BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13477_g1_i3 len=1324 path=[1:0-512 514:513-626 628:627-1323]

Length=1324
                                                                      Score     E

gb|AFK88675.1|  WRKY22                                                  206   7e-59   
ref|XP_009764282.1|  PREDICTED: probable WRKY transcription facto...    194   6e-54   
gb|EYU23422.1|  hypothetical protein MIMGU_mgv1a024960mg                179   2e-48   
ref|XP_009602736.1|  PREDICTED: probable WRKY transcription facto...    177   1e-47   
ref|XP_011081142.1|  PREDICTED: probable WRKY transcription facto...    175   8e-47   
ref|XP_004245564.1|  PREDICTED: probable WRKY transcription facto...    172   8e-46   
ref|XP_006343927.1|  PREDICTED: probable WRKY transcription facto...    168   1e-44   
emb|CDP12077.1|  unnamed protein product                                169   3e-44   
ref|XP_010658402.1|  PREDICTED: WRKY transcription factor 22-like...    154   8e-39   
ref|XP_002278221.1|  PREDICTED: WRKY transcription factor 22-like...    152   3e-38   Vitis vinifera
emb|CBI34393.3|  unnamed protein product                                149   2e-37   
ref|XP_010279056.1|  PREDICTED: WRKY transcription factor 22            147   2e-36   
ref|XP_010261384.1|  PREDICTED: WRKY transcription factor 22-like       145   2e-35   
ref|XP_006476490.1|  PREDICTED: WRKY transcription factor 22-like       142   6e-35   
ref|XP_010053209.1|  PREDICTED: WRKY transcription factor 22            140   4e-34   
ref|XP_010092573.1|  WRKY transcription factor 22                       140   5e-34   
gb|KDO76342.1|  hypothetical protein CISIN_1g021896mg                   139   8e-34   
gb|EPS61412.1|  hypothetical protein M569_13384                         133   1e-33   
ref|XP_004298837.1|  PREDICTED: probable WRKY transcription facto...    138   2e-33   
ref|XP_008792407.1|  PREDICTED: WRKY transcription factor 22-like       137   5e-33   
ref|XP_002301374.2|  hypothetical protein POPTR_0002s16590g             137   7e-33   Populus trichocarpa [western balsam poplar]
ref|XP_006368768.1|  hypothetical protein POPTR_0001s09900g             136   8e-33   
gb|KCW77472.1|  hypothetical protein EUGRSUZ_D01811                     135   9e-33   
ref|XP_011037096.1|  PREDICTED: WRKY transcription factor 22            136   1e-32   
ref|XP_006439465.1|  hypothetical protein CICLE_v10024061mg             135   1e-32   
ref|XP_002320158.1|  transcription factor family protein                135   2e-32   Populus trichocarpa [western balsam poplar]
ref|XP_006375351.1|  hypothetical protein POPTR_0014s08600g             135   4e-32   
ref|XP_007051705.1|  WRKY transcription factor 23, putative             135   4e-32   
ref|XP_011023273.1|  PREDICTED: WRKY transcription factor 22-like       135   4e-32   
ref|XP_011015965.1|  PREDICTED: WRKY transcription factor 22-like       135   5e-32   
gb|AGQ04238.1|  WRKY transcription factor 47                            134   7e-32   
ref|XP_006386616.1|  hypothetical protein POPTR_0002s16590g             135   9e-32   
ref|XP_008437986.1|  PREDICTED: WRKY transcription factor 22            133   2e-31   
ref|XP_009409443.1|  PREDICTED: WRKY transcription factor 22-like       134   2e-31   
ref|XP_009381766.1|  PREDICTED: probable WRKY transcription facto...    132   2e-31   
ref|XP_010915790.1|  PREDICTED: WRKY transcription factor 22-like       133   3e-31   
ref|XP_008797253.1|  PREDICTED: WRKY transcription factor 22-like       132   5e-31   
ref|XP_011092990.1|  PREDICTED: WRKY transcription factor 22            131   8e-31   
ref|XP_008795077.1|  PREDICTED: WRKY transcription factor 22-like       131   9e-31   
gb|KGN56482.1|  hypothetical protein Csa_3G121580                       131   9e-31   
ref|NP_001267594.1|  WRKY transcription factor 22-like                  131   1e-30   
ref|XP_007160109.1|  hypothetical protein PHAVU_002G293200g             130   1e-30   
ref|XP_002303610.1|  hypothetical protein POPTR_0003s13250g             130   1e-30   Populus trichocarpa [western balsam poplar]
ref|XP_009413820.1|  PREDICTED: WRKY transcription factor 22-like       130   1e-30   
ref|XP_009343870.1|  PREDICTED: probable WRKY transcription facto...    130   2e-30   
gb|AGQ04236.1|  WRKY transcription factor 45                            127   2e-30   
ref|XP_010925829.1|  PREDICTED: probable WRKY transcription facto...    131   2e-30   
ref|XP_009343869.1|  PREDICTED: probable WRKY transcription facto...    129   2e-30   
ref|XP_002513635.1|  hypothetical protein RCOM_1581940                  131   2e-30   Ricinus communis
gb|ACV92025.1|  WRKY transcription factor 23                            129   3e-30   (Populus tomentosa x Populus bolleana) x Populus tomentosa
ref|XP_008375964.1|  PREDICTED: probable WRKY transcription facto...    128   5e-30   
gb|AIY62484.1|  WRKY113                                                 130   6e-30   
ref|XP_007099721.1|  WRKY DNA-binding protein 27, putative              130   8e-30   
ref|XP_009363390.1|  PREDICTED: probable WRKY transcription facto...    127   1e-29   
ref|XP_008363283.1|  PREDICTED: probable WRKY transcription facto...    125   2e-29   
ref|XP_011022614.1|  PREDICTED: WRKY transcription factor 22-like       127   2e-29   
ref|XP_008363282.1|  PREDICTED: probable WRKY transcription facto...    125   2e-29   
ref|XP_004308337.1|  PREDICTED: WRKY transcription factor 22-like       128   2e-29   
ref|XP_008239089.1|  PREDICTED: probable WRKY transcription facto...    126   2e-29   
gb|KHG04290.1|  WRKY transcription factor 22 -like protein              126   3e-29   
ref|XP_010055079.1|  PREDICTED: WRKY transcription factor 22-like...    127   3e-29   
ref|XP_007211114.1|  hypothetical protein PRUPE_ppa025013mg             125   3e-29   
ref|XP_011029360.1|  PREDICTED: WRKY transcription factor 22-like       126   4e-29   
ref|XP_011026978.1|  PREDICTED: WRKY transcription factor 22-like       126   4e-29   
gb|KDO86314.1|  hypothetical protein CISIN_1g019126mg                   126   5e-29   
ref|XP_006444950.1|  hypothetical protein CICLE_v10020943mg             126   5e-29   
gb|AIE43844.1|  WRKY transcription factor 57                            126   6e-29   
ref|XP_007218198.1|  hypothetical protein PRUPE_ppa007745mg             126   7e-29   
ref|XP_009406781.1|  PREDICTED: WRKY transcription factor 22-like       126   7e-29   
ref|XP_007143479.1|  hypothetical protein PHAVU_007G075400g             125   8e-29   
ref|XP_010053762.1|  PREDICTED: WRKY transcription factor 22            125   9e-29   
ref|XP_008232978.1|  PREDICTED: WRKY transcription factor 22            125   9e-29   
ref|NP_001046497.1|  Os02g0265200                                       125   1e-28   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA05104.1|  TPA: WRKY transcription factor 39                      125   1e-28   
ref|XP_004510691.1|  PREDICTED: WRKY transcription factor 22-like       124   1e-28   
ref|XP_010924759.1|  PREDICTED: WRKY transcription factor 22-like       124   1e-28   
gb|KHG10389.1|  WRKY transcription factor 22 -like protein              124   1e-28   
ref|XP_009386306.1|  PREDICTED: WRKY transcription factor 22 isof...    124   1e-28   
gb|KCW78114.1|  hypothetical protein EUGRSUZ_D02324                     125   1e-28   
ref|XP_006843337.1|  hypothetical protein AMTR_s00053p00025460          124   2e-28   
ref|XP_004229932.1|  PREDICTED: WRKY transcription factor 22            125   2e-28   
gb|AGV75969.1|  WRKY transcription factor 88                            124   2e-28   
emb|CDY48511.1|  BnaA09g00120D                                          123   2e-28   
ref|XP_009416719.1|  PREDICTED: WRKY transcription factor 22-like       124   2e-28   
ref|NP_001288962.1|  WRKY transcription factor 22                       123   3e-28   
gb|AIY62475.1|  WRKY67                                                  124   3e-28   
ref|XP_006339631.1|  PREDICTED: WRKY transcription factor 22-like       124   3e-28   
ref|XP_002511920.1|  WRKY transcription factor, putative                124   3e-28   Ricinus communis
ref|XP_003555395.1|  PREDICTED: probable WRKY transcription facto...    123   3e-28   
gb|ACI14389.1|  WRKY22-1 transcription factor                           122   3e-28   Brassica napus [oilseed rape]
ref|NP_001151984.1|  WRKY39v2 - superfamily of TFs having WRKY an...    124   4e-28   Zea mays [maize]
ref|XP_011046055.1|  PREDICTED: probable WRKY transcription facto...    124   5e-28   
ref|XP_010055078.1|  PREDICTED: WRKY transcription factor 22-like...    123   5e-28   
emb|CDY07185.1|  BnaCnng02000D                                          122   5e-28   
gb|ACN26067.1|  unknown                                                 124   5e-28   Zea mays [maize]
ref|XP_002276925.1|  PREDICTED: WRKY transcription factor 22            123   5e-28   Vitis vinifera
ref|XP_003548638.1|  PREDICTED: WRKY transcription factor 22            123   5e-28   
ref|XP_002451907.1|  hypothetical protein SORBIDRAFT_04g009800          123   6e-28   Sorghum bicolor [broomcorn]
gb|AIE43845.1|  WRKY transcription factor 58                            124   6e-28   
ref|XP_009341117.1|  PREDICTED: WRKY transcription factor 22-like       123   6e-28   
gb|AGQ04239.1|  WRKY transcription factor 48                            123   7e-28   
ref|XP_004492798.1|  PREDICTED: WRKY transcription factor 22-like       122   7e-28   
gb|AGV75933.1|  WRKY transcription factor 12                            121   8e-28   
ref|XP_009626813.1|  PREDICTED: WRKY transcription factor 22-like       122   9e-28   
ref|XP_007040356.1|  WRKY family transcription factor, putative         122   9e-28   
ref|XP_004951247.1|  PREDICTED: probable WRKY transcription facto...    122   1e-27   
ref|XP_010445280.1|  PREDICTED: probable WRKY transcription facto...    122   1e-27   
ref|XP_010482660.1|  PREDICTED: probable WRKY transcription facto...    122   1e-27   
ref|XP_006372370.1|  hypothetical protein POPTR_0017s00960g             122   2e-27   
ref|XP_002509862.1|  WRKY transcription factor, putative                121   2e-27   Ricinus communis
gb|ACU17673.1|  unknown                                                 121   3e-27   Glycine max [soybeans]
ref|XP_006601715.1|  PREDICTED: transcription factor isoform X1         121   3e-27   
gb|KHN18817.1|  WRKY transcription factor 22                            120   3e-27   
ref|XP_010442827.1|  PREDICTED: probable WRKY transcription facto...    121   3e-27   
ref|XP_009386375.1|  PREDICTED: WRKY transcription factor 22 isof...    120   3e-27   
ref|XP_010916830.1|  PREDICTED: WRKY transcription factor 22-like       120   4e-27   
gb|EYU32172.1|  hypothetical protein MIMGU_mgv1a009333mg                120   5e-27   
ref|XP_007139781.1|  hypothetical protein PHAVU_008G058300g             120   5e-27   
ref|XP_010112624.1|  putative WRKY transcription factor 29              120   5e-27   
ref|XP_003622494.1|  WRKY transcription factor                          120   6e-27   
ref|XP_003534539.1|  PREDICTED: WRKY transcription factor 22-like       120   6e-27   
emb|CDY01962.1|  BnaC02g27650D                                          119   6e-27   
ref|NP_568777.1|  WRKY DNA-binding protein 27                           120   6e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003535592.1|  PREDICTED: probable WRKY transcription facto...    119   6e-27   
ref|XP_008776340.1|  PREDICTED: WRKY transcription factor 22-like       120   7e-27   
gb|KHN21793.1|  Putative WRKY transcription factor 27                   119   9e-27   
ref|XP_010060258.1|  PREDICTED: probable WRKY transcription facto...    120   9e-27   
gb|KFK26883.1|  hypothetical protein AALP_AA8G305900                    119   1e-26   
ref|NP_001237508.1|  transcription factor                               118   1e-26   
ref|XP_003571185.1|  PREDICTED: WRKY transcription factor 22-like       119   1e-26   
ref|NP_001267532.1|  WRKY transcription factor 22-like                  117   1e-26   
ref|NP_001130964.1|  putative WRKY DNA-binding domain superfamily...    119   1e-26   Zea mays [maize]
ref|XP_004496517.1|  PREDICTED: probable WRKY transcription facto...    118   1e-26   
ref|XP_009366563.1|  PREDICTED: WRKY transcription factor 22-like       119   1e-26   
ref|NP_192034.1|  WRKY transcription factor 22                          118   1e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006401776.1|  hypothetical protein EUTSA_v10013872mg             119   1e-26   
ref|XP_009350327.1|  PREDICTED: WRKY transcription factor 22-like       119   1e-26   
ref|XP_003624081.1|  WRKY transcription factor                          119   1e-26   
ref|XP_009127213.1|  PREDICTED: probable WRKY transcription facto...    119   1e-26   
emb|CDY27045.1|  BnaA02g10650D                                          119   1e-26   
gb|ACI14392.1|  WRKY27-1 transcription factor                           119   2e-26   Brassica napus [oilseed rape]
ref|XP_002864197.1|  hypothetical protein ARALYDRAFT_495347             119   2e-26   
emb|CDX96157.1|  BnaC02g14940D                                          119   2e-26   
gb|KHN40435.1|  WRKY transcription factor 22                            118   2e-26   
ref|XP_010427624.1|  PREDICTED: WRKY transcription factor 22            117   2e-26   
ref|XP_008452006.1|  PREDICTED: probable WRKY transcription facto...    117   3e-26   
gb|EYU35112.1|  hypothetical protein MIMGU_mgv1a009324mg                118   3e-26   
ref|XP_009768958.1|  PREDICTED: WRKY transcription factor 22-like       118   3e-26   
ref|XP_006280638.1|  hypothetical protein CARUB_v10026599mg             118   3e-26   
gb|ACQ76802.1|  WRKY transcription factor 22                            117   3e-26   Brassica napus [oilseed rape]
emb|CDP08759.1|  unnamed protein product                                118   3e-26   
ref|XP_010541208.1|  PREDICTED: probable WRKY transcription facto...    117   3e-26   
ref|XP_003592183.1|  WRKY transcription factor                          117   4e-26   
ref|XP_008234823.1|  PREDICTED: probable WRKY transcription facto...    115   4e-26   
gb|AIE16093.1|  WRKY transcription factor 22-like protein               115   4e-26   
ref|XP_009758175.1|  PREDICTED: WRKY transcription factor 22-like       117   5e-26   
ref|XP_009421224.1|  PREDICTED: WRKY transcription factor 22-like       117   6e-26   
ref|XP_008347124.1|  PREDICTED: WRKY transcription factor 22-like       117   6e-26   
ref|XP_006580551.1|  PREDICTED: probable WRKY transcription facto...    115   9e-26   
ref|XP_010456229.1|  PREDICTED: WRKY transcription factor 22-like       115   9e-26   
gb|AIE43847.1|  WRKY transcription factor 61                            115   1e-25   
ref|XP_010544418.1|  PREDICTED: WRKY transcription factor 22            115   1e-25   
gb|AIE43841.1|  WRKY transcription factor 19                            114   1e-25   
ref|XP_004248063.1|  PREDICTED: WRKY transcription factor 22-like       115   1e-25   
ref|XP_010522946.1|  PREDICTED: WRKY transcription factor 22-like       115   1e-25   
ref|XP_006584734.1|  PREDICTED: probable WRKY transcription facto...    115   1e-25   
ref|XP_009419794.1|  PREDICTED: WRKY transcription factor 22-like       115   1e-25   
gb|AFL91245.1|  WRKY 5 transcription factor                             109   2e-25   
ref|XP_009790285.1|  PREDICTED: WRKY transcription factor 22-like       114   2e-25   
ref|XP_010060266.1|  PREDICTED: probable WRKY transcription facto...    116   2e-25   
gb|AFL91251.1|  WRKY 5 transcription factor                             108   2e-25   
gb|AAO23324.1|  WRKY transcription factor 22                            114   3e-25   Capsella rubella
ref|XP_002872898.1|  WRKY transcription factor 22                       114   3e-25   
ref|XP_010422786.1|  PREDICTED: WRKY transcription factor 22-like       114   3e-25   
ref|XP_006288206.1|  hypothetical protein CARUB_v10001446mg             114   3e-25   
ref|XP_009400662.1|  PREDICTED: probable WRKY transcription facto...    115   4e-25   
ref|XP_008345081.1|  PREDICTED: WRKY transcription factor 22            114   4e-25   
ref|XP_010669828.1|  PREDICTED: WRKY transcription factor 22            115   4e-25   
ref|XP_007219641.1|  hypothetical protein PRUPE_ppa025042mg             115   5e-25   
ref|XP_006490616.1|  PREDICTED: probable WRKY transcription facto...    115   5e-25   
ref|XP_007135139.1|  hypothetical protein PHAVU_010G104200g             114   5e-25   
gb|KDO56823.1|  hypothetical protein CISIN_1g015616mg                   115   5e-25   
ref|XP_006422058.1|  hypothetical protein CICLE_v10005095mg             115   5e-25   
emb|CDY59336.1|  BnaC01g15320D                                          113   6e-25   
ref|XP_006396285.1|  hypothetical protein EUTSA_v10028843mg             113   6e-25   
gb|AFL91247.1|  WRKY 5 transcription factor                             107   6e-25   
ref|XP_002305271.2|  hypothetical protein POPTR_0004s07050g             114   9e-25   Populus trichocarpa [western balsam poplar]
gb|KFK30708.1|  hypothetical protein AALP_AA6G017400                    112   1e-24   
ref|XP_009590526.1|  PREDICTED: WRKY transcription factor 22-like       112   1e-24   
ref|XP_007152141.1|  hypothetical protein PHAVU_004G105800g             114   1e-24   
gb|AEO31492.1|  WRKY transcription factor 23-2                          106   2e-24   
ref|XP_011076091.1|  PREDICTED: probable WRKY transcription facto...    112   2e-24   
ref|XP_008437536.1|  PREDICTED: probable WRKY transcription facto...    112   2e-24   
gb|AFL91252.1|  WRKY 5 transcription factor                             106   2e-24   
ref|XP_009588575.1|  PREDICTED: WRKY transcription factor 22-like...    110   2e-24   
gb|KHN09281.1|  Putative WRKY transcription factor 27                   112   3e-24   
ref|XP_003549016.1|  PREDICTED: probable WRKY transcription facto...    112   3e-24   
gb|KHN09277.1|  WRKY transcription factor 22                            112   3e-24   
gb|EYU25159.1|  hypothetical protein MIMGU_mgv1a023144mg                112   4e-24   
gb|AFL91250.1|  WRKY 5 transcription factor                             105   4e-24   
ref|XP_009137157.1|  PREDICTED: probable WRKY transcription facto...    110   4e-24   
gb|ADN33775.1|  WRKY transcription factor                               111   5e-24   
emb|CDY44115.1|  BnaA01g13230D                                          110   6e-24   
ref|XP_010676412.1|  PREDICTED: WRKY transcription factor 22-like       109   8e-24   
gb|KHN42469.1|  Putative WRKY transcription factor 27                   111   9e-24   
ref|XP_003533143.1|  PREDICTED: probable WRKY transcription facto...    111   9e-24   
ref|XP_004145903.1|  PREDICTED: WRKY transcription factor 22-like       110   1e-23   
ref|XP_010537133.1|  PREDICTED: LOW QUALITY PROTEIN: probable WRK...    110   2e-23   
gb|KFK28904.1|  hypothetical protein AALP_AA7G063500                    108   3e-23   
ref|NP_194086.3|  putative WRKY transcription factor 29                 108   4e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009137359.1|  PREDICTED: probable WRKY transcription facto...    107   5e-23   
emb|CDY10943.1|  BnaA03g46020D                                          107   5e-23   
ref|XP_010439158.1|  PREDICTED: probable WRKY transcription facto...    107   7e-23   
ref|XP_008347128.1|  PREDICTED: WRKY transcription factor 22-like       105   9e-23   
ref|XP_010433890.1|  PREDICTED: probable WRKY transcription facto...    107   9e-23   
ref|XP_006644388.1|  PREDICTED: WRKY transcription factor 22-like       107   9e-23   
ref|XP_010105730.1|  putative WRKY transcription factor 27              108   1e-22   
ref|XP_010448687.1|  PREDICTED: probable WRKY transcription facto...    107   2e-22   
gb|AAT84155.1|  transcription factor WRKY03                             106   2e-22   Oryza sativa Indica Group [Indian rice]
gb|AAQ54543.1|  transcription factor                                    100   2e-22   Malus domestica [apple tree]
ref|XP_006284033.1|  hypothetical protein CARUB_v10005155mg             106   2e-22   
ref|XP_006413542.1|  hypothetical protein EUTSA_v10025799mg             105   3e-22   
gb|AGA37241.1|  WRKY transcription factor 29.2                          105   3e-22   
gb|ACI14394.1|  WRKY29-1 transcription factor                           105   3e-22   Brassica napus [oilseed rape]
emb|CDX94201.1|  BnaC07g38350D                                          105   3e-22   
emb|CDY41375.1|  BnaC03g65200D                                          105   3e-22   
ref|NP_001288936.1|  probable WRKY transcription factor 29              105   3e-22   
emb|CDP05130.1|  unnamed protein product                                104   5e-22   
ref|NP_001043621.1|  Os01g0624700                                       105   5e-22   Oryza sativa Japonica Group [Japonica rice]
gb|EEE55013.1|  hypothetical protein OsJ_02664                          105   5e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004308041.1|  PREDICTED: uncharacterized protein LOC101304426    106   5e-22   
ref|XP_008380237.1|  PREDICTED: probable WRKY transcription facto...    102   2e-21   
ref|XP_006662643.1|  PREDICTED: probable WRKY transcription facto...    102   3e-21   
ref|XP_002458190.1|  hypothetical protein SORBIDRAFT_03g028440          103   5e-21   Sorghum bicolor [broomcorn]
ref|XP_003549012.1|  PREDICTED: probable WRKY transcription facto...    100   7e-21   
ref|XP_004983519.1|  PREDICTED: probable WRKY transcription facto...    103   8e-21   
ref|XP_002269170.1|  PREDICTED: probable WRKY transcription facto...    103   8e-21   Vitis vinifera
emb|CBI31090.3|  unnamed protein product                                103   8e-21   
gb|EMS55675.1|  putative WRKY transcription factor 27                 99.4    9e-21   
ref|XP_006597676.1|  PREDICTED: probable WRKY transcription facto...    103   1e-20   
ref|XP_009399434.1|  PREDICTED: probable WRKY transcription facto...    102   1e-20   
ref|XP_010036633.1|  PREDICTED: probable WRKY transcription facto...    103   1e-20   
ref|XP_009399433.1|  PREDICTED: probable WRKY transcription facto...    102   1e-20   
ref|XP_010036632.1|  PREDICTED: probable WRKY transcription facto...    103   1e-20   
ref|XP_002869775.1|  WRKY DNA-binding protein 29                        100   2e-20   
gb|KHN44673.1|  Putative WRKY transcription factor 14                   103   2e-20   
ref|XP_006597675.1|  PREDICTED: probable WRKY transcription facto...    103   2e-20   
ref|XP_007211832.1|  hypothetical protein PRUPE_ppa004535mg             103   2e-20   
ref|XP_007147420.1|  hypothetical protein PHAVU_006G123000g             103   2e-20   
ref|XP_004293685.1|  PREDICTED: probable WRKY transcription facto...    103   2e-20   
ref|XP_002317080.1|  WRKY transcription factor 35 family protein        102   2e-20   Populus trichocarpa [western balsam poplar]
ref|XP_011040526.1|  PREDICTED: probable WRKY transcription facto...    102   3e-20   
gb|AGQ04240.1|  WRKY transcription factor 49                            100   4e-20   
ref|XP_008225685.1|  PREDICTED: probable WRKY transcription facto...    102   4e-20   
emb|CDM83437.1|  unnamed protein product                              99.8    4e-20   
gb|AEO31477.1|  WRKY transcription factor 14-1                          101   5e-20   
tpg|DAA05131.1|  TPA: WRKY transcription factor 66                      102   5e-20   
ref|NP_001047827.1|  Os02g0698800                                       102   5e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009622546.1|  PREDICTED: probable WRKY transcription facto...    101   5e-20   
ref|XP_006448817.1|  hypothetical protein CICLE_v10014984mg             102   6e-20   
ref|XP_009377624.1|  PREDICTED: probable WRKY transcription facto...    101   6e-20   
gb|KDO77574.1|  hypothetical protein CISIN_1g012605mg                   101   6e-20   
ref|XP_004976670.1|  PREDICTED: probable WRKY transcription facto...    100   6e-20   
ref|XP_009362177.1|  PREDICTED: probable WRKY transcription facto...    101   7e-20   
gb|AAG46150.1|AC018727_2  putative DNA-binding protein                99.0    7e-20   Oryza sativa [red rice]
ref|XP_009389339.1|  PREDICTED: probable WRKY transcription facto...    100   7e-20   
ref|XP_006468371.1|  PREDICTED: probable WRKY transcription facto...    101   7e-20   
ref|XP_010098516.1|  putative WRKY transcription factor 35              101   7e-20   
ref|XP_006586862.1|  PREDICTED: probable WRKY transcription facto...    101   7e-20   
ref|XP_002466074.1|  hypothetical protein SORBIDRAFT_01g000696          100   8e-20   Sorghum bicolor [broomcorn]
gb|AFL91248.1|  WRKY 5 transcription factor                           93.6    8e-20   
ref|XP_006586861.1|  PREDICTED: probable WRKY transcription facto...    101   9e-20   
ref|XP_008668957.1|  PREDICTED: probable WRKY transcription facto...    101   1e-19   
gb|EEC71118.1|  hypothetical protein OsI_02922                        99.4    1e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_003534796.2|  PREDICTED: probable WRKY transcription facto...    101   1e-19   
ref|XP_002447031.1|  hypothetical protein SORBIDRAFT_06g027290          101   1e-19   Sorghum bicolor [broomcorn]
gb|KEH37125.1|  WRKY family transcription factor                        100   1e-19   
tpg|DAA05077.1|  TPA: WRKY transcription factor 12                    99.4    1e-19   
ref|XP_009382611.1|  PREDICTED: probable WRKY transcription facto...  99.4    1e-19   
ref|XP_009789029.1|  PREDICTED: probable WRKY transcription facto...    100   1e-19   
gb|AIE43848.1|  WRKY transcription factor 72                            100   1e-19   
ref|XP_008663553.1|  PREDICTED: probable WRKY transcription facto...    100   2e-19   
ref|XP_009353871.1|  PREDICTED: probable WRKY transcription facto...    100   2e-19   
ref|NP_001053735.1|  Os04g0597300                                     99.4    2e-19   
ref|XP_008367402.1|  PREDICTED: probable WRKY transcription facto...    100   2e-19   
ref|XP_008788702.1|  PREDICTED: probable WRKY transcription facto...  99.4    2e-19   
gb|EPS65077.1|  hypothetical protein M569_09702                       93.6    2e-19   
ref|XP_006652742.1|  PREDICTED: probable WRKY transcription facto...    100   2e-19   
gb|EEE61600.1|  hypothetical protein OsJ_16009                        99.8    2e-19   
gb|EEC77906.1|  hypothetical protein OsI_17230                        99.8    2e-19   
tpg|DAA05102.1|  TPA: WRKY transcription factor 37                      100   2e-19   
gb|KEH37124.1|  WRKY family transcription factor                      99.8    2e-19   
ref|XP_008383367.1|  PREDICTED: probable WRKY transcription facto...    100   2e-19   
ref|XP_010247841.1|  PREDICTED: probable WRKY transcription facto...  99.4    2e-19   
ref|XP_011085607.1|  PREDICTED: probable WRKY transcription facto...  98.2    3e-19   
gb|AIB05290.1|  WRKY transcription factor                             99.4    3e-19   
ref|XP_004486508.1|  PREDICTED: probable WRKY transcription facto...  99.8    3e-19   
gb|ADE92934.1|  transcription factor WRKY                             91.7    3e-19   
emb|CAE03935.3|  OSJNba0093F12.9                                      99.8    3e-19   
ref|NP_001167966.1|  putative WRKY DNA-binding domain superfamily...  99.4    3e-19   
ref|XP_009397814.1|  PREDICTED: probable WRKY transcription facto...  98.6    3e-19   
gb|EPS68080.1|  hypothetical protein M569_06699                       96.3    4e-19   
gb|EMT18262.1|  Putative WRKY transcription factor 35                 99.0    4e-19   
ref|NP_001174543.1|  Os05g0584000                                     96.7    4e-19   
gb|KEH21139.1|  WRKY family transcription factor                      96.3    5e-19   
dbj|BAK03476.1|  predicted protein                                    99.0    5e-19   
ref|XP_010540640.1|  PREDICTED: probable WRKY transcription facto...  99.0    5e-19   
ref|XP_006647734.1|  PREDICTED: glycine, alanine and asparagine-r...  99.0    5e-19   
gb|AAS16888.2|  hypothetical protein                                  97.1    5e-19   
dbj|BAK00197.1|  predicted protein                                    99.0    5e-19   
ref|XP_011096716.1|  PREDICTED: probable WRKY transcription facto...  98.6    6e-19   
gb|AFW83329.1|  putative WRKY DNA-binding domain superfamily protein  97.1    6e-19   
ref|XP_008675323.1|  PREDICTED: WRKY transcription factor 22-like     97.1    6e-19   
ref|XP_006655635.1|  PREDICTED: probable WRKY transcription facto...  97.1    6e-19   
ref|XP_002299016.1|  WRKY transcription factor 35 family protein      97.8    6e-19   
ref|XP_004980994.1|  PREDICTED: probable WRKY transcription facto...  97.1    7e-19   
ref|XP_010315625.1|  PREDICTED: probable WRKY transcription facto...  97.4    7e-19   
ref|XP_003566901.1|  PREDICTED: WRKY transcription factor 22-like     96.7    7e-19   
ref|XP_009416100.1|  PREDICTED: probable WRKY transcription facto...  97.4    7e-19   
ref|XP_002454437.1|  hypothetical protein SORBIDRAFT_04g030930        98.6    7e-19   
ref|XP_006853288.1|  hypothetical protein AMTR_s00032p00016380        97.8    7e-19   
ref|XP_011005315.1|  PREDICTED: probable WRKY transcription facto...  98.2    8e-19   
ref|XP_009413286.1|  PREDICTED: probable WRKY transcription facto...  97.4    8e-19   
ref|XP_002440335.1|  hypothetical protein SORBIDRAFT_09g029850        96.3    8e-19   
ref|XP_004158081.1|  PREDICTED: probable WRKY transcription facto...  97.4    8e-19   
ref|XP_006650925.1|  PREDICTED: probable WRKY transcription facto...  96.7    8e-19   
ref|XP_010920047.1|  PREDICTED: probable WRKY transcription facto...  97.4    9e-19   
emb|CDP12602.1|  unnamed protein product                              97.8    9e-19   
ref|XP_008465657.1|  PREDICTED: probable WRKY transcription facto...  97.4    9e-19   
gb|KGN65962.1|  hypothetical protein Csa_1G547510                     97.4    9e-19   
dbj|BAJ99716.1|  predicted protein                                    95.9    9e-19   
ref|XP_010227247.1|  PREDICTED: probable WRKY transcription facto...  98.2    9e-19   
ref|XP_006359101.1|  PREDICTED: probable WRKY transcription facto...  97.4    1e-18   
ref|XP_008656686.1|  PREDICTED: WRKY transcription factor 22-like     97.1    1e-18   
ref|XP_009385188.1|  PREDICTED: probable WRKY transcription facto...  96.3    1e-18   
gb|EYU43209.1|  hypothetical protein MIMGU_mgv1a017713mg              97.1    1e-18   
ref|XP_002533765.1|  WRKY transcription factor, putative              97.4    1e-18   
ref|XP_007022995.1|  WRKY DNA-binding protein 14, putative            97.1    1e-18   
ref|XP_010662789.1|  PREDICTED: WRKY transcription factor 22          95.5    1e-18   
ref|XP_004961083.1|  PREDICTED: WRKY transcription factor 22-like     95.1    2e-18   
ref|XP_008646113.1|  PREDICTED: probable WRKY transcription facto...  97.1    2e-18   
ref|XP_010665626.1|  PREDICTED: probable WRKY transcription facto...  96.7    2e-18   
ref|XP_006584998.1|  PREDICTED: probable WRKY transcription facto...  96.3    2e-18   
ref|XP_004953547.1|  PREDICTED: probable WRKY transcription facto...  96.7    3e-18   
gb|EPS71531.1|  hypothetical protein M569_03225                       90.1    3e-18   
gb|KHN39167.1|  Putative WRKY transcription factor 14                 96.3    3e-18   
gb|AIY62464.1|  WRKY27                                                96.7    3e-18   
ref|XP_003572849.1|  PREDICTED: probable WRKY transcription facto...  96.7    3e-18   
ref|XP_006591525.1|  PREDICTED: WRKY transcription factor 22-like     92.8    3e-18   
emb|CDX98217.1|  BnaC07g08810D                                        95.5    4e-18   
gb|EEE57627.1|  hypothetical protein OsJ_08035                        95.1    4e-18   
ref|XP_008439520.1|  PREDICTED: probable WRKY transcription facto...  96.7    4e-18   
emb|CDX77581.1|  BnaA07g07190D                                        95.1    4e-18   
gb|KGN49489.1|  hypothetical protein Csa_6G526230                     96.3    4e-18   
ref|XP_009124607.1|  PREDICTED: probable WRKY transcription facto...  95.5    4e-18   
ref|XP_004134891.1|  PREDICTED: uncharacterized protein LOC101209169  96.3    4e-18   
ref|XP_008677498.1|  PREDICTED: putative WRKY DNA-binding domain ...  95.9    4e-18   
ref|XP_009124606.1|  PREDICTED: probable WRKY transcription facto...  95.5    5e-18   
ref|XP_010504968.1|  PREDICTED: probable WRKY transcription facto...  95.5    5e-18   
ref|XP_009144762.1|  PREDICTED: probable WRKY transcription facto...  95.1    5e-18   
ref|XP_010509700.1|  PREDICTED: probable WRKY transcription facto...  95.5    6e-18   
ref|XP_002890885.1|  WRKY DNA-binding protein 14                      95.1    6e-18   
ref|XP_010933393.1|  PREDICTED: probable WRKY transcription facto...  95.1    6e-18   
ref|XP_002467424.1|  hypothetical protein SORBIDRAFT_01g027770        95.1    6e-18   
ref|XP_011011972.1|  PREDICTED: WRKY transcription factor 6-like ...  95.1    6e-18   
ref|XP_002962865.1|  hypothetical protein SELMODRAFT_77979            89.0    7e-18   
gb|EMS62657.1|  putative WRKY transcription factor 35                 95.1    7e-18   
ref|XP_006294231.1|  hypothetical protein CARUB_v10023228mg           95.1    7e-18   
ref|XP_010499609.1|  PREDICTED: probable WRKY transcription facto...  95.1    7e-18   
ref|XP_006410636.1|  hypothetical protein EUTSA_v10016714mg           94.7    8e-18   
ref|XP_006415439.1|  hypothetical protein EUTSA_v10007691mg           94.7    8e-18   
ref|NP_181029.1|  putative WRKY transcription factor 35               94.7    8e-18   
ref|XP_011011970.1|  PREDICTED: uncharacterized protein LOC105116...  95.1    8e-18   
ref|XP_007159024.1|  hypothetical protein PHAVU_002G202000g           94.7    8e-18   
ref|XP_011011971.1|  PREDICTED: uncharacterized protein LOC105116...  94.7    9e-18   
gb|AJA32884.1|  WRKY transcription factor                             94.4    9e-18   
ref|XP_010519038.1|  PREDICTED: probable WRKY transcription facto...  95.1    1e-17   
ref|NP_001051941.1|  Os03g0855100                                     94.0    1e-17   
ref|XP_003572136.1|  PREDICTED: probable WRKY transcription facto...  93.6    1e-17   
ref|NP_001149833.1|  WRKY transcription factor 14                     94.0    1e-17   
ref|XP_010235060.1|  PREDICTED: probable WRKY transcription facto...  93.6    1e-17   
ref|NP_001065507.1|  Os10g0579400                                     91.3    1e-17   
ref|XP_004969219.1|  PREDICTED: probable WRKY transcription facto...  93.6    1e-17   
ref|XP_008658838.1|  PREDICTED: probable WRKY transcription facto...  94.4    1e-17   
ref|XP_008677423.1|  PREDICTED: WRKY transcription factor 14 isof...  93.6    1e-17   
gb|ACN35650.1|  unknown                                               93.6    1e-17   
gb|KFK36384.1|  hypothetical protein AALP_AA4G116800                  94.0    1e-17   
gb|KHN22935.1|  Putative WRKY transcription factor 35                 94.4    1e-17   
ref|XP_006580027.1|  PREDICTED: probable WRKY transcription facto...  94.4    1e-17   
gb|EYU19085.1|  hypothetical protein MIMGU_mgv1a006007mg              94.4    2e-17   
ref|XP_008465658.1|  PREDICTED: probable WRKY transcription facto...  93.6    2e-17   
ref|XP_009416099.1|  PREDICTED: probable WRKY transcription facto...  93.2    2e-17   
ref|XP_004135749.1|  PREDICTED: probable WRKY transcription facto...  92.4    2e-17   
ref|XP_002881360.1|  hypothetical protein ARALYDRAFT_482446           93.2    3e-17   
ref|XP_009143736.1|  PREDICTED: probable WRKY transcription facto...  93.2    3e-17   
ref|XP_008656076.1|  PREDICTED: probable WRKY transcription facto...  92.0    3e-17   
gb|ACH99804.1|  WRKY35 transcription factor                           92.8    3e-17   
ref|XP_009375603.1|  PREDICTED: probable WRKY transcription facto...  93.2    4e-17   
gb|AAD25752.1|AC007060_10  Identical to gb|D88748 AR411 gene from...  92.8    4e-17   
ref|XP_003559113.2|  PREDICTED: probable WRKY transcription facto...  93.2    4e-17   
ref|NP_564359.1|  putative WRKY transcription factor 14               92.8    4e-17   
emb|CDY09551.1|  BnaC05g23680D                                        92.8    4e-17   
gb|EMS54218.1|  putative WRKY transcription factor 14                 92.0    4e-17   
ref|XP_010460874.1|  PREDICTED: probable WRKY transcription facto...  92.8    4e-17   
ref|XP_008779946.1|  PREDICTED: probable WRKY transcription facto...  89.7    4e-17   
ref|XP_006307568.1|  hypothetical protein CARUB_v10009191mg           92.8    5e-17   
emb|CDY52525.1|  BnaCnng22580D                                        92.4    5e-17   
ref|XP_010478495.1|  PREDICTED: probable WRKY transcription facto...  92.4    5e-17   
gb|KFK44871.1|  hypothetical protein AALP_AA1G313500                  92.0    6e-17   
emb|CBI22627.3|  unnamed protein product                              88.2    7e-17   
gb|AAO22609.1|  putative WRKY family transcription factor             90.9    8e-17   
ref|XP_009141404.1|  PREDICTED: probable WRKY transcription facto...  91.7    1e-16   
emb|CDY43651.1|  BnaA04g20400D                                        91.3    1e-16   
ref|XP_004162853.1|  PREDICTED: probable WRKY transcription facto...  89.4    1e-16   
ref|XP_006573789.1|  PREDICTED: WRKY transcription factor 22-like     88.6    1e-16   
ref|XP_002438452.1|  hypothetical protein SORBIDRAFT_10g020010        90.1    1e-16   
gb|KHN25675.1|  WRKY transcription factor 22                          88.6    1e-16   
ref|XP_007158533.1|  hypothetical protein PHAVU_002G160100g           88.6    1e-16   
gb|EMS55134.1|  putative WRKY transcription factor 35                 91.3    2e-16   
gb|KGN49916.1|  hypothetical protein Csa_5G139930                     86.3    3e-16   
gb|AAM62708.1|  putative DNA-binding protein                          90.1    3e-16   
emb|CDY69417.1|  BnaAnng30430D                                        87.4    3e-16   
ref|XP_010516644.1|  PREDICTED: probable WRKY transcription facto...  87.0    3e-16   
ref|XP_006656997.1|  PREDICTED: probable WRKY transcription facto...  89.4    3e-16   
gb|AFW79983.1|  putative WRKY DNA-binding domain superfamily protein  89.0    4e-16   
gb|EAY99202.1|  hypothetical protein OsI_21160                        88.6    4e-16   
ref|XP_008649219.1|  PREDICTED: probable WRKY transcription facto...  87.4    4e-16   
ref|XP_002865288.1|  predicted protein                                90.9    5e-16   
gb|ACD80368.1|  WRKY7 transcription factor                            88.6    5e-16   
gb|AIA66973.1|  WRKY66                                                86.7    6e-16   
ref|NP_851133.1|  putative WRKY transcription factor 16               89.4    2e-15   
ref|XP_009630404.1|  PREDICTED: probable WRKY transcription facto...  87.0    2e-15   
ref|NP_199318.2|  putative WRKY transcription factor 16               89.0    2e-15   
ref|XP_004516708.1|  PREDICTED: probable WRKY transcription facto...  87.4    2e-15   
ref|XP_009778379.1|  PREDICTED: probable WRKY transcription facto...  87.0    2e-15   
ref|XP_002863534.1|  predicted protein                                88.6    3e-15   
dbj|BAA13689.1|  AR411                                                84.3    5e-15   
gb|EAZ01095.1|  hypothetical protein OsI_23123                        84.0    5e-15   
gb|ABI13411.1|  WRKY transcription factor 44                          82.0    5e-15   
gb|EMT21586.1|  Putative WRKY transcription factor 35                 85.9    9e-15   
gb|ABF81432.1|  TIR-NBS-TIR-TIR-WRKY type disease resistance protein  87.0    1e-14   
tpg|DAA05096.1|  TPA: WRKY transcription factor 31                    84.0    2e-14   
gb|EMT26633.1|  WRKY transcription factor 22                          81.3    3e-14   
dbj|BAD45650.1|  WRKY transcription factor-like                       83.6    3e-14   
ref|XP_006654004.1|  PREDICTED: probable WRKY transcription facto...  80.5    4e-14   
gb|AEQ29018.1|  WRKY5                                                 80.9    5e-14   
gb|KHN48014.1|  Putative WRKY transcription factor 65                 81.6    5e-14   
ref|XP_010316839.1|  PREDICTED: probable WRKY transcription facto...  82.0    6e-14   
ref|NP_001237221.1|  WRKY48 protein                                   81.3    6e-14   
ref|XP_010538215.1|  PREDICTED: probable WRKY transcription facto...  80.9    6e-14   
ref|XP_010321524.1|  PREDICTED: probable WRKY transcription factor 4  82.0    7e-14   
ref|XP_006358112.1|  PREDICTED: probable WRKY transcription facto...  81.6    7e-14   
ref|XP_009758491.1|  PREDICTED: probable WRKY transcription facto...  81.6    7e-14   
ref|XP_010671600.1|  PREDICTED: probable WRKY transcription facto...  82.8    8e-14   
ref|XP_004233062.1|  PREDICTED: probable WRKY transcription facto...  81.6    8e-14   
ref|XP_007159480.1|  hypothetical protein PHAVU_002G240900g           80.9    8e-14   
gb|ACI14404.1|  WRKY65-1 transcription factor                         80.9    9e-14   
ref|NP_001274847.1|  WRKY transcription factor 5                      81.3    9e-14   
ref|XP_009595577.1|  PREDICTED: probable WRKY transcription facto...  81.3    9e-14   
gb|KEH20096.1|  WRKY DNA-binding domain protein                       83.2    9e-14   
ref|XP_008369035.1|  PREDICTED: probable WRKY transcription facto...  80.5    9e-14   
ref|XP_010460705.1|  PREDICTED: probable WRKY transcription facto...  80.5    1e-13   
emb|CDX90180.1|  BnaA08g18040D                                        80.5    1e-13   
gb|KFK44770.1|  hypothetical protein AALP_AA1G300900                  80.5    1e-13   
ref|XP_009109676.1|  PREDICTED: probable WRKY transcription facto...  80.5    1e-13   
ref|XP_003628855.1|  WRKY transcription factor                        82.8    1e-13   
dbj|BAJ88038.1|  predicted protein                                    80.9    1e-13   
ref|XP_006304098.1|  hypothetical protein CARUB_v10010013mg           80.1    1e-13   
ref|XP_010321551.1|  PREDICTED: probable WRKY transcription facto...  80.5    2e-13   
ref|XP_010538217.1|  PREDICTED: probable WRKY transcription facto...  78.6    2e-13   
ref|XP_003565854.1|  PREDICTED: WRKY transcription factor 22-like     80.5    2e-13   
ref|XP_006585175.1|  PREDICTED: probable WRKY transcription facto...  79.7    2e-13   
ref|XP_010538216.1|  PREDICTED: probable WRKY transcription facto...  79.3    2e-13   
ref|XP_003524970.1|  PREDICTED: probable WRKY transcription facto...  79.3    2e-13   
gb|KHN06418.1|  Putative WRKY transcription factor 65                 79.3    2e-13   
gb|KFK44771.1|  hypothetical protein AALP_AA1G300900                  79.3    3e-13   
gb|AFS64071.1|  WRKY transcription factor 6                           80.5    3e-13   
gb|KEH36934.1|  WRKY DNA-binding domain protein                       81.6    3e-13   
ref|XP_010460704.1|  PREDICTED: probable WRKY transcription facto...  79.0    3e-13   
ref|XP_010499444.1|  PREDICTED: probable WRKY transcription facto...  79.0    4e-13   
ref|XP_009352729.1|  PREDICTED: probable WRKY transcription facto...  79.0    4e-13   
ref|NP_174222.2|  putative WRKY transcription factor 65               78.6    4e-13   
gb|AAS79556.1|  WRKY family transcription factor                      78.6    4e-13   
ref|NP_001183574.1|  putative WRKY DNA-binding domain superfamily...  79.0    4e-13   
ref|XP_009758490.1|  PREDICTED: probable WRKY transcription facto...  79.3    4e-13   
ref|XP_009378733.1|  PREDICTED: probable WRKY transcription facto...  78.6    5e-13   
gb|AAZ99027.1|  WRKY-A1244                                            79.3    5e-13   
ref|XP_009595576.1|  PREDICTED: probable WRKY transcription facto...  79.0    5e-13   
ref|XP_003628824.1|  WRKY transcription factor                        80.5    6e-13   
ref|XP_002890801.1|  WRKY DNA-binding protein 65                      78.2    6e-13   
ref|XP_003628849.1|  WRKY transcription factor                        80.5    6e-13   
ref|XP_007011614.1|  WRKY protein isoform 1                           79.3    6e-13   
ref|XP_006415591.1|  hypothetical protein EUTSA_v10008510mg           78.2    6e-13   
gb|AHC54615.1|  WRKY10                                                78.6    6e-13   
gb|KHG15095.1|  putative WRKY transcription factor 65 -like protein   78.6    6e-13   
ref|XP_010540523.1|  PREDICTED: probable WRKY transcription facto...  77.8    7e-13   
ref|XP_004295586.1|  PREDICTED: probable WRKY transcription facto...  78.2    7e-13   
ref|XP_009772110.1|  PREDICTED: probable WRKY transcription facto...  77.4    7e-13   
ref|XP_006304099.1|  hypothetical protein CARUB_v10010013mg           78.2    7e-13   
ref|XP_009346616.1|  PREDICTED: probable WRKY transcription facto...  77.8    8e-13   



