABK23555.1| unknown [Picea sitchensis]
Length=360

 Score =   261 bits (668),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 150/322 (47%), Positives = 201/322 (62%), Gaps = 20/322 (6%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellr---eeemkqlESVVV  864
             K+VCVT+G S+ G  ++R+LL+RGY+VR T  N  + ++++E+          +L  VVV
Sbjct  36    KMVCVTNGTSFLGLWIVRQLLLRGYIVRLTAHNTGELQKVEEMEEFALYSANNKLSGVVV  95

Query  863   ARMTD-LDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYA  687
                TD    LCEAF GC+ VFHTSSFIDPHG+SGYTE M  LE + A   +EACS T+  
Sbjct  96    NVATDSTASLCEAFDGCYGVFHTSSFIDPHGLSGYTEHMVNLEVKGAEKTVEACSLTSSV  155

Query  686   RRCIFTSSLLASIWKGNNHEHDD---LDESSWTDEDFCRENKLWFALAKTRAEKVAWRKA  516
             RRC+FTSSL A  W+ +    D    +DE  W+D+  CRE KLW AL+KT +EK AWR A
Sbjct  156   RRCVFTSSLTACTWQRDGFSEDGDFVVDEKCWSDQHLCREKKLWLALSKTMSEKAAWRAA  215

Query  515   METK-VKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFV  339
              E+  V LVTVCPAL+  P+F  +   S++ YLKG + M  + +LAT DV +AAEAHV V
Sbjct  216   EESGGVNLVTVCPALLTGPAFSASCASSAVAYLKGAREMYEKNLLATVDVRRAAEAHVCV  275

Query  338   YEEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQ-GLLSAYESGEIPA-----------  195
             YEEM+ G  GRY+CF + IT PEDA  LE +L M  G  +  +SG+              
Sbjct  276   YEEMEIGGSGRYICFDKVITRPEDARDLEKKLNMGLGFSADEDSGDRDEYRSSQSHIGSH  335

Query  194   RLCKSKLTRLLFHTARRLSCKH  129
             R+  +KL R++  +A   SC+H
Sbjct  336   RIFNAKLRRIMDLSASARSCRH  357



>gb|ABK23547.1| unknown [Picea sitchensis]
Length=360

 Score =   261 bits (668),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 150/322 (47%), Positives = 199/322 (62%), Gaps = 20/322 (6%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellr---eeemkqlESVVV  864
             K+VCVT+G S+ G  ++R+LL+RGY+VR T  N  + ++++E+          +L  VVV
Sbjct  36    KMVCVTNGTSFLGLWIVRQLLLRGYIVRLTAHNTGELQKVEEMEEFALYSANNKLSGVVV  95

Query  863   ARMTD-LDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYA  687
                TD    LCEAF GC+ VFHTSSFIDPHG+SGYTE M  LE + A   +EACS T+  
Sbjct  96    NVATDSTASLCEAFDGCYGVFHTSSFIDPHGLSGYTEHMVNLEVKGAEKTVEACSLTSSV  155

Query  686   RRCIFTSSLLASIWKGNNHEHDD---LDESSWTDEDFCRENKLWFALAKTRAEKVAWRKA  516
             RRC+FTSSL A  W+ +    D    +DE  W+D+  CRE KLW AL+KT +EK AWR A
Sbjct  156   RRCVFTSSLTACTWQRDGFSEDGDFVVDEKCWSDQHLCREKKLWLALSKTMSEKAAWRAA  215

Query  515   METK-VKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFV  339
              E+  V LVTVCPAL+  P+F  +   S++ YLKG + M  + +LAT DV +AAEAHV V
Sbjct  216   EESGGVNLVTVCPALLTGPAFSASCASSAVAYLKGAREMYEKNLLATVDVRRAAEAHVCV  275

Query  338   YEEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGEI------------PA  195
             YEEM+ G  GRY+CF + IT PEDA  LE +L M    SA E  +               
Sbjct  276   YEEMEIGGSGRYICFDKVITRPEDARDLEKKLNMGLGFSADEDSDDRDEYRSSQSHIGSH  335

Query  194   RLCKSKLTRLLFHTARRLSCKH  129
             R+  +KL R++  +A   SC+H
Sbjct  336   RIFNAKLRRIMDLSASARSCRH  357



>gb|AEO45117.1| cinnamoyl-CoA reductase [Betula platyphylla]
Length=362

 Score =   259 bits (661),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 140/305 (46%), Positives = 193/305 (63%), Gaps = 10/305 (3%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreee---mkqlESVVV  864
             KLVCVTSG SY G  +++KLL+RGY VR  ++++ D  +++E+    E        SVV+
Sbjct  53    KLVCVTSGVSYLGLAIVKKLLLRGYSVRIIVESEEDINKLREMETSGEMRPTNNNISVVM  112

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
             A++TD++ L EAF+GC  VFHTS FIDP G+SGYT+ MA +E +A+  V+ AC++T   R
Sbjct  113   AKLTDIESLSEAFQGCRGVFHTSGFIDPAGLSGYTKSMAEIEVKASETVMTACARTPSVR  172

Query  683   RCIFTSSLLASIWKGNNHEH--DDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAME  510
             +C+ TSSL A IW+ N+H      ++   W+DE FC + KLW+AL K RAE+VAWR A E
Sbjct  173   KCVLTSSLSACIWRDNSHYDLSSVINHGCWSDELFCIDKKLWYALGKLRAERVAWRIARE  232

Query  509   TKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEE  330
              ++KL T+CP L+  P F   +  +++ YLKG Q M   G+LAT DV+K AEA V V+E 
Sbjct  233   NRLKLATICPGLITGPEFCQRNPMATIAYLKGAQEMYANGLLATVDVNKLAEAEVCVFEA  292

Query  329   MDYGACGRYLCFGRTITTPEDAVLLENRLKM--QGLLSAYESGEIPAR--LCKSKLTRLL  162
             MD  A GRY+CF   I   E A  L   L M    +    ESG++ AR  L   KL+RL+
Sbjct  293   MDKNAAGRYICFDEVIERDE-AEKLAGELGMPTNKICGGDESGDVEARFQLSNEKLSRLM  351

Query  161   FHTAR  147
               T R
Sbjct  352   TRTLR  356



>ref|NP_001043674.1| Os01g0639200 [Oryza sativa Japonica Group]
 dbj|BAF05588.1| Os01g0639200 [Oryza sativa Japonica Group]
Length=379

 Score =   258 bits (659),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 149/323 (46%), Positives = 200/323 (62%), Gaps = 21/323 (7%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlES-VVVAR  858
             + VCVT G S+ G  ++ +LL  GY VR  ++ Q D ++++E+    E  +     V+A 
Sbjct  60    RTVCVTGGISFVGFAVVDRLLRHGYTVRLALETQEDLDKLREMEMFGEDGRDGVWTVMAN  119

Query  857   MTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRC  678
             +TD + L  AF GC  VFHTS+F+DP G+SGYT+ MA LE +AA  VIEAC +T   R+C
Sbjct  120   VTDPESLHRAFDGCAGVFHTSAFVDPGGMSGYTKHMASLEAKAAEQVIEACVRTESVRKC  179

Query  677   IFTSSLLASIWKGNNHEHDD-----LDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAM  513
             +FTSSLLA +W+  N+ HD      +DE+ W+DE FCR+NKLWFAL KT AEK AWR A 
Sbjct  180   VFTSSLLACVWR-QNYPHDRRFPTIIDENCWSDESFCRDNKLWFALGKTAAEKTAWRAAR  238

Query  512   ETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYE  333
                +KLVTVCPALV  P F   ++ +S+ YLKG + ML  G+LAT  V+  AEAHV VYE
Sbjct  239   GRDLKLVTVCPALVTGPGFRRRNSTASIAYLKGARAMLADGLLATASVETVAEAHVRVYE  298

Query  332   EM-DYGACGRYLCFGRTITTPEDAVLLENRL----KMQGLLSAYESGEIPAR--LCKSKL  174
              M D  A GRY+C+   +  PE+   LE +L    +     +A +SG+ PAR  LC+ KL
Sbjct  299   AMGDNTAGGRYICYDHVVKRPEEFAELERQLGIPRRAAAAAAAQDSGDRPARFDLCRQKL  358

Query  173   TRLLFHTARRLSCKHR*ALCDYY  105
              RL       +S + R    DYY
Sbjct  359   ARL-------MSTRRRCTYDDYY  374



>gb|AIX92146.1| cinnamoyl-CoA reductase 1 [Betula platyphylla]
Length=362

 Score =   257 bits (657),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 140/306 (46%), Positives = 195/306 (64%), Gaps = 12/306 (4%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreee---mkqlESVVV  864
             KLVCVTSG SY G  +++KLL+RGY VR  ++++ D  +++E+    E        SVV+
Sbjct  53    KLVCVTSGVSYLGLAIVKKLLLRGYSVRIIVESEEDINKLREMETSGEMRPTNNNISVVM  112

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
             A++TD++ L EAF+GC  VFHTS FIDP G+SGYT+ MA +E +A+  V+ AC++T   R
Sbjct  113   AKLTDIESLSEAFQGCRGVFHTSGFIDPAGLSGYTKSMAEIEVKASETVMTACARTPSVR  172

Query  683   RCIFTSSLLASIWKGNNHEHD---DLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAM  513
             +C+ TSSL A IW+ +N ++D    ++   W+DE FC + KLW+AL K RAE+VAWR A 
Sbjct  173   KCVLTSSLSACIWR-DNSQYDLSSVINHGCWSDELFCIDKKLWYALGKLRAERVAWRIAR  231

Query  512   ETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYE  333
             E ++KL T+CP L+  P F   +  +++ YLKG Q M   G+LAT DV+K AEA V V+E
Sbjct  232   ENRLKLATICPGLITGPEFCQRNPMATIAYLKGAQEMYANGLLATVDVNKLAEAEVCVFE  291

Query  332   EMDYGACGRYLCFGRTITTPEDAVLLENRLKM--QGLLSAYESGEIPAR--LCKSKLTRL  165
              MD  A GRY+CF   I   E A  L   L M    +    ESG++ AR  L   KL+RL
Sbjct  292   AMDKNAAGRYICFDEVIERDE-AEKLAGELGMPTNKICGGDESGDVEARFQLSNEKLSRL  350

Query  164   LFHTAR  147
             +  T R
Sbjct  351   MTRTLR  356



>ref|XP_008790508.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Phoenix dactylifera]
Length=445

 Score =   259 bits (663),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 139/309 (45%), Positives = 195/309 (63%), Gaps = 10/309 (3%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlES-VVVAR  858
             ++VCVTS  S+ G  ++ +LL  GY+VR  +++Q D ++++++    EM +     V+A 
Sbjct  132   RMVCVTSAVSFLGFAIVNRLLALGYIVRLALESQEDLDKLRDMEMFGEMGRDGVWAVMAN  191

Query  857   MTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRC  678
             + D+D LC AF GC AVFHTS+F+DP G+SGY++ MA +E   A  VIE+C +T   R+C
Sbjct  192   VMDVDSLCHAFDGCAAVFHTSAFMDPGGVSGYSKPMAHMEARVAERVIESCVRTQSVRKC  251

Query  677   IFTSSLLASIWKGNN----HEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAME  510
             +FTSSLLA +W+ N+    H    +DE+ W+DE  CR+ KLWFAL KT AEK AWR A  
Sbjct  252   VFTSSLLACVWRQNSPRNRHIPTIVDENCWSDESLCRDKKLWFALGKTMAEKAAWRAARG  311

Query  509   TKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEE  330
               +KLV VCPALV  P F   ++  S+ YLKG   M  +G+LAT DV K AEAHV VYE 
Sbjct  312   RDLKLVAVCPALVTGPRFCRRNSTGSIAYLKGAHEMFAEGLLATVDVQKVAEAHVCVYEA  371

Query  329   MDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGEIPA--RLCKSKLTRLLFH  156
             M   ACGRY+C+ R I   E+A  LE +L +   +S     + P   +LC  K++RL+  
Sbjct  372   MSNTACGRYICYDRIIQRAEEAAELERQLGIANRISGETPTDHPTWFKLCNRKISRLM--  429

Query  155   TARRLSCKH  129
              + R SC +
Sbjct  430   -SSRRSCTY  437



>gb|KHG12895.1| Dihydroflavonol-4-reductase [Gossypium arboreum]
Length=367

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 146/320 (46%), Positives = 201/320 (63%), Gaps = 14/320 (4%)
 Frame = -1

Query  1067  VFSSH---LWCRERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellre  897
             + SSH   L  ++ KLVCVTSG S+ G  L+ +LL+RGY VR  + NQ D E ++E+   
Sbjct  41    LMSSHIADLDFQQDKLVCVTSGVSFLGLALVNRLLLRGYSVRILVDNQEDVETLREMQVS  100

Query  896   eemkql----ESVVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEA  729
              EM        SVV+AR T++  L EAF GC  VFHTS+F+DP GISGY++ MA +E +A
Sbjct  101   GEMMMACNNKISVVMARQTEIQGLMEAFDGCRGVFHTSAFVDPSGISGYSKSMAEIEVKA  160

Query  728   AGNVIEACSKTAYARRCIFTSSLLASIWKGNNHEHDD---LDESSWTDEDFCRENKLWFA  558
             + NV++AC++TA  R C+ TSSLLA IW+ ++ +HD    ++  SW++E  C E KLWFA
Sbjct  161   SENVMKACARTASVRNCVLTSSLLACIWR-DSSQHDLPLLVNHDSWSNEALCMEKKLWFA  219

Query  557   LAKTRAEKVAWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLAT  378
             L K +AEKVAW+ A E  +KL T+CP L+  P F H +  +++ YLKG Q M  +G+LAT
Sbjct  220   LGKLKAEKVAWKIAEEMSLKLTTICPGLITGPQFSHRNPTATIAYLKGAQEMYAKGLLAT  279

Query  377   EDVDKAAEAHVFVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGE-I  201
              DV + AEAHV V+E M+  A GRY+CF R I   E+A  L + + +     +  S E I
Sbjct  280   VDVIRLAEAHVAVFEAMNKTAFGRYICFDRIIERDEEAEKLASEIGIPPNRISGNSLEFI  339

Query  200   PA--RLCKSKLTRLLFHTAR  147
             P    L   KL  L+  T R
Sbjct  340   PTHFELSNKKLNNLMSRTIR  359



>ref|XP_006844944.1| hypothetical protein AMTR_s00058p00164240 [Amborella trichopoda]
 gb|ERN06619.1| hypothetical protein AMTR_s00058p00164240 [Amborella trichopoda]
Length=340

 Score =   255 bits (651),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 148/318 (47%), Positives = 202/318 (64%), Gaps = 21/318 (7%)
 Frame = -1

Query  1088  PRRCASNVFSSHLWCRERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemke  909
             P +  S +F         K VCVT G S F   L+++LL RGY VR T+ ++ + E M++
Sbjct  32    PEKSNSRLFLPQ--SGNEKHVCVTGGGS-FSLILVKELLSRGYTVRLTVHSEGEMETMEK  88

Query  908   llreeemkqlESVVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEA  729
             +     +++    + A+M+D++ LC+AF+GC AVFHTSSFIDPHG+SGYTERMA LE++ 
Sbjct  89    IEDLWSVEK----LSAKMSDIESLCDAFQGCGAVFHTSSFIDPHGLSGYTERMASLESKG  144

Query  728   AGNVIEACSKTAYARRCIFTSSLLASIWKG----NNHEHDDLDESSWTDEDFCRENKLWF  561
             A NVI+AC+K A   +CI TSSLLA IW+            +DES W+DE  CRENKLW 
Sbjct  145   AENVIKACAK-ARVNKCILTSSLLACIWQSPTTATTTTTTTIDESFWSDEALCRENKLWL  203

Query  560   ALAKTRAEKVAWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLA  381
             AL KT AE+ AWR A E KVK+V++ P L+  P   H++  +S+ YLKGG+ ML +G+LA
Sbjct  204   ALGKTTAEQKAWRLAEERKVKMVSILPGLI-PPVSLHSNLATSVAYLKGGRHMLERGLLA  262

Query  380   TEDVDKAAEAHVFVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGEI  201
             T +V K A+AHV +YE+MDY A GR+LCF + I   ED + LE +  M G L     G +
Sbjct  263   TIEVTKVAKAHVHIYEKMDYKAKGRFLCFDKVINQNEDILDLEKKFGMCGQLLG---GTL  319

Query  200   PAR-----LCKSKLTRLL  162
             P       L  SKL +L+
Sbjct  320   PCEYYHPILTNSKLLQLI  337



>ref|XP_010924262.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Elaeis guineensis]
Length=367

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 140/304 (46%), Positives = 188/304 (62%), Gaps = 11/304 (4%)
 Frame = -1

Query  1040  ERK----LVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlES  873
             ERK    +VCVTS  S+ G  ++ +LL  GY VR  ++ Q D ++++++    EM +   
Sbjct  48    ERKGHGTVVCVTSAVSFLGFAIVNRLLALGYSVRLALETQEDLDKLRDMEMFGEMGRDGV  107

Query  872   -VVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKT  696
              VV+A + DLD LC AF GC  VFHTS+F+DP G+SGY++ MA +E   A  VIEAC +T
Sbjct  108   WVVMADVMDLDSLCHAFDGCTGVFHTSAFVDPGGVSGYSKHMADMEARVAERVIEACVRT  167

Query  695   AYARRCIFTSSLLASIWKGNNHEHDDL----DESSWTDEDFCRENKLWFALAKTRAEKVA  528
                 RC+FTSSLLA +W+ N+  +  L    DE+ W+DE  CRE KLW AL KT AEK A
Sbjct  168   QSVTRCVFTSSLLACVWRQNSPRNRRLPTIVDETCWSDESLCREKKLWLALGKTMAEKAA  227

Query  527   WRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAH  348
             WR A    +KLVTVCPALV  P F   ++  S+ YLKG   M  +G+LAT DV+K AEAH
Sbjct  228   WRVARGRNLKLVTVCPALVTGPRFCRQNSTGSIAYLKGAHEMFAEGLLATVDVNKVAEAH  287

Query  347   VFVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGEIPA--RLCKSKL  174
               VYE M   ACGRY+C+   I   E+A  LE +L +   +S     + P   +LC  K+
Sbjct  288   ACVYEAMSGSACGRYICYDHIIQRAEEAAELERQLGIANRISGETPTDHPTWFKLCNRKI  347

Query  173   TRLL  162
             +RL+
Sbjct  348   SRLM  351



>ref|XP_008801809.1| PREDICTED: cinnamoyl-CoA reductase 2-like isoform X1 [Phoenix 
dactylifera]
Length=367

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 136/298 (46%), Positives = 190/298 (64%), Gaps = 7/298 (2%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlES-VVVAR  858
             ++VCVTS  S+ G  ++ +LL  GY VR  ++ Q D ++++++    EM++     V+A 
Sbjct  54    RIVCVTSAVSFLGFAIVNRLLSLGYCVRLALETQEDLDKLRDMEMFGEMERDGVWAVMAS  113

Query  857   MTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRC  678
             + DLD LC AF GC  VFHTS+F+DP G SGY++ MA +E  AA  VIEAC +T   R+C
Sbjct  114   VMDLDSLCRAFDGCTGVFHTSAFVDPGGASGYSKHMADMEARAAERVIEACVRTQSVRKC  173

Query  677   IFTSSLLASIWKGNNHEHDDL----DESSWTDEDFCRENKLWFALAKTRAEKVAWRKAME  510
             +FTSSLLA +W+ N+  ++ L    DE+ W+DE  CR+ KLWFAL KT AEK AWR A  
Sbjct  174   VFTSSLLACVWRQNSPRNNRLPTVVDENCWSDESLCRDKKLWFALGKTMAEKAAWRAARG  233

Query  509   TKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEE  330
               +KLVTVCPALV  P F   ++  S+ YLKG + +  +G+LAT DV K AEAHV VYE 
Sbjct  234   RDLKLVTVCPALVTGPGFRRRNSTGSIAYLKGARDLFAEGLLATVDVCKVAEAHVSVYEA  293

Query  329   MDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGEIPA--RLCKSKLTRLL  162
             M   ACGRY+C+   I   E+A  LE +L +   +S+    + P    LC  K++R++
Sbjct  294   MGSTACGRYICYDHIIQRKEEAAELERQLGIPNRISSETPTDHPTWFELCNRKISRIM  351



>ref|XP_008801810.1| PREDICTED: cinnamoyl-CoA reductase 2-like isoform X2 [Phoenix 
dactylifera]
Length=366

 Score =   254 bits (649),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 134/297 (45%), Positives = 183/297 (62%), Gaps = 6/297 (2%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARM  855
             ++VCVTS  S+ G  ++ +LL  GY VR  ++ Q   +     +  E  +     V+A +
Sbjct  54    RIVCVTSAVSFLGFAIVNRLLSLGYCVRLALETQDLDKLRDMEMFGEMERDGVWAVMASV  113

Query  854   TDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCI  675
              DLD LC AF GC  VFHTS+F+DP G SGY++ MA +E  AA  VIEAC +T   R+C+
Sbjct  114   MDLDSLCRAFDGCTGVFHTSAFVDPGGASGYSKHMADMEARAAERVIEACVRTQSVRKCV  173

Query  674   FTSSLLASIWKGNNHEHDDL----DESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMET  507
             FTSSLLA +W+ N+  ++ L    DE+ W+DE  CR+ KLWFAL KT AEK AWR A   
Sbjct  174   FTSSLLACVWRQNSPRNNRLPTVVDENCWSDESLCRDKKLWFALGKTMAEKAAWRAARGR  233

Query  506   KVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEM  327
              +KLVTVCPALV  P F   ++  S+ YLKG + +  +G+LAT DV K AEAHV VYE M
Sbjct  234   DLKLVTVCPALVTGPGFRRRNSTGSIAYLKGARDLFAEGLLATVDVCKVAEAHVSVYEAM  293

Query  326   DYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGEIPA--RLCKSKLTRLL  162
                ACGRY+C+   I   E+A  LE +L +   +S+    + P    LC  K++R++
Sbjct  294   GSTACGRYICYDHIIQRKEEAAELERQLGIPNRISSETPTDHPTWFELCNRKISRIM  350



>ref|XP_009400169.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Musa acuminata subsp. 
malaccensis]
Length=362

 Score =   253 bits (647),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 129/272 (47%), Positives = 175/272 (64%), Gaps = 5/272 (2%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVA  861
             E ++VCVT   S+ G+ ++R+LL RGY VR  +  Q D E+++E    +      +  VA
Sbjct  50    EGRVVCVTGAVSFVGSAIVRRLLARGYAVRLLVDTQEDLEKLREKEMFQGGGVW-AAAVA  108

Query  860   RMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARR  681
              + DLD LC AF GC AVFH+SS +DP GISGY++ M  +E  A   VIEAC +T   R+
Sbjct  109   NVMDLDSLCRAFDGCTAVFHSSSSVDPRGISGYSKHMVDVEVRATERVIEACVRTESVRK  168

Query  680   CIFTSSLLASIWKGNNHEHDD----LDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAM  513
             C+FTSSLLA +W+  +  H      +D++ W+DE  CR+ KLWFAL KT AEK AWR A 
Sbjct  169   CVFTSSLLACVWRQRDPCHARRATIVDDNCWSDETICRDRKLWFALGKTMAEKAAWRVAR  228

Query  512   ETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYE  333
                + LVTVCPALV  P F H +   S+ YLKG Q M  +G+LAT DV++ A+AHV +YE
Sbjct  229   GRDLNLVTVCPALVTGPGFQHLNPTGSIAYLKGAQYMFAEGLLATVDVEQLADAHVSIYE  288

Query  332   EMDYGACGRYLCFGRTITTPEDAVLLENRLKM  237
              M+  ACGRY+C+   I T E+A  LE +L++
Sbjct  289   AMNRNACGRYICYDHVIQTGEEAAELERQLRL  320



>ref|XP_009416556.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Musa acuminata subsp. 
malaccensis]
Length=369

 Score =   253 bits (645),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 136/287 (47%), Positives = 181/287 (63%), Gaps = 6/287 (2%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlES-VVV  864
             + + VCVT G S+ G  ++  LL RGY VR  ++ Q D ++++E     EM +     V+
Sbjct  52    DERAVCVTGGISFVGFAVVNHLLDRGYTVRLALETQEDMDKLRETEMFGEMGRDGVWAVM  111

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
             A + DL+ LC AF GC  VFHTSS +DP G+SGY+++MA +E  AA  V+EAC +T   R
Sbjct  112   ASVMDLESLCRAFDGCVGVFHTSSVVDPGGLSGYSKQMAQMEVRAAELVVEACVRTQSVR  171

Query  683   RCIFTSSLLASIWKGNNHEHDD-----LDESSWTDEDFCRENKLWFALAKTRAEKVAWRK  519
             RC+FTSSLLA +W+ N+          +DE+ W+D+  CR+ KLWFAL KT AEK AWR 
Sbjct  172   RCVFTSSLLACVWRENSTPRSSRRPTIVDENCWSDQRVCRDKKLWFALGKTMAEKAAWRA  231

Query  518   AMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFV  339
             A    VKLVTVCPALV  P F   ++ SS+ YLKG Q ML +G+LAT DV+K AEAHV V
Sbjct  232   ARGRDVKLVTVCPALVTGPGFLRRNSTSSIAYLKGAQDMLTEGLLATIDVEKVAEAHVAV  291

Query  338   YEEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGEIP  198
             YE M   ACGRY+C+   I   E+A  LE +L +   +S     + P
Sbjct  292   YEAMSSTACGRYICYDHVIRRGEEAAELERQLGLPNRVSRDAHADCP  338



>ref|XP_011047301.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Populus euphratica]
Length=364

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 137/314 (44%), Positives = 192/314 (61%), Gaps = 11/314 (4%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVD---FeemkellreeemkqlESV  870
             E +LVCVTSG SY G  ++ +LL RGY VR  + N+ D     E++        K     
Sbjct  52    EEELVCVTSGVSYLGVAIVNRLLTRGYSVRIIVDNEEDKERLRELETSGEMRTSKNGIDA  111

Query  869   VVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAY  690
             V+A++T+++ L EAF+GCH VFHTS+F DP G+SGYT+ MA +E +A+ NV+EACS+T  
Sbjct  112   VMAKLTEVESLVEAFQGCHGVFHTSAFTDPAGLSGYTKSMAEIEVKASENVMEACSRTPS  171

Query  689   ARRCIFTSSLLASIWKGNN-HEHDDL-DESSWTDEDFCRENKLWFALAKTRAEKVAWRKA  516
              R C+ TSSLL  +W+    HE   + +  SW+DE  C   KLW+A+ K RAEK AW++A
Sbjct  172   VRNCVVTSSLLTCLWRDTTTHELPPVVNHESWSDESLCIRKKLWYAVGKLRAEKAAWKRA  231

Query  515   METKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVY  336
              E  +KL T+CP L+  P +   +  +++ YLKGGQ M + G+LAT DV K AEAH  V+
Sbjct  232   KERGLKLATICPGLITGPEYFGRNPTATIAYLKGGQEMFKDGLLATVDVMKLAEAHTCVF  291

Query  335   EEMDYGACGRYLCFGRTITTPEDA--VLLENRLKMQGLLSAYESGEIPAR--LCKSKLTR  168
             E M+  ACGRY+CF R I   ++A  + +E  +    ++S   S   PAR  L   KL  
Sbjct  292   EAMNKTACGRYICFDRVIQVEDEAERLAMEIGIPANQIVSEDASNCGPARFVLSNKKLCN  351

Query  167   LLFHTARRLSCKHR  126
             L+  T R  SC +R
Sbjct  352   LMSRTHR--SCYNR  363



>ref|XP_002300033.2| hypothetical protein POPTR_0001s34880g [Populus trichocarpa]
 gb|EEE84838.2| hypothetical protein POPTR_0001s34880g [Populus trichocarpa]
Length=364

 Score =   252 bits (643),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 135/307 (44%), Positives = 188/307 (61%), Gaps = 9/307 (3%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVD---FeemkellreeemkqlESV  870
             E +LVCVTSG SY G  ++ +LL RGY VR  + N+ D     E++        K     
Sbjct  52    EEELVCVTSGVSYLGVAIVNRLLTRGYSVRIIVDNEEDKERLRELETSGEMRTSKNGIDA  111

Query  869   VVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAY  690
             V+A++T+++ L EAF+GCH VFHTS+F DP G+SGYT+ MA +E +A+ NV+EACS+T  
Sbjct  112   VMAKLTEVESLVEAFQGCHGVFHTSAFTDPAGLSGYTKSMAEIEVKASENVMEACSRTPS  171

Query  689   ARRCIFTSSLLASIWKGNN-HEHDDL-DESSWTDEDFCRENKLWFALAKTRAEKVAWRKA  516
              R C+ TSSLL  +W+    HE   + +  SW+DE  C   KLW+A+ K RAEK AW++A
Sbjct  172   VRNCVVTSSLLTCLWRDTTTHELPPVVNHESWSDESLCIRKKLWYAVGKLRAEKAAWKRA  231

Query  515   METKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVY  336
              E  +KL T+CP L+  P +   +  +++ YLKGGQ M + G+LAT DV K AEAH  VY
Sbjct  232   EERGLKLATICPGLITGPEYFGRNPTATIAYLKGGQEMFKDGLLATVDVMKLAEAHTCVY  291

Query  335   EEMDYGACGRYLCFGRTITTPEDA--VLLENRLKMQGLLSAYESGEIPAR--LCKSKLTR  168
             E M+  ACGRY+CF R I   ++A  + +E  +    ++S   S   PAR  L   KL  
Sbjct  292   EAMNKTACGRYICFDRVIQVEDEAERLAMEIGISANQIVSEDASTCGPARFVLSNKKLCN  351

Query  167   LLFHTAR  147
             L+  T R
Sbjct  352   LMSRTHR  358



>ref|XP_009406301.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Musa acuminata subsp. 
malaccensis]
Length=368

 Score =   249 bits (637),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 137/299 (46%), Positives = 187/299 (63%), Gaps = 8/299 (3%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlES-VVVAR  858
             + VCVT G S+ G  ++ +LL RGY VR  +Q+Q D ++++E     EM +     V+A 
Sbjct  54    RTVCVTGGISFIGFAVVNRLLDRGYTVRLALQSQEDLDKLRETEMFGEMGRDGVWAVMAD  113

Query  857   MTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRC  678
             + +L+ L +AF GC  VFHTSS +DP G+SGYT+ MA  E  AA  V+EAC +T   RRC
Sbjct  114   VMNLESLRQAFDGCAGVFHTSSVVDPGGLSGYTKHMADKEVRAAELVVEACVRTQSVRRC  173

Query  677   IFTSSLLASIWKGN-----NHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAM  513
             +FTSSLLA +W+ N     +     +DE+ W+D+  CR+ KLW AL KT AEK AWR A 
Sbjct  174   VFTSSLLACVWRENTCTRSSRRATSVDENCWSDQSVCRDRKLWLALGKTMAEKAAWRAAR  233

Query  512   ETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYE  333
                +KLVTVCPALV    F   ++ SS+ YLKG + +  +G+LAT DV+K AEAHV VYE
Sbjct  234   GRDLKLVTVCPALVTGHGFRRRNSTSSIAYLKGARQLFTEGLLATIDVEKVAEAHVAVYE  293

Query  332   EMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGEIPA--RLCKSKLTRLL  162
              MD  ACGRY+C+   I + ++A  LE +L + G +S     + P    L   KL+RLL
Sbjct  294   AMDSTACGRYICYDHIIRSGQEATELERQLGLPGRISGDAHADHPTWVELSNRKLSRLL  352



>ref|XP_003567812.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Brachypodium distachyon]
Length=381

 Score =   250 bits (638),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 142/316 (45%), Positives = 194/316 (61%), Gaps = 15/316 (5%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlES-VVV  864
             E + VCVT G S+ G  ++ +LL  GY VR  ++ Q D ++++E+    E  +     V+
Sbjct  60    EARDVCVTGGISFVGLAVVDRLLRHGYTVRLALETQEDLDKLREMEMFRENGRDGVWTVM  119

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
             A + D + L  AF GC  VFHTSS +DP GISGYT+ MA LET+AA  V+EAC +T   R
Sbjct  120   ANVMDPESLHRAFNGCVGVFHTSSLVDPGGISGYTKHMASLETKAAERVVEACVRTESVR  179

Query  683   RCIFTSSLLASIWKGNNHEH----DDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKA  516
             +C+FTSSLLA +W+ +  +H      +DE+ W+DE FCR+NKLWFAL KT AEK AWR A
Sbjct  180   KCVFTSSLLACVWRQSYPQHRRFPTTVDENCWSDETFCRDNKLWFALGKTMAEKAAWRAA  239

Query  515   METKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVY  336
                 +KLVT+CPALV  P F   ++  S+ YLKG   M+ +G+LAT DV++ AEAHV VY
Sbjct  240   RGRDLKLVTICPALVTGPGFRRRNSTPSIAYLKGAHAMVAEGLLATTDVEQVAEAHVRVY  299

Query  335   EEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLL------SAYESGEIPA-RLCKSK  177
             E M+  A GRY+C+   +   E+ V LE +L +Q          A  +   P+  LC  K
Sbjct  300   EAMNGTAGGRYICYDHIVRRAEEFVELELQLGLQARAPPPHDEQAATAIATPSFELCNRK  359

Query  176   LTRLLFHTARRLSCKH  129
             LTRL+   + R  C H
Sbjct  360   LTRLV---SSRRRCTH  372



>ref|XP_002440306.1| hypothetical protein SORBIDRAFT_09g029490 [Sorghum bicolor]
 gb|EES18736.1| hypothetical protein SORBIDRAFT_09g029490 [Sorghum bicolor]
Length=367

 Score =   249 bits (635),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 140/306 (46%), Positives = 191/306 (62%), Gaps = 12/306 (4%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlES-VVVAR  858
             + VCVT G S+ G  ++  LL  GY VR  I+ Q D ++++E+    E  +     V+A 
Sbjct  52    RTVCVTGGTSFLGFAVVDCLLRHGYDVRLAIETQEDLDKLREMEMFGENGRDGVWTVIAN  111

Query  857   MTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRC  678
             + D + L EAF GC  VFHTSS +DP GISGYT+ MA LE +AA  V+EAC +T   R+C
Sbjct  112   VMDPESLHEAFDGCVGVFHTSSLVDPGGISGYTKHMARLEAKAAEQVVEACVRTESVRKC  171

Query  677   IFTSSLLASIWKGNNHEHD-----DLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAM  513
             + TSSLLA +W+  N+ HD      +DE+ W+DE FCR+NKLW +L KT AEK AWR A 
Sbjct  172   VLTSSLLACVWR-QNYPHDRRFPTTIDENCWSDESFCRDNKLWLSLGKTMAEKAAWRAAR  230

Query  512   ETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYE  333
              T +KLVT+CPALV  P F   +   S+ YLKG   ML +G+LAT +V++ AEAHV VYE
Sbjct  231   GTDLKLVTICPALVTGPGFRRRNPTPSIAYLKGAHAMLAEGLLATANVERVAEAHVRVYE  290

Query  332   EMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAY-ESGEIPAR--LCKSKLTRLL  162
             EM   A GRY+C+   +   E+   L+ +L + G + A  +  + P R  LC  KL+ L+
Sbjct  291   EMSGTAGGRYICYDHVVRRGEEFAELQRQLGLPGRVPATPDDDDRPPRFQLCNRKLSALM  350

Query  161   FHTARR  144
               +ARR
Sbjct  351   --SARR  354



>ref|XP_007215573.1| hypothetical protein PRUPE_ppa007494mg [Prunus persica]
 gb|EMJ16772.1| hypothetical protein PRUPE_ppa007494mg [Prunus persica]
Length=366

 Score =   244 bits (623),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 131/308 (43%), Positives = 191/308 (62%), Gaps = 15/308 (5%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVA  861
             E +LVCVTSG S+ G  L+ +LL+RGY VR  + N  D E++ E+       ++ S V+A
Sbjct  54    EGRLVCVTSGVSFLGLALVNRLLLRGYSVRILVDNPEDVEKLGEMSTRTNNNKI-SAVMA  112

Query  860   RMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARR  681
              + D++ L +AF GC  VFHTS+F DP G+SGYT+ MA +E +A+ NV++ACS TA  R+
Sbjct  113   NLADVESLSQAFHGCRGVFHTSAFTDPAGLSGYTKSMAEIEVKASENVMKACSLTASVRK  172

Query  680   CIFTSSLLASIWKGNNHEHDD---LDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAME  510
             C+ TSSLLA +W  ++++H+    ++   W+ E  C + KLW+AL K RAEK AWR A E
Sbjct  173   CVLTSSLLACVWHDSSNQHNPSPVINHDCWSSESLCTDKKLWYALGKLRAEKAAWRIAEE  232

Query  509   TKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEE  330
               +KL T+CPAL+  P F   +  +++ YLKG Q M + GVLAT D+ + A+AHV V+E 
Sbjct  233   KGMKLATICPALITGPEFSTRNPTATIAYLKGSQDMYQSGVLATVDIMRLADAHVCVFEA  292

Query  329   MDYGACGRYLCFGRTITTPEDAVLL-------ENRLKMQGLLSAYESGEIPARLCKSKLT  171
             M+  A GRY+CF + I T E A  L       +N++   G ++     ++   L   KLT
Sbjct  293   MNKAAFGRYICFDQVIETEEVAEKLAQETSMSKNKIMGNGSINV----QVRYELSNRKLT  348

Query  170   RLLFHTAR  147
              LL  + R
Sbjct  349   NLLSGSLR  356



>ref|XP_007031486.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY02412.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=362

 Score =   244 bits (622),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 137/311 (44%), Positives = 196/311 (63%), Gaps = 13/311 (4%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkq---lESV  870
             E KLVCVTSG S+ G  ++ +LL+RGY VR  + NQ D ++++E+ R  EM       SV
Sbjct  51    EEKLVCVTSGVSFLGLAIVNRLLLRGYSVRILVDNQEDVQKLREMERSGEMMACTNKISV  110

Query  869   VVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAY  690
             V+A+ T++  L EAF GC  VFHTS+F DP GISGY++ MA +E +A+ NV++AC++T  
Sbjct  111   VMAKPTEIQGLMEAFDGCRGVFHTSAFADPGGISGYSKSMAEIEVKASENVMKACARTPS  170

Query  689   ARRCIFTSSLLASIWKGNNHEHDD---LDESSWTDEDFCRENKLWFALAKTRAEKVAWRK  519
              R C+ TSSLLA IW+ ++ +HD    ++   W+DE  C + KLW+AL K +AEKVAW+ 
Sbjct  171   VRNCVLTSSLLACIWR-DSTQHDLPTLVNHDCWSDESLCMDKKLWYALGKLKAEKVAWKI  229

Query  518   AMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFV  339
             A E  +KL T+CP L+  P F   +  +++ YLKG Q M   G+LA  DV + AEAH+ V
Sbjct  230   AEEMGIKLTTICPGLITGPEFSLRNPTATIAYLKGAQEMYADGLLAIVDVSRLAEAHLSV  289

Query  338   YEEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGE-IPAR--LCKSKLTR  168
             +EEM+  A GRY+CF + I   E+A  L   + M       +S + IP R  +   KLT 
Sbjct  290   FEEMNKTAFGRYICFDQVIKREEEAEKLAREMGMPSNKICGDSFDIIPTRFDVSNKKLTN  349

Query  167   LLFHTARRLSC  135
             L+   +R+L C
Sbjct  350   LM---SRKLRC  357



>ref|XP_004306348.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Fragaria vesca subsp. 
vesca]
Length=356

 Score =   243 bits (620),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 140/317 (44%), Positives = 188/317 (59%), Gaps = 22/317 (7%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVA  861
             + KLVCVTSG S+ G  ++ +LL+RGY VR  + N VD EE++E+          +VV+A
Sbjct  45    DNKLVCVTSGVSFLGLAVVNRLLLRGYSVRIIVDNSVDVEELREMTTANVNV---TVVMA  101

Query  860   RMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARR  681
             ++ +++ L +AF+GC  VFHTS + DP G+SGYT+ MA +E  A  NV+ AC  TA  RR
Sbjct  102   KLAEVESLSQAFQGCRGVFHTSGYTDPAGLSGYTKSMAGIEVMATENVMRACV-TATVRR  160

Query  680   CIFTSSLLASIWKGNNHEHDDL------DESSWTDEDFCRENKLWFALAKTRAEKVAWRK  519
             C+ TSSLLA +W+    E +DL      +  SW++E  C   KLW+AL K RAEK AW  
Sbjct  161   CVLTSSLLACVWQ----EQNDLSTIPVINHDSWSNESLCIHKKLWYALGKLRAEKAAWTL  216

Query  518   AMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFV  339
             A ET +KL T+CP L+  P F   ++ +++ YLKG Q M R GVLAT DV + AEAHV V
Sbjct  217   AKETGLKLTTICPGLITGPEFCSRNSTATIAYLKGAQEMYRSGVLATVDVMRLAEAHVSV  276

Query  338   YEEMDYGACGRYLCFGRTITTPEDAVLL--ENRLKMQGLLSAYESGEIPA----RLCKSK  177
             YEE+   A GRY+CF + I T + A  L  E  L    +    E   I       L   K
Sbjct  277   YEEIKKSAFGRYICFDQVIETEKQAEKLAGETSLTRNKICGNEEGSSIVHHLRYELSNKK  336

Query  176   LTRLLFHTARRLSCKHR  126
             LT LL  T R  SC ++
Sbjct  337   LTNLLSRTLR--SCNNQ  351



>ref|XP_004961121.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Setaria italica]
Length=375

 Score =   243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 142/318 (45%), Positives = 190/318 (60%), Gaps = 26/318 (8%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlES-VVV  864
             E + VCVT G S+ G  ++ +LL  GY VR  ++ Q D ++++E+    E  +     V+
Sbjct  52    EARTVCVTGGTSFVGFAVVDRLLRHGYNVRLALETQEDLDKLREMEMFGENGRDRVWTVM  111

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
             A + D   L EAF GC  VFHTSS +DP GISGYT+ MA LE +AA  V+EAC +T   R
Sbjct  112   ANVMDPVSLHEAFDGCVGVFHTSSLVDPGGISGYTKHMARLEAKAAELVVEACVRTESVR  171

Query  683   RCIFTSSLLASIWKGNNHEHD-----DLDESSWTDEDFCRENKLWFALAKTRAEKVAWRK  519
             +C+FTSSLLA +W+  N+  D      +DE+ W+DE  CR+NKLWF+L KT AEK AWR 
Sbjct  172   KCVFTSSLLACVWR-QNYARDRRFPTTVDENCWSDESLCRDNKLWFSLGKTMAEKAAWRA  230

Query  518   AMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFV  339
             A  T +KLVTVCPALV  P F   +   S+ YLKG   ML +G+LAT +V++ AEAHV V
Sbjct  231   ARGTDLKLVTVCPALVTGPGFRRRNPTPSIAYLKGAHAMLAEGLLATANVERVAEAHVRV  290

Query  338   YEEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGEIPA------------  195
             YEEM+  A GRY+C+   +   E+   L+ +L     L A     +PA            
Sbjct  291   YEEMNGTAGGRYICYDHVVRRAEEFAELQRQLG----LRAPAGSRVPAASEPDGDDRAAR  346

Query  194   -RLCKSKLTRLLFHTARR  144
               LC  KLT L+  +ARR
Sbjct  347   FELCNRKLTALM--SARR  362



>ref|XP_008656701.1| PREDICTED: cinnamoyl-CoA reductase 1 isoform X2 [Zea mays]
Length=369

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 144/302 (48%), Positives = 194/302 (64%), Gaps = 14/302 (5%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellr--eeemkqlESVVVARM  855
             VCVT G S+ G  ++ +LL  GY VR  ++ Q D ++++E+    E+      S V+A +
Sbjct  51    VCVTGGISFVGFAVVDRLLRHGYTVRLALETQEDMDKLREMEMFGEDGRDGGVSTVMANV  110

Query  854   TDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCI  675
              D D L  AF GC  VFHTS+F+DP G+SGYT+ MA LE +AA  VIEAC +T   R+C+
Sbjct  111   MDPDGLRRAFDGCAGVFHTSAFVDPGGMSGYTKHMAALEAQAAERVIEACVRTESVRKCV  170

Query  674   FTSSLLASIWKGNNHEHD-----DLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAME  510
             FTSSLLA +W+  ++ HD      +DES W+DE FCR+NKLWFAL KT AEK AWR A  
Sbjct  171   FTSSLLACVWR-QDYPHDRRCPTTIDESCWSDESFCRDNKLWFALGKTAAEKAAWRAARG  229

Query  509   TKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEE  330
               +KLVT+CPALV  P F   ++ +S+ YLKG + ML  G+LAT +V+  AEAHV  YE 
Sbjct  230   RDLKLVTICPALVTGPGFRRRNSTASIAYLKGARAMLADGLLATANVETVAEAHVHAYEA  289

Query  329   M-DYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLS---AYESGEIPAR--LCKSKLTR  168
             M D  A GRY+C+   +  PE+   LE +L + G  +   A+ S + PAR  LCK KL+R
Sbjct  290   MGDNTAGGRYICYDHVVKRPEEFAELERQLGLPGGAAPAPAHGSDDRPARFELCKRKLSR  349

Query  167   LL  162
             L+
Sbjct  350   LM  351



>ref|XP_009595723.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Nicotiana tomentosiformis]
Length=367

 Score =   241 bits (616),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 132/308 (43%), Positives = 185/308 (60%), Gaps = 11/308 (4%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlES----  873
             E K VCVTSG S+ G  ++ +LL+RGY VR  ++ Q D E+++E+    EM+Q +S    
Sbjct  58    EEKKVCVTSGVSFLGIAIVNQLLLRGYSVRVIVEKQEDLEKLREMEITGEMRQSKSSTVE  117

Query  872   VVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTA  693
              V+A + D+  L EAF GC  VFHT++F+DP G+SGY++ MA +E   + N+ +AC+ T 
Sbjct  118   AVMANLNDVQSLSEAFNGCRGVFHTAAFVDPAGLSGYSKSMAEVEVMVSKNMTQACAVTP  177

Query  692   YARRCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAM  513
               + C+ TSSLLA +WK  N     +D  SW+DE  C   KLW+AL K +AE+VAW  A 
Sbjct  178   SVKYCMLTSSLLACVWKDLNS-STTIDNDSWSDESICINKKLWYALGKLKAERVAWNVAK  236

Query  512   ETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYE  333
             E+  KL T+CP LV  P F   +  S++ YLKG Q M R G+LAT DV++ A +HV V+E
Sbjct  237   ESGFKLATICPGLVTGPDFLSRNPTSTIAYLKGAQEMFRNGLLATVDVNRLAISHVLVFE  296

Query  332   EMDYGACGRYLCFGRTITTPEDAVLL------ENRLKMQGLLSAYESGEIPARLCKSKLT  171
             EM   A GRY+ F R I + ED   L      E R     ++ A  +  I  +L  +KL 
Sbjct  297   EMKNTASGRYISFERVIRSEEDFEKLARETGTEIRTSTNSIIGASNTHRIGIKLSNAKLC  356

Query  170   RLLFHTAR  147
             RL+  T R
Sbjct  357   RLMSATFR  364



>ref|XP_008675300.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Zea mays]
 tpg|DAA58405.1| TPA: hypothetical protein ZEAMMB73_758171 [Zea mays]
Length=372

 Score =   241 bits (616),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 147/323 (46%), Positives = 199/323 (62%), Gaps = 17/323 (5%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlES-VVVARMT  852
             VCVT G S+ G  ++ +LL  GY VR  ++ Q D ++++E+    +  +     V+A + 
Sbjct  58    VCVTGGISFVGFAVVDRLLRHGYTVRLALETQEDMDKLREMEMFGDDGRDGVWTVMANVM  117

Query  851   DLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIF  672
             D + L  AF GC  VFHTS+F+DP G+SGYT+ MA LE +AA  VIEAC +T   R+C+F
Sbjct  118   DPESLHRAFDGCAGVFHTSAFVDPGGMSGYTKHMATLEAQAAERVIEACVRTGSVRKCVF  177

Query  671   TSSLLASIWKGNNHEHDD----LDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETK  504
             TSSLLA +W+ NN         +DES W+DE FCR+NKLWFAL KT AEK AWR A    
Sbjct  178   TSSLLACVWRQNNPHGRRCPTIIDESCWSDESFCRDNKLWFALGKTAAEKAAWRAARGRD  237

Query  503   VKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEM-  327
             +KLVT+CPALV  P F   ++ +S+ YLKG + ML  G+LAT +V+  AEAHV  YE M 
Sbjct  238   LKLVTICPALVTGPGFRRRNSTASIAYLKGARAMLADGLLATANVETVAEAHVLAYEAMG  297

Query  326   DYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYE-SGEIPAR--LCKSKLTRLLFH  156
             D  A GRY+C+   +  PE+   LE +L + G  +A + S + PAR  LCK KL+RL+  
Sbjct  298   DNTAGGRYICYDHVVKRPEEFAELERQLGLPGGAAAAQGSDDRPARFELCKRKLSRLM--  355

Query  155   TARRLSCKHR*ALCDYYYYEGLD  87
              + R  C +     D YY    D
Sbjct  356   -SSRRRCTY-----DTYYSVAFD  372



>ref|XP_006646136.1| PREDICTED: cinnamoyl-CoA reductase 1-like, partial [Oryza brachyantha]
Length=329