>gb|AFK88675.1| WRKY22 [Catharanthus roseus]
Length=304

 Score =   206 bits (525),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 148/307 (48%), Positives = 191/307 (62%), Gaps = 29/307 (9%)
 Frame = +1

Query  157   GFEDNWGLQAIVQQPPL---MASSEFTLQSCHDYLFDFSQENVL--NFDDFVRTAMVPDD  321
             GFEDNWGLQAIV        +++      SC+  +   S+   L  NF D   T M  DD
Sbjct  4     GFEDNWGLQAIVGGKSFSSAISALPIPNSSCYSIMDHMSEHRDLANNFPDLFET-MFTDD  62

Query  322   ALLEELYKPFIQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPN-NYV  498
               LE+LYKPF    +S S +  + Q+    + +   + D KKS      PV  A   +YV
Sbjct  63    DRLEQLYKPFYPVVSSDSSSESITQQV---EEKLFVEEDEKKSNF---CPVESATTVDYV  116

Query  499   PKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQ  678
             PK+KRRKN+ K+VV+QV AE+L  DKWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQ
Sbjct  117   PKYKRRKNQQKKVVIQVTAEDLSSDKWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQ  176

Query  679   VEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFP-PAVKAAAEDSTAHHVPELVA  855
             VEQS     +FIVTYTAEHSHSQPT++N+LAGT+R+KFP P   + A  S++  V +   
Sbjct  177   VEQSCKDPSIFIVTYTAEHSHSQPTKKNALAGTVRHKFPNPKTPSKATSSSSKLVAKAKD  236

Query  856   ASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGV-SQVAMDNEDFFAGLE  1032
             +SS++ SP   +              E + ++M  +E  D + + S V +D+E FF+GLE
Sbjct  237   SSSSVPSPLIPS-------------VENVKQEMMSIEEDDNNIIFSGVKLDDE-FFSGLE  282

Query  1033  DLDGLIS  1053
             DLD LIS
Sbjct  283   DLDELIS  289



>ref|XP_009764282.1| PREDICTED: probable WRKY transcription factor 29 [Nicotiana sylvestris]
Length=313

 Score =   194 bits (492),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 154/338 (46%), Positives = 198/338 (59%), Gaps = 54/338 (16%)
 Frame = +1

Query  169   NWGLQAIVQQPPLMASSEFTLQSCHDYL--------FDFSQENVLNFDDFVRTAMVPDDA  324
             +WGLQA+V    + +S+   +Q   +Y+         DF +   L F D ++T  + D+ 
Sbjct  3     DWGLQAVV----IGSSTCNDIQYGANYIDQKSYFSPLDFQESEYLAFSD-MKTEGLSDE-  56

Query  325   LLEELYKPF-------IQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEA  483
              LEELYKPF          A+S+SF  E K+E              +K   ++ S  L A
Sbjct  57    -LEELYKPFYPVVGQNTLMASSVSFPKEPKEE--------------QKGENEQQSFALVA  101

Query  484   PNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGC  663
                YVPK+KRRKNE KRVV Q+ AE+L  DKWAWRKYGQKPIKGSPYPRSYYRCSSSKGC
Sbjct  102   APAYVPKYKRRKNEQKRVVFQLKAEDLSSDKWAWRKYGQKPIKGSPYPRSYYRCSSSKGC  161

Query  664   LARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFP----------PAVKAA  813
             LARKQVEQS +  G FIVTYTAEHSHSQPTRRNSLAGTI+ KFP          P ++  
Sbjct  162   LARKQVEQSCTEIGTFIVTYTAEHSHSQPTRRNSLAGTIKTKFPTSNNSNKNGSPKMEKE  221

Query  814   AEDSTAHHVPELVAASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQS-GVS  990
                ST     +LV + + L +  +N     S+  +++  + E+ ++  + E SD++  VS
Sbjct  222   KISSTHGSTSDLVLSKATLLNIESNIHE--SQFPEKEFPEIEINQENNMFEGSDENECVS  279

Query  991   QVAMDNEDFFAGLEDL-DGLISYFSYSSQCNYPSMFSS  1101
                M + DFFAGLED+ DG    FS S  CN    FSS
Sbjct  280   IEDMFDGDFFAGLEDIHDG----FSSSFGCNSTFPFSS  313



>gb|EYU23422.1| hypothetical protein MIMGU_mgv1a024960mg, partial [Erythranthe 
guttata]
Length=334

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 146/325 (45%), Positives = 190/325 (58%), Gaps = 44/325 (14%)
 Frame = +1

Query  166   DNWGLQAIVQQPPLMASSEF-----TLQSCHDYLFDFSQENVLNFD--DFVRT--AMVPD  318
             ++W LQAIV+     +S ++     T    HD  FD    N   FD  +F+ +  A  P+
Sbjct  3     EDWSLQAIVRG----SSGDYAKIADTEMDGHDSFFD----NHDQFDPREFLSSSAAGFPE  54

Query  319   -----DALLEELYKPFIQPAASIS----------FTGEVKQEAAVHqmqqqqDGDVKKSG  453
                     L+ELYKPF  PAA  +           TG V       ++Q   + D K+  
Sbjct  55    MFAGSSEELQELYKPFYHPAAVTTTTTTSTSPPVHTGTVLDFQQDQKLQNILEDDSKQK-  113

Query  454   LDKSSPVLEAPNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprs  633
             L + SP   A   Y PK+K+RKN+HKRVVVQV AE L  D WAWRKYGQKPIKGSP+PRS
Sbjct  114   LARVSPAAAA---YTPKYKKRKNQHKRVVVQVSAEGLASDMWAWRKYGQKPIKGSPFPRS  170

Query  634   yyrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFP-PAVKA  810
             YYRCSSSKGCLARKQVE+S +  G FI+TYTAEHSHSQPTRRNSLAGT+R KFP P+ K 
Sbjct  171   YYRCSSSKGCLARKQVEESCTDPGKFIITYTAEHSHSQPTRRNSLAGTVRQKFPSPSSKT  230

Query  811   AAEDSTAHHVPE-LVAASSALSSPT---ANNWRAGSEIKdeddddeeLGEKMQVVEMSDQ  978
                ++ +    + L AA  A+S P    A++    + IK+E  + +   EK  VVE    
Sbjct  231   TPNNNISRPAKQDLKAADVAMSPPMKTLADDHHHEARIKEEMINRQ---EKEGVVEEDGG  287

Query  979   SGVSQVAMDNEDFFAGLEDLDGLIS  1053
               ++   + NE+FF+GLED D  ++
Sbjct  288   DFMASDFVFNEEFFSGLEDFDQFMA  312



>ref|XP_009602736.1| PREDICTED: probable WRKY transcription factor 29 [Nicotiana tomentosiformis]
Length=313

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 141/331 (43%), Positives = 192/331 (58%), Gaps = 40/331 (12%)
 Frame = +1

Query  169   NWGLQAIVQQPPLMASSEFTLQSCHDYL--------FDFSQENVLNFDDFVRTAMVPDDA  324
             +WGLQA+V    + +S+   +Q   +Y+         DF +   L F + ++T ++ D+ 
Sbjct  3     DWGLQAVV----IGSSTCSDIQYGANYIDQKSYFSPLDFQESEYLAFSE-MKTEVLSDE-  56

Query  325   LLEELYKPFIQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPNNYVPK  504
              LEELYKPF            + +    +  + +++   +     +S  ++ AP  YVPK
Sbjct  57    -LEELYKPFYPVVGK----NTLMENGGCYPKKPKEEQKEENE--QQSFSLVAAPI-YVPK  108

Query  505   FKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVE  684
             +KRRKNE KRVV Q+ AE+L  DKWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVE
Sbjct  109   YKRRKNEQKRVVFQLKAEDLSSDKWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVE  168

Query  685   QSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFP----------PAVKAAAEDSTAH  834
             QS +  G FIVTYTAEH+HSQPTRRNSLAGTI+ KFP          P ++     ST  
Sbjct  169   QSCTELGTFIVTYTAEHNHSQPTRRNSLAGTIKTKFPTSNNSNKNGCPKIEKEKLTSTHG  228

Query  835   HVPELVAASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQS-GVSQVAMDNE  1011
                +LV + + L +   N  +   +  + +  + E+ +   + E SD++  VS   M + 
Sbjct  229   STSDLVLSKATLLNIEPNIQQ--EQFPEIEFPEIEINQGNNMFEGSDENECVSIEDMFDG  286

Query  1012  DFFAGLEDL-DGLISYFSYSSQCNYPSMFSS  1101
             DFFAGLED+ DG  S F     CN    FS+
Sbjct  287   DFFAGLEDIHDGFNSSFG----CNSTFPFST  313



>ref|XP_011081142.1| PREDICTED: probable WRKY transcription factor 29 [Sesamum indicum]
Length=336

 Score =   175 bits (444),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 140/326 (43%), Positives = 174/326 (53%), Gaps = 43/326 (13%)
 Frame = +1

Query  166   DNWGLQAIVQQPPL-------------MASSEFTLQSCHDYL-FDFSQENVLNFDDFVRT  303
             ++W LQAIV+                 + SS    ++CH +  FD +     +F +F   
Sbjct  6     EDWSLQAIVRGSSGDYSKIVDINDMDGLDSSFDVSETCHHHQKFDLA-----SFPEFFEL  60

Query  304   AMVPDDALLEELYKPFIQPAAS--------ISFTGEVKQEAAVHqmqqqqDGDVKKSGLD  459
                  D L EELYKPF   A S        + F  ++ QE +          D   SG  
Sbjct  61    PTGFRDEL-EELYKPFYPVAGSDPAKTTTVLDFQEQLPQEVSSEDKLGPGRSD-HSSGAG  118

Query  460   KSSPVLEAPNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyy  639
               S V      Y PK+KRRKN+HKRVV+QV AE L  D WAWRKYGQKPIKGSPYPRSYY
Sbjct  119   LPSRVTAG---YTPKYKRRKNQHKRVVIQVSAEGLASDMWAWRKYGQKPIKGSPYPRSYY  175

Query  640   rcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAE  819
             RCSS KGCLARKQVEQS +  GMFI+TYTAEHSHSQPTRRN LAGT+R KFP   K+   
Sbjct  176   RCSSLKGCLARKQVEQSCADPGMFIITYTAEHSHSQPTRRNCLAGTVRQKFPSRAKSPTS  235

Query  820   DSTAHHVPELVAASSALSSP-------TANNWRAGSEIKdeddddeeLGE-KMQVVEMSD  975
                     +  + SS   SP       +     AG+ +K+E+  +E     K +  E  D
Sbjct  236   RRVKQETTDQESTSSG--SPKTPQQVSSTEVAFAGARVKEENCREETEARGKGESPESYD  293

Query  976   QSGVSQVAMDNEDFFAGLEDLDGLIS  1053
                +S     NEDFF+G ED DG+ +
Sbjct  294   DFIMSDFVF-NEDFFSGFEDFDGIFT  318



>ref|XP_004245564.1| PREDICTED: probable WRKY transcription factor 29 [Solanum lycopersicum]
Length=306

 Score =   172 bits (435),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 135/325 (42%), Positives = 181/325 (56%), Gaps = 52/325 (16%)
 Frame = +1

Query  169   NWGLQAIVQQPPLMASSEFTLQSCHDY--LFDF--SQENVLNFDDFVRTAMVPDDALLEE  336
             +WGLQA+V    + +SS ++  +  D+    DF  S    L+F   ++      D L EE
Sbjct  5     DWGLQAVV----IGSSSSYSANNI-DFSPKLDFQESDHQYLSFSHEMKKEFFISDEL-EE  58