 Score =   240 bits (612),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 149/320 (47%), Positives = 200/320 (63%), Gaps = 18/320 (6%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlES-VVVAR  858
             + VCVT G S+ G  ++ +LL  GY VR  ++ Q D ++++E+    E  +     V+A 
Sbjct  13    RTVCVTGGISFVGFAVVDRLLRHGYTVRLALETQEDLDKLREMEMFGEDGRDGVWTVMAN  72

Query  857   MTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRC  678
             +TD + L  AF GC  VFHTS+F+DP G+SGYT+ MA LE +AA  VIEAC +T   R+C
Sbjct  73    VTDPESLHRAFDGCAGVFHTSAFVDPGGMSGYTKHMASLEAKAAEQVIEACVRTGSVRKC  132

Query  677   IFTSSLLASIWKGNNHEHDD-----LDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAM  513
             +FTSSLLA +W+  N+  D      +DE+ W+DE FCR+NKLWFAL KT AEK AWR A 
Sbjct  133   VFTSSLLACVWR-QNYPPDRRFPTIIDENCWSDESFCRDNKLWFALGKTAAEKAAWRAAR  191

Query  512   ETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYE  333
                +KLVTVCPALV  P F   ++ +S+ YLKG + ML  G+LAT +V+  AEAHV VYE
Sbjct  192   GRDLKLVTVCPALVTGPGFRRRNSPASIAYLKGARAMLADGLLATANVETVAEAHVRVYE  251

Query  332   EM-DYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYE-SGEIPAR--LCKSKLTRL  165
              M +  A GRY+C+   +  PE+ V LE +L +    +A E SG+ PAR  LC  KL RL
Sbjct  252   AMGNNTAGGRYICYDHVVQRPEEFVELERQLGLPRRAAAVEDSGDRPARFELCMQKLARL  311

Query  164   LFHTARRLSCKHR*ALCDYY  105
                    +S + R    DYY
Sbjct  312   -------MSTRRRCTYDDYY  324



>gb|AFW81232.1| hypothetical protein ZEAMMB73_472948 [Zea mays]
Length=350

 Score =   240 bits (612),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 127/276 (46%), Positives = 175/276 (63%), Gaps = 8/276 (3%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlES-VVV  864
             E + VCVT G S+ G  ++ +LL  GY VR  ++ Q D ++++E+    E  +     V+
Sbjct  26    EARTVCVTGGTSFLGFAVVDRLLRHGYTVRLALETQEDLDKLREMEMFGENGRDGVWTVI  85

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
             A + D + L EAF GC  VFHTSS +DP GISGYT+ MA LE +AA  V+EAC +T   R
Sbjct  86    ANVMDPESLHEAFDGCVGVFHTSSHVDPAGISGYTKHMAGLEAKAAELVVEACVRTESVR  145

Query  683   RCIFTSSLLASIWKGNNHEHD------DLDESSWTDEDFCRENKLWFALAKTRAEKVAWR  522
             +C+ TSSLLA +W+  N+ HD       +DE+ W+DE  CR+NKLW +L KT AEK AWR
Sbjct  146   KCVLTSSLLACVWR-QNYPHDRRRFPTTIDENCWSDESLCRDNKLWLSLGKTMAEKAAWR  204

Query  521   KAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVF  342
              A  T +KLVT+CPALV  P F   +   S+ YLKG   ML QG+LAT +V++ AEAHV 
Sbjct  205   AARGTDLKLVTICPALVTGPGFRRRNPTPSIAYLKGAHAMLVQGLLATANVERVAEAHVR  264

Query  341   VYEEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQ  234
             VYEE+   A GRY+C+   +   E+   L+ +L ++
Sbjct  265   VYEELSGTAGGRYICYDHVVRRGEEFAELQRQLGLR  300



>gb|KFK25710.1| hypothetical protein AALP_AA8G149200 [Arabis alpina]
Length=369

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/274 (45%), Positives = 179/274 (65%), Gaps = 8/274 (3%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATI---QNQVDFeemkellreeemkqlESVVV  864
             +LVCVT G SY G  ++++LLV GY VR  +   +++    EM+            S VV
Sbjct  52    RLVCVTGGVSYLGRAIVKRLLVHGYSVRIVVDCLEDKEKVSEMEADAETASFSNRISSVV  111

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
             +R+T+++ L +AF GC  VFHTS+F+DP G+SGY++ MA LE + + NVIEAC++T   R
Sbjct  112   SRLTEIESLIKAFDGCAGVFHTSAFVDPAGVSGYSKSMAELEAKVSENVIEACTRTGSVR  171

Query  683   RCIFTSSLLASIWKGN---NHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAM  513
             +C+FTSSLLA  W+ N   N +H  ++E SW+DE  C +NKLW+AL K RAEK AWR A 
Sbjct  172   KCVFTSSLLACAWQDNSLNNLDHSVINEESWSDEQLCIDNKLWYALGKLRAEKAAWRIAE  231

Query  512   ETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYE  333
             E  +KL T+CPAL+  P F + ++ S+L YLKG + M   G+LAT DV++ A+AHV ++E
Sbjct  232   EKGLKLATICPALITGPDFFNRNSTSTLAYLKGAKEMYSNGLLATMDVNRLAKAHVCLWE  291

Query  332   EM-DYGACGRYLCFGRTITTPEDAVLLENRLKMQ  234
              + +  A GRY+CF  TI + + A  L   + +Q
Sbjct  292   GLGNKTAFGRYVCFD-TILSKDGAEKLAKDIGVQ  324



>ref|XP_004489265.1| PREDICTED: tetraketide alpha-pyrone reductase 2-like [Cicer arietinum]
Length=360

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 138/322 (43%), Positives = 193/322 (60%), Gaps = 13/322 (4%)
 Frame = -1

Query  1073  SNVFSSHLWCRER--KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkell-  903
             +N FSS L   ++   LVCVTSG SYFG  L+  LLV GY VR  + N  + E+++E+  
Sbjct  39    NNNFSSSLDDDDKGTTLVCVTSGVSYFGLALVNHLLVLGYSVRIIVDNPEEIEKLREMER  98

Query  902   --reeemkqlESVVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEA  729
               +         +++A++ D++ L +AF GC  VFHTSSFIDP G+SGYT+ +A +E   
Sbjct  99    DGKMRSNNINLEIIMAKVNDVESLEKAFEGCFGVFHTSSFIDPAGLSGYTKSIAEIEVSV  158

Query  728   AGNVIEACSKTAYARRCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAK  549
               NV+EAC++TA  +RC+FTSSL A +W+ N+H  + ++  SW+ E  C + KLW+AL K
Sbjct  159   TENVMEACARTASIKRCVFTSSLAACVWQHNSHS-NVINHHSWSSESLCIDKKLWYALGK  217

Query  548   TRAEKVAWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDV  369
             TRAEKVAWR A E  +KL T+CPAL+  P F   +  +++ YLKG Q M   G+LAT DV
Sbjct  218   TRAEKVAWRIANERGLKLTTICPALITGPEFCLRNPTATIAYLKGAQEMYYNGLLATVDV  277

Query  368   DKAAEAHVFVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLKM--QGLLSAYESGEIPA  195
              K AEAH  V++EM+  A GRY+C+   I    +   L   + M    +    ES     
Sbjct  278   KKVAEAHESVFKEMNGNASGRYICYDNVIEGTSEVEKLAKEIGMPKDKICGVDESNNSLH  337

Query  194   R--LCKSKLTRLLFHTARRLSC  135
             R  L   KL RL+   +R L C
Sbjct  338   RFQLSNDKLCRLM---SRPLRC  356



>ref|XP_010029161.1| PREDICTED: cinnamoyl-CoA reductase 2 [Eucalyptus grandis]
Length=374

 Score =   239 bits (610),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 131/307 (43%), Positives = 180/307 (59%), Gaps = 13/307 (4%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVD---FeemkellreeemkqlESVVVAR  858
             VCVTSG S+ G  ++ +LL+RGY VR  + N+ D     EM+        +   S VVA+
Sbjct  59    VCVTSGVSFLGRAVVNRLLLRGYSVRILVDNEEDVEKLREMETSGEMGSARSNFSAVVAK  118

Query  857   MTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRC  678
             + D+  LC+AF GC  VFHTS+F DP G+SGYT+ MA +E +A+ +V+EAC++T   RRC
Sbjct  119   LGDVQSLCKAFEGCAGVFHTSAFADPAGLSGYTKAMAQIEVKASESVMEACARTPSVRRC  178

Query  677   IFTSSLLASIWK--GNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETK  504
             + TSSLLA +W+    NH  + +    W+DE  C   KLW+AL K +AEK+AW+ A E  
Sbjct  179   VLTSSLLACVWRDTARNHLSNVIGPDCWSDETVCTNKKLWYALGKLKAEKIAWKIAEERG  238

Query  503   VKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMD  324
             +KL T+CPALV  P F   +  +++ YLKG   M   GVLAT DV + A+AHV V+E + 
Sbjct  239   LKLATICPALVTGPQFISRNPTATIAYLKGASEMYSDGVLATVDVTRLADAHVCVFEAII  298

Query  323   YGACGRYLCFGRTITTPEDAVLLENRLKMQ-----GLLSAYESGEIPA---RLCKSKLTR  168
               A GRY+CF R I   +DA  L   + M      G +   ES   P     L   KL+ 
Sbjct  299   NTASGRYICFDRVIGGEDDAARLAGEMGMPVDKICGGVGGGESSTQPRPRFELSNRKLSC  358

Query  167   LLFHTAR  147
             L+  T R
Sbjct  359   LMSRTLR  365



>gb|KEH24813.1| cinnamoyl-CoA reductase [Medicago truncatula]
Length=358

 Score =   238 bits (608),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 131/303 (43%), Positives = 179/303 (59%), Gaps = 7/303 (2%)
 Frame = -1

Query  1037  RKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVAR  858
             + LVCVTSG SY G  L+  LLV GY VR  + N  D  E    +R EEM+    +++A+
Sbjct  52    KTLVCVTSGVSYLGLALVNHLLVLGYSVRIIVDNPGD-REKLREIRHEEMRNNLEIIIAK  110

Query  857   MTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRC  678
             + D+D L +AF GC  +FHTS+F DP G+SGYT+ MA +E     NV+EAC++T   +RC
Sbjct  111   LNDVDSLVKAFEGCRGIFHTSAFTDPAGLSGYTKSMAEIEVNVTENVMEACARTPSIKRC  170

Query  677   IFTSSLLASIWKGNNHEH---DDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMET  507
             +FTSSL A IW+ N +       ++  SW+ E  C + KLW+AL K RAEK AWR A E 
Sbjct  171   VFTSSLAACIWQDNVNSDLTTPIINHGSWSSESLCIDKKLWYALGKMRAEKAAWRIANER  230

Query  506   KVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEM  327
              +KL T+CPAL+  P F H +  +++ YLKG Q M   G+LAT DV K AEAH  V++EM
Sbjct  231   GLKLTTICPALITGPEFCHRNPTATIAYLKGAQKMYSNGLLATVDVKKVAEAHACVFKEM  290

Query  326   DYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGEIPAR---LCKSKLTRLLFH  156
             +  A GRY+CF   I    +A  L   + M       ++  I  +   L  +KL RL+  
Sbjct  291   NENAYGRYICFDNVIDAQSEAEKLAKDIGMPKEKICGDASNISLQRYELSNNKLCRLMSR  350

Query  155   TAR  147
               R
Sbjct  351   PIR  353



>ref|XP_008458771.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Cucumis melo]
Length=363

 Score =   238 bits (608),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 121/263 (46%), Positives = 169/263 (64%), Gaps = 7/263 (3%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVA  861
             E K+VCVTSG S+ G+ ++ +L   GY VR  + N  D  +++E           +VVVA
Sbjct  49    EEKVVCVTSGVSFLGSAIVEELSTHGYSVRVIVDNPEDVNKLEETTSGRHNV---TVVVA  105

Query  860   RMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARR  681
             ++TD++ L EAF GC  VFHTSS IDP G+SGYT+ M+ +E     NV+EACS+T   R 
Sbjct  106   KLTDVNSLVEAFNGCRGVFHTSSSIDPAGLSGYTKVMSEVEMRNTENVMEACSRTETVRN  165

Query  680   CIFTSSLLASIWK---GNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAME  510
             C+ TSSLLA IW+   G N     +D +SW+  + C+  KLW AL K ++EKVAW+ A E
Sbjct  166   CVLTSSLLACIWRDQHGENETSQIVDHASWSSLELCQHKKLWLALGKLKSEKVAWKIAQE  225

Query  509   TKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEE  330
             + +KL T+C AL+  P+F    + ++L YLKG + M   G+LAT DV K A+AH++VYE 
Sbjct  226   SGLKLATICSALITGPNFHLRSSTATLAYLKGAREMYANGLLATVDVTKLAKAHLYVYEG  285

Query  329   M-DYGACGRYLCFGRTITTPEDA  264
             M D  A GRY+CF R I+T ++A
Sbjct  286   MKDNAASGRYICFDRVISTADEA  308



>ref|XP_007151024.1| hypothetical protein PHAVU_004G012500g [Phaseolus vulgaris]
 gb|ESW23018.1| hypothetical protein PHAVU_004G012500g [Phaseolus vulgaris]
Length=356

 Score =   238 bits (607),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 151/351 (43%), Positives = 204/351 (58%), Gaps = 21/351 (6%)
 Frame = -1

Query  1151  RSIKMAME--CRNELSFALPVEPPRRCASNVFSSHLWCRER-KLVCVTSGNSYFGAHLIR  981
              S KM ME  CR  ++ A   +   R    V S      E+  L+CVTSG SY G  L+ 
Sbjct  8     ESKKMEMEAFCRKLVAAAGKADEGGRNHHFVCSHDEDVDEKGSLLCVTSGVSYVGLALVN  67

Query  980   KLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTDLDCLCEAFRGCHAVFH  801
              LL  GY +R T+ N  + E++KE+ +  E K     ++A++TD+D L +AF GC  VFH
Sbjct  68    HLLQLGYSLRITVDNPEEMEKVKEIEKSGEGKL--EAIMAKLTDIDGLQKAFEGCRGVFH  125

Query  800   TSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTSSLLASIWKGNNHEHD  621
             TS+F DP G+SGYT+ MA +E   A NV+EAC++TA  ++C+FTSSL A +W+ +N E D
Sbjct  126   TSAFTDPAGLSGYTKSMAEIEVRVAENVMEACARTASIKKCVFTSSLAACVWQ-DNAESD  184

Query  620   D---LDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTVCPALVMAPSFPH  450
                 ++ +SW+ E FC E KLW+AL K RAEK AWR A E  +KL T+CPAL+  P F H
Sbjct  185   VTPVINHTSWSSESFCIEKKLWYALGKMRAEKAAWRIANEKGLKLTTICPALITGPQFCH  244

Query  449   ADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGRYLCFGRTITTPE  270
              +  +++ YLKGGQ M   G+LAT DV K AEAH  V + M+  A GRY+CF + I +  
Sbjct  245   RNPTATIAYLKGGQEMYSLGLLATVDVTKLAEAHASVLKAMNNNASGRYICFDKVIDSQI  304

Query  269   DAVLLENRLKMQGLLSAYESGEIPA------RLCKSKLTRLLFHTARRLSC  135
              A   EN  K  G+      GE          L   KL RL+   +R L C
Sbjct  305   GA---ENLAKEIGVPKEKICGEASKSSVQRFELSNEKLCRLM---SRPLRC  349



>ref|XP_002458214.1| hypothetical protein SORBIDRAFT_03g029100 [Sorghum bicolor]
 gb|EES03334.1| hypothetical protein SORBIDRAFT_03g029100 [Sorghum bicolor]
Length=381

 Score =   239 bits (609),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 148/325 (46%), Positives = 199/325 (61%), Gaps = 20/325 (6%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlES-VVVARMT  852
             VCVT G S+ G  ++ +LL  GY VR  ++ Q D ++++E+    E  +     V+A + 
Sbjct  66    VCVTGGISFVGFAVVDRLLRHGYTVRLALETQEDMDKLREMEMFGEDGRDGVWTVMANVM  125

Query  851   DLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIF  672
             D + L  AF GC  VFHTS+F+DP G+SGYT+ MA LE +AA  VIEAC +T   R+C+F
Sbjct  126   DPESLHRAFDGCAGVFHTSAFVDPGGMSGYTKHMATLEAQAAERVIEACVRTESVRKCVF  185

Query  671   TSSLLASIWKGNNHEHDD-----LDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMET  507
             TSSLLA +W+  N+ HD      +DES W+DE FCR+NKLWFAL KT AEK AWR A   
Sbjct  186   TSSLLACVWR-QNYPHDRRCPTIIDESCWSDESFCRDNKLWFALGKTAAEKAAWRAARGR  244

Query  506   KVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEM  327
              +KLVT+CPALV  P F   ++ +S+ YLKG + ML  G+LAT +V+  AEAHV  YE M
Sbjct  245   DLKLVTICPALVTGPGFRRRNSTASIAYLKGARAMLADGLLATANVETVAEAHVHAYEAM  304

Query  326   -DYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGEI--PAR--LCKSKLTRLL  162
              D  A GRY+C+   +  PE+   LE +L + G  +A    +   PAR  LCK KL+RL+
Sbjct  305   GDNTAGGRYICYDHVVKRPEEFAELERQLGLPGGATAARGSDDDRPARFELCKRKLSRLM  364

Query  161   FHTARRLSCKHR*ALCDYYYYEGLD  87
                + R  C +     D YY    D
Sbjct  365   ---SSRRRCTY-----DTYYSVAFD  381



>ref|XP_010108781.1| Anthocyanidin reductase [Morus notabilis]
 gb|EXC20296.1| Anthocyanidin reductase [Morus notabilis]
Length=369

 Score =   238 bits (607),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 128/302 (42%), Positives = 180/302 (60%), Gaps = 11/302 (4%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTD  849
             VCVTSG S+ G  L+  LL RGY VR  ++N  D E ++E+          S  +AR+TD
Sbjct  59    VCVTSGLSFLGIALVNNLLARGYSVRIVVENPEDLEIIQEMETTNSNI---SATMARLTD  115

Query  848   LDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFT  669
             ++ L EAF+ C  VFHTSSFIDP G+SGYT+ M  +E  A+ NVI+AC++T   ++C+FT
Sbjct  116   VESLPEAFKDCRGVFHTSSFIDPTGVSGYTKYMVDVEARASENVIKACARTPSVKKCVFT  175

Query  668   SSLLASIWKG---NNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVK  498
             SSLLA +W+    N      ++   W+DE  C + KLW+AL K RAEK AW+ A E+ + 
Sbjct  176   SSLLACLWQDRAQNESNSSVINHDCWSDESVCIDKKLWYALGKIRAEKSAWKVAEESGLN  235

Query  497   LVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYG  318
             + T+CP L+  P F   ++ ++  YLKG + M   GVLAT DVD+ AEAHV V+E ++  
Sbjct  236   MATLCPGLITGPEFCSRNSTATFAYLKGAEEMYESGVLATMDVDRLAEAHVCVFEALNKT  295

Query  317   ACGRYLCFGRTITTPEDAVLLENRLKMQ-----GLLSAYESGEIPARLCKSKLTRLLFHT  153
               GRY+CF R I   EDA  L + + M      G  S+  S +   +L   KL+ L+   
Sbjct  296   TGGRYVCFDRVIQEEEDAEKLASEMSMPKTRICGTGSSSFSTDNVFQLSDKKLSSLMSTA  355

Query  152   AR  147
              R
Sbjct  356   LR  357



>ref|NP_001146745.1| uncharacterized protein LOC100280347 [Zea mays]
 gb|ACL54667.1| unknown [Zea mays]
 gb|AFW81231.1| LOW QUALITY PROTEIN: dihydroflavonol-4-reductase [Zea mays]
Length=373

 Score =   238 bits (607),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 126/272 (46%), Positives = 173/272 (64%), Gaps = 8/272 (3%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlES-VVVARMT  852
             VCVT G S+ G  ++ +LL  GY VR  ++ Q D ++++E+    E  +     V+A + 
Sbjct  53    VCVTGGTSFLGFAVVDRLLRHGYTVRLALETQEDLDKLREMEMFGENGRDGVWTVIANVM  112

Query  851   DLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIF  672
             D + L EAF GC  VFHTSS +DP GISGYT+ MA LE +AA  V+EAC +T   R+C+ 
Sbjct  113   DPESLHEAFDGCVGVFHTSSHVDPAGISGYTKHMAGLEAKAAELVVEACVRTESVRKCVL  172

Query  671   TSSLLASIWKGNNHEHD------DLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAME  510
             TSSLLA +W+  N+ HD       +DE+ W+DE  CR+NKLW +L KT AEK AWR A  
Sbjct  173   TSSLLACVWR-QNYPHDRRRFPTTIDENCWSDESLCRDNKLWLSLGKTMAEKAAWRAARG  231

Query  509   TKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEE  330
             T +KLVT+CPALV  P F   +   S+ YLKG   ML QG+LAT +V++ AEAHV VYEE
Sbjct  232   TDLKLVTICPALVTGPGFRRRNPTPSIAYLKGAHAMLVQGLLATANVERVAEAHVRVYEE  291

Query  329   MDYGACGRYLCFGRTITTPEDAVLLENRLKMQ  234
             +   A GRY+C+   +   E+   L+ +L ++
Sbjct  292   LSGTAGGRYICYDHVVRRGEEFAELQRQLGLR  323



>ref|NP_001288486.1| cinnamoyl-CoA reductase 1 [Zea mays]
 gb|ACR34585.1| unknown [Zea mays]
 gb|AFW83387.1| hypothetical protein ZEAMMB73_643711 [Zea mays]
Length=370

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 144/303 (48%), Positives = 194/303 (64%), Gaps = 15/303 (5%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellr--eeemkqlESVVVARM  855
             VCVT G S+ G  ++ +LL  GY VR  ++ Q D ++++E+    E+      S V+A +
Sbjct  51    VCVTGGISFVGFAVVDRLLRHGYTVRLALETQEDMDKLREMEMFGEDGRDGGVSTVMANV  110

Query  854   TDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCI  675
              D D L  AF GC  VFHTS+F+DP G+SGYT+ MA LE +AA  VIEAC +T   R+C+
Sbjct  111   MDPDGLRRAFDGCAGVFHTSAFVDPGGMSGYTKHMAALEAQAAERVIEACVRTESVRKCV  170

Query  674   FTSSLLASIWKGNNHEHD-----DLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAME  510
             FTSSLLA +W+  ++ HD      +DES W+DE FCR+NKLWFAL KT AEK AWR A  
Sbjct  171   FTSSLLACVWR-QDYPHDRRCPTTIDESCWSDESFCRDNKLWFALGKTAAEKAAWRAARG  229

Query  509   TKVKLVTVCPALVMAPSFPHADTESSLPYLK-GGQVMLRQGVLATEDVDKAAEAHVFVYE  333
               +KLVT+CPALV  P F   ++ +S+ YLK G + ML  G+LAT +V+  AEAHV  YE
Sbjct  230   RDLKLVTICPALVTGPGFRRRNSTASIAYLKAGARAMLADGLLATANVETVAEAHVHAYE  289

Query  332   EM-DYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLS---AYESGEIPAR--LCKSKLT  171
              M D  A GRY+C+   +  PE+   LE +L + G  +   A+ S + PAR  LCK KL+
Sbjct  290   AMGDNTAGGRYICYDHVVKRPEEFAELERQLGLPGGAAPAPAHGSDDRPARFELCKRKLS  349

Query  170   RLL  162
             RL+
Sbjct  350   RLM  352



>ref|XP_008341448.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Malus domestica]
Length=359

 Score =   237 bits (605),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/256 (47%), Positives = 167/256 (65%), Gaps = 3/256 (1%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVA  861
             E  LVCVTSG S+ G  L+ +LL RGY VR  + NQ D E+++E+          S V+A
Sbjct  50    EDMLVCVTSGVSFLGLALVDRLLRRGYSVRLVVDNQEDVEKLREMRTSGSTDDRISAVMA  109

Query  860   RMTD-LDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
             ++TD ++ L  AF GC  VFHTS+F+DP G+SGYT+ MA +E +A+ NV++AC+ T   R
Sbjct  110   KLTDDVESLSHAFDGCRGVFHTSAFVDPAGLSGYTKSMAEIEVKASENVMKACAVTPSVR  169

Query  683   RCIFTSSLLASIWKGN--NHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAME  510
             +C+ TSSLLA +W+ +  NH    ++  SW+ E  C + KLW+AL K RAEK AW+ A E
Sbjct  170   KCVLTSSLLACVWQXSTXNHLSPVINHDSWSTESLCIDKKLWYALGKLRAEKAAWKIAEE  229

Query  509   TKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEE  330
               VKL T+CPAL+  P     +  ++L YLKG Q M + GVLAT D+ + AEAH+ V+E 
Sbjct  230   KGVKLATICPALITGPEISTRNPTATLAYLKGAQEMYQSGVLATVDITRLAEAHLGVFEA  289

Query  329   MDYGACGRYLCFGRTI  282
             M+  A GRY+CF R +
Sbjct  290   MNEAAFGRYICFDRVV  305



>ref|NP_001056413.1| Os05g0578500 [Oryza sativa Japonica Group]
 gb|AAT39157.1| putative cinnamoyl CoA reductase [Oryza sativa Japonica Group]
 gb|AAU10688.1| putative cinnamoyl CoA reductase [Oryza sativa Japonica Group]
 dbj|BAF18327.1| Os05g0578500 [Oryza sativa Japonica Group]
 gb|EAY99157.1| hypothetical protein OsI_21116 [Oryza sativa Indica Group]
 gb|EEE64805.1| hypothetical protein OsJ_19661 [Oryza sativa Japonica Group]
Length=379

 Score =   238 bits (606),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 144/337 (43%), Positives = 193/337 (57%), Gaps = 27/337 (8%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlES-VVV  864
             E + VCVT G S+ G  ++ +LL  GY VR  ++ Q D ++++E+    E  +     V+
Sbjct  51    EARTVCVTGGISFVGLAVVDRLLRHGYAVRLALETQEDLDKLREMEMFGENGRDGVWTVM  110

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
             A + D + L +AF GC  VFHTSS IDP GISGYT+ MA LE  AA  V+EAC +T   R
Sbjct  111   ANVMDPESLNQAFNGCVGVFHTSSLIDPGGISGYTKHMAILEARAAEQVVEACVRTESVR  170

Query  683   RCIFTSSLLASIWKGNNHEHDD-----LDESSWTDEDFCRENKLWFALAKTRAEKVAWRK  519
             +C+FTSSLLA +W+ +   H       +DES W+DE FCR+NKLWFAL KT AEK AWR 
Sbjct  171   KCVFTSSLLACVWRQSYPHHRRRFPAIIDESCWSDESFCRDNKLWFALGKTMAEKAAWRA  230

Query  518   AMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFV  339
             A    +KLVT+CPALV  P F   ++  S+ YLKG   ML +G+LAT DV++ AEAHV V
Sbjct  231   ARGRDLKLVTICPALVTGPGFRRRNSTPSIAYLKGAHAMLAEGLLATADVERVAEAHVRV  290

Query  338   YEEMD--YGACGRYLCFGRTITTPEDAVLLENRLKM--QGLLSAYESGEIPAR-------  192
             YE M     A GRY+C+   +   E+   L+ +L +   G+ +A   G            
Sbjct  291   YEAMSGGGAAGGRYICYDHVVRRGEEFAELQRQLGLPITGVAAASRPGYSDDGDVGGDGR  350

Query  191   --LCKSKLTRLLFHTARRLSCKHR*ALCDYYYYEGLD  87
               LC  KL RL+   + R  C +     D YY    D
Sbjct  351   FALCNGKLARLV---SSRRRCTY-----DVYYPASYD  379



>ref|XP_008230591.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Prunus mume]
Length=367

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 129/301 (43%), Positives = 183/301 (61%), Gaps = 6/301 (2%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARM  855
             KLVCVTSG S+ G  L+ +LL+RGY VR  + N  D E++ E        ++ S ++A +
Sbjct  56    KLVCVTSGVSFLGLALVNRLLLRGYSVRILVDNPEDVEKLGETRTRTNNNKI-SAIMANL  114

Query  854   TDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCI  675
              D++ L +AF GC  VFHTS+F DP G+SGYT+ MA +E +A+ NV++ACS T   R+C+
Sbjct  115   ADVESLSQAFHGCRGVFHTSAFTDPAGLSGYTKSMAEIEVKASENVMKACSLTDSVRKCV  174

Query  674   FTSSLLASIWKGNNHEHDD--LDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKV  501
              TSSLLA +W  +N ++    ++   W+ E  C + KLW+AL K RAEK AW+ A E  +
Sbjct  175   LTSSLLACVWHDSNQDNPSPVINHDCWSSESLCIDKKLWYALGKLRAEKAAWKIAEEKGI  234

Query  500   KLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDY  321
             KL T+CPAL+  P F   +  +++ YLKG Q M + GVLAT D+ + A+AHV V+E M+ 
Sbjct  235   KLATICPALITGPEFFTRNPTATIAYLKGSQDMYQSGVLATVDMMRLADAHVCVFEAMNK  294

Query  320   GACGRYLCFGRTITTPEDAVLLENRLKM-QGLLSAYESGEIPAR--LCKSKLTRLLFHTA  150
              A GRY+CF + I T E A  L     M +  +    S  +  R  L   KLT LL  + 
Sbjct  295   AAFGRYICFDQVIETEEVAEKLAQETSMSKNKIMGNGSINVQVRYELSNRKLTNLLSGSL  354

Query  149   R  147
             R
Sbjct  355   R  355



>ref|XP_006399984.1| hypothetical protein EUTSA_v10013866mg [Eutrema salsugineum]
 gb|ESQ41437.1| hypothetical protein EUTSA_v10013866mg [Eutrema salsugineum]
Length=370

 Score =   236 bits (602),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 123/274 (45%), Positives = 177/274 (65%), Gaps = 8/274 (3%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATI---QNQVDFeemkellreeemkqlESVVV  864
             +LVCVT G SY G  ++++LLV GY VR  +   +++    EM+            + VV
Sbjct  52    RLVCVTGGVSYLGRAIVKRLLVHGYSVRIVVDCPEDKEKVSEMEADAETASFSNRITSVV  111

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
             +R+T+ + L +AF GC  VFHT++F+DP GISGY++ MA LET+ + NVIEAC++T   R
Sbjct  112   SRLTETESLVQAFDGCAGVFHTAAFVDPAGISGYSKSMAELETKVSENVIEACTRTGSVR  171

Query  683   RCIFTSSLLASIWKGN---NHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAM  513
             +C+FTSSLLA  W+ +   N +H  ++E SW+DE  C  NKLW+AL K RAEK AWR A 
Sbjct  172   KCVFTSSLLACAWQDDYVYNFDHSVINEESWSDEQLCINNKLWYALGKLRAEKAAWRIAD  231

Query  512   ETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYE  333
                +KL T+CPAL+  P F H ++ S+L YLKG + M   G+LAT DV++ A+AHV ++E
Sbjct  232   SKGLKLATICPALINGPDFFHCNSTSTLAYLKGAKEMYINGLLATMDVNRLAKAHVCLWE  291

Query  332   EM-DYGACGRYLCFGRTITTPEDAVLLENRLKMQ  234
              + +  A GRY+CF  TI + + A  L   + +Q
Sbjct  292   GLGNKTAFGRYICFD-TILSKDGAEKLAKDIGVQ  324



>ref|XP_003569424.1| PREDICTED: cinnamoyl-CoA reductase 2 [Brachypodium distachyon]
Length=368

 Score =   236 bits (602),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 150/324 (46%), Positives = 200/324 (62%), Gaps = 21/324 (6%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlES-VVVAR  858
             + VCVT G S+ G  ++ +LL +GY VR  ++ Q D ++++E+    E  +     V+A 
Sbjct  48    RTVCVTGGISFVGFAIVDRLLRQGYTVRLALETQEDVDKLREMEMFGEDGRDGVWTVMAN  107

Query  857   MTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRC  678
             + D + L  AF GC  VFHTS+F+DP G+SGYT+ MA LE +AA  VIE C +T   R+C
Sbjct  108   VMDPESLHRAFDGCAGVFHTSAFVDPGGMSGYTKHMASLEAKAAERVIETCVRTESVRKC  167

Query  677   IFTSSLLASIWKGNNHEHDD-----LDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAM  513
             IFTSSLLA +W+  N+ HD      +DE+ W+DE FCR+NKLWFAL KT AEK AWR A 
Sbjct  168   IFTSSLLACVWR-QNYPHDRRGPSIIDENCWSDESFCRDNKLWFALGKTAAEKAAWRAAR  226

Query  512   ETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYE  333
                +KLVTVCPALV  P F   ++ +S+ YLKG + ML +GVLAT +V+  AEAHV  YE
Sbjct  227   GRDLKLVTVCPALVTGPGFRRRNSTASIAYLKGSRDMLAEGVLATANVETVAEAHVRAYE  286

Query  332   EM-DYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSA--YESG--EIPAR--LCKSKL  174
              M +  A GRY+C+   I   ED   LE +L +    +A   +SG  + PAR  LCK KL
Sbjct  287   AMGNNTAGGRYICYDHVIRRAEDFAELERQLGIPSRTAASVLQSGDEDRPARFELCKRKL  346

Query  173   TRLLFHTARRLSCKHR*ALCDYYY  102
              RL       +S + R    DYYY
Sbjct  347   ARL-------MSSRRRCTYDDYYY  363



>gb|KCW56013.1| hypothetical protein EUGRSUZ_I01783 [Eucalyptus grandis]
Length=488

 Score =   239 bits (610),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 131/307 (43%), Positives = 180/307 (59%), Gaps = 13/307 (4%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVD---FeemkellreeemkqlESVVVAR  858
             VCVTSG S+ G  ++ +LL+RGY VR  + N+ D     EM+        +   S VVA+
Sbjct  173   VCVTSGVSFLGRAVVNRLLLRGYSVRILVDNEEDVEKLREMETSGEMGSARSNFSAVVAK  232

Query  857   MTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRC  678
             + D+  LC+AF GC  VFHTS+F DP G+SGYT+ MA +E +A+ +V+EAC++T   RRC
Sbjct  233   LGDVQSLCKAFEGCAGVFHTSAFADPAGLSGYTKAMAQIEVKASESVMEACARTPSVRRC  292

Query  677   IFTSSLLASIWK--GNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETK  504
             + TSSLLA +W+    NH  + +    W+DE  C   KLW+AL K +AEK+AW+ A E  
Sbjct  293   VLTSSLLACVWRDTARNHLSNVIGPDCWSDETVCTNKKLWYALGKLKAEKIAWKIAEERG  352

Query  503   VKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMD  324
             +KL T+CPALV  P F   +  +++ YLKG   M   GVLAT DV + A+AHV V+E + 
Sbjct  353   LKLATICPALVTGPQFISRNPTATIAYLKGASEMYSDGVLATVDVTRLADAHVCVFEAII  412

Query  323   YGACGRYLCFGRTITTPEDAVLLENRLKMQ-----GLLSAYESGEIPA---RLCKSKLTR  168
               A GRY+CF R I   +DA  L   + M      G +   ES   P     L   KL+ 
Sbjct  413   NTASGRYICFDRVIGGEDDAARLAGEMGMPVDKICGGVGGGESSTQPRPRFELSNRKLSC  472

Query  167   LLFHTAR  147
             L+  T R
Sbjct  473   LMSRTLR  479



>ref|XP_009375115.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Pyrus x 
bretschneideri]
 ref|XP_009377211.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Pyrus x 
bretschneideri]
Length=361

 Score =   235 bits (600),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 121/258 (47%), Positives = 166/258 (64%), Gaps = 5/258 (2%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVA  861
             E  LVCVTSG S+ G  L+ +LL RGY VR  + NQ D E+++E+          S V+A
Sbjct  50    EDMLVCVTSGVSFLGLALVDRLLRRGYSVRLVVDNQEDVEKLREMRTGGSTDDRISAVMA  109

Query  860   RMTDLD---CLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAY  690
             ++TD D    L  AF GC  VFHTS+F+DP G+SGYT+ MA +E +A+ NV++AC+ T  
Sbjct  110   KLTDDDDVESLSHAFDGCRGVFHTSAFVDPAGLSGYTKSMAEIEVKASENVMKACAVTPS  169

Query  689   ARRCIFTSSLLASIWKGN--NHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKA  516
              R+C+FTSSLLA +W+ +  N     ++  SW+ E  C + KLW+AL K RAEK AW+ A
Sbjct  170   VRKCVFTSSLLACVWQDSTRNDLSPVINHDSWSTESLCIDKKLWYALGKLRAEKAAWKIA  229

Query  515   METKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVY  336
              E  VKL T+CPAL+  P     +  ++L YLKG Q M + GVLAT D+ + AEAHV V+
Sbjct  230   EEKGVKLATICPALITGPEISTRNPTATLAYLKGAQQMYQSGVLATVDITRLAEAHVGVF  289

Query  335   EEMDYGACGRYLCFGRTI  282
             E M+  A GRY+CF + +
Sbjct  290   EAMNKAAFGRYICFDQVV  307



>ref|XP_002873686.1| hypothetical protein ARALYDRAFT_488312 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49945.1| hypothetical protein ARALYDRAFT_488312 [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/274 (44%), Positives = 179/274 (65%), Gaps = 8/274 (3%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATI---QNQVDFeemkellreeemkqlESVVV  864
             +LVCVT G SY G  ++++LLV GY VR  +   +++    EM+            + VV
Sbjct  53    RLVCVTGGVSYLGRAIVKRLLVHGYSVRIVVDCPEDKEKVSEMEADAETASFSNRITSVV  112

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
             +R+T+++ L +AF GC  VFHTS+F+DP G+SGY++ MA LE + + NVIEAC++T+  R
Sbjct  113   SRLTEIESLLKAFDGCAGVFHTSAFVDPAGVSGYSKSMAELEAKVSENVIEACTRTSSVR  172

Query  683   RCIFTSSLLASIWKGNNHEHDD---LDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAM  513
             +C+FTSSLLA  W+ N + + D   ++E SW+DE  C +NKLW+AL K +AEK AWR A 
Sbjct  173   KCVFTSSLLACTWQNNTYNNLDYSVINEESWSDEQLCIDNKLWYALGKLKAEKAAWRIAD  232

Query  512   ETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYE  333
                +KL T+CPAL+  P F + ++ S+L YLKG + M   G+LAT DV+K A+AHV ++E
Sbjct  233   SKGLKLATICPALITGPDFFNRNSTSTLAYLKGAKEMYSNGLLATMDVNKLAKAHVCLWE  292

Query  332   EM-DYGACGRYLCFGRTITTPEDAVLLENRLKMQ  234
              + +  A GRY+CF  TI + + A  L   + +Q
Sbjct  293   GLGNKTAFGRYICFD-TILSRDGAEKLAKDIGVQ  325



>emb|CDP02106.1| unnamed protein product [Coffea canephora]
Length=361

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/261 (46%), Positives = 169/261 (65%), Gaps = 5/261 (2%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARM  855
             KLVCVTSG S+ G  ++ +LL+RGY VR  + NQ D E+++E+   EEM+   ++V A M
Sbjct  55    KLVCVTSGVSFLGIAIVNQLLLRGYSVRLIVHNQEDVEKVREIKASEEMRGSNNMVEAVM  114

Query  854   TDL---DCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
              +L   + L EAF GC  VFHT++F+DP G+SGY++ MA +E +A  N++EAC+  +  R
Sbjct  115   ANLSQVESLIEAFEGCGGVFHTAAFVDPAGLSGYSKTMAQIEVKATKNIVEACAAASSVR  174

Query  683   RCIFTSSLLASIW--KGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAME  510
             +C+ TSSLLA +W  K  N+    +D+  W+DE  C   KLW+AL K RAEK AW  A E
Sbjct  175   QCVLTSSLLACVWQDKSINNTSLIIDQKCWSDESVCINKKLWYALGKLRAEKAAWELAKE  234

Query  509   TKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEE  330
               +KL T+CP LV  P F +    S++ YLKG   M   GVLAT DV + A+AH+ VYEE
Sbjct  235   RGLKLATICPGLVTGPEFHYRGLTSTIAYLKGAGEMYADGVLATVDVSRLAKAHICVYEE  294

Query  329   MDYGACGRYLCFGRTITTPED  267
             M   + GRY+CF R + + E+
Sbjct  295   MKKTSVGRYICFDRRLESQEE  315



>ref|XP_009121639.1| PREDICTED: cinnamoyl-CoA reductase 2 [Brassica rapa]
Length=368

 Score =   234 bits (597),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 124/274 (45%), Positives = 175/274 (64%), Gaps = 8/274 (3%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVD---FeemkellreeemkqlESVVV  864
             +LVCVT G SY G  ++++LLV GY VR  I  + D     EM+            + VV
Sbjct  52    RLVCVTGGVSYLGRAIVKRLLVHGYTVRIVIDCEEDKEKVSEMEADAETASFSNRITSVV  111

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
             +R+T+++ L +AF GC  VFHT++F+DP GISGY++ MA LE + + NV EAC++T   R
Sbjct  112   SRLTEIESLVKAFDGCAGVFHTAAFVDPAGISGYSKSMAELEAKVSENVTEACTRTGSVR  171

Query  683   RCIFTSSLLASIWKGN---NHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAM  513
             +C+FTSSLLA   + N   + +H  ++E SW+DE FC  NKLW+AL K +AEK AWR A 
Sbjct  172   KCVFTSSLLACALQENFYNDLDHSVINEESWSDEQFCINNKLWYALGKLKAEKAAWRIAD  231

Query  512   ETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYE  333
                +KL T+CPAL+  P F H ++ S+L YLKG + M   G+LAT DV++ A+AHV V+E
Sbjct  232   SKGLKLATICPALITGPDFFHRNSTSTLAYLKGAKEMYSNGLLATMDVNRLAKAHVRVWE  291

Query  332   EM-DYGACGRYLCFGRTITTPEDAVLLENRLKMQ  234
              + D  A GRY+CF  TI + + A  L   + +Q
Sbjct  292   GLGDKTAFGRYICFD-TILSKDGAQKLAKDIGVQ  324



>ref|NP_196974.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
 emb|CAB87637.1| cinnamoyl CoA reductase-like protein [Arabidopsis thaliana]
 gb|AAL07065.1| putative cinnamoyl CoA reductase [Arabidopsis thaliana]
 gb|AAM14340.1| putative cinnamoyl CoA reductase [Arabidopsis thaliana]
 gb|AED92064.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=368

 Score =   234 bits (596),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 121/274 (44%), Positives = 180/274 (66%), Gaps = 8/274 (3%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATI---QNQVDFeemkellreeemkqlESVVV  864
             +LVCVT G SY G  ++++LLV GY VR  +   +++    EM+          + + VV
Sbjct  53    RLVCVTGGVSYLGRAIVKRLLVHGYSVRIVVDCPEDKEKVSEMEADAETASFSNMITSVV  112

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
             +R+T++D L +AF GC  VFHTS+F+DP G+SGY++ MA LE + + +VIEAC++TA  R
Sbjct  113   SRLTEIDSLIKAFDGCAGVFHTSAFVDPAGVSGYSKSMAELEAKVSESVIEACTRTASVR  172

Query  683   RCIFTSSLLASIWKGN---NHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAM  513
             +C+FTSSLLA  W+ N   + +H  ++E SW+DE  C +NKLW+AL K +AEK AWR A 
Sbjct  173   KCVFTSSLLACAWQKNPCNSLDHSVINEESWSDEQLCIDNKLWYALGKLKAEKAAWRIAD  232

Query  512   ETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYE  333
                +KL T+CPAL+  P F + ++ S+L YLKG + M   G+LAT DV++ A+AHV ++E
Sbjct  233   SKGLKLATICPALITGPDFFNRNSTSTLAYLKGAKEMYSNGLLATMDVNRLAKAHVCLWE  292

Query  332   EM-DYGACGRYLCFGRTITTPEDAVLLENRLKMQ  234
              + +  A GRY+CF  TI + + A  L   + +Q
Sbjct  293   GLGNKTAFGRYICFD-TILSRDGAEKLAKDIDVQ  325



>emb|CDX69564.1| BnaA10g19130D [Brassica napus]
Length=368

 Score =   233 bits (594),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 123/274 (45%), Positives = 175/274 (64%), Gaps = 8/274 (3%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVD---FeemkellreeemkqlESVVV  864
             +LVCVT G SY G  ++++LLV GY VR  I  + D     EM+            + VV
Sbjct  52    RLVCVTGGVSYLGRAIVKRLLVHGYTVRIVIDCEEDKEKVSEMEADAETASFSNRITSVV  111

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
             +R+T+++ L +AF GC  VFHT++F+DP GI+GY++ MA LE + + NV EAC++T   R
Sbjct  112   SRLTEIESLVKAFDGCAGVFHTAAFVDPAGIAGYSKSMAELEAKVSENVTEACTRTGSVR  171

Query  683   RCIFTSSLLASIWKGN---NHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAM  513
             +C+FTSSLLA   + N   + +H  ++E SW+DE FC  NKLW+AL K +AEK AWR A 
Sbjct  172   KCVFTSSLLACALQENFYNDLDHSVINEESWSDEQFCINNKLWYALGKLKAEKAAWRIAD  231

Query  512   ETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYE  333
                +KL T+CPAL+  P F H ++ S+L YLKG + M   G+LAT DV++ A+AHV V+E
Sbjct  232   SKGLKLATICPALITGPDFFHRNSTSTLAYLKGAKEMYSNGLLATMDVNRLAKAHVRVWE  291

Query  332   EM-DYGACGRYLCFGRTITTPEDAVLLENRLKMQ  234
              + D  A GRY+CF  TI + + A  L   + +Q
Sbjct  292   GLGDKTAFGRYICFD-TILSKDGAQKLAKDIGVQ  324



>gb|AAM62926.1| cinnamoyl CoA reductase-like protein [Arabidopsis thaliana]
Length=368

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/274 (44%), Positives = 180/274 (66%), Gaps = 8/274 (3%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATI---QNQVDFeemkellreeemkqlESVVV  864
             +LVCV+ G SY G  ++++LLV GY VR  +   +++    EM+          + + VV
Sbjct  53    RLVCVSGGVSYLGRAIVKRLLVHGYSVRIVVDCPEDKEKVSEMEADAETASFSNMITSVV  112

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
             +R+T++D L +AF GC  VFHTS+F+DP G+SGY++ MA LE + + +VIEAC++TA  R
Sbjct  113   SRLTEIDSLIKAFDGCAGVFHTSAFVDPAGVSGYSKSMAELEAKVSESVIEACTRTASVR  172

Query  683   RCIFTSSLLASIWKGN---NHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAM  513
             +C+FTSSLLA  W+ N   + +H  ++E SW+DE  C +NKLW+AL K +AEK AWR A 
Sbjct  173   KCVFTSSLLACAWQKNPCNSLDHSVINEESWSDEQLCIDNKLWYALGKLKAEKAAWRIAD  232

Query  512   ETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYE  333
                +KL T+CPAL+  P F + ++ S+L YLKG + M   G+LAT DV++ A+AHV ++E
Sbjct  233   SKGLKLATICPALITGPDFFNRNSTSTLAYLKGAKEMYSNGLLATMDVNRLAKAHVCLWE  292

Query  332   EM-DYGACGRYLCFGRTITTPEDAVLLENRLKMQ  234
              + +  A GRY+CF  TI + + A  L   + +Q
Sbjct  293   GLGNKTAFGRYICFD-TILSRDGAEKLAKDIDVQ  325



>ref|XP_004969276.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Setaria italica]
Length=379

 Score =   233 bits (593),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 149/333 (45%), Positives = 200/333 (60%), Gaps = 24/333 (7%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlES-VVV  864
             E + VCVT G S+ G  ++ +LL  GY VR  ++ Q D ++++E+    E  +     V+
Sbjct  56    EARAVCVTGGISFVGFAVVDRLLRHGYTVRLALETQEDVDKLREMEMFGEDGRDGVWTVM  115

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
             A + D + L  AF GC  VFHTS+F+DP G+SGYT+ MA LE +AA  VIEAC +T   R
Sbjct  116   ANVMDPESLHRAFDGCAGVFHTSAFVDPGGMSGYTKHMARLEAQAAERVIEACVRTESVR  175

Query  683   RCIFTSSLLASIWKGNNHEHDD-----LDESSWTDEDFCRENKLWFALAKTRAEKVAWRK  519
             +C+FTSSLLA +W+  N+ HD      +DE+ W+DE FCR+NKLWFAL KT AEK AWR 
Sbjct  176   KCVFTSSLLACVWR-QNYPHDRRFPTIIDENCWSDESFCRDNKLWFALGKTAAEKAAWRA  234

Query  518   AMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFV  339
             A    +KLVT+CPALV  P F   ++ +S+ YLKG + ML  G+LAT +V+  AEAHV  
Sbjct  235   ARGRDLKLVTICPALVTGPGFRRRNSTASIAYLKGARAMLSDGLLATANVETVAEAHVRA  294

Query  338   YEEM-DYGACGRYLCFGRTITTPEDAVLLENRLKM------QGLLSAYESGEIPAR--LC  186
             YE M D  A GRY+C+   +  PE+   LE +L M          +     + PAR  LC
Sbjct  295   YEAMGDNTAGGRYICYDHVVRRPEEFTELERQLAMPGGAAAAAAAAQGAGDDRPARFELC  354