Query  337   LYKPFIQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPNNYVPKFKRR  516
             LYKPF          G              ++   ++   ++   V+   + YVPK+K+R
Sbjct  59    LYKPFYH------VDGGQNMLMGSSISLIPKEIIKEEKREEEQQQVVAPTSTYVPKYKKR  112

Query  517   KNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNS  696
             KNE KRVV+Q+ A++L  DKWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVEQS +
Sbjct  113   KNEQKRVVLQLKADDLSSDKWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVEQSCT  172

Query  697   AAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAASSALSS  876
               G FIVTYTAEH+HSQPTRRNSLAGTI++KFP        +S   ++ + +     +SS
Sbjct  173   ENGTFIVTYTAEHNHSQPTRRNSLAGTIKSKFP--------NSKNTNIKKNIVKDEKISS  224

Query  877   P---TANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQV-------------AMDN  1008
             P   T+NN    S        +  + ++ Q +EM+D   +  +              M +
Sbjct  225   PHGSTSNNNLGFS-------PETLMIDEFQEIEMNDHEEIKNMFEGSDENECVSIQEMFD  277

Query  1009  EDFFAGLEDL-DGLISYFSYSSQCN  1080
              DFFAGLED+ DG  S F     CN
Sbjct  278   GDFFAGLEDIHDGFTSSFG----CN  298



>ref|XP_006343927.1| PREDICTED: probable WRKY transcription factor 29-like [Solanum 
tuberosum]
Length=310

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 139/315 (44%), Positives = 180/315 (57%), Gaps = 43/315 (14%)
 Frame = +1

Query  169   NWGLQAIVQQPPLMASSEFTLQSCHDYLFDFS-----QEN---VLNFDDFVRTAMVPDDA  324
             +WGLQA+V     + SS     SC     DFS     QE+    L+F   ++     D+ 
Sbjct  5     DWGLQAVV-----IGSS----SSCSANNIDFSPKLDFQESDHQYLSFSHEMKKEFFSDE-  54

Query  325   LLEELYKPFIQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPNNYVPK  504
              LEELYKPF          G              ++   ++   ++   V+   + YVPK
Sbjct  55    -LEELYKPFYH------VDGGQNMLMGSSISLIPKEIIKEEKREEEQQQVVAPTSTYVPK  107

Query  505   FKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVE  684
             +K+RKNE KRVV+Q+ A++L  DKWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVE
Sbjct  108   YKKRKNEQKRVVLQLKADDLSSDKWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVE  167

Query  685   QSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAASS  864
             QS +  G FIVTYTAEH+HSQPTRRNSLAGTI++KFP      ++++   H   +V    
Sbjct  168   QSCTENGTFIVTYTAEHNHSQPTRRNSLAGTIKSKFP-----NSKNTINSHKKSIV-KDE  221

Query  865   ALSSP---TANNWRAGSEI-------KdeddddeeLGEKMQVVEMSDQS-GVSQVAMDNE  1011
              +SSP   T+NN     E        + E + +    E   + E SD++  VS   M + 
Sbjct  222   KISSPHGSTSNNLGFSPETLMIDEFQEIEINQENNHEEIKNMFEGSDENECVSIQEMFDG  281

Query  1012  DFFAGLEDL-DGLIS  1053
             DFFAGLED+ DG  S
Sbjct  282   DFFAGLEDIHDGFTS  296



>emb|CDP12077.1| unnamed protein product [Coffea canephora]
Length=352

 Score =   169 bits (427),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 137/335 (41%), Positives = 185/335 (55%), Gaps = 46/335 (14%)
 Frame = +1

Query  154   IGFEDNWGLQAIVQ-------QPPLMASSEFTLQSCHDYLFDFSQEN---VLNFDD-FVR  300
              G  ++WGLQAIV+             SS   L SC+  L     E+   +L+F   F  
Sbjct  4     FGSLEDWGLQAIVRGSTGYYCNTSATGSSTEHLTSCYGLLDTPKDEHHGLLLSFPGPFET  63

Query  301   TAMVPDDALLEELYKPF----------------IQPAASISFTGEVKQEAA-VHqmqqqq  429
              AM+ D+  L++LYKPF                  P+ S+S   E K+E   VHQ + + 
Sbjct  64    AAMLTDE--LQDLYKPFYTVSHSSPAQNSPVGPTTPSDSVSVCKETKEEPEEVHQQKVKV  121

Query  430   DGDVKKSGLDKSSPVLEAPNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPI  609
              GD          P   A + Y+PK+KRRKN+ KRVV+Q  A++L  D WAWRKYGQKPI
Sbjct  122   HGD--------QPPAATATSTYMPKYKRRKNQQKRVVLQSTAKDLSSDMWAWRKYGQKPI  173

Query  610   KGspyprsyyrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK  789
             KGSPYPRSYYRCSSSKGC+ARKQVEQS +   +F++TYTAEH+HSQPTR+N+LAGT+R+K
Sbjct  174   KGSPYPRSYYRCSSSKGCIARKQVEQSCTDPSIFVITYTAEHNHSQPTRKNALAGTVRHK  233

Query  790   FPPAVKAAAEDSTAHHVPELVAASS----ALSSPTANNWRAGSEIKdeddddeeLGEK-M  954
             F         +S A         S      LSSP A       E ++ + + E   E   
Sbjct  234   FSTTKTPTGSNSKAAKKGNSGGCSPNPGLVLSSPEARLLADEEESQERNIEREIKDENDG  293

Query  955   QVVEMSDQSGV--SQVAMDNEDFFAGLEDLDGLIS  1053
             Q+V++   +GV   +V  D +DFF+G+ D +  +S
Sbjct  294   QIVDVKPDNGVLIPEVMFD-DDFFSGICDWNAFMS  327



>ref|XP_010658402.1| PREDICTED: WRKY transcription factor 22-like isoform X2 [Vitis 
vinifera]
Length=330

 Score =   154 bits (388),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 134/333 (40%), Positives = 179/333 (54%), Gaps = 47/333 (14%)
 Frame = +1

Query  139   LMGECIGFEDNWGLQAIVQQPPL--MASSEF--TLQSCHDYLFDFSQENVLNFDDFVRTA  306
             +M E +G  D W LQ++V+   +   +S+ F  T   C   L     E + +F DF  T 
Sbjct  1     MMSEFLGMGD-WDLQSVVRGCAINEASSAAFMDTSLPCFGPLAIQQDELLFSFPDFFETT  59

Query  307   MVPDDALLEELYKPF---IQP--------AASISFTGEVKQEAAVHqmqqqqDGDVKKSG  453
              V D+  LE+LYKPF   +QP        A SIS     K +   H      D      G
Sbjct  60    TVLDE--LEQLYKPFYPVLQPLSPVRTAAAPSISMEDPKKMKGQDHLPGTA-DNGGGGPG  116

Query  454   LDKSSPVLEAPNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprs  633
                + P            K+RKN+ KRVV  V AE L  D WAWRKYGQKPIKGSPYPRS
Sbjct  117   SHGAKP------------KKRKNQQKRVVQHVTAEGLSSDVWAWRKYGQKPIKGSPYPRS  164

Query  634   yyrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAA  813
             YYRCSS KGCLARKQVE+S +   +FIVTYTAEHSHS PTRRNSLAG  RNKF    K +
Sbjct  165   YYRCSSLKGCLARKQVERSRTDPEIFIVTYTAEHSHSHPTRRNSLAGITRNKFSTPKKPS  224

Query  814   AEDSTAHHVPELVAASSALSSPTANNWRAGS--------EIKdeddddeeLGEKMQVVEM  969
               +  +   P  VA  S+ S  + +++ A +        E++      E  GE+ Q  ++
Sbjct  225   KAEPPS--TPTTVANDSSSSPISTSDFSATTPLMSAMEDELQPYVSQQEIRGEEDQ--KL  280

Query  970   SDQSGVSQVAMDNE----DFFAGLEDLDGLISY  1056
             ++++  ++V + +E    DFF GLED+D  + +
Sbjct  281   NERNNTNEVHISDEILNNDFFLGLEDMDFSVQF  313



>ref|XP_002278221.1| PREDICTED: WRKY transcription factor 22-like isoform X1 [Vitis 
vinifera]
Length=331

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 134/333 (40%), Positives = 179/333 (54%), Gaps = 46/333 (14%)
 Frame = +1

Query  139   LMGECIGFEDNWGLQAIVQQPPL--MASSEF--TLQSCHDYLFDFSQENVLNFDDFVRTA  306
             +M E +G  D W LQ++V+   +   +S+ F  T   C   L     E + +F DF  T 
Sbjct  1     MMSEFLGMGD-WDLQSVVRGCAINEASSAAFMDTSLPCFGPLAIQQDELLFSFPDFFETT  59

Query  307   MVPDDALLEELYKPF---IQP--------AASISFTGEVKQEAAVHqmqqqqDGDVKKSG  453
              V D+  LE+LYKPF   +QP        A SIS     K +   H             G
Sbjct  60    TVLDE--LEQLYKPFYPVLQPLSPVRTAAAPSISMEDPKKMKGQDHL-----------PG  106

Query  454   LDKSSPVLEAPNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprs  633
                +       +   PK K RKN+ KRVV  V AE L  D WAWRKYGQKPIKGSPYPRS
Sbjct  107   TADNGGGGPGSHGAKPK-KSRKNQQKRVVQHVTAEGLSSDVWAWRKYGQKPIKGSPYPRS  165

Query  634   yyrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAA  813
             YYRCSS KGCLARKQVE+S +   +FIVTYTAEHSHS PTRRNSLAG  RNKF    K +
Sbjct  166   YYRCSSLKGCLARKQVERSRTDPEIFIVTYTAEHSHSHPTRRNSLAGITRNKFSTPKKPS  225

Query  814   AEDSTAHHVPELVAASSALSSPTANNWRAGS--------EIKdeddddeeLGEKMQVVEM  969
               +  +   P  VA  S+ S  + +++ A +        E++      E  GE+ Q  ++
Sbjct  226   KAEPPS--TPTTVANDSSSSPISTSDFSATTPLMSAMEDELQPYVSQQEIRGEEDQ--KL  281

Query  970   SDQSGVSQVAMDNE----DFFAGLEDLDGLISY  1056
             ++++  ++V + +E    DFF GLED+D  + +
Sbjct  282   NERNNTNEVHISDEILNNDFFLGLEDMDFSVQF  314



>emb|CBI34393.3| unnamed protein product [Vitis vinifera]
Length=323

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 130/323 (40%), Positives = 174/323 (54%), Gaps = 46/323 (14%)
 Frame = +1

Query  169   NWGLQAIVQQPPL--MASSEF--TLQSCHDYLFDFSQENVLNFDDFVRTAMVPDDALLEE  336
             +W LQ++V+   +   +S+ F  T   C   L     E + +F DF  T  V D+  LE+
Sbjct  3     DWDLQSVVRGCAINEASSAAFMDTSLPCFGPLAIQQDELLFSFPDFFETTTVLDE--LEQ  60

Query  337   LYKPF---IQP--------AASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEA  483
             LYKPF   +QP        A SIS     K +   H      D      G   + P    
Sbjct  61    LYKPFYPVLQPLSPVRTAAAPSISMEDPKKMKGQDHLPGTA-DNGGGGPGSHGAKP----  115

Query  484   PNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGC  663
                     K+RKN+ KRVV  V AE L  D WAWRKYGQKPIKGSPYPRSYYRCSS KGC
Sbjct  116   --------KKRKNQQKRVVQHVTAEGLSSDVWAWRKYGQKPIKGSPYPRSYYRCSSLKGC  167

Query  664   LARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVP  843
             LARKQVE+S +   +FIVTYTAEHSHS PTRRNSLAG  RNKF    K +  +  +   P
Sbjct  168   LARKQVERSRTDPEIFIVTYTAEHSHSHPTRRNSLAGITRNKFSTPKKPSKAEPPS--TP  225

Query  844   ELVAASSALSSPTANNWRAGS--------EIKdeddddeeLGEKMQVVEMSDQSGVSQVA  999
               VA  S+ S  + +++ A +        E++      E  GE+ Q  ++++++  ++V 
Sbjct  226   TTVANDSSSSPISTSDFSATTPLMSAMEDELQPYVSQQEIRGEEDQ--KLNERNNTNEVH  283

Query  1000  MDNE----DFFAGLEDLDGLISY  1056
             + +E    DFF GLED+D  + +
Sbjct  284   ISDEILNNDFFLGLEDMDFSVQF  306



>ref|XP_010279056.1| PREDICTED: WRKY transcription factor 22 [Nelumbo nucifera]
Length=368

 Score =   147 bits (372),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 132/338 (39%), Positives = 169/338 (50%), Gaps = 54/338 (16%)
 Frame = +1

Query  160   FEDNWGLQAIVQQPPLMASSEFTLQSCHDYLFDFSQENVLNFDD----FVRTAMVPDDAL  327
              E +W LQA+V+   +  +   T     D LF FS  + L  DD    F      P  A 
Sbjct  1     MEVDWDLQAVVRGCAIGTTPTTTATFMEDPLFCFSPSSGLQQDDHLHYFSDPFQSPTMAF  60

Query  328   --LEELYKPFI--------QPAASISFT---GEVKQEAAVHqmqqqqDGDVKKSGLDKSS  468
               LE+LYKPF         Q  +  SF+   G +K +    Q+Q Q     ++       
Sbjct  61    EELEDLYKPFFPKFEPLSPQTISHTSFSAPLGGLKDQQQQQQIQPQLQQRQQQQQKQPQV  120

Query  469   PVLEAPNNYV----------PKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGs  618
              +   P   V          P+ KRRKN+ KRVV QVPAE L  D WAWRKYGQKPIKGS
Sbjct  121   SLAGPPTAAVSSTTTAHSQTPRSKRRKNQQKRVVCQVPAEGLSSDMWAWRKYGQKPIKGS  180

Query  619   pyprsyyrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPP  798
             PYPR YYRCSSSKGCLARKQVE+S +  GMFI+TYTAEH+H  PT RNSLAG+ R KFP 
Sbjct  181   PYPRGYYRCSSSKGCLARKQVERSRTDPGMFIITYTAEHNHPLPTHRNSLAGSTRQKFPT  240

Query  799   AVK-AAAEDSTAHHVPELVAASSALSSPTANNWRAGSEIKdeddddeeL-GEKMQVVEMS  972
             + +    E  T+   P      S  SSPT     +GS +         +  E +Q ++  
Sbjct  241   SQRPTTGEPDTSTTKP------SCASSPT-----SGSGLSPTTPLTTSMEDELLQPIKQE  289

Query  973   DQSGVSQVAMD--------------NEDFFAGLEDLDG  1044
              Q    +  ++              N+DFF GLE++ G
Sbjct  290   SQEDDGEEMVEDDEDDESLIPDMVINDDFFMGLEEIAG  327



>ref|XP_010261384.1| PREDICTED: WRKY transcription factor 22-like [Nelumbo nucifera]
Length=365

 Score =   145 bits (365),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 121/188 (64%), Gaps = 5/188 (3%)
 Frame = +1

Query  499   PKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQ  678
             P+ KRRKN+ KRVV QVPAE L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGCLARKQ
Sbjct  142   PRSKRRKNQQKRVVCQVPAEGLSSDMWAWRKYGQKPIKGSPYPRGYYRCSSSKGCLARKQ  201

Query  679   VEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFP-PAVKAAAEDSTAHHVPELVA  855
             VE+S +  GMFI+TYTAEH+H  PT RNSLAG+ R+KFP P      E  T    P   +
Sbjct  202   VERSRTDPGMFIITYTAEHNHPLPTHRNSLAGSTRHKFPTPQRPTTGEPDTNTTKPSCAS  261

Query  856   ASS--ALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFAGL  1029
              +S   LS  T +      E   + +  E+ GE+M   +  D+  +  V   N+DFF GL
Sbjct  262   PTSTGGLSPTTPSTTSVEDEQPMKQESREDDGEEMVEDDDEDELLIPDVI--NDDFFMGL  319

Query  1030  EDLDGLIS  1053
             E+L G  S
Sbjct  320   EELAGPTS  327



>ref|XP_006476490.1| PREDICTED: WRKY transcription factor 22-like [Citrus sinensis]
Length=306

 Score =   142 bits (358),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 129/305 (42%), Positives = 165/305 (54%), Gaps = 41/305 (13%)
 Frame = +1

Query  169   NWGLQAIVQQPPLMASSEFTLQSCHDYLFD---FSQENVLNFDDFVRTAMVPDDALLEEL  339
             +W LQAIV+     AS +F +     Y        Q+    F D   T  + D+  LEEL
Sbjct  2     DWDLQAIVRGCSSEASIDFVMDKPQSYNLSPSSLQQDVRFKFPDVSETTTILDE--LEEL  59

Query  340   YKPF----IQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLE--APNNYVP  501
             YKPF    I  + SIS   EV +               K   L K  P L   A N   P
Sbjct  60    YKPFYPQTILTSTSISAPTEVNK---------------KPKKLRKQRPKLSDSASNTDHP  104

Query  502   --KFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
               + K  KN+HKRVV +V A+ L  DKWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARK
Sbjct  105   AAQPKGGKNQHKRVVQRVTADCLACDKWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARK  164

Query  676   QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVA  855
             QVE+S++  G+FI+TY AEH+H  PTRR++LAG+ R+K     KA      A + P L  
Sbjct  165   QVERSSADPGVFIITYGAEHNHGHPTRRSALAGSTRSKLASMSKAQG---PAQNKP-LEP  220

Query  856   ASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFAGLED  1035
             AS A  S    +      IK ED++    G+++++V M D      +   +E  F  LED
Sbjct  221   ASEA--SAELGDLVYQGNIKKEDENVFLDGQEIELV-MPD------LTFSDELMFPSLED  271

Query  1036  LDGLI  1050
             L+G +
Sbjct  272   LEGFL  276



>ref|XP_010053209.1| PREDICTED: WRKY transcription factor 22 [Eucalyptus grandis]
Length=311

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 118/313 (38%), Positives = 170/313 (54%), Gaps = 35/313 (11%)
 Frame = +1

Query  166   DNWGLQAIVQQPPLMASSEFTLQSCHDYL-----FDFSQENVL--NFDDFVRTAMVPDDA  324
             D+W LQA+V+   +  SS   +    D++      D  QE +L   F DF  T+ + DD 
Sbjct  7     DDWDLQAVVRGCGVGESSYDIM----DWMSWQSDADLRQEEILFGGFSDFAETSALLDD-  61

Query  325   LLEELYKPFIQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPNNYVPK  504
              LE+LYKPF     ++   G + +E       + ++    +  L  +S   +  +    K
Sbjct  62    -LEQLYKPFYPEPEAVRDAGLISEEVIEEAENKLKE----EEPLTDASTTSQVVHYEETK  116

Query  505   FKRRKNEHKRVVVQVPAEE-LCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQV  681
              +RRKN+ KR V  V A + +  D WAWRKYGQKPIKGSP+PRSYYRCSSSKGCLARK V
Sbjct  117   QRRRKNQQKREVHHVTAADGVSSDMWAWRKYGQKPIKGSPHPRSYYRCSSSKGCLARKLV  176

Query  682   EQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKF-PPAVKAAAEDSTAHHVPELVAA  858
             E+S+S   +F+VTYT EH+H+ PTRRN+LAG+ RNKF  P  K  A      H P    A
Sbjct  177   ERSSSDPRVFVVTYTGEHNHTHPTRRNALAGSTRNKFASPKAKQPAIAKGNRHAP---LA  233

Query  859   SSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDN---------E  1011
             +    SP++   R  S +           +K Q+   S++SG+S  + +N         +
Sbjct  234   NGPCDSPSSTATR--SPVTPPPVVTHSEEDKRQL--SSNESGLSSGSDENNTVPTMFFSD  289

Query  1012  DFFAGLEDLDGLI  1050
             + F G E+L+ ++
Sbjct  290   EMFMGFEELNDMV  302



>ref|XP_010092573.1| WRKY transcription factor 22 [Morus notabilis]
 gb|EXB51621.1| WRKY transcription factor 22 [Morus notabilis]
Length=361

 Score =   140 bits (354),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 120/279 (43%), Positives = 147/279 (53%), Gaps = 29/279 (10%)
 Frame = +1

Query  295   VRTAMVPDDALLEELYKPFIQPAASISFTGEV-----------KQEAAVHqmqqqqDGDV  441
             VR  +   +  L ELYKPF  P +  + T  +            Q   V   Q   +   
Sbjct  84    VRNHVAAMEEELHELYKPFF-PKSQTNITPNIISVSSSLNSSNDQRVIVQTKQNNINQST  142

Query  442   KKS-GLDKSSPVLEAPNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGs  618
             K+S G   SS          P+ K+RKN+ K+V  QVPAE L  D WAWRKYGQKPIKGS
Sbjct  143   KQSHGASTSS--------TTPRSKKRKNQLKKVC-QVPAESLSSDIWAWRKYGQKPIKGS  193

Query  619   pyprsyyrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPP  798
             PYPR YYRCSSSKGCLARKQVE++ S  GMFIVTYTAEH+H  PT RNSLAG+ R K   
Sbjct  194   PYPRGYYRCSSSKGCLARKQVERNRSDPGMFIVTYTAEHNHPAPTHRNSLAGSTRQKPSS  253

Query  799   AVKAAAEDSTAHHVPELVAASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQ  978
             A    A  ST    P   A S+      A      +E K+  +    L +     E  D+
Sbjct  254   AAAGDAGKSTPITKPSSPATSAEEDLAAAQAQSTTTESKEGPESSTVLMDD----EEEDE  309

Query  979   SGVSQVAMDNEDFFAGLEDLDGLISYFSYSSQCNYPSMF  1095
              G S VA+ ++DFF GLE L    +   +S   N+PS F
Sbjct  310   FGFSDVAV-SDDFFVGLEGLGTPATGDFFSD--NFPSSF  345



>gb|KDO76342.1| hypothetical protein CISIN_1g021896mg [Citrus sinensis]
Length=306

 Score =   139 bits (350),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 126/301 (42%), Positives = 167/301 (55%), Gaps = 33/301 (11%)
 Frame = +1

Query  169   NWGLQAIVQQPPLMASSEFTLQSCHDYLFD---FSQENVLNFDDFVRTAMVPDDALLEEL  339
             +W LQAIV+     AS +  +     Y F      Q+    F D   T  + D+  LEEL
Sbjct  2     DWDLQAIVRGCSTEASIDSVMDKPQSYNFSPSSLQQDVRFKFPDVSETTTILDE--LEEL  59

Query  340   YKPF----IQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPNNYVPKF  507
             YKPF    I  + SIS   EV ++    + QQ++  D   S  +   P  +         
Sbjct  60    YKPFYPQTILTSTSISAPTEVNKKPKKLRKQQRKLSD---SASNTDHPAAQP--------  108

Query  508   KRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQ  687
             K  KN+HKRVV +V A+ L  DKWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVE+
Sbjct  109   KGGKNQHKRVVQRVTADCLACDKWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVER  168

Query  688   SNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAASSA  867
             S++  G+FI+TY AEH+H  PTRR++LAG+ R+K     KA      A + P L  AS A
Sbjct  169   SSADPGVFIITYGAEHNHGHPTRRSALAGSTRSKLASMSKAQG---PAQNKP-LEPASEA  224

Query  868   LSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFAGLEDLDGL  1047
               S    +      IK ED++    G+++++V M D      +   +E  F  LEDL+G 
Sbjct  225   --SAELGDLVYQGNIKKEDENVFLDGQEIELV-MPD------LTFSDELMFPSLEDLEGF  275

Query  1048  I  1050
             +
Sbjct  276   L  276



>gb|EPS61412.1| hypothetical protein M569_13384, partial [Genlisea aurea]
Length=120

 Score =   133 bits (334),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 77/98 (79%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +1

Query  502  KFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQV  681
            K KRRKN+HKRVV+QV A+ L  D WAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQ+
Sbjct  18   KHKRRKNQHKRVVIQVSADGLSSDMWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQL  77

Query  682  EQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFP  795
            EQS S  G F VTY+ EH+H+QPTRRNSLAGT+R KFP
Sbjct  78   EQSRSDPGKFTVTYSGEHNHTQPTRRNSLAGTVRQKFP  115



>ref|XP_004298837.1| PREDICTED: probable WRKY transcription factor 29-like [Fragaria 
vesca subsp. vesca]
Length=308

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 103/224 (46%), Positives = 130/224 (58%), Gaps = 27/224 (12%)
 Frame = +1

Query  163  EDNWGLQAIVQQ-----PPLMASSEFTLQSCHDYLFDFSQENVLNFDDFVRTAMVPDDAL  327
            E++W LQA+V+           + EF+  SC      F+   +   DD  RT     D  
Sbjct  2    ENSWDLQAVVRGCNNNLEGFANTMEFSQSSC----VGFAPATIEEDDDIFRTFPQLFDTT  57

Query  328  -----LEELYKPF---IQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEA  483
                 LEELYKPF   +QP + I               +++++   K   L +SSP+   
Sbjct  58   TALDELEELYKPFYPNLQPISPIIPNPTPAASVLQEVAKEEKEEPKKLKSLKESSPIC--  115

Query  484  PNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGC  663
                    KRRKN+ KRVV +V  ++L  D WAWRKYGQKPIKGSPYPRSYYRCSSSKGC
Sbjct  116  --------KRRKNQSKRVVKEVKEQDLFSDVWAWRKYGQKPIKGSPYPRSYYRCSSSKGC  167

Query  664  LARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFP  795
             ARKQVE+SNS   +FI+T+TAEH+H  PTRRNSLAG+ R KFP
Sbjct  168  SARKQVERSNSNPELFIITFTAEHNHDHPTRRNSLAGSTRTKFP  211



>ref|XP_008792407.1| PREDICTED: WRKY transcription factor 22-like [Phoenix dactylifera]
Length=322

 Score =   137 bits (345),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 108/265 (41%), Positives = 140/265 (53%), Gaps = 47/265 (18%)
 Frame = +1

Query  166  DNWGLQAIVQQ--------------PPLMASSEFTLQSCHDYLFDF--SQENVLNFDDFV  297
            DNW LQA+V+               PPL+   E  +    D LFDF  + +   +F +  
Sbjct  4    DNWDLQAVVRGCCLTRPSTDPFSSFPPLVLKEE-QVDGGKDILFDFPDAMDTETSFHE--  60

Query  298  RTAMVPDDALLEELYKPF-IQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPV  474
                      LEEL KPF ++P         ++Q+ ++           + S   +  P 
Sbjct  61   ----------LEELCKPFFLKPHQQ-----PLRQQPSLLSP--------QLSSPSQQQPR  97

Query  475  L-EAPNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcss  651
            L + P    P+ K+RKN+ KRVV  VPA+ L  D WAWRKYGQKPIKGSPYPR YYRCSS
Sbjct  98   LPQRPVTDTPRSKKRKNQQKRVVCHVPADGLPCDLWAWRKYGQKPIKGSPYPRGYYRCSS  157

Query  652  sKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPA---VKAAAED  822
            SKGCLARKQVE+S S   M +VTYTAEH+H  PT RNSLAG  R K PP    V  +   
Sbjct  158  SKGCLARKQVEKSQSDPAMLVVTYTAEHNHPLPTHRNSLAGCTRQKLPPPSSLVSTSPSA  217

Query  823  STAHHVPELVAASSALSSPTANNWR  897
            S +  +   + ASS++       W+
Sbjct  218  SVSDRMTPSIPASSSVKDELLRQWK  242



>ref|XP_002301374.2| hypothetical protein POPTR_0002s16590g [Populus trichocarpa]
 gb|EEE80647.2| hypothetical protein POPTR_0002s16590g [Populus trichocarpa]
Length=365

 Score =   137 bits (346),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 102/250 (41%), Positives = 135/250 (54%), Gaps = 37/250 (15%)
 Frame = +1

Query  328   LEELYKPFIQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDK----------SSPVL  477
             L+ELYKPF      + ++ +     +        + D++     +          +  V 
Sbjct  107   LDELYKPFFPKTQPLLYSPQACTPISSFSSFASFNKDLQTQPKQQQKKSQPKQSLAGSVT  166

Query  478   EAPNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssK  657
              + N++ P+ KRRKN+ K+V  QVPAE L  D WAWRKYGQKPIKGSPYPR YYRCSSSK
Sbjct  167   SSGNSHTPRSKRRKNQLKKVC-QVPAEALSSDVWAWRKYGQKPIKGSPYPRGYYRCSSSK  225

Query  658   GCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHH  837
             GCLARKQVE++ S  GMFIVTYTAEH+H  PT RNSLAG+ R K        + DS    
Sbjct  226   GCLARKQVERNRSDPGMFIVTYTAEHNHPAPTHRNSLAGSTRQKTSTPQAGTSNDSNKPS  285

Query  838   VPELVAASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQ---SGVSQVAMDN  1008
              P     SS  +S                       E   +V+  D+   +G S++A+ +
Sbjct  286   SPAQPTCSSPATS----------------------LEDELLVQNDDEDELAGFSEIAV-S  322

Query  1009  EDFFAGLEDL  1038
             +DFFAGLE+ 
Sbjct  323   DDFFAGLEEF  332



>ref|XP_006368768.1| hypothetical protein POPTR_0001s09900g [Populus trichocarpa]
 gb|ERP65337.1| hypothetical protein POPTR_0001s09900g [Populus trichocarpa]
Length=325

 Score =   136 bits (343),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 120/338 (36%), Positives = 176/338 (52%), Gaps = 50/338 (15%)
 Frame = +1

Query  139   LMGECIGFEDNWGLQAIVQQPPLMASSEFT-LQSCHDYLF---DFSQENVLNFDDFVRTA  306
             +  E +  E++W LQA+V+        EF+ + +    LF    F Q  +LN  +   T 
Sbjct  1     MSSESVCMEESWDLQAVVRSGCSTNYQEFSNIMNNPPSLFAPLSFDQHELLNSQETYETP  60