Query  185   KSKLTRLLFHTARRLSCKHR*ALCDYYYYEGLD  87
             K KL RL+  +ARR  C +     D YY    D
Sbjct  355   KRKLGRLM--SARR-RCTY-----DTYYSVAFD  379



>ref|XP_011098464.1| PREDICTED: cinnamoyl-CoA reductase 2 [Sesamum indicum]
Length=360

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 127/304 (42%), Positives = 182/304 (60%), Gaps = 8/304 (3%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlES---VVV  864
             +LVCVTSG SY G  ++ +LLV GY VR  + N+ D E+++E+    EM+   S   VV+
Sbjct  53    RLVCVTSGVSYLGIAIVNQLLVNGYSVRIIVDNEEDVEKLREMGNSGEMRLNNSFVEVVM  112

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
             A++T+++ L EAF GC  VFHT++F+DP G+SGY++ MA +E  A+ NVI+AC  +   R
Sbjct  113   AKLTEVESLTEAFDGCRGVFHTAAFVDPAGLSGYSKAMADIEVNASKNVIKACGLSPSVR  172

Query  683   RCIFTSSLLASIWKGN--NHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAME  510
              C+ TSSLL  IW+ N  +   + +D   W+DE  C   KLW+AL K RAEK AW  A +
Sbjct  173   HCVLTSSLLTCIWRENPPDETSNVIDHKCWSDESVCLNKKLWYALGKLRAEKAAWDIAKQ  232

Query  509   TKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEE  330
             + +KL T+CP L+    F   +   ++ YLKG Q M   G+LAT D+DK A+AHV V+E+
Sbjct  233   SGLKLATICPGLITGSKFYERNPTFTIAYLKGAQEMYTYGLLATVDIDKLAKAHVRVFED  292

Query  329   MDYGACGRYLCFGRTITTPEDAVLL--ENRLKMQGLLSAYESGEIPA-RLCKSKLTRLLF  159
             M   A GRY+CF + I   ++   L  E  +    +         P   L  +KLTRL+ 
Sbjct  293   MKKTATGRYICFDQVIEREDEVEELARETGINASSIAGGASCSNRPRYELSNAKLTRLML  352

Query  158   HTAR  147
              T R
Sbjct  353   RTRR  356



>ref|XP_003553818.1| PREDICTED: anthocyanidin reductase-like [Glycine max]
Length=362

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 127/270 (47%), Positives = 176/270 (65%), Gaps = 5/270 (2%)
 Frame = -1

Query  1031  LVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlES---VVVA  861
             L+CVT G SYFG  L+  LL+ GY +R T+ N  D E+++E+ R  E++  E    V++A
Sbjct  54    LICVTCGVSYFGLALVNHLLLLGYSLRVTVDNPEDIEKLREMERRGEVRATEGNLEVIMA  113

Query  860   RMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARR  681
             ++TD+D L +AF+GC  VFHTS+F DP G+SGYT+ MA +E  AA NV+EAC++T    R
Sbjct  114   KLTDVDGLEKAFQGCRGVFHTSAFTDPAGLSGYTKSMAEIEVRAAENVMEACARTPSITR  173

Query  680   CIFTSSLLASIWKGNNHEH--DDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMET  507
             C+FTSSL A +W+ N+       ++ +SW+ E FC E KLW+AL K RAEK AWR + E 
Sbjct  174   CVFTSSLSACVWQDNSQSDFTPVINHASWSTESFCIEKKLWYALGKMRAEKAAWRISNER  233

Query  506   KVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEM  327
              +KL T+CPAL+  P F H +  +++ YLKG Q M  QG LA+ DV K AEAH  V++ M
Sbjct  234   GLKLTTICPALITGPEFCHRNPTATIAYLKGAQEMYSQGFLASVDVTKLAEAHASVFKAM  293

Query  326   DYGACGRYLCFGRTITTPEDAVLLENRLKM  237
             +  A GRY+CF   I T  +A  L   + M
Sbjct  294   NNEASGRYICFDHVIDTHSEAEKLAKDIGM  323



>emb|CDY09878.1| BnaC09g42830D [Brassica napus]
Length=368

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 122/274 (45%), Positives = 175/274 (64%), Gaps = 8/274 (3%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVD---FeemkellreeemkqlESVVV  864
             +LVCVT G SY G  ++++LLV GY VR  I  + D     EM+            + VV
Sbjct  52    RLVCVTGGVSYLGRAIVKRLLVHGYTVRIVIDCEEDKEKVSEMEADAETASFSNRITSVV  111

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
             +R+T+++ L +AF GC  VFHT++F+DP GI+GY++ MA LE + + NV EAC++T   R
Sbjct  112   SRLTEIESLVKAFDGCAGVFHTAAFVDPAGIAGYSKSMAELEAKVSENVTEACTRTGSVR  171

Query  683   RCIFTSSLLASIWKGN---NHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAM  513
             +C+FTSSLLA   + N   + +H  ++E SW+DE FC  NKLW+AL K +AEK AWR A 
Sbjct  172   KCVFTSSLLACALQENFYNDLDHSVINEESWSDEQFCINNKLWYALGKLKAEKAAWRIAD  231

Query  512   ETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYE  333
                +KL T+CPAL+  P F H ++ S+L YLKG + M   G+LAT DV++ A+AHV ++E
Sbjct  232   SKGLKLATICPALITGPDFFHRNSTSTLAYLKGAKEMYSNGLLATMDVNRLAKAHVRLWE  291

Query  332   EM-DYGACGRYLCFGRTITTPEDAVLLENRLKMQ  234
              + D  A GRY+CF  TI + + A  L   + +Q
Sbjct  292   GLGDKTAFGRYICFD-TILSKDGAEKLAKDIGVQ  324



>ref|XP_004142801.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Cucumis sativus]
 gb|KGN51385.1| hypothetical protein Csa_5G524780 [Cucumis sativus]
Length=363

 Score =   231 bits (589),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 126/301 (42%), Positives = 184/301 (61%), Gaps = 11/301 (4%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVA  861
             E K+VCVTSG S+ G+ ++ +L   GY VR  + +  D  ++ E           +VVVA
Sbjct  49    EEKVVCVTSGVSFLGSAIVEELSTHGYSVRVIVDSPEDVSKLDETTSGRHNV---TVVVA  105

Query  860   RMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARR  681
             ++TD++ L EAF GC  VFHTSS IDP G+SGYT+ M+ +E  +  NV+EACS+T   R 
Sbjct  106   KLTDVNSLVEAFNGCRGVFHTSSSIDPAGLSGYTKVMSEVEMRSTENVMEACSRTETIRN  165

Query  680   CIFTSSLLASIWKGNNHEHDD---LDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAME  510
             C+ TSSLLA IW+  + E +    +D +SW+  + C+  KLW AL K ++EKVAW+ A E
Sbjct  166   CVLTSSLLACIWRDQHGETETSQIVDHASWSSLELCQHKKLWLALGKLKSEKVAWKIAQE  225

Query  509   TKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEE  330
             + +KL T+C AL+  P+     + ++L YLKG   M   GVLAT DV K A+AH++VYE 
Sbjct  226   SGLKLATICSALITGPNSHLRSSTATLAYLKGAGEMYANGVLATVDVTKLAKAHLYVYEG  285

Query  329   M-DYGACGRYLCFGRTITTPEDAVLL--ENRLKMQGLLSAYESGEIPA--RLCKSKLTRL  165
             M D  A GRY+CF R I+T ++A     E R+ ++ ++      + P   +L   KL+ L
Sbjct  286   MKDNTASGRYICFDRVISTADEAATFAAEIRVPIRTIVQTTPLIDSPISFQLSNKKLSNL  345

Query  164   L  162
             +
Sbjct  346   I  346



>gb|EYU44756.1| hypothetical protein MIMGU_mgv1a008662mg [Erythranthe guttata]
Length=366

 Score =   231 bits (588),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 116/261 (44%), Positives = 166/261 (64%), Gaps = 5/261 (2%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVV---V  864
             +LVCVTSG SY G  ++ +LLV GY VR  + NQ D E+++E+    EM+   S+V   +
Sbjct  54    RLVCVTSGVSYLGIAIVNQLLVNGYSVRIIVDNQEDVEKLREMEISGEMRLSNSIVEIVM  113

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
             A++T +D L +AF GC  VFHT++F+DP G+SGY++ MA +E  A+ NV++AC  +   R
Sbjct  114   AKLTQVDSLTQAFDGCRCVFHTAAFVDPAGLSGYSKAMANIEVNASKNVVKACGVSPSVR  173

Query  683   RCIFTSSLLASIWKGNNHEHDD--LDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAME  510
              C+ TSSLL  IW+ N+ +     +D  SW+DE  C   KLW+AL K RAEK AW  A E
Sbjct  174   HCVLTSSLLTCIWQDNSLDQVSRLIDHKSWSDESVCINKKLWYALGKLRAEKAAWEIAKE  233

Query  509   TKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEE  330
             + + L T+CP L+    F      S++ YLKG Q M   G+LAT D+++ A+AHV V+EE
Sbjct  234   SGLNLSTICPGLITGSEFFLKSPTSTIAYLKGVQEMYVNGILATVDINRLAKAHVIVFEE  293

Query  329   MDYGACGRYLCFGRTITTPED  267
             M   + GRY+CF R I   ++
Sbjct  294   MKKASSGRYICFDRVIERQDE  314



>ref|XP_008365383.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Malus domestica]
Length=365

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/256 (46%), Positives = 163/256 (64%), Gaps = 6/256 (2%)
 Frame = -1

Query  1031  LVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMT  852
             LVCVTSG S+ G  ++ +LL RGY VR  + NQ D E M+E+          S V+A++T
Sbjct  56    LVCVTSGVSFLGLXIVDRLLHRGYSVRLIVDNQEDAEIMREMRTSGTNSDRISAVIAKLT  115

Query  851   DLDC---LCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARR  681
             D D    L  AF GC  VFHTS+F+DP G+SGYT+ MA  E +A+ NV++AC+ T   R+
Sbjct  116   DTDVVESLSHAFHGCRGVFHTSAFVDPAGLSGYTKSMAEXEVKASENVMKACAMTPSVRK  175

Query  680   CIFTSSLLASIWKGNNHEHD---DLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAME  510
             C+ TSSLLA +W+ ++   +    ++ + W+ E  C + KLW+AL K RAEK AW+ A E
Sbjct  176   CVLTSSLLACVWQDSSQNLNFSRVINHNHWSSESLCIDKKLWYALGKLRAEKAAWKIAEE  235

Query  509   TKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEE  330
               +KL T+CPAL+  P     +T ++L YLKG Q M + GVLAT D+ + AEAHV V+E 
Sbjct  236   KGLKLTTICPALITGPEISTRNTTATLAYLKGAQEMYQSGVLATVDITRLAEAHVGVFEA  295

Query  329   MDYGACGRYLCFGRTI  282
             M+  A GRY+ F R I
Sbjct  296   MNKAAFGRYIWFDRVI  311



>ref|XP_002524651.1| cinnamoyl-CoA reductase, putative [Ricinus communis]
 gb|EEF37670.1| cinnamoyl-CoA reductase, putative [Ricinus communis]
Length=361

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 134/315 (43%), Positives = 183/315 (58%), Gaps = 8/315 (3%)
 Frame = -1

Query  1067  VFSSHLWCRERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeem  888
             V SS +     K VCVTSG S+ G  ++ +LL RGY V+  +  + + E+++EL    EM
Sbjct  41    VSSSEMIGDCDKSVCVTSGVSFLGLAIVNRLLRRGYSVKIIVHTEEEMEKLRELETSGEM  100

Query  887   kqlES---VVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNV  717
             +   S    V+A++T+++ L +AF GC  VFHTS+F DP G+SGYT+ MA +E +A  NV
Sbjct  101   RSSNSSIKAVMAKLTEIESLLDAFDGCRGVFHTSAFTDPAGLSGYTKSMAEVEVKACENV  160

Query  716   IEACSKTAYARRCIFTSSLLASIWKGNNHEHDD--LDESSWTDEDFCRENKLWFALAKTR  543
             I ACS+T   R C+ TSSLLA IW+    +     ++  SW+DE  C + KLW+AL K R
Sbjct  161   IMACSRTPSVRHCVLTSSLLACIWRDGFSQDLSPVINHDSWSDESLCADKKLWYALGKLR  220

Query  542   AEKVAWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDK  363
             AEK AWR A E  +KL T+CP L+  P F H +  +++ YLKG Q M   G+LAT DV K
Sbjct  221   AEKAAWRIAKEKGLKLATICPGLITGPDFFHRNPTATIAYLKGAQEMFGDGLLATTDVMK  280

Query  362   AAEAHVFVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLKM-QGLLSAYESGEIPAR--  192
              AEA   V E MD  A GRY+CF   I   ++A  L   + M    +    +   PAR  
Sbjct  281   LAEAQACVLEGMDKRAFGRYICFDNIIERKDEAEKLAKEIGMPANKICGTSTDNTPARFE  340

Query  191   LCKSKLTRLLFHTAR  147
             L   KL  L+  T R
Sbjct  341   LSNKKLLNLMSRTLR  355



>dbj|BAJ89981.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=408

 Score =   231 bits (588),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 145/321 (45%), Positives = 197/321 (61%), Gaps = 19/321 (6%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlES-VVVAR  858
             + VCVT G S+ G  ++ +LL  GY VR  ++ Q D ++++E+    E  +     V+A 
Sbjct  90    RTVCVTGGISFVGFAIVDRLLRHGYTVRLALETQEDLDKLREMEMFGEDGRDGVWTVMAN  149

Query  857   MTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRC  678
             + + + L  AF GC  VFHTS+F+DP G+SGYT+ MA LE +AA  VIEAC +T   R+C
Sbjct  150   VMEPESLHRAFDGCAGVFHTSAFVDPGGMSGYTKHMASLEAQAAERVIEACVRTESVRKC  209

Query  677   IFTSSLLASIWKGNNHEHDD-----LDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAM  513
             +FTSSLLA +W+  ++ H+      +DE+ W+DE FCR NKLWFAL KT AEK AWR A 
Sbjct  210   VFTSSLLACVWR-QSYPHERRGPTIVDENCWSDESFCRNNKLWFALGKTAAEKAAWRAAR  268

Query  512   ETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYE  333
                +KLVTVCPALV  P F   ++ +S+ YLKG  VML  GVLAT +V+  AEAHV  YE
Sbjct  269   GRDLKLVTVCPALVTGPGFRRRNSTASIAYLKGSGVMLADGVLATANVETVAEAHVRAYE  328

Query  332   EM-DYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYES--GEIPAR--LCKSKLTR  168
              M D  A GRY+C+   I + ++   LE +L +    +A +S   + PAR  LCK KL R
Sbjct  329   AMGDNTAGGRYICYDHVIQSAQEFAELERQLGIPSRTAATQSVGDDRPARFELCKRKLGR  388

Query  167   LLFHTARRLSCKHR*ALCDYY  105
             L       +S + R    DYY
Sbjct  389   L-------MSSRRRCTYDDYY  402



>ref|XP_006446518.1| hypothetical protein CICLE_v10015683mg [Citrus clementina]
 gb|ESR59758.1| hypothetical protein CICLE_v10015683mg [Citrus clementina]
Length=366

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 129/308 (42%), Positives = 178/308 (58%), Gaps = 13/308 (4%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVA  861
             E KLVCVTSG S+ G  L+  LL+RGY VR  I ++ D  E    L         SVV A
Sbjct  55    EEKLVCVTSGVSFLGLALVNCLLLRGYAVRILIDHRED-REELRELMRRTCSNSVSVVTA  113

Query  860   RMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARR  681
             ++T++D L  AF GC  VFHTS+  DP G+SGY++ MA +E +   NV++AC++ +  R 
Sbjct  114   KLTEVDDLTAAFEGCRGVFHTSALADPAGLSGYSKSMAEVEVKTTENVMKACARASSVRN  173

Query  680   CIFTSSLLASIWKG---NNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAME  510
             C+ TSSL A IW+     +     ++  SW+DE  C + KLW+AL K ++EK AW+ A E
Sbjct  174   CVLTSSLSACIWRDGPLQDLSSPVINHESWSDESLCIDKKLWYALGKLKSEKNAWKLAEE  233

Query  509   TKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEE  330
                KL T+CP LV  P F   ++ +++ YLKG Q M   G+LAT DV + AEAH+ VYE 
Sbjct  234   NDFKLATICPGLVTGPDFIQRNSTATIAYLKGAQEMYADGLLATVDVTRLAEAHLCVYEA  293

Query  329   MDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGEI------PARLCKSKLTR  168
             M+  A GRY+CF R I + ++A   EN  K  G+ ++   G        P  L   KLT 
Sbjct  294   MNKTAFGRYICFDRVIASEDEA---ENLAKEMGMPASKICGNAHDHIPCPFELSNRKLTS  350

Query  167   LLFHTARR  144
             L+  T  R
Sbjct  351   LMSSTLGR  358



>dbj|BAK02570.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=437

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 145/321 (45%), Positives = 197/321 (61%), Gaps = 19/321 (6%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlES-VVVAR  858
             + VCVT G S+ G  ++ +LL  GY VR  ++ Q D ++++E+    E  +     V+A 
Sbjct  119   RTVCVTGGISFVGFAIVDRLLRHGYTVRLALETQEDLDKLREMEMFGEDGRDGVWTVMAN  178

Query  857   MTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRC  678
             + + + L  AF GC  VFHTS+F+DP G+SGYT+ MA LE +AA  VIEAC +T   R+C
Sbjct  179   VMEPESLHRAFDGCAGVFHTSAFVDPGGMSGYTKHMASLEAQAAERVIEACVRTESVRKC  238

Query  677   IFTSSLLASIWKGNNHEHDD-----LDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAM  513
             +FTSSLLA +W+  ++ H+      +DE+ W+DE FCR NKLWFAL KT AEK AWR A 
Sbjct  239   VFTSSLLACVWR-QSYPHERRGPTIVDENCWSDESFCRNNKLWFALGKTAAEKAAWRAAR  297

Query  512   ETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYE  333
                +KLVTVCPALV  P F   ++ +S+ YLKG  VML  GVLAT +V+  AEAHV  YE
Sbjct  298   GRDLKLVTVCPALVTGPGFRRRNSTASIAYLKGSGVMLADGVLATANVETVAEAHVRAYE  357

Query  332   EM-DYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYES--GEIPAR--LCKSKLTR  168
              M D  A GRY+C+   I + ++   LE +L +    +A +S   + PAR  LCK KL R
Sbjct  358   AMGDNTAGGRYICYDHVIQSAQEFAELERQLGIPSRTAATQSVGDDRPARFELCKRKLGR  417

Query  167   LLFHTARRLSCKHR*ALCDYY  105
             L       +S + R    DYY
Sbjct  418   L-------MSSRRRCTYDDYY  431



>dbj|BAJ90135.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=433

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 145/321 (45%), Positives = 197/321 (61%), Gaps = 19/321 (6%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlES-VVVAR  858
             + VCVT G S+ G  ++ +LL  GY VR  ++ Q D ++++E+    E  +     V+A 
Sbjct  115   RTVCVTGGISFVGFAIVDRLLRHGYTVRLALETQEDLDKLREMEMFGEDGRDGVWTVMAN  174

Query  857   MTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRC  678
             + + + L  AF GC  VFHTS+F+DP G+SGYT+ MA LE +AA  VIEAC +T   R+C
Sbjct  175   VMEPESLHRAFDGCAGVFHTSAFVDPGGMSGYTKHMASLEAQAAERVIEACVRTESVRKC  234

Query  677   IFTSSLLASIWKGNNHEHDD-----LDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAM  513
             +FTSSLLA +W+  ++ H+      +DE+ W+DE FCR NKLWFAL KT AEK AWR A 
Sbjct  235   VFTSSLLACVWR-QSYPHERRGPTIVDENCWSDESFCRNNKLWFALGKTAAEKAAWRAAR  293

Query  512   ETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYE  333
                +KLVTVCPALV  P F   ++ +S+ YLKG  VML  GVLAT +V+  AEAHV  YE
Sbjct  294   GRDLKLVTVCPALVTGPGFRRRNSTASIAYLKGSGVMLADGVLATANVETVAEAHVRAYE  353

Query  332   EM-DYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYES--GEIPAR--LCKSKLTR  168
              M D  A GRY+C+   I + ++   LE +L +    +A +S   + PAR  LCK KL R
Sbjct  354   AMGDNTAGGRYICYDHVIQSAQEFAELERQLGIPSRTAATQSVGDDRPARFELCKRKLGR  413

Query  167   LLFHTARRLSCKHR*ALCDYY  105
             L       +S + R    DYY
Sbjct  414   L-------MSSRRRCTYDDYY  427



>gb|ACG37436.1| dihydroflavonol-4-reductase [Zea mays]
Length=372

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 124/273 (45%), Positives = 171/273 (63%), Gaps = 9/273 (3%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlES-VVVARMT  852
             VCVT G S+ G  ++ +LL  GY VR  ++ Q D ++++E+    E  +     V+A + 
Sbjct  53    VCVTGGTSFLGFAVVDRLLRHGYTVRLALETQEDLDKLREMEMFGENGRDGVWTVIANVM  112

Query  851   DLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERM-AFLETEAAGNVIEACSKTAYARRCI  675
             D + L EAF GC  VFHTSS +DP GISGYT+     LE +AA  V+EAC +T   R+C+
Sbjct  113   DPESLHEAFDGCVGVFHTSSHVDPAGISGYTKNTWQALEAKAAELVVEACVRTESVRKCV  172

Query  674   FTSSLLASIWKGNNHEHD------DLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAM  513
              TSSLLA +W+  N+ HD       +DE+ W+DE  CR+NKLW +L KT AEK AWR A 
Sbjct  173   LTSSLLACVWR-QNYPHDRRRFPTTIDENCWSDESLCRDNKLWLSLGKTMAEKAAWRAAR  231

Query  512   ETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYE  333
              T +KLVT+CPALV  P F   +   S+ YLKG   ML QG+LAT +V++ AEAHV VYE
Sbjct  232   GTDLKLVTICPALVTGPGFRRRNPTPSIAYLKGAHAMLVQGLLATANVERVAEAHVRVYE  291

Query  332   EMDYGACGRYLCFGRTITTPEDAVLLENRLKMQ  234
             E+   A GRY+C+   +   E+   L+ +L ++
Sbjct  292   ELSGTAGGRYICYDHVVRRGEEFAELQRQLGLR  324



>ref|XP_006291491.1| hypothetical protein CARUB_v10017639mg, partial [Capsella rubella]
 gb|EOA24389.1| hypothetical protein CARUB_v10017639mg, partial [Capsella rubella]
Length=325

 Score =   228 bits (580),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 123/314 (39%), Positives = 183/314 (58%), Gaps = 7/314 (2%)
 Frame = -1

Query  1070  NVFSSHLWCRERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreee  891
             N++   L     K+VC+T G ++FG  ++ +LL+ GY VR  +    D E ++ +  E  
Sbjct  2     NIYDYDLDQDNAKIVCITDGLTFFGRTIVERLLLHGYTVRVIVNTPDDLERVRAMKDETA  61

Query  890   m-kqlESVVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVI  714
                     V A++T+ + L +AF GC+ VFHTS FIDP G+SGY++ M  +E + + NV+
Sbjct  62    KFHGRIEEVSAKLTETESLVDAFDGCYGVFHTSGFIDPSGVSGYSKYMVEIEAKVSENVM  121

Query  713   EACSKTAYARRCIFTSSLLASIWKGNNH--EHDDLDESSWTDEDFCRENKLWFALAKTRA  540
              AC+ T   RRC+ TSSLLA +W+ +        +D SSW+DE  C++ KLW+AL K +A
Sbjct  122   NACTMTQSVRRCLMTSSLLACLWQNSTQLGRRSVIDHSSWSDESLCKDKKLWYALGKLKA  181

Query  539   EKVAWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKA  360
             EK+AW+ A +   KL T+C ALV + +  H +   ++ YLKGG+ M   GVLAT DV+  
Sbjct  182   EKIAWKIAEDKGFKLSTICAALVTSLNILHHNPTPTIAYLKGGEEMYGNGVLATVDVNTL  241

Query  359   AEAHVFVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGEIPARLCKS  180
             A+ HV VYEEM+  + GRY+CF + IT   +AV L N   +   L      +     C+ 
Sbjct  242   AKVHVKVYEEMNKASFGRYVCFDKVITGEYEAVELANETSIS--LERIRGDKYD--FCEK  297

Query  179   KLTRLLFHTARRLS  138
              LT+    + RRLS
Sbjct  298   DLTKPFCLSNRRLS  311



>ref|XP_006287978.1| hypothetical protein CARUB_v10001213mg [Capsella rubella]
 gb|EOA20876.1| hypothetical protein CARUB_v10001213mg [Capsella rubella]
Length=369

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 117/259 (45%), Positives = 170/259 (66%), Gaps = 7/259 (3%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATI---QNQVDFeemkellreeemkqlESVVV  864
             +LVCVT G SY G  ++++LLV GY VR  +   +++    EM+            + VV
Sbjct  53    RLVCVTGGVSYLGRAIVKRLLVHGYSVRIVVDCPEDKEKVSEMEADAETASFGNRITSVV  112

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
             +R+T+++ L +AF GC  VFHT++FIDP GISGY++ MA LE + + +VIEAC++TA  R
Sbjct  113   SRLTEMESLIKAFDGCAGVFHTTAFIDPAGISGYSKSMAELEAKVSESVIEACTRTASVR  172

Query  683   RCIFTSSLLASIWKG---NNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAM  513
             +C+FTSSLLA   +    NN  H  ++E SW+DE  C +NKLW+AL K +AEK AWR A 
Sbjct  173   KCVFTSSLLACALQNSSFNNLNHSVINEESWSDEQLCVDNKLWYALGKLKAEKAAWRIAD  232

Query  512   ETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYE  333
                +KL T+CPALV  P F + ++ S+L YLKG + M   G+LAT DV++ A+AHV ++E
Sbjct  233   SKGLKLATICPALVTGPDFFNRNSTSTLAYLKGAKEMYSHGLLATMDVNRLAKAHVCLWE  292

Query  332   EM-DYGACGRYLCFGRTIT  279
              + +  A GRY+CF   ++
Sbjct  293   GLGNKTAFGRYICFDNILS  311



>ref|XP_010453599.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Camelina sativa]
Length=372

 Score =   228 bits (580),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 120/274 (44%), Positives = 177/274 (65%), Gaps = 8/274 (3%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATI---QNQVDFeemkellreeemkqlESVVV  864
             +LVCVT G SY G  ++++LLV GY VR  +   +++    EM+            + VV
Sbjct  54    RLVCVTGGVSYLGRAIVKRLLVHGYSVRIVVDCPEDKEKVSEMEADAEMASFNNRITSVV  113

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
             +R+T++  L +AF GC  VFHTS+F+DP GI+GY++ MA LE + + +VI+AC++TA  R
Sbjct  114   SRLTEIGSLIKAFDGCAGVFHTSAFVDPAGIAGYSKSMAELEAKVSESVIKACTRTASVR  173

Query  683   RCIFTSSLLASIWKG---NNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAM  513
             +C+FTSSLLA   +    NN +H  ++E SW+DE  C +NKLW+AL K +AEK AWR A 
Sbjct  174   KCVFTSSLLACALQNSSFNNLDHSVINEESWSDEQLCIDNKLWYALGKLKAEKAAWRIAD  233

Query  512   ETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYE  333
                +KL T+CPAL+  P F + ++ S+L YLKG + M   G+LAT DV+K A+AHV ++E
Sbjct  234   SKGLKLATICPALITGPDFFNRNSTSTLAYLKGAKEMYSHGLLATMDVNKLAKAHVCLWE  293

Query  332   EM-DYGACGRYLCFGRTITTPEDAVLLENRLKMQ  234
              + +  A GRY+CF  TI + + A  L   + +Q
Sbjct  294   GLGNKTAFGRYICFD-TILSQDGAENLAKDIGVQ  326



>gb|AFW83384.1| hypothetical protein ZEAMMB73_643711 [Zea mays]
Length=285

 Score =   223 bits (568),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 165/249 (66%), Gaps = 12/249 (5%)
 Frame = -1

Query  875  SVVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKT  696
            S V+A + D D L  AF GC  VFHTS+F+DP G+SGYT+ MA LE +AA  VIEAC +T
Sbjct  20   STVMANVMDPDGLRRAFDGCAGVFHTSAFVDPGGMSGYTKHMAALEAQAAERVIEACVRT  79

Query  695  AYARRCIFTSSLLASIWKGNNHEHD-----DLDESSWTDEDFCRENKLWFALAKTRAEKV  531
               R+C+FTSSLLA +W+  ++ HD      +DES W+DE FCR+NKLWFAL KT AEK 
Sbjct  80   ESVRKCVFTSSLLACVWR-QDYPHDRRCPTTIDESCWSDESFCRDNKLWFALGKTAAEKA  138

Query  530  AWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEA  351
            AWR A    +KLVT+CPALV  P F   ++ +S+ YLKG + ML  G+LAT +V+  AEA
Sbjct  139  AWRAARGRDLKLVTICPALVTGPGFRRRNSTASIAYLKGARAMLADGLLATANVETVAEA  198

Query  350  HVFVYEEM-DYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLS---AYESGEIPAR--L  189
            HV  YE M D  A GRY+C+   +  PE+   LE +L + G  +   A+ S + PAR  L
Sbjct  199  HVHAYEAMGDNTAGGRYICYDHVVKRPEEFAELERQLGLPGGAAPAPAHGSDDRPARFEL  258

Query  188  CKSKLTRLL  162
            CK KL+RL+
Sbjct  259  CKRKLSRLM  267



>ref|XP_009405808.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Musa acuminata subsp. 
malaccensis]
Length=363

 Score =   225 bits (573),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 139/302 (46%), Positives = 182/302 (60%), Gaps = 15/302 (5%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVA  861
             E + VCVT G S+ G+ L+ +LL RGY VR  ++ Q D+++++E           S V+A
Sbjct  51    EGRAVCVTGGVSFVGSALVDRLLDRGYAVRLLVETQEDWDKLRETETLWGGV---SAVMA  107

Query  860   RMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARR  681
              MTD+D LC AF GC  VFHTSS +DP GISGY++ MA +E  AA  VIEAC +T   R+
Sbjct  108   DMTDMDSLCRAFDGCTGVFHTSSSLDPGGISGYSKHMAEIEVRAAERVIEACVRTESVRK  167

Query  680   CIFTSSLLASIWKGNN-HEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETK  504
             C+FTSSLLA  W+ ++      +DES W+DE  CR+ KLW+AL KT AEK AW  A   +
Sbjct  168   CVFTSSLLACTWRQSDPRSRRVVDESCWSDEQLCRDKKLWYALGKTMAEKAAWEAAARGR  227

Query  503   --VKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEE  330
               +KL TVCPALV    F   +  +S+ YLKG + M  +G+L T DV+K A AHV +YE 
Sbjct  228   RDLKLATVCPALVTGSGFHRRNIAASIAYLKGAREMFAEGLLVTVDVEKLAGAHVSIYEA  287

Query  329   MDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGEIPA------RLCKSKLTR  168
             M   ACGRY+C+ R I   E A  LE RL +   +    SGE  A       L   KL R
Sbjct  288   MSSHACGRYICYDRVIERGE-AEELERRLGIPSRI--LLSGETAAPCSPSSELSNQKLFR  344

Query  167   LL  162
             L+
Sbjct  345   LM  346



>ref|XP_006470314.1| PREDICTED: cinnamoyl-CoA reductase 2-like isoform X1 [Citrus 
sinensis]
Length=366

 Score =   225 bits (573),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 127/308 (41%), Positives = 177/308 (57%), Gaps = 13/308 (4%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVA  861
             E KLVCVTSG S+ G  ++  LL+RGY VR  I ++ D  E    L         SVV A
Sbjct  55    EEKLVCVTSGVSFLGLAIVNCLLLRGYAVRILIDHRED-REELRELMRRTCSNSVSVVTA  113

Query  860   RMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARR  681
             ++T+ D L  AF GC  VFHTS+  DP G+SGY++ MA +E +   NV++AC++ +  R 
Sbjct  114   KLTEADDLTAAFEGCRGVFHTSALADPAGLSGYSKSMAEVEVKTTENVMKACARASSVRN  173

Query  680   CIFTSSLLASIWKG---NNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAME  510
             C+ TSSL A IW+     +     ++  SW+DE  C + KLW+AL K ++EK AW+ A E
Sbjct  174   CVLTSSLSACIWRDGPLQDLSSPVINHESWSDESLCIDKKLWYALGKLKSEKNAWKLAEE  233

Query  509   TKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEE  330
                KL T+CP LV  P F   ++ +++ YLKG Q M    +LAT DV + AEAH+ VYE 
Sbjct  234   NDFKLATICPGLVTGPDFIQRNSTATIAYLKGAQEMYADSLLATVDVTRLAEAHLCVYEA  293

Query  329   MDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLS------AYESGEIPARLCKSKLTR  168
             M+  A GRY+CF R I + ++A   EN  K  G+ +      A++    P  L   KLT 
Sbjct  294   MNKTAFGRYICFDRVIASEDEA---ENLAKEMGMPASKICGNAHDHIPCPFELSNRKLTS  350

Query  167   LLFHTARR  144
             L+  T  R
Sbjct  351   LMSSTLGR  358



>emb|CDX91029.1| BnaC02g05680D [Brassica napus]
Length=367

 Score =   225 bits (573),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 122/274 (45%), Positives = 171/274 (62%), Gaps = 8/274 (3%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVD---FeemkellreeemkqlESVVV  864
             KLVCVT G SY G  ++++LLV GY VR  +  Q D     EM+            + VV
Sbjct  52    KLVCVTGGVSYLGRAIVKRLLVHGYSVRIVVDCQEDKEKVSEMEADAETASYGNRITSVV  111

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
             +R+T+ + L +AF GC  VFHT++F+DP GISGY++ MA LE + + NVIEAC++T   R
Sbjct  112   SRLTETERLIKAFDGCDGVFHTAAFVDPAGISGYSKSMAELEAKVSENVIEACTRTGSVR  171

Query  683   RCIFTSSLLASIWKGNNHEHDD---LDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAM  513
             +C+FTSSLLA   K N+    D   ++E SW+DE  C  NKLW+AL K +AEK AWR A 
Sbjct  172   KCVFTSSLLACALKDNSFNDLDNSIINEESWSDEQLCVHNKLWYALGKLKAEKAAWRIAD  231

Query  512   ETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYE  333
                +KL T+CPAL+  P F   ++ S+L YLKG + M R  +LAT DV++ A+ HV ++E
Sbjct  232   SKGLKLATICPALITGPDFFQLNSTSTLAYLKGAKDMYRNRLLATMDVNRLAKIHVRLWE  291

Query  332   EM-DYGACGRYLCFGRTITTPEDAVLLENRLKMQ  234
              + +  A GRY+CF  TI + + A  L   + +Q
Sbjct  292   GLGNKTAFGRYICFD-TILSKDGAEKLAKDIGVQ  324



>ref|XP_009125995.1| PREDICTED: cinnamoyl-CoA reductase 2-like isoform X1 [Brassica 
rapa]
Length=367

 Score =   224 bits (572),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 119/274 (43%), Positives = 172/274 (63%), Gaps = 8/274 (3%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATI---QNQVDFeemkellreeemkqlESVVV  864
             +LVCVT G SY G  ++++LLV GY VR  +   +++    EM+            + VV
Sbjct  52    RLVCVTGGVSYLGRAIVKRLLVHGYSVRIVVDCPEDKEKVSEMEADAETASFGNRITSVV  111

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
             +R+T+ + L +AF GC  VFHT++F+DP GISGY++ MA LE + + NVIEAC++T   R
Sbjct  112   SRLTETESLIKAFDGCDGVFHTAAFVDPAGISGYSKSMAELEAKVSENVIEACTRTGSVR  171

Query  683   RCIFTSSLLASIWKGN---NHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAM  513
             +C+FTSSLLA   K N   + +H  ++E SW+DE  C  NKLW+AL K +AEK AWR A 
Sbjct  172   KCVFTSSLLACALKDNSLNDLDHSIINEESWSDEQLCVHNKLWYALGKLKAEKAAWRIAD  231

Query  512   ETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYE  333
                +KL T+CPAL+  P F   ++ S+L YLKG + M R  +LAT DV++ A+ HV ++E
Sbjct  232   SKGLKLATICPALITGPDFFQLNSTSTLAYLKGAKDMYRNRLLATMDVNRLAKVHVRLWE  291

Query  332   EM-DYGACGRYLCFGRTITTPEDAVLLENRLKMQ  234
              + +  A GRY+CF  TI + + A  L   +  Q
Sbjct  292   GLGNKTAFGRYICFD-TILSKDGAEKLAKDIGAQ  324



>emb|CDX85588.1| BnaA02g02250D [Brassica napus]
Length=368

 Score =   224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/275 (43%), Positives = 172/275 (63%), Gaps = 9/275 (3%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATI----QNQVDFeemkellreeemkqlESVV  867
             +LVCVT G SY G  ++++LLV GY VR  +    +++    EM+            + V
Sbjct  52    RLVCVTGGVSYLGRAIVKRLLVHGYSVRIVVDCPAEDKEKVSEMEADAETASFGNRITSV  111

Query  866   VARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYA  687
             V+R+T+ + L +AF GC  VFHT++F+DP GISGY++ MA LE + + NVIEAC++T   
Sbjct  112   VSRLTETESLIKAFDGCDGVFHTAAFVDPAGISGYSKSMAELEAKVSENVIEACTRTGSV  171

Query  686   RRCIFTSSLLASIWKGN---NHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKA  516
             R+C+FTSSLLA   K N   + +H  ++E SW+DE  C  NKLW+AL K +AEK AWR A
Sbjct  172   RKCVFTSSLLACALKDNSLNDLDHSIINEESWSDEQLCVHNKLWYALGKLKAEKAAWRIA  231

Query  515   METKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVY  336
                 +KL T+CPAL+  P F   ++ S+L YLKG + M R  +LAT DV++ A+ HV ++
Sbjct  232   DSKGLKLATICPALITGPDFFQLNSTSTLAYLKGAKDMYRNRLLATMDVNRLAKVHVRLW  291

Query  335   EEM-DYGACGRYLCFGRTITTPEDAVLLENRLKMQ  234
             E + +  A GRY+CF  TI + + A  L   +  Q
Sbjct  292   EGLGNKTAFGRYICFD-TILSKDGAEKLAKDIGAQ  325



>gb|KDP45331.1| hypothetical protein JCGZ_09580 [Jatropha curcas]
Length=352

 Score =   223 bits (569),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 130/304 (43%), Positives = 180/304 (59%), Gaps = 8/304 (3%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlES---VVV  864
             K+VCVTSG S+ G  ++  LL R Y V+  +  + D E+++EL    EM+   S    V+
Sbjct  43    KVVCVTSGVSFLGLAVVNCLLRRRYSVKIIVNTEEDMEKLRELETCGEMRASNSSIKAVM  102

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
             A +T+++ L EAF GC  VFHTS+F DP G+SGYT+ MA +E  A+ NV+ ACS+T   R
Sbjct  103   ANLTEIESLMEAFEGCRGVFHTSAFADPAGLSGYTKTMAEIEVRASENVMMACSRTPSVR  162

Query  683   RCIFTSSLLASIWKGNNHEHDD--LDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAME  510
              C+ TSSLLA IW+    +     ++  SW+DE  C + KLW AL K RAEK AWR A E
Sbjct  163   HCVLTSSLLACIWRDGMKQDFSPVINHESWSDESLCTDKKLWHALGKLRAEKAAWRIAKE  222

Query  509   TKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEE  330
               +KL T+CP L+  P F + +  +++ YLKG Q M   G+LAT DV K AEAHV V+E 
Sbjct  223   KGLKLATICPGLITGPDFFNRNPTATIAYLKGAQEMFAHGLLATIDVMKVAEAHVCVFEA  282

Query  329   MDYGACGRYLCFGRTITTPEDAVLLENRLKMQ-GLLSAYESGEIPAR--LCKSKLTRLLF  159
             M   A GRY+ +   I + E A  L   ++M    +    SG +PAR  +   K+  L+ 
Sbjct  283   MKTTAFGRYIYYDSMIESEEKAEKLAAMVRMPVSKICGNASGYVPARFQISNEKILNLMS  342

Query  158   HTAR  147
              T R
Sbjct  343   RTLR  346



>ref|XP_010550135.1| PREDICTED: cinnamoyl-CoA reductase 1 [Tarenaya hassleriana]
Length=360

 Score =   223 bits (567),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 128/310 (41%), Positives = 179/310 (58%), Gaps = 9/310 (3%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVR---ATIQNQVDFeemkellreeemkqlESVVV  864
             +LVCVT G SY G  ++ +LL+ GY VR   A+ + +    EM             S V+
Sbjct  52    RLVCVTGGVSYLGRAVVERLLIHGYSVRIVVASPEEEEQVREMGISGETASFNNRISAVM  111

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
             AR+TD+  L +AF GC  VFHTS+FID  GISGY++ MA LE + +  VIEAC++T   R
Sbjct  112   ARLTDIGSLIQAFDGCFGVFHTSAFIDQAGISGYSKSMAELEAKVSEAVIEACTRTGSVR  171

Query  683   RCIFTSSLLASIWKGNN--HEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAME  510
             +C+FTSSLLA IW+  +       +++  W+ E  C + KLW+AL K +AEK AWR A E
Sbjct  172   KCVFTSSLLACIWQDGSLCDLPAVVNDECWSQEQVCTQKKLWYALGKLKAEKAAWRIAGE  231

Query  509   TKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEE  330
               +KL T+CPAL+  P F   +  S+L YLKG + M  +GVLAT DV + A+AHVF++E 
Sbjct  232   KGLKLATICPALITGPDFFPRNPTSTLAYLKGAEEMYGKGVLATVDVKRVAKAHVFLFEG  291

Query  329   MDYG-ACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGEIPARLCKSKLTRLLFHT  153
             M+   A GRY+CF   +     A  L   + +        SG  P+ +   K  +LL   
Sbjct  292   MNRASASGRYICFDNVVMCRHSAEKLAKVIGINPHKLCGHSGHPPSSVLSDK--KLLHLM  349

Query  152   ARRL-SCKHR  126
             +R L SC  +
Sbjct  350   SRTLTSCSQQ  359



>ref|XP_006470315.1| PREDICTED: cinnamoyl-CoA reductase 2-like isoform X2 [Citrus 
sinensis]
Length=365

 Score =   222 bits (566),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 126/308 (41%), Positives = 175/308 (57%), Gaps = 14/308 (5%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVA  861
             E KLVCVTSG S+ G  ++  LL+RGY VR  I ++    E    L         SVV A
Sbjct  55    EEKLVCVTSGVSFLGLAIVNCLLLRGYAVRILIDHR--DREELRELMRRTCSNSVSVVTA  112

Query  860   RMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARR  681
             ++T+ D L  AF GC  VFHTS+  DP G+SGY++ MA +E +   NV++AC++ +  R 
Sbjct  113   KLTEADDLTAAFEGCRGVFHTSALADPAGLSGYSKSMAEVEVKTTENVMKACARASSVRN  172

Query  680   CIFTSSLLASIWKG---NNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAME  510
             C+ TSSL A IW+     +     ++  SW+DE  C + KLW+AL K ++EK AW+ A E
Sbjct  173   CVLTSSLSACIWRDGPLQDLSSPVINHESWSDESLCIDKKLWYALGKLKSEKNAWKLAEE  232

Query  509   TKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEE  330
                KL T+CP LV  P F   ++ +++ YLKG Q M    +LAT DV + AEAH+ VYE 
Sbjct  233   NDFKLATICPGLVTGPDFIQRNSTATIAYLKGAQEMYADSLLATVDVTRLAEAHLCVYEA  292

Query  329   MDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGEI------PARLCKSKLTR  168
             M+  A GRY+CF R I + ++A   EN  K  G+ ++   G        P  L   KLT 
Sbjct  293   MNKTAFGRYICFDRVIASEDEA---ENLAKEMGMPASKICGNAHDHIPCPFELSNRKLTS  349

Query  167   LLFHTARR  144
             L+  T  R
Sbjct  350   LMSSTLGR  357



>ref|XP_002274230.1| PREDICTED: cinnamoyl-CoA reductase 1 [Vitis vinifera]
 emb|CBI34910.3| unnamed protein product [Vitis vinifera]
Length=361

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/255 (45%), Positives = 162/255 (64%), Gaps = 5/255 (2%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVA  861
             E KLVCVTSG S+ G  L+ KLL RGY VR  + ++ D E+++E+ R          V A
Sbjct  56    EEKLVCVTSGVSFLGLALVNKLLSRGYSVRVIVDSEGDVEKVEEMRRNNSNIWP---VTA  112

Query  860   RMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARR  681
             ++++++ L  A  GC  VFHTS F+DP G++GY++ MA +E +A+ NV+EAC++T   + 
Sbjct  113   KLSEVESLEAAMEGCRGVFHTSGFVDPAGLTGYSKAMAGIEVKASENVMEACARTPSVKG  172

Query  680   CIFTSSLLASIWKG--NNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMET  507
             C+ TSSLLA +W+G  N      +D  SW+DE FC + KLW+A  K +AEK AWR A E 
Sbjct  173   CVLTSSLLACVWQGGFNADPSPIVDHDSWSDEAFCLDRKLWYAWGKLKAEKAAWRVAEEK  232

Query  506   KVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEM  327
              ++L T+CPALV  P F   +  +++ YLKG   M   G+LAT DV + AEAHV V+E M
Sbjct  233   GLRLSTICPALVTGPEFYRRNPTATIAYLKGAYEMYGSGLLATVDVTRLAEAHVVVFEAM  292

Query  326   DYGACGRYLCFGRTI  282
                + GRY+CF   +
Sbjct  293   SKASFGRYICFDSVV  307



>gb|KHG09510.1| Dihydroflavonol-4-reductase [Gossypium arboreum]
Length=360

 Score =   221 bits (562),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 122/274 (45%), Positives = 176/274 (64%), Gaps = 6/274 (2%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlES---V  870
             + KLVCVTSG S+FG  L+  LL+ GY VR  + NQ D E+++E+    EM   +S   V
Sbjct  47    QDKLVCVTSGVSFFGFALVNHLLLHGYFVRVLVANQEDVEKLREMEISGEMMGCKSKIAV  106

Query  869   VVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAY  690
             V+A+  ++  L EAF GC  VFHTSSF DP G+SGY++ MA +E +A+ NV++AC++T  
Sbjct  107   VMAKPNEIQGLMEAFDGCCGVFHTSSFADPAGLSGYSKSMAEMEGKASENVMKACARTPS  166

Query  689   ARRCIFTSSLLASIWKGNN-HEHDDL-DESSWTDEDFCRENKLWFALAKTRAEKVAWRKA  516
              + C+ TSSLLA IW+ N+ +E   L + + W++E  C + KLW+AL K +AEKVAW+ A
Sbjct  167   VKHCVLTSSLLACIWRDNSQYELPPLVNHNCWSNESLCVDKKLWYALGKLKAEKVAWKIA  226

Query  515   METKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVY  336
              E  + L T+CP L+    F + +  +++ YLKG Q M   G+LAT DV + AEAHV V+
Sbjct  227   EEMSLNLTTICPGLITGHEFSYRNPTATIAYLKGAQEMYANGLLATADVRRLAEAHVSVF  286

Query  335   EEMD-YGACGRYLCFGRTITTPEDAVLLENRLKM  237
             E M    A GRY+CF R I   ++A  L + + +
Sbjct  287   EAMKTTTAFGRYICFDRVIQCEDEAEKLADEIGI  320



>ref|XP_009334087.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Pyrus x bretschneideri]
Length=360

 Score =   219 bits (559),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 118/263 (45%), Positives = 158/263 (60%), Gaps = 22/263 (8%)
 Frame = -1

Query  1031  LVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMT  852
             LVCVTSG S+ G  L+ +LL RGY VR  +  Q D E ++E+          S  +A++T
Sbjct  53    LVCVTSGVSFLGLALVDRLLHRGYSVRLIVDKQEDVEILREMRTRGATSDRISAFIAKLT  112

Query  851   DLDC---LCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARR  681
             D D    L  AF GC  VFHTS+F+DP G+SGYT+ MA +E +A+ NV++AC+ T   R+
Sbjct  113   DTDVVESLSHAFHGCRGVFHTSAFVDPAGLSGYTKSMAEIEVKASENVMKACAMTPSVRK  172

Query  680   CIFTSSLLASIWKGN----------NHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKV  531
             C+ TSSLLA +W+ +          NH H       W+ E  C + KLW+AL K RAEK 
Sbjct  173   CVLTSSLLACVWQDSYQNLNFSPVINHNH-------WSSESLCIDKKLWYALGKLRAEKA  225

Query  530   AWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEA  351
             AW+ A E  +KL T+CPAL+  P     +  ++L YLKG Q M + GVLAT D+ + AEA
Sbjct  226   AWKIAEEKGLKLTTICPALITGPEISTKNPTATLSYLKGAQEMYQSGVLATVDITRLAEA  285