Query  307   MVPDDALLEELYKPF------------------IQPAASISFTGEVKQEAAVHqmqqqqD  432
                D+  L+ LY+PF                       S+S   EVK+   V + +   +
Sbjct  61    TDFDE--LDGLYRPFYPVLHQTLNSSQNNILGTCTNTTSMSVRKEVKERQKVQKKKPLSE  118

Query  433   GDV--KKSGLDKSSPVLEAPNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKP  606
                    S +D +S           K KRR+N+HKRVV  V  + L  D WAWRKYGQKP
Sbjct  119   PATCPNSSNIDATSAT---------KSKRRENQHKRVVQHVKEDGLSSDMWAWRKYGQKP  169

Query  607   IKGspyprsyyrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRN  786
             IKGSPYPRSYYRCSS KGCLARKQVE+S++   +FI+TYTAEHSH+ PTRR+SLAG+ R 
Sbjct  170   IKGSPYPRSYYRCSSLKGCLARKQVERSSTDPSIFIITYTAEHSHAHPTRRSSLAGSTRI  229

Query  787   KFPPAVKAAAEDSTAHHVPELVAAS-------SALSSPTANNWRAGSE--IKdeddddee  939
             K     + A + +T +  P +             L SPT  +  +  +  +++    +EE
Sbjct  230   K-----RDAIKGTTPNIEPNMPTIKDQRSPNFDGLISPTTPSMTSTEDELVQNLSIKNEE  284

Query  940   LGEKMQVVEMSDQSGVSQVAMD-NEDFFAGLEDLDGLI  1050
             L ++ Q++E ++   +S   +  ++D F  LEDL+G +
Sbjct  285   LLDQGQILEGNESKEISVPDLVFSDDLFPTLEDLEGFL  322



>gb|KCW77472.1| hypothetical protein EUGRSUZ_D01811 [Eucalyptus grandis]
Length=284

 Score =   135 bits (341),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 109/278 (39%), Positives = 154/278 (55%), Gaps = 26/278 (9%)
 Frame = +1

Query  256   DFSQENVL--NFDDFVRTAMVPDDALLEELYKPFIQPAASISFTGEVKQEAAVHqmqqqq  429
             D  QE +L   F DF  T+ + DD  LE+LYKPF     ++   G + +E       + +
Sbjct  11    DLRQEEILFGGFSDFAETSALLDD--LEQLYKPFYPEPEAVRDAGLISEEVIEEAENKLK  68

Query  430   DGDVKKSGLDKSSPVLEAPNNYVPKFKRRKNEHKRVVVQVPAEE-LCEDKWAWRKYGQKP  606
             +    +  L  +S   +  +    K +RRKN+ KR V  V A + +  D WAWRKYGQKP
Sbjct  69    E----EEPLTDASTTSQVVHYEETKQRRRKNQQKREVHHVTAADGVSSDMWAWRKYGQKP  124

Query  607   IKGspyprsyyrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRN  786
             IKGSP+PRSYYRCSSSKGCLARK VE+S+S   +F+VTYT EH+H+ PTRRN+LAG+ RN
Sbjct  125   IKGSPHPRSYYRCSSSKGCLARKLVERSSSDPRVFVVTYTGEHNHTHPTRRNALAGSTRN  184

Query  787   KF-PPAVKAAAEDSTAHHVPELVAASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVV  963
             KF  P  K  A      H P    A+    SP++   R  S +           +K Q+ 
Sbjct  185   KFASPKAKQPAIAKGNRHAP---LANGPCDSPSSTATR--SPVTPPPVVTHSEEDKRQLS  239

Query  964   EMSDQSGVSQVAMDN---------EDFFAGLEDLDGLI  1050
               S++SG+S  + +N         ++ F G E+L+ ++
Sbjct  240   --SNESGLSSGSDENNTVPTMFFSDEMFMGFEELNDMV  275



>ref|XP_011037096.1| PREDICTED: WRKY transcription factor 22 [Populus euphratica]
Length=348

 Score =   136 bits (343),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 122/195 (63%), Gaps = 13/195 (7%)
 Frame = +1

Query  472   VLEAPNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcss  651
             V+ + N++ P+ KRRKN+ K+V  QVPAE L  D WAWRKYGQKPIKGSPYPR YYRCSS
Sbjct  132   VISSANSHTPRSKRRKNQLKKVC-QVPAEALSSDVWAWRKYGQKPIKGSPYPRGYYRCSS  190

Query  652   sKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTA  831
             SKGCLARKQVE++ S  GMFIVTYTAEH+H  PT RNSLAG+ R K        A DS+ 
Sbjct  191   SKGCLARKQVERNRSDPGMFIVTYTAEHNHPAPTHRNSLAGSTRQKTSTPQTGKANDSSK  250

Query  832   HHVPELVAASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQ----SGVSQVA  999
                P   A SS  +S          E+  +   + EL  + + +   D      G S +A
Sbjct  251   PSSPAKPACSSPATS-------LEDELLAQSTSNTELSREEKDITEDDDEDEIGGFSDIA  303

Query  1000  MDNEDFFAGLEDLDG  1044
             + ++DFFAG+E+  G
Sbjct  304   V-SDDFFAGVEEFVG  317



>ref|XP_006439465.1| hypothetical protein CICLE_v10024061mg, partial [Citrus clementina]
 gb|ESR52705.1| hypothetical protein CICLE_v10024061mg, partial [Citrus clementina]
Length=315

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 124/301 (41%), Positives = 164/301 (54%), Gaps = 33/301 (11%)
 Frame = +1

Query  169   NWGLQAIVQQPPLMASSEFTLQSCHDYLFD---FSQENVLNFDDFVRTAMVPDDALLEEL  339
             +W LQAIV+     AS +  +     Y F      Q+    F D   T  + D+  LEEL
Sbjct  11    DWDLQAIVRGCSTEASIDSVMDKPQSYNFSPSSLQQDVRFKFPDVSETTTILDE--LEEL  68

Query  340   YKPF----IQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPNNYVPKF  507
             YKPF    I  + SIS   EV ++    + QQ++  D   S  +   P  +         
Sbjct  69    YKPFYPQTILTSTSISAPTEVNKKPKKLRKQQRKLSD---SASNTDHPAAQP--------  117

Query  508   KRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQ  687
             K  KN+HKRVV +V A+ L  DKWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVE+
Sbjct  118   KGGKNQHKRVVQRVTADCLACDKWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVER  177

Query  688   SNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAASSA  867
             S++  G+FI+TY AEH+H  PTRR++LAG+ R+K     KA          P    AS A
Sbjct  178   SSADPGVFIITYGAEHNHGHPTRRSALAGSTRSKLASMSKAQGPAQKEPFEP----ASEA  233

Query  868   LSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFAGLEDLDGL  1047
               S    +      IK ED++  + G++ ++V M D      +   +E  F  LEDL+G 
Sbjct  234   --SAELGDLVYQGNIKKEDENAFKDGQENELV-MPD------LTFGDELMFPSLEDLEGF  284

Query  1048  I  1050
             +
Sbjct  285   L  285



>ref|XP_002320158.1| transcription factor family protein [Populus trichocarpa]
 gb|EEE98473.1| transcription factor family protein [Populus trichocarpa]
Length=322

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 120/191 (63%), Gaps = 21/191 (11%)
 Frame = +1

Query  472   VLEAPNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcss  651
             V  + N++ P+ KRRKN+ K+V  QVPAE L  D WAWRKYGQKPIKGSPYPR YYRCSS
Sbjct  122   VTSSANSHTPRSKRRKNQLKKVC-QVPAEALSSDVWAWRKYGQKPIKGSPYPRGYYRCSS  180

Query  652   sKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTA  831
             SKGCLARKQVE++ S  GMFIVTYTAEH+H  PT RNSLAG+ R K        A DS+ 
Sbjct  181   SKGCLARKQVERNRSDPGMFIVTYTAEHNHPAPTHRNSLAGSTRQKTSTPQTGKANDSSK  240

Query  832   HHVPELVAASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNE  1011
                P     SS  +S          E+   +DD++E+G            G S +A+ ++
Sbjct  241   PSSPAKPTCSSPATS-------LEDELLARNDDEDEIG------------GFSDIAV-SD  280

Query  1012  DFFAGLEDLDG  1044
             DFFAGLE+  G
Sbjct  281   DFFAGLEEFVG  291



>ref|XP_006375351.1| hypothetical protein POPTR_0014s08600g [Populus trichocarpa]
 gb|ERP53148.1| hypothetical protein POPTR_0014s08600g [Populus trichocarpa]
Length=349

 Score =   135 bits (340),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 119/195 (61%), Gaps = 13/195 (7%)
 Frame = +1

Query  472   VLEAPNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcss  651
             V  + N++ P+ KRRKN+ K+V  QVPAE L  D WAWRKYGQKPIKGSPYPR YYRCSS
Sbjct  133   VTSSANSHTPRSKRRKNQLKKVC-QVPAEALSSDVWAWRKYGQKPIKGSPYPRGYYRCSS  191

Query  652   sKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTA  831
             SKGCLARKQVE++ S  GMFIVTYTAEH+H  PT RNSLAG+ R K        A DS+ 
Sbjct  192   SKGCLARKQVERNRSDPGMFIVTYTAEHNHPAPTHRNSLAGSTRQKTSTPQTGKANDSSK  251

Query  832   HHVPELVAASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQ----SGVSQVA  999
                P     SS  +S          E+      + EL  + + +   D      G S +A
Sbjct  252   PSSPAKPTCSSPATS-------LEDELLARSTSNTELSREEKDITEDDDEDEIGGFSDIA  304

Query  1000  MDNEDFFAGLEDLDG  1044
             + ++DFFAGLE+  G
Sbjct  305   V-SDDFFAGLEEFVG  318



>ref|XP_007051705.1| WRKY transcription factor 23, putative [Theobroma cacao]
 gb|EOX95862.1| WRKY transcription factor 23, putative [Theobroma cacao]
Length=340

 Score =   135 bits (339),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 123/292 (42%), Positives = 161/292 (55%), Gaps = 32/292 (11%)
 Frame = +1

Query  265   QENVLNFDDFV--RTAMVPDDALLEELYKPFI----------QPAASISFTG--EVKQEA  402
             Q  VL+F + +  R AM      L ELYKPF            P +S S  G  + + + 
Sbjct  50    QSQVLSFPNPIEARNAM----EELHELYKPFFPKSQPLSPQSTPLSSFSSLGMSKDQPQI  105

Query  403   AVHqmqqqqDGDVKKSGLDKSSPVLEAPNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWA  582
                Q Q+Q       S +  +S      N++  + KRRKN+ KRV  QVPAE L  D WA
Sbjct  106   KQQQQQKQSHASSVTSAVTTASSNTATANSHNSRSKRRKNQLKRVC-QVPAEGLSADVWA  164

Query  583   WRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRN  762
             WRKYGQKPIKGSPYPR YYRCSSSKGCLARKQVE++ S   MFIVTYTAEH+H  PT RN
Sbjct  165   WRKYGQKPIKGSPYPRGYYRCSSSKGCLARKQVERNRSDPAMFIVTYTAEHNHPAPTHRN  224

Query  763   SLAGTIRNK-FPPAVKAAAEDSTAHHVPELVAASSALSSPTANNWRAGSEIKdeddddee  939
             SLAG+ R K F P    A  DST     +   +SS  +S         ++++  +D  E+
Sbjct  225   SLAGSTRQKPFTPQTVTAG-DSTKSSSAKPANSSSPTTSVEEELVLQSTKVESREDLAED  283

Query  940   LGEKMQVVEMSDQSGVSQVAMDNEDFFAGLEDLDGLISYFSYSSQCNYPSMF  1095
              GE        D  G+S  A+ ++DFF GLE +  +++   +S Q  +P+ F
Sbjct  284   EGE--------DDFGMSDTAV-SDDFFEGLEGIADMVTGDCFSDQ--FPASF  324



>ref|XP_011023273.1| PREDICTED: WRKY transcription factor 22-like [Populus euphratica]
Length=362

 Score =   135 bits (340),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 104/251 (41%), Positives = 138/251 (55%), Gaps = 23/251 (9%)
 Frame = +1

Query  328   LEELYKPFIQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGL----------DKSSPVL  477
             L+ELYKPF      + ++ +     +        + D++                +  V 
Sbjct  84    LDELYKPFFPKTQPLLYSPQACTPISSFSSFVSFNKDLQTQPKQQQKKSQPKRSHAGSVT  143

Query  478   EAPNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssK  657
              + N++ P+ KRRKN+ K+V  QVPAE L  D WAWRKYGQKPIKGSPYPR YYRCSSSK
Sbjct  144   SSGNSHTPRSKRRKNQLKKVC-QVPAEALSSDVWAWRKYGQKPIKGSPYPRGYYRCSSSK  202

Query  658   GCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHH  837
             GCLARKQVE++ S  GMFIVTYTAEH+H  PT RNSLAG+ R K        ++DS    
Sbjct  203   GCLARKQVERNRSDPGMFIVTYTAEHNHPAPTHRNSLAGSTRQKTSTPQTGTSDDSNKPS  262

Query  838   VPELVAASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQ----SGVSQVAMD  1005
              P     SS  +S          E+  +   D EL  + + +   D     +G S++A+ 
Sbjct  263   SPAQPTCSSPATS-------LEDELLVQSTTDTELSREEKDITEDDDEDELAGFSEIAV-  314

Query  1006  NEDFFAGLEDL  1038
              +DFFAGLE+ 
Sbjct  315   GDDFFAGLEEF  325



>ref|XP_011015965.1| PREDICTED: WRKY transcription factor 22-like [Populus euphratica]
Length=358

 Score =   135 bits (340),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 104/251 (41%), Positives = 138/251 (55%), Gaps = 23/251 (9%)
 Frame = +1

Query  328   LEELYKPFIQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGL----------DKSSPVL  477
             L+ELYKPF      + ++ +     +        + D++                +  V 
Sbjct  84    LDELYKPFFPKTQPLLYSPQACTPISSFSSFVSFNKDLQTQPKQQQKKSQPKRSHAGSVT  143

Query  478   EAPNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssK  657
              + N++ P+ KRRKN+ K+V  QVPAE L  D WAWRKYGQKPIKGSPYPR YYRCSSSK
Sbjct  144   SSGNSHTPRSKRRKNQLKKVC-QVPAEALSSDVWAWRKYGQKPIKGSPYPRGYYRCSSSK  202

Query  658   GCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHH  837
             GCLARKQVE++ S  GMFIVTYTAEH+H  PT RNSLAG+ R K        ++DS    
Sbjct  203   GCLARKQVERNRSDPGMFIVTYTAEHNHPAPTHRNSLAGSTRQKTSTPQTGTSDDSNKPS  262

Query  838   VPELVAASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQ----SGVSQVAMD  1005
              P     SS  +S          E+  +   D EL  + + +   D     +G S++A+ 
Sbjct  263   SPAQPTCSSPATS-------LEDELLVQSTTDTELSREEKDITEDDDEDELAGFSEIAV-  314

Query  1006  NEDFFAGLEDL  1038
              +DFFAGLE+ 
Sbjct  315   GDDFFAGLEEF  325



>gb|AGQ04238.1| WRKY transcription factor 47 [Jatropha curcas]
 gb|KDP28561.1| hypothetical protein JCGZ_14332 [Jatropha curcas]
Length=344

 Score =   134 bits (338),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 112/267 (42%), Positives = 146/267 (55%), Gaps = 38/267 (14%)
 Frame = +1

Query  328   LEELYKPFI------------QPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSP  471
             L +LYKPF              P +S+S  G    +   H         +K+    K S 
Sbjct  79    LHDLYKPFFPKSHFTLYSPQSAPISSLSSFGVSNSKEQTH---------LKQQQQPKQSV  129

Query  472   VLEAPNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcss  651
                A N++ P+ KRRKN+ K++  QVPAE L  D WAWRKYGQKPIKGSPYPR YYRCSS
Sbjct  130   TSSANNSHTPRSKRRKNQLKKIC-QVPAEALSSDVWAWRKYGQKPIKGSPYPRGYYRCSS  188

Query  652   sKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTA  831
             SKGCLARKQVE++ S  GMFI+TYT EH+H  PT RNSLAG+ R K        A DS  
Sbjct  189   SKGCLARKQVERNRSDPGMFILTYTGEHNHPAPTHRNSLAGSTRQKTTTPQNVTASDSNK  248

Query  832   HHVPELVAASSALSSPTANNWRAGSEI--KdeddddeeLGEKMQVVEMSDQSGVSQVAMD  1005
                P  V    A SSP  +      E+  +  + +  E  + ++  E  +  G S +A+ 
Sbjct  249   ---PSPVGK-PACSSPATS---MDDELLPQSTNTESREEKDMIEDDEEDEFGGFSDMAV-  300

Query  1006  NEDFFAGLEDL------DGLISYFSYS  1068
             ++DFF GLE+L      D L  +FS++
Sbjct  301   SDDFFVGLEELADPATGDHLSDHFSFN  327



>ref|XP_006386616.1| hypothetical protein POPTR_0002s16590g [Populus trichocarpa]
 gb|ERP64413.1| hypothetical protein POPTR_0002s16590g [Populus trichocarpa]
Length=409

 Score =   135 bits (340),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 104/251 (41%), Positives = 139/251 (55%), Gaps = 23/251 (9%)
 Frame = +1

Query  328   LEELYKPFIQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDK----------SSPVL  477
             L+ELYKPF      + ++ +     +        + D++     +          +  V 
Sbjct  135   LDELYKPFFPKTQPLLYSPQACTPISSFSSFASFNKDLQTQPKQQQKKSQPKQSLAGSVT  194

Query  478   EAPNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssK  657
              + N++ P+ KRRKN+ K+V  QVPAE L  D WAWRKYGQKPIKGSPYPR YYRCSSSK
Sbjct  195   SSGNSHTPRSKRRKNQLKKVC-QVPAEALSSDVWAWRKYGQKPIKGSPYPRGYYRCSSSK  253

Query  658   GCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHH  837
             GCLARKQVE++ S  GMFIVTYTAEH+H  PT RNSLAG+ R K        + DS    
Sbjct  254   GCLARKQVERNRSDPGMFIVTYTAEHNHPAPTHRNSLAGSTRQKTSTPQAGTSNDSNKPS  313

Query  838   VPELVAASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQ----SGVSQVAMD  1005
              P     SS  +S          E+  +   D EL  + + +   D     +G S++A+ 
Sbjct  314   SPAQPTCSSPATS-------LEDELLVQSTTDTELSREEKDITEDDDEDELAGFSEIAV-  365

Query  1006  NEDFFAGLEDL  1038
             ++DFFAGLE+ 
Sbjct  366   SDDFFAGLEEF  376



>ref|XP_008437986.1| PREDICTED: WRKY transcription factor 22 [Cucumis melo]
Length=331

 Score =   133 bits (334),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 121/199 (61%), Gaps = 18/199 (9%)
 Frame = +1

Query  499   PKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQ  678
             P+ KRRKN+ K+V  QVPAE L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGC+ARKQ
Sbjct  132   PRSKRRKNQLKKVC-QVPAESLSSDIWAWRKYGQKPIKGSPYPRGYYRCSSSKGCMARKQ  190

Query  679   VEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAA  858
             VE++ S  GMFIVTYTAEH+H  PT RNSLAG+ R K P      A  S      + V +
Sbjct  191   VERNRSDPGMFIVTYTAEHNHPAPTHRNSLAGSTRQK-PVTPTTTASGSEKLDPKQPVCS  249

Query  859   SSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFAGLEDL  1038
             S   S+ T +              +E+    M   E  D  GVS + + N+DF+ G E+L
Sbjct  250   SEEQSTITESK-------------EEKEELLMAEDEEDDDLGVSDLIV-NDDFYVGFEEL  295

Query  1039  DGLISYFSYSSQCNYPSMF  1095
             D  I+   +S Q  +P+ F
Sbjct  296   DSPITDDCFSDQ--FPANF  312



>ref|XP_009409443.1| PREDICTED: WRKY transcription factor 22-like [Musa acuminata 
subsp. malaccensis]
Length=370

 Score =   134 bits (336),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = +1

Query  484  PNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGC  663
            P   + + KRRKN+ K+VV  VPA  L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGC
Sbjct  120  PAPQIARSKRRKNQQKKVVCHVPAAGLSSDVWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  179

Query  664  LARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAA  816
            LARKQVE+S +  GMFI+TYTAEH+H  PT RNSLAG+ R+KFP    AAA
Sbjct  180  LARKQVERSRTDPGMFIITYTAEHNHPVPTHRNSLAGSTRHKFPSTTPAAA  230



>ref|XP_009381766.1| PREDICTED: probable WRKY transcription factor 27 [Musa acuminata 
subsp. malaccensis]
Length=300

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 96/222 (43%), Positives = 125/222 (56%), Gaps = 32/222 (14%)
 Frame = +1

Query  163  EDNWGLQAIVQQPPLMASSEFTLQSCHDYLFDFSQE-------NVLNFDDFVRTAMVPDD  321
            +D+W L A+V+   + A+    L S   +      E       + L F D  R      D
Sbjct  3    DDDWDLGAVVRSCRMAAAPRQPLSSSPLHTAPVEAEAEGGKGGSFLGFPDLFRG----RD  58

Query  322  AL--LEELYKPFIQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEA--PN  489
             +  LEEL KPF           +V+Q+             V  +G  +  P  ++  P 
Sbjct  59   GVWELEELCKPFFP---------KVRQQLP--------RAAVAVAGPHQPPPSRQSHRPV  101

Query  490  NYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLA  669
            + +P+ KR+KN+ K+VV  VPA  L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGCLA
Sbjct  102  SQIPRSKRKKNQQKKVVCHVPAAGLSSDVWAWRKYGQKPIKGSPYPRGYYRCSSSKGCLA  161

Query  670  RKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFP  795
            RKQVE+S +   +FI+TYTAEH+H  PT RNSLAG+ R+K P
Sbjct  162  RKQVERSRADPAIFIITYTAEHNHPAPTHRNSLAGSTRHKLP  203



>ref|XP_010915790.1| PREDICTED: WRKY transcription factor 22-like [Elaeis guineensis]
Length=374

 Score =   133 bits (335),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 88/117 (75%), Gaps = 1/117 (1%)
 Frame = +1

Query  484  PNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGC  663
            P + +P+ KRRKN  KRVV  VPA+ L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGC
Sbjct  112  PLSQIPRTKRRKNPQKRVVCHVPADGLSSDMWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  171

Query  664  LARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKF-PPAVKAAAEDSTA  831
            LARKQVE+S +   MFI+TYTAEH+H  PT RNSLAG+ R+K  PPA  +  +  T 
Sbjct  172  LARKQVERSRTDPAMFIITYTAEHNHPLPTHRNSLAGSTRHKLSPPAASSTTQPPTT  228



>ref|XP_008797253.1| PREDICTED: WRKY transcription factor 22-like [Phoenix dactylifera]
Length=383

 Score =   132 bits (333),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = +1

Query  484  PNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGC  663
            P +   + KRRKN+ KRVV  VPA+ L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGC
Sbjct  126  PPSQTSRSKRRKNQQKRVVCHVPADGLSSDMWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  185

Query  664  LARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPP  798
            LARKQVE+S +   MF++TYTAEH+H  PT RNSLAG+ R KFPP
Sbjct  186  LARKQVERSRTDPDMFVITYTAEHNHPLPTHRNSLAGSTRQKFPP  230



>ref|XP_011092990.1| PREDICTED: WRKY transcription factor 22 [Sesamum indicum]
Length=332

 Score =   131 bits (329),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 114/188 (61%), Gaps = 22/188 (12%)
 Frame = +1

Query  481   APNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKG  660
             A +N  P+ KRRKN  KRV   V AE +  D W+WRKYGQKPIKGSPYPR YYRCS+SKG
Sbjct  135   ASHNPSPRSKRRKNHMKRVC-HVAAENISSDMWSWRKYGQKPIKGSPYPRGYYRCSTSKG  193

Query  661   CLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHV  840
             C+ARKQVE++ S  GMFIVTYTAEH+H  PT RNSLAG+ R K  PA   +    ++   
Sbjct  194   CMARKQVERNRSDPGMFIVTYTAEHNHPMPTHRNSLAGSTRQK--PAEAPSKPTCSS---  248

Query  841   PELVAASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFF  1020
              EL  A+S   SP      +  E            +  +  E  D   VS +A+D+ DFF
Sbjct  249   -ELSPAASL--SPVPEKLESSPE------------QLAEAEEEDDDFSVSNMALDD-DFF  292

Query  1021  AGLEDLDG  1044
             AGLED  G
Sbjct  293   AGLEDFTG  300



>ref|XP_008795077.1| PREDICTED: WRKY transcription factor 22-like [Phoenix dactylifera]
Length=344

 Score =   131 bits (329),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = +1

Query  499  PKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQ  678
            P+ KRRKN  KRVV  VP + L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGCLARKQ
Sbjct  120  PRSKRRKNPQKRVVCHVPPDGLSSDMWAWRKYGQKPIKGSPYPRGYYRCSSSKGCLARKQ  179

Query  679  VEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTA  831
            VEQS     MFI+TYTAEH+H  PT RNSLAG+ R+KF P   ++A    A
Sbjct  180  VEQSRMDPAMFIITYTAEHNHPLPTHRNSLAGSTRHKFSPPPSSSATQPPA  230



>gb|KGN56482.1| hypothetical protein Csa_3G121580 [Cucumis sativus]
Length=335

 Score =   131 bits (329),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 115/187 (61%), Gaps = 18/187 (10%)
 Frame = +1

Query  496   VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
              P+ KRRKN+ K+V  QVPAE L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGC+ARK
Sbjct  135   APRSKRRKNQLKKVC-QVPAESLSSDIWAWRKYGQKPIKGSPYPRGYYRCSSSKGCMARK  193

Query  676   QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK-FPPAVKAAAEDSTAHHVPELV  852
             QVE++ S  GMFIVTYTAEH+H  PT RNSLAG+ R K   P+  A+  +      P  V
Sbjct  194   QVERNRSDPGMFIVTYTAEHNHPAPTHRNSLAGSTRQKPITPSTTASGSEKLDPKQP--V  251

Query  853   AASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFAGLE  1032
              +S   S+ T                +E+    M   E  D  G+S + + N+DF+ G E
Sbjct  252   CSSEEQSTITE-------------SKEEKEELLMAEDEEDDDLGISDLIV-NDDFYVGFE  297

Query  1033  DLDGLIS  1053
             +LD  I+
Sbjct  298   ELDSPIT  304



>ref|NP_001267594.1| WRKY transcription factor 22-like [Cucumis sativus]
 gb|ADU52510.1| WRKY protein [Cucumis sativus]
Length=336

 Score =   131 bits (329),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 115/187 (61%), Gaps = 18/187 (10%)
 Frame = +1

Query  496   VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
              P+ KRRKN+ K+V  QVPAE L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGC+ARK
Sbjct  136   APRSKRRKNQLKKVC-QVPAESLSSDIWAWRKYGQKPIKGSPYPRGYYRCSSSKGCMARK  194

Query  676   QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK-FPPAVKAAAEDSTAHHVPELV  852
             QVE++ S  GMFIVTYTAEH+H  PT RNSLAG+ R K   P+  A+  +      P  V
Sbjct  195   QVERNRSDPGMFIVTYTAEHNHPAPTHRNSLAGSTRQKPITPSTTASGSEKLDPKQP--V  252

Query  853   AASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFAGLE  1032
              +S   S+ T                +E+    M   E  D  G+S + + N+DF+ G E
Sbjct  253   CSSEEQSTITE-------------SKEEKEELLMAEDEEDDDLGISDLIV-NDDFYVGFE  298

Query  1033  DLDGLIS  1053
             +LD  I+
Sbjct  299   ELDSPIT  305



>ref|XP_007160109.1| hypothetical protein PHAVU_002G293200g [Phaseolus vulgaris]
 gb|ESW32103.1| hypothetical protein PHAVU_002G293200g [Phaseolus vulgaris]
Length=292

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 100/226 (44%), Positives = 129/226 (57%), Gaps = 21/226 (9%)
 Frame = +1

Query  169  NWGLQAIVQQPPLMASSEFTLQSCHDYLFDFSQENVLNFDDFVRTAMVPDDALLEELYKP  348
            +W L+AIV+     A++         Y F    E + +F +F  T  V DD  LE+LYKP
Sbjct  9    DWDLEAIVRGSSGEATAMDDPNPHFSYFFSHQDELLDSFPEFSETTRVLDD--LEDLYKP  66

Query  349  F------IQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPNNYVPKFK  510
            F      + P   ++ +  +  E    +  +  +  +   GL K  P         PK K
Sbjct  67   FYPVLHPLSPHTIVTTSLSIPIEPQQVKELKASEEKLALQGL-KVPPT--------PKCK  117

Query  511  R-RKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQ  687
            + +KN++K VV QV   E  +D WAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVE+
Sbjct  118  KGKKNQNKSVVKQVTTAEGLDDAWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVER  177

Query  688  SNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK---FPPAVKAAA  816
            S+    +F+VTYTAEHSH  PTRRNSLAGT R      PP   + +
Sbjct  178  SHLDPAVFLVTYTAEHSHPHPTRRNSLAGTTRKNNSLIPPPTTSCS  223



>ref|XP_002303610.1| hypothetical protein POPTR_0003s13250g [Populus trichocarpa]
 gb|EEE78589.1| hypothetical protein POPTR_0003s13250g [Populus trichocarpa]
Length=330

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 120/325 (37%), Positives = 173/325 (53%), Gaps = 33/325 (10%)
 Frame = +1

Query  139   LMGECIGFEDNWGLQAIVQQPPLMASSEF-TLQSCHDYLF---DFSQENVLNFDDFVRTA  306
             +M E +  ED+W L A+V+        +F  + +    LF    F Q+ +LNF +     
Sbjct  1     MMDEFVCMEDSWDLHAVVRSGSSTNYEDFANITNNPPSLFAPLSFYQDELLNFQE-----  55