Query  350   HVFVYEEMDYGACGRYLCFGRTI  282
             HV V+E M   A GRY+ F R I
Sbjct  286   HVGVFEAM--AAFGRYIWFDRVI  306



>ref|XP_006338567.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Solanum tuberosum]
Length=360

 Score =   218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/278 (41%), Positives = 169/278 (61%), Gaps = 7/278 (3%)
 Frame = -1

Query  1091  PPRRCASNVFSSHLWCRERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemk  912
             P +  A+N  +  L   E K VCVTSG S+ G  ++ +LL+RGY VR  ++ Q D E+++
Sbjct  39    PGKLPAANRHNREL---EEKKVCVTSGVSFLGIAIVNQLLLRGYSVRVIVEKQEDLEKLR  95

Query  911   ellreeemkqlESVV---VARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFL  741
             E+    EM+Q  + V   +AR+ D+  L +AF GC  VFHT++F+DP G+SGY++ M  +
Sbjct  96    EMEISGEMRQSMNTVEAVMARLNDIQSLSQAFSGCRGVFHTAAFVDPAGLSGYSKSMVEV  155

Query  740   ETEAAGNVIEACSKTAYARRCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWF  561
             E     NV +AC+ T   R C+ TSSL+A +W+  N     +D   W+DE  C + KLW+
Sbjct  156   EVLVTKNVTQACAITPSVRNCVLTSSLVACVWQDINSSRT-IDHDCWSDESICIDKKLWY  214

Query  560   ALAKTRAEKVAWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLA  381
             AL K +AE+VAW  A E+  KL T+CP L+  P F   +   ++ YLKG Q M R G+LA
Sbjct  215   ALGKLKAERVAWNIARESGFKLATICPGLLTGPEFISRNPTPTIAYLKGAQEMFRNGLLA  274

Query  380   TEDVDKAAEAHVFVYEEMDYGACGRYLCFGRTITTPED  267
             T DV++ A  HV V+E+M   +  RY+ F + I + E+
Sbjct  275   TVDVNRLAVEHVLVFEDMKNTSYNRYISFDQVIRSEEE  312



>gb|AFK33366.1| unknown [Medicago truncatula]
Length=259

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/251 (43%), Positives = 151/251 (60%), Gaps = 6/251 (2%)
 Frame = -1

Query  872  VVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTA  693
            +++A++ D+D L +AF GC  +FHTS+F DP G+SGYT+ MA +E     NV+EAC++T 
Sbjct  7    IIIAKLNDVDSLVKAFEGCRGIFHTSAFTDPAGLSGYTKSMAEIEVNVTENVMEACARTP  66

Query  692  YARRCIFTSSLLASIWKGNNHEH---DDLDESSWTDEDFCRENKLWFALAKTRAEKVAWR  522
              +RC+FTSSL A IW+ N +       ++  SW+ E  C + KLW+AL K RAEK AWR
Sbjct  67   SIKRCVFTSSLAACIWQDNVNSDLTTPIINHGSWSSESLCIDKKLWYALDKMRAEKAAWR  126

Query  521  KAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVF  342
             A E  +KL T+CPAL+  P F H +  +++ YLKG Q M   G+LAT DV K AEAH  
Sbjct  127  IANERGLKLTTICPALITGPEFCHRNPTATIAYLKGAQKMYFNGLLATVDVKKVAEAHAC  186

Query  341  VYEEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGEIPAR---LCKSKLT  171
            V++EM+  A GRY+CF   I    +A  L   + M       ++  I  +   L  +KL 
Sbjct  187  VFKEMNENAYGRYICFDNVIDAQSEAEKLAKDIGMPKEKICGDASNISLQRYELSNNKLC  246

Query  170  RLLFHTARRLS  138
            RL+F   R  S
Sbjct  247  RLMFRPIRCFS  257



>ref|XP_006395395.1| hypothetical protein EUTSA_v10005604mg, partial [Eutrema salsugineum]
 gb|ESQ32681.1| hypothetical protein EUTSA_v10005604mg, partial [Eutrema salsugineum]
Length=341

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 115/270 (43%), Positives = 159/270 (59%), Gaps = 3/270 (1%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeem-kqlESVVVAR  858
             K+VC+T G +  G  + ++LL+ GY VR  +    D E ++ +  E    +     V A+
Sbjct  56    KVVCITDGLTLLGRAITQRLLLHGYTVRIIVNGPDDLERLRVVRDETATFQGRIEAVTAK  115

Query  857   MTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRC  678
             +T+ + L  AF GC  VFHTS FIDP G+SGY++ MA +E + +  V+ ACS T   RRC
Sbjct  116   LTETESLVYAFDGCDGVFHTSGFIDPSGVSGYSKYMAEIEAKVSEKVMNACSITQSVRRC  175

Query  677   IFTSSLLASIWKGNNH--EHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETK  504
             + TSSLLA +W+          +D SSW+DE  C + KLW+AL K +AEK+AW+ A    
Sbjct  176   LMTSSLLACLWQNGTQFVSPSVIDHSSWSDESLCHDKKLWYALGKLKAEKIAWKIAENKG  235

Query  503   VKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMD  324
              KL T+C AL+ AP+  H     ++ YLKG   M   GVLAT DV   A+AHV VYEEM+
Sbjct  236   FKLSTICAALITAPNLLHHHPTPTIAYLKGADEMYENGVLATVDVHTLAKAHVQVYEEMN  295

Query  323   YGACGRYLCFGRTITTPEDAVLLENRLKMQ  234
               A GRYLCF + IT   +A  L N  ++ 
Sbjct  296   KAAFGRYLCFDKVITREYEAEKLANETRVD  325



>gb|KHN23530.1| Anthocyanidin reductase [Glycine soja]
Length=268

 Score =   215 bits (547),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/214 (49%), Positives = 142/214 (66%), Gaps = 2/214 (1%)
 Frame = -1

Query  872  VVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTA  693
            V++A++TD+D L +AF+GC  VFHTS+F DP G+SGYT+ MA +E  AA NV+EAC++T 
Sbjct  16   VIMAKLTDVDGLEKAFQGCRGVFHTSAFTDPAGLSGYTKSMAEIEVRAAENVMEACARTP  75

Query  692  YARRCIFTSSLLASIWKGNNHEH--DDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRK  519
               RC+FTSSL A +W+ N+       ++ +SW+ E FC E KLW+AL K RAEK AWR 
Sbjct  76   SITRCVFTSSLSACVWQDNSQSDFTPVINHASWSTESFCIEKKLWYALGKMRAEKAAWRI  135

Query  518  AMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFV  339
            + E  +KL T+CPAL+  P F H +  +++ YLKG Q M  QG LA+ DV K AEAH  V
Sbjct  136  SNERGLKLTTICPALITGPEFCHRNPTATIAYLKGAQEMYSQGFLASVDVTKLAEAHASV  195

Query  338  YEEMDYGACGRYLCFGRTITTPEDAVLLENRLKM  237
            ++ M+  A GRY+CF   I T  +A  L   + M
Sbjct  196  FKAMNNEASGRYICFDHVIDTHSEAEKLAKDIGM  229



>gb|EAY75114.1| hypothetical protein OsI_03009 [Oryza sativa Indica Group]
Length=323

 Score =   216 bits (550),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 131/313 (42%), Positives = 170/313 (54%), Gaps = 65/313 (21%)
 Frame = -1

Query  872  VVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYT----------------------  759
             V+A +TD + L  AF GC  VFHTS+F+DP G+SGYT                      
Sbjct  14   TVMANVTDPESLHRAFDGCAGVFHTSAFVDPGGMSGYTVSAPNSVPNLKILATTTPTYVM  73

Query  758  -----------------------ERMAFLETEAAGNVIEACSKTAYARRCIFTSSLLASI  648
                                   + MA LE +AA  VIEAC +T   R+C+FTSSLLA +
Sbjct  74   CSLMLSQKSLRDRVYYLIRTGNQKHMASLEAKAAEQVIEACVRTESVRKCVFTSSLLACV  133

Query  647  WKGNNHEHDD-----LDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTVC  483
            W+  N+ HD      +DE+ W++E FCR+NKLWFAL KT AEK AWR A    +KLVTVC
Sbjct  134  WR-QNYPHDRRFPTIIDENCWSEESFCRDNKLWFALGKTAAEKTAWRAARGRDLKLVTVC  192

Query  482  PALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEM-DYGACGR  306
            PALV  P F   ++ +S+ YLKG + ML  G+LAT  V+  AEAHV VYE M D  A GR
Sbjct  193  PALVTGPGFRRRNSTASIAYLKGARAMLADGLLATASVETVAEAHVRVYEAMGDNTAGGR  252

Query  305  YLCFGRTITTPEDAVLLENRL----KMQGLLSAYESGEIPAR--LCKSKLTRLLFHTARR  144
            Y+C+   +  PE+   LE +L    +     +A +SG+ PAR  LC+ KL RL       
Sbjct  253  YICYDHVVKRPEEFAELERQLGIPRRAAAEAAAQDSGDRPARFELCRQKLARL-------  305

Query  143  LSCKHR*ALCDYY  105
            +S + R    DYY
Sbjct  306  MSTRRRCTYDDYY  318



>ref|XP_006579765.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Glycine max]
 gb|KHN27436.1| Anthocyanidin reductase [Glycine soja]
Length=268

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/252 (45%), Positives = 155/252 (62%), Gaps = 9/252 (4%)
 Frame = -1

Query  872  VVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTA  693
            V++A +TD+D L +AF+GC  VFHTS+F DP G+SGYT+ MA +E  AA NV+EAC++T 
Sbjct  16   VIMANLTDVDGLEKAFQGCRGVFHTSAFTDPAGLSGYTKSMAEIEVRAAENVMEACARTP  75

Query  692  YARRCIFTSSLLASIWKGNNHEH--DDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRK  519
               RC+FTSSL A +W+ N        +   SW+ E FC E KLW+AL K RAEK AWR 
Sbjct  76   SITRCVFTSSLSACVWQDNAQSELSSVISHGSWSTESFCTEKKLWYALGKMRAEKAAWRI  135

Query  518  AMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFV  339
            + E  +KL T+CPAL+  P F + +  +++ YLKG Q M  + +LAT DV K AEAH  V
Sbjct  136  SDERGLKLTTICPALITGPEFCNRNPTATIAYLKGAQEMYSRRLLATVDVTKLAEAHASV  195

Query  338  YEEMDYGACGRYLCFGRTITTPEDAVLLENRLKM--QGLLSAYESGEIPAR--LCKSKLT  171
            ++EM+  A GRY+CF   I T  +A  L   + M  + +     +  I  R  L   KL 
Sbjct  196  FKEMNNNASGRYICFDHVIDTHSEAEKLAKDIGMPEEKICGDASNNSIINRFELSNEKLC  255

Query  170  RLLFHTARRLSC  135
            RL+   +RRL C
Sbjct  256  RLM---SRRLRC  264



>ref|XP_010425566.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Camelina sativa]
Length=328

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/256 (42%), Positives = 160/256 (63%), Gaps = 3/256 (1%)
 Frame = -1

Query  1085  RRCASNVFSSHLWCRERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkel  906
             +R   +++  +L     K+VC+T G ++ G  ++ +LL+ GY VR  +    + E ++ +
Sbjct  39    KRSEKSIYDYNLDEDNPKVVCITDGVTFVGRAIVERLLLHGYTVRVIVNTPDELERVRVM  98

Query  905   lreeem-kqlESVVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEA  729
               E          V A++T+++ L +AF GC+ VFHTS FIDP G+SGY++ MA +E + 
Sbjct  99    KDEMAKFYGRIEAVSAKLTEIESLVDAFDGCYGVFHTSGFIDPSGVSGYSKYMAEIEAKV  158

Query  728   AGNVIEACSKTAYARRCIFTSSLLASIWKGNNH--EHDDLDESSWTDEDFCRENKLWFAL  555
             + NV+ ACS T   RRC+ TSSLLA +W+ N        +D SSW+DE  C++ KLW+AL
Sbjct  159   SENVMNACSMTQSVRRCLMTSSLLACLWQNNTQLDRRSVIDHSSWSDESLCKDKKLWYAL  218

Query  554   AKTRAEKVAWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATE  375
              K +AEK+AW+ A     KLVT+C ALV +P+    ++  ++ YLKGG+ M R GVLAT 
Sbjct  219   GKLKAEKIAWKIAENKGFKLVTICAALVTSPNILQHNSTPTIAYLKGGEEMYRNGVLATV  278

Query  374   DVDKAAEAHVFVYEEM  327
             DV+  A+ HV VYEEM
Sbjct  279   DVNTLAKVHVRVYEEM  294



>gb|AFW83385.1| hypothetical protein ZEAMMB73_643711 [Zea mays]
Length=297

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 127/261 (49%), Positives = 165/261 (63%), Gaps = 24/261 (9%)
 Frame = -1

Query  875  SVVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKT  696
            S V+A + D D L  AF GC  VFHTS+F+DP G+SGYT+ MA LE +AA  VIEAC +T
Sbjct  20   STVMANVMDPDGLRRAFDGCAGVFHTSAFVDPGGMSGYTKHMAALEAQAAERVIEACVRT  79

Query  695  AYARRCIFTSSLLASIWKGNNHEHD-----DLDESSWTDEDFCRENK------------L  567
               R+C+FTSSLLA +W+  ++ HD      +DES W+DE FCR+NK            L
Sbjct  80   ESVRKCVFTSSLLACVWR-QDYPHDRRCPTTIDESCWSDESFCRDNKEEATYCDASFFQL  138

Query  566  WFALAKTRAEKVAWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGV  387
            WFAL KT AEK AWR A    +KLVT+CPALV  P F   ++ +S+ YLKG + ML  G+
Sbjct  139  WFALGKTAAEKAAWRAARGRDLKLVTICPALVTGPGFRRRNSTASIAYLKGARAMLADGL  198

Query  386  LATEDVDKAAEAHVFVYEEM-DYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLS---A  219
            LAT +V+  AEAHV  YE M D  A GRY+C+   +  PE+   LE +L + G  +   A
Sbjct  199  LATANVETVAEAHVHAYEAMGDNTAGGRYICYDHVVKRPEEFAELERQLGLPGGAAPAPA  258

Query  218  YESGEIPAR--LCKSKLTRLL  162
            + S + PAR  LCK KL+RL+
Sbjct  259  HGSDDRPARFELCKRKLSRLM  279



>gb|EMS50301.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Triticum urartu]
Length=380

 Score =   215 bits (547),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 126/248 (51%), Positives = 160/248 (65%), Gaps = 12/248 (5%)
 Frame = -1

Query  872  VVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTA  693
             V+A + + D L  AF GC  VFHTS+F+DP G+SGYT+ MA LE +AA  VI+AC +T 
Sbjct  127  TVMANVMEPDSLHRAFDGCTGVFHTSAFVDPGGMSGYTKHMASLEAQAAERVIQACVRTE  186

Query  692  YARRCIFTSSLLASIWKGNNHEHDD-----LDESSWTDEDFCRENKLWFALAKTRAEKVA  528
              R+C+FTSSLLA +W+  NH H+      +DE+ W+DE FCR NKLWFAL KT AEK A
Sbjct  187  SVRKCVFTSSLLACVWR-QNHPHERRGPTIVDENCWSDESFCRNNKLWFALGKTAAEKAA  245

Query  527  WRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAH  348
            WR A    +KL+TVCPALV  P F   ++ +S+ YLKG  VML  GVLAT +V   AEAH
Sbjct  246  WRAARGRDLKLLTVCPALVTGPGFRRRNSTASIAYLKGSGVMLADGVLATANVATVAEAH  305

Query  347  VFVYEEM-DYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYES---GEIPAR--LC  186
            V VYE M D  A GRY+C+   I   E+   LE +L +    +A +S    + PAR  LC
Sbjct  306  VRVYEAMGDNTAGGRYICYDHVIQRAEEFAELERQLGIPSRTAAAQSVDDDDRPARFELC  365

Query  185  KSKLTRLL  162
            K KL RL+
Sbjct  366  KGKLGRLM  373



>ref|XP_004232300.1| PREDICTED: cinnamoyl-CoA reductase 1 [Solanum lycopersicum]
Length=360

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/261 (41%), Positives = 161/261 (62%), Gaps = 4/261 (2%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVV--  867
             E K VCVTSG S+ G  ++ +LL+RGY VR  ++ Q D E+++E+    EM+Q  + V  
Sbjct  53    EEKKVCVTSGVSFLGIAIVNQLLLRGYSVRVIVEKQEDLEKLREMEISGEMRQSMNTVEA  112

Query  866   -VARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAY  690
              +AR+ D++ L +AF GC  VFHT++F+DP G+SGY++ M  +E     NV +AC+ T  
Sbjct  113   VMARLNDIESLSQAFSGCRGVFHTAAFVDPAGLSGYSKSMVEVEVLVTKNVSQACAITPS  172

Query  689   ARRCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAME  510
              R C+ TSSL+A +W+  N     +D   W+DE  C + KLW+AL K +AE+VA   A E
Sbjct  173   VRNCVLTSSLVACVWQDINSS-TIIDHDCWSDESLCIDKKLWYALGKLKAERVACNIARE  231

Query  509   TKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEE  330
             +  KL T+CP LV  P F   +   ++ YLKG + M R G LAT DV++ A  HV V+E+
Sbjct  232   SGFKLATICPGLVTGPEFISRNPTPTIAYLKGAEEMFRNGALATVDVNRLAVEHVLVFED  291

Query  329   MDYGACGRYLCFGRTITTPED  267
             M   +  RY+ F + + + E+
Sbjct  292   MKNTSYNRYISFDQVVRSEEE  312



>ref|XP_004141093.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Cucumis 
sativus]
 gb|KGN59674.1| hypothetical protein Csa_3G837550 [Cucumis sativus]
Length=384

 Score =   210 bits (534),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 122/269 (45%), Positives = 161/269 (60%), Gaps = 11/269 (4%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARM  855
             +LVCVTSG S  G  L+ +LL+RG+ VR  + +  D E++ E+  + E     S +    
Sbjct  61    ELVCVTSGVSLLGLALVNQLLLRGFSVRILVDSPEDREKVNEMKLKTEAGGGVSKIWTLW  120

Query  854   TDL---DCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
              DL     L  AF GC  VFHTSSFIDP G++GY++ M  +E + + NV+EAC++T+  R
Sbjct  121   GDLRESHSLANAFEGCRGVFHTSSFIDPSGLTGYSKAMVEVEKKVSENVMEACARTSSVR  180

Query  683   RCIFTSSLLASIWKGNNHEH--DDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAME  510
              C+FTSSLLA IW+          +D   W+D   C+  KLW+AL K +AEK AWR A E
Sbjct  181   YCVFTSSLLACIWRDGTRAELPPVVDHDCWSDPSLCKNKKLWYALGKLKAEKAAWRIAKE  240

Query  509   TKVKLVTVCPALVMAPSFPHADTESSLP---YLKGGQVMLRQGVLATEDVDKAAEAHVFV  339
               +KLVT+C AL+  P  PH  T +S P   YLKG Q M  QG+LAT  V   AEAHV V
Sbjct  241   RDIKLVTICSALLTPP--PHLSTNNSTPTIAYLKGAQEMYDQGLLATVSVRTLAEAHVNV  298

Query  338   YEEM-DYGACGRYLCFGRTITTPEDAVLL  255
             YE M +  A GRY+CF + I T  +A  L
Sbjct  299   YEAMGENEAHGRYICFDQIIKTQAEAEAL  327



>gb|EPS68136.1| hypothetical protein M569_06636, partial [Genlisea aurea]
Length=270

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 113/265 (43%), Positives = 165/265 (62%), Gaps = 14/265 (5%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlES----VVVA  861
             VCVTSG +Y G  + ++LL RGY VR     + D E+++E++   EM++ +S    + +A
Sbjct  5     VCVTSGVTYLGTAIAKQLLSRGYSVRIIADKEEDVEKLREMVSSGEMRRADSGAIEIAMA  64

Query  860   RMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARR  681
             +++D+D L EAF GC  VFHT++F+DP G+SGY++ MA +E EA  NVI+AC  +    +
Sbjct  65    KLSDVDSLVEAFDGCCGVFHTAAFVDPSGLSGYSKAMAGIEVEACENVIKACGMSQSVVQ  124

Query  680   CIFTSSLLASIWKGNNHEHDD-----LDESSWTDEDFCRENKLWFALAKTRAEKVAWRKA  516
             C+ TSSLL  IW+  + EHDD     +D  SW++E  C   KLW+AL K RAEK A   A
Sbjct  125   CVLTSSLLTCIWQ--DVEHDDDVPLLIDHKSWSNESLCIAKKLWYALGKLRAEKAAMEIA  182

Query  515   METKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVY  336
               +++ L TVC  L+    F   +  +++ YLKG   M R+G+LA  DVD  A+AH+ V+
Sbjct  183   KRSRLNLATVCGGLITGRDFIQRNPTATIAYLKGTNEMYRRGLLAINDVDLLAKAHIVVF  242

Query  335   EEMD---YGACGRYLCFGRTITTPE  270
             EEM     G+ GRY+ F R I + E
Sbjct  243   EEMKRSPSGSGGRYIWFDRVIESEE  267



>gb|EAZ12850.1| hypothetical protein OsJ_02770 [Oryza sativa Japonica Group]
Length=336

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 132/326 (40%), Positives = 169/326 (52%), Gaps = 78/326 (24%)
 Frame = -1

Query  872  VVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYT----------------------  759
             V+A +TD + L  AF GC  VFHTS+F+DP G+SGYT                      
Sbjct  14   TVMANVTDPESLHRAFDGCAGVFHTSAFVDPGGMSGYTVSAPNSVPNLKILATTTPTYVM  73

Query  758  -----------------------ERMAFLE-------------TEAAGNVIEACSKTAYA  687
                                   + MA LE              +AA  VIEAC +T   
Sbjct  74   CSLMLSQKSLRDRVYYLIRTGNQKHMASLEAKAAEQKHMASLEAKAAEQVIEACVRTESV  133

Query  686  RRCIFTSSLLASIWKGNNHEHDD-----LDESSWTDEDFCRENKLWFALAKTRAEKVAWR  522
            R+C+FTSSLLA +W+  N+ HD      +DE+ W+DE FCR+NKLWFAL KT AEK AWR
Sbjct  134  RKCVFTSSLLACVWR-QNYPHDRRFPTIIDENCWSDESFCRDNKLWFALGKTAAEKTAWR  192

Query  521  KAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVF  342
             A    +KLVTVCPALV  P F   +  +S+ YLKG + ML  G+LAT  V+  AEAHV 
Sbjct  193  AARGRDLKLVTVCPALVTGPGFRRRNYTASIAYLKGARAMLADGLLATASVETVAEAHVR  252

Query  341  VYEEM-DYGACGRYLCFGRTITTPEDAVLLENRL----KMQGLLSAYESGEIPAR--LCK  183
            VYE M D  A GRY+C+   +  PE+   LE +L    +     +A +SG+ PAR  LC+
Sbjct  253  VYEAMGDNTAGGRYICYDHVVKRPEEFAELERQLGIPRRAAAAAAAQDSGDRPARFDLCR  312

Query  182  SKLTRLLFHTARRLSCKHR*ALCDYY  105
             KL RL       +S + R    DYY
Sbjct  313  QKLARL-------MSTRRRCTYDDYY  331



>ref|XP_009125996.1| PREDICTED: cinnamoyl-CoA reductase 2-like isoform X2 [Brassica 
rapa]
Length=350

 Score =   199 bits (505),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 112/274 (41%), Positives = 162/274 (59%), Gaps = 25/274 (9%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATI---QNQVDFeemkellreeemkqlESVVV  864
             +LVCVT G SY G  ++++LLV GY VR  +   +++    EM+            + VV
Sbjct  52    RLVCVTGGVSYLGRAIVKRLLVHGYSVRIVVDCPEDKEKVSEMEADAETASFGNRITSVV  111

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
             +R+T+ + L +AF GC  VFHT++F+DP GISGY++ MA LE + + NVIEAC++T   R
Sbjct  112   SRLTETESLIKAFDGCDGVFHTAAFVDPAGISGYSKSMAELEAKVSENVIEACTRTGSVR  171

Query  683   RCIFTSSLLASIWKG---NNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAM  513
             +C+FTSSLLA   K    N+ +H  ++E SW+DE  C  NKLW+AL K +AEK AWR A 
Sbjct  172   KCVFTSSLLACALKDNSLNDLDHSIINEESWSDEQLCVHNKLWYALGKLKAEKAAWRIAD  231

Query  512   ETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYE  333
                +KL T+CPAL+                  G + M R  +LAT DV++ A+ HV ++E
Sbjct  232   SKGLKLATICPALIT-----------------GAKDMYRNRLLATMDVNRLAKVHVRLWE  274

Query  332   EM-DYGACGRYLCFGRTITTPEDAVLLENRLKMQ  234
              + +  A GRY+CF  TI + + A  L   +  Q
Sbjct  275   GLGNKTAFGRYICFD-TILSKDGAEKLAKDIGAQ  307



>dbj|BAD68587.1| cinnamoyl CoA reductase-like [Oryza sativa Japonica Group]
 dbj|BAD68953.1| cinnamoyl CoA reductase-like [Oryza sativa Japonica Group]
Length=225

 Score =   192 bits (489),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 110/228 (48%), Positives = 141/228 (62%), Gaps = 20/228 (9%)
 Frame = -1

Query  752  MAFLETEAAGNVIEACSKTAYARRCIFTSSLLASIWKGNNHEHDD-----LDESSWTDED  588
            MA LE +AA  VIEAC +T   R+C+FTSSLLA +W+  N+ HD      +DE+ W+DE 
Sbjct  1    MASLEAKAAEQVIEACVRTESVRKCVFTSSLLACVWR-QNYPHDRRFPTIIDENCWSDES  59

Query  587  FCRENKLWFALAKTRAEKVAWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQ  408
            FCR+NKLWFAL KT AEK AWR A    +KLVTVCPALV  P F   ++ +S+ YLKG +
Sbjct  60   FCRDNKLWFALGKTAAEKTAWRAARGRDLKLVTVCPALVTGPGFRRRNSTASIAYLKGAR  119

Query  407  VMLRQGVLATEDVDKAAEAHVFVYEEM-DYGACGRYLCFGRTITTPEDAVLLENRL----  243
             ML  G+LAT  V+  AEAHV VYE M D  A GRY+C+   +  PE+   LE +L    
Sbjct  120  AMLADGLLATASVETVAEAHVRVYEAMGDNTAGGRYICYDHVVKRPEEFAELERQLGIPR  179

Query  242  KMQGLLSAYESGEIPAR--LCKSKLTRLLFHTARRLSCKHR*ALCDYY  105
            +     +A +SG+ PAR  LC+ KL RL       +S + R    DYY
Sbjct  180  RAAAAAAAQDSGDRPARFDLCRQKLARL-------MSTRRRCTYDDYY  220



>gb|KEH24814.1| cinnamoyl-CoA reductase [Medicago truncatula]
Length=263

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/211 (46%), Positives = 134/211 (64%), Gaps = 4/211 (2%)
 Frame = -1

Query  1037  RKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVAR  858
             + LVCVTSG SY G  L+  LLV GY VR  + N  D  E    +R EEM+    +++A+
Sbjct  52    KTLVCVTSGVSYLGLALVNHLLVLGYSVRIIVDNPGD-REKLREIRHEEMRNNLEIIIAK  110

Query  857   MTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRC  678
             + D+D L +AF GC  +FHTS+F DP G+SGYT+ MA +E     NV+EAC++T   +RC
Sbjct  111   LNDVDSLVKAFEGCRGIFHTSAFTDPAGLSGYTKSMAEIEVNVTENVMEACARTPSIKRC  170

Query  677   IFTSSLLASIWKGNNHEH---DDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMET  507
             +FTSSL A IW+ N +       ++  SW+ E  C + KLW+AL K RAEK AWR A E 
Sbjct  171   VFTSSLAACIWQDNVNSDLTTPIINHGSWSSESLCIDKKLWYALGKMRAEKAAWRIANER  230

Query  506   KVKLVTVCPALVMAPSFPHADTESSLPYLKG  414
              +KL T+CPAL+  P F H +  +++ YLKG
Sbjct  231   GLKLTTICPALITGPEFCHRNPTATIAYLKG  261



>gb|ABK21355.1| unknown [Picea sitchensis]
Length=314

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 109/323 (34%), Positives = 174/323 (54%), Gaps = 19/323 (6%)
 Frame = -1

Query  1103  LPVEPPRRCASNVFSSHLWCRERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDF  924
             +PV PP   AS            K+VCV   +SY G+ +++ LL RGY V AT+Q     
Sbjct  1     MPVFPPGLDASE--------GNGKVVCVMDASSYVGSWIVQGLLQRGYSVHATVQRDAG-  51

Query  923   eemkellreeemkqlESVVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAF  744
                +     +  +    +  A + D   + +A +GC A+F+T  F  P   +GY E MA 
Sbjct  52    ---EVESLRKLHENRLQIFYADVLDYHSITDALKGCSALFYT--FEHPQSAAGYDEVMAE  106

Query  743   LETEAAGNVIEACSKTAYARRCIFTSSLLASIWKGNN-HEHDDLDESSWTDEDFCRENKL  567
             +E +AA N +EAC++T    + +FTSS+ A+IW+ +  ++ + +DE  W+D + CR+ KL
Sbjct  107   IEVQAAHNALEACAQTETIEKVVFTSSVAAAIWREDGEYKVNAIDERHWSDANLCRKLKL  166

Query  566   WFALAKTRAEKVAWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGV  387
             W+ALAKT +EK AW  AM+  + +VT+  +L++ P   +  + S++ YLKG   M  +G 
Sbjct  167   WYALAKTLSEKAAWALAMDRGLNMVTINASLIVGPGITYKSSGSTIAYLKGAAQMYEKGT  226

Query  386   LATEDVDKAAEAHVFVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLK-MQGLLSAYES  210
             L++ D+   A+AH+  YE  D  A GRY+CF + ++  ED   L   L+ +      +E 
Sbjct  227   LSSVDIRFLADAHICAYE--DPSAYGRYICFNQIVSNAEDVANLAQSLRHLVPFPDRFED  284

Query  209   GEI-PARLCKSKLTRLLFHTARR  144
               +   RL   KLT L+     R
Sbjct  285   STVHQQRLSNKKLTGLMVGFGNR  307



>emb|CDP02864.1| unnamed protein product [Coffea canephora]
Length=310

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/304 (37%), Positives = 170/304 (56%), Gaps = 17/304 (6%)
 Frame = -1

Query  1037  RKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVAR  858
              K VCV   ++Y G  +++KLL++GY+V A +QN  D   MK+++  E+ ++  +     
Sbjct  13    EKAVCVLDASTYVGFWVVKKLLLKGYMVHAALQNSGDEVVMKKIVELEKTEERLTAFTVD  72

Query  857   MTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRC  678
             + D   + EA +GC A+F      D     GY E+    E   A NV+EAC++T    + 
Sbjct  73    VLDYHSVLEALKGCCAMFCCLDIAD-----GYDEKDVDYEVRGAINVVEACAQTDTIEKI  127

Query  677   IFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVK  498
             +F+SSL A+IW+ N     D+DE +W+D++FCRE KLW+ALAKT +EK AW  AM+  + 
Sbjct  128   VFSSSLTAAIWRENICSQKDVDERTWSDQEFCREKKLWYALAKTLSEKAAWALAMDRMLN  187

Query  497   LVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYG  318
             +V+V   LV+ P     +   ++ YL+G   M   GVLA  DV+  A+ H+  +E  D  
Sbjct  188   MVSVNAGLVLGPGVVQLNPRVTMAYLQGTAQMYENGVLAFVDVNFLADVHIRAFE--DKS  245

Query  317   ACGRYLCFGRTITTPEDAVLLENRLKMQGLLS-----AYESGEI---PARLCKSKLTRLL  162
               GRYLCF + + T E+AV L   L    L+S      ++ GE+     RL  +KL +L+
Sbjct  246   TTGRYLCFNQIVNTEEEAVKLAESL--SPLISLPPRYKFQEGEVEECAERLRNNKLNKLV  303

Query  161   FHTA  150
               TA
Sbjct  304   EGTA  307



>ref|XP_008223579.1| PREDICTED: cinnamoyl-CoA reductase 2-like isoform X2 [Prunus 
mume]
Length=298

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/299 (37%), Positives = 167/299 (56%), Gaps = 15/299 (5%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVA  861
             E+ +VCV   ++Y G  +++ LL RG+ V A IQN  + E  K +   E++++   V V 
Sbjct  4     EKPVVCVLDASTYVGFWILKGLLGRGFTVHAAIQNNGETEIQKRIREMEKVEERLEVFVV  63

Query  860   RMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARR  681
              + D   +  A +GC A+F      D     GY E+M  LE   A NV+EAC++T    +
Sbjct  64    DVLDYHSVLLALKGCSAMFCCLDSSD-----GYEEKMVDLEVRGAINVVEACAQTETVEK  118

Query  680   CIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKV  501
              +FTSSL A+IW+ N     D+DE SW+D++FCR+ KLW+ALAKT +E+ AW  +M+  +
Sbjct  119   IVFTSSLTAAIWRENICSEKDVDEKSWSDQEFCRKLKLWYALAKTLSEQAAWALSMDRML  178

Query  500   KLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDY  321
             K+V++   LV+ PS    +  +++ YL G   M   GVLA  DV+  A+ H+   E  D 
Sbjct  179   KMVSINSGLVLGPSVVQQNPRTTMSYLNGAAQMYENGVLAFVDVNFLADIHIRALE--DE  236

Query  320   GACGRYLCFGRTITTPEDAVLLENRLKMQGLLS-----AYESGEI-PARLCKSKLTRLL  162
               CGRY CF R + T ++AV L   L    L+S      Y   E+   RL   KL++L+
Sbjct  237   STCGRYFCFNRIVNTEDEAVKLAESL--SPLISLPPRYEYHGSEVHTERLRTKKLSKLV  293



>ref|XP_010268414.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Nelumbo nucifera]
Length=314

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 113/301 (38%), Positives = 167/301 (55%), Gaps = 11/301 (4%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVA  861
             ++  VCV   +SY G  +++ LL RGY V A IQN  + E ++++   E M++   V V 
Sbjct  20    QKPSVCVLDSSSYVGFSILKGLLSRGYKVHAAIQNNGETEIVRKIRELERMEERLVVFVV  79

Query  860   RMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARR  681
              + D   +  A +GC A+F +    D     GY ++M  LE   A NV+EAC++T    +
Sbjct  80    DVLDYQSIVGALKGCSALFCSLDSSD-----GYDDKMVDLEVRGAINVVEACAQTETIEK  134

Query  680   CIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKV  501
              +F+SSL +SIW+ N     D+DE SW+D +FCR  KLW+ALAKT +E+ AW  AM+  +
Sbjct  135   IVFSSSLASSIWRENISVEKDIDEKSWSDPEFCRRQKLWYALAKTLSEQAAWALAMDRML  194

Query  500   KLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDY  321
              +V+V   LV+ PS    +   ++ YLKG   M   GVLA  DVD   + H+  YE  D 
Sbjct  195   SMVSVNAGLVLGPSVAQQNPRPTMSYLKGAAEMYENGVLAFVDVDFLVDVHIRTYE--DK  252

Query  320   GACGRYLCFGRTITTPEDAVLLENRLK-MQGLLSAYE---SGEIPARLCKSKLTRLLFHT  153
               CGRY+CF + I T E+A+ L   L  +  L   Y+   S     +L K+KL +L+   
Sbjct  253   STCGRYICFSQIINTDEEAIKLAEALSPLISLPPGYQCQASVAYADKLRKTKLNKLVESA  312

Query  152   A  150
             A
Sbjct  313   A  313



>ref|XP_007222830.1| hypothetical protein PRUPE_ppa008797mg [Prunus persica]
 ref|XP_007222832.1| hypothetical protein PRUPE_ppa008797mg [Prunus persica]
 gb|EMJ24029.1| hypothetical protein PRUPE_ppa008797mg [Prunus persica]
 gb|EMJ24031.1| hypothetical protein PRUPE_ppa008797mg [Prunus persica]
Length=315

 Score =   184 bits (468),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 101/266 (38%), Positives = 153/266 (58%), Gaps = 7/266 (3%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVA  861
             ++ +VCV   ++Y G  +++ LL RG+ V A IQN  + E  K +   E++++   V V 
Sbjct  21    KKPIVCVLDASTYVGFWILKGLLGRGFTVHAAIQNNGETEIQKRIREMEKVEERLEVFVV  80

Query  860   RMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARR  681
              + D   +  A +GC A+F      D     GY E+M  LE   A NV+EAC++T    +
Sbjct  81    DVLDYHSILLALKGCSAMFCCLDSSD-----GYDEKMVDLEVRGAINVVEACAQTETLEK  135

Query  680   CIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKV  501
              +FTSSL A+IW+ +     D+DE SW+D+DFCR+ KLW+ALAKT +E+ AW  +M+  +
Sbjct  136   IVFTSSLTAAIWREDICSEKDVDEKSWSDQDFCRKLKLWYALAKTLSEQAAWALSMDRML  195

Query  500   KLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDY  321
             K+V++   LV+ PS    +  +++ YL G   M   GVLA  DV+  A+ H+   E  D 
Sbjct  196   KMVSINSGLVLGPSVAQQNPRTTMSYLNGAAQMYENGVLAFVDVNFLADIHIRALE--DQ  253

Query  320   GACGRYLCFGRTITTPEDAVLLENRL  243
               CGRY CF R + T ++AV L   L
Sbjct  254   STCGRYFCFNRIVNTEDEAVKLAESL  279



>tpg|DAA58407.1| TPA: hypothetical protein ZEAMMB73_758171 [Zea mays]
Length=332

 Score =   184 bits (468),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 126/319 (39%), Positives = 172/319 (54%), Gaps = 49/319 (15%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlES-VVVARMT  852
             VCVT G S+ G  ++ +LL  GY VR  ++ Q D ++++E+    +  +     V+A + 
Sbjct  58    VCVTGGISFVGFAVVDRLLRHGYTVRLALETQEDMDKLREMEMFGDDGRDGVWTVMANVM  117

Query  851   DLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIF  672
             D + L  AF GC  VFHTS+F+DP G+SGYT                      + RRC  
Sbjct  118   DPESLHRAFDGCAGVFHTSAFVDPGGMSGYT-------------------NNPHGRRCPT  158

Query  671   TSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLV  492
                               +DES W+DE FCR+NKLWFAL KT AEK AWR A    +KLV
Sbjct  159   I-----------------IDESCWSDESFCRDNKLWFALGKTAAEKAAWRAARGRDLKLV  201

Query  491   TVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEM-DYGA  315
             T+CPALV  P F   ++ +S+ YLKG + ML  G+LAT +V+  AEAHV  YE M D  A
Sbjct  202   TICPALVTGPGFRRRNSTASIAYLKGARAMLADGLLATANVETVAEAHVLAYEAMGDNTA  261

Query  314   CGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYE-SGEIPAR--LCKSKLTRLLFHTARR  144
              GRY+C+   +  PE+   LE +L + G  +A + S + PAR  LCK KL+RL+   + R
Sbjct  262   GGRYICYDHVVKRPEEFAELERQLGLPGGAAAAQGSDDRPARFELCKRKLSRLM---SSR  318

Query  143   LSCKHR*ALCDYYYYEGLD  87
               C +     D YY    D
Sbjct  319   RRCTY-----DTYYSVAFD  332



>ref|XP_009137924.1| PREDICTED: cinnamoyl-CoA reductase 2 [Brassica rapa]
 emb|CDX72244.1| BnaC07g42660D [Brassica napus]
Length=303

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 108/294 (37%), Positives = 160/294 (54%), Gaps = 13/294 (4%)
 Frame = -1

Query  1025  CVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTDL  846
             CV   ++Y G  +++KLL RGY V A I+   D E  + +   E  ++   V    + D 
Sbjct  11    CVLDASTYVGFWILKKLLSRGYSVHAAIRKNGDSEIEETIREMEATEERLVVYDVDVLDY  70

Query  845   DCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTS  666
               +  + + C+AVF       P G   Y E+   LE   A NV+EAC +T    + +F+S
Sbjct  71    QSILVSLKTCNAVF--CCLDSPEG---YDEKEVDLEVRGAINVVEACGRTESIEKIVFSS  125

Query  665   SLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTV  486
             SL ASIW+ N     D+DE  W+D+DFCR  KLW ALAK  +EK AW  AM+ ++ +V++
Sbjct  126   SLTASIWRDNIGTQKDVDEKCWSDQDFCRNKKLWHALAKMLSEKAAWALAMDRRLNMVSI  185

Query  485   CPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGR  306
              P L++ PS    +   ++ YLKG   M   GVLA  DV   A+ H+  YE  D  ACGR
Sbjct  186   NPGLIVGPSVAQYNPRPTMSYLKGAAQMYENGVLAYVDVKFLADVHIRAYE--DVSACGR  243

Query  305   YLCFGRTITTPEDAV-LLENRLKMQGLLSAYES----GEI-PARLCKSKLTRLL  162
             Y CF + + T E+A+ L+E+   +  +   YES     E+   RL  +KL++L+
Sbjct  244   YFCFNQIVNTEEEALKLVESLSPLIPMPPRYESVMQGSEVYEERLRNNKLSKLV  297



>ref|XP_008223578.1| PREDICTED: cinnamoyl-CoA reductase 2-like isoform X1 [Prunus 
mume]
Length=302

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 111/303 (37%), Positives = 167/303 (55%), Gaps = 19/303 (6%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQV----DFeemkellreeemkqlES  873
             E+ +VCV   ++Y G  +++ LL RG+ V A IQN      + E  K +   E++++   
Sbjct  4     EKPVVCVLDASTYVGFWILKGLLGRGFTVHAAIQNNGFDAGETEIQKRIREMEKVEERLE  63

Query  872   VVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTA  693
             V V  + D   +  A +GC A+F      D     GY E+M  LE   A NV+EAC++T 
Sbjct  64    VFVVDVLDYHSVLLALKGCSAMFCCLDSSD-----GYEEKMVDLEVRGAINVVEACAQTE  118

Query  692   YARRCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAM  513
                + +FTSSL A+IW+ N     D+DE SW+D++FCR+ KLW+ALAKT +E+ AW  +M
Sbjct  119   TVEKIVFTSSLTAAIWRENICSEKDVDEKSWSDQEFCRKLKLWYALAKTLSEQAAWALSM  178

Query  512   ETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYE  333
             +  +K+V++   LV+ PS    +  +++ YL G   M   GVLA  DV+  A+ H+   E
Sbjct  179   DRMLKMVSINSGLVLGPSVVQQNPRTTMSYLNGAAQMYENGVLAFVDVNFLADIHIRALE  238

Query  332   EMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLS-----AYESGEI-PARLCKSKLT  171
               D   CGRY CF R + T ++AV L   L    L+S      Y   E+   RL   KL+
Sbjct  239   --DESTCGRYFCFNRIVNTEDEAVKLAESL--SPLISLPPRYEYHGSEVHTERLRTKKLS  294

Query  170   RLL  162
             +L+
Sbjct  295   KLV  297



>ref|XP_010933456.1| PREDICTED: cinnamoyl-CoA reductase 2-like isoform X1 [Elaeis 
guineensis]
Length=306

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 108/262 (41%), Positives = 143/262 (55%), Gaps = 12/262 (5%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARM  855
             K VCV   +   G  L+++LL RGY+V A   N V     +    +    + E + + R 
Sbjct  11    KTVCVMDASGRLGVSLVQRLLQRGYIVHAATYNHVGAPGGELHGLKGLSCEKERLKLFRT  70

Query  854   TDLD--CLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARR  681
                D   L +A +GC  +F+T    +P     Y E MA +E  AA NV+EAC++T    R
Sbjct  71    DPFDYQSLVDAMKGCAGLFYT---FEPPQDQNYDEFMAEVEVRAAHNVLEACAQTESMER  127

Query  680   CIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKV  501
              +FTSS+ A IWK N     D DE  W++ +FCR+ KLW ALAKT AEK AW  AM+  V
Sbjct  128   VVFTSSVAAVIWKENRKLDTDFDERDWSELNFCRKLKLWHALAKTLAEKTAWALAMDRGV  187

Query  500   KLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDY  321
              + +V   LV+ P     DT  + PYLKG   M   GVL T DV+  A+AH+ V+E    
Sbjct  188   DMASVNAGLVVGP-----DTSLASPYLKGAPEMYEDGVLVTVDVNFLADAHIAVFETP--  240

Query  320   GACGRYLCFGRTITTPEDAVLL  255
              A GRYLCF R +  PEDAV L
Sbjct  241   SAYGRYLCFNRAVCRPEDAVKL  262



>emb|CDY39681.1| BnaA04g13980D [Brassica napus]
Length=303

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/257 (38%), Positives = 144/257 (56%), Gaps = 7/257 (3%)
 Frame = -1

Query  1025  CVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTDL  846
             CV   ++Y G  +++KLL RGY VRA I+   +    +++   +  ++   V    + D 
Sbjct  11    CVLDASTYVGFWILKKLLTRGYSVRAAIRKNGESILEEKIRNMQATEERLVVYDVDVLDY  70

Query  845   DCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTS  666
               +  +   C+AVF      +P G   Y E    LE   A NV+EAC++T    + +F+S
Sbjct  71    QSILVSLNNCNAVF--CCLDNPEG---YDEMEVDLEVRGAINVVEACARTESIDKIVFSS  125

Query  665   SLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTV  486
             SL A+IW  N     D+DE SW+D DFC + KLW ALAKT++EK AW  AM+  V +V+V
Sbjct  126   SLTAAIWTDNIGTQKDVDEKSWSDLDFCLKKKLWHALAKTQSEKAAWALAMDRMVNMVSV  185

Query  485   CPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGR  306
              P L++ PS    +   ++ +LKG   M   GVLA  DV+  A+ H+ V+E  D  ACGR
Sbjct  186   NPGLIVGPSVTQHNPRPTMSFLKGAAQMYENGVLAYVDVEFVADVHIRVFE--DTSACGR  243

Query  305   YLCFGRTITTPEDAVLL  255
             Y CF + + T E+A+ L
Sbjct  244   YFCFNQIVNTEEEALKL  260



>ref|XP_007222831.1| hypothetical protein PRUPE_ppa008797mg [Prunus persica]
 gb|EMJ24030.1| hypothetical protein PRUPE_ppa008797mg [Prunus persica]
Length=319

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/270 (37%), Positives = 153/270 (57%), Gaps = 11/270 (4%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQV----DFeemkellreeemkqlES  873
             ++ +VCV   ++Y G  +++ LL RG+ V A IQN      + E  K +   E++++   
Sbjct  21    KKPIVCVLDASTYVGFWILKGLLGRGFTVHAAIQNNGFDAGETEIQKRIREMEKVEERLE  80

Query  872   VVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTA  693
             V V  + D   +  A +GC A+F      D     GY E+M  LE   A NV+EAC++T 
Sbjct  81    VFVVDVLDYHSILLALKGCSAMFCCLDSSD-----GYDEKMVDLEVRGAINVVEACAQTE  135

Query  692   YARRCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAM  513
                + +FTSSL A+IW+ +     D+DE SW+D+DFCR+ KLW+ALAKT +E+ AW  +M
Sbjct  136   TLEKIVFTSSLTAAIWREDICSEKDVDEKSWSDQDFCRKLKLWYALAKTLSEQAAWALSM  195

Query  512   ETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYE  333
             +  +K+V++   LV+ PS    +  +++ YL G   M   GVLA  DV+  A+ H+   E
Sbjct  196   DRMLKMVSINSGLVLGPSVAQQNPRTTMSYLNGAAQMYENGVLAFVDVNFLADIHIRALE  255

Query  332   EMDYGACGRYLCFGRTITTPEDAVLLENRL  243
               D   CGRY CF R + T ++AV L   L
Sbjct  256   --DQSTCGRYFCFNRIVNTEDEAVKLAESL  283



>ref|XP_011018095.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Populus euphratica]
Length=299

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 110/300 (37%), Positives = 165/300 (55%), Gaps = 16/300 (5%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQN-QVDFeemkellreeemkqlESVVVARMT  852
             VCV   ++Y G  +++ LL +GY V A IQ    +    K++      ++  SV    + 
Sbjct  9     VCVLDASTYVGFWILKGLLSKGYTVHAAIQKYNGETGMEKKIRDLAREEERLSVFEVDVL  68

Query  851   DLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIF  672
             D   +  A +GC A+F      D     GY ++M  LE   A NV+EAC++T    + IF
Sbjct  69    DYHSILIALKGCSAMFCCLDCPD-----GYDDKMIDLEVRGAINVVEACAQTDTIEKIIF  123

Query  671   TSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLV  492
             +SSL A+IW+ N    +D+DE SW+D++FCR+ KLW+ALAKT +E  AW  AM+ K+ +V
Sbjct  124   SSSLTAAIWRENICSQEDVDERSWSDQEFCRKLKLWYALAKTLSEHAAWALAMDRKLNMV  183

Query  491   TVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGAC  312
             ++   LV+ P     +  S++ YLKG   M   GVLA+ DV+   + H+  ++  D   C
Sbjct  184   SINAGLVLGPGVSQQNPLSTMSYLKGVAQMYENGVLASVDVNFLVDVHIRAFQ--DRSTC  241

Query  311   GRYLCFGRTITTPEDAVLLENRLKMQGLLS-----AYESGEIPA-RLCKSKLTRLLFHTA  150
             GRY CF +T+ T E+AV L   L    L+S      Y+  E+ A RL   KL +L+  TA
Sbjct  242   GRYFCFNQTVHTEEEAVKLTQSLS--PLISLPQRYEYQGSEVYAERLRTKKLNKLVEGTA  299



>ref|XP_002324600.2| hypothetical protein POPTR_0018s10950g [Populus trichocarpa]
 gb|ABK93002.1| unknown [Populus trichocarpa]
 gb|EEF03165.2| hypothetical protein POPTR_0018s10950g [Populus trichocarpa]
Length=299

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 111/300 (37%), Positives = 164/300 (55%), Gaps = 16/300 (5%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQN-QVDFeemkellreeemkqlESVVVARMT  852
             VCV   ++Y G  +++ LL RGY V A IQ    +    K++      ++  SV    + 
Sbjct  9     VCVLDASTYVGFWILKGLLSRGYTVHAAIQKYNGETGMEKKIRDLAREEERLSVFEVDVL  68

Query  851   DLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIF  672
             D   +  A +GC A+F      D     GY ++M  LE   A NV+EAC++T    + IF
Sbjct  69    DYHSILVALKGCSAMFCCLDCPD-----GYDDKMIDLEVRGAINVVEACAQTDTIEKIIF  123

Query  671   TSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLV  492
             +SSL A+IW+ N    +D+DE SW+D++FCR+ KLW+ALAKT +E  AW  AM+ K+ +V
Sbjct  124   SSSLTAAIWRENICSQEDVDERSWSDQEFCRKLKLWYALAKTLSEHAAWALAMDRKLNMV  183

Query  491   TVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGAC  312
             ++   LV+ P     +  S++ YLKG   M   GVLA  DV+   + H+  ++  D   C
Sbjct  184   SINAGLVLGPGVSQQNPLSTMSYLKGIAQMYENGVLACVDVNFLVDVHIRAFQ--DRSTC  241

Query  311   GRYLCFGRTITTPEDAVLLENRLKMQGLLS-----AYESGEIPA-RLCKSKLTRLLFHTA  150
             GRY CF +T+ T E+AV L   L    L+S      Y+  E+ A RL   KL +L+  TA
Sbjct  242   GRYFCFNQTVHTEEEAVKLTQSLS--PLISLPQRYEYQGSEVYAERLRTKKLNKLVEGTA  299



>gb|KDP38748.1| hypothetical protein JCGZ_04101 [Jatropha curcas]
Length=298

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 109/301 (36%), Positives = 163/301 (54%), Gaps = 11/301 (4%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVA  861
             E   VCV   ++Y G  +++ LL +GY V A  QN+ D E  K++   E+ ++   V   
Sbjct  4     ELPTVCVLDASTYVGFWILKGLLNKGYTVHAATQNKGDTEIGKKIKELEKEEERLVVFSV  63

Query  860   RMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARR  681
              + D   +  A +GC A+F      D     GY + M  LE   A NV+EAC+++    +
Sbjct  64    DVLDYQSILFALKGCSALFCCLDSPD-----GYEDEMVDLEVRGAINVVEACAQSYSIDK  118

Query  680   CIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKV  501
              +F+SSL A+IWK N     D+DE SW+D++FC++ KLW ALAKT+AE+ AW  AM+  +
Sbjct  119   IVFSSSLNAAIWKENIDSQKDVDERSWSDQEFCKKLKLWHALAKTQAEQAAWALAMDRML  178

Query  500   KLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDY  321
              +V++   LVM P+    +  S++ YLKG   M   GVLA  +V+   + H+   E  D 
Sbjct  179   NMVSINAGLVMGPAVTQQNPGSTVSYLKGAAQMYENGVLAFVEVNFLVDVHIRALE--DR  236

Query  320   GACGRYLCFGRTITTPEDAVLLENRLKMQGLLSA---YESGEIPA-RLCKSKLTRLLFHT  153
               CGRY CF + + T ++AV L   L     L     Y+  E+ A RL   KL +L+  T
Sbjct  237   STCGRYFCFNQIVNTEQEAVKLAQSLSPLIPLPPRYEYQGSEVHAERLTNKKLNKLVEGT  296

Query  152   A  150
             A
Sbjct  297   A  297



>ref|XP_010103123.1| hypothetical protein L484_022996 [Morus notabilis]
 gb|EXB94888.1| hypothetical protein L484_022996 [Morus notabilis]
Length=300

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 109/302 (36%), Positives = 166/302 (55%), Gaps = 12/302 (4%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQV--DFeemkellreeemkqlESVV  867
             E+  VCV   ++Y G  ++++LL RGY V A I   +  + E  K+L   E++++  SV 
Sbjct  4     EKPAVCVLDASTYVGFWILKRLLSRGYSVHAAIHRNIGAETEIEKKLKEMEKVEERLSVF  63

Query  866   VARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYA  687
                + D   +  A +GC+ +F      D     GY +++   E   A NV+EAC++T   
Sbjct  64    AIDILDYQSILLALKGCNGLFCCLENPD-----GYDDKLVKWEVRGAINVVEACAQTESV  118

Query  686   RRCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMET  507
              + +FTSSL A+IW+ N     D+DESSW++++FCR+ KLW ALAKT +EK AW  AM+ 
Sbjct  119   EKIVFTSSLTAAIWRENISSEKDIDESSWSNQEFCRKLKLWQALAKTLSEKAAWALAMDR  178

Query  506   KVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEM  327
              + +V++   LV+ P+    +  S++ YL G   M   GVLA  DV+  A+ H+  +E  
Sbjct  179   ALNMVSINAGLVVGPAVAQENPLSTMSYLNGAAQMYENGVLALVDVNFLADVHIRAFE--  236

Query  326   DYGACGRYLCFGRTITTPEDAVLLENRLK-MQGLLSAYE--SGEIPARLCKSKLTRLLFH  156
             D   CGRY CF + + T E+AV L + L  +  L   YE    E   RL   KL +L+  
Sbjct  237   DRSTCGRYFCFDQIVNTEEEAVKLAHSLSPLISLPPRYERQGSERQGRLRTEKLNKLVES  296

Query  155   TA  150
              A
Sbjct  297   AA  298



>ref|XP_010525771.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Tarenaya hassleriana]
Length=302

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 108/304 (36%), Positives = 162/304 (53%), Gaps = 23/304 (8%)
 Frame = -1

Query  1043  RERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVV  864
             +++   CV   ++Y G  ++++LL RGY V A I+   + E  K++   E  ++   V  
Sbjct  6     KKKPTCCVLDASTYVGFWILKRLLSRGYFVHAAIRKNGESEIEKKIKDMEVAEERLDVYY  65

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
               + D   +  + +GC+ VF      +P   SGY E+   LE   A NV+EAC++T    
Sbjct  66    VDVLDYQSILMSLKGCNVVF--CCLDNP---SGYDEKEVDLEVRGAINVVEACAQTDTID  120

Query  683   RCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETK  504
             + +F+SSL A+IW+ N     D+DE  W+D+DFCR+ KLW ALAKT +EK AW  AM+  
Sbjct  121   KIVFSSSLTAAIWRDNIGTQKDVDERCWSDQDFCRKKKLWHALAKTLSEKAAWALAMDRM  180

Query  503   VKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMD  324
             V +V++   L++ P     +   +L YLKG   M   GVLA  DV+  A+ H+   E  D
Sbjct  181   VNMVSINAGLIIGPYVSQQNPSPTLSYLKGAAQMYENGVLAHVDVEFLADVHIRALE--D  238

Query  323   YGACGRYLCFGRTITTPEDAVLLEN----------RLKMQGLLSAYESGEIPARLCKSKL  174
                CGRY CF R + T E+A+ L +          R +MQG    YE      RL   KL
Sbjct  239   SSTCGRYFCFDRIVNTDEEALKLVHSLSPLIPVPPRYEMQG-NEVYEE-----RLRNKKL  292

Query  173   TRLL  162
             ++L+
Sbjct  293   SKLV  296



>emb|CDY65186.1| BnaC04g56240D [Brassica napus]
Length=303

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/257 (38%), Positives = 143/257 (56%), Gaps = 7/257 (3%)
 Frame = -1

Query  1025  CVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTDL  846
             CV   ++Y G  +++KLL RGY VRA I+   +    +++   +  ++   V    + D 
Sbjct  11    CVLDASTYVGFWILKKLLTRGYSVRAAIRKNGESILEEKIRNMQATEERLVVYDVDVLDY  70

Query  845   DCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTS  666
               +  +   C+AVF      +P G   Y E    LE   A NV+EAC++T    + +F+S
Sbjct  71    QSILVSLNNCNAVF--CCLDNPEG---YDEMEVDLEVRGAINVVEACARTESIDKIVFSS  125

Query  665   SLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTV  486
             SL A+IW  N     D+DE SW+D DFC + KLW ALAKT++EK AW  AM+  V +V+V
Sbjct  126   SLTAAIWTDNIGTQKDVDEKSWSDLDFCLKKKLWHALAKTQSEKAAWALAMDRMVNMVSV  185

Query  485   CPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGR  306
              P L + PS    +   ++ +LKG   M   GVLA  DV+  A+ H+ V+E  D  ACGR
Sbjct  186   NPGLTVGPSVTQHNPRPTMSFLKGAAQMYENGVLAYVDVEFVADVHIRVFE--DTSACGR  243

Query  305   YLCFGRTITTPEDAVLL  255
             Y CF + + T E+A+ L
Sbjct  244   YFCFNQIVNTEEEALKL  260



>ref|XP_009140504.1| PREDICTED: cinnamoyl-CoA reductase 2 [Brassica rapa]
Length=341

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/257 (38%), Positives = 144/257 (56%), Gaps = 7/257 (3%)
 Frame = -1

Query  1025  CVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTDL  846
             CV   ++Y G  +++KLL RGY VRA I+   +    +++   +  ++   V    + D 
Sbjct  49    CVLDASTYVGFWILKKLLTRGYSVRAAIRKNGESILEEKIRNMQATEERLVVYDVDVLDY  108

Query  845   DCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTS  666
               +  +   C+AVF      +P G   Y E    LE   A NV+EAC++T    + +F+S
Sbjct  109   QSILVSLNNCNAVF--CCLDNPEG---YDELEVDLEVRGAINVVEACARTESIDKIVFSS  163

Query  665   SLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTV  486
             SL A+IW  N     D+DE SW+D DFC + KLW ALAKT++EK AW  AM+  V +V+V
Sbjct  164   SLTAAIWTDNIGTQKDVDEKSWSDLDFCLKKKLWHALAKTQSEKAAWALAMDRMVNMVSV  223

Query  485   CPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGR  306
              P L++ PS    +   ++ +LKG   M   GVLA  DV+  A+ H+ V+E  D  ACGR
Sbjct  224   NPGLIVGPSVTQHNPRPTMSFLKGAAQMYENGVLAYVDVEFVADVHIRVFE--DTSACGR  281

Query  305   YLCFGRTITTPEDAVLL  255
             Y CF + + T E+A+ L
Sbjct  282   YFCFNQIVNTEEEALKL  298



>gb|KFK29618.1| hypothetical protein AALP_AA7G157400 [Arabis alpina]
Length=303

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 105/294 (36%), Positives = 157/294 (53%), Gaps = 13/294 (4%)
 Frame = -1

Query  1025  CVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTDL  846
             CV   ++Y G  +++KLL RGY V A I+   D E  + +   E  ++   V    + D 
Sbjct  11    CVLDASTYVGFWILKKLLSRGYSVHAAIRKNGDSEIEETIREMEATEERLVVYDVDVLDY  70

Query  845   DCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTS  666
               +  + + C+AVF       P G   Y E+   LE   A NV+EAC +T    + +F+S
Sbjct  71    QTILVSLKNCNAVF--CCLDSPEG---YDEKEVDLEVRGAINVVEACGRTESIEKIVFSS  125

Query  665   SLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTV  486
             SL ASIW+ N     D+DE  W+D+DFCR  KLW ALAK  +EK AW  AM+ ++ +V++
Sbjct  126   SLTASIWRDNIGTQKDVDEKCWSDQDFCRNKKLWHALAKMLSEKAAWALAMDRRINMVSI  185

Query  485   CPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGR  306
              P L++ P     +   ++ YLKG   M   GVLA  DV   A+ H+  +E  D  ACGR
Sbjct  186   NPGLIVGPFVAQHNPRPTMSYLKGAAQMYENGVLAYVDVKFLADVHIRAFE--DVSACGR  243

Query  305   YLCFGRTITTPEDAV-LLENRLKMQGLLSAYE-----SGEIPARLCKSKLTRLL  162
             Y CF + + T E+A+ L+E+   +  +   YE     S     RL  +KL++L+
Sbjct  244   YFCFNQIVNTEEEALKLVESLSPLIPMPPRYENEMQGSEVYEERLRNNKLSKLV  297



>ref|XP_010240887.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Nelumbo nucifera]
Length=307

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 107/295 (36%), Positives = 153/295 (52%), Gaps = 15/295 (5%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARM  855
             K VCV   +   G+ L+ +LL  GY V A +QN  D +  K +  + +      V  A  
Sbjct  14    KTVCVMDASGRLGSSLVDRLLQGGYTVHAAVQNHGDLQAFKGISSDNDKNL--KVFHADP  71

Query  854   TDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCI  675
              D   + +A +GC  +F+T  F  P   S + E MA +E  AA NV+EAC++T    + +
Sbjct  72    FDYQSIMDALKGCSGLFYT--FEPPQDQSTFDEFMAEVEVRAAHNVLEACAQTDTIDKVV  129

Query  674   FTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKL  495
             FTSS+ A IW+ +     D DE +W+D +FCR+ KLW AL+KT AEK AW  AM+  + +
Sbjct  130   FTSSVTAVIWREDRKSSSDFDERNWSDVNFCRKFKLWHALSKTMAEKTAWALAMDRGLNM  189

Query  494   VTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGA  315
             V++   L+M P     +     PYLKG   M   GV  T D+    +AH+  YE  D   
Sbjct  190   VSINAGLLMGPELSITN-----PYLKGAAEMYEDGVFVTVDLRFLVDAHICAYE--DIST  242

Query  314   CGRYLCFGRTITTPEDAVLLENRL---KMQGLLSAYESGEI-PARLCKSKLTRLL  162
              GRYLCF   I  PEDA+ L   L       L  ++E   I   R+   KL++L+
Sbjct  243   YGRYLCFNHVINRPEDALKLAQMLTPSTASALPPSWEDTRILEQRISNKKLSKLM  297



>ref|XP_006352867.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like isoform 
X2 [Solanum tuberosum]
Length=314

 Score =   176 bits (446),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 119/315 (38%), Positives = 166/315 (53%), Gaps = 27/315 (9%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVD---FeemkellreeemkqlESVVVAR  858
             VCV   +S  G  L++ LL RGY V A++QN  +   F +  E   +++  +   +  + 
Sbjct  5     VCVMDASSCLGTKLVKCLLQRGYTVHASLQNYGESSLFLDELECDDDDDKMKKLKIFKSD  64

Query  857   MTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRC  678
               D   + +A +GC A+F+  SF  PH  S Y E +  +E  AA NV+EAC++T    + 
Sbjct  65    PFDYHSIVDALKGCCALFY--SFEPPHDHSTYDEYIGEVEVRAAHNVLEACAQTDTIEKV  122

Query  677   IFTSSLLASIWKGNNHEHDD------LDESSWTDEDFCRENKLWFALAKTRAEKVAWRKA  516
             +FTSS  A IW   +HE+D       LDE  W+D + CR+ KLW AL+KT AEK AW  A
Sbjct  123   VFTSSATAIIW--GHHENDQNSASMLLDERHWSDINVCRKFKLWHALSKTLAEKTAWALA  180

Query  515   METKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVY  336
             M+  V +V+V   L+M P     D     PYLKG   M   GV  T D+D   EAH+ VY
Sbjct  181   MDRGVNMVSVNAGLLMGP-----DLTIKNPYLKGAAEMYEDGVFVTVDLDFLVEAHICVY  235

Query  335   EEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGE-----IPARLCKSKLT  171
             E++     GRYLCF   I   EDAV L N L    L S+ +S E     I  R+   KL 
Sbjct  236   EQI--STYGRYLCFNHIINQTEDAVKLANIL--SPLPSSPQSMESDTRIIQERISNKKLN  291

Query  170   RLLFHTARRLSCKHR  126
             +L+     +++ K R
Sbjct  292   KLMVECQPQINGKSR  306



>gb|KFK32695.1| hypothetical protein AALP_AA6G276900 [Arabis alpina]
Length=308

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/257 (36%), Positives = 144/257 (56%), Gaps = 7/257 (3%)
 Frame = -1

Query  1025  CVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTDL  846
             CV   ++Y G  ++++LL +GY V A+I+   +    +++   E  ++   V    + D 
Sbjct  16    CVLDASTYVGFRILKRLLTKGYSVHASIRKNGESMLEEKIRNMEVTEERLVVYDVDVLDY  75

Query  845   DCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTS  666
               +  +   C+ VF      +P G   Y E+   LE   A NV+EAC++T    + +F+S
Sbjct  76    QSIIVSLNNCNVVF--CCLDNPEG---YDEKEVDLEVRGAINVVEACARTERLEKIVFSS  130

Query  665   SLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTV  486
             SL A+IW+ N     D+DE  W+D +FCR+ KLW ALAKT++EK AW  AM+  V +V+V
Sbjct  131   SLTAAIWRDNITSQKDVDEKCWSDLNFCRKKKLWHALAKTQSEKAAWALAMDRMVNMVSV  190

Query  485   CPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGR  306
              P L++ PS    +   ++ YLKG   M   GVLA  DV+  A+ H+  +E  D  ACGR
Sbjct  191   NPGLIVGPSVAQHNPRPTMSYLKGAAEMYENGVLAYVDVEFVADVHIRAFE--DTSACGR  248

Query  305   YLCFGRTITTPEDAVLL  255
             Y CF + + T E+A+ L
Sbjct  249   YFCFNQIVNTEEEALKL  265



>ref|XP_002278778.1| PREDICTED: tetraketide alpha-pyrone reductase 1 isoform X2 [Vitis 
vinifera]
Length=308

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 111/300 (37%), Positives = 160/300 (53%), Gaps = 19/300 (6%)
 Frame = -1

Query  1031  LVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMT  852
             +VCV   +S  G+ L+  LL+RGY V A +QN  + + +  L  + +      +  +   
Sbjct  14    IVCVMDASSTLGSTLVGSLLLRGYTVHAAVQNHGEIQLLNGLSCDTQKL---KIFHSDPF  70

Query  851   DLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIF  672
             D   + +A +GC  +F+T  F  PH  + Y E MA +E  AA NVIEAC++T    + +F
Sbjct  71    DYQSIMDALKGCSGLFYT--FEPPHDQTSYDELMADVEVRAAHNVIEACAQTETIEKVVF  128

Query  671   TSSLLASIWKGNNHE-HDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKL  495
             TSS+ A +W+ +      DLDE+ WTD +F R+ KLW A++KT AEK AW  AM+  V +
Sbjct  129   TSSVTAVVWRDDRKSIPSDLDETHWTDINFSRKFKLWHAMSKTLAEKSAWALAMDRGVNM  188

Query  494   VTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGA  315
             V+V   L+MAP     D   + PYLKG   M   GV  T  VD   +AH+ V+E  D  +
Sbjct  189   VSVNAGLLMAP-----DLTITHPYLKGAAEMYEDGVFVTVSVDFLVDAHICVFE--DVSS  241

Query  314   CGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGE-----IPARLCKSKLTRLLFHTA  150
              GRYLCF   I   EDA+ L   L      S  +S +     I  R+   KL +L+ + A
Sbjct  242   YGRYLCFNHIINNNEDALKLAKTLAPSA-PSPPQSCDRDMKMIQQRISNKKLNKLMVNFA  300



>ref|XP_010933457.1| PREDICTED: cinnamoyl-CoA reductase 2-like isoform X2 [Elaeis 
guineensis]
Length=302

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 108/260 (42%), Positives = 141/260 (54%), Gaps = 12/260 (5%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARM  855
             K VCV   +   G  L+++LL RGY+V A   N     E+  L      K+   +     
Sbjct  11    KTVCVMDASGRLGVSLVQRLLQRGYIVHAATYNH--GGELHGLKGLSCEKERLKLFRTDP  68

Query  854   TDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCI  675
              D   L +A +GC  +F+T    +P     Y E MA +E  AA NV+EAC++T    R +
Sbjct  69    FDYQSLVDAMKGCAGLFYT---FEPPQDQNYDEFMAEVEVRAAHNVLEACAQTESMERVV  125

Query  674   FTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKL  495
             FTSS+ A IWK N     D DE  W++ +FCR+ KLW ALAKT AEK AW  AM+  V +
Sbjct  126   FTSSVAAVIWKENRKLDTDFDERDWSELNFCRKLKLWHALAKTLAEKTAWALAMDRGVDM  185

Query  494   VTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGA  315
              +V   LV+ P     DT  + PYLKG   M   GVL T DV+  A+AH+ V+E     A
Sbjct  186   ASVNAGLVVGP-----DTSLASPYLKGAPEMYEDGVLVTVDVNFLADAHIAVFETP--SA  238

Query  314   CGRYLCFGRTITTPEDAVLL  255
              GRYLCF R +  PEDAV L
Sbjct  239   YGRYLCFNRAVCRPEDAVKL  258



>ref|XP_006443240.1| hypothetical protein CICLE_v10021083mg [Citrus clementina]
 ref|XP_006478945.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X4 [Citrus 
sinensis]
 gb|ESR56480.1| hypothetical protein CICLE_v10021083mg [Citrus clementina]
Length=329

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 109/298 (37%), Positives = 157/298 (53%), Gaps = 16/298 (5%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARM  855
             K VCV   + +F + L+R+LL+RGY V A + N    + ++  L     ++   V  A  
Sbjct  27    KTVCVMDASGHFASALVRRLLLRGYTVHAALHNHGKLQCIEGELINYNEEKKLKVFQADP  86

Query  854   TDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCI  675
              D   L  A +GC  +F+  SF  P   S Y E  A +ET AA NV+EAC++T    + +
Sbjct  87    FDYHSLVNALKGCSGLFY--SFEPPSDHSTYDELTAEVETMAAHNVLEACAQTNTVDKVV  144

Query  674   FTSSLLASIWKG--NNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKV  501
             FTSSL A +W    +N    D DE +W+D + C++ KLW  L+KT AEK AW  AM+  +
Sbjct  145   FTSSLTAVVWSNHRDNPTSHDFDERNWSDVNLCKKFKLWHGLSKTLAEKTAWALAMDRGI  204

Query  500   KLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDY  321
              +V++   LVM P     D   S PYLKG   M   GV+A+ D+    +AH+ V+E  D 
Sbjct  205   SMVSINGGLVMGP-----DVTISNPYLKGAAEMYEDGVMASVDLRFYVDAHICVFE--DV  257

Query  320   GACGRYLCFGRTITTPEDAVLLENRLKMQGLLS----AYESGEI-PARLCKSKLTRLL  162
              + GRYLCF   I   EDA+ L   L      S    ++E   + P R+   KL +L+
Sbjct  258   SSYGRYLCFNHVINCNEDAMKLARMLLPPSDTSTPPLSFEDTRVHPQRISNKKLNKLM  315



>ref|XP_002325101.1| cinnamoyl-CoA reductase-related family protein [Populus trichocarpa]
 gb|EEF03666.1| cinnamoyl-CoA reductase-related family protein [Populus trichocarpa]
Length=307

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 111/308 (36%), Positives = 164/308 (53%), Gaps = 24/308 (8%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQN---------QVDFeemkellreeemkqlE  876
             VCV   ++Y G  +++ LL RGY V A IQ            +    K++      ++  
Sbjct  9     VCVLDASTYVGFWILKGLLSRGYTVHAAIQKYNGKSSSSLSGETGMEKKIRDLAREEERL  68

Query  875   SVVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKT  696
             SV    + D   +  A +GC A+F      D     GY ++M  LE   A NV+EAC++T
Sbjct  69    SVFEVDVLDYHSILVALKGCSAMFCCLDCPD-----GYDDKMIDLEVRGAINVVEACAQT  123

Query  695   AYARRCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKA  516
                 + IF+SSL A+IW+ N    +D+DE SW+D++FCR+ KLW+ALAKT +E  AW  A
Sbjct  124   DTIEKIIFSSSLTAAIWRENICSQEDVDERSWSDQEFCRKLKLWYALAKTLSEHAAWALA  183

Query  515   METKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVY  336
             M+ K+ +V++   LV+ P     +  S++ YLKG   M   GVLA  DV+   + H+  +
Sbjct  184   MDRKLNMVSINAGLVLGPGVSQQNPLSTMSYLKGIAQMYENGVLACVDVNFLVDVHIRAF  243

Query  335   EEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLS-----AYESGEIPA-RLCKSKL  174
             +  D   CGRY CF +T+ T E+AV L   L    L+S      Y+  E+ A RL   KL
Sbjct  244   Q--DRSTCGRYFCFNQTVHTEEEAVKLTQSLS--PLISLPQRYEYQGSEVYAERLRTKKL  299

Query  173   TRLLFHTA  150
              +L+  TA
Sbjct  300   NKLVEGTA  307



>ref|NP_194776.1| cinnamoyl-CoA reductase like protein [Arabidopsis thaliana]
 emb|CAB79765.1| cinnamoyl-CoA reductase-like protein [Arabidopsis thaliana]
 gb|AAK68826.1| cinnamoyl-CoA reductase-like protein [Arabidopsis thaliana]
 gb|AAN65066.1| cinnamoyl-CoA reductase-like protein [Arabidopsis thaliana]
 gb|AEE85768.1| cinnamoyl-CoA reductase like protein [Arabidopsis thaliana]
Length=303

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 105/294 (36%), Positives = 157/294 (53%), Gaps = 13/294 (4%)
 Frame = -1

Query  1025  CVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTDL  846
             CV   ++Y G  +++KLL RGY V A I+   + E  + +   E  ++   V    + D 
Sbjct  11    CVLDASTYVGFWILKKLLSRGYSVHAAIRRNGESEIEEMIREMETTEERLVVYDVDVLDY  70

Query  845   DCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTS  666
               +  + + C+ VF       P G   Y E+   LE   A NV+EAC +T    + +F+S
Sbjct  71    QSILVSLKTCNVVF--CCLDSPEG---YDEKEVDLEVRGAINVVEACGRTESIEKIVFSS  125

Query  665   SLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTV  486
             SL ASIW+ N     D+DE  W+D+DFCR  KLW ALAK  +EK AW  AM+ ++ +V++
Sbjct  126   SLTASIWRDNIGTQKDVDEKCWSDQDFCRSKKLWHALAKMLSEKAAWALAMDRRLNMVSI  185

Query  485   CPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGR  306
              P LV+ PS    +   ++ YLKG   M   GVLA  DV   A+ H+  +E  D  ACGR
Sbjct  186   NPGLVVGPSVAQHNARPTMSYLKGAAQMYENGVLAYVDVKFLADVHIRAFE--DVSACGR  243

Query  305   YLCFGRTITTPEDAV-LLENRLKMQGLLSAYE-----SGEIPARLCKSKLTRLL  162
             Y CF + + T E+A+ L+E+   +  +   YE     S     RL  +KL++L+
Sbjct  244   YFCFNQIVNTEEEALKLVESLSPLIPMPPRYENEMHGSEVYEERLRNNKLSKLV  297



>ref|XP_010663392.1| PREDICTED: tetraketide alpha-pyrone reductase 1 isoform X1 [Vitis 
vinifera]
Length=309

 Score =   174 bits (441),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 113/300 (38%), Positives = 159/300 (53%), Gaps = 18/300 (6%)
 Frame = -1

Query  1031  LVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMT  852
             +VCV   +S  G+ L+  LL+RGY V A +QN     E++ L       Q   +  +   
Sbjct  14    IVCVMDASSTLGSTLVGSLLLRGYTVHAAVQNHA--GEIQLLNGLSCDTQKLKIFHSDPF  71

Query  851   DLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIF  672
             D   + +A +GC  +F+T  F  PH  + Y E MA +E  AA NVIEAC++T    + +F
Sbjct  72    DYQSIMDALKGCSGLFYT--FEPPHDQTSYDELMADVEVRAAHNVIEACAQTETIEKVVF  129

Query  671   TSSLLASIWKGNNHE-HDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKL  495
             TSS+ A +W+ +      DLDE+ WTD +F R+ KLW A++KT AEK AW  AM+  V +
Sbjct  130   TSSVTAVVWRDDRKSIPSDLDETHWTDINFSRKFKLWHAMSKTLAEKSAWALAMDRGVNM  189

Query  494   VTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGA  315
             V+V   L+MAP     D   + PYLKG   M   GV  T  VD   +AH+ V+E  D  +
Sbjct  190   VSVNAGLLMAP-----DLTITHPYLKGAAEMYEDGVFVTVSVDFLVDAHICVFE--DVSS  242

Query  314   CGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGE-----IPARLCKSKLTRLLFHTA  150
              GRYLCF   I   EDA+ L   L      S  +S +     I  R+   KL +L+ + A
Sbjct  243   YGRYLCFNHIINNNEDALKLAKTLAPSA-PSPPQSCDRDMKMIQQRISNKKLNKLMVNFA  301



>ref|XP_006412703.1| hypothetical protein EUTSA_v10025830mg [Eutrema salsugineum]
 dbj|BAJ34378.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ54156.1| hypothetical protein EUTSA_v10025830mg [Eutrema salsugineum]
Length=303

 Score =   174 bits (440),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 96/261 (37%), Positives = 145/261 (56%), Gaps = 7/261 (3%)
 Frame = -1

Query  1025  CVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTDL  846
             CV   +++ G  +++KLL RGY V A I+ + + E  +++   E  ++   V    + D 
Sbjct  11    CVLDASTFVGFWILKKLLSRGYSVHAAIRKKGESEIEEKIREMEATEERLVVYDVDVLDY  70

Query  845   DCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTS  666
               +  + + C+AVF       P G   Y E+   LE   A NV+EAC +T    + +F+S
Sbjct  71    QSILVSLKTCNAVF--CCLDSPEG---YDEKEVDLEVRGAINVVEACGRTESIDKIVFSS  125

Query  665   SLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTV  486
             SL ASIW+ N     D+DE  W+D+DFCR+ KLW ALAK  +EK AW  AM+ ++ +V++
Sbjct  126   SLTASIWRDNIGTQKDVDEKCWSDQDFCRKKKLWHALAKMLSEKAAWALAMDRRLNMVSI  185

Query  485   CPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGR  306
              P L++ PS    +   ++ YLKG   M   GVLA  DV   A+ H+  +E  D  ACGR
Sbjct  186   NPGLIVGPSVAQHNAGPTMSYLKGAAQMYENGVLAYVDVKFLADVHIRAFE--DVSACGR  243

Query  305   YLCFGRTITTPEDAVLLENRL  243
             Y CF + + T E+A+ L   L
Sbjct  244   YFCFNQIVNTEEEALKLVQSL  264



>ref|XP_010497202.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Camelina sativa]
Length=303

 Score =   174 bits (440),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 96/261 (37%), Positives = 142/261 (54%), Gaps = 7/261 (3%)
 Frame = -1

Query  1025  CVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTDL  846
             CV   ++Y G  +++KLL RGY V A I+   D E  +++   E  ++   V    + D 
Sbjct  11    CVLDASTYVGFWILKKLLSRGYSVHAAIRRNGDSEIEEKVREMEATEERLVVYDVDVLDY  70

Query  845   DCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTS  666
               +  + + C+ VF       P G   Y E+   LE   A NV+EAC +T    + +F+S
Sbjct  71    QSILVSLKTCNVVF--CCLDSPEG---YDEKEVDLEVRGAINVVEACGRTESIEKIVFSS  125

Query  665   SLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTV  486
             SL ASIW+ N     D+DE  W+D+DFCR  KLW ALAK  +EK AW  AM+ ++ +V++
Sbjct  126   SLTASIWRDNIGTQKDVDEKCWSDQDFCRNKKLWHALAKMLSEKAAWALAMDRRLNMVSI  185

Query  485   CPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGR  306
              P L++ PS    +   ++ YLKG   M   GVLA  DV   A+ H+  +E  D  ACGR
Sbjct  186   NPGLIVGPSVAQHNARPTMSYLKGAAQMYENGVLAYVDVTFLADVHIRAFE--DTSACGR  243

Query  305   YLCFGRTITTPEDAVLLENRL  243
             Y CF + + T ++A+ L   L
Sbjct  244   YFCFNQIVNTEDEALKLVQTL  264



>ref|XP_002869377.1| hypothetical protein ARALYDRAFT_491705 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45636.1| hypothetical protein ARALYDRAFT_491705 [Arabidopsis lyrata subsp. 
lyrata]
Length=303

 Score =   173 bits (439),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 104/294 (35%), Positives = 157/294 (53%), Gaps = 13/294 (4%)
 Frame = -1

Query  1025  CVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTDL  846
             CV   ++Y G  +++KLL RGY V A I+   + E  + +   E  ++   V    + D 
Sbjct  11    CVLDASTYVGFWILKKLLSRGYSVHAAIRRNGESEIEEMIREMETTEERLVVYDVDVLDY  70

Query  845   DCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTS  666
               +  + + C+ VF       P G   Y E+   LE   A NV+EAC +T    + +F+S
Sbjct  71    QSILVSLKTCNVVF--CCLDSPEG---YDEKEVDLEVRGAINVVEACGRTESIEKIVFSS  125

Query  665   SLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTV  486
             SL ASIW+ N     D+DE  W+D+DFCR  KLW ALAK  +EK AW  AM+ ++ +V++
Sbjct  126   SLTASIWRDNIGTQKDVDEKCWSDQDFCRNKKLWHALAKMLSEKAAWALAMDRRLNMVSI  185

Query  485   CPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGR  306
              P L++ PS    +   ++ YLKG   M   GVLA  DV   A+ H+  +E  D  ACGR
Sbjct  186   NPGLIVGPSVAQHNARPTMSYLKGAAQMYENGVLAYVDVKFLADVHIRAFE--DVSACGR  243

Query  305   YLCFGRTITTPEDAV-LLENRLKMQGLLSAYE-----SGEIPARLCKSKLTRLL  162
             Y CF + + T E+A+ L+E+   +  +   YE     S     RL  +KL++L+
Sbjct  244   YFCFNQIVNTEEEALKLVESLSPLIPMPPRYENEMHGSEVYEERLRNNKLSKLV  297



>gb|KDO47229.1| hypothetical protein CISIN_1g043792mg, partial [Citrus sinensis]
Length=294

 Score =   173 bits (438),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 105/268 (39%), Positives = 147/268 (55%), Gaps = 15/268 (6%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARM  855
             K VCV   + +F + L+R+LL+RGY V A + N    + ++E L     ++   V  A  
Sbjct  27    KTVCVMDASGHFASALVRRLLLRGYTVHAALHNHGKLQCIEEELINYNEEKKLKVFQADP  86

Query  854   TDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCI  675
              D   L  A +GC  +F+  SF  P   S Y E  A +ET AA NV+EAC++T    + +
Sbjct  87    FDYHSLVNALKGCSGLFY--SFEPPSDHSTYDELTAEVETMAAHNVLEACAQTNTVDKVV  144

Query  674   FTSSLLASIWKGNNHEHD----DLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMET  507
             FTSSL A +W  NNH  +    D DE +W+D + C++ KLW  L+KT AEK AW  AM+ 
Sbjct  145   FTSSLTAVVW--NNHRDNPTSHDFDERNWSDVNLCKKFKLWHGLSKTLAEKTAWALAMDR  202

Query  506   KVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEM  327
              + +V++   LVM P     D   S PYLKG   M   GV+A+ D+    +AH+ V+E  
Sbjct  203   GISMVSINGGLVMGP-----DVTISNPYLKGAAEMYEDGVMASVDLRFYVDAHICVFE--  255

Query  326   DYGACGRYLCFGRTITTPEDAVLLENRL  243
             D  + GRYLCF   I   EDA+ L   L
Sbjct  256   DVSSYGRYLCFNHVINCNEDAMKLARML  283



>ref|XP_008796251.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Phoenix dactylifera]
Length=303

 Score =   173 bits (439),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 111/297 (37%), Positives = 151/297 (51%), Gaps = 13/297 (4%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARM  855
             K VCV   +   G  L+ +LL RGY+V A   +  D  E+          +   V     
Sbjct  11    KAVCVMDASGRLGVSLVERLLQRGYIVHAATCDHGD--ELLGSKVLSCDNKRLKVFRTDP  68

Query  854   TDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCI  675
              D   + +A +GC  +F+T  F  P   S Y E M   E  AA NV+EAC++T    R +
Sbjct  69    FDYQSIVDAMKGCAGLFYT--FEPPQDQSNYDEFMVEEEVRAAHNVLEACAQTETIERVV  126

Query  674   FTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKL  495
             FTSS+ A +WK N     D DE  W++ +FCR+ KLW  LAKT AEK AW  AM+  V +
Sbjct  127   FTSSVTAVVWKENRKLAADFDERDWSEPNFCRKFKLWHGLAKTLAEKTAWALAMDRGVDM  186

Query  494   VTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGA  315
             V+V   L++ P     DT  + P+LKG   M   GVL T DV+  A+AH+ V+E     A
Sbjct  187   VSVNAGLMVGP-----DTSLTSPHLKGAPEMYEDGVLVTVDVNLLADAHIAVFETP--SA  239

Query  314   CGRYLCFGRTITTPEDAVLLENRLKMQGLLSAY--ESGEIPARLCKSKLTRLLFHTA  150
              GRYLCF R +  P+DAV L   L      ++   E   I  R+   KL +L+   A
Sbjct  240   YGRYLCFNRAVCRPDDAVKLAQLLSPSSPCTSPSDELRVIQQRIQNKKLNKLMVEVA  296



>ref|XP_010438175.1| PREDICTED: cinnamoyl-CoA reductase 2 [Camelina sativa]
Length=303

 Score =   173 bits (439),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 104/294 (35%), Positives = 157/294 (53%), Gaps = 13/294 (4%)
 Frame = -1

Query  1025  CVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTDL  846
             CV   ++Y G  +++KLL RGY V A I+   D E  +++   E  ++   V    + D 
Sbjct  11    CVLDASTYVGFWILKKLLSRGYSVHAAIRRNGDSEIEEKVREMEATEERLVVYDVDVLDY  70

Query  845   DCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTS  666
               +  + + C+ VF       P G   Y E+   LE   A NV+EAC +T    + +F+S
Sbjct  71    QSILVSLKTCNVVF--CCLDSPEG---YDEKEVDLEVRGAINVVEACGRTESIEKIVFSS  125

Query  665   SLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTV  486
             SL ASIW+ N     D+DE  W+D+DFCR  KLW ALAK  +EK AW  AM+ ++ +V++
Sbjct  126   SLTASIWRDNIGTQKDVDEKCWSDQDFCRNKKLWHALAKMLSEKAAWALAMDRRLNMVSI  185

Query  485   CPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGR  306
              P L++ P     +   ++ YLKG   M   GVLA  DV   A+ H+  +E  D  ACGR
Sbjct  186   NPGLIVGPLVAQHNARPTMSYLKGAAQMYENGVLAYVDVTFLADVHIRAFE--DVSACGR  243

Query  305   YLCFGRTITTPEDAV-LLENRLKMQGLLSAYE-----SGEIPARLCKSKLTRLL  162
             Y CF + + T E+A+ L+E+   +  +   YE     S     RL  +KL++L+
Sbjct  244   YFCFNQIVNTEEEALKLVESLSPLIPMPPRYENEMHGSEVYEERLRNNKLSKLV  297



>ref|XP_006294670.1| hypothetical protein CARUB_v10023711mg [Capsella rubella]
 gb|EOA27568.1| hypothetical protein CARUB_v10023711mg [Capsella rubella]
Length=304

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 105/300 (35%), Positives = 159/300 (53%), Gaps = 24/300 (8%)
 Frame = -1

Query  1025  CVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTDL  846
             CV   ++Y G  ++++LL +GY V A I+   +    +E+   E  ++   V    + D 
Sbjct  11    CVLDASTYVGFWILKRLLTKGYSVHAAIRKNGESMLEEEIRDMEATEERLEVYDVDVLDY  70

Query  845   DCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTS  666
               +  A   C+AVF      +P G +   E+   LE   A NV+EAC++T    + +F+S
Sbjct  71    QSILVALNNCNAVF--CCLDNPEGYN--EEKEVDLEVRGAINVVEACARTESIEKIVFSS  126

Query  665   SLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTV  486
             SL A+IW+ N     D+DE SW+D DFC + KLW ALAKT++EK AW  AM+  V +V+V
Sbjct  127   SLTAAIWRDNIGTQKDVDEKSWSDLDFCLKKKLWHALAKTQSEKAAWALAMDRMVNMVSV  186

Query  485   CPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGR  306
              P L++ PS    ++  ++ YLKG   M   GVLA  DV+  A+ H+  +E  D   CGR
Sbjct  187   NPGLIVGPSVAQHNSRPTMSYLKGAAQMYENGVLAYVDVEFVADVHIRAFE--DTSTCGR  244

Query  305   YLCFGRTITTPEDAVLLENRL------------KMQGLLSAYESGEIPARLCKSKLTRLL  162
             Y CF + + T ++A+ L   L            +MQG    YE      RL   KL++L+
Sbjct  245   YFCFNQIVNTEDEALKLVQTLSPLIPMPPRYEKEMQG-SEVYEE-----RLRNKKLSKLV  298



>ref|XP_010919962.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Elaeis guineensis]
Length=306

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 113/300 (38%), Positives = 151/300 (50%), Gaps = 17/300 (6%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARM  855
             K VCV   +   G  L+ +LL RGY V A   N       + L  +      + + V R 
Sbjct  12    KTVCVMDASGRLGVSLVERLLQRGYNVHAATCNN---GGEELLGLKGLSCDNKQLKVFRT  68

Query  854   TDLD--CLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARR  681
                D   + +A +GC  +F+  SF  P   S Y E M  +E  AA NV+EAC++T    R
Sbjct  69    DPFDYHSIVDAMKGCAGLFY--SFESPQDQSNYDEFMVEVEMRAAHNVLEACAQTETIER  126

Query  680   CIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKV  501
              +FTSS+ A +WK N     D DE  W++ +FCR+ KLW  LAKT AEK AW  AM+  V
Sbjct  127   VVFTSSVTAVVWKENRKLGADFDERDWSEPNFCRKFKLWHGLAKTLAEKTAWALAMDRGV  186

Query  500   KLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDY  321
              +V+V   LV+ P      T  + PYLKG   M   GVL T DV+  A+AH+ V+E    
Sbjct  187   DMVSVNAGLVVGPG-----TSLASPYLKGAPEMYEDGVLVTVDVNLLADAHLAVFETP--  239

Query  320   GACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGE---IPARLCKSKLTRLLFHTA  150
              A GRYLCF R +  P+DAV L   L       +    E   I  R+   KL +L+   A
Sbjct  240   SAYGRYLCFNRAVCRPDDAVKLAQMLSPTSPCPSPSGDELRVIQQRIQNKKLNKLMVEFA  299



>gb|KDP39532.1| hypothetical protein JCGZ_02552 [Jatropha curcas]
Length=305

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 106/296 (36%), Positives = 160/296 (54%), Gaps = 17/296 (6%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARM  855
             K +CV   +   G +L+ +LL RGY V A +QN  + +  +EL R  +  +   V  +  
Sbjct  12    KTICVMDASGCLGTNLVLRLLHRGYTVHAAVQNHGNLKYFEELSRNSKKLR---VFYSDP  68

Query  854   TDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCI  675
              D   + +A +GC+ +F+  SF  P     Y E MA +E  AA NV+EAC++T    + +
Sbjct  69    FDYQSIMDALKGCYGLFY--SFEPPSDQPNYDEFMADVEVRAAHNVLEACAQTETINKVV  126

Query  674   FTSSLLASIWKGN-NHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVK  498
             FTSS  A IW  N N   DD+DE +W+D +FCR+ KLW A++KT AEK AW  AM+  + 
Sbjct  127   FTSSATAVIWSNNHNKTPDDMDERNWSDINFCRKFKLWHAMSKTLAEKTAWALAMDRGIN  186

Query  497   LVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYG  318
             +V++   L+M+P     D   + PYLKG   M   GV  T D+    +AH+ V+E  D  
Sbjct  187   MVSINAGLLMSP-----DLTITNPYLKGAAEMYEYGVFVTVDLSFNVDAHICVFE--DIS  239

Query  317   ACGRYLCFGRTITTPEDAVLLENRL---KMQGLLSAYESGEI-PARLCKSKLTRLL  162
             + GRYLCF   I   E+A+ L + L       +  ++E   +   R+   KL +L+
Sbjct  240   SYGRYLCFNNVINCNEEAIKLAHILVPPSESSVPQSFEDTRVHQQRISNKKLNKLM  295



>ref|XP_011010515.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Populus euphratica]
 ref|XP_011010595.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Populus euphratica]
Length=299

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/264 (38%), Positives = 147/264 (56%), Gaps = 8/264 (3%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQ-NQVDFeemkellreeemkqlESVVVARMT  852
             VCV   ++Y G+ +++ LL RGY V A IQ N  + E  KE+      ++   V    + 
Sbjct  9     VCVLDASTYVGSWILKGLLSRGYTVHAAIQKNNGETEIEKEIRGMGREEERLVVFEVDVL  68

Query  851   DLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIF  672
             D   +  A +GC A+F      D     GY E+M   E   A NV EAC++T    + IF
Sbjct  69    DYHSILIALKGCSAMFCCLDSRD-----GYDEKMVDSEIRGAINVAEACAQTDTIEKIIF  123

Query  671   TSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLV  492
             +SSL A+IWK +     D+DE SW+D++FCR+ KLW ALAKT +E+ AW  AM+  + +V
Sbjct  124   SSSLTAAIWKESICSEKDVDERSWSDQEFCRKLKLWHALAKTLSEQAAWALAMDRMLNMV  183

Query  491   TVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGAC  312
             ++   LV+ P     +  S++ YL+G   M   GVLA  DV+  A+ H+  ++  D   C
Sbjct  184   SINAGLVLGPGVSQQNPLSTMSYLRGAAQMYENGVLAYVDVNFLADVHIRAFQ--DRSTC  241

Query  311   GRYLCFGRTITTPEDAVLLENRLK  240
             GRY CF +T+TT E+AV  E  L 
Sbjct  242   GRYFCFNQTVTTEEEAVKFEQSLN  265



>gb|AAM62641.1| cinnamoyl-CoA reductase-like protein [Arabidopsis thaliana]
Length=303

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 104/294 (35%), Positives = 156/294 (53%), Gaps = 13/294 (4%)
 Frame = -1

Query  1025  CVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTDL  846
             CV   ++Y G  +++KLL RGY V A I+   + E  + +   E  ++   V    + D 
Sbjct  11    CVLDASTYVGFWILKKLLSRGYSVHAAIRRNGESEIEEMIREMETTEERLVVYDVDVLDY  70

Query  845   DCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTS  666
               +  + + C+ VF       P G   Y E+   LE     NV+EAC +T    + +F+S
Sbjct  71    QSILVSLKTCNVVF--CCLDSPEG---YDEKEVDLEVRGVINVVEACGRTESIEKIVFSS  125

Query  665   SLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTV  486
             SL ASIW+ N     D+DE  W+D+DFCR  KLW ALAK  +EK AW  AM+ ++ +V++
Sbjct  126   SLTASIWRDNIGTQKDVDEKCWSDQDFCRSKKLWHALAKMLSEKAAWALAMDRRLNMVSI  185

Query  485   CPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGR  306
              P LV+ PS    +   ++ YLKG   M   GVLA  DV   A+ H+  +E  D  ACGR
Sbjct  186   NPGLVVGPSVAQHNARPTMSYLKGAAQMYENGVLAYVDVKFLADVHIRAFE--DVSACGR  243

Query  305   YLCFGRTITTPEDAV-LLENRLKMQGLLSAYE-----SGEIPARLCKSKLTRLL  162
             Y CF + + T E+A+ L+E+   +  +   YE     S     RL  +KL++L+
Sbjct  244   YFCFNQIVNTEEEALKLVESLSPLIPMPPRYENEMHGSEVYEERLRNNKLSKLV  297



>ref|XP_009787126.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Nicotiana 
sylvestris]
Length=319

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 112/297 (38%), Positives = 154/297 (52%), Gaps = 20/297 (7%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTD  849
             +CV  G+S FG  L+++LL RGY V A +Q   +   +     E + K+   +  +   D
Sbjct  13    ICVMDGSSRFGTKLVKRLLKRGYTVHAALQTHGE-NSLSLKGIECDHKKKLKIFESDPFD  71

Query  848   LDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFT  669
                +  A +GC  +F+  SF  P     Y E MA +E  AA NV+EAC++T    + +FT
Sbjct  72    YHTILAALKGCSGLFY--SFQPPSDYPTYDEDMAEVEVRAAHNVLEACAQTDTIEKVVFT  129

Query  668   SSLLASIW---KGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVK  498
             SS    IW   K  +   D LDE  WTD +FCR+ KLW A++KT AEK AW  AM+  + 
Sbjct  130   SSATTIIWGHVKDQSASTDYLDERHWTDINFCRKFKLWHAISKTLAEKTAWALAMDRGIN  189