Query  307   MVPDD-ALLEELYKP--------FIQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLD  459
               P D   L+ LYKP        F  P ++I  T       +V +  +++    KK  + 
Sbjct  56    -TPTDFDGLDGLYKPLYPLLHQTFNSPQSNILSTSISTTSISVPKEVKERQKVQKKKPVS  114

Query  460   KSSPVL--EAPNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprs  633
               S             K KRRKN+HK+VV  V  + L  D WAWRKYGQKPIKGSPYPRS
Sbjct  115   PESATFANTVDATSAAKSKRRKNQHKKVVQHVKEDGLSSDMWAWRKYGQKPIKGSPYPRS  174

Query  634   yyrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAA  813
             YYRCSS KGCLARKQ+E+S +    FI+TYTAEHSH+ PTRR+SLAG+ R K  P++   
Sbjct  175   YYRCSSLKGCLARKQMERSRTDPSTFIITYTAEHSHAHPTRRSSLAGSTRIK--PSMPKE  232

Query  814   AEDSTAHHVP----ELVAASSALSSPTANNWRAGSE--IKdeddddeeLGEKMQVVEMSD  975
             A  +   ++P    EL      + SPT  +  +  +  +++    +EEL ++ QV+   D
Sbjct  233   ATKNIEPNMPTIKDELSPNFDGVLSPTTPSVTSIEDELVQNVCIKNEELLDQGQVL---D  289

Query  976   QSGVSQVAMDNEDFFAGLEDLDGLI  1050
             +  +  +   +E  F  +EDL+GL+
Sbjct  290   EIALPDILFSDE-LFPSIEDLEGLL  313



>ref|XP_009413820.1| PREDICTED: WRKY transcription factor 22-like [Musa acuminata 
subsp. malaccensis]
Length=335

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 99/155 (64%), Gaps = 9/155 (6%)
 Frame = +1

Query  328  LEELYKPFIQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPNNYVPKF  507
            LEELYKPF           +V+Q+             V        S   + P + +P+ 
Sbjct  74   LEELYKPFFP---------KVQQQRPRGSPSCPSPAAVAGPHQPPPSRQSQRPPSQIPRS  124

Query  508  KRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQ  687
            KRRKN+ K+VV  VP + +  D WAWRKYGQKPIKGSPYPR YYRCSSSKGCLARKQVE+
Sbjct  125  KRRKNQQKKVVCHVPTDGISSDVWAWRKYGQKPIKGSPYPRGYYRCSSSKGCLARKQVER  184

Query  688  SNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKF  792
            S +   MFI+TYTAEH+H  PT RN+LAG+ R+KF
Sbjct  185  SPADPAMFIITYTAEHNHPVPTHRNTLAGSTRHKF  219



>ref|XP_009343870.1| PREDICTED: probable WRKY transcription factor 29 isoform X2 [Pyrus 
x bretschneideri]
Length=315

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 108/270 (40%), Positives = 145/270 (54%), Gaps = 45/270 (17%)
 Frame = +1

Query  328   LEELYKPF------IQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPN  489
             LEELYKPF        P   ++ +  V QE      +  ++       +++S+PV     
Sbjct  59    LEELYKPFYPVFQLTTPPTILTSSISVPQEIITQAPKLIKN-------MEESTPV-----  106

Query  490   NYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLA  669
                 + + RKN++KRVV +V AE+L  D WAWRKYGQKPIKGSPYPRSYYRCSSSKGC A
Sbjct  107   ----RKRIRKNQNKRVVKEVKAEDLFSDVWAWRKYGQKPIKGSPYPRSYYRCSSSKGCSA  162

Query  670   RKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPEL  849
             RKQVE+S S    FI+TYTAEH+H  PTRRNSLAG+ R+KFP +                
Sbjct  163   RKQVERSCSNPETFIITYTAEHNHVHPTRRNSLAGSTRSKFPSSKNKD------------  210

Query  850   VAASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQ--VAMD---NED  1014
                 S+ +SP   N  A  E   E  +   +       ++S+Q  +S+    +D   N++
Sbjct  211   -KCGSSSNSPATPNIAASIEDDREFVESMSINAVKVEAKLSEQDEISKEIFLLDTTVNDE  269

Query  1015  FFAGLEDLDGLI-----SYFSYSSQCNYPS  1089
              F   EDLD  +      +FS     N+PS
Sbjct  270   IFPSFEDLDRKLEPVMDGWFSDEFSDNFPS  299



>gb|AGQ04236.1| WRKY transcription factor 45 [Jatropha curcas]
 gb|KDP25380.1| hypothetical protein JCGZ_20536 [Jatropha curcas]
Length=224

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 123/201 (61%), Gaps = 8/201 (4%)
 Frame = +1

Query  463   SSPVLEAPNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyr  642
             +SPV+        K KRRKN+ KRVV  V  + L  D WAWRKYGQKPIKGSPYPRSYYR
Sbjct  18    ASPVIATDATMAAKLKRRKNQQKRVVKHVTEDGLSSDMWAWRKYGQKPIKGSPYPRSYYR  77

Query  643   csssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAED  822
             CSS KGCLARKQVE+S+S   +FI+ YT EHSH+ PTRRNSLAG+ R K   A +A A +
Sbjct  78    CSSLKGCLARKQVERSSSDPSIFIINYTGEHSHAHPTRRNSLAGSTRIKSTMAKQAVAIN  137

Query  823   STAHHVPELVAASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAM  1002
                +++  +    +  SS T  +  +  E +   +   +  E+ QV+   D  G +++ M
Sbjct  138   E-PNNMQNIKKDETFPSSSTTPSMTSTEEDQLMQNVRIKNEEEEQVL---DDGGSNEIPM  193

Query  1003  DN----EDFFAGLEDLDGLIS  1053
              +    +D F  LED +GL +
Sbjct  194   QDIVFTDDMFPSLEDFEGLFN  214



>ref|XP_010925829.1| PREDICTED: probable WRKY transcription factor 27 [Elaeis guineensis]
Length=371

 Score =   131 bits (329),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 108/242 (45%), Positives = 130/242 (54%), Gaps = 46/242 (19%)
 Frame = +1

Query  163  EDNWGLQAIVQQPPLMAS-------SEFT----LQSCHDYLFDFSQENV------LNFDD  291
            +DNW L A+V+    M S       S F     L +    L D  +         L F D
Sbjct  3    DDNWDLHAVVRSCRFMGSASTMDPFSSFPPPSDLLAEETGLMDGGEGGGGSGGLPLCFPD  62

Query  292  FVRTAMVPDDALLEELYKPFI-----QP----------AASISFTGEVKQEAAVHqmqqq  426
               +  V  +  LEEL KPF+     QP          +A +S TG      AV   QQQ
Sbjct  63   MFESRSVLQE--LEELCKPFLPKAQQQPQRSGPSSPPSSAVLSVTGAASLVPAVGATQQQ  120

Query  427  qDGDVKKSGLDKSSPVLEAPNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKP  606
            Q     +            P + + + KRRKN+ KRVV QVPA+ L  D WAWRKYGQKP
Sbjct  121  QSRQPHR------------PPSQISRSKRRKNQQKRVVCQVPADGLSSDMWAWRKYGQKP  168

Query  607  IKGspyprsyyrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRN  786
            IKGSPYPR YYRCSSSKGCLARKQVE+S +   MF++TYTAEH+H  PT RNSLAG+ R 
Sbjct  169  IKGSPYPRGYYRCSSSKGCLARKQVERSRTDPAMFVITYTAEHNHPLPTHRNSLAGSTRQ  228

Query  787  KF  792
            KF
Sbjct  229  KF  230



>ref|XP_009343869.1| PREDICTED: probable WRKY transcription factor 29 isoform X1 [Pyrus 
x bretschneideri]
Length=316

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 109/270 (40%), Positives = 144/270 (53%), Gaps = 44/270 (16%)
 Frame = +1

Query  328   LEELYKPF------IQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPN  489
             LEELYKPF        P   ++ +  V QE      +  ++       +++S+PV     
Sbjct  59    LEELYKPFYPVFQLTTPPTILTSSISVPQEIITQAPKLIKN-------MEESTPVR----  107

Query  490   NYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLA  669
                 K   RKN++KRVV +V AE+L  D WAWRKYGQKPIKGSPYPRSYYRCSSSKGC A
Sbjct  108   ----KRISRKNQNKRVVKEVKAEDLFSDVWAWRKYGQKPIKGSPYPRSYYRCSSSKGCSA  163

Query  670   RKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPEL  849
             RKQVE+S S    FI+TYTAEH+H  PTRRNSLAG+ R+KFP +                
Sbjct  164   RKQVERSCSNPETFIITYTAEHNHVHPTRRNSLAGSTRSKFPSSKNKD------------  211

Query  850   VAASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQ--VAMD---NED  1014
                 S+ +SP   N  A  E   E  +   +       ++S+Q  +S+    +D   N++
Sbjct  212   -KCGSSSNSPATPNIAASIEDDREFVESMSINAVKVEAKLSEQDEISKEIFLLDTTVNDE  270

Query  1015  FFAGLEDLDGLI-----SYFSYSSQCNYPS  1089
              F   EDLD  +      +FS     N+PS
Sbjct  271   IFPSFEDLDRKLEPVMDGWFSDEFSDNFPS  300



>ref|XP_002513635.1| hypothetical protein RCOM_1581940 [Ricinus communis]
 gb|EEF49038.1| hypothetical protein RCOM_1581940 [Ricinus communis]
Length=459

 Score =   131 bits (330),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 94/134 (70%), Gaps = 4/134 (3%)
 Frame = +1

Query  496  VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
            V + +++K+  KR V QV AE LC D WAWRKYGQKPIKGSPYPR+YYRCSSSKGC ARK
Sbjct  209  VSRSRKKKSHIKRQVTQVTAENLCNDVWAWRKYGQKPIKGSPYPRNYYRCSSSKGCAARK  268

Query  676  QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVA  855
            QVE+SN    MFIV+YT +H+H +PT RNSLAG+ RNKFP   K +A  +     PE   
Sbjct  269  QVERSNIDPNMFIVSYTGDHTHPRPTHRNSLAGSTRNKFPSLQKTSATTNKESDEPEKAP  328

Query  856  ASSALS----SPTA  885
             SS LS    SPT 
Sbjct  329  CSSPLSVTSFSPTT  342



>gb|ACV92025.1| WRKY transcription factor 23 [(Populus tomentosa x Populus bolleana) 
x Populus tomentosa]
Length=350

 Score =   129 bits (325),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 117/195 (60%), Gaps = 13/195 (7%)
 Frame = +1

Query  472   VLEAPNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcss  651
             V  + N++ P+ KRRKN+ K+V  QVP   L  D WAWRKYGQKPIKGSPYPR YYRCSS
Sbjct  134   VTSSANSHTPRSKRRKNQLKKVC-QVPVAALSSDVWAWRKYGQKPIKGSPYPRGYYRCSS  192

Query  652   sKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTA  831
             SKGCLARKQVE++ S  GMFIVTYTAEH+H  PT RNSLAG+ R K        A D + 
Sbjct  193   SKGCLARKQVERNRSDPGMFIVTYTAEHNHPAPTHRNSLAGSTRQKTSTPQTGKANDPSK  252

Query  832   HHVPELVAASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQ----SGVSQVA  999
                P     SS  +S          E+  +   + EL  + + +   D      G S +A
Sbjct  253   PSSPAKPTCSSPATS-------LEDELLAQSTSNTELSREDKDITEDDDEDEIGGFSDIA  305

Query  1000  MDNEDFFAGLEDLDG  1044
             + ++DFFAGLE+  G
Sbjct  306   V-SDDFFAGLEEFVG  319



>ref|XP_008375964.1| PREDICTED: probable WRKY transcription factor 29 [Malus domestica]
Length=316

 Score =   128 bits (322),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 110/270 (41%), Positives = 145/270 (54%), Gaps = 44/270 (16%)
 Frame = +1

Query  328   LEELYKPF------IQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPN  489
             LEELYKPF        P   ++ +  V QE      +  ++       +++S+PV     
Sbjct  59    LEELYKPFYPVFQLTTPPTILTSSISVPQEIITLAPKLIKN-------MEESTPVR----  107

Query  490   NYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLA  669
                 K   RKN++KRVV +V AE+L  D WAWRKYGQKPIKGSPYPRSYYRCSSSKGC A
Sbjct  108   ----KRISRKNQNKRVVKEVKAEDLFSDVWAWRKYGQKPIKGSPYPRSYYRCSSSKGCSA  163

Query  670   RKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPEL  849
             RKQVE+S S    FI+TYTAEH+H  PTRRNSLAG+ R+KF  +                
Sbjct  164   RKQVERSCSNPETFIITYTAEHNHVYPTRRNSLAGSTRSKFSSSKNKD------------  211

Query  850   VAASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQ--VAMD---NED  1014
                 S+L+SP   N  A  E   E  +   +       ++S+Q  +S+    +D   N++
Sbjct  212   -KCGSSLNSPATPNIAASIEDDREFVESVNINAVKVEAKLSEQDEISKENFFLDTTVNDE  270

Query  1015  FFAGLEDLDGLI-----SYFSYSSQCNYPS  1089
              F  LEDLD  +      +FS     N+PS
Sbjct  271   IFPSLEDLDRKLEPVMDGWFSDEFSDNFPS  300



>gb|AIY62484.1| WRKY113 [Gossypium aridum]
Length=397

 Score =   130 bits (326),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 119/200 (60%), Gaps = 19/200 (10%)
 Frame = +1

Query  496   VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
              P+ ++RKN+ KR V  V A++L  D WAWRKYGQKPIKGSPYPR+YYRCSSSKGC ARK
Sbjct  165   TPRSRKRKNQQKRTVCHVTADKLSSDPWAWRKYGQKPIKGSPYPRNYYRCSSSKGCSARK  224

Query  676   QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVK-AAAEDSTAHHVP--E  846
             QVE+SN  + +FI+TYT EH+H +PT RNSLAG+ RNK  P  K    +DS A  +P   
Sbjct  225   QVERSNLDSDIFIITYTGEHTHPKPTHRNSLAGSTRNKLSPVQKPTTTKDSAAETIPTTS  284

Query  847   LVAASSALS-------SPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSG-------  984
              V+ SS  S       SPT     A  +         + G + + V M  +S        
Sbjct  285   TVSCSSPRSATSLSPISPT-TTLSAPEDTAAAVHKTGDNGGEEESVYMDVESDEDDDDLL  343

Query  985   VSQVAMDNEDFFAGLEDLDG  1044
             +  V +D ED F GLE+L G
Sbjct  344   IPNVHVD-EDLFKGLEELVG  362



>ref|XP_007099721.1| WRKY DNA-binding protein 27, putative [Theobroma cacao]
 gb|EOY20308.1| WRKY DNA-binding protein 27, putative [Theobroma cacao]
Length=545

 Score =   130 bits (328),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 97/209 (46%), Positives = 123/209 (59%), Gaps = 14/209 (7%)
 Frame = +1

Query  487   NNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCL  666
             N+  P+ ++RKN+ KR V  V  + L  D WAWRKYGQKPIKGSPYPR+YYRCSSSKGC 
Sbjct  309   NSQAPRSRKRKNQQKRTVCHVAVDNLSSDPWAWRKYGQKPIKGSPYPRNYYRCSSSKGCA  368

Query  667   ARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPE  846
             ARKQVE+SN    +FIVTYT +H+H +PT RNSLAG+ RNK     KAA++DS    +P 
Sbjct  369   ARKQVERSNFDPNIFIVTYTGDHTHPRPTHRNSLAGSTRNKLSTIQKAASKDSAPEALPS  428

Query  847   LVAAS--SALS-SPTANNWRAGSEIKdeddddeeLGEKMQVVEM---------SDQSGVS  990
                +S  SA S SPT            + + D   G + + V+M         SD+    
Sbjct  429   ASCSSPRSATSLSPTTPLSAPEDAAAPQHNTDGINGGEEESVDMTLETALDGESDEDDDP  488

Query  991   QVAMD--NEDFFAGLEDLDGLISYFSYSS  1071
              +  D  +ED F GLE+L G     S SS
Sbjct  489   LIPNDHVDEDLFKGLEELVGGADAGSTSS  517



>ref|XP_009363390.1| PREDICTED: probable WRKY transcription factor 29 [Pyrus x bretschneideri]
Length=316

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 106/162 (65%), Gaps = 21/162 (13%)
 Frame = +1

Query  328  LEELYKPF------IQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPN  489
            LEELYKPF        P   ++ +  V QE      +  ++       +++S+PV     
Sbjct  59   LEELYKPFYPVFQLTTPPTILTSSISVPQEIITQAPKLIKN-------MEESTPVR----  107

Query  490  NYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLA  669
                K   RKN++KRVV +V AE+L  D WAWRKYGQKPIKGSPYPRSYYRCSSSKGC A
Sbjct  108  ----KRISRKNQNKRVVKEVKAEDLFSDVWAWRKYGQKPIKGSPYPRSYYRCSSSKGCSA  163

Query  670  RKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFP  795
            RKQVE+S S    FI+TYTAEH+H  PTRRNSLAG+ R+KFP
Sbjct  164  RKQVERSCSNPETFIITYTAEHNHVHPTRRNSLAGSTRSKFP  205



>ref|XP_008363283.1| PREDICTED: probable WRKY transcription factor 29 isoform X2 [Malus 
domestica]
Length=253

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 106/168 (63%), Gaps = 30/168 (18%)
 Frame = +1

Query  322  ALLEELYKPF------IQP----AASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSP  471
            A LEELYKPF        P    A+SIS   EV  EA                 + +S+P
Sbjct  57   AELEELYKPFYPVNQITSPPTILASSISVPQEVITEAPKLIK-----------NMKESAP  105

Query  472  VLEAPNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcss  651
            + +         + RKN++KRV  +V AE+L  D WAWRKYGQKPIKGSP+PRSYYRCSS
Sbjct  106  ICK---------RIRKNQNKRVXKEVKAEDLFSDVWAWRKYGQKPIKGSPHPRSYYRCSS  156

Query  652  sKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFP  795
            SKGC ARKQVE+S S    FI+TYTAEH+H  PTRRNSLAG+ R+KFP
Sbjct  157  SKGCSARKQVERSCSNPETFIITYTAEHNHVHPTRRNSLAGSTRSKFP  204



>ref|XP_011022614.1| PREDICTED: WRKY transcription factor 22-like [Populus euphratica]
Length=330

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 104/263 (40%), Positives = 136/263 (52%), Gaps = 45/263 (17%)
 Frame = +1

Query  139  LMGECIGFEDNWGLQAIVQQ----------------PPLMASSEFTLQSCHDYLFDFSQE  270
            +M E +  ED+W L A+V+                 P L A   F      D L +F QE
Sbjct  1    MMSEFVCMEDSWDLHAVVRSGSSTNYEDFANITNNSPSLFAPLSFY----QDELLNF-QE  55

Query  271  NVLNFDDFVRTAMVPDDALLEELYKP--------FIQPAASISFTGEVKQEAAVHqmqqq  426
            N  +FD             L+ LYKP        F  P ++I  T       +V +  ++
Sbjct  56   NPTDFDG------------LDGLYKPLHPLLHQTFNSPQSNILSTSISTASISVPKEVKE  103

Query  427  qDGDVKKSGLDKSSPVL--EAPNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQ  600
            +    KK  +   S             K KRRKN+HK+VV  V  + L  D WAWRKYGQ
Sbjct  104  RQKVQKKKPVSSESATFANTVDATRAAKSKRRKNQHKKVVQHVKEDGLSSDMWAWRKYGQ  163

Query  601  KPIKGspyprsyyrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTI  780
            KPIKGSPYPRSYYRCSS KGCLARKQ+E+S +    FI+TYTAEHSH+ PTRR+SLAG+ 
Sbjct  164  KPIKGSPYPRSYYRCSSLKGCLARKQMERSRTDPSTFIITYTAEHSHAHPTRRSSLAGST  223

Query  781  RNKFPPAVKAAAEDSTAHHVPEL  849
            R K  P++   A  +   ++P +
Sbjct  224  RIK--PSMPKEATKNIEPNMPTI  244



>ref|XP_008363282.1| PREDICTED: probable WRKY transcription factor 29 isoform X1 [Malus 
domestica]
Length=254

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 105/168 (63%), Gaps = 29/168 (17%)
 Frame = +1

Query  322  ALLEELYKPF------IQP----AASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSP  471
            A LEELYKPF        P    A+SIS   EV  EA                 + +S+P
Sbjct  57   AELEELYKPFYPVNQITSPPTILASSISVPQEVITEAPKLIK-----------NMKESAP  105

Query  472  VLEAPNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcss  651
            +         K   RKN++KRV  +V AE+L  D WAWRKYGQKPIKGSP+PRSYYRCSS
Sbjct  106  IC--------KRISRKNQNKRVXKEVKAEDLFSDVWAWRKYGQKPIKGSPHPRSYYRCSS  157

Query  652  sKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFP  795
            SKGC ARKQVE+S S    FI+TYTAEH+H  PTRRNSLAG+ R+KFP
Sbjct  158  SKGCSARKQVERSCSNPETFIITYTAEHNHVHPTRRNSLAGSTRSKFP  205



>ref|XP_004308337.1| PREDICTED: WRKY transcription factor 22-like [Fragaria vesca 
subsp. vesca]
Length=399

 Score =   128 bits (321),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 102/221 (46%), Positives = 127/221 (57%), Gaps = 19/221 (9%)
 Frame = +1

Query  454   LDKSSPVLEAPNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprs  633
             L K  P L A  N   + K+RKN  K+V  QVPAE L  D WAWRKYGQKPIKGSPYPR 
Sbjct  186   LHKHQPKLSA-TNTTQRSKKRKNLLKKVC-QVPAESLSSDVWAWRKYGQKPIKGSPYPRG  243

Query  634   yyrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK---FPPAV  804
             YYRCSSSKGC+ARKQVE+  S  GMFIVTYTAEH+H  PT RNSLAG+ R+K    P + 
Sbjct  244   YYRCSSSKGCMARKQVERHRSDPGMFIVTYTAEHNHPAPTHRNSLAGSTRHKPVSSPQSG  303

Query  805   KAAAEDSTAHHVPELVAASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSG  984
                  DST    P+  + SS  +S       A  E+       +   EK   +   D++ 
Sbjct  304   SVTGGDSTK---PKGGSPSSPATS-------AEEEVGRSVTMMDAKEEKQSPLADEDETE  353

Query  985   VSQV--AMDNEDFFAGLEDLDGLISYFSYSSQCNYPSMFSS  1101
               +V   +  +DFF GL+ L G   YFS  S  ++   +S+
Sbjct  354   FFRVCDTIVTDDFFVGLDGLAG--DYFSDHSTASFGGPWST  392



>ref|XP_008239089.1| PREDICTED: probable WRKY transcription factor 29 [Prunus mume]
Length=294

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 114/308 (37%), Positives = 156/308 (51%), Gaps = 67/308 (22%)
 Frame = +1

Query  166   DNWGLQAIVQQPPLMASSEFTLQSCHDYLFDFSQENVLNFDDFVR--------TAMVPDD  321
             +NW LQA+V+     A+ +  +++     + F+  ++   DDF          TA + + 
Sbjct  2     ENWDLQAVVRGCNTTANIDEAMENSQ-IPYCFAPLSIEEEDDFFHALPQLFEATAALDE-  59

Query  322   ALLEELYKPF---IQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPNN  492
               LEELYKPF   +QP+                                 + P++ A + 
Sbjct  60    --LEELYKPFYPVLQPS---------------------------------TPPIIVASSM  84

Query  493   YVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLAR  672
              VP+ +    E KRVV +V AEEL  D WAWRKYGQKPIKGSPYPRSYYRCSSSKGCLAR
Sbjct  85    SVPQ-EAITVESKRVVKEVRAEELFSDVWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLAR  143

Query  673   KQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELV  852
             KQVE+S S    FI+TYTAEH+H  PTRRNSLAG+ R+KFP +                 
Sbjct  144   KQVERSCSNPETFIITYTAEHNHVHPTRRNSLAGSTRSKFPSSKNKG-------------  190

Query  853   AASSALSSPTANNWRAGSE--IKdeddddeeLGEKMQVVEMSDQSGVSQVAMD---NEDF  1017
                S+L+SP   N  A  E     +      + E+ Q++   D+     V +D   +++ 
Sbjct  191   KCKSSLNSPAMTNLAASIEEDPDVQSASTNAVKEEAQLLLEEDEISHENVMLDVMLSDEM  250

Query  1018  FAGLEDLD  1041
                LE+LD
Sbjct  251   IPSLENLD  258



>gb|KHG04290.1| WRKY transcription factor 22 -like protein [Gossypium arboreum]
Length=335

 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 117/194 (60%), Gaps = 20/194 (10%)
 Frame = +1

Query  502   KFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQV  681
             + KRRKN+ K+V  QVP E L  D W+WRKYGQKPIKGSPYPR YYRCS+SKGCLARKQV
Sbjct  134   RSKRRKNQLKKVC-QVPTEGLSSDVWSWRKYGQKPIKGSPYPRGYYRCSTSKGCLARKQV  192

Query  682   EQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAAS  861
             E+S +   MFIVTYTAEH+H  PT RNSLAG+ R K   +    A DS    V    A S
Sbjct  193   ERSRTNPAMFIVTYTAEHNHPAPTHRNSLAGSTRQKPFTSQTPTAGDS-VKPVSAKPAGS  251

Query  862   SALSSPT-----ANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFAG  1026
             S+L++         N +AGS             E +   E  D  G+S  A+ ++DFF G
Sbjct  252   SSLTTSVDEELMVQNTKAGSR------------EDLVEDEGEDDFGMSDTAV-SDDFFEG  298

Query  1027  LEDLDGLISYFSYS  1068
             LE +  +++   +S
Sbjct  299   LEGIADMVTGNCFS  312



>ref|XP_010055079.1| PREDICTED: WRKY transcription factor 22-like isoform X2 [Eucalyptus 
grandis]
Length=357

 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 89/179 (50%), Positives = 111/179 (62%), Gaps = 10/179 (6%)
 Frame = +1

Query  508   KRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQ  687
             KRRKN+ K+V   VPAE L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGCLARKQVE+
Sbjct  153   KRRKNQLKKVC-HVPAESLSSDIWAWRKYGQKPIKGSPYPRGYYRCSSSKGCLARKQVER  211

Query  688   SNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK--FPPAVKAAAEDSTAHHVPELVAAS  861
             + S  GMF+VTYTAEH+H  PT RNSLAG+ R K   P         + A   P   + +
Sbjct  212   NRSDPGMFVVTYTAEHNHPAPTHRNSLAGSTRQKPVMPQTDTVEDPSAAASTKPPCSSPT  271

Query  862   SALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFAGLEDL  1038
             ++L    A      +E +++ +        M   E    +G+S +AM ++DFF GLE L
Sbjct  272   TSLEEEVAKTQSTNTESREDKEG------SMADDEEDGDAGLSDMAM-SDDFFVGLEGL  323



>ref|XP_007211114.1| hypothetical protein PRUPE_ppa025013mg [Prunus persica]
 gb|EMJ12313.1| hypothetical protein PRUPE_ppa025013mg [Prunus persica]
Length=283

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 104/221 (47%), Positives = 132/221 (60%), Gaps = 35/221 (16%)
 Frame = +1

Query  166  DNWGLQAIVQQPPLMASSEFTLQSCHDYLFDFSQENVLNFDDFVR--------TAMVPDD  321
            +NW LQA+V+     A+ +  +++     + F+  ++   DDF          TA + + 
Sbjct  2    ENWDLQAVVRGCNTTANIDEAMENSQ-IPYCFAPLSIEEEDDFFHALPQLFEATAALDE-  59

Query  322  ALLEELYKPF---IQPAAS---ISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEA  483
              LEELYKPF   +QP+A    ++ +  V QEA           +V K  L +SS V   
Sbjct  60   --LEELYKPFYPVLQPSAPPVILASSMSVPQEAIT--------VEVPKK-LKESSTVC--  106

Query  484  PNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGC  663
                  K   RKN+ KRVV +V AEEL  D WAWRKYGQKPIKGSPYPRSYYRCSSSKGC
Sbjct  107  ------KKISRKNQSKRVVKEVRAEELFSDVWAWRKYGQKPIKGSPYPRSYYRCSSSKGC  160

Query  664  LARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRN  786
             ARKQVE+S S    FI+TYTAEH+H  PTRRNSLAG+ R+
Sbjct  161  SARKQVERSCSNPETFIITYTAEHNHVHPTRRNSLAGSTRS  201



>ref|XP_011029360.1| PREDICTED: WRKY transcription factor 22-like [Populus euphratica]
Length=334

 Score =   126 bits (317),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 100/239 (42%), Positives = 140/239 (59%), Gaps = 20/239 (8%)
 Frame = +1

Query  361   AASISFTGEVKQEAAVHqmqqqqD-GDVKKSGLDKSSPVLEAPNNYVPKFKRRKNEHKRV  537
              AS+S   EVK+   V + +   +      S  D +S           K KRR+N+HKRV
Sbjct  104   TASMSVRKEVKERPKVQKKKPLSEPATCPNSSTDATS---------TAKSKRRENQHKRV  154

Query  538   VVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNSAAGMFIV  717
             V  V  + L  D WAWRKYGQKPIKGSPYPRSYYRCSS KGCLARKQVE+S++   +FI+
Sbjct  155   VQHVKEDGLSSDMWAWRKYGQKPIKGSPYPRSYYRCSSLKGCLARKQVERSSTDPSIFII  214

Query  718   TYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAASS----ALSSPTA  885
             TYTAEHSH++PTRR+SLAG+ R K   A+      S   ++P +    S     L SPT 
Sbjct  215   TYTAEHSHARPTRRSSLAGSTRIKR-DAIPKGTTPSIEPNMPTIKDQRSPNFDGLISPTT  273