Query  497   LVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYG  318
             +VT+   L+M P     D   S PYLKG   M   GV  T D+D   +AH+ VYE++   
Sbjct  190   MVTINAGLLMGP-----DLTISNPYLKGAAEMYEDGVFVTVDLDFLVDAHICVYEKV--A  242

Query  317   ACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGE-----IPARLCKSKLTRLL  162
               GRYLCF   I   +DA  L N L    L S  +S E     I  R+   KL +L+
Sbjct  243   TYGRYLCFNHIINQQQDAFQLANMLS--PLPSPPQSMENDTRIIQQRISNKKLNKLM  297



>ref|XP_008786341.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Phoenix dactylifera]
Length=303

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 104/264 (39%), Positives = 139/264 (53%), Gaps = 11/264 (4%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARM  855
             K VCV   +   G  L+ KLL RGY+V A   N    E            +   V     
Sbjct  11    KTVCVMDASGRLGVSLVHKLLQRGYIVHAATYNH-GGELHGLKGLSSCDNERLKVFRTDP  69

Query  854   TDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCI  675
              D   L +A +GC  +F+     +P     Y E M  +E  +A NV+EAC++T    R +
Sbjct  70    FDYQSLVDAMKGCAGLFYA---FEPPQDQNYDEFMVEVEVRSAHNVLEACARTETMERVV  126

Query  674   FTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKL  495
             FTSS+ A +WK N+    D DE  W++ +FCR+ KLW ALAKT+AEK AW  AM+  V++
Sbjct  127   FTSSVAAVVWKENHKLGMDFDERDWSEPNFCRKFKLWHALAKTQAEKTAWALAMDRGVEM  186

Query  494   VTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGA  315
              +V   LV+ P     DT  + PYLKG   M   GVL T D++  A+AH+ V+E     A
Sbjct  187   ASVNAGLVVGP-----DTSLASPYLKGAPEMYEDGVLVTVDLNFLADAHLAVFETP--SA  239

Query  314   CGRYLCFGRTITTPEDAVLLENRL  243
              GRYLCF R +  PEDAV L   L
Sbjct  240   YGRYLCFNRAVCRPEDAVKLAQML  263



>ref|NP_565557.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AAC63661.2| putative cinnamoyl CoA reductase [Arabidopsis thaliana]
 gb|ABK32183.1| At2g23910 [Arabidopsis thaliana]
 gb|AEC07501.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=304

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/257 (37%), Positives = 142/257 (55%), Gaps = 6/257 (2%)
 Frame = -1

Query  1025  CVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTDL  846
             CV   ++Y G  ++++LL RGY V A I+   +    +++   E  ++   V    + D 
Sbjct  11    CVLDASTYVGFWILKRLLTRGYSVHAAIRKNGESVLEEKIRDMEANEERLEVYDVDVLDY  70

Query  845   DCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTS  666
               +  +   C+AVF      +P G     E+   LE   A NV+EAC++T    + +F+S
Sbjct  71    QSILISLNNCNAVF--CCLDNPEGYD--EEKEVDLEVRGAINVVEACARTESIEKIVFSS  126

Query  665   SLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTV  486
             SL A+IW+ N     D+DE  W+D DFC + KLW ALAKT++EK AW  AM+  V +V+V
Sbjct  127   SLTAAIWRDNIGTQKDVDEKCWSDLDFCLKKKLWHALAKTQSEKAAWALAMDRMVNMVSV  186

Query  485   CPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGR  306
              P L++ PS    +   ++ YLKG   M   GVLA  DV+  A+ H+  +E  D  ACGR
Sbjct  187   NPGLIVGPSVAQHNPRPTMSYLKGAAQMYENGVLAYVDVEFVADVHIRAFE--DTSACGR  244

Query  305   YLCFGRTITTPEDAVLL  255
             Y CF + + T E+A+ L
Sbjct  245   YFCFNQIVNTEEEALKL  261



>gb|AAM62475.1| putative cinnamoyl CoA reductase [Arabidopsis thaliana]
Length=304

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/257 (37%), Positives = 142/257 (55%), Gaps = 6/257 (2%)
 Frame = -1

Query  1025  CVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTDL  846
             CV   ++Y G  ++++LL RGY V A I+   +    +++   E  ++   V    + D 
Sbjct  11    CVLDASTYVGFWILKRLLTRGYSVHAAIRKNGESVLEEKIRDMEANEERLEVYDVDVLDY  70

Query  845   DCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTS  666
               +  +   C+AVF      +P G     E+   LE   A NV+EAC++T    + +F+S
Sbjct  71    QSILISLNNCNAVF--CCLDNPEGYD--EEKEVDLEVRGAINVVEACARTESIEKIVFSS  126

Query  665   SLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTV  486
             SL A+IW+ N     D+DE  W+D DFC + KLW ALAKT++EK AW  AM+  V +V+V
Sbjct  127   SLTAAIWRDNIGTQKDVDEKCWSDLDFCLKKKLWHALAKTQSEKAAWALAMDRMVNMVSV  186

Query  485   CPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGR  306
              P L++ PS    +   ++ YLKG   M   GVLA  DV+  A+ H+  +E  D  ACGR
Sbjct  187   NPGLIVGPSVAQHNPRPTMSYLKGAAQMYENGVLAYVDVEFVADVHIRAFE--DTSACGR  244

Query  305   YLCFGRTITTPEDAVLL  255
             Y CF + + T E+A+ L
Sbjct  245   YFCFNQIVNTEEEALKL  261



>gb|KHG08807.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Gossypium arboreum]
Length=305

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 108/297 (36%), Positives = 153/297 (52%), Gaps = 21/297 (7%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTD  849
             VCV   +   G+ L+ +LL RGY V A +Q  VD  ++K      E ++   +  A   D
Sbjct  11    VCVMDASGRLGSTLVERLLERGYTVHAAVQGHVD--DLKLNGVATEREKKLKIFQADPFD  68

Query  848   LDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFT  669
                + +A +GC  +F+  +F  P     Y E M  +E  AA NV+EAC++T    + +FT
Sbjct  69    YQSITDALKGCSGLFY--AFEPPQDHPAYDEYMVEVEVRAAHNVVEACARTETIDKVVFT  126

Query  668   SSLLASIWKGNNHEH--DDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKL  495
             SS  A +W+ NN +    DLDE  W+D +FCR+ KLW AL+KT AEK AW  AM+  + +
Sbjct  127   SSATAVLWRDNNSQSLASDLDERHWSDVNFCRKFKLWHALSKTVAEKTAWALAMDRDINM  186

Query  494   VTVCPALVMAP--SFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDY  321
             V++   L+M P  S  H       PYLKG   M   G   T D+    +AH+ V+E  D 
Sbjct  187   VSINGGLLMEPHLSITH-------PYLKGAAEMYESGTFVTVDLQFLVDAHICVFE--DV  237

Query  320   GACGRYLCFGRTITTPEDAVLLENRL--KMQGLLSAYESGE--IPARLCKSKLTRLL  162
              + GRYLCF   IT  EDA+ L   L         +YE     I  RL   KL +++
Sbjct  238   SSYGRYLCFNHAITNHEDAIHLARLLTPSAPSPPPSYEEANMIIQQRLSNKKLNKVM  294



>ref|XP_006375991.1| hypothetical protein POPTR_0013s07700g [Populus trichocarpa]
 gb|ERP53788.1| hypothetical protein POPTR_0013s07700g [Populus trichocarpa]
Length=305

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 112/302 (37%), Positives = 155/302 (51%), Gaps = 15/302 (5%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARM  855
             K VCV   +   G+ ++ +LL RGY V A +QNQ    +  E L     K    V  +  
Sbjct  12    KTVCVMDASGPLGSSIVHRLLQRGYSVHAAVQNQGKLWQSFEGLSCNNEKL--KVFHSDP  69

Query  854   TDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCI  675
              D   + +A +GC  +F+  SF  P     Y E MA +E  AA NV+EAC++T    + +
Sbjct  70    FDYHSIMDALKGCCGLFY--SFEPPSDQPTYDEFMADVEVRAAHNVLEACAQTNTIDKVV  127

Query  674   FTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKL  495
             FTSS    IW  ++ +  DLDE +W+D +FCR+ KLW AL+KT AEK AW  AM+  + +
Sbjct  128   FTSSATTVIWNDSHRKAPDLDERNWSDLNFCRKFKLWQALSKTLAEKTAWALAMDRSINM  187

Query  494   VTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGA  315
             VTV   L+M+P    A+     PYLKG   M   GV  T D+    + H+ V+E  D  +
Sbjct  188   VTVNGGLLMSPDLTIAN-----PYLKGAAEMYEDGVFVTVDLRFIVDTHIHVFE--DITS  240

Query  314   CGRYLCFGRTITTPEDAVLLENRL---KMQGLLSAYESGEI-PARLCKSKLTRLLFHTAR  147
              GRYLCF   I   EDAV L N L       L  + E   I   R+   KL +L+     
Sbjct  241   YGRYLCFNHVIKCNEDAVKLANTLLPPSESSLPQSLEDTRIHQQRISNKKLNKLMVDFDS  300

Query  146   RL  141
             +L
Sbjct  301   KL  302



>ref|XP_010274271.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Nelumbo nucifera]
Length=343

 Score =   172 bits (436),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 104/290 (36%), Positives = 148/290 (51%), Gaps = 12/290 (4%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARM  855
             K VCV   +   G+ L+ +LL RGY V A IQN  D +    +  +        V  A  
Sbjct  48    KTVCVMDASGRLGSSLVDRLLQRGYTVHAAIQNHGDLQFEAGISSDNSKNL--KVFHADP  105

Query  854   TDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCI  675
              D   + +A +GC  +F+T  F  P     + E M  +E  AA NV+EAC++T    + +
Sbjct  106   FDYQSIIDALKGCSGLFYT--FEPPQYQPTFDEFMVEVEVRAAHNVLEACAQTDTIDKVV  163

Query  674   FTSSLLASIWKGNNHEH-DDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVK  498
             FTSS+ A++W+    +   D DE +W+D +FCR+ KLW AL+KT AEK AW  AM+ ++ 
Sbjct  164   FTSSVTAAVWREERGKSASDFDERNWSDVNFCRKFKLWHALSKTVAEKTAWALAMDRELN  223

Query  497   LVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYG  318
             +VT+   L+  P     +     PYLKG   M   GV  T D+    +AH+ VYE  D  
Sbjct  224   MVTINAGLLTGPELSITN-----PYLKGAAEMYEDGVFVTVDLKFLVDAHICVYE--DIS  276

Query  317   ACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGEIPARLCKSKLTR  168
             + GRYLCF   I  PEDAV L+  L      SA        R+ K  ++ 
Sbjct  277   SYGRYLCFNHVINRPEDAVKLDQMLTRPSSPSALPQRWQDTRIFKQSISN  326



>ref|XP_009396847.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Musa acuminata subsp. 
malaccensis]
Length=302

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 111/299 (37%), Positives = 144/299 (48%), Gaps = 21/299 (7%)
 Frame = -1

Query  1043  RERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVV  864
             R+R  +CV   +   G  L+ +LL RGY V A   N  D      L R         +  
Sbjct  8     RDRNTICVMDASCSLGVSLVDRLLQRGYTVHAAAYNHGD--SSGNLKRLSGENTRLKLFQ  65

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
             A   D   + EA +GC  +F+T    +P     Y E M  +E  AA NV+EAC++     
Sbjct  66    ADPFDYHSIVEAMKGCSGLFYT---FEPPQDQFYDELMVEIEVRAAHNVLEACAQVETIE  122

Query  683   RCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETK  504
             R +FTSS+ A +W  N     D+DE  W++  FCR  KLW ALAKT AEK AW  AM+  
Sbjct  123   RVVFTSSVTAVVWSENQEPVTDVDERGWSEPSFCRTFKLWHALAKTLAEKTAWAMAMDRG  182

Query  503   VKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMD  324
             V +V V   LV  P         + PYLKG Q M   GVL T DV    +AHV VYE   
Sbjct  183   VDMVAVNAGLVTVPGI-----SVTSPYLKGAQRMYEGGVLVTVDVGFLVDAHVAVYESP-  236

Query  323   YGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGEIPA---RLCKSKLTRLLFH  156
               A GRYLCF   +  P DAV      K+  LLS  ++G  P    R+ + ++     H
Sbjct  237   -SAYGRYLCFSDAVCRPHDAV------KLAQLLSPSDAGAPPCDELRVVQQRIQNKKLH  288



>ref|XP_006443241.1| hypothetical protein CICLE_v10021083mg [Citrus clementina]
 ref|XP_006478943.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X2 [Citrus 
sinensis]
 gb|ESR56481.1| hypothetical protein CICLE_v10021083mg [Citrus clementina]
Length=330

 Score =   172 bits (435),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 109/299 (36%), Positives = 157/299 (53%), Gaps = 17/299 (6%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQV-DFeemkellreeemkqlESVVVAR  858
             K VCV   + +F + L+R+LL+RGY V A + N     + ++  L     ++   V  A 
Sbjct  27    KTVCVMDASGHFASALVRRLLLRGYTVHAALHNHAGKLQCIEGELINYNEEKKLKVFQAD  86

Query  857   MTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRC  678
               D   L  A +GC  +F+  SF  P   S Y E  A +ET AA NV+EAC++T    + 
Sbjct  87    PFDYHSLVNALKGCSGLFY--SFEPPSDHSTYDELTAEVETMAAHNVLEACAQTNTVDKV  144

Query  677   IFTSSLLASIWKG--NNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETK  504
             +FTSSL A +W    +N    D DE +W+D + C++ KLW  L+KT AEK AW  AM+  
Sbjct  145   VFTSSLTAVVWSNHRDNPTSHDFDERNWSDVNLCKKFKLWHGLSKTLAEKTAWALAMDRG  204

Query  503   VKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMD  324
             + +V++   LVM P     D   S PYLKG   M   GV+A+ D+    +AH+ V+E  D
Sbjct  205   ISMVSINGGLVMGP-----DVTISNPYLKGAAEMYEDGVMASVDLRFYVDAHICVFE--D  257

Query  323   YGACGRYLCFGRTITTPEDAVLLENRLKMQGLLS----AYESGEI-PARLCKSKLTRLL  162
               + GRYLCF   I   EDA+ L   L      S    ++E   + P R+   KL +L+
Sbjct  258   VSSYGRYLCFNHVINCNEDAMKLARMLLPPSDTSTPPLSFEDTRVHPQRISNKKLNKLM  316



>ref|XP_006478944.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X3 [Citrus 
sinensis]
Length=330

 Score =   171 bits (434),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 108/299 (36%), Positives = 158/299 (53%), Gaps = 17/299 (6%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARM  855
             K VCV   + +F + L+R+LL+RGY V A + N    + ++  L     ++   V  A  
Sbjct  27    KTVCVMDASGHFASALVRRLLLRGYTVHAALHNHGKLQCIEGELINYNEEKKLKVFQADP  86

Query  854   TDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERM-AFLETEAAGNVIEACSKTAYARRC  678
              D   L  A +GC  +F+  SF  P   S Y + + A +ET AA NV+EAC++T    + 
Sbjct  87    FDYHSLVNALKGCSGLFY--SFEPPSDHSTYDQELTAEVETMAAHNVLEACAQTNTVDKV  144

Query  677   IFTSSLLASIWKG--NNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETK  504
             +FTSSL A +W    +N    D DE +W+D + C++ KLW  L+KT AEK AW  AM+  
Sbjct  145   VFTSSLTAVVWSNHRDNPTSHDFDERNWSDVNLCKKFKLWHGLSKTLAEKTAWALAMDRG  204

Query  503   VKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMD  324
             + +V++   LVM P     D   S PYLKG   M   GV+A+ D+    +AH+ V+E  D
Sbjct  205   ISMVSINGGLVMGP-----DVTISNPYLKGAAEMYEDGVMASVDLRFYVDAHICVFE--D  257

Query  323   YGACGRYLCFGRTITTPEDAVLLENRLKMQGLLS----AYESGEI-PARLCKSKLTRLL  162
               + GRYLCF   I   EDA+ L   L      S    ++E   + P R+   KL +L+
Sbjct  258   VSSYGRYLCFNHVINCNEDAMKLARMLLPPSDTSTPPLSFEDTRVHPQRISNKKLNKLM  316



>ref|XP_006367452.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Solanum 
tuberosum]
Length=306

 Score =   171 bits (432),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 110/297 (37%), Positives = 157/297 (53%), Gaps = 20/297 (7%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTD  849
             VCV   ++ FG+ LI +LL +G+ V A IQN  D    +  L     K+   V    + D
Sbjct  13    VCVMGSSTQFGSSLIIRLLEKGFTVHAAIQNHGD----EVELMSICDKKRLKVFCLDLFD  68

Query  848   LDCLCEAFRGCHAVFHTSSFIDPHGISG-YTERMAFLETEAAGNVIEACSKTAYARRCIF  672
                + +A +GC  +F+  SF  P   S  Y E MA +E  AA NV+EAC++     + IF
Sbjct  69    YHSIIDALKGCSCLFY--SFEPPKDHSTIYDEYMAEIEVRAAHNVLEACAQIDTIEKVIF  126

Query  671   TSSLLASIWKGNNHE---HDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKV  501
             TSS  A IW  ++ +   H DLDE  W+D +FCR+ KLW+AL+KT AEK AW  AM+  +
Sbjct  127   TSSATAIIWGFDDKKSSSHVDLDEKHWSDINFCRKYKLWYALSKTLAEKTAWALAMDRGI  186

Query  500   KLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDY  321
              +V++   L+M       D     PYLKG + M   GV  + DVD   +AH+ VY+  D 
Sbjct  187   NMVSINSGLLMDH-----DLNIKNPYLKGAKEMYENGVFVSVDVDFLVDAHICVYD--DV  239

Query  320   GACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAY---ESGEIPARLCKSKLTRLLF  159
              + GRYLCF   I T +DA+ L N+L            +S  I  R+   KL +++ 
Sbjct  240   SSYGRYLCFNHIINTIDDAINLANKLSPLPSSPPSFEKDSKIIQQRISNKKLNKIMI  296



>ref|XP_006375990.1| hypothetical protein POPTR_0013s07700g [Populus trichocarpa]
 gb|ERP53787.1| hypothetical protein POPTR_0013s07700g [Populus trichocarpa]
Length=279

 Score =   170 bits (430),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 110/285 (39%), Positives = 150/285 (53%), Gaps = 17/285 (6%)
 Frame = -1

Query  1043  RERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVV  864
             +  K VCV   +   G+ ++ +LL RGY V A +QNQ    +  E L     K    V  
Sbjct  9     QTSKTVCVMDASGPLGSSIVHRLLQRGYSVHAAVQNQGKLWQSFEGLSCNNEKL--KVFH  66

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
             +   D   + +A +GC  +F+  SF  P     Y E MA +E  AA NV+EAC++T    
Sbjct  67    SDPFDYHSIMDALKGCCGLFY--SFEPPSDQPTYDEFMADVEVRAAHNVLEACAQTNTID  124

Query  683   RCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETK  504
             + +FTSS    IW  ++ +  DLDE +W+D +FCR+ KLW AL+KT AEK AW  AM+  
Sbjct  125   KVVFTSSATTVIWNDSHRKAPDLDERNWSDLNFCRKFKLWQALSKTLAEKTAWALAMDRS  184

Query  503   VKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMD  324
             + +VTV   L+M+P    A+     PYLKG   M   GV  T D+    + H+ V+E  D
Sbjct  185   INMVTVNGGLLMSPDLTIAN-----PYLKGAAEMYEDGVFVTVDLRFIVDTHIHVFE--D  237

Query  323   YGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGEIPARL  189
               + GRYLCF   I   EDAV L N      LL   ES  +P RL
Sbjct  238   ITSYGRYLCFNHVIKCNEDAVKLANT-----LLPPSESS-LPQRL  276



>ref|XP_006282680.1| hypothetical protein CARUB_v10005316mg [Capsella rubella]
 gb|EOA15578.1| hypothetical protein CARUB_v10005316mg [Capsella rubella]
Length=307

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 103/293 (35%), Positives = 155/293 (53%), Gaps = 13/293 (4%)
 Frame = -1

Query  1022  VTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTDLD  843
             V   ++Y G  +++KLL RGY V A I+   D E  + +   E  ++   V    + D  
Sbjct  16    VLDASTYVGFWILKKLLSRGYSVHAAIRRNGDSEIEEIVREMETTEERLVVYDVDVLDYQ  75

Query  842   CLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTSS  663
              +  + + C+ VF       P G   Y E+   LE   A NV+EAC +T    + +F+SS
Sbjct  76    SILVSLKTCNVVF--CCLDSPEG---YDEKEVDLEVRGAINVVEACGRTESIEKIVFSSS  130

Query  662   LLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTVC  483
             L ASIW+ N     D+DE  W+D+DFCR  KLW ALAK  +EK AW  AM+ ++ +V++ 
Sbjct  131   LTASIWRDNIGTQKDVDEKCWSDQDFCRNKKLWHALAKMLSEKAAWALAMDRRLNMVSIN  190

Query  482   PALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGRY  303
             P L++ P     +   ++ YLKG   M   GVLA  DV   A+ H+  +E  D  ACGRY
Sbjct  191   PGLIVGPFVAQHNARPTMSYLKGAAQMYENGVLAYVDVKFLADVHIKAFE--DVSACGRY  248

Query  302   LCFGRTITTPEDAV-LLENRLKMQGLLSAYE-----SGEIPARLCKSKLTRLL  162
              CF + + T E+A+ L+E+   +  +   YE     S     RL  +KL++L+
Sbjct  249   FCFNQIVNTEEEALKLVESLSPLIPMPPRYENEMHGSEVYEERLRNNKLSKLV  301



>ref|XP_008443817.1| PREDICTED: cinnamoyl-CoA reductase 1 isoform X1 [Cucumis melo]
Length=297

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 103/300 (34%), Positives = 161/300 (54%), Gaps = 11/300 (4%)
 Frame = -1

Query  1037  RKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVAR  858
             + ++CV   +SY G  + + LL +GY V A +QN    E  K +    +++    V    
Sbjct  5     KPILCVLDASSYVGFWVTKGLLSKGYPVHAAVQNTGKPEIEKTIREMCKVENGLMVFSVD  64

Query  857   MTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRC  678
             + D   +  A +GC  +F     +D H +  Y E+M  LE     NV+EAC++T    + 
Sbjct  65    IMDYQSILVALKGCSGLF---CCMDTHHV--YDEKMVDLEVRGTINVVEACAQTDSVEKI  119

Query  677   IFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVK  498
             +FTSSL A++W+ N     D+DE  W+D++FCR+ KLW+ LAKT +E+ AW  AM+ ++K
Sbjct  120   VFTSSLTAAVWRENILSEKDVDERCWSDKEFCRKMKLWYPLAKTLSEQAAWALAMDRRLK  179

Query  497   LVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYG  318
             +V++   LV+ P+    ++ S++ YLKG   M   GVLA  DV    + H+   E+   G
Sbjct  180   MVSINAGLVLGPAVAEENSGSTISYLKGAAQMYENGVLAVVDVKFLVDVHIRAMEDSSTG  239

Query  317   ACGRYLCFGRTITTPEDAVLLENRLK-MQGLLSAYESGEIPA---RLCKSKLTRLLFHTA  150
               GRY CF + + + E+ V L N L+ +  L   YE     A   RL   KL +L+  TA
Sbjct  240   --GRYFCFDQIVNSEEETVKLANILRPLISLPQRYEVQGKEAFAERLRTRKLHKLIEGTA  297



>ref|XP_010047877.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Eucalyptus grandis]
Length=308

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 108/301 (36%), Positives = 162/301 (54%), Gaps = 11/301 (4%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVA  861
             ++  VCV   ++Y G  +++ LL +GY V A IQ   + E ++++   E +++   V   
Sbjct  14    DKPAVCVLDASTYVGFWILQGLLSKGYSVHAAIQKNGETEIVEKIRDMELIEERLVVYSV  73

Query  860   RMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYT-ERMAFLETEAAGNVIEACSKTAYAR  684
                D   + EA +GC A+F      D     GY  E+ A LE   A NV+EAC++T    
Sbjct  74    EALDYRSILEALKGCSALFCCLDSSD-----GYDDEKNADLEVRGAINVVEACAQTDSID  128

Query  683   RCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETK  504
             + +F+SSL A+IWK +     D+DE SW+D DFCR+ KLW AL+KT +E+ AW  AM+  
Sbjct  129   KVVFSSSLTAAIWKDDISSQVDVDERSWSDPDFCRKLKLWHALSKTLSEQAAWALAMDRM  188

Query  503   VKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMD  324
             + +V++   LV+ P+    + +S+L YLKG   M   GVLA+ D +  A+ H+   E  D
Sbjct  189   LNMVSINSGLVLGPAVAQQNPKSTLAYLKGASQMYESGVLASVDTNFLADVHIRALE--D  246

Query  323   YGACGRYLCFGRTITTPEDAVLLENRLK-MQGLLSAYESGE--IPARLCKSKLTRLLFHT  153
                 GRY CF + + T E A  +  RL  +  L   YE G      RL   KL +L+  T
Sbjct  247   PSTRGRYFCFNQAVNTEELAAKVAQRLSPLISLPPRYEQGSEAFAERLRTKKLDKLVEGT  306

Query  152   A  150
             A
Sbjct  307   A  307



>gb|KHG27464.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Gossypium arboreum]
Length=298

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 112/304 (37%), Positives = 166/304 (55%), Gaps = 16/304 (5%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQ-VDFeemkellreeemkqlESVVV  864
             E+   CV   ++Y G  +++ LL RGY V A IQ +  + + +K++   E +++  SV  
Sbjct  4     EKPAACVLDASTYVGFWILKGLLNRGYTVHAAIQMKGSETDIVKKIKEMERVEERLSVFS  63

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
               + D   +  A +GC A+F      D     GY + +  LE   A NV+EAC++T   +
Sbjct  64    VDILDYHSILVALKGCSALFCCLDCPD-----GYDDLIVDLEVRGAINVVEACAQTDSMQ  118

Query  683   RCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETK  504
             + +FTSSL A+IW+ N     D+DE  W+D+DFCR+ KLW+ALAKT +E+ AW  AM+  
Sbjct  119   KIVFTSSLTAAIWRENICSQTDVDERFWSDQDFCRKMKLWYALAKTLSEQAAWALAMDRM  178

Query  503   VKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMD  324
             + +V+V   LV+ P+    +  S++ YLKG   M   GVLA  DV   A+ H+  +E  D
Sbjct  179   LNMVSVNAGLVVGPAVAQQNPCSTVSYLKGAAEMFENGVLAVVDVKFLADVHIRAFE--D  236

Query  323   YGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSA---YE---SGEIPARLCKSKLTRLL  162
                 GRY CF + + T E+AV L   L    LLS+   YE   S     RL   KL +L+
Sbjct  237   SSTIGRYFCFNQIVHTEEEAVKLVETL--SPLLSSQPKYECQGSEAYAERLRTKKLNKLV  294

Query  161   FHTA  150
               TA
Sbjct  295   EGTA  298



>ref|XP_004300411.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Fragaria vesca subsp. 
vesca]
Length=315

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 110/313 (35%), Positives = 159/313 (51%), Gaps = 20/313 (6%)
 Frame = -1

Query  1076  ASNVFSSHLWCRERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellre  897
             AS+ F           VCV   + + G+ L+R+L+ RGY V A +Q+  +    K     
Sbjct  5     ASDPFDDLHHTMSSTTVCVMDASGHLGSTLVRRLVQRGYTVHAALQSHGE---SKLGSVS  61

Query  896   eemkqlESVVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNV  717
              E  +   +      D   + +A +GC  +F+T  F  P     Y E MA +E  AA NV
Sbjct  62    FENNKRLKIFHLDPFDYQSIVDALKGCSGLFYT--FEPPQDQPDYDEYMADVEVRAAHNV  119

Query  716   IEACSKTAYARRCIFTSSLLASIWKGNNHE---HDDLDESSWTDEDFCRENKLWFALAKT  546
             +EAC++T    + +FTSS+ A +W  N        +LDE  WTD +FCR+ KLW AL+KT
Sbjct  120   LEACARTETIDKVVFTSSVTAVVWSNNRSTAAATPELDERHWTDVNFCRKVKLWHALSKT  179

Query  545   RAEKVAWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVD  366
              AEK AW  AM+  + +V++   L++     +AD   S PYLKG   M   GVL T DV+
Sbjct  180   LAEKTAWAMAMDRGLNMVSMNVGLML-----NADLSISNPYLKGAAEMYEDGVLVTVDVN  234

Query  365   KAAEAHVFVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGE-----I  201
                +AH+ V+E  D  + GRYLCF   IT  EDAV L  +L      +  +  +     I
Sbjct  235   FVVDAHICVFE--DVTSYGRYLCFNNIITQSEDAVNLARKLTPSAPAALPQGKDQDVRII  292

Query  200   PARLCKSKLTRLL  162
               R+   KL +L+
Sbjct  293   QERISNKKLNKLM  305



>ref|XP_010417131.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Camelina sativa]
Length=304

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/257 (36%), Positives = 141/257 (55%), Gaps = 6/257 (2%)
 Frame = -1

Query  1025  CVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTDL  846
             CV   ++Y G  ++ +LL +GY V A I+   +    +++   E  ++   V    + D 
Sbjct  11    CVLDASTYVGFWILNRLLTKGYSVHAAIRKNGESMLEEKIRDMEAKEERLEVYDVDVLDY  70

Query  845   DCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTS  666
               +  A   C+AVF      +P G     E+   +E   A NV+EAC++T    + +F+S
Sbjct  71    QTILVALNNCNAVF--CCLDNPEGYD--EEKEVDVEVRGAINVVEACARTESIEKIVFSS  126

Query  665   SLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTV  486
             SL A+IW+ N     D+DE  W+D DFC + KLW ALAKT++EK AW  AM+  V +V+V
Sbjct  127   SLTAAIWRDNIGTQKDVDEKCWSDLDFCLKKKLWHALAKTQSEKAAWALAMDRMVNMVSV  186

Query  485   CPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGR  306
              P L++ PS    +   ++ YLKG   M   GVLA  DV+  A+ H+  +E  D  ACGR
Sbjct  187   NPGLIVGPSVAQQNPRPTMSYLKGASQMYENGVLAYVDVEFVADVHIRAFE--DTSACGR  244

Query  305   YLCFGRTITTPEDAVLL  255
             Y CF + + T ++A+ L
Sbjct  245   YFCFNQIVNTEDEALKL  261



>ref|XP_004166068.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Cucumis sativus]
 gb|KGN65259.1| hypothetical protein Csa_1G277460 [Cucumis sativus]
Length=297

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 103/299 (34%), Positives = 161/299 (54%), Gaps = 15/299 (5%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTD  849
             +CV   +SY G  + + LL +GY V A +QN    E  K +    E++   +V    + D
Sbjct  8     LCVLDASSYVGFWVTKGLLNKGYPVHAAVQNTGKPEIEKTIREMGEVENGLAVFSVDIMD  67

Query  848   LDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFT  669
                +  A +GC  +F     +D H +  Y E+M  LE     NV+EAC++T    + +FT
Sbjct  68    YQSILVALKGCSGLF---CCMDTHHV--YDEKMVDLEVRGTINVVEACAQTDSVEKIVFT  122

Query  668   SSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVT  489
             SSL A++W+ N     D+DE  W+D++FCR+ KLW+ LAKT +E+ AW  AM+ ++K+V+
Sbjct  123   SSLTAAVWRENILSEKDVDERCWSDKEFCRKMKLWYPLAKTLSEQAAWALAMDRRLKMVS  182

Query  488   VCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACG  309
             +   LV+ P+    ++ S++ YLKG   M   GVLA  DV    + H+   E+   G  G
Sbjct  183   INAGLVLGPAVAEENSGSTISYLKGAAQMYENGVLAVVDVKFLVDVHIRAMEDSSTG--G  240

Query  308   RYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGEIPA------RLCKSKLTRLLFHTA  150
             RY CF + + + E+ V L N L+   L+S  +  E+        RL   KL +L+  TA
Sbjct  241   RYFCFDQIVNSEEETVKLANILR--PLISIPQRYEVQGREAFAERLRTRKLHKLIEGTA  297



>ref|XP_010472384.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Camelina sativa]
 ref|XP_010472385.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Camelina sativa]
Length=304

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/257 (36%), Positives = 141/257 (55%), Gaps = 6/257 (2%)
 Frame = -1

Query  1025  CVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTDL  846
             CV   ++Y G  ++ +LL +GY V A I+   +    +++   E  ++   V    + D 
Sbjct  11    CVLDASTYVGFWILNRLLTKGYSVHAAIRKNGESMLEEKIRDMEAKEERLEVYDVDVLDY  70

Query  845   DCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTS  666
               +  A   C+AVF      +P G     E+   +E   A NV+EAC++T    + +F+S
Sbjct  71    QTILVALNNCNAVF--CCLDNPEGYD--EEKEVDVEVRGAINVVEACARTESIEKIVFSS  126

Query  665   SLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTV  486
             SL A+IW+ N     D+DE  W+D DFC + KLW ALAKT++EK AW  AM+  V +V+V
Sbjct  127   SLTAAIWRDNIGTQKDVDEKCWSDLDFCLKKKLWHALAKTQSEKAAWALAMDRMVNMVSV  186

Query  485   CPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGR  306
              P L++ PS    +   ++ YLKG   M   GVLA  DV+  A+ H+  +E  D  ACGR
Sbjct  187   NPGLIVGPSVAQQNPRPTMSYLKGASQMYENGVLAYVDVEFVADVHIRAFE--DTSACGR  244

Query  305   YLCFGRTITTPEDAVLL  255
             Y CF + + T ++A+ L
Sbjct  245   YFCFNQIVNTEDEALKL  261



>ref|XP_002308427.1| cinnamoyl-CoA reductase-related family protein [Populus trichocarpa]
 gb|EEE91950.1| cinnamoyl-CoA reductase-related family protein [Populus trichocarpa]
Length=310

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 113/307 (37%), Positives = 164/307 (53%), Gaps = 27/307 (9%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQ-NQVDFe---------emkellreeemkql  879
             VCV   ++Y G+ +++ LL RGY V A IQ N  +F             E       ++ 
Sbjct  9     VCVLDASTYVGSWILKGLLSRGYTVHAAIQKNNGNFSVLGGFCSGETEIEKEIRGLGREE  68

Query  878   ESVVVARMTDLD--CLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEAC  705
             E +VV  +  LD   +  A +GC A+F      D     GY E+M   E   A NV EAC
Sbjct  69    ERLVVFEVDVLDYHSILIALKGCSAMFCCLDSRD-----GYDEKMVDSEIRGAINVAEAC  123

Query  704   SKTAYARRCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAW  525
             ++T    + IF+SSL A+IWK +     D+DE SW+D++FCR+ KLW ALAKT +E+ AW
Sbjct  124   AQTDTIEKIIFSSSLTAAIWKESICSEKDVDERSWSDQEFCRKLKLWHALAKTLSEQAAW  183

Query  524   RKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHV  345
               AM+  + +V++   LV+ P     +  S++ YL+G   M   GVLA  DV+  A+ H+
Sbjct  184   ALAMDRMLNMVSINAGLVLGPGVSQQNPLSTMSYLRGAAQMYENGVLAYVDVNFLADVHI  243

Query  344   FVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLS-----AYESGEIPA-RLCK  183
               ++  D   CGRY CF +T+TT E+AV L   L    L+S      Y+  E+ A RL  
Sbjct  244   RAFQ--DRSTCGRYFCFNQTVTTEEEAVKLAQSL--NPLISLPPRYEYQGNEVHAERLRT  299

Query  182   SKLTRLL  162
              KL +L+
Sbjct  300   KKLNKLV  306



>ref|XP_009625955.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Nicotiana tomentosiformis]
Length=313

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 114/296 (39%), Positives = 158/296 (53%), Gaps = 20/296 (7%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTD  849
             VCV   +S  G+ L+++LL RG+ V A IQN  D E +     ++E      V  +   D
Sbjct  13    VCVMDASSRLGSSLVKRLLERGFKVHAAIQNHGDHELISLPPCDKERL---EVFQSDPFD  69

Query  848   LDCLCEAFRGCHAVFHTSSFIDPHGIS-GYTERMAFLETEAAGNVIEACSKTAYARRCIF  672
                +  A +GC  +F+  SF  P   S  Y E MA +E  AA NV+EAC++T    + +F
Sbjct  70    YHSVLGALKGCSCLFY--SFEPPKDHSNAYDEYMAEVEVRAAQNVLEACAQTETIEKVVF  127

Query  671   TSSLLASIWKGNNHEHD---DLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKV  501
             TSS  A IW G++H+     DLDE  W+D +FCR+ KLW ALAKT AEK AW  AM+  +
Sbjct  128   TSSATAIIW-GHDHKKSASLDLDERHWSDINFCRKFKLWHALAKTLAEKTAWALAMDRGL  186

Query  500   KLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDY  321
              +V++   L++ P     D   + PYLKG   M   GVL T D+D   ++H+ VYE  D 
Sbjct  187   NMVSINSGLLINP-----DLNITNPYLKGAAEMYEDGVLVTVDLDFLVDSHICVYE--DI  239

Query  320   GACGRYLCFGRTITTPEDAVLLENR---LKMQGLLSAYESGEIPARLCKSKLTRLL  162
                GRYLCF   I T EDA  L  +   L    L    ++  I  R+   KL +L+
Sbjct  240   STYGRYLCFNHMINTTEDAFKLAKKLFPLPSSPLSFEKDTRIIQQRISNKKLNKLM  295



>gb|AHD25273.1| dihydroflavonol 4-reductase [Indosasa hispida]
Length=314

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 116/306 (38%), Positives = 147/306 (48%), Gaps = 20/306 (7%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATI---------QNQVDFeemkellreeemkq  882
             K VCV   +   G  L+ +LL RGY V A           Q+              + +Q
Sbjct  10    KSVCVMDASGPLGHALVDRLLRRGYTVHAATYTHHADQDDQDSESLLRQLSSSCSGDKQQ  69

Query  881   lESVVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACS  702
                V  A   D   +  A RGC  +F    F  PH  +   E MA +E  AA NV+EAC+
Sbjct  70    RLKVFQADPFDYHTIAGAVRGCSGLF--CMFSTPHDQATCDEAMAEMEVRAAHNVLEACA  127

Query  701   KTAYARRCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWR  522
             +T    R +FTSS+ A +WK N+   D  DE +W++  FCR+ KLW ALAKT +EK AW 
Sbjct  128   QTETMERVVFTSSVTAVVWKENHKLVDAFDEKNWSELSFCRKFKLWHALAKTLSEKTAWA  187

Query  521   KAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVF  342
              AM+  V +V +   L+  P    A      PYLKG   M   GVL T DVD  A+AHV 
Sbjct  188   LAMDRGVDMVAINAGLLTGPGLTAAH-----PYLKGAPDMYEDGVLVTVDVDFLADAHVA  242

Query  341   VYEEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAY--ESGEIPARLCKSKLTR  168
             VYE     A GRYLCF   +  PEDAV L   L      S    E   IP R+   KL +
Sbjct  243   VYESP--TAYGRYLCFNNAVCGPEDAVKLAQMLSPSAPRSPPSDELKVIPQRIQDKKLNK  300

Query  167   LLFHTA  150
             L+   A
Sbjct  301   LMVEFA  306



>ref|XP_010429343.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Camelina sativa]
 ref|XP_010429344.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Camelina sativa]
Length=304

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 92/257 (36%), Positives = 141/257 (55%), Gaps = 6/257 (2%)
 Frame = -1

Query  1025  CVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTDL  846
             CV   ++Y G  ++ +LL +GY V A I+   +    +++   E  ++   V    + D 
Sbjct  11    CVLDASTYVGFWILNRLLTKGYSVHAAIRKNGESMLEEKIRDMEAKEERLEVYDVDVLDY  70

Query  845   DCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTS  666
               +  A   C+AVF      +P G     E+   +E   A NV+EAC++T    + +F+S
Sbjct  71    QTILVALNNCNAVF--CCLDNPEGYD--EEKEVDVEVRGAINVVEACARTESIEKIVFSS  126

Query  665   SLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTV  486
             SL A+IW+ N     D+DE  W+D DFC + KLW ALAKT++EK AW  AM+  V +V+V
Sbjct  127   SLTAAIWRDNIGTQKDVDEKCWSDLDFCLKKKLWHALAKTQSEKAAWALAMDRMVNMVSV  186

Query  485   CPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGR  306
              P L++ PS    +   ++ YLKG   M   GVLA  DV+  A+ H+  +E  D  ACGR
Sbjct  187   NPGLIVGPSVTQHNPRPTMSYLKGASQMYENGVLAYADVEFVADVHIRAFE--DTSACGR  244

Query  305   YLCFGRTITTPEDAVLL  255
             Y CF + + T ++A+ L
Sbjct  245   YFCFNQIVNTEDEALKL  261



>ref|XP_007013938.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY31557.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=298

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 110/303 (36%), Positives = 168/303 (55%), Gaps = 12/303 (4%)
 Frame = -1

Query  1043  RERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkql-ESVV  867
             +E+  VCV   ++Y G  +++ LL RGY V A +Q +    E++E ++E E  +   +V 
Sbjct  3     QEKPTVCVLDASTYVGFWILKGLLSRGYTVHAALQRKGSETEIEEKIKEMERVEDRLAVF  62

Query  866   VARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYA  687
                + D   +  A +GC A+F      D     GY + +  LE   A NV+EAC++T   
Sbjct  63    TVDILDYQSILVALKGCSALFCCLDSPD-----GYDDVIVDLEVRGAINVVEACAQTDTI  117

Query  686   RRCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMET  507
              + +F+SSL A++W+ N     D+DE  W+D+DFCR+ KLW+ALAKT +E+ AW  AM+ 
Sbjct  118   EKIVFSSSLTAAVWRENICLEKDVDERCWSDQDFCRKMKLWYALAKTLSEQAAWALAMDR  177

Query  506   KVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEM  327
              + +V+V   LV+ P     +  S++ YLKG   M   GVLA  DV   A+ ++  +E  
Sbjct  178   MLNMVSVNAGLVLGPGVAQQNPRSTMSYLKGAAQMFENGVLAFVDVGFLADVNIRAFE--  235

Query  326   DYGACGRYLCFGRTITTPEDAV-LLENRLKMQGLLSAYE--SGEIPA-RLCKSKLTRLLF  159
             D   CGRY CF + + T E+AV L ++   +  L S YE    E+ A RL   KL +L+ 
Sbjct  236   DSSTCGRYFCFNQIVNTEEEAVKLAQSLSPLLSLPSKYECQGSEVYAERLRTKKLNKLVE  295

Query  158   HTA  150
              TA
Sbjct  296   GTA  298



>ref|XP_006838596.1| hypothetical protein AMTR_s00002p00222610 [Amborella trichopoda]
 gb|ERN01165.1| hypothetical protein AMTR_s00002p00222610 [Amborella trichopoda]
Length=304

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 103/296 (35%), Positives = 147/296 (50%), Gaps = 14/296 (5%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTD  849
             VCV   +   G  L+ +LL +GY V A +QN  D    + L +     +   V    M D
Sbjct  13    VCVMDASGNLGIGLVERLLKKGYSVHAAVQNGDD---GQILRKMITENENLKVFGTDMMD  69

Query  848   LDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFT  669
                + +A +GC  +F+  +F  P   S Y E     E  AA NV+EAC++T    R +FT
Sbjct  70    YQSIIDAIKGCFGLFY--AFKSPMDQSDYDEFSVETEVMAAHNVLEACAQTESMERVVFT  127

Query  668   SSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVT  489
             SS+ A +WKG+ ++  D+DE  W+D + CR+ KLW  LAKT AE+ AW  AM+  V +V+
Sbjct  128   SSVTAVVWKGDKNQASDVDERDWSDPNLCRKFKLWHGLAKTLAERTAWALAMDRGVDMVS  187

Query  488   VCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACG  309
             +   L+  P  P      S PYLKG   M   GV  T D+    +AH+ VYE  +  A G
Sbjct  188   INSGLLTRPQIPL-----SHPYLKGAAEMYEGGVFVTVDIGFLVDAHICVYE--NPSAYG  240

Query  308   RYLCFGRTITTPEDAVLLENRLKMQGLLSAY--ESGEIPARLCKSKLTRLLFHTAR  147
             RY+CF + I   EDA      L+          +S     R+   KL +L+    R
Sbjct  241   RYICFNQLINRSEDAARFARMLRPPVPSPPSSEDSKIYEQRITNKKLNKLMVDFER  296



>ref|XP_004241958.1| PREDICTED: dihydroflavonol-4-reductase-like [Solanum lycopersicum]
Length=311

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 105/294 (36%), Positives = 152/294 (52%), Gaps = 22/294 (7%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTD  849
             +CV   ++  G  L+++LL RGY V A IQN  +      L   E  ++   +  +   D
Sbjct  13    ICVMDASTRLGTKLVKRLLKRGYTVHAAIQNHGE---SSSLKGIECEEKKLKIFESDPFD  69

Query  848   LDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFT  669
                + +A +GC  +F+  +F  P     Y E M  +E  AA NV+EAC++T    + +FT
Sbjct  70    YHSILDALKGCSGLFY--NFESPPDYPTYDEEMGEVEVRAAHNVLEACAQTDTIEKVVFT  127

Query  668   SSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVT  489
             SS    IW    H+   +DE  WTD +FCR+ KLW+A++KT AEK AW  AM+  + +VT
Sbjct  128   SSATTIIW---GHDAPSIDERHWTDINFCRKFKLWYAMSKTLAEKTAWGLAMDRGINMVT  184

Query  488   VCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACG  309
             +   L+M P     +     PYLKG   M   GV  T D+D   +AH+ VYE  D  + G
Sbjct  185   INSGLLMGPELTITN-----PYLKGAAEMYEDGVFVTVDLDFLVDAHICVYE--DIASYG  237

Query  308   RYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGE-----IPARLCKSKLTRLL  162
             RYLCF   I   +DA+ L   L    L S  +S E     I  R+   KL++L+
Sbjct  238   RYLCFNHIINQKQDALELVQMLS--PLPSPPQSLEENTTIIQQRISNKKLSKLM  289



>ref|XP_004245906.1| PREDICTED: cinnamoyl-CoA reductase 2-like isoform X2 [Solanum 
lycopersicum]
Length=315

 Score =   169 bits (427),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 114/314 (36%), Positives = 163/314 (52%), Gaps = 24/314 (8%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQN--QVDFeemkellreeemkqlESVVVARM  855
             +CV   +S  G+ L++ LL RGY V A +QN  +      +    ++   +++ + + R 
Sbjct  5     ICVMDASSCLGSKLVKCLLQRGYTVHAALQNYGESSLFLDELECDDDGDDKMKKLKIFRS  64

Query  854   TDLD--CLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARR  681
                D   + +A +GC A+F+  SF  P   S Y E +  +E  AA NV+EAC++T    +
Sbjct  65    DPFDYHSIVDALKGCCALFY--SFEPPRDHSTYDEYIGEVEVRAAHNVVEACAQTDTIEK  122

Query  680   CIFTSSLLASIWKGNNHEHDD------LDESSWTDEDFCRENKLWFALAKTRAEKVAWRK  519
              +FTSS  A IW   +HE+D       LDE  W+D + CR+ KLW AL+KT AEK AW  
Sbjct  123   VVFTSSATAIIW--GHHENDQNSASMLLDERHWSDINVCRKFKLWHALSKTLAEKTAWAL  180

Query  518   AMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFV  339
             AM+  V +V+V   L+M P     D     PYLKG   M   GV  T D+D   EAH+ V
Sbjct  181   AMDRGVNMVSVNAGLLMGP-----DLTIKNPYLKGAAEMYEDGVFVTVDLDFLVEAHICV  235

Query  338   YEEMDYGACGRYLCFGRTITTPEDAVLLENRLK-MQGLLSAYESGE--IPARLCKSKLTR  168
             YE++     GRYLCF   I   EDA+ L N L  M     + ES    I  R+   KL +
Sbjct  236   YEQI--STYGRYLCFNHIINQTEDALKLANMLSPMPSSPQSMESDTRIIQERISNKKLNK  293

Query  167   LLFHTARRLSCKHR  126
             L+     +++ K R
Sbjct  294   LMIECQPQINGKSR  307



>ref|XP_003534280.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Glycine max]
 gb|KHN38934.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Glycine soja]
Length=299

 Score =   168 bits (425),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 106/295 (36%), Positives = 150/295 (51%), Gaps = 18/295 (6%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTD  849
             VCV   + + G  L+++LL RGY V A++Q    + E               V  +   D
Sbjct  12    VCVMDASGHLGFSLVQRLLQRGYTVHASVQK---YGEENLFTGISSDPDKLKVFRSDPFD  68

Query  848   LDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFT  669
                + +A RGC  +F+T  F  P     Y E MA +E  AA NV+EAC++T    + +FT
Sbjct  69    YHSIIDALRGCSGLFYT--FEPPFDQPNYDEYMADVEVRAAHNVLEACAQTETMDKVVFT  126

Query  668   SSLLASIWKGNNHEHD-DLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLV  492
             SS  A +W+ +    + DLDE  W+D +FCR+ KLW  ++KT AEK AW  AM+  V +V
Sbjct  127   SSATAVVWREDRKTMELDLDERHWSDVNFCRKFKLWHGVSKTMAEKSAWALAMDRGVNMV  186

Query  491   TVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGAC  312
             ++   L+MA      D     PYL+G   M   GV  T D+    +AH+ VYE  D  + 
Sbjct  187   SINAGLMMA-----HDLSIKHPYLRGAAEMYEDGVFVTVDLAFLVDAHICVYE--DVSSY  239

Query  311   GRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGE-----IPARLCKSKLTRLL  162
             GRYLCF   I T EDAV L  +L      S  +S +     I  R+   KL +L+
Sbjct  240   GRYLCFNHIINTHEDAVQLARKLTPGASSSLPQSDDYGKSFIEQRISNKKLNKLM  294



>ref|XP_009390701.1| PREDICTED: cinnamoyl-CoA reductase 2-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=305

 Score =   168 bits (425),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 109/297 (37%), Positives = 147/297 (49%), Gaps = 11/297 (4%)
 Frame = -1

Query  1043  RERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVV  864
             R+R  VCV   +   G  L+ +LL RGY+V A    +   E    L R     Q   +  
Sbjct  8     RDRNTVCVMDASRRLGVSLVERLLRRGYVVHAATYGRGFGESSGSLRRLFGENQRLKLFH  67

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
             A   D   + +A +GC  +F+T    +P     Y E +  +E  +A NV+EAC++     
Sbjct  68    ADPFDYQSIVDAMKGCAGLFYT---FEPPQDQSYDEFLVEVEVRSAHNVLEACAQVETME  124

Query  683   RCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETK  504
             R +FTSS+ A +WK N     D DE  W++ +FCR+ KLW ALAKT AEK AW  AM+  
Sbjct  125   RAVFTSSVTAVVWKENRKAAADFDEREWSEPNFCRKYKLWHALAKTVAEKTAWALAMDRG  184

Query  503   VKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMD  324
             V +V V   L++      AD   + PY+KG   M   GVL T DVD   +AHV VYE   
Sbjct  185   VDMVCVNAGLLLVA----ADLSVADPYMKGAAQMYEDGVLVTVDVDFLVDAHVAVYETP-  239

Query  323   YGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESG--EIPARLCKSKLTRLLF  159
               A GRYLCF   +  P DAV LE  L       A   G      R+   KL +++ 
Sbjct  240   -SAYGRYLCFNGAVCHPHDAVKLERLLSHDAAQPASSDGLTATQQRIQNKKLNQVMI  295



>ref|XP_006404875.1| hypothetical protein EUTSA_v10000263mg [Eutrema salsugineum]
 gb|ESQ46328.1| hypothetical protein EUTSA_v10000263mg [Eutrema salsugineum]
Length=304

 Score =   168 bits (425),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 90/255 (35%), Positives = 139/255 (55%), Gaps = 7/255 (3%)
 Frame = -1

Query  1025  CVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTDL  846
             CV   ++Y G  ++++LL +GY V A I+   +    + +   +  ++   V    + D 
Sbjct  12    CVLDASTYVGFWILKRLLAKGYSVHAAIRKNGESMLEEIIRNMQATEERLVVYDVDVLDY  71

Query  845   DCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTS  666
               +  +   C+AVF      +P G   Y E+   LE   A NV+EAC++T    + +F+S
Sbjct  72    QSILVSLNNCNAVF--CCLDNPEG---YDEKEVDLEVRGAINVVEACARTETIEKIVFSS  126

Query  665   SLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTV  486
             SL A+IW  +     D+DE  W+D DFC + KLW A+AKT++EK AW  AM+  V +V+V
Sbjct  127   SLTAAIWSDDIRTQKDVDEKCWSDLDFCVKKKLWHAMAKTQSEKAAWALAMDRMVNMVSV  186

Query  485   CPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGR  306
              P L++ PS    ++   + YLKG   M   GVLA  DV+  A+ H+  +E  D  ACGR
Sbjct  187   NPGLIVGPSVAQYNSRPIMSYLKGAAQMYESGVLAYVDVEFVADVHIRAFE--DSSACGR  244

Query  305   YLCFGRTITTPEDAV  261
             Y CF + + T E A+
Sbjct  245   YFCFNQIVNTEEAAL  259



>ref|XP_003517041.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Glycine max]
 gb|KHN04871.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Glycine soja]
Length=299

 Score =   167 bits (424),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 106/295 (36%), Positives = 151/295 (51%), Gaps = 18/295 (6%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTD  849
             VCV   + + G  L+++LL RGY V A++Q+   + E               V  +   D
Sbjct  12    VCVMDASGHLGFSLVQRLLQRGYTVHASVQS---YGEENLFNGISSDPDKLRVFRSDPFD  68

Query  848   LDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFT  669
                + +A RGC  +F+  SF  P     Y E MA +E  AA NV+EAC++T    + IFT
Sbjct  69    YHSIIDALRGCSGLFY--SFEPPFDQPNYDEYMADVEVRAAHNVLEACAQTETIDKVIFT  126

Query  668   SSLLASIWKGNNHEHD-DLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLV  492
             SS  A +W+ +    + DLDE  W+D +FCR+ KLW  ++KT AEK AW  AM+  V +V
Sbjct  127   SSATAVVWREDRKTMELDLDERHWSDVNFCRKFKLWHGVSKTMAEKSAWALAMDRGVNMV  186

Query  491   TVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGAC  312
             ++   L+MA      D     PYL+G   M   GV  T D+    +AH+ VYE  D  + 
Sbjct  187   SINAGLLMA-----HDLSVKHPYLRGAAEMYEDGVFVTVDLGFLVDAHICVYE--DVSSY  239

Query  311   GRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGE-----IPARLCKSKLTRLL  162
             GRYLCF   I T +DAV L  +L      S  +S +     I  R+   KL +L+
Sbjct  240   GRYLCFNHIINTHDDAVQLARKLTPGASSSLQQSDDYGKSFIEQRINNKKLNKLM  294



>emb|CBI33869.3| unnamed protein product [Vitis vinifera]
Length=291

 Score =   167 bits (424),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 108/294 (37%), Positives = 156/294 (53%), Gaps = 19/294 (6%)
 Frame = -1

Query  1013  GNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTDLDCLC  834
              +S  G+ L+  LL+RGY V A +QN  + + +  L  + +      +  +   D   + 
Sbjct  3     ASSTLGSTLVGSLLLRGYTVHAAVQNHGEIQLLNGLSCDTQKL---KIFHSDPFDYQSIM  59

Query  833   EAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTSSLLA  654
             +A +GC  +F+T  F  PH  + Y E MA +E  AA NVIEAC++T    + +FTSS+ A
Sbjct  60    DALKGCSGLFYT--FEPPHDQTSYDELMADVEVRAAHNVIEACAQTETIEKVVFTSSVTA  117

Query  653   SIWKGNNHE-HDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTVCPA  477
              +W+ +      DLDE+ WTD +F R+ KLW A++KT AEK AW  AM+  V +V+V   
Sbjct  118   VVWRDDRKSIPSDLDETHWTDINFSRKFKLWHAMSKTLAEKSAWALAMDRGVNMVSVNAG  177

Query  476   LVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGRYLC  297
             L+MAP     D   + PYLKG   M   GV  T  VD   +AH+ V+E  D  + GRYLC
Sbjct  178   LLMAP-----DLTITHPYLKGAAEMYEDGVFVTVSVDFLVDAHICVFE--DVSSYGRYLC  230

Query  296   FGRTITTPEDAVLLENRLKMQGLLSAYESGE-----IPARLCKSKLTRLLFHTA  150
             F   I   EDA+ L   L      S  +S +     I  R+   KL +L+ + A
Sbjct  231   FNHIINNNEDALKLAKTLAPSA-PSPPQSCDRDMKMIQQRISNKKLNKLMVNFA  283



>ref|XP_006367444.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Solanum 
tuberosum]
Length=314

 Score =   168 bits (425),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 106/294 (36%), Positives = 150/294 (51%), Gaps = 19/294 (6%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTD  849
             +CV   ++  G  L+++LL RGY V A IQN  +      L R E  ++   +  +   D
Sbjct  13    ICVMDASTRLGTKLVKRLLKRGYTVHAAIQNHGE---SSSLKRIECEEKKLKIFESDPFD  69

Query  848   LDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFT  669
                + +A +GC  +F+  SF  P     Y E M  +E  AA NV+EAC++T    + +FT
Sbjct  70    YHSILDALKGCSGLFY--SFEPPADYPTYDEEMGEVEVRAAHNVLEACAQTDTIEKVVFT  127

Query  668   SSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVT  489
             SS    IW  +      +DE  WTD +FCR+ KLW A++KT AEK AW  AM+  + +VT
Sbjct  128   SSATTIIWGHDKDSAPSIDERHWTDINFCRKFKLWHAMSKTLAEKTAWALAMDRGINMVT  187

Query  488   VCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACG  309
             +   L+M P     +     PYLKG   M   GV  T D+D   +AH+ VYE  D  + G
Sbjct  188   INSGLLMGPELTITN-----PYLKGAAEMYEDGVFVTVDLDFLVDAHICVYE--DIASYG  240

Query  308   RYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGE-----IPARLCKSKLTRLL  162
             RYLCF   I   +DA+ L   L    L S  +S E     I  R+   KL +L+
Sbjct  241   RYLCFNHIINQKQDALNLVQML--SPLPSPPQSLEEDTTIIQQRISNKKLNKLM  292



>ref|XP_006453520.1| hypothetical protein CICLE_v10009021mg [Citrus clementina]
 ref|XP_006474078.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Citrus 
sinensis]
 gb|ESR66760.1| hypothetical protein CICLE_v10009021mg [Citrus clementina]
Length=303

 Score =   167 bits (424),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 93/262 (35%), Positives = 150/262 (57%), Gaps = 7/262 (3%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTD  849
             VCV   ++Y G  ++++LL +GY V A IQ   +    K++   E++++   +    + D
Sbjct  10    VCVLDASTYVGFWILKRLLNKGYFVHAAIQKNGEKAIEKQIKEMEKVEEKLVLFNVDVLD  69

Query  848   LDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFT  669
                +  A + C A+F      D     GY ++M  LE   A NV+EAC++T   ++ +F+
Sbjct  70    YQSILVALKDCCALFCCLDSPD-----GYDDKMVDLEVRGAINVVEACAQTDSIQKLVFS  124

Query  668   SSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVT  489
             SSL A+IW+ +     D+DE SW+++DFCR+ KLW+ALAKT +E+ AW  AM+  + +V+
Sbjct  125   SSLTAAIWREDICSEKDVDERSWSNQDFCRKLKLWYALAKTLSEQAAWALAMDRLLCMVS  184

Query  488   VCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACG  309
             +   LV+ P+    + +S++ YLKG   M   GVLA  DV+  A+ H+ V+E  D    G
Sbjct  185   INAGLVLGPAVTQQNPQSTMFYLKGAAQMYENGVLAFVDVNFLADVHIRVFE--DRSTSG  242

Query  308   RYLCFGRTITTPEDAVLLENRL  243
             RY CF + + T E+A  L   L
Sbjct  243   RYFCFNQIVNTEEEAFKLAQSL  264



>ref|XP_009789693.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 
4-reductase-like isoform X1 [Nicotiana sylvestris]
Length=311

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 110/296 (37%), Positives = 159/296 (54%), Gaps = 20/296 (7%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTD  849
             VCV   +S  G+ L+++LL RG+ V A IQN  +    + +      K+   +  +   D
Sbjct  13    VCVMDASSRLGSSLVKRLLERGFTVHAAIQNHGN---HELMSLPPCDKKGLKIFQSDPFD  69

Query  848   LDCLCEAFRGCHAVFHTSSFIDPHGISG-YTERMAFLETEAAGNVIEACSKTAYARRCIF  672
                + +A +GC  +F+  SF  P   S  Y E MA +E  AA NV+EAC++T    + +F
Sbjct  70    YHSVLDALKGCSCLFY--SFEPPKDHSNAYDEYMAEVEVRAAHNVLEACAQTETIEKVVF  127

Query  671   TSSLLASIWKGNNHEHD---DLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKV  501
             TSS  A IW G++H+     DLDE  W+D +FCR+ KLW ALAKT AEK AW  AM+  +
Sbjct  128   TSSATAIIW-GHDHKKSASFDLDERHWSDINFCRKFKLWHALAKTLAEKTAWALAMDRGL  186

Query  500   KLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDY  321
              +V++   L+++P     D   + PYL G   M   GV  T D+D   ++H+ VYE  D 
Sbjct  187   NMVSINSGLLISP-----DLNITNPYLNGVAEMYEAGVFVTVDLDFLVDSHICVYE--DI  239

Query  320   GACGRYLCFGRTITTPEDAVLLENRL-KMQGLLSAYESGE--IPARLCKSKLTRLL  162
                GRYLCF   I T EDA  L  +L  +    S++E     I  R+   KL +L+
Sbjct  240   STYGRYLCFNHIINTTEDAFKLAEKLFPLPSSPSSFEKDTRIIQQRISNKKLNKLM  295



>ref|XP_002272449.1| PREDICTED: tetraketide alpha-pyrone reductase 1 [Vitis vinifera]
 emb|CBI26487.3| unnamed protein product [Vitis vinifera]
Length=306

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 99/265 (37%), Positives = 146/265 (55%), Gaps = 15/265 (6%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARM  855
             K VCV   +   G+ L+R+LL RGY V A +  + +  E     +++       V  A  
Sbjct  14    KTVCVMDASGRVGSALVRRLLRRGYTVHAALHGEYEIVEGVCCNKKKL-----RVFPADP  68

Query  854   TDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCI  675
              D   + +A +GC A+F+  SF  P     Y E MA +E  AA NV+EAC++T    + +
Sbjct  69    LDYHSIMDALKGCSALFY--SFEPPSDHPNYDEYMADVEVRAAHNVLEACAQTDTIEKVV  126

Query  674   FTSSLLASIWKGN-NHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVK  498
             FTSS+ A IW+ + N    DLDE +W+D +FCR+ KLW  ++KT AE+ AW  AM+  V 
Sbjct  127   FTSSITAVIWRDDRNSTPSDLDERNWSDVNFCRKFKLWHGVSKTLAERTAWALAMDRGVN  186

Query  497   LVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYG  318
             +V++   L+MA     ++     PYLKG   M   GV  T D++   +AH+ V+E  D  
Sbjct  187   MVSINGGLLMADHLTISN-----PYLKGAAEMFEDGVFVTVDLNFLVDAHISVFE--DSS  239

Query  317   ACGRYLCFGRTITTPEDAVLLENRL  243
             + GRYLCF   I + +DA+ L N L
Sbjct  240   SYGRYLCFNHVINSNQDAIHLANML  264



>ref|XP_010526323.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Tarenaya hassleriana]
Length=300

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 110/305 (36%), Positives = 163/305 (53%), Gaps = 24/305 (8%)
 Frame = -1

Query  1043  RERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVV  864
             +E+   CV   ++Y G  ++++LL RG+LV A I+   + E  K++    EM++   VV 
Sbjct  3     QEKPTCCVLDASTYAGFWILKRLLARGHLVHAAIRKDGESEMEKKIKEMMEMEEERLVVY  62

Query  863   ARMT-DLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYA  687
                T D   +  + +GC+ VF       P   SGY E+   LE   A NV+EAC++T   
Sbjct  63    DVDTLDYQSILSSLKGCNLVF--CCLDSP---SGYDEKEVDLEVRGAINVVEACAQTETI  117

Query  686   RRCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMET  507
              + +F+SSL A+IW+ N     D+DE  W+D DFC + KLW ALAKT +EK AW  AM+ 
Sbjct  118   DKVVFSSSLTAAIWRDNIGTQKDVDERCWSDRDFCLKKKLWHALAKTLSEKAAWALAMDR  177

Query  506   KVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEM  327
              + +V++   L+  PS    +   ++ YLKG   M   GVLA  DV   A+ H+   E  
Sbjct  178   TLNMVSINAGLITGPSVSQQNPNPTMSYLKGAAQMYENGVLAYVDVKFLADVHIRASE--  235

Query  326   DYGACGRYLCFGRTITTPEDAV-LLEN---------RLKMQGLLSAYESGEIPARLCKSK  177
             D  +CGRY CF R + T E+A+ LL++         R +MQG     E      RL   K
Sbjct  236   DSSSCGRYFCFDRIVNTEEEALKLLQSLSPLIPIPPRYEMQGAEVQEE------RLRNKK  289

Query  176   LTRLL  162
             L++L+
Sbjct  290   LSKLV  294



>ref|XP_002520066.1| cinnamoyl-CoA reductase, putative [Ricinus communis]
 gb|EEF42390.1| cinnamoyl-CoA reductase, putative [Ricinus communis]
Length=312

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 105/296 (35%), Positives = 150/296 (51%), Gaps = 17/296 (6%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARM  855
             + VCV   +   G  L+ KLL RGY V A + N     ++K         +   V  +  
Sbjct  13    QTVCVMDASGRLGTTLVHKLLKRGYTVHAAVHNH---GKLKYFEELSCKSKKLRVFYSDP  69

Query  854   TDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCI  675
              D   + EA +GC  +F+  SF  P     Y E MA +E  AA NV+EAC+KT    + +
Sbjct  70    FDFHSIIEALKGCCGLFY--SFEPPSDQPTYDEFMADVEVRAAHNVLEACAKTVTIHKVV  127

Query  674   FTSSLLASIWKGN-NHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVK  498
             FTSS+ A IW  + N    DLDE  W+D +FCR+ KLW  L+K  AEK AW  AM+  + 
Sbjct  128   FTSSVTAVIWSNDRNSTSSDLDERYWSDVNFCRKFKLWHGLSKALAEKTAWALAMDRGIN  187

Query  497   LVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYG  318
             +V++   L+M+P    A+     PYLKG   M   G+  T D+  A +AH+ V+E  D  
Sbjct  188   MVSINGGLLMSPDLSIAN-----PYLKGAAEMYEDGLFVTVDLSVAVDAHICVFE--DVA  240

Query  317   ACGRYLCFGRTITTPEDAVLLENRL---KMQGLLSAYESGEI-PARLCKSKLTRLL  162
             + GRYLCF   I   EDA+ L   L       +  ++E   +   R+   KL +L+
Sbjct  241   SYGRYLCFNHVINCNEDAIKLARELLPPSESTVPQSFEDTRVHQQRISNKKLNKLM  296



>ref|XP_009397665.1| PREDICTED: cinnamoyl-CoA reductase 2-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=301

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 111/307 (36%), Positives = 155/307 (50%), Gaps = 16/307 (5%)
 Frame = -1

Query  1043  RERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVV  864
             R+R  VCV   +   G  L+R+LL RG  V A   +  +      L R     +   +  
Sbjct  8     RDRNTVCVMDASCRLGISLVRRLLQRGCTVHAASYHHGE--SSGVLKRMCSENRRLKLFQ  65

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
             A   D   + +A +GC  +F+T    +P     Y E M  +E  AA NV+EAC++     
Sbjct  66    ADPFDYQTIVDAVKGCSGLFYT---FEPPQDESYDELMVEVEVRAAHNVVEACAQVDTIE  122

Query  683   RCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETK  504
             R +FTSS+ A +WK N     D+DE  W++ +FCR+ KLW ALAKT AEK AW  AM+  
Sbjct  123   RVVFTSSVTAVVWKENRKLAADVDEREWSEPNFCRKFKLWHALAKTLAEKTAWALAMDRG  182

Query  503   VKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMD  324
             V +V+V   L+  P     +   S PYLKG   M   GVL T D+D   +AH+ VYE   
Sbjct  183   VDMVSVNAGLLTGP-----EISVSNPYLKGAPQMYEDGVLVTVDIDFLVDAHIAVYE--G  235

Query  323   YGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGE---IPARLCKSKLTRLLFHT  153
               A GRYLCF   +  P DAV L  +L      S+ +S E   I  R+   KL++L+   
Sbjct  236   PSAYGRYLCFSNVVCRPPDAVKLA-QLVSPDAPSSPQSNELKVIAQRIQNKKLSKLMVDF  294

Query  152   ARRLSCK  132
               R+  +
Sbjct  295   DVRIQVE  301



>ref|XP_008443819.1| PREDICTED: cinnamoyl-CoA reductase 1 isoform X2 [Cucumis melo]
Length=273

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 100/300 (33%), Positives = 154/300 (51%), Gaps = 35/300 (12%)
 Frame = -1

Query  1037  RKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVAR  858
             + ++CV   +SY G  + + LL +GY V A +QN                          
Sbjct  5     KPILCVLDASSYVGFWVTKGLLSKGYPVHAAVQN------------------------TD  40

Query  857   MTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRC  678
             + D   +  A +GC  +F     +D H +  Y E+M  LE     NV+EAC++T    + 
Sbjct  41    IMDYQSILVALKGCSGLF---CCMDTHHV--YDEKMVDLEVRGTINVVEACAQTDSVEKI  95

Query  677   IFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVK  498
             +FTSSL A++W+ N     D+DE  W+D++FCR+ KLW+ LAKT +E+ AW  AM+ ++K
Sbjct  96    VFTSSLTAAVWRENILSEKDVDERCWSDKEFCRKMKLWYPLAKTLSEQAAWALAMDRRLK  155

Query  497   LVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYG  318
             +V++   LV+ P+    ++ S++ YLKG   M   GVLA  DV    + H+   E+   G
Sbjct  156   MVSINAGLVLGPAVAEENSGSTISYLKGAAQMYENGVLAVVDVKFLVDVHIRAMEDSSTG  215

Query  317   ACGRYLCFGRTITTPEDAVLLENRLK-MQGLLSAYESGEIPA---RLCKSKLTRLLFHTA  150
               GRY CF + + + E+ V L N L+ +  L   YE     A   RL   KL +L+  TA
Sbjct  216   --GRYFCFDQIVNSEEETVKLANILRPLISLPQRYEVQGKEAFAERLRTRKLHKLIEGTA  273



>ref|XP_006443242.1| hypothetical protein CICLE_v10021083mg [Citrus clementina]
 ref|XP_006478942.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Citrus 
sinensis]
 gb|ESR56482.1| hypothetical protein CICLE_v10021083mg [Citrus clementina]
Length=331

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 108/300 (36%), Positives = 158/300 (53%), Gaps = 18/300 (6%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQV-DFeemkellreeemkqlESVVVAR  858
             K VCV   + +F + L+R+LL+RGY V A + N     + ++  L     ++   V  A 
Sbjct  27    KTVCVMDASGHFASALVRRLLLRGYTVHAALHNHAGKLQCIEGELINYNEEKKLKVFQAD  86

Query  857   MTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERM-AFLETEAAGNVIEACSKTAYARR  681
               D   L  A +GC  +F+  SF  P   S Y + + A +ET AA NV+EAC++T    +
Sbjct  87    PFDYHSLVNALKGCSGLFY--SFEPPSDHSTYDQELTAEVETMAAHNVLEACAQTNTVDK  144

Query  680   CIFTSSLLASIWKG--NNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMET  507
              +FTSSL A +W    +N    D DE +W+D + C++ KLW  L+KT AEK AW  AM+ 
Sbjct  145   VVFTSSLTAVVWSNHRDNPTSHDFDERNWSDVNLCKKFKLWHGLSKTLAEKTAWALAMDR  204

Query  506   KVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEM  327
              + +V++   LVM P     D   S PYLKG   M   GV+A+ D+    +AH+ V+E  
Sbjct  205   GISMVSINGGLVMGP-----DVTISNPYLKGAAEMYEDGVMASVDLRFYVDAHICVFE--  257

Query  326   DYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLS----AYESGEI-PARLCKSKLTRLL  162
             D  + GRYLCF   I   EDA+ L   L      S    ++E   + P R+   KL +L+
Sbjct  258   DVSSYGRYLCFNHVINCNEDAMKLARMLLPPSDTSTPPLSFEDTRVHPQRISNKKLNKLM  317



>ref|XP_001765421.1| predicted protein [Physcomitrella patens]
 gb|EDQ69682.1| predicted protein [Physcomitrella patens]
Length=315

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 106/293 (36%), Positives = 153/293 (52%), Gaps = 17/293 (6%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVA  861
             +RK VCVT   S   + L+R LL +GY VR+TI+  VD  E   L+     +Q   +  A
Sbjct  21    KRKYVCVTGNWSLLASWLVRALLEKGYNVRSTIRTTVD--EAAALMALPGAEQRLELTQA  78

Query  860   RMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARR  681
              M D   L E F GC  VFHTSS  D   +S Y   MA  E     N++EAC+ ++  +R
Sbjct  79    DMLDYGSLVEVFMGCDGVFHTSSPSDL--VSNYPSEMADFEVRGTLNIVEACANSS-VKR  135

Query  680   CIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKV  501
              + TSSL A +W    H    +DE  W++ DFCR  KLW  LAKT AEK AW  A + ++
Sbjct  136   LVLTSSLAAMVWDQQRHADKVIDEKCWSNMDFCRSKKLWGPLAKTMAEKAAWSLARDKEL  195

Query  500   KLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDY  321
              +V + PA+V+ P      T+    YLKG + + + G+ A   V+  A+AH+   E  D 
Sbjct  196   DMVVINPAIVLGPKV-FGTTQCIFTYLKGVKELPQSGLFAYAHVEDVAKAHISALEVSD-  253

Query  320   GACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGEIPARLCKSKLTRLL  162
              A GRY+C+  ++ + E  V L  +L        Y    +P+R  K+ +  +L
Sbjct  254   -ASGRYICY-ESVVSEEKLVGLIRKL--------YPDSSVPSRFSKNGIPHVL  296



>ref|XP_009390702.1| PREDICTED: cinnamoyl-CoA reductase 2-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=303

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 108/297 (36%), Positives = 147/297 (49%), Gaps = 13/297 (4%)
 Frame = -1

Query  1043  RERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVV  864
             R+R  VCV   +   G  L+ +LL RGY+V A    + +      L R     Q   +  
Sbjct  8     RDRNTVCVMDASRRLGVSLVERLLRRGYVVHAATYGRGE--SSGSLRRLFGENQRLKLFH  65

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
             A   D   + +A +GC  +F+T    +P     Y E +  +E  +A NV+EAC++     
Sbjct  66    ADPFDYQSIVDAMKGCAGLFYT---FEPPQDQSYDEFLVEVEVRSAHNVLEACAQVETME  122

Query  683   RCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETK  504
             R +FTSS+ A +WK N     D DE  W++ +FCR+ KLW ALAKT AEK AW  AM+  
Sbjct  123   RAVFTSSVTAVVWKENRKAAADFDEREWSEPNFCRKYKLWHALAKTVAEKTAWALAMDRG  182

Query  503   VKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMD  324
             V +V V   L++      AD   + PY+KG   M   GVL T DVD   +AHV VYE   
Sbjct  183   VDMVCVNAGLLLVA----ADLSVADPYMKGAAQMYEDGVLVTVDVDFLVDAHVAVYETP-  237

Query  323   YGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESG--EIPARLCKSKLTRLLF  159
               A GRYLCF   +  P DAV LE  L       A   G      R+   KL +++ 
Sbjct  238   -SAYGRYLCFNGAVCHPHDAVKLERLLSHDAAQPASSDGLTATQQRIQNKKLNQVMI  293



>ref|XP_009390703.1| PREDICTED: cinnamoyl-CoA reductase 2-like isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=302

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 109/297 (37%), Positives = 147/297 (49%), Gaps = 14/297 (5%)
 Frame = -1

Query  1043  RERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVV  864
             R+R  VCV   +   G  L+ +LL RGY+V A    +   E    L R     Q   +  
Sbjct  8     RDRNTVCVMDASRRLGVSLVERLLRRGYVVHAATYGR---ESSGSLRRLFGENQRLKLFH  64

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
             A   D   + +A +GC  +F+T    +P     Y E +  +E  +A NV+EAC++     
Sbjct  65    ADPFDYQSIVDAMKGCAGLFYT---FEPPQDQSYDEFLVEVEVRSAHNVLEACAQVETME  121

Query  683   RCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETK  504
             R +FTSS+ A +WK N     D DE  W++ +FCR+ KLW ALAKT AEK AW  AM+  
Sbjct  122   RAVFTSSVTAVVWKENRKAAADFDEREWSEPNFCRKYKLWHALAKTVAEKTAWALAMDRG  181

Query  503   VKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMD  324
             V +V V   L++      AD   + PY+KG   M   GVL T DVD   +AHV VYE   
Sbjct  182   VDMVCVNAGLLLVA----ADLSVADPYMKGAAQMYEDGVLVTVDVDFLVDAHVAVYETP-  236

Query  323   YGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESG--EIPARLCKSKLTRLLF  159
               A GRYLCF   +  P DAV LE  L       A   G      R+   KL +++ 
Sbjct  237   -SAYGRYLCFNGAVCHPHDAVKLERLLSHDAAQPASSDGLTATQQRIQNKKLNQVMI  292



>ref|XP_002319253.1| hypothetical protein POPTR_0013s07700g [Populus trichocarpa]
 gb|EEE95176.1| hypothetical protein POPTR_0013s07700g [Populus trichocarpa]
Length=306

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 112/303 (37%), Positives = 155/303 (51%), Gaps = 16/303 (5%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARM  855
             K VCV   +   G+ ++ +LL RGY V A +QNQ    +  E L     K    V  +  
Sbjct  12    KTVCVMDASGPLGSSIVHRLLQRGYSVHAAVQNQGKLWQSFEGLSCNNEKL--KVFHSDP  69

Query  854   TDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCI  675
              D   + +A +GC  +F+  SF  P     Y E MA +E  AA NV+EAC++T    + +
Sbjct  70    FDYHSIMDALKGCCGLFY--SFEPPSDQPTYDEFMADVEVRAAHNVLEACAQTNTIDKVV  127

Query  674   FTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENK-LWFALAKTRAEKVAWRKAMETKVK  498
             FTSS    IW  ++ +  DLDE +W+D +FCR+ K LW AL+KT AEK AW  AM+  + 
Sbjct  128   FTSSATTVIWNDSHRKAPDLDERNWSDLNFCRKFKQLWQALSKTLAEKTAWALAMDRSIN  187

Query  497   LVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYG  318
             +VTV   L+M+P    A+     PYLKG   M   GV  T D+    + H+ V+E  D  
Sbjct  188   MVTVNGGLLMSPDLTIAN-----PYLKGAAEMYEDGVFVTVDLRFIVDTHIHVFE--DIT  240

Query  317   ACGRYLCFGRTITTPEDAVLLENRL---KMQGLLSAYESGEI-PARLCKSKLTRLLFHTA  150
             + GRYLCF   I   EDAV L N L       L  + E   I   R+   KL +L+    
Sbjct  241   SYGRYLCFNHVIKCNEDAVKLANTLLPPSESSLPQSLEDTRIHQQRISNKKLNKLMVDFD  300

Query  149   RRL  141
              +L
Sbjct  301   SKL  303



>ref|XP_007209388.1| hypothetical protein PRUPE_ppa009107mg [Prunus persica]
 gb|EMJ10587.1| hypothetical protein PRUPE_ppa009107mg [Prunus persica]
Length=306

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 107/297 (36%), Positives = 149/297 (50%), Gaps = 23/297 (8%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTD  849
             VCV   + + G  L  +LL RGY V A +Q+  +      L      K+   V      D
Sbjct  15    VCVMDASGHVGTTLTERLLQRGYTVHAALQSHGE----SRLGELSCDKKKLKVFNLDPFD  70

Query  848   LDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFT  669
                + +A +GC  +F+  +F  P     Y E MA +E  AA NV+EAC++T    + +FT
Sbjct  71    YQSILDALKGCSGLFY--AFEPPQDQPNYDEYMAEVEVRAAHNVLEACARTETVDKVVFT  128

Query  668   SSLLASIWKGNNHEHD-DLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLV  492
             SS  A +W+ +      +LDE  WTD +FCR  KLW AL+KT AEK AW  AM+  + +V
Sbjct  129   SSATAVVWRNDRKSMALELDERHWTDVNFCRNFKLWHALSKTLAEKTAWALAMDRSLNMV  188

Query  491   TVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGAC  312
             +V   L+M P     D   + PY+KG   M   GVL T DVD   +AH+ V+E  D  + 
Sbjct  189   SVNAGLLMGP-----DLSITNPYMKGAAEMYEDGVLVTVDVDFLVDAHICVFE--DVSSY  241

Query  311   GRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGE-------IPARLCKSKLTRLL  162
             GRYLCF   I   EDAV L  +L       +Y   +       I  R+   KL +L+
Sbjct  242   GRYLCFNNIINRSEDAVELARKLTTSA--PSYPKSQDQDDMMIIQQRISNKKLNKLM  296



>gb|KHN23531.1| Anthocyanidin reductase, partial [Glycine soja]
Length=220

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 112/181 (62%), Gaps = 2/181 (1%)
 Frame = -1

Query  773  ISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTSSLLASIWKGNNHEH--DDLDESSW  600
            +S   + MA +E  AA NV+EAC++T    RC+FTSSL A +W+ N+       ++ +SW
Sbjct  1    LSDIQKSMAEIEVRAAENVMEACARTPSITRCVFTSSLSACVWQDNSQSDFTPVINHASW  60

Query  599  TDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYL  420
            + E FC E KLW+AL K RAEK AWR + E  +KL T+CPAL+  P F H +  +++ YL
Sbjct  61   STESFCIEKKLWYALGKMRAEKAAWRISNERGLKLTTICPALITGPEFCHRNPTATIAYL  120

Query  419  KGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLK  240
            KG Q M  QG LA+ DV K AEAH  V++ M+  A GRY+CF   I T  +A  L   + 
Sbjct  121  KGAQEMYSQGFLASVDVTKLAEAHASVFKAMNNEASGRYICFDHVIDTHSEAEKLAKDIG  180

Query  239  M  237
            M
Sbjct  181  M  181



>gb|AFK39509.1| unknown [Lotus japonicus]
Length=300

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 106/296 (36%), Positives = 151/296 (51%), Gaps = 19/296 (6%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQN-QVDFeemkellreeemkqlESVVVARMT  852
             VCV   +   G  L++KLL RGY V A+IQ   VD    +             V  +   
Sbjct  12    VCVMDASGQLGFRLVQKLLQRGYTVHASIQKYGVD---KEMFNEISADSDKLKVFRSDPF  68

Query  851   DLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIF  672
             D   L +A +GC  +F+T  F  P     Y E MA +E  AA NV+EAC++T    + +F
Sbjct  69    DYHSLIDALKGCSGLFYT--FEPPFDQPDYDEFMADVEVRAAHNVLEACAQTETMDKVVF  126

Query  671   TSSLLASIWKGNNHEHD-DLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKL  495
             TS+  A++W+ +    + DLDE  W+D +FCR+ KLW  ++KT AEK AW  AM+  V +
Sbjct  127   TSAATATVWREDRKTMELDLDERHWSDVNFCRKFKLWHGMSKTLAEKTAWALAMDRGVNM  186

Query  494   VTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGA  315
             V++   L M+      D     PYL+G   M   GV  T D++   +AH+ VYE  D  +
Sbjct  187   VSINSGLGMS-----HDLSIKNPYLRGAAEMYEDGVFVTVDLEFLVDAHICVYE--DVSS  239

Query  314   CGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGE-----IPARLCKSKLTRLL  162
              GRYLCF   I T +DAV L  +L      S  +S +     I  R+   KL +L+
Sbjct  240   YGRYLCFNHIINTQDDAVQLARKLTPAASSSMPQSDDHGKSFIEQRISNKKLNKLM  295



>ref|XP_011044464.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Populus 
euphratica]
Length=305

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 111/304 (37%), Positives = 155/304 (51%), Gaps = 17/304 (6%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARM  855
             K VCV   +   G+ ++ +LL RGY V A +QN     +  E L   +      +  +  
Sbjct  12    KTVCVMDASGCLGSSIVHRLLQRGYSVHAAVQNHGKLWQSFEGLSCNKKNL--KIFHSDP  69

Query  854   TDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCI  675
              D   + +A +GC  +F+  SF  P     Y E MA +E  AA NV+EAC++T    + +
Sbjct  70    FDYHSIMDALKGCCGLFY--SFEPPSDQPTYDEFMADVEVRAAHNVLEACAQTNTIDKVV  127

Query  674   FTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKL  495
             FTSS    IW  ++ +  DLDE +W+D +FCR+ KLW AL+KT AEK AW  AM+  + +
Sbjct  128   FTSSATTVIWNDSHRKAPDLDERNWSDLNFCRKFKLWQALSKTLAEKTAWALAMDRSINM  187

Query  494   VTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGA  315
             VTV   L+M+P     D   S PYLKG   M   GV  T D+    + H+ V+E  D  +
Sbjct  188   VTVNGGLLMSP-----DLTISNPYLKGAAEMYEDGVFVTVDLRFIVDTHIHVFE--DATS  240

Query  314   CGRYLCFGRTITTPEDAVLLENRL---KMQGLLSAYESGEI-PARLCKSKLTRLL--FHT  153
              GRYLCF   I    DAV L N L       L  + E   I   R+   KL +L+  F T
Sbjct  241   YGRYLCFNHVIKCNGDAVKLANMLLPPSESSLPQSLEDTRIHQQRISNKKLNKLMVDFDT  300

Query  152   ARRL  141
               R+
Sbjct  301   KLRV  304



>gb|EPS68267.1| hypothetical protein M569_06505, partial [Genlisea aurea]
Length=307

 Score =   166 bits (419),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 104/264 (39%), Positives = 149/264 (56%), Gaps = 20/264 (8%)
 Frame = -1

Query  1031  LVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMT  852
             LVCVTSG SY G  ++ +L  RGY VR  + N+ D E++ E+     +     + VA+  
Sbjct  27    LVCVTSGVSYLGMAIVNQLRFRGYSVRIIVDNEEDLEKLTEIDGGAGV----ELAVAKFG  82

Query  851   DLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIF  672
             D++ L  AF G  AVFHT+ F+DP GISGYT+ M  +E +   NV+ A   +   R C+ 
Sbjct  83    DVESLVRAFHGAVAVFHTAGFVDPSGISGYTKSMVEVEVKGTENVMRASEMSGSVRYCVL  142

Query  671   TSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLV  492
             TSSL+A +W+ ++     +D +SW+D  +C   KLW+AL K + EK A   A +  +KL 
Sbjct  143   TSSLVACVWR-DDDRRIIIDHNSWSDHSYCAAKKLWYALGKLKMEKAATEMAQQLGLKLG  201

Query  491   TVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVL-ATEDVDKAAEAHVFVYEEM----  327
             T+C  L+     PH     S+ YLKG + M  +GV+ A +DV   AEAH  V+EEM    
Sbjct  202   TICCGLI--RDGPH-----SIAYLKGAREMYARGVVAAVDDVRTLAEAHALVFEEMKKKK  254

Query  326   DYGACGRYLCFGRTITTPEDAVLL  255
             +    GRY+ + R I   ED V L
Sbjct  255   NGSGSGRYVWYDRVI---EDDVEL  275



>ref|XP_003553821.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Glycine 
max]
Length=213

 Score =   162 bits (410),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 109/174 (63%), Gaps = 2/174 (1%)
 Frame = -1

Query  752  MAFLETEAAGNVIEACSKTAYARRCIFTSSLLASIWKGNNHEH--DDLDESSWTDEDFCR  579
            MA +E  AA NV+EAC++T    RC+FTSSL A +W+ N+       ++ +SW+ E FC 
Sbjct  1    MAEIEVRAAENVMEACARTPSITRCVFTSSLSACVWQDNSQSDFTPVINHASWSTESFCI  60

Query  578  ENKLWFALAKTRAEKVAWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVML  399
            E KLW+AL K RAEK AWR + E  +KL T+CPAL+  P F H +  +++ YLKG Q M 
Sbjct  61   EKKLWYALGKMRAEKAAWRISNERGLKLTTICPALITGPEFCHRNPTATIAYLKGAQEMY  120

Query  398  RQGVLATEDVDKAAEAHVFVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLKM  237
             QG LA+ DV K AEAH  V++ M+  A GRY+CF   I T  +A  L   + M
Sbjct  121  SQGFLASVDVTKLAEAHASVFKAMNNEASGRYICFDHVIDTHSEAEKLAKDIGM  174



>ref|XP_009600266.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Nicotiana tomentosiformis]
Length=317

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 111/297 (37%), Positives = 154/297 (52%), Gaps = 22/297 (7%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTD  849
             +CV   +S  G  L+++LL RGY V A +QN  +   +     E + K+   +  +   D
Sbjct  13    ICVMDASSRLGTKLVKRLLKRGYTVHAAVQNHGE--SLSLKGIECDHKKKLKIFESDPFD  70

Query  848   LDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFT  669
                +  A +GC  +F+  SF        Y E MA +E  AA NV+EAC++T    + +FT
Sbjct  71    YHSILTALKGCSGLFY--SFEPLSDYPTYDEDMAEVEVRAAHNVLEACAQTDTIEKVVFT  128

Query  668   SSLLASIWKGNNHEHDD---LDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVK  498
             SS  A IW G++ E      LDE  WTD +FCR+ KLW A++KT AEK AW  AM+  + 
Sbjct  129   SSATAIIW-GHDKESASTGYLDERHWTDINFCRKFKLWHAMSKTLAEKTAWALAMDRGIN  187

Query  497   LVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYG  318
             +VT+   L+M P     D   S PYLKG   M   GV  T D+D   +AH+ VYEE+   
Sbjct  188   MVTINAGLLMGP-----DLTISNPYLKGAAEMYEDGVFVTVDLDFLVDAHICVYEEI--A  240

Query  317   ACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGE-----IPARLCKSKLTRLL  162
               GRYLCF   I   +DA  L   L    L S+ +S E     I  R+   KL +L+
Sbjct  241   TYGRYLCFNHIINQQQDAFHLAKML--SPLPSSPQSMENDTRIIQQRISNKKLNKLM  295



>ref|XP_006385669.1| hypothetical protein POPTR_0003s09250g [Populus trichocarpa]
 gb|ERP63466.1| hypothetical protein POPTR_0003s09250g [Populus trichocarpa]
Length=281

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 102/263 (39%), Positives = 138/263 (52%), Gaps = 13/263 (5%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTD  849
             VCV   +   G  L+ +LL RGY V A +QN    +   +       K+   ++ A   D
Sbjct  13    VCVMDASGSLGFSLVERLLQRGYTVHAAVQNH---DCELQFGGLSCDKKKLKILYADPFD  69

Query  848   LDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFT  669
                + +A RGC  VF+  +F  P   S Y E M  +E  AA NV+EAC++T    + +FT
Sbjct  70    YKSIIDALRGCCGVFY--NFEPPQDQSSYDEFMTEVEVRAAHNVLEACAQTETIDKVVFT  127

Query  668   SSLLASIWKGNNHE-HDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLV  492
             SS  A IW+ +      D DE  W+D +FCR+ KLW AL+KT AEK AW  AM+  V +V
Sbjct  128   SSATAVIWRDDRKSITADFDERHWSDINFCRKFKLWHALSKTLAEKTAWALAMDRGVNMV  187

Query  491   TVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGAC  312
             +V   LVM+P     D     PYLKG   M   GV  T  ++   +AHV +YE  D  + 
Sbjct  188   SVNAGLVMSP-----DLSIKNPYLKGAAEMYEDGVFVTVGLNFLVDAHVCIYE--DVSSY  240

Query  311   GRYLCFGRTITTPEDAVLLENRL  243
             GRYLCF   +   EDAV L + L
Sbjct  241   GRYLCFNHVVNQHEDAVKLASML  263



>ref|XP_002304342.2| hypothetical protein POPTR_0003s09250g [Populus trichocarpa]
 gb|EEE79321.2| hypothetical protein POPTR_0003s09250g [Populus trichocarpa]
Length=305

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/263 (39%), Positives = 138/263 (52%), Gaps = 13/263 (5%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTD  849
             VCV   +   G  L+ +LL RGY V A +QN    +   +       K+   ++ A   D
Sbjct  13    VCVMDASGSLGFSLVERLLQRGYTVHAAVQNH---DCELQFGGLSCDKKKLKILYADPFD  69

Query  848   LDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFT  669
                + +A RGC  VF+  +F  P   S Y E M  +E  AA NV+EAC++T    + +FT
Sbjct  70    YKSIIDALRGCCGVFY--NFEPPQDQSSYDEFMTEVEVRAAHNVLEACAQTETIDKVVFT  127

Query  668   SSLLASIWKGNNHE-HDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLV  492
             SS  A IW+ +      D DE  W+D +FCR+ KLW AL+KT AEK AW  AM+  V +V
Sbjct  128   SSATAVIWRDDRKSITADFDERHWSDINFCRKFKLWHALSKTLAEKTAWALAMDRGVNMV  187

Query  491   TVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGAC  312
             +V   LVM+P     D     PYLKG   M   GV  T  ++   +AHV +YE  D  + 
Sbjct  188   SVNAGLVMSP-----DLSIKNPYLKGAAEMYEDGVFVTVGLNFLVDAHVCIYE--DVSSY  240

Query  311   GRYLCFGRTITTPEDAVLLENRL  243
             GRYLCF   +   EDAV L + L
Sbjct  241   GRYLCFNHVVNQHEDAVKLASML  263



>ref|XP_004146663.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Cucumis sativus]
Length=306

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 104/306 (34%), Positives = 162/306 (53%), Gaps = 20/306 (7%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTD  849
             +CV   +SY G  + + LL +GY V A +QN    E  K +    E++   +V    + D
Sbjct  8     LCVLDASSYVGFWVTKGLLNKGYPVHAAVQNTGKPEIEKTIREMGEVENGLAVFSVDIMD  67

Query  848   LDCLCEAFRGCHAVFHTSSFIDPHGI-----SGYT--ERMAFLETEAAGNVIEACSKTAY  690
                +  A +GC  +F     +D H +      GY   E+M  LE     NV+EAC++T  
Sbjct  68    YQSILVALKGCSGLF---CCMDTHHVYDVRFVGYCCFEKMVDLEVRGTINVVEACAQTDS  124

Query  689   ARRCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAME  510
               + +FTSSL A++W+ N     D+DE  W+D++FCR+ KLW+ LAKT +E+ AW  AM+
Sbjct  125   VEKIVFTSSLTAAVWRENILSEKDVDERCWSDKEFCRKMKLWYPLAKTLSEQAAWALAMD  184

Query  509   TKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEE  330
              ++K+V++   LV+ P+    ++ S++ YLKG   M   GVLA  DV    + H+   E+
Sbjct  185   RRLKMVSINAGLVLGPAVAEENSGSTISYLKGAAQMYENGVLAVVDVKFLVDVHIRAMED  244

Query  329   MDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGEIPA------RLCKSKLTR  168
                G  GRY CF + + + E+ V L N L+   L+S  +  E+        RL   KL +
Sbjct  245   SSTG--GRYFCFDQIVNSEEETVKLANILR--PLISIPQRYEVQGREAFAERLRTRKLHK  300

Query  167   LLFHTA  150
             L+  TA
Sbjct  301   LIEGTA  306



>ref|XP_008238223.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Prunus mume]
Length=306

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 107/297 (36%), Positives = 149/297 (50%), Gaps = 23/297 (8%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTD  849
             VCV   + + G  L  +LL RGY V A +Q+  +      L      K+   V      D
Sbjct  15    VCVMDASGHVGTTLTERLLQRGYTVHAALQSHGE----SRLGELSCDKKKLKVFNLDPFD  70

Query  848   LDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFT  669
                + +A +GC  +F+  +F  P     Y E MA +E  AA NV+EAC++T    + +FT
Sbjct  71    YQSILDALKGCSGLFY--AFEPPPDQPNYDEYMAEVEVRAAHNVLEACARTETIDKVVFT  128

Query  668   SSLLASIWKGNNHEHD-DLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLV  492
             SS  A +W+ +      +LDE  WTD +FCR  KLW AL+KT AEK AW  AM+  + +V
Sbjct  129   SSATAVVWRSDRKSMTLELDERHWTDVNFCRNFKLWHALSKTLAEKTAWALAMDRSLNMV  188

Query  491   TVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGAC  312
             +V   L+M P     D   + PY+KG   M   GVL T DVD   +AH+ V+E  D  + 
Sbjct  189   SVNAGLLMGP-----DLSITNPYMKGAAEMYEDGVLVTVDVDFFVDAHICVFE--DVSSY  241

Query  311   GRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGE-------IPARLCKSKLTRLL  162
             GRYLCF   I   EDAV L  +L       +Y   +       I  R+   KL +L+
Sbjct  242   GRYLCFNNIINRSEDAVELARKLTPSA--PSYPKSQDQDDMMIIQQRISNKKLNKLM  296



>ref|XP_009399410.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Musa acuminata subsp. 
malaccensis]
Length=311

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 115/307 (37%), Positives = 151/307 (49%), Gaps = 16/307 (5%)
 Frame = -1

Query  1043  RERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATI-QNQVDFeemkellreeemkqlESVV  867
             R+ K VCV   +   GA L+  LL RGY V AT   +          L+  E  Q     
Sbjct  8     RDPKTVCVMDASCRLGASLVEALLRRGYTVHATAYASSHGKLNDLRRLQSGENTQQLRCF  67

Query  866   VARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYA  687
              A   D   L +A +GC  +F+   F  PH    Y E M  +E  AA NV+EAC++T   
Sbjct  68    RADPFDYQSLVDAMKGCWGLFYV--FEPPHD-QPYDECMVEVEVRAAHNVLEACAQTETM  124