Query  886   NNWRAGSE--IKdeddddeeLGEKMQVVEMSDQSGV--SQVAMDNEDFFAGLEDLDGLI  1050
              +  +  +  +++  + +EEL +  Q++E ++   +    V   ++D F  LEDL+G +
Sbjct  274   PSMTSIEDEFVQNLSNKNEELLDHGQILEENESKEIFFPDVVF-SDDLFPTLEDLEGFL  331



>ref|XP_011026978.1| PREDICTED: WRKY transcription factor 22-like [Populus euphratica]
Length=334

 Score =   126 bits (316),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 124/191 (65%), Gaps = 10/191 (5%)
 Frame = +1

Query  502   KFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQV  681
             K KRR+N+HKRVV  V  + L  D WAWRKYGQKPIKGSPYPRSYYRCSS KGCLARKQV
Sbjct  143   KSKRRENQHKRVVQHVKEDGLSSDMWAWRKYGQKPIKGSPYPRSYYRCSSLKGCLARKQV  202

Query  682   EQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAAS  861
             E+S++   +FI+TYTAEHSH++PTRR+SLAG+ R K   A+      S   ++P +    
Sbjct  203   ERSSTDPSIFIITYTAEHSHARPTRRSSLAGSTRIKR-DAIPKGTTPSIEPNMPTIKDQR  261

Query  862   S----ALSSPTANNWRAGSE--IKdeddddeeLGEKMQVVEMSDQSGV--SQVAMDNEDF  1017
             S     L SPT  +  +  +  +++  + +EEL +  Q++E ++   +    V   ++D 
Sbjct  262   SPNFDGLISPTTPSMTSIEDEFVQNLSNKNEELLDHGQILEENESKEIFFPDVVF-SDDL  320

Query  1018  FAGLEDLDGLI  1050
             F  LEDL+G +
Sbjct  321   FPTLEDLEGFL  331



>gb|KDO86314.1| hypothetical protein CISIN_1g019126mg [Citrus sinensis]
Length=346

 Score =   126 bits (316),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 102/247 (41%), Positives = 139/247 (56%), Gaps = 19/247 (8%)
 Frame = +1

Query  328   LEELYKPFI----QPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLD-KSSPVLEAPNN  492
             L ELYKPF     QP +  S        +++     ++    K+   + K S      ++
Sbjct  79    LHELYKPFFPKSPQPISPKSSQPISSSISSITSSSSKEQTQFKQQQPNNKQSHASSVTSS  138

Query  493   YVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLAR  672
               P+ KRRKN+ KRV   VPAE L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGCLAR
Sbjct  139   TTPRTKRRKNQLKRVC-HVPAEGLSSDVWAWRKYGQKPIKGSPYPRGYYRCSSSKGCLAR  197

Query  673   KQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK-FPPAVKAAAEDSTAHHVPEL  849
             KQVE++ S  GMFIVTYTAEH+H  PT RNSLAG+ R K F P    +++ +        
Sbjct  198   KQVERNRSDPGMFIVTYTAEHNHPAPTHRNSLAGSTRQKPFTPQTVTSSDSNKP------  251

Query  850   VAASSALSSPTANNWRAGSEIKdeddddeeLGEK----MQVVEMSDQSGVSQVAMDNEDF  1017
              ++ ++ + PT ++    + ++++        E     +   E   +  VS V + ++DF
Sbjct  252   -SSPTSSTKPTFSSLSPATSMEEDTVPQSTNTESREIDLLEDEEEVELAVSDVGI-SDDF  309

Query  1018  FAGLEDL  1038
             F GLE L
Sbjct  310   FVGLEGL  316



>ref|XP_006444950.1| hypothetical protein CICLE_v10020943mg [Citrus clementina]
 ref|XP_006491188.1| PREDICTED: WRKY transcription factor 22-like [Citrus sinensis]
 gb|ESR58190.1| hypothetical protein CICLE_v10020943mg [Citrus clementina]
Length=346

 Score =   126 bits (316),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 102/247 (41%), Positives = 140/247 (57%), Gaps = 19/247 (8%)
 Frame = +1

Query  328   LEELYKPFI----QPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLD-KSSPVLEAPNN  492
             L ELYKPF     QP +  S        ++++    ++    K+   + K S      ++
Sbjct  79    LHELYKPFFPKSPQPISPKSSQPISSSISSINSSSSKEQTQFKQQQPNNKQSHASSVTSS  138

Query  493   YVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLAR  672
               P+ KRRKN+ KRV   VPAE L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGCLAR
Sbjct  139   TTPRTKRRKNQLKRVC-HVPAEGLSSDVWAWRKYGQKPIKGSPYPRGYYRCSSSKGCLAR  197

Query  673   KQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK-FPPAVKAAAEDSTAHHVPEL  849
             KQVE++ S  GMFIVTYTAEH+H  PT RNSLAG+ R K F P    +++ +        
Sbjct  198   KQVERNRSDPGMFIVTYTAEHNHPAPTHRNSLAGSTRQKPFTPQTVTSSDSNKP------  251

Query  850   VAASSALSSPTANNWRAGSEIKdeddddeeLGEK----MQVVEMSDQSGVSQVAMDNEDF  1017
              ++ ++ + PT ++    + ++++        E     +   E   +  VS V + ++DF
Sbjct  252   -SSPTSSTKPTFSSLSPATSMEEDTVPQSTNTESREIDLLEDEEEVELAVSDVGI-SDDF  309

Query  1018  FAGLEDL  1038
             F GLE L
Sbjct  310   FVGLEGL  316



>gb|AIE43844.1| WRKY transcription factor 57 [Gossypium hirsutum]
Length=349

 Score =   126 bits (316),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 114/191 (60%), Gaps = 19/191 (10%)
 Frame = +1

Query  502   KFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQV  681
             K ++RKN+ KR V  V A+ L  D WAWRKYGQKPIKGSPYPR+YYRCSSSKGC ARKQV
Sbjct  127   KPRKRKNQQKRTVCHVTADNLSSDPWAWRKYGQKPIKGSPYPRNYYRCSSSKGCSARKQV  186

Query  682   EQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFP-------PAVKAAAEDSTAHHV  840
             E+SN    +FIVTYT +H+H +PT RNSLAG+ RNK         PA  + +   T   V
Sbjct  187   ERSNLEPNVFIVTYTGDHTHPRPTHRNSLAGSTRNKLSTFQRAAAPATASCSTSPTTVSV  246

Query  841   PELVAASSALSSPTANNWRAGSEIKdeddddeeLGEKMQ---VVEMSDQSGVSQVAMDNE  1011
             PE  AA         NN  AG     +D+  + +  +M    V +  D   +  V +D +
Sbjct  247   PEGTAAD-------LNN-NAGDNGDGDDESADNIAPEMSPEAVSDAEDDLLIPDVHVD-D  297

Query  1012  DFFAGLEDLDG  1044
             D F GLE+L G
Sbjct  298   DLFKGLEELVG  308



>ref|XP_007218198.1| hypothetical protein PRUPE_ppa007745mg [Prunus persica]
 gb|EMJ19397.1| hypothetical protein PRUPE_ppa007745mg [Prunus persica]
Length=357

 Score =   126 bits (316),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 115/196 (59%), Gaps = 14/196 (7%)
 Frame = +1

Query  499   PKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQ  678
             P+ K+RKN+ K+V  QVPAE L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGC+ARKQ
Sbjct  159   PRSKKRKNQLKKVC-QVPAESLSADIWAWRKYGQKPIKGSPYPRGYYRCSSSKGCMARKQ  217

Query  679   VEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK-FPPAVKAAAEDSTAHHVPELVA  855
             VE++ S   MFIVTYTAEH+H  PT RNSLAG+ R K F P       DST    P    
Sbjct  218   VERNRSDPNMFIVTYTAEHNHPAPTHRNSLAGSTRQKPFSPQT-VTGSDSTKPTSP--AT  274

Query  856   ASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFAGLED  1035
             ++S    P           K+E        +  ++  M D       ++ ++DFF GLE 
Sbjct  275   SASVDEDPVVPQSTTMESFKEEKGSPMVDDDDDELFGMCD-------SVVSDDFFVGLEG  327

Query  1036  LDGLISYFSYSSQCNY  1083
             L G   YFS  S  ++
Sbjct  328   LAG--DYFSDHSPTSF  341



>ref|XP_009406781.1| PREDICTED: WRKY transcription factor 22-like [Musa acuminata 
subsp. malaccensis]
Length=373

 Score =   126 bits (316),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +1

Query  496  VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
             P+ KRRKN+ K+VV QVPA+    D WAWRKYGQKPIKGSPYPR YYRCSSSKGC ARK
Sbjct  131  TPRSKRRKNQQKKVVCQVPADGASSDMWAWRKYGQKPIKGSPYPRGYYRCSSSKGCQARK  190

Query  676  QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAA  813
            QVE++    G+ ++TYTAEH+H  PT RNSL+G+ R KFPP   +A
Sbjct  191  QVERNREDPGILVITYTAEHNHPVPTHRNSLSGSTRQKFPPTGSSA  236



>ref|XP_007143479.1| hypothetical protein PHAVU_007G075400g [Phaseolus vulgaris]
 gb|ESW15473.1| hypothetical protein PHAVU_007G075400g [Phaseolus vulgaris]
Length=315

 Score =   125 bits (313),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +1

Query  496  VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
             PK ++RK++ K++V QV A+ L  D WAWRKYGQKPIKGSPYPR+YYRCSSSKGC+ARK
Sbjct  157  TPKSRKRKSQQKKMVCQVTADNLSADLWAWRKYGQKPIKGSPYPRNYYRCSSSKGCMARK  216

Query  676  QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK  789
            QVE+SN+   MFIVTYT +HSH +PT RNSLAG+ RNK
Sbjct  217  QVERSNTETDMFIVTYTGDHSHPRPTHRNSLAGSTRNK  254



>ref|XP_010053762.1| PREDICTED: WRKY transcription factor 22 [Eucalyptus grandis]
Length=339

 Score =   125 bits (314),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 107/250 (43%), Positives = 139/250 (56%), Gaps = 19/250 (8%)
 Frame = +1

Query  328   LEELYKPFIQPAASISFTGEVKQE-----AAVHqmqqqqDGDVKKSGLDKSSPVLE-AP-  486
             L ELYKPF+ PA    F+           A          G ++K     +S +   AP 
Sbjct  67    LHELYKPFL-PAYGPLFSHRSSLSVSSPLAVEGAKSSSSAGLMQKRPFQSASAIAPLAPF  125

Query  487   --NNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKG  660
               ++  P+ K+RK++ K VV QVPAE++  D+WAWRKYGQKPIKGSPYPRSYYRCSSSKG
Sbjct  126   KTSSSAPRSKKRKSQMK-VVRQVPAEKVSSDEWAWRKYGQKPIKGSPYPRSYYRCSSSKG  184

Query  661   CLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDS--TAH  834
             CLARKQVE++ S  G+FIVTYT+EH+H  PT R+SLAG+ R K        + DS  TA 
Sbjct  185   CLARKQVERNRSDPGIFIVTYTSEHNHVAPTHRSSLAGSTRPKTSTPETEVSVDSAATAT  244

Query  835   HVPELVAASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNED  1014
               P       A   P + +  +G E +            M   +  D++G S  A  ++D
Sbjct  245   TTPGTSGEEEAAHVPQSTSSESGEEKEYSQSSS------MLDNDGEDETGGSSGAALSDD  298

Query  1015  FFAGLEDLDG  1044
             FF GLE L G
Sbjct  299   FFVGLEGLLG  308



>ref|XP_008232978.1| PREDICTED: WRKY transcription factor 22 [Prunus mume]
Length=361

 Score =   125 bits (315),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 115/196 (59%), Gaps = 14/196 (7%)
 Frame = +1

Query  499   PKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQ  678
             P+ K+RKN+ K+V  QVPAE L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGC+ARKQ
Sbjct  163   PRSKKRKNQLKKVC-QVPAESLSADIWAWRKYGQKPIKGSPYPRGYYRCSSSKGCMARKQ  221

Query  679   VEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK-FPPAVKAAAEDSTAHHVPELVA  855
             VE++ S   MFIVTYTAEH+H  PT RNSLAG+ R K F P       DST    P    
Sbjct  222   VERNRSDPNMFIVTYTAEHNHPAPTHRNSLAGSTRQKPFSPQT-VTGSDSTKPTSP--AT  278

Query  856   ASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFAGLED  1035
             ++S    P           K+E        +  ++  M D       ++ ++DFF GLE 
Sbjct  279   SASVDEDPVVPQSTTMESFKEEKGSPMVDDDDDELFGMCD-------SVVSDDFFVGLEG  331

Query  1036  LDGLISYFSYSSQCNY  1083
             L G   YFS  S  ++
Sbjct  332   LAG--DYFSDHSPTSF  345



>ref|NP_001046497.1| Os02g0265200 [Oryza sativa Japonica Group]
 dbj|BAD27888.1| putative WRKY transcription factor [Oryza sativa Japonica Group]
 dbj|BAF08411.1| Os02g0265200 [Oryza sativa Japonica Group]
 dbj|BAG90123.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56697.1| hypothetical protein OsJ_06167 [Oryza sativa Japonica Group]
Length=361

 Score =   125 bits (315),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = +1

Query  478  EAPNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssK  657
            + P   VP+ KRRKN+ K+VV  VPA+ +  D WAWRKYGQKPIKGSPYPR YYRCSSSK
Sbjct  145  QVPAGGVPRSKRRKNQQKKVVRHVPADGVSADVWAWRKYGQKPIKGSPYPRGYYRCSSSK  204

Query  658  GCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKF  792
            GC ARKQVE+S S    FI+TYT EH+HS PT RNSLAGT RNK 
Sbjct  205  GCPARKQVERSRSDPNTFILTYTGEHNHSAPTHRNSLAGTTRNKL  249



>tpg|DAA05104.1| TPA_inf: WRKY transcription factor 39 [Oryza sativa (indica cultivar-group)]
 gb|EEC72879.1| hypothetical protein OsI_06657 [Oryza sativa Indica Group]
Length=361

 Score =   125 bits (315),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = +1

Query  478  EAPNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssK  657
            + P   VP+ KRRKN+ K+VV  VPA+ +  D WAWRKYGQKPIKGSPYPR YYRCSSSK
Sbjct  145  QVPAGGVPRSKRRKNQQKKVVRHVPADGVSADVWAWRKYGQKPIKGSPYPRGYYRCSSSK  204

Query  658  GCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKF  792
            GC ARKQVE+S S    FI+TYT EH+HS PT RNSLAGT RNK 
Sbjct  205  GCPARKQVERSRSDPNTFILTYTGEHNHSAPTHRNSLAGTTRNKL  249



>ref|XP_004510691.1| PREDICTED: WRKY transcription factor 22-like [Cicer arietinum]
Length=316

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 117/195 (60%), Gaps = 12/195 (6%)
 Frame = +1

Query  496   VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
              P+ KRRK + K+V  +V AE L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGCLARK
Sbjct  111   TPRSKRRKIQLKKVC-EVHAENLSSDIWAWRKYGQKPIKGSPYPRGYYRCSSSKGCLARK  169

Query  676   QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVA  855
             QVE++ S   MFIVTYT EHSH  PT RNSLAG+ R K P + +      T+ H+ + V+
Sbjct  170   QVERNKSDPTMFIVTYTGEHSHPAPTHRNSLAGSTRQK-PLSPQTVTVGDTSQHLTKPVS  228

Query  856   ASSALSSPTANN---WRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFAG  1026
              S   S           A SE K+E +D     ++    E+SD      V  D  DFF G
Sbjct  229   VSPTTSEAEEEEAAPLSAKSETKEELEDLIMNDDEENEFELSD-----MVVTD--DFFEG  281

Query  1027  LEDLDGLISYFSYSS  1071
             L++L G +   + SS
Sbjct  282   LDELTGFVDSTTKSS  296



>ref|XP_010924759.1| PREDICTED: WRKY transcription factor 22-like [Elaeis guineensis]
Length=328

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 117/213 (55%), Gaps = 14/213 (7%)
 Frame = +1

Query  166  DNWGLQAIVQQPPLMASSEFTLQSCHDYLF-----DFSQENVLNFDDFVRTAMVPDDALL  330
            DNW LQA+V+   L   S     S    L      D  ++ +  F D + T     +  L
Sbjct  4    DNWDLQAVVRGCCLTRPSTDPFSSFPPLLLKEEQVDGEKDILFGFPDIMDTEKSFHE--L  61

Query  331  EELYKPFIQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPNNYVPKFK  510
            EEL KPF           + +Q++     Q       ++       PV     N  P+ K
Sbjct  62   EELCKPFFLKPQQQPLEQQQQQQSLPSPQQGNPSQQQRRL---PQRPV----TNSNPRSK  114

Query  511  RRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQS  690
            RRKN+ KR V  VPA+ L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGCLARKQVE+S
Sbjct  115  RRKNQQKRAVCHVPADGLPSDMWAWRKYGQKPIKGSPYPRGYYRCSSSKGCLARKQVERS  174

Query  691  NSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK  789
             +   M +VTYTAEH+H  PT RNSLAG+ R K
Sbjct  175  RTDPAMLVVTYTAEHNHPLPTHRNSLAGSTRQK  207



>gb|KHG10389.1| WRKY transcription factor 22 -like protein [Gossypium arboreum]
Length=288

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 96/197 (49%), Positives = 117/197 (59%), Gaps = 14/197 (7%)
 Frame = +1

Query  508   KRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQ  687
             KRRKN+ KRV   VP E L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGCLARKQVE+
Sbjct  89    KRRKNQLKRVC-HVPPEGLSSDVWAWRKYGQKPIKGSPYPRGYYRCSSSKGCLARKQVER  147

Query  688   SNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK-FPPAVKAAAEDSTAHHVPELVAASS  864
               S   MFIVTYTAEH+H  PT RNSLAG+ R K F P    A +       P     + 
Sbjct  148   HRSDPNMFIVTYTAEHNHPAPTHRNSLAGSTRQKPFTPQTVIAGDSVK----PSSSKPAD  203

Query  865   ALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFAGLEDLDG  1044
             +L SPTA    +  E         +  E +   E  D+ G+S  A+ ++DFF GLE L  
Sbjct  204   SL-SPTA----SVDEGVVVQSTKVDSREDLVEDEGEDEFGMSDTAV-SDDFFEGLEGLAE  257

Query  1045  LISYFSYSSQCNYPSMF  1095
             +++   +    N+P+ F
Sbjct  258   IVTRNCFPD--NFPASF  272



>ref|XP_009386306.1| PREDICTED: WRKY transcription factor 22 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=299

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 98/233 (42%), Positives = 123/233 (53%), Gaps = 34/233 (15%)
 Frame = +1

Query  163  EDNWGLQAIVQQPPLMASSEFTLQSCHDYLFD-------------FSQENVLNFDDFVRT  303
            +DNW L A+V+       S  T     D LF                +E    F + V T
Sbjct  3    DDNWDLYAVVR-----GCSAGTAVDVDDPLFSPFPPFLLQERDVGGEKERAFGFPELVGT  57

Query  304  AMVPDDALLEELYKPFIQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEA  483
            +  P    L EL KPF        +  ++ QE  +        GD ++S      P    
Sbjct  58   SSYPYG--LHELCKPF--------YAMDLHQEPPLIPAV----GDPRQSQRQSRQPQRPV  103

Query  484  PNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGC  663
              +  P+  RRKN+ K+VV QV A  +  D WAWRKYGQKPIKGSPYPRSYYRCS+SKGC
Sbjct  104  --SQAPRSARRKNQQKKVVCQVAAHGVRSDLWAWRKYGQKPIKGSPYPRSYYRCSTSKGC  161

Query  664  LARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAED  822
             ARKQVEQS +  GM ++TYTAEH+H  PT RNSLAG+ R K PP   A  ++
Sbjct  162  QARKQVEQSRADPGMLLITYTAEHNHPMPTIRNSLAGSTRPKLPPPTSADGDN  214



>gb|KCW78114.1| hypothetical protein EUGRSUZ_D02324 [Eucalyptus grandis]
Length=396

 Score =   125 bits (315),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 107/250 (43%), Positives = 139/250 (56%), Gaps = 19/250 (8%)
 Frame = +1

Query  328   LEELYKPFIQPAASISFTGEVKQE-----AAVHqmqqqqDGDVKKSGLDKSSPVLE-AP-  486
             L ELYKPF+ PA    F+           A          G ++K     +S +   AP 
Sbjct  124   LHELYKPFL-PAYGPLFSHRSSLSVSSPLAVEGAKSSSSAGLMQKRPFQSASAIAPLAPF  182

Query  487   --NNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKG  660
               ++  P+ K+RK++ K VV QVPAE++  D+WAWRKYGQKPIKGSPYPRSYYRCSSSKG
Sbjct  183   KTSSSAPRSKKRKSQMK-VVRQVPAEKVSSDEWAWRKYGQKPIKGSPYPRSYYRCSSSKG  241

Query  661   CLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDS--TAH  834
             CLARKQVE++ S  G+FIVTYT+EH+H  PT R+SLAG+ R K        + DS  TA 
Sbjct  242   CLARKQVERNRSDPGIFIVTYTSEHNHVAPTHRSSLAGSTRPKTSTPETEVSVDSAATAT  301

Query  835   HVPELVAASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNED  1014
               P       A   P + +  +G E +            M   +  D++G S  A  ++D
Sbjct  302   TTPGTSGEEEAAHVPQSTSSESGEEKEYSQSS------SMLDNDGEDETGGSSGAALSDD  355

Query  1015  FFAGLEDLDG  1044
             FF GLE L G
Sbjct  356   FFVGLEGLLG  365



>ref|XP_006843337.1| hypothetical protein AMTR_s00053p00025460 [Amborella trichopoda]
 gb|ERN05012.1| hypothetical protein AMTR_s00053p00025460 [Amborella trichopoda]
Length=323

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 110/184 (60%), Gaps = 17/184 (9%)
 Frame = +1

Query  328  LEELYKPFIQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPNNYVPKF  507
            LEE YKPF    +S       KQ+              +  GL     V  A + ++ + 
Sbjct  88   LEESYKPFYSNNSSCEAPLLQKQK------------QKQARGLS----VSGASHTHLRRS  131

Query  508  KRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQ  687
            KR K++ +RVV QVPAE L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGC ARKQVE+
Sbjct  132  KRSKSQLRRVVCQVPAEGLPSDMWAWRKYGQKPIKGSPYPRGYYRCSSSKGCSARKQVER  191

Query  688  SNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAASSA  867
            S S  G+F++TYT+EH+H  PT RNSLAG+ RNK P A    A+ +T+   P        
Sbjct  192  SRSDPGVFVITYTSEHNHPLPTHRNSLAGSTRNK-PEASPTPADTTTSSQPPPTHNHPKP  250

Query  868  LSSP  879
             SSP
Sbjct  251  ASSP  254



>ref|XP_004229932.1| PREDICTED: WRKY transcription factor 22 [Solanum lycopersicum]
Length=355

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 113/206 (55%), Gaps = 32/206 (16%)
 Frame = +1

Query  250  LFDFSQENVLNFDDFVRTAMVPDDALLEELYKPFIQPAASISFTGE--------------  387
             F F    V  FD+ +      D   L  LYKPF   A  I  + +              
Sbjct  46   FFSFQDPFVPRFDNPIS-----DFEELHNLYKPFFPKAQQIPLSPQNNTNNIPISPLSVL  100

Query  388  -----------VKQEAAVHqmqqqqDGDVKKSGLDK-SSPVLEAPNNYVPKFKRRKNEHK  531
                       +KQ+  +HQ+   +    K+S L    S    A +   P+ KRRKN+ K
Sbjct  101  GGLQDLSPQQTLKQQQHIHQLNSTRLTQPKQSPLSAYGSTTTSASHVQSPRPKRRKNQLK  160

Query  532  RVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNSAAGMF  711
            +V  QVPAE L  D W+WRKYGQKPIKGSPYPR YYRCS+SKGCLARKQVE++ S   MF
Sbjct  161  KVC-QVPAEGLSSDMWSWRKYGQKPIKGSPYPRGYYRCSTSKGCLARKQVERNRSDPNMF  219

Query  712  IVTYTAEHSHSQPTRRNSLAGTIRNK  789
            IVTYTAEH+H  PT RNSLAG+ R K
Sbjct  220  IVTYTAEHNHPMPTHRNSLAGSTRQK  245



>gb|AGV75969.1| WRKY transcription factor 88 [Gossypium hirsutum]
 gb|AIE43842.1| WRKY transcription factor 48 [Gossypium hirsutum]
Length=335

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 94/216 (44%), Positives = 124/216 (57%), Gaps = 22/216 (10%)
 Frame = +1

Query  502   KFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQV  681
             + KRRKN+ K+V  QVP E +  D WAWRKYGQKPIKGSPYPR YYRCS+SKGCLARKQV
Sbjct  134   RSKRRKNQLKKVC-QVPTEGISSDVWAWRKYGQKPIKGSPYPRGYYRCSTSKGCLARKQV  192

Query  682   EQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAAS  861
             E+S +   MFIVTYTAEH+H  PT  NSLAG+ R K   +    A DS      +   +S
Sbjct  193   ERSRTDPAMFIVTYTAEHNHPAPTHHNSLAGSTRQKPCTSQTPTAGDSVKPFSAKPAGSS  252

Query  862   SALSSP----TANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFAGL  1029
             S  +S        N +AGS             E +   E  D  G+S  A+ ++DFF GL
Sbjct  253   SLTTSVDEELMVQNTKAGSR------------EDLVEDEGEDDFGMSDTAV-SDDFFEGL  299

Query  1030  EDLDGLISYFSYSSQ----CNYPSMFSS*HSIVHGL  1125
             E +  +++   +S +    C+ P + S+  +   G+
Sbjct  300   EGIADMVTGNCFSDRFQPSCDLPWIASNAATAAGGV  335



>emb|CDY48511.1| BnaA09g00120D [Brassica napus]
Length=298

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 109/291 (37%), Positives = 155/291 (53%), Gaps = 26/291 (9%)
 Frame = +1

Query  166   DNWGLQAIVQQPPLMASSEFTLQSCHDYLFDFSQENVLNFDDFVRTAMVPDDALLEELYK  345
             D+W L A+V+     +SS  T  +            V  F+    T +  +     +LY 
Sbjct  3     DDWDLHAVVRGCSAFSSSATTTATVFSSNVSSHTSPVFTFEPRSNTVVFGE---TRDLYT  59

Query  346   PFIQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPNNYVPKFKRRKNE  525
             PF Q + + SF+     E    +  Q++   +  S    +S    A N    + KRRK +
Sbjct  60    PFTQESNASSFSCLNYPEEPRQRQNQKRPLSLSASSGSVTSKPTGASN--TSRSKRRKIQ  117

Query  526   HKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNSAAG  705
             HK+V   V AE L  D WAWRKYGQKPIKGSPYPR YYRCS+SKGCLARKQVE++ S   
Sbjct  118   HKKVC-HVAAEALNNDVWAWRKYGQKPIKGSPYPRGYYRCSTSKGCLARKQVERNRSDPT  176

Query  706   MFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAASSALSSPTA  885
             MFIVTYTAEH+H  PT RNSLAG+ R K      ++ + +T      + A S++  + +A
Sbjct  177   MFIVTYTAEHNHPAPTHRNSLAGSTRQK-----TSSDQPTTKSPTTTIAAYSTSPVTSSA  231

Query  886   NNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFAGLEDL  1038
             +++    E       D E+G++  ++ +SD        + +EDFF GLE+ 
Sbjct  232   DDFVMPVE-------DIEVGDE-DLLSLSD-------TVVSEDFFEGLEEF  267



>ref|XP_009416719.1| PREDICTED: WRKY transcription factor 22-like [Musa acuminata 
subsp. malaccensis]
Length=364

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +1

Query  508  KRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQ  687
            KRRKN+HK+VV QVPA+ +  D WAWRKYGQKPIKGSPYPR YYRCSSSKGC ARKQVE+
Sbjct  124  KRRKNQHKKVVCQVPADGISPDMWAWRKYGQKPIKGSPYPRGYYRCSSSKGCQARKQVER  183

Query  688  SNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAA  813
            S +  GM ++TYTAEH H  PT RNSL+G+ R K P    AA
Sbjct  184  SRAEPGMLVITYTAEHDHPVPTHRNSLSGSTRQKLPHPSSAA  225



>ref|NP_001288962.1| WRKY transcription factor 22 [Brassica rapa]
 gb|AHB33829.1| WRKY transcription factor 22 [Brassica rapa]
Length=298

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 92/208 (44%), Positives = 118/208 (57%), Gaps = 6/208 (3%)
 Frame = +1

Query  166  DNWGLQAIVQQPPLMASSEFTLQSCHDYLFDFSQENVLNFDDFVRTAMVPDDALLEELYK  345
            D+W L A+V+    ++SS  T  +            V  F+    T +  +     +LY 
Sbjct  3    DDWDLHAVVRGCSAVSSSATTTATVFSSNVSSHTSPVFTFEPRSNTVVFGE---TRDLYT  59

Query  346  PFIQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPNNYVPKFKRRKNE  525
            PF Q + + SF+     E    +  Q++   +  S    +S    A N    + KRRK +
Sbjct  60   PFTQESNASSFSCLNYPEEPRQRQNQKRPLSLSASSGSVTSKPTGASN--TSRSKRRKIQ  117

Query  526  HKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNSAAG  705
            HK+V   V AE L  D WAWRKYGQKPIKGSPYPR YYRCS+SKGCLARKQVE++ S   
Sbjct  118  HKKVC-HVAAEALNNDVWAWRKYGQKPIKGSPYPRGYYRCSTSKGCLARKQVERNRSDPT  176

Query  706  MFIVTYTAEHSHSQPTRRNSLAGTIRNK  789
            MFIVTYTAEH+H  PT RNSLAG+ R K
Sbjct  177  MFIVTYTAEHNHPAPTHRNSLAGSTRQK  204



>gb|AIY62475.1| WRKY67 [Gossypium aridum]
Length=325

 Score =   124 bits (310),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 117/197 (59%), Gaps = 14/197 (7%)
 Frame = +1

Query  508   KRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQ  687
             KRRKN+ KRV   VP E L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGCLARKQVE+
Sbjct  126   KRRKNQLKRVC-HVPPEGLSSDVWAWRKYGQKPIKGSPYPRGYYRCSSSKGCLARKQVER  184

Query  688   SNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK-FPPAVKAAAEDSTAHHVPELVAASS  864
               S   MFIVTYTAEH+H  PT RNSLAG+ R K F P    A +       P     + 
Sbjct  185   HRSDPNMFIVTYTAEHNHPAPTHRNSLAGSTRQKPFTPQTVTAGDSVK----PSSSKPAD  240

Query  865   ALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFAGLEDLDG  1044
             +LS  T+ +   G  ++          E +   E  D+ G+S  A+ ++DFF GLE L  
Sbjct  241   SLSPTTSVD--EGVVVQSTKVHSR---EDLVEDEGEDEFGMSDTAV-SDDFFEGLEGLAE  294

Query  1045  LISYFSYSSQCNYPSMF  1095
             +++   +    N+P+ F
Sbjct  295   IVTGNCFPD--NFPASF  309



>ref|XP_006339631.1| PREDICTED: WRKY transcription factor 22-like [Solanum tuberosum]
Length=352

 Score =   124 bits (311),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 94/206 (46%), Positives = 114/206 (55%), Gaps = 32/206 (16%)
 Frame = +1

Query  250  LFDFSQENVLNFDDFVRTAMVPDDALLEELYKPFIQ----------------PAASISFT  381
             F F    V  FD+ +      D   L  LYKPF                  P + +S  
Sbjct  43   FFSFQDPFVPRFDNPIS-----DFEELHNLYKPFFPKSQQIPLSPQNNSNNIPISPLSVL  97

Query  382  G---------EVKQEAAVHqmqqqqDGDVKKSGLD-KSSPVLEAPNNYVPKFKRRKNEHK  531
            G          +KQ+  +HQ+   +    K+S L    S    A +   P+ KRRKN+ K
Sbjct  98   GGLQDLSPQQTLKQQQHIHQLNSTRLTQPKQSPLSVYGSTTTSASHVQSPRPKRRKNQLK  157

Query  532  RVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNSAAGMF  711
            +V  QVPAE L  D W+WRKYGQKPIKGSPYPR YYRCS+SKGCLARKQVE++ S   MF
Sbjct  158  KVC-QVPAEGLSSDMWSWRKYGQKPIKGSPYPRGYYRCSTSKGCLARKQVERNRSDPNMF  216

Query  712  IVTYTAEHSHSQPTRRNSLAGTIRNK  789
            IVTYTAEH+H  PT RNSLAG+ R K
Sbjct  217  IVTYTAEHNHPMPTHRNSLAGSTRQK  242



>ref|XP_002511920.1| WRKY transcription factor, putative [Ricinus communis]
 gb|EEF50589.1| WRKY transcription factor, putative [Ricinus communis]
Length=347

 Score =   124 bits (310),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 99/250 (40%), Positives = 127/250 (51%), Gaps = 31/250 (12%)
 Frame = +1

Query  154  IGFEDNWGLQAIVQ--------------------QPPLMASSEFTLQSCHDYLFDFSQEN  273
            I  +D+W LQA+V+                        + + +F  QSC  +  + +  +
Sbjct  6    IAMDDDWDLQAVVRGCTTASPSVAVTTTTNIGGYASSFINTGDFYTQSC--FGSESASGS  63

Query  274  VLNFDDFVRTAMVPDDALLEELYKPFIQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSG  453
            + +  D   T        L ELYKPF   +   +      Q A +  +   ++    K  
Sbjct  64   LFSTPDPFETRNNNVTGELHELYKPFFPKSHQTTTCLYTPQGAPISPVVISKEQTQLK--  121

Query  454  LDKSSP------VLEAPNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKG  615
            L    P       + +  N   + KRRKN+ K++  QVPAE L  D WAWRKYGQKPIKG
Sbjct  122  LQHQQPKQSHTGSVTSSANSQTRSKRRKNQLKKIC-QVPAEALSSDVWAWRKYGQKPIKG  180

Query  616  spyprsyyrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFP  795
            SPYPR YYRCSSSKGCLARKQVE++ S  GMFIVTYT EH+H  P  RNSLAG  R K  
Sbjct  181  SPYPRGYYRCSSSKGCLARKQVERNRSDPGMFIVTYTGEHNHPAPAHRNSLAGITRQKTT  240

Query  796  PAVKAAAEDS  825
                 AA DS
Sbjct  241  APQTVAASDS  250



>ref|XP_003555395.1| PREDICTED: probable WRKY transcription factor 27-like [Glycine 
max]
 gb|KHN12931.1| Putative WRKY transcription factor 27 [Glycine soja]
Length=321

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +1

Query  496  VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
             PK ++RK++ K++V  V A+ L  D WAWRKYGQKPIKGSPYPR+YYRCSSSKGC+ARK
Sbjct  160  TPKSRKRKSQQKKMVCHVTADNLSADLWAWRKYGQKPIKGSPYPRNYYRCSSSKGCMARK  219

Query  676  QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFP  795
            QVE+SN+   MFIVTY+ +HSH +PT RNSLAG+ RNK P
Sbjct  220  QVERSNTEPDMFIVTYSGDHSHPRPTHRNSLAGSTRNKIP  259



>gb|ACI14389.1| WRKY22-1 transcription factor [Brassica napus]
Length=259

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 118/209 (56%), Gaps = 9/209 (4%)
 Frame = +1

Query  166  DNWGLQAIVQQPPLMASSEFTLQSCHDYLFDFSQENVLNFDDFVRTAMVPDDALLEELYK  345
            D+W L A+V+    ++SS  T  +            V  F+    T +  +     +LY 
Sbjct  3    DDWDLHAVVRGCSAVSSSATTTATVFSSNVSSHTSPVFTFEPRSNTVVFGE---TRDLYT  59

Query  346  PFIQPAASISFTG-EVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPNNYVPKFKRRKN  522
            PF Q + + SF+     +E    Q Q++       SG   S P      +   + KRRK 
Sbjct  60   PFTQESNTSSFSCLNYPEEPRQRQNQKRPLSLSASSGSVTSKPT----GSNTSRSKRRKI  115

Query  523  EHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNSAA  702
            +HK+V   V AE L  D WAWRKYGQKPIKGSPYPR YYRCS+SKGCLARKQVE++ S  
Sbjct  116  QHKKVC-HVAAEALNNDVWAWRKYGQKPIKGSPYPRGYYRCSTSKGCLARKQVERNRSDP  174

Query  703  GMFIVTYTAEHSHSQPTRRNSLAGTIRNK  789
             MFIVTYTAEH+H  PT RNSLAG+ R K
Sbjct  175  TMFIVTYTAEHNHPAPTHRNSLAGSTRQK  203



>ref|NP_001151984.1| WRKY39v2 - superfamily of TFs having WRKY and zinc finger domains 
[Zea mays]
 gb|ACG45221.1| WRKY39v2 - superfamily of TFs having WRKY and zinc finger domains 
[Zea mays]
Length=383

 Score =   124 bits (311),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +1

Query  496  VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
            VP+ KRRKN+ K+VV  VPA+    D WAWRKYGQKPIKGSPYPR YYRCSSSKGC ARK
Sbjct  154  VPRSKRRKNQVKKVVCHVPADGSSSDMWAWRKYGQKPIKGSPYPRGYYRCSSSKGCAARK  213

Query  676  QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKF  792
            QVE+S +    FI+TYT EH+H+ PT RNSLAGT RNKF
Sbjct  214  QVERSRADPNTFILTYTGEHNHAAPTHRNSLAGTTRNKF  252



>ref|XP_011046055.1| PREDICTED: probable WRKY transcription factor 27 [Populus euphratica]
Length=411

 Score =   124 bits (311),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 91/128 (71%), Gaps = 2/128 (2%)
 Frame = +1

Query  496  VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
             P+ +++K+  KR+V+ V AE L  D WAWRKYGQKPIKGSPYPR+YYRCSSSKGC ARK
Sbjct  198  TPRSRKKKSNQKRLVLHVTAENLSNDVWAWRKYGQKPIKGSPYPRNYYRCSSSKGCAARK  257

Query  676  QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVA  855
            QVE+SN+   MFIV+YT +H+H +PT RNSLAG+ RNK   AV+   E  +    P + A
Sbjct  258  QVERSNTDPNMFIVSYTGDHTHPRPTHRNSLAGSTRNKVQQAVQKPEEKESEQ--PNISA  315

Query  856  ASSALSSP  879
                 SSP
Sbjct  316  DKGLCSSP  323



>ref|XP_010055078.1| PREDICTED: WRKY transcription factor 22-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW71556.1| hypothetical protein EUGRSUZ_E00098 [Eucalyptus grandis]
Length=358

 Score =   123 bits (309),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 110/179 (61%), Gaps = 10/179 (6%)
 Frame = +1

Query  508   KRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQ  687
             + RKN+ K+V   VPAE L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGCLARKQVE+
Sbjct  154   RSRKNQLKKVC-HVPAESLSSDIWAWRKYGQKPIKGSPYPRGYYRCSSSKGCLARKQVER  212

Query  688   SNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK--FPPAVKAAAEDSTAHHVPELVAAS  861
             + S  GMF+VTYTAEH+H  PT RNSLAG+ R K   P         + A   P   + +
Sbjct  213   NRSDPGMFVVTYTAEHNHPAPTHRNSLAGSTRQKPVMPQTDTVEDPSAAASTKPPCSSPT  272

Query  862   SALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFAGLEDL  1038
             ++L    A      +E +++ +        M   E    +G+S +AM ++DFF GLE L
Sbjct  273   TSLEEEVAKTQSTNTESREDKEG------SMADDEEDGDAGLSDMAM-SDDFFVGLEGL  324



>emb|CDY07185.1| BnaCnng02000D [Brassica napus]
Length=292

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 118/209 (56%), Gaps = 9/209 (4%)
 Frame = +1

Query  166  DNWGLQAIVQQPPLMASSEFTLQSCHDYLFDFSQENVLNFDDFVRTAMVPDDALLEELYK  345
            D+W L A+V+    ++SS  T  +            V  F+    T +  +     +LY 
Sbjct  3    DDWDLHAVVRGCSAVSSSATTTATVFSSNVSSHTSPVFTFEPRSNTVVFGE---TRDLYT  59

Query  346  PFIQPAASISFTG-EVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPNNYVPKFKRRKN  522
            PF Q + + SF+     +E    Q Q++       SG   S P      +   + KRRK 
Sbjct  60   PFTQESNTSSFSCLNYPEEPRQRQNQKRPLSLSASSGSVTSKPT----GSNTSRSKRRKI  115

Query  523  EHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNSAA  702
            +HK+V   V AE L  D WAWRKYGQKPIKGSPYPR YYRCS+SKGCLARKQVE++ S  
Sbjct  116  QHKKVC-HVAAEALNNDVWAWRKYGQKPIKGSPYPRGYYRCSTSKGCLARKQVERNRSDP  174

Query  703  GMFIVTYTAEHSHSQPTRRNSLAGTIRNK  789
             MFIVTYTAEH+H  PT RNSLAG+ R K
Sbjct  175  TMFIVTYTAEHNHPAPTHRNSLAGSTRQK  203



>gb|ACN26067.1| unknown [Zea mays]
 gb|ADX60131.1| WRKY transcription factor [Zea mays]
 gb|AFW70996.1| putative WRKY DNA-binding domain superfamily protein [Zea mays]
Length=383

 Score =   124 bits (310),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +1

Query  496  VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
            VP+ KRRKN+ K+VV  VPA+    D WAWRKYGQKPIKGSPYPR YYRCSSSKGC ARK
Sbjct  154  VPRSKRRKNQVKKVVCHVPADGSSSDMWAWRKYGQKPIKGSPYPRGYYRCSSSKGCAARK  213

Query  676  QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKF  792
            QVE+S +    FI+TYT EH+H+ PT RNSLAGT RNKF
Sbjct  214  QVERSRADPNTFILTYTGEHNHAAPTHRNSLAGTTRNKF  252



>ref|XP_002276925.1| PREDICTED: WRKY transcription factor 22 [Vitis vinifera]
 emb|CBI40407.3| unnamed protein product [Vitis vinifera]
Length=348

 Score =   123 bits (309),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 113/180 (63%), Gaps = 9/180 (5%)
 Frame = +1

Query  499   PKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQ  678
             P+ KRRKN+ K+V   +PAE L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGCLARKQ
Sbjct  145   PRSKRRKNQMKKVC-HIPAEGLSSDMWAWRKYGQKPIKGSPYPRGYYRCSSSKGCLARKQ  203

Query  679   VEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAA  858
             VE++ S   MFIVTYTAEH+H  PT RNSLAG+ R K      AA   ++A  V    +A
Sbjct  204   VERNRSDPDMFIVTYTAEHNHPMPTHRNSLAGSTRQKPVTPPAAATTTASADAV--KPSA  261

Query  859   SSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFAGLEDL  1038
               A SSP  +   A  E+           + +   E  D+ G S  A+D+ DFF GLE+L
Sbjct  262   KPACSSPATS---ADDEL--VQQSTSVQSKDLVEDEEDDELGFSDTAVDD-DFFMGLEEL  315



>ref|XP_003548638.1| PREDICTED: WRKY transcription factor 22 [Glycine max]
Length=335

 Score =   123 bits (308),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 121/187 (65%), Gaps = 19/187 (10%)
 Frame = +1

Query  496   VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
              P+ KRRKN+ K+V  QV AE L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGCLARK
Sbjct  135   TPRSKRRKNQLKKVC-QVAAENLSSDIWAWRKYGQKPIKGSPYPRGYYRCSSSKGCLARK  193

Query  676   QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVA  855
             QVE++ S   MFIVTYT EH+H  PT +NSLAG+ R+K      A AED          A
Sbjct  194   QVERNRSDPAMFIVTYTGEHNHPAPTHKNSLAGSTRHK---PQTATAED----------A  240

Query  856   ASSALSSPTANNWR---AGSEIKdeddddeeLGEKMQV-VEMSDQSGVSQVAMDNEDFFA  1023
             A+   +SP+ +      A    K E  ++E++ + M+   E+ ++ G+++  + ++DFF 
Sbjct  241   ATIKPASPSTSGMEEEVAQHSAKSESTEEEDMEDLMKNDEELPNEFGLTETVV-SDDFFE  299

Query  1024  GLEDLDG  1044
             GLE+L G
Sbjct  300   GLEELTG  306



>ref|XP_002451907.1| hypothetical protein SORBIDRAFT_04g009800 [Sorghum bicolor]
 gb|EES04883.1| hypothetical protein SORBIDRAFT_04g009800 [Sorghum bicolor]
Length=375

 Score =   123 bits (309),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +1

Query  496  VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
            VP+ KRRKN+ K+VV  VPA+    D WAWRKYGQKPIKGSPYPR YYRCSSSKGC ARK
Sbjct  146  VPRSKRRKNQVKKVVCHVPADGSSSDVWAWRKYGQKPIKGSPYPRGYYRCSSSKGCAARK  205

Query  676  QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFP  795
            QVE+S +    FI+TYT EH+H+ PT RNSLAGT R+KFP
Sbjct  206  QVERSRADPNTFILTYTGEHNHAAPTHRNSLAGTTRHKFP  245



>gb|AIE43845.1| WRKY transcription factor 58 [Gossypium hirsutum]
Length=396

 Score =   124 bits (310),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 91/129 (71%), Gaps = 3/129 (2%)
 Frame = +1

Query  496  VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
             P+ ++RKN+ KR V  V A++L  D WAWRKYGQKPIKGSPYPR+YYRCSSSKGC AR 
Sbjct  164  TPRSRKRKNQQKRTVCHVTADKLSSDPWAWRKYGQKPIKGSPYPRNYYRCSSSKGCSARN  223

Query  676  QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVK-AAAEDSTAHHVPELV  852
            QVE+SN  + +FI+TYT EH+H +PT RNSLAG  RNK     K    +DS A  +P   
Sbjct  224  QVERSNLDSDIFIITYTGEHTHPKPTHRNSLAGCTRNKLSTVQKPTTTKDSAAETIP--T  281

Query  853  AASSALSSP  879
             ++ + SSP
Sbjct  282  TSTVSCSSP  290



>ref|XP_009341117.1| PREDICTED: WRKY transcription factor 22-like [Pyrus x bretschneideri]
Length=346

 Score =   123 bits (308),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 113/186 (61%), Gaps = 12/186 (6%)
 Frame = +1

Query  508   KRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQ  687
             K+RKN+ K+V  QVPAE L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGC+ARKQVE+
Sbjct  149   KKRKNQLKKVC-QVPAEGLSSDVWAWRKYGQKPIKGSPYPRGYYRCSSSKGCMARKQVER  207

Query  688   SNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK-FPPAVKAAAEDSTAHHVPELVAASS  864
             + S   MFIVTYT EH+H  PT RNSLAG+ R K F P   A   DS     P    ++ 
Sbjct  208   NRSDPNMFIVTYTGEHNHPAPTHRNSLAGSTRQKPFSPQT-ATRGDSAKPASPTTSVSAD  266

Query  865   ALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFAGLEDLDG  1044
               ++    +    S  K+E        E+ +++ M D       ++ ++DFF GL+ L G
Sbjct  267   EETAVAPQSTTVESSCKEEKGSPLITDEEDELLGMCD-------SVVSDDFFVGLDGLAG  319

Query  1045  LISYFS  1062
                YFS
Sbjct  320   --DYFS  323



>gb|AGQ04239.1| WRKY transcription factor 48 [Jatropha curcas]
 gb|KDP22210.1| hypothetical protein JCGZ_26041 [Jatropha curcas]
Length=364

 Score =   123 bits (308),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 87/112 (78%), Gaps = 4/112 (4%)
 Frame = +1

Query  502  KFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQV  681
            + +++K+  KR V+QV A+ LC D WAWRKYGQKPIKGSPYPR+YYRCSSSKGC ARKQV
Sbjct  107  RSRKKKSNMKRQVMQVTADNLCNDVWAWRKYGQKPIKGSPYPRNYYRCSSSKGCAARKQV  166

Query  682  EQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFP----PAVKAAAEDS  825
            E+SN+   MF+V+Y+ +H+H +PT RNSLAG+ RNKFP    P +K   E S
Sbjct  167  ERSNTDPNMFVVSYSGDHTHPRPTHRNSLAGSTRNKFPTIQKPDIKETEEPS  218



>ref|XP_004492798.1| PREDICTED: WRKY transcription factor 22-like [Cicer arietinum]
Length=328

 Score =   122 bits (306),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 120/193 (62%), Gaps = 30/193 (16%)
 Frame = +1

Query  496   VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
              P+ KRRKN+ K+V  QVP E L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGCLARK
Sbjct  135   TPRSKRRKNQLKKVC-QVPVENLSSDIWAWRKYGQKPIKGSPYPRGYYRCSSSKGCLARK  193

Query  676   QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVA  855
             QVE++ S   MFIVTYT+EH+H  PT +NSLAG+ RNK  P+    ++ +         A
Sbjct  194   QVERNRSDPTMFIVTYTSEHNHPAPTHKNSLAGSTRNK--PSTPPQSDTNK--------A  243

Query  856   ASSALSSPTANNWRAGSEIKdeddddeeLGEKMQ------VVEMSDQSGVSQVAMDNEDF  1017
              ++  SSPT +      E++ +       GEK +        E  DQ G+S V + ++DF
Sbjct  244   LTTKPSSPTTSE-----EVQTQ-------GEKSESKEDLMDEEEDDQFGLSDVVL-SDDF  290

Query  1018  FAGLEDLDGLISY  1056
             +  L++L  L ++
Sbjct  291   YESLDELSQLAAF  303



>gb|AGV75933.1| WRKY transcription factor 12 [Gossypium hirsutum]
Length=278

 Score =   121 bits (303),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 98/218 (45%), Positives = 128/218 (59%), Gaps = 23/218 (11%)
 Frame = +1

Query  166  DNWGLQAIV------QQPPLMASSEFTLQSCHDYLFDFSQ-ENVLNFDDFVRT-AMVPDD  321
            +NW LQA+V        P  +A+ EF+        + F Q E+ ++F +   T   V D+
Sbjct  2    ENWDLQAVVGRNSSNDHP--IANPEFSFGP-----WSFQQDEDFMSFPEIFETNPKVLDE  54

Query  322  ALLEELYKPFIQPAASISFTGEVKQEAAV--HqmqqqqDGDVKKSGLDKSSPVLEAPNNY  495
              LE+LYKPF       S    +     V  H  +  +    + S     S +  +PN  
Sbjct  55   --LEQLYKPFYPDLNPFSTQTIITSSIPVPLHVDEPAEKRKKRPSFTVSQSDISASPN--  110

Query  496  VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
             P+ + RKN+  RVV  V A++L  D WAWRKYGQKPIKGSP+PRSYYRCSSSKGCLARK
Sbjct  111  -PR-RFRKNQQNRVVEHVTADDLPSDVWAWRKYGQKPIKGSPFPRSYYRCSSSKGCLARK  168

Query  676  QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK  789
            QVE+S S   +FI+TYTAEH H  PTRR+SLAG+ R+K
Sbjct  169  QVERSCSDPRVFIITYTAEHCHGHPTRRSSLAGSTRSK  206



>ref|XP_009626813.1| PREDICTED: WRKY transcription factor 22-like [Nicotiana tomentosiformis]
Length=359

 Score =   122 bits (307),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 114/185 (62%), Gaps = 8/185 (4%)
 Frame = +1

Query  484   PNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGC  663
             P+   P+ KRRKN+ K+V  QVPAE L  D W+WRKYGQKPIKGSPYPR YYRCS+SKGC
Sbjct  149   PHTQSPRPKRRKNQLKKVC-QVPAEGLSSDMWSWRKYGQKPIKGSPYPRGYYRCSTSKGC  207

Query  664   LARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVP  843
             LARKQVE++ S   MFIVTYT+EH+H  PT RNSLAG+ R K P   +A     +     
Sbjct  208   LARKQVERNRSDPNMFIVTYTSEHNHPMPTHRNSLAGSTRQK-PVNSEAGTPSDSNKPTS  266

Query  844   ELVAASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFA  1023
                 +S A  SP      A  + +   +D E++ E       S  +G+  +   ++DFF 
Sbjct  267   SSPVSSPACHSP------ATEKQESSKEDKEDIFEDDDDEFGSSNTGLDNMEPADDDFFE  320

Query  1024  GLEDL  1038
             GLE+L
Sbjct  321   GLEEL  325



>ref|XP_007040356.1| WRKY family transcription factor, putative [Theobroma cacao]
 gb|EOY24857.1| WRKY family transcription factor, putative [Theobroma cacao]
Length=319

 Score =   122 bits (305),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 97/216 (45%), Positives = 126/216 (58%), Gaps = 18/216 (8%)
 Frame = +1

Query  160  FEDNWGLQAIVQQP------PLMASSEFTLQSCHDYLFDFSQEN-VLNFDDFVRT-AMVP  315
            + +NW L+A+V         P M +  F+        + F QE+ +++F D   T   V 
Sbjct  5    YMENWDLRAVVGGSSNGACIPDMENPPFSFDP-----WSFQQEDLIMSFPDVFETNPKVL  59

Query  316  DDALLEELYKPFIQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSS---PVLEAP  486
            D+  LEELYKPF       S    +     V Q +++ +   K+  + +S+      ++ 
Sbjct  60   DE--LEELYKPFYPEFNPFSTQTIITSSLPVPQDEEKPESQKKQQPVSQSAVSGTNKDST  117

Query  487  NNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCL  666
                PK   RKN+  RVV  V A+ L  D WAWRKYGQKPIKGSPYPRSYYRCSSSKGCL
Sbjct  118  QTAKPKRSSRKNQQNRVVKHVTADGLSSDIWAWRKYGQKPIKGSPYPRSYYRCSSSKGCL  177

Query  667  ARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAG  774
            ARKQVE+S S   +FI+TYTAEHSH  PTRR+SLAG
Sbjct  178  ARKQVERSCSDPRIFIITYTAEHSHGHPTRRSSLAG  213



>ref|XP_004951247.1| PREDICTED: probable WRKY transcription factor 27-like [Setaria 
italica]
Length=378

 Score =   122 bits (307),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +1

Query  496  VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
            VP+ KRRKN+ K+VV  VPA+    D WAWRKYGQKPIKGSPYPR YYRCSSSKGC ARK
Sbjct  154  VPRSKRRKNQVKKVVCHVPADGSSSDVWAWRKYGQKPIKGSPYPRGYYRCSSSKGCAARK  213

Query  676  QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKF  792
            QVE+S S    FI+TYT EH+H+ PT RNSLAGT R+KF
Sbjct  214  QVERSRSDPNTFILTYTGEHNHAAPTHRNSLAGTTRHKF  252



>ref|XP_010445280.1| PREDICTED: probable WRKY transcription factor 27 [Camelina sativa]
Length=364

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 82/113 (73%), Gaps = 0/113 (0%)
 Frame = +1

Query  502  KFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQV  681
            + ++RKN+ KR +  V  E L  D WAWRKYGQKPIKGSPYPR+YYRCSSSKGCLARKQV
Sbjct  156  RSRKRKNQQKRTICHVTQENLSSDMWAWRKYGQKPIKGSPYPRNYYRCSSSKGCLARKQV  215

Query  682  EQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHV  840
            E+SN    +FIVTYT EH+H +PT RNSLAG+ RNK  P       DS+   V
Sbjct  216  ERSNLDPNIFIVTYTGEHTHPRPTHRNSLAGSTRNKSQPVNPIPKPDSSGQTV  268



>ref|XP_010482660.1| PREDICTED: probable WRKY transcription factor 27 [Camelina sativa]
Length=366

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 82/113 (73%), Gaps = 0/113 (0%)
 Frame = +1

Query  502  KFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQV  681
            + ++RKN+ KR +  V  E L  D WAWRKYGQKPIKGSPYPR+YYRCSSSKGCLARKQV
Sbjct  155  RSRKRKNQQKRTICHVTQENLSSDMWAWRKYGQKPIKGSPYPRNYYRCSSSKGCLARKQV  214

Query  682  EQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHV  840
            E+SN    +FIVTYT EH+H +PT RNSLAG+ RNK  P       DS+   V
Sbjct  215  ERSNLDPNIFIVTYTGEHTHPRPTHRNSLAGSTRNKSQPVNPIPKPDSSGQTV  267



>ref|XP_006372370.1| hypothetical protein POPTR_0017s00960g [Populus trichocarpa]
 gb|ERP50167.1| hypothetical protein POPTR_0017s00960g [Populus trichocarpa]
Length=412

 Score =   122 bits (307),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 91/128 (71%), Gaps = 2/128 (2%)
 Frame = +1

Query  496  VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
             P+ +++K+  K++V+ V AE L  D WAWRKYGQKPIKGSPYPR+YYRCSSSKGC ARK
Sbjct  198  TPRSRKKKSNQKKLVLHVTAENLSNDVWAWRKYGQKPIKGSPYPRNYYRCSSSKGCAARK  257

Query  676  QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVA  855
            QVE+SN+   MFIV+YT +H+H +PT RNSLAG+ RNK   AV+   E  +    P + A
Sbjct  258  QVERSNTDPNMFIVSYTGDHTHPRPTHRNSLAGSTRNKVQQAVQKPEEKESEQ--PNISA  315

Query  856  ASSALSSP  879
                 SSP
Sbjct  316  DKGLCSSP  323



>ref|XP_002509862.1| WRKY transcription factor, putative [Ricinus communis]
 gb|EEF51249.1| WRKY transcription factor, putative [Ricinus communis]
Length=334

 Score =   121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 105/248 (42%), Positives = 131/248 (53%), Gaps = 47/248 (19%)
 Frame = +1

Query  142  MGECIGFEDNWGLQAIVQ---------------QPPLMASSEFTLQSCHDYLFDFSQENV  276
            MGE   F ++W L+A+V+                PP + S   TL        D  QE +
Sbjct  1    MGE-FTFMEDWDLEAVVRGCSTNEAFADIMINNNPPSVLSPLSTLDQ------DDRQE-L  52

Query  277  LNFDDFVRTAMVPDDALLE-ELYKPFI--------------QPAASISFTGEVKQEA-AV  408
            L+  DF   A    D  +E E YKP +               P +S+S      QE   +
Sbjct  53   LSSPDFFEFATKDFDYGVEKETYKPLLFYPNQQALSPQSILSPTSSMSIPSYDGQEPEKL  112

Query  409  HqmqqqqDGDVKKSGLDKSSPVLEAPNNYVPKFKR-RKNEHKRVVVQVPAEELCEDKWAW  585
             +     + D   S  D ++P+         K KR RK+   RVV  V A+ L  D WAW
Sbjct  113  QKKHLFSESDAPVSCSDDATPLAS-------KSKRCRKSAQNRVVKHVTADGLSSDMWAW  165

Query  586  RKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNS  765
            RKYGQKPIKGSPYPRSYYRCSS KGCLARKQVE+S+S   +FI+TYTAEHSH+ PTRRNS
Sbjct  166  RKYGQKPIKGSPYPRSYYRCSSLKGCLARKQVERSSSDPSIFIITYTAEHSHAHPTRRNS  225

Query  766  LAGTIRNK  789
            LAG+ R K
Sbjct  226  LAGSTRIK  233



>gb|ACU17673.1| unknown [Glycine max]
Length=351

 Score =   121 bits (303),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 82/112 (73%), Gaps = 3/112 (3%)
 Frame = +1

Query  496  VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
             P+ KRRKN+ K+V  QVP E L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGCLARK
Sbjct  137  TPRSKRRKNQLKKVC-QVPVENLSSDIWAWRKYGQKPIKGSPYPRGYYRCSSSKGCLARK  195

Query  676  QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK--FPPAVKAAAEDS  825
            QVE++ S   MFIVTYTAEH+H  PT RNSLAG+ R K   P       EDS
Sbjct  196  QVERNRSDPTMFIVTYTAEHNHPAPTHRNSLAGSTRQKPLVPQTATTTEEDS  247



>ref|XP_006601715.1| PREDICTED: transcription factor isoform X1 [Glycine max]
Length=351

 Score =   121 bits (303),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 82/112 (73%), Gaps = 3/112 (3%)
 Frame = +1

Query  496  VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
             P+ KRRKN+ K+V  QVP E L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGCLARK
Sbjct  137  TPRSKRRKNQLKKVC-QVPVENLSSDIWAWRKYGQKPIKGSPYPRGYYRCSSSKGCLARK  195

Query  676  QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK--FPPAVKAAAEDS  825
            QVE++ S   MFIVTYTAEH+H  PT RNSLAG+ R K   P       EDS
Sbjct  196  QVERNRSDPTMFIVTYTAEHNHPAPTHRNSLAGSTRQKPLVPQTATTTEEDS  247



>gb|KHN18817.1| WRKY transcription factor 22 [Glycine soja]
Length=334

 Score =   120 bits (302),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 114/192 (59%), Gaps = 30/192 (16%)
 Frame = +1

Query  496   VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
              P+ KRRKN+ K+V  QV AE L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGCLARK
Sbjct  135   TPRSKRRKNQLKKVC-QVAAENLSSDIWAWRKYGQKPIKGSPYPRGYYRCSSSKGCLARK  193

Query  676   QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAE----DSTAHHVP  843
             QVE++ S   MFIVTYT EH+H  PT +NSLAG+ R+K   A   AA       +   + 
Sbjct  194   QVERNRSDPAMFIVTYTGEHNHPAPTHKNSLAGSTRHKPQTATADAATIKPASPSTSGME  253

Query  844   ELVAASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVV-----EMSDQSGVSQVAMDN  1008
             E VA  SA S  T                     E M+ +     E+ ++ G+++  + +
Sbjct  254   EEVAQHSAKSESTEE-------------------EDMEDLMKNDEELPNEFGLTETVV-S  293

Query  1009  EDFFAGLEDLDG  1044
             +DFF GLE+L G
Sbjct  294   DDFFEGLEELTG  305



>ref|XP_010442827.1| PREDICTED: probable WRKY transcription factor 27 [Camelina sativa]
Length=361

 Score =   121 bits (303),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = +1

Query  502  KFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQV  681
            + ++RKN+ KR +  V  E L  D WAWRKYGQKPIKGSPYPR+YYRCSSSKGCLARKQV
Sbjct  150  RSRKRKNQQKRTICHVTQENLSSDMWAWRKYGQKPIKGSPYPRNYYRCSSSKGCLARKQV  209

Query  682  EQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHV  840
            E+SN    +FIVTYT EH+H  PT RNSLAG+ RNK  P       DS+   V
Sbjct  210  ERSNLDPNIFIVTYTGEHTHPLPTHRNSLAGSTRNKSQPVNPIPKPDSSGQTV  262



>ref|XP_009386375.1| PREDICTED: WRKY transcription factor 22 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=295

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 91/233 (39%), Positives = 115/233 (49%), Gaps = 38/233 (16%)
 Frame = +1

Query  163  EDNWGLQAIVQQPPLMASSEFTLQSCHDYLFD-------------FSQENVLNFDDFVRT  303
            +DNW L A+V+       S  T     D LF                +E    F + V T
Sbjct  3    DDNWDLYAVVR-----GCSAGTAVDVDDPLFSPFPPFLLQERDVGGEKERAFGFPELVGT  57

Query  304  AMVPDDALLEELYKPFIQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEA  483
            +  P    L EL KPF        +  ++ QE  +        GD ++S      P    
Sbjct  58   SSYPYG--LHELCKPF--------YAMDLHQEPPLIPAV----GDPRQSQRQSRQPQRPV  103

Query  484  PNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGC  663
              +  P+  RRKN+ K+VV QV A  +  D WAWRKYGQKPIKGSPYPR        KGC
Sbjct  104  --SQAPRSARRKNQQKKVVCQVAAHGVRSDLWAWRKYGQKPIKGSPYPRCSTS----KGC  157

Query  664  LARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAED  822
             ARKQVEQS +  GM ++TYTAEH+H  PT RNSLAG+ R K PP   A  ++
Sbjct  158  QARKQVEQSRADPGMLLITYTAEHNHPMPTIRNSLAGSTRPKLPPPTSADGDN  210



>ref|XP_010916830.1| PREDICTED: WRKY transcription factor 22-like [Elaeis guineensis]
Length=346

 Score =   120 bits (301),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 94/227 (41%), Positives = 118/227 (52%), Gaps = 24/227 (11%)
 Frame = +1

Query  166  DNWGLQAIVQ-----QP------------PLMASSEFTLQSCHDYLFDFSQENVLNFDDF  294
            DNW L+A+V+     +P            P  + +   L+       D  ++++  F D 
Sbjct  4    DNWDLEAVVRGCCFRRPSTRTTSTATMTDPFSSFASLVLKGEQG---DGEKDHLFGFPDI  60

Query  295  VRTAMVPDDALLEELYKPFIQ-PAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSP  471
            + T     D  LE+L KPF   P    S                    D  ++    S P
Sbjct  61   MDTETAFRD--LEDLCKPFFHTPHQQPSQQQSQLFPQQSRPSSSPAVADPCQTQQQWSPP  118

Query  472  VLEAPNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcss  651
                  N  P+ +RRKN+ KRVV  VPA+ L  D WAWRKYGQKPIKGSPYPR YYRCSS
Sbjct  119  QRPLEAN-TPRSRRRKNQQKRVVRHVPADGLYSDMWAWRKYGQKPIKGSPYPRGYYRCSS  177

Query  652  sKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKF  792
            SKGCLARKQVE+S +   M +VTYTA+H H  PT RNSLAG+ R K 
Sbjct  178  SKGCLARKQVERSRTDPAMLVVTYTADHDHPLPTHRNSLAGSTRQKL  224



>gb|EYU32172.1| hypothetical protein MIMGU_mgv1a009333mg [Erythranthe guttata]
Length=345

 Score =   120 bits (301),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 108/180 (60%), Gaps = 24/180 (13%)
 Frame = +1

Query  499   PKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQ  678
             P+ KRRKN  KRV   V AE L  D W+WRKYGQKPIKGSPYPR YYRCS+SKGCLARKQ
Sbjct  164   PRSKRRKNNLKRVC-HVAAENLSSDMWSWRKYGQKPIKGSPYPRGYYRCSTSKGCLARKQ  222

Query  679   VEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAA  858
             VE++ S  GMFIVTYTAEH+H  P  RNSLAG+ RNK                      A
Sbjct  223   VERNRSDPGMFIVTYTAEHNHPIPAHRNSLAGSTRNK---------------------QA  261

Query  859   SSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFAGLEDL  1038
              + +S    N     S  +  +   ++   +    E  D+  +S++A+D EDFFAGLED+
Sbjct  262   ETPISD-DPNKQPTSSSPEKMESSRDDDLAEAAADEDDDEFSISEMALD-EDFFAGLEDI  319



>ref|XP_007139781.1| hypothetical protein PHAVU_008G058300g [Phaseolus vulgaris]
 gb|ESW11775.1| hypothetical protein PHAVU_008G058300g [Phaseolus vulgaris]
Length=346

 Score =   120 bits (301),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 90/129 (70%), Gaps = 2/129 (2%)
 Frame = +1

Query  496  VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
             P+ KRRKN+ K+V  QVP E L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGCLARK
Sbjct  135  TPRSKRRKNQLKKVC-QVPFENLSSDIWAWRKYGQKPIKGSPYPRGYYRCSSSKGCLARK  193

Query  676  QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVA  855
            QVE++ S   MFIVTYTAEH+H  PT RNSLAG+ R K P A + A  +  +     L  
Sbjct  194  QVERNRSDPTMFIVTYTAEHNHPAPTHRNSLAGSTRQK-PLAPQTATTEQDSDKSKSLTK  252

Query  856  ASSALSSPT  882
             SS  +S T
Sbjct  253  PSSPATSGT  261



>ref|XP_010112624.1| putative WRKY transcription factor 29 [Morus notabilis]
 gb|EXC34349.1| putative WRKY transcription factor 29 [Morus notabilis]
Length=330

 Score =   120 bits (300),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 109/156 (70%), Gaps = 9/156 (6%)
 Frame = +1

Query  328  LEELYKPFIQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPNNYVPKF  507
            LE+LYKPF  P     F+      A+   + QQ + +V +    K   V EA +    K+
Sbjct  64   LEDLYKPFY-PVLHSPFSSPSTPLASCISLPQQAEINVPQ----KIKKVKEAAS----KY  114

Query  508  KRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQ  687
            K+RKN+ K+VV QV  + LC D WAWRKYGQKPIKGSPYPRSYYRCSSSKGC ARKQVE+
Sbjct  115  KKRKNQQKKVVKQVKEDGLCADMWAWRKYGQKPIKGSPYPRSYYRCSSSKGCSARKQVER  174

Query  688  SNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFP  795
            S S   +F++TYTAEHSH+ PTRRNSLAG+ R+KFP
Sbjct  175  SPSNPEIFVITYTAEHSHTHPTRRNSLAGSTRSKFP  210



>ref|XP_003622494.1| WRKY transcription factor [Medicago truncatula]
 gb|KEH18798.1| WRKY family transcription factor [Medicago truncatula]
Length=338

 Score =   120 bits (300),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 117/191 (61%), Gaps = 10/191 (5%)
 Frame = +1

Query  481   APNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKG  660
             A +   P+ KRRK +HK+V  +V AE+L  D WAWRKYGQKPIKGSPYPR YYRCSSSKG
Sbjct  127   AASAITPRSKRRKIQHKKVC-EVQAEKLSSDIWAWRKYGQKPIKGSPYPRGYYRCSSSKG  185

Query  661   CLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHV  840
             CLARKQVE++ S   MFIVTYT EHSH  PT RNSLAG+ R K        AEDS+    
Sbjct  186   CLARKQVERNKSDPSMFIVTYTGEHSHPAPTHRNSLAGSTRQKPLSPQTVTAEDSSQQPF  245

Query  841   PELVAASSALSSP--TANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNED  1014
              + V++S++ +            SE K++ ++     E+    E+SD        +  +D
Sbjct  246   TKQVSSSTSEAEEEDVTTLLSVKSESKEDLEEMMNDDEEENEFELSDM-------VVTDD  298

Query  1015  FFAGLEDLDGL  1047
             FF GL++L G 
Sbjct  299   FFEGLDELTGF  309



>ref|XP_003534539.1| PREDICTED: WRKY transcription factor 22-like [Glycine max]
 gb|KHN29312.1| WRKY transcription factor 22 [Glycine soja]
Length=348

 Score =   120 bits (300),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 82/112 (73%), Gaps = 3/112 (3%)
 Frame = +1

Query  496  VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
             P+ KRRKN+ K+V  QVP E L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGCLARK
Sbjct  134  TPRSKRRKNQLKKVC-QVPVENLSSDIWAWRKYGQKPIKGSPYPRGYYRCSSSKGCLARK  192

Query  676  QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK--FPPAVKAAAEDS  825
            QVE++ S   MFIVTYTAEH+H  PT RNSLAG+ R K   P       EDS
Sbjct  193  QVERNRSDPTMFIVTYTAEHNHPAPTHRNSLAGSTRQKPLAPQTATTTEEDS  244



>emb|CDY01962.1| BnaC02g27650D [Brassica napus]
Length=291

 Score =   119 bits (298),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 111/310 (36%), Positives = 153/310 (49%), Gaps = 41/310 (13%)
 Frame = +1

Query  166   DNWGLQAIVQQPPLMASSEFTLQSCHDYLFDFSQENVLNFDDFVRTAMVPDDALLEELYK  345
             D+W L A+V+    ++SS  T+ S            +  +++  +  +  D   +++ Y 
Sbjct  3     DDWDLHAVVRGCSAVSSSATTVFSG---AVSSHTNPMFTYEEQSKAVLFRD---IQDFYT  56

Query  346   PFIQPAASISFTG-EVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPNNYVPKFKRRKN  522
             PF Q +   SF+     +E    Q Q++       SG   S P      +   + KRRK 
Sbjct  57    PFTQESNVSSFSCLNYPEEPRQRQNQKRPLSLSASSGSVTSKPT----GSNTSRSKRRKI  112

Query  523   EHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNSAA  702
             +HK+V   V AE L  D WAWRKYGQKPIKGSPYPR YYRCS+SKGCLARKQVE++ S A
Sbjct  113   QHKKVC-HVAAEALNSDVWAWRKYGQKPIKGSPYPRGYYRCSTSKGCLARKQVERNRSDA  171

Query  703   GMFIVTYTAEHSHSQPTRRNSLAGTIRNK---FPPAVKAAAEDSTAHHVPELVAASSALS  873
              +FIVTYTAEH+H  PT RNSLAG+ R K    P    A    S      E V  +  L+
Sbjct  172   TIFIVTYTAEHNHPAPTHRNSLAGSTRQKSSDHPTTTIATYSSSPVTSTDEFVLPAEDLA  231

Query  874   SPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFAGLEDLDGLIS  1053
                                  +L     ++ +SD        + +EDFF GLE+  G  S
Sbjct  232   -------------------VGDLDGDEDLLSLSD-------TVVSEDFFEGLEEFAGGDS  265

Query  1054  YFSYSSQCNY  1083
             +   SS  ++
Sbjct  266   FSGNSSPASF  275



>ref|NP_568777.1| WRKY DNA-binding protein 27 [Arabidopsis thaliana]
 sp|Q9FLX8.1|WRK27_ARATH RecName: Full=Probable WRKY transcription factor 27; AltName: 
Full=WRKY DNA-binding protein 27 [Arabidopsis thaliana]
 gb|AAL13041.1|AF418310_1 WRKY transcription factor 27 [Arabidopsis thaliana]
 dbj|BAB10431.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAF02234.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABH04558.1| At5g52830 [Arabidopsis thaliana]
 dbj|BAH30628.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED96266.1| WRKY DNA-binding protein 27 [Arabidopsis thaliana]
Length=348

 Score =   120 bits (300),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +1

Query  508  KRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQ  687
            ++RKN+ KR +  V  E L  D WAWRKYGQKPIKGSPYPR+YYRCSSSKGCLARKQVE+
Sbjct  145  RKRKNQQKRTICHVTQENLSSDLWAWRKYGQKPIKGSPYPRNYYRCSSSKGCLARKQVER  204

Query  688  SNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDST  828
            SN    +FIVTYT EH+H +PT RNSLAG+ RNK  P       D++
Sbjct  205  SNLDPNIFIVTYTGEHTHPRPTHRNSLAGSTRNKSQPVNPVPKPDTS  251



>ref|XP_003535592.1| PREDICTED: probable WRKY transcription factor 27 [Glycine max]
Length=297

 Score =   119 bits (298),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +1

Query  496  VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
             PK ++RK++ K++V  V A+ L  D WAWRKYGQKPIKGSPYPR+YYRCSSSKGC+ARK
Sbjct  156  TPKSRKRKSQQKKMVCHVTADNLSADLWAWRKYGQKPIKGSPYPRNYYRCSSSKGCMARK  215

Query  676  QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK  789
            QVE+SN+   MF+VTYT +HSH +PT RNSLAG+ R+K
Sbjct  216  QVERSNTEPDMFVVTYTGDHSHPRPTHRNSLAGSTRSK  253



>ref|XP_008776340.1| PREDICTED: WRKY transcription factor 22-like [Phoenix dactylifera]
Length=344

 Score =   120 bits (300),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +1

Query  496  VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
             P+ KRRK++ KRVV  VPA+ L  D WAWRKYGQKPIKGSPYPR YYRCSSS+GCLARK
Sbjct  126  TPRSKRRKDQQKRVVCHVPADGLSSDMWAWRKYGQKPIKGSPYPRGYYRCSSSRGCLARK  185

Query  676  QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK  789
            QVE+S     M +VTYTAEH+H  PT RNSLAG+ R K
Sbjct  186  QVERSQIDPAMLVVTYTAEHNHPLPTHRNSLAGSTRQK  223



>gb|KHN21793.1| Putative WRKY transcription factor 27 [Glycine soja]
Length=295

 Score =   119 bits (297),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +1

Query  496  VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
             PK ++RK++ K++V  V A+ L  D WAWRKYGQKPIKGSPYPR+YYRCSSSKGC+ARK
Sbjct  154  TPKSRKRKSQQKKMVCHVTADNLSADLWAWRKYGQKPIKGSPYPRNYYRCSSSKGCMARK  213

Query  676  QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK  789
            QVE+SN+   MF+VTYT +HSH +PT RNSLAG+ R+K
Sbjct  214  QVERSNTEPDMFVVTYTGDHSHPRPTHRNSLAGSTRSK  251



>ref|XP_010060258.1| PREDICTED: probable WRKY transcription factor 27 isoform X1 [Eucalyptus 
grandis]
 gb|KCW90610.1| hypothetical protein EUGRSUZ_A02718 [Eucalyptus grandis]
Length=398

 Score =   120 bits (301),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 90/126 (71%), Gaps = 2/126 (2%)
 Frame = +1

Query  496  VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
             P+ ++RK++ K+ V  V AE L  D WAWRKYGQKPIKGSP+PR+YYRCSSSKGC ARK
Sbjct  161  TPRSRKRKSQQKKSVCHVTAENLSSDPWAWRKYGQKPIKGSPFPRNYYRCSSSKGCSARK  220

Query  676  QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDST--AHHVPEL  849
            QVE+SN+   +F++TYT +H+H +PT RNSLAG+ RNK+  +      DS   AH  P  
Sbjct  221  QVERSNADPNIFVITYTGDHTHPRPTHRNSLAGSTRNKYSTSSSLQKPDSICPAHSAPAA  280

Query  850  VAASSA  867
              ++S+
Sbjct  281  PCSTSS  286



>gb|KFK26883.1| hypothetical protein AALP_AA8G305900 [Arabis alpina]
Length=340

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +1

Query  508  KRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQ  687
            ++RKN+ KR +  V  E L  D WAWRKYGQKPIKGSPYPR+YYRCSS+KGCLARKQVE+
Sbjct  146  RKRKNQQKRTICHVTQENLSSDMWAWRKYGQKPIKGSPYPRNYYRCSSTKGCLARKQVER  205

Query  688  SNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPA  801
            SN    +FIVTYT EH+H +PT RNSLAG+ RNK  P 
Sbjct  206  SNLDPNIFIVTYTGEHTHPRPTHRNSLAGSTRNKSQPV  243



>ref|NP_001237508.1| transcription factor [Glycine max]
 gb|ABY84652.1| transcription factor [Glycine max]
Length=276

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 78/99 (79%), Gaps = 1/99 (1%)
 Frame = +1

Query  496  VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
             P+ KRRKN+ K+V  QVP E L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGCLARK
Sbjct  137  TPRSKRRKNQLKKVC-QVPVENLSSDIWAWRKYGQKPIKGSPYPRGYYRCSSSKGCLARK  195

Query  676  QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKF  792
            QVE++ S   MFIVTYTAEH+H  PT RNSLAG+ R K 
Sbjct  196  QVERNRSDPTMFIVTYTAEHNHPAPTHRNSLAGSTRQKL  234



>ref|XP_003571185.1| PREDICTED: WRKY transcription factor 22-like [Brachypodium distachyon]
Length=358

 Score =   119 bits (299),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +1

Query  496  VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
            VP+ KRRKN+ K+VV  V A+ +  D WAWRKYGQKPIKGSPYPR YYRCSSSKGC ARK
Sbjct  144  VPRSKRRKNQQKKVVCHVAADGVSSDVWAWRKYGQKPIKGSPYPRGYYRCSSSKGCPARK  203

Query  676  QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKF  792
            QVE+S +    FI+T+T EH+H+ PT RNSLAGT RNKF
Sbjct  204  QVERSRADPNTFILTFTGEHNHAAPTHRNSLAGTSRNKF  242



>ref|NP_001267532.1| WRKY transcription factor 22-like [Cucumis sativus]
 ref|XP_004173708.1| PREDICTED: WRKY transcription factor 22-like [Cucumis sativus]
 gb|ADU52517.1| WRKY protein [Cucumis sativus]
 gb|KGN53355.1| hypothetical protein Csa_4G050120 [Cucumis sativus]
Length=269

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +1

Query  514  RKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSN  693
            +K+   RVV +V A+++C D W WRKYGQKPIKGSPYPRSYYRCSSSKGC ARKQVE+S 
Sbjct  121  KKSRQNRVVKEVKADKVCSDSWGWRKYGQKPIKGSPYPRSYYRCSSSKGCSARKQVERSL  180

Query  694  SAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFP  795
            S   +FIVTYTAEH+H++PTRRN+LAGT R KFP
Sbjct  181  SDPEVFIVTYTAEHNHAEPTRRNALAGTTRKKFP  214



>ref|NP_001130964.1| putative WRKY DNA-binding domain superfamily protein [Zea mays]
 gb|ACF79368.1| unknown [Zea mays]
 gb|AFW65839.1| putative WRKY DNA-binding domain superfamily protein [Zea mays]
Length=370

 Score =   119 bits (299),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +1

Query  496  VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
            VP+ KRRKN+ K+VV  VPA+    D WAWRKYGQKPIKGSPYPR YYRCSSSKGC ARK
Sbjct  148  VPRSKRRKNQVKKVVCHVPADGSSPDVWAWRKYGQKPIKGSPYPRGYYRCSSSKGCAARK  207

Query  676  QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKF  792
            QVE+S +    FI+T+T EH+H+ PT RNSLAGT R+KF
Sbjct  208  QVERSRADPNTFILTFTGEHNHAAPTHRNSLAGTTRHKF  246



>ref|XP_004496517.1| PREDICTED: probable WRKY transcription factor 27-like [Cicer 
arietinum]
Length=298

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +1

Query  496  VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
             P+ ++RK++  ++V  V A+ L  D WAWRKYGQKPIKGSPYPR+YYRCSSSKGC ARK
Sbjct  151  TPRSRKRKSQQGKMVCHVTADNLSADLWAWRKYGQKPIKGSPYPRNYYRCSSSKGCTARK  210

Query  676  QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFP  795
            QVE+SNS A MFIVTYT +H+H +PT RNSLAG+ R K P
Sbjct  211  QVERSNSEAEMFIVTYTGDHTHPRPTHRNSLAGSTRTKSP  250



>ref|XP_009366563.1| PREDICTED: WRKY transcription factor 22-like [Pyrus x bretschneideri]
 ref|XP_009366569.1| PREDICTED: WRKY transcription factor 22-like [Pyrus x bretschneideri]
Length=348

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 110/186 (59%), Gaps = 12/186 (6%)
 Frame = +1

Query  508   KRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQ  687
             K+RKN+ K+V  QVPAE L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGC+ARKQVE+
Sbjct  151   KKRKNQLKKVC-QVPAEGLSSDIWAWRKYGQKPIKGSPYPRGYYRCSSSKGCMARKQVER  209

Query  688   SNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAASSA  867
             + S   +FIVTYTAEH+H  PT RNSLAG+ R K     K    DS     P    ++S 
Sbjct  210   NKSDPNIFIVTYTAEHNHPAPTHRNSLAGSTRQKPLSPQKTTGGDSAKPTSP--TTSASV  267

Query  868   LSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFAGLEDLDGL  1047
                P      AG     E    EE G  +   E  +  G+    + ++DFF G   LDGL
Sbjct  268   DEEPVV----AGRSTTVESSCKEEKGSPLITDEEDELLGICDSVV-SDDFFEG---LDGL  319

Query  1048  I-SYFS  1062
                YFS
Sbjct  320   AEDYFS  325



>ref|NP_192034.1| WRKY transcription factor 22 [Arabidopsis thaliana]
 sp|O04609.1|WRK22_ARATH RecName: Full=WRKY transcription factor 22; AltName: Full=WRKY 
DNA-binding protein 22 [Arabidopsis thaliana]
 gb|AAL35285.1|AF442392_1 WRKY transcription factor 22 [Arabidopsis thaliana]
 gb|AAB61016.1| similar to SPF1 DNA-binding protein [Arabidopsis thaliana]
 emb|CAB80934.1| putative DNA-binding protein [Arabidopsis thaliana]
 gb|AAK76583.1| putative DNA-binding protein [Arabidopsis thaliana]
 gb|AAL85135.1| putative DNA-binding protein [Arabidopsis thaliana]
 gb|AEE81999.1| WRKY transcription factor 22 [Arabidopsis thaliana]
Length=298

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 94/216 (44%), Positives = 122/216 (56%), Gaps = 25/216 (12%)
 Frame = +1

Query  166  DNWGLQAIVQQPPLMASSEFT------LQSCHDYLFDFS-QENVLNFDDFVRTAMVPDDA  324
            D+W L A+V+    ++SS  T      + S  + +F    Q N ++F +           
Sbjct  3    DDWDLHAVVRGCSAVSSSATTTVYSPGVSSHTNPIFTVGRQSNAVSFGE-----------  51

Query  325  LLEELYKPFIQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPN-NYVP  501
             + +LY PF Q +   SF+     E       Q++   +  S    S  V   P+ +   
Sbjct  52   -IRDLYTPFTQESVVSSFSCINYPEEPRKPQNQKRPLSLSAS----SGSVTSKPSGSNTS  106

Query  502  KFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQV  681
            + KRRK +HK+V   V AE L  D WAWRKYGQKPIKGSPYPR YYRCS+SKGCLARKQV
Sbjct  107  RSKRRKIQHKKVC-HVAAEALNSDVWAWRKYGQKPIKGSPYPRGYYRCSTSKGCLARKQV  165

Query  682  EQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK  789
            E++ S   MFIVTYTAEH+H  PT RNSLAG+ R K
Sbjct  166  ERNRSDPKMFIVTYTAEHNHPAPTHRNSLAGSTRQK  201



>ref|XP_006401776.1| hypothetical protein EUTSA_v10013872mg [Eutrema salsugineum]
 gb|ESQ43229.1| hypothetical protein EUTSA_v10013872mg [Eutrema salsugineum]
Length=369

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 85/121 (70%), Gaps = 3/121 (2%)
 Frame = +1

Query  508  KRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQ  687
            ++RKN+ KR +  V  E L  D WAWRKYGQKPIKGSPYPR+YYRCSSSKGCLARKQVE+
Sbjct  159  RKRKNQQKRTICHVTQENLSSDMWAWRKYGQKPIKGSPYPRNYYRCSSSKGCLARKQVER  218

Query  688  SNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAASSA  867
            SN    +FIVTYT EH+H +PT RNSLAG+ RNK  P       D   H   + V+ S+ 
Sbjct  219  SNLDPNIFIVTYTGEHTHPRPTHRNSLAGSTRNKSQPVNPIPKPD---HSSGQTVSGSNT  275

Query  868  L  870
            +
Sbjct  276  V  276



>ref|XP_009350327.1| PREDICTED: WRKY transcription factor 22-like [Pyrus x bretschneideri]
Length=346

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 110/186 (59%), Gaps = 12/186 (6%)
 Frame = +1

Query  508   KRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQ  687
             K+RKN+ K+V  QVPAE L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGC+ARKQVE+
Sbjct  149   KKRKNQLKKVC-QVPAEGLSSDIWAWRKYGQKPIKGSPYPRGYYRCSSSKGCMARKQVER  207

Query  688   SNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAASSA  867
             + S   +FIVTYTAEH+H  PT RNSLAG+ R K     K    DS     P    ++S 
Sbjct  208   NKSDPNIFIVTYTAEHNHPAPTHRNSLAGSTRQKPLSPQKTTGGDSAKPTSP--TTSASV  265

Query  868   LSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFAGLEDLDGL  1047
                P      AG     E    EE G  +   E  +  G+    + ++DFF G   LDGL
Sbjct  266   DEEPVV----AGRSTTVESSCKEEKGSPLITDEEDELLGICDSVV-SDDFFEG---LDGL  317

Query  1048  I-SYFS  1062
                YFS
Sbjct  318   AEDYFS  323



>ref|XP_003624081.1| WRKY transcription factor [Medicago truncatula]
 gb|AES80299.1| WRKY family transcription factor [Medicago truncatula]
Length=328

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 111/183 (61%), Gaps = 18/183 (10%)
 Frame = +1

Query  499   PKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQ  678
             P+ KRRKN+ K+V  QVP E L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGCLARKQ
Sbjct  132   PRSKRRKNQLKKVC-QVPVESLSSDIWAWRKYGQKPIKGSPYPRGYYRCSSSKGCLARKQ  190

Query  679   VEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAA  858
             VE++ +   MFIVTYT EH+H  PT +NSLAG+ R K  P      E +     P     
Sbjct  191   VERNRTDPTMFIVTYTCEHNHPAPTHKNSLAGSTRQK--PLTPPQGETNKDLTKP-----  243

Query  859   SSALSSPTANNWRAGSEIKdeddddeeLGEKMQVV---EMSDQSGVSQVAMDNEDFFAGL  1029
                 SSPT +      E++ + D  E   EK   +   E  D+ G+S V + ++DFF  L
Sbjct  244   ----SSPTTSG--GEEEVQTQGDKSESREEKEDSLMDDEEGDEFGLSDVVL-SDDFFESL  296

Query  1030  EDL  1038
             ++ 
Sbjct  297   DEF  299



>ref|XP_009127213.1| PREDICTED: probable WRKY