Query  686   RRCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMET  507
              R +FTSS+ A IWK        +DE  W++ +FCR  KLW AL KT AEK AW  AM+ 
Sbjct  125   ERVVFTSSVTAVIWKEERRSTATVDERDWSEPNFCRGFKLWHALGKTLAEKTAWALAMDR  184

Query  506   KVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEM  327
              V++++V  AL   P     +     PYLKG   M   GVL T DV    +AHV VYE  
Sbjct  185   GVEMISVNAALPTGPQLSVTN-----PYLKGAAEMYEDGVLVTVDVQLLVDAHVAVYESP  239

Query  326   DYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGE---IPARLCKSKLTRLL--  162
                A GRY+CFG  +  P+DAV L   L      +   S E   I  R+   KL++L+  
Sbjct  240   --SAYGRYICFGDAVCRPQDAVKLARMLSPNSSCAPPPSDELRVIEQRIQNKKLSKLMVS  297

Query  161   FHTARRL  141
             F+  R +
Sbjct  298   FYAGRHV  304



>emb|CDP13048.1| unnamed protein product [Coffea canephora]
Length=293

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 102/253 (40%), Positives = 138/253 (55%), Gaps = 18/253 (7%)
 Frame = -1

Query  1001  FGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTDLDCLCEAFR  822
              G+ L+ +LL RGY V A +Q + D      L  +++      V  +   D   + +A +
Sbjct  7     LGSTLVDRLLKRGYTVHAAVQTEGDLASFSGLANDKKNL---KVFHSDPFDYHSVVDALK  63

Query  821   GCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTSSLLASIWK  642
             GC  +F+T  F  P   S Y E M  +E  AA NV+EAC +T    + +FTSS  A IW+
Sbjct  64    GCSCLFYT--FEPPQDHSIYDENMVEVEVRAAHNVVEACDQTDTMEKVVFTSSATAVIWR  121

Query  641   GNNHEHDD----LDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTVCPAL  474
               +H+  D    LDE SW++ +FCR+ KLW AL+KT AEK AW  AM+  V +V++   L
Sbjct  122   --DHQISDSSAELDEKSWSEINFCRKFKLWHALSKTLAEKTAWALAMDRGVSMVSINAGL  179

Query  473   VMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGRYLCF  294
             +MAP     D     PYLKG   M   G+LAT D+D   +AH+ V E  D    GRYLCF
Sbjct  180   LMAP-----DLSIRNPYLKGAAEMYENGLLATVDLDFLVDAHICVSE--DISTYGRYLCF  232

Query  293   GRTITTPEDAVLL  255
                IT  EDAV L
Sbjct  233   NHVITNTEDAVKL  245



>ref|XP_004148082.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Cucumis sativus]
 ref|XP_004166239.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Cucumis sativus]
 gb|KGN63418.1| hypothetical protein Csa_2G441240 [Cucumis sativus]
Length=298

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 102/265 (38%), Positives = 144/265 (54%), Gaps = 16/265 (6%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARM  855
             K VCV   +S  G+ L+  LL RGY V A++QN  D + +K    +        V  + +
Sbjct  6     KTVCVMDASSRVGSALVAALLHRGYTVHASLQNHDDLQCVKGNANKL------KVFRSDL  59

Query  854   TDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCI  675
              D   +  A +GC A+F+  SF  P   S Y E M  +E  AA NV+EAC++T    + I
Sbjct  60    LDYHSIMIALKGCSALFY--SFQPPPDHSTYDELMVEIEVRAAHNVLEACAQTETMEKVI  117

Query  674   FTSSLLASIWK-GNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVK  498
             FTSS+ A IW+ G      D+DE  W+D + C++ KLW AL+KT AEK AW  AM+  V 
Sbjct  118   FTSSITAVIWRDGLKTMSSDVDERHWSDVNLCKKFKLWHALSKTVAEKTAWALAMDRGVN  177

Query  497   LVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYG  318
             +V++   LVM       D   + PYLKG   M   GVL T D+    +AH+ V+E  D  
Sbjct  178   MVSINGGLVMG-----HDVTMNNPYLKGAAEMYEDGVLVTVDLKFIVDAHICVFE--DVS  230

Query  317   ACGRYLCFGRTITTPEDAVLLENRL  243
             + GRYLCF   I + ++A+ L + L
Sbjct  231   SYGRYLCFNNIINSHKEALRLAHML  255



>ref|XP_004245905.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like isoform 
X1 [Solanum lycopersicum]
Length=319

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 114/318 (36%), Positives = 160/318 (50%), Gaps = 37/318 (12%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMT-  852
             VCV   ++  G+ L+++LL  GY V A IQN         +      + L++  + R+  
Sbjct  14    VCVMDASTRLGSSLVKRLLTNGYTVHAAIQN---------IHNGGHGEFLDACDMKRLKN  64

Query  851   ------DLDCLCEAFRGCHAVFHTSSFIDPHGIS-GYTERMAFLETEAAGNVIEACSKTA  693
                   D   + +A +GC  +F+  SF  P   S  Y E +  +E  AA NV+EAC++T 
Sbjct  65    FHLDPFDYHSIIDALKGCSGLFY--SFEPPKDQSCTYDEYIGEVEVRAAHNVVEACAQTD  122

Query  692   YARRCIFTSSLLASIWKGNNHEHDD------LDESSWTDEDFCRENKLWFALAKTRAEKV  531
                + +FTSS  A IW   +HE+D       LDE  W+D + CR+ KLW AL+KT AEK 
Sbjct  123   TIEKVVFTSSATAIIW--GHHENDQNSASMLLDERHWSDINVCRKFKLWHALSKTLAEKT  180

Query  530   AWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEA  351
             AW  AM+  V +V+V   L+M P     D     PYLKG   M   GV  T D+D   EA
Sbjct  181   AWALAMDRGVNMVSVNAGLLMGP-----DLTIKNPYLKGAAEMYEDGVFVTVDLDFLVEA  235

Query  350   HVFVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLK-MQGLLSAYESGE--IPARLCKS  180
             H+ VYE++     GRYLCF   I   EDA+ L N L  M     + ES    I  R+   
Sbjct  236   HICVYEQI--STYGRYLCFNHIINQTEDALKLANMLSPMPSSPQSMESDTRIIQERISNK  293

Query  179   KLTRLLFHTARRLSCKHR  126
             KL +L+     +++ K R
Sbjct  294   KLNKLMIECQPQINGKSR  311



>gb|AIX92149.1| cinnamoyl-CoA reductase 1 [Betula platyphylla]
Length=449

 Score =   167 bits (422),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 95/244 (39%), Positives = 141/244 (58%), Gaps = 8/244 (3%)
 Frame = -1

Query  872  VVVARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTA  693
            V  A + D   +  A +GC A+F      D  G  GY +++  LE   A NV+EAC++T 
Sbjct  208  VFSADVLDYHSILVALKGCSALFCCLDGSD--GSDGYDDKIVDLEVRGAINVVEACAQTE  265

Query  692  YARRCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAM  513
               + +FTSSL A+IW+ N     D+DE SW+D++FCR+ KLW+ALAKT +E+ AW  AM
Sbjct  266  NFEKIVFTSSLTAAIWRENICTEKDVDERSWSDQEFCRKMKLWYALAKTLSEQAAWALAM  325

Query  512  ETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYE  333
            +  + +V++   LV+ PS    ++ S++ YL+G   M   GVLA+ DV+   + H+  +E
Sbjct  326  DRMLNMVSINAGLVVGPSVTQQNSSSTMSYLQGAAQMYENGVLASVDVNFLVDIHIRAFE  385

Query  332  EMDYGACGRYLCFGRTITTPEDAVLLENRLK-MQGLLSAYE--SGEIPA-RLCKSKLTRL  165
              D+  CGRY CF RT+ T ++AV L   L  +  L   YE    E+ A RL   KL +L
Sbjct  386  --DHSTCGRYFCFNRTVHTEDEAVKLAQSLSPLISLPPRYECQGSEVYAERLRTKKLNKL  443

Query  164  LFHT  153
            +  T
Sbjct  444  IEGT  447


 Score =   127 bits (319),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 76/240 (32%), Positives = 126/240 (53%), Gaps = 27/240 (11%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVA  861
             E+  VCV   +SY G   I+K +     +   ++                      V  A
Sbjct  4     EKTTVCVLDASSYVGETEIQKKIRNMERIEERLE----------------------VFSA  41

Query  860   RMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARR  681
              + D   +  A +GC A+F      D  G  GY +++  LE   A NV+EAC++T    +
Sbjct  42    DVLDYHSILVALKGCSALFCCLDGSD--GSDGYDDKIVDLEVRGAINVVEACAQTENFEK  99

Query  680   CIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKV  501
              +FTSSL A+IW+ N     D+DE SW+D++FCR+ KLW+ALAKT +E+ AW  AM+  +
Sbjct  100   IVFTSSLTAAIWRENICTEKDVDERSWSDQEFCRKMKLWYALAKTLSEQAAWALAMDRML  159

Query  500   KLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDY  321
              +V++   LV+ PS    ++ S++ YL+ G+  +++ +   E +++  E  VF  + +DY
Sbjct  160   NMVSINAGLVVGPSVTQQNSSSTMSYLQ-GETEIQKKIRNMERIEERLE--VFSADVLDY  216



>ref|XP_007158289.1| hypothetical protein PHAVU_002G140100g [Phaseolus vulgaris]
 gb|ESW30283.1| hypothetical protein PHAVU_002G140100g [Phaseolus vulgaris]
Length=307

 Score =   164 bits (414),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 96/263 (37%), Positives = 138/263 (52%), Gaps = 13/263 (5%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTD  849
             VCV   + + G  ++++LL RGY V A++Q      +               +  +   D
Sbjct  12    VCVMDASGHLGFSIVQRLLQRGYTVHASLQKH---GKEDMFNGISTDSNKLKLFRSDPFD  68

Query  848   LDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFT  669
                + EA RGC  +F+T  F  PH    + E MA +E  AA NV+EAC++T    + +FT
Sbjct  69    YPSIIEALRGCSGLFYT--FEPPHDQPNHDEYMADVEVRAAHNVLEACAQTETIDKVVFT  126

Query  668   SSLLASIWKGNNHEHD-DLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLV  492
             SS  A +W+ +    + DLDE  W+D +FCR+ KLW  ++KT AEK AW  AM+  V +V
Sbjct  127   SSATAVVWREDRKTMELDLDERHWSDVNFCRKFKLWHGVSKTMAEKSAWALAMDRGVNMV  186

Query  491   TVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGAC  312
             ++   L+M       D     PYL+G   M   GV  T D+    +AH+ VYEE+   + 
Sbjct  187   SINAGLLMT-----HDLSIKHPYLRGAAEMYEDGVFVTVDLPFLVDAHICVYEEV--SSY  239

Query  311   GRYLCFGRTITTPEDAVLLENRL  243
             GRYLCF   I T EDAV L  +L
Sbjct  240   GRYLCFNHIINTHEDAVQLAQKL  262



>ref|XP_007029640.1| NAD(P)-binding Rossmann-fold superfamily protein, putative [Theobroma 
cacao]
 gb|EOY10142.1| NAD(P)-binding Rossmann-fold superfamily protein, putative [Theobroma 
cacao]
Length=302

 Score =   162 bits (411),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 101/258 (39%), Positives = 137/258 (53%), Gaps = 13/258 (5%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARM  855
             + VCV   + + G+ L+  LL RGY V A +Q+  +F+    L    E      V  A +
Sbjct  8     RAVCVMDASGHLGSALVHLLLHRGYTVHAAVQHHGEFQSFGGLPCSNEKL---KVFHADL  64

Query  854   TDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCI  675
              D   +  A  GC  +F+   F  P   S Y E MA +E  AA NV+EAC++T    + +
Sbjct  65    FDYHSITNALEGCCGLFYC--FEPPSDHSTYDEFMAEVEVRAAHNVLEACARTDTVEKVV  122

Query  674   FTSSLLASIWKG-NNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVK  498
             FTSS+ A IW    N    DLDE +W+D +FC++ KLW AL+KT AEK AW  AM+  + 
Sbjct  123   FTSSVTAVIWNEVRNTSSTDLDERNWSDINFCKKFKLWHALSKTLAEKSAWALAMDRGIN  182

Query  497   LVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYG  318
             +VT+   L+M P     D   + PYLKG   M   GV  T D+   A+AH+ V+E  D  
Sbjct  183   MVTINAGLLMTP-----DLTITNPYLKGAAEMYEDGVFVTVDLRFIADAHISVFE--DIS  235

Query  317   ACGRYLCFGRTITTPEDA  264
             A GRYLCF   I    DA
Sbjct  236   AYGRYLCFNHVINRSHDA  253



>gb|AIX92145.1| cinnamoyl-CoA reductase 1 [Betula platyphylla]
Length=309

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 147/294 (50%), Gaps = 18/294 (6%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTD  849
             VCV   +   G+ ++ +LL RGY V A +Q+  +     +        +   +  +   D
Sbjct  13    VCVMDASGRLGSSIVERLLQRGYTVHAAVQHHDE----SQFSGLSCDDKKLKIFRSDPFD  68

Query  848   LDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFT  669
                +  A +GC  +F+T  F  P     Y E M  +E  AA NV+EAC++T    + +FT
Sbjct  69    YQSIIHALKGCSGLFYT--FEPPQDQPAYDEFMLEVEVRAAHNVLEACAQTETIDKVVFT  126

Query  668   SSLLASIWKGNNHEHD-DLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLV  492
             SS+ A++W+ +    + DLDE  W+D +FCR+ KLW AL+KT AEK AW   M+  V +V
Sbjct  127   SSVTAAVWRDDRKSMESDLDERHWSDVNFCRKFKLWHALSKTLAEKTAWALTMDRGVNMV  186

Query  491   TVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGAC  312
             ++   L+M       D   S PYLKG   M   GV  T D+    +AH+ V+E  D  + 
Sbjct  187   SINAGLLMG-----TDVSISNPYLKGAAEMYEDGVFVTVDLKLLVDAHICVFE--DISSY  239

Query  311   GRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGE----IPARLCKSKLTRLL  162
             GRYLCF   +   EDA+ L   L          + +    IP R+   KL +L+
Sbjct  240   GRYLCFNHVVNRHEDALKLAQMLTPSAPTLPQSNDQDMRIIPQRISNKKLNQLM  293



>ref|XP_010087460.1| hypothetical protein L484_019664 [Morus notabilis]
 gb|EXB29141.1| hypothetical protein L484_019664 [Morus notabilis]
Length=305

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 97/264 (37%), Positives = 143/264 (54%), Gaps = 13/264 (5%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARM  855
             K VCV   + + G+ L+ +LL RGY V A +Q+  ++ +  E L      +   V  + +
Sbjct  5     KTVCVMDASGHLGSSLVYRLLHRGYTVHAALQSHGEWLQPVEDLPFPCNAKRLKVFKSDL  64

Query  854   TDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCI  675
              D   + +A +GC   F+   F  P     Y E MA +E  AA NV+EAC++T   ++ +
Sbjct  65    LDYHSIMDALKGCSGSFYC--FEPPSDHPFYDEFMAEVEVRAAHNVLEACAQTESIQKVV  122

Query  674   FTSSLLASIWKGN----NHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMET  507
             FTSS+ A +W+ +         D DE +WTD +FC++ KLW  L+KT AEK AW  AM+ 
Sbjct  123   FTSSVTAVVWRDDLTSTTSSSCDFDERNWTDINFCKKLKLWHGLSKTLAEKTAWALAMDR  182

Query  506   KVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEM  327
              + +V++   L+M P     +     PYLKG   M   GVL T D+   A+AH+ V+E  
Sbjct  183   GLNMVSINGGLLMGPHLTITN-----PYLKGAAEMYENGVLVTVDLKFIADAHICVFE--  235

Query  326   DYGACGRYLCFGRTITTPEDAVLL  255
             D  A GRYLCF R I   +DA+ L
Sbjct  236   DTAAFGRYLCFDRVINCNQDALEL  259



>gb|AIX92148.1| cinnamoyl-CoA reductase 1 [Betula platyphylla]
Length=281

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 102/268 (38%), Positives = 149/268 (56%), Gaps = 11/268 (4%)
 Frame = -1

Query  1043  RERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVV  864
             +  K VCV   +   G+ L+++LL RGY V A +QN  + +   E+L   E K+L  V  
Sbjct  8     QNSKTVCVMDASGRLGSALVQQLLHRGYTVHAAVQNHGELQSFGEVLNCSEQKKL-RVFH  66

Query  863   ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYAR  684
             +   +   + +A +GC A+F+T  F  P     Y E MA +E  AA NV+EAC++T    
Sbjct  67    SDHLEYHSIMDALKGCSALFYT--FEPPPDQPTYDEFMAEVEVRAAHNVLEACAQTETID  124

Query  683   RCIFTSSLLASIWK-GNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMET  507
             + +FTSS+ A +W+ G +    D+DE  W+D + C++ KLW AL+KT AEK AW  AM+ 
Sbjct  125   KVVFTSSVTAVVWRDGLSTMSSDVDERHWSDINLCKKYKLWHALSKTLAEKTAWALAMDR  184

Query  506   KVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEM  327
              V +V++   L+M P     D   + PYLKG   M   GV  T D+    +AH+ V+E  
Sbjct  185   GVNMVSINGGLLMGP-----DLTITNPYLKGAAEMYTDGVFVTVDLKVIVDAHIRVFE--  237

Query  326   DYGACGRYLCFGRTITTPEDAVLLENRL  243
             D  + GRYLCF   I   +DAV L + L
Sbjct  238   DVSSYGRYLCFNHVINCNKDAVKLAHML  265



>gb|EPS59154.1| hypothetical protein M569_15655, partial [Genlisea aurea]
Length=290

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 105/298 (35%), Positives = 152/298 (51%), Gaps = 19/298 (6%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTD  849
             VCV   +   GA L+R+LL+ GY V A + NQ + +  +    E    +   V  +   D
Sbjct  2     VCVMDASGRLGAALVRRLLLGGYAVHAAVNNQGELQRYEMESSENSRLR---VFHSDPLD  58

Query  848   LDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFT  669
                + +A RGC A+F+  SF  P   S Y E M   E  AA NV+EAC++T    + +FT
Sbjct  59    YHSIIDALRGCSALFY--SFEPPADHSTYDEFMTESEVRAAHNVLEACAQTDTIDKVVFT  116

Query  668   SSLLASIWKGNNH----EHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKV  501
             SS  A IWK + H      D +DE  W+D + CR+ KLW+ L+KT AEK AW  AM+  V
Sbjct  117   SSATAVIWKDHRHRPPSSDDVIDEKIWSDVNLCRKFKLWYGLSKTVAEKTAWALAMDRGV  176

Query  500   KLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDY  321
              +V++   LVM P     D     PYL G + M   GV  T D+    +AH+ ++E  D 
Sbjct  177   NMVSINAGLVMRPDLSIKD-----PYLLGAEDMFNNGVFVTVDLKFLVDAHMCIFE--DP  229

Query  320   GACGRYLCFGRTITTPEDAV-LLENRLKMQGLLSAYESGE--IPARLCKSKLTRLLFH  156
              + GRYLCF   + + +D V L E  +      +     E     R+  +KL++L+ H
Sbjct  230   SSYGRYLCFNHAMNSTKDVVNLAETLIPPSSTPNTLLDDERVCRQRISNAKLSKLMKH  287



>ref|XP_006474079.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X2 [Citrus 
sinensis]
Length=301

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/262 (35%), Positives = 149/262 (57%), Gaps = 9/262 (3%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTD  849
             VCV   ++Y G  ++++LL +GY V A IQ   +    K++   E++++   +    + D
Sbjct  10    VCVLDASTYVGFWILKRLLNKGYFVHAAIQKNGEKAIEKQIKEMEKVEEKLVLFNVDVLD  69

Query  848   LDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFT  669
                +  A + C A+F      D     GY ++M  LE   A NV+EAC++T   ++ +F+
Sbjct  70    YQSILVALKDCCALFCCLDSPD-----GYDDKMVDLEVRGAINVVEACAQTDSIQKLVFS  124

Query  668   SSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVT  489
             SSL A+IW+ +     D+DE SW+++DFCR+ KLW+ALAKT +E+ AW  AM+  + +V+
Sbjct  125   SSLTAAIWREDICSEKDVDERSWSNQDFCRKLKLWYALAKTLSEQAAWALAMDRLLCMVS  184

Query  488   VCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACG  309
             +   LV+ P+    + +S++ YLK    M   GVLA  DV+  A+ H+ V+E  D    G
Sbjct  185   INAGLVLGPAVTQQNPQSTMFYLKAQ--MYENGVLAFVDVNFLADVHIRVFE--DRSTSG  240

Query  308   RYLCFGRTITTPEDAVLLENRL  243
             RY CF + + T E+A  L   L
Sbjct  241   RYFCFNQIVNTEEEAFKLAQSL  262



>ref|XP_006352866.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like isoform 
X1 [Solanum tuberosum]
Length=319

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 115/320 (36%), Positives = 161/320 (50%), Gaps = 41/320 (13%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMT-  852
             VCV   ++  G+ L+++LL  GY V A  QN         +      + L++  + R+  
Sbjct  14    VCVMDASTRLGSSLVKRLLTNGYTVHAATQN---------IHNGGHGEFLDACDMKRIKN  64

Query  851   ------DLDCLCEAFRGCHAVFHTSSFIDPHGIS-GYTERMAFLETEAAGNVIEACSKTA  693
                   D   + +A +GC  +F+  SF  P   S  Y E +  +E  AA NV+EAC++T 
Sbjct  65    FHLDPFDYHSIVDALKGCSGLFY--SFEPPKDQSCTYDEYIGEVEVRAAHNVLEACAQTD  122

Query  692   YARRCIFTSSLLASIWKGNNHEHDD------LDESSWTDEDFCRENKLWFALAKTRAEKV  531
                + +FTSS  A IW   +HE+D       LDE  W+D + CR+ KLW AL+KT AEK 
Sbjct  123   TIEKVVFTSSATAIIW--GHHENDQNSASMLLDERHWSDINVCRKFKLWHALSKTLAEKT  180

Query  530   AWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEA  351
             AW  AM+  V +V+V   L+M P     D     PYLKG   M   GV  T D+D   EA
Sbjct  181   AWALAMDRGVNMVSVNAGLLMGP-----DLTIKNPYLKGAAEMYEDGVFVTVDLDFLVEA  235

Query  350   HVFVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGE-----IPARLC  186
             H+ VYE++     GRYLCF   I   EDAV L N L    L S+ +S E     I  R+ 
Sbjct  236   HICVYEQI--STYGRYLCFNHIINQTEDAVKLANIL--SPLPSSPQSMESDTRIIQERIS  291

Query  185   KSKLTRLLFHTARRLSCKHR  126
               KL +L+     +++ K R
Sbjct  292   NKKLNKLMVECQPQINGKSR  311



>ref|XP_010695556.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Beta vulgaris 
subsp. vulgaris]
Length=313

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 106/294 (36%), Positives = 156/294 (53%), Gaps = 15/294 (5%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTD  849
             VCV   +   G +L+R+LL RGY+V A +Q   + + +K L  +    +L  +    + D
Sbjct  13    VCVMDASGSLGLNLVRRLLQRGYIVHAAVQPHGEVKGLKGLCDDHGKDRL-KIFDCDLFD  71

Query  848   LDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFT  669
                + EA +GC A+F+  +F  PH    Y E  A +E  AA NV+EAC++     + IFT
Sbjct  72    YQTILEALKGCSALFY--NFQLPHDQPEYDEYTADIEVRAAQNVLEACAQMDMIDKVIFT  129

Query  668   SSLLASIWKGNNHE-HDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLV  492
             SS    +W+ +      +LDE  W+D  FCR+ KLW AL+KT AEK AW  AM+ ++ +V
Sbjct  130   SSATTILWREDRKAMSSELDERHWSDVGFCRKFKLWHALSKTLAEKSAWALAMDREISMV  189

Query  491   TVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGAC  312
             T+   L++      +D     PYLKG   M + GVL T D++   +AH+ V+E  D    
Sbjct  190   TINAGLLVG-----SDLSIRHPYLKGAAEMYQDGVLVTVDLNFLLDAHIHVFE--DISTY  242

Query  311   GRYLCFGRTITTPEDAVLLENRLKMQGLLSA---YESGE-IPARLCKSKLTRLL  162
             GRYLCF   I  PE+A+ L   L     + A    E G+ I  R+   KL  +L
Sbjct  243   GRYLCFNNVINRPENAIKLAKILMPSASVQAQSFQEDGKMIQQRISNKKLKEVL  296



>ref|XP_009776407.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Nicotiana sylvestris]
Length=326

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 106/307 (35%), Positives = 151/307 (49%), Gaps = 24/307 (8%)
 Frame = -1

Query  1034  KLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVV---  864
             K VCV       G+ L+ +LL+RGY V A  QN  + +  K       + +  S  +   
Sbjct  18    KKVCVMEAAGQLGSTLVHRLLLRGYTVHAAFQNHDEMQRFKRKYAGGNVDESRSKNLICF  77

Query  863   -ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYA  687
              A   D   + +A +GC  +F+  SF  P     Y E M  +E  AA NV+EAC++T   
Sbjct  78    HADPLDYHSIVDALKGCCGLFY--SFEPPSDYPTYDELMGEMEVRAAHNVMEACAQTDTL  135

Query  686   RRCIFTSSLLASIW-------KGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVA  528
              + +FTSS  A +W         ++H H  +DE  WTD  FC++ KLW  L+KT+AEK A
Sbjct  136   HKVVFTSSATAVLWGTRKRDQHDSSHSHSCVDERDWTDISFCKKYKLWHGLSKTQAEKAA  195

Query  527   WRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAH  348
             W  AM+  V +V++   L++ P     D     PYLKG   M   GV    D++   +AH
Sbjct  196   WALAMDRGVSMVSINGGLLIHP-----DLNIREPYLKGAAEMYEGGVFVAVDLNFLVDAH  250

Query  347   VFVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGE----IPARLCKS  180
             + V+E  D  + GRYLCF R I + +DA  L N L      S  ES E       R+   
Sbjct  251   ICVFE--DVSSYGRYLCFNRVINSSKDATTLANMLLPPSASSKTESLEDDMVYEQRISNQ  308

Query  179   KLTRLLF  159
             KL +L+ 
Sbjct  309   KLNKLML  315



>ref|XP_011028167.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Populus euphratica]
Length=305

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 100/263 (38%), Positives = 137/263 (52%), Gaps = 13/263 (5%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTD  849
             VCV   +   G  L+ +LL RGY V A +QN    +   +       K+   ++ A   D
Sbjct  13    VCVMDASGSLGFSLVERLLQRGYTVHAAVQNH---DCELQFGGLSCDKKKLKILYADPFD  69

Query  848   LDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFT  669
                + +A RGC  VF+  +F  P   S Y E M  +E  AA NV+EAC++T    + +FT
Sbjct  70    YKSIIDALRGCCGVFY--NFEPPQDQSSYDEFMTEVEVRAAHNVLEACAQTETIHKVVFT  127

Query  668   SSLLASIWKGNNHE-HDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLV  492
             SS  A IW+ +      D DE  W+D +FCR+ KLW AL+KT AEK AW  AM+  V +V
Sbjct  128   SSATAVIWRDDRKSITADFDERHWSDINFCRKFKLWHALSKTLAEKTAWALAMDRGVNMV  187

Query  491   TVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGAC  312
             +V   LVM+P     D      YLKG   M   GV  T  ++   +AH+ +YE  D  + 
Sbjct  188   SVNAGLVMSP-----DLSIENSYLKGAAEMYEDGVFVTVGLNFLVDAHICIYE--DVSSY  240

Query  311   GRYLCFGRTITTPEDAVLLENRL  243
             GRYLCF   +   EDAV L + L
Sbjct  241   GRYLCFNHVVNQHEDAVKLASML  263



>ref|XP_009361150.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like isoform 
X2 [Pyrus x bretschneideri]
Length=352

 Score =   162 bits (409),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 100/272 (37%), Positives = 148/272 (54%), Gaps = 18/272 (7%)
 Frame = -1

Query  1046  CRERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVV  867
             C     VCV   +   G+ L+ +LL RGY V A +Q        +    E   K+  SV 
Sbjct  74    CSRTTTVCVMDASGCLGSSLVHRLLHRGYAVHAALQTD-----HRCFDDELVKKKKVSVF  128

Query  866   VARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYA  687
              + + D   + +A +GC A+F+  SF  P     Y E MA +E  AA NV+EAC++T   
Sbjct  129   RSDLFDYHSIMDALKGCSALFY--SFEPPSDHPTYDEFMAEVEVRAAHNVLEACAQTDTI  186

Query  686   RRCIFTSSLLASIWKGNN----HEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRK  519
              + +FTSS+ A IW+ +         D+DE +W+D +FC++ KLW AL+KT AEK AW  
Sbjct  187   HKVVFTSSVTAVIWRDDRTTSPSSSHDIDERNWSDVNFCKKFKLWHALSKTLAEKTAWAL  246

Query  518   AMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFV  339
             AM+  + +V+V   L+M+P     D   + P+LKG   M + G+L T D++   +AH+ V
Sbjct  247   AMDRGLNMVSVNGGLLMSP-----DLTITNPHLKGAAEMYQDGLLVTVDLEFIVDAHISV  301

Query  338   YEEMDYGACGRYLCFGRTITTPEDAVLLENRL  243
             +E  D  + GRY+CF R I   +DAV L   L
Sbjct  302   FE--DASSYGRYVCFDRVINCYKDAVELARML  331



>ref|XP_009361149.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like isoform 
X1 [Pyrus x bretschneideri]
Length=334

 Score =   161 bits (408),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 100/272 (37%), Positives = 148/272 (54%), Gaps = 18/272 (7%)
 Frame = -1

Query  1046  CRERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVV  867
             C     VCV   +   G+ L+ +LL RGY V A +Q        +    E   K+  SV 
Sbjct  22    CSRTTTVCVMDASGCLGSSLVHRLLHRGYAVHAALQTD-----HRCFDDELVKKKKVSVF  76

Query  866   VARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYA  687
              + + D   + +A +GC A+F+  SF  P     Y E MA +E  AA NV+EAC++T   
Sbjct  77    RSDLFDYHSIMDALKGCSALFY--SFEPPSDHPTYDEFMAEVEVRAAHNVLEACAQTDTI  134

Query  686   RRCIFTSSLLASIWKGNN----HEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRK  519
              + +FTSS+ A IW+ +         D+DE +W+D +FC++ KLW AL+KT AEK AW  
Sbjct  135   HKVVFTSSVTAVIWRDDRTTSPSSSHDIDERNWSDVNFCKKFKLWHALSKTLAEKTAWAL  194

Query  518   AMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFV  339
             AM+  + +V+V   L+M+P     D   + P+LKG   M + G+L T D++   +AH+ V
Sbjct  195   AMDRGLNMVSVNGGLLMSP-----DLTITNPHLKGAAEMYQDGLLVTVDLEFIVDAHISV  249

Query  338   YEEMDYGACGRYLCFGRTITTPEDAVLLENRL  243
             +E  D  + GRY+CF R I   +DAV L   L
Sbjct  250   FE--DASSYGRYVCFDRVINCYKDAVELARML  279



>ref|XP_009397664.1| PREDICTED: cinnamoyl-CoA reductase 2-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=329

 Score =   161 bits (407),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 114/330 (35%), Positives = 158/330 (48%), Gaps = 40/330 (12%)
 Frame = -1

Query  1043  RERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATI-----QNQVDFeemkel-------lr  900
             R+R  VCV   +   G  L+R+LL RG  V A       Q  + F  +  +       + 
Sbjct  8     RDRNTVCVMDASCRLGISLVRRLLQRGCTVHAASYHHGSQFALGFFLLVVVGCFCVCWIP  67

Query  899   eeemkqlESVVVARMT--------------DLDCLCEAFRGCHAVFHTSSFIDPHGISGY  762
                     S V+ RM               D   + +A +GC  +F+T    +P     Y
Sbjct  68    TIAASGESSGVLKRMCSENRRLKLFQADPFDYQTIVDAVKGCSGLFYT---FEPPQDESY  124

Query  761   TERMAFLETEAAGNVIEACSKTAYARRCIFTSSLLASIWKGNNHEHDDLDESSWTDEDFC  582
              E M  +E  AA NV+EAC++     R +FTSS+ A +WK N     D+DE  W++ +FC
Sbjct  125   DELMVEVEVRAAHNVVEACAQVDTIERVVFTSSVTAVVWKENRKLAADVDEREWSEPNFC  184

Query  581   RENKLWFALAKTRAEKVAWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVM  402
             R+ KLW ALAKT AEK AW  AM+  V +V+V   L+  P     +   S PYLKG   M
Sbjct  185   RKFKLWHALAKTLAEKTAWALAMDRGVDMVSVNAGLLTGP-----EISVSNPYLKGAPQM  239

Query  401   LRQGVLATEDVDKAAEAHVFVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLS  222
                GVL T D+D   +AH+ VYE     A GRYLCF   +  P DAV L  +L      S
Sbjct  240   YEDGVLVTVDIDFLVDAHIAVYE--GPSAYGRYLCFSNVVCRPPDAVKLA-QLVSPDAPS  296

Query  221   AYESGE---IPARLCKSKLTRLLFHTARRL  141
             + +S E   I  R+   KL++L+     R+
Sbjct  297   SPQSNELKVIAQRIQNKKLSKLMVDFDVRI  326



>gb|AFK48965.1| unknown [Lotus japonicus]
Length=212

 Score =   158 bits (399),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 85/210 (40%), Positives = 118/210 (56%), Gaps = 5/210 (2%)
 Frame = -1

Query  752  MAFLETEAAGNVIEACSKTAYARRCIFTSSLLASIWKGNNHEHDD--LDESSWTDEDFCR  579
            MA +E   A NV+EAC+ T+  +RC+FT SL A +W+ N        ++  SW+ E FC 
Sbjct  1    MAEIEVRVAENVMEACASTSSVKRCVFTPSLSACMWQNNAQSETSPVINHESWSSESFCI  60

Query  578  ENKLWFALAKTRAEKVAWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVML  399
            E KLW+AL K  AEK AWR A E  +KL ++CPAL+  P F   +  +++ YLKG Q + 
Sbjct  61   EKKLWYALGKLGAEKTAWRIANERGLKLTSICPALITGPEFYQKNPTATIAYLKGAQEIY  120

Query  398  RQGVLATEDVDKAAEAHVFVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLKM-QGLLS  222
              G+LAT D+ K  EAH  V++ M+  ACGRY+CF   I T  +A  L   + M +  + 
Sbjct  121  SNGLLATVDLKKVVEAHSSVFKAMNNNACGRYICFDNVIGTQSEAENLAKEIGMPKEKIC  180

Query  221  AYESGEIPAR--LCKSKLTRLLFHTARRLS  138
              ES     R  L   KL RL+    R +S
Sbjct  181  GDESNNSLHRFELSNEKLCRLMSRPIRCIS  210



>ref|XP_010096557.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Morus notabilis]
 gb|EXB64916.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Morus notabilis]
Length=309

 Score =   160 bits (404),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 98/303 (32%), Positives = 149/303 (49%), Gaps = 18/303 (6%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQV----DFeemkellreeemkqlESVVVA  861
             VCV   +   G+ L+ +LL RGY V A +Q+      D +         +  +   V  +
Sbjct  6     VCVMDASGELGSSLVERLLQRGYTVHAVVQSGQNHGDDHDLKYLDGICCDENKKLKVFHS  65

Query  860   RMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARR  681
                D   +  A RGC  +F+T  F  P     Y E M  +E  AA NV+EAC++T    +
Sbjct  66    DPFDYQSIIGALRGCSGLFYT--FEPPQDQPTYDEFMTDVEVRAAHNVLEACAQTDTIEK  123

Query  680   CIFTSSLLASIWKGN-NHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETK  504
              +FTSS+ A +W+ +   +  DLDE  W+D + CR+ KLW  L+KT  EK AW  AM+  
Sbjct  124   VVFTSSITAVVWRDDRTSDSSDLDERHWSDANLCRKFKLWHGLSKTLTEKTAWALAMDRG  183

Query  503   VKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMD  324
             + +V++   L+M P    ++     PYLKG   M   G+  T D++   +AH+  +E  D
Sbjct  184   LSMVSINAGLLMGPQLSISN-----PYLKGAAEMYEDGLFVTVDLNFLVDAHICAFE--D  236

Query  323   YGACGRYLCFGRTITTPEDAVLLENRL--KMQGLLSAYESGE--IPARLCKSKLTRLLFH  156
               + GRYLCF   I  PEDA+ L  +L         +YE  +     R+   KL +++  
Sbjct  237   VSSYGRYLCFNHVINRPEDALQLARKLTPSSPPPPQSYEEDKRIFQQRISNKKLNKIMVD  296

Query  155   TAR  147
               R
Sbjct  297   FQR  299



>ref|XP_011018544.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Populus euphratica]
Length=305

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 101/294 (34%), Positives = 147/294 (50%), Gaps = 17/294 (6%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTD  849
             VCV   +   G  L+++LL RGY+V A +QN+       +L       +   +  A   D
Sbjct  13    VCVMDASGSLGLSLVQRLLQRGYMVHAAVQNR---NCELQLNGLSCENKKLKIFYADPFD  69

Query  848   LDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFT  669
                + +A R C  +F+T  F  P     Y E M  +E  AA NV+EAC++T    + +FT
Sbjct  70    YKSIIDALRSCSGLFYT--FEPPVDQPTYDESMTEVEVRAAHNVLEACAQTDTIDKVVFT  127

Query  668   SSLLASIWKGN-NHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLV  492
             SS  A IW+ +   E  DLDE  W+D +FCR+ KLW AL+KT AEK  W  AM+  V +V
Sbjct  128   SSATAVIWRDDRKSEIADLDERHWSDINFCRKFKLWHALSKTLAEKTTWALAMDRGVNMV  187

Query  491   TVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGAC  312
             +V   L+++P     +     PYL G   +   GV  T D++   +AH+ +YE  D  + 
Sbjct  188   SVNAGLLVSPELSIKN-----PYLTGAAELYEDGVFVTVDLNFLVDAHICIYE--DVSSY  240

Query  311   GRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGE----IPARLCKSKLTRLL  162
             GRYLCF   +   EDA+ L + L          S +    I  R+   KL  L+
Sbjct  241   GRYLCFNHVVNRHEDAIELASMLTPSAPSLPQSSDQDVKIIQQRISNKKLNELM  294



>ref|XP_004235331.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Solanum lycopersicum]
Length=328

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 105/315 (33%), Positives = 154/315 (49%), Gaps = 28/315 (9%)
 Frame = -1

Query  1052  LWCRERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlES  873
             ++C +R  VCV     + G+ ++ +LL+RGY V A  QN  + +  K             
Sbjct  14    VFCSKR--VCVMDAAGHLGSAIVHQLLLRGYTVHAAFQNHDEMQCFKRKYGCANDDSKSK  71

Query  872   VVV---ARMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACS  702
              ++   A   D   + +A +GC  +F+  SF  P     Y E M  +E  AA NV+EAC+
Sbjct  72    KLICFHADPLDYHSIVDALKGCCGLFY--SFETPSDYPTYDELMGEMEVRAAHNVMEACA  129

Query  701   KTAYARRCIFTSSLLASIW---KGNNHE-------HDDLDESSWTDEDFCRENKLWFALA  552
             +T    + +FTSS  A +W   K + H+       H  +DE  WTD +FC++ KLW  L+
Sbjct  130   QTDTLNKVVFTSSATAVLWGTRKRDQHDSPEASYSHSYVDERDWTDINFCKKYKLWHGLS  189

Query  551   KTRAEKVAWRKAMETKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATED  372
             KT+AEK AW  AM+  V +V++   L++ P     D     PYLKG   M   GV    D
Sbjct  190   KTQAEKAAWALAMDRDVNMVSINAGLLIHP-----DLNIREPYLKGAAEMYEDGVFVAVD  244

Query  371   VDKAAEAHVFVYEEMDYGACGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGE----  204
             +    +AH+ V+E  D  + GRYLCF R I   +DA  L N L      S  +S E    
Sbjct  245   LKFLVDAHMCVFE--DVSSYGRYLCFNRVINNTKDATTLANMLLPPSASSGTQSLEDDTV  302

Query  203   IPARLCKSKLTRLLF  159
                R+   KL +L+ 
Sbjct  303   YEQRISNKKLNKLML  317



>emb|CAN81853.1| hypothetical protein VITISV_041264 [Vitis vinifera]
Length=314

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 96/249 (39%), Positives = 135/249 (54%), Gaps = 48/249 (19%)
 Frame = -1

Query  1040  ERKLVCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVA  861
             E KLVCVTSG S+ G  L+ KLL RGY VR  + ++ D E+++E+ R          V A
Sbjct  56    EEKLVCVTSGVSFLGLALVNKLLSRGYSVRVIVDSEGDVEKVEEMRRNNSNIWP---VTA  112

Query  860   RMTDLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARR  681
             ++++++ L  A  GC  VFHTS F+DP G++GY++ MA +E +A+ NV+EAC++T   + 
Sbjct  113   KLSEVESLEAAMEGCRGVFHTSGFVDPAGLTGYSKAMAGIEVKASENVMEACARTPSVKG  172

Query  680   CIFTSSLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKV  501
             C+ TSS     W  +                     KLW+A  K +AEK AWR A E  +
Sbjct  173   CVLTSS---PFWPAS--------------------GKLWYAWGKLKAEKAAWRVAEEKGL  209

Query  500   KLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDY  321
             +L T+CPAL M  S                      G+LAT DV + AEAHV V+E M  
Sbjct  210   RLSTICPALEMYGS----------------------GLLATVDVTRLAEAHVVVFEAMSK  247

Query  320   GACGRYLCF  294
              + GRY+CF
Sbjct  248   ASFGRYICF  256



>ref|XP_006584553.1| PREDICTED: uncharacterized protein LOC100783579 isoform X1 [Glycine 
max]
Length=297

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 103/292 (35%), Positives = 152/292 (52%), Gaps = 14/292 (5%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTD  849
             VCV   +   GA L+++LL+RGY V A++Q+  +    ++L           +      D
Sbjct  12    VCVMDASGQLGASLVQQLLLRGYHVHASVQSHGN----EQLNGISADPNRLKIFHLDPFD  67

Query  848   LDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFT  669
                + +A RGC  +F+   F  P     Y E +A +E  AA NVIEAC++T    + +FT
Sbjct  68    YHSITDALRGCSGLFYV--FEPPQDQPYYDEYIADVEVRAAHNVIEACAQTETIDKVVFT  125

Query  668   SSLLASIWKGNNHEHD-DLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLV  492
             SS  A +W+ +    + ++DE  W+D +FCR+ KLW  ++KT AE+ AW  AM+ +V +V
Sbjct  126   SSATAVVWREDRKAMESNMDEKHWSDINFCRKFKLWHGMSKTMAERTAWALAMDREVNMV  185

Query  491   TVCPALVMAPSFPHADT-ESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGA  315
             ++   L+M+ S  H D      PYL+G   M   GVL T D+    + H+ VYE  D  +
Sbjct  186   SINAGLLMS-SDQHQDLCIQKNPYLRGASEMYEDGVLVTVDLGILVDTHICVYE--DISS  242

Query  314   CGRYLCFGRTITTPEDAVLLENRLKMQGLLSAYESGE-IPARLCKSKLTRLL  162
              GRYLCF   I T  DAV L +  K    LS     E I  R+   KL  L+
Sbjct  243   YGRYLCFNHVINTQHDAVQLAH--KTTTPLSCDPGKEFIQQRISNKKLNELM  292



>ref|XP_002878708.1| hypothetical protein ARALYDRAFT_481248 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54967.1| hypothetical protein ARALYDRAFT_481248 [Arabidopsis lyrata subsp. 
lyrata]
Length=303

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 91/257 (35%), Positives = 139/257 (54%), Gaps = 7/257 (3%)
 Frame = -1

Query  1025  CVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTDL  846
             CV   ++Y G  ++++LL RGY V A I+   D    +E+   E  ++   V    + D 
Sbjct  11    CVLDASTYVGFWILKRLLTRGYSVHAAIRKNEDSVLEEEIRDMEAKEERLEVYDVDVLDY  70

Query  845   DCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFTS  666
               +  +   C+AVF      +P G     E+   LE   A NV+EAC++T    + +F+S
Sbjct  71    QSILISLNNCNAVF--CCLDNPEGYD--EEKEVDLEVGGAINVVEACARTESIEKIVFSS  126

Query  665   SLLASIWKGNNHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLVTV  486
             SL A+IW+ N     D+DE  W+D DFC + K+W ALAK ++EK AW  AM+  V +V+V
Sbjct  127   SLTAAIWRDNIGTQKDVDEKCWSDLDFCLKKKMWHALAKMQSEKAAWALAMDRMVNMVSV  186

Query  485   CPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGACGR  306
              P L++ PS    +   ++   +  Q M   GVLA  DV+  A+ H+  +E  D  ACGR
Sbjct  187   NPGLIVGPSVAQHNPRPTVLPQRSAQ-MYENGVLAYVDVEFVADVHIRAFE--DTSACGR  243

Query  305   YLCFGRTITTPEDAVLL  255
             Y CF + + T E+A+ L
Sbjct  244   YFCFNQIVNTEEEALKL  260



>ref|XP_006368386.1| hypothetical protein POPTR_0001s02320g [Populus trichocarpa]
 gb|ERP64955.1| hypothetical protein POPTR_0001s02320g [Populus trichocarpa]
Length=305

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 101/294 (34%), Positives = 146/294 (50%), Gaps = 17/294 (6%)
 Frame = -1

Query  1028  VCVTSGNSYFGAHLIRKLLVRGYLVRATIQNQVDFeemkellreeemkqlESVVVARMTD  849
             VCV   +   G  L+++LL RGY+V A +QN        +L       +   +  A   D
Sbjct  13    VCVMDASGNLGLSLVQRLLQRGYMVHAAVQNH---NCELQLNGLSCENKKLKIFYADPFD  69

Query  848   LDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIFT  669
                + +A R C  +F+T  F  P     Y E M  +E  AA NV+EAC+ T    + +FT
Sbjct  70    YKSILDALRSCSGLFYT--FEPPEDQPTYDESMTEVEVRAAHNVLEACAHTETMDKVVFT  127

Query  668   SSLLASIWKGN-NHEHDDLDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAMETKVKLV  492
             SS  A IW+ +   E  D DE  W+D +FCR+ KLW AL+KT AEK  W  AM+  V +V
Sbjct  128   SSATAVIWRDDRKSEIADFDERHWSDINFCRKFKLWHALSKTLAEKTTWALAMDRGVNMV  187

Query  491   TVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEEMDYGAC  312
             +V   L+++P     D     PYL G   +   GV  T D++   +AH+ +YE  D  + 
Sbjct  188   SVNAGLLVSP-----DLSIKNPYLTGAAELYEDGVFVTVDLNFLVDAHICIYE--DVSSY  240

Query  311   GRYLCFGRTITTPEDAVLLENRLK--MQGLLSAYESGE--IPARLCKSKLTRLL  162
             GRYLCF   +   EDA+ L + L      L  +++     I  R+   KL  L+
Sbjct  241   GRYLCFNHVVNRHEDAIELASMLTPAAPSLPQSFDQDVKIIQQRISNKKLNELM  294



>ref|XP_010325560.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like isoform 
X3 [Solanum lycopersicum]
Length=260

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 99/251 (39%), Positives = 133/251 (53%), Gaps = 20/251 (8%)
 Frame = -1

Query  851  DLDCLCEAFRGCHAVFHTSSFIDPHGISGYTERMAFLETEAAGNVIEACSKTAYARRCIF  672
            D   + +A +GC A+F+  SF  P   S Y E +  +E  AA NV+EAC++T    + +F
Sbjct  13   DYHSIVDALKGCCALFY--SFEPPRDHSTYDEYIGEVEVRAAHNVVEACAQTDTIEKVVF  70

Query  671  TSSLLASIWKGNNHEHDD------LDESSWTDEDFCRENKLWFALAKTRAEKVAWRKAME  510
            TSS  A IW   +HE+D       LDE  W+D + CR+ KLW AL+KT AEK AW  AM+
Sbjct  71   TSSATAIIW--GHHENDQNSASMLLDERHWSDINVCRKFKLWHALSKTLAEKTAWALAMD  128

Query  509  TKVKLVTVCPALVMAPSFPHADTESSLPYLKGGQVMLRQGVLATEDVDKAAEAHVFVYEE  330
              V +V+V   L+M P     D     PYLKG   M   GV  T D+D   EAH+ VYE+
Sbjct  129  RGVNMVSVNAGLLMGP-----DLTIKNPYLKGAAEMYEDGVFVTVDLDFLVEAHICVYEQ  183

Query  329  MDYGACGRYLCFGRTITTPEDAVLLENRLK-MQGLLSAYESGE--IPARLCKSKLTRLLF  159
            +     GRYLCF   I   EDA+ L N L  M     + ES    I  R+   KL +L+ 
Sbjct  184  I--STYGRYLCFNHIINQTEDALKLANMLSPMPSSPQSMESDTRIIQERISNKKLNKLMI  241

Query  158  HTARRLSCKHR  126
                +++ K R
Sbjct  242  ECQPQINGKSR  252



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2929097739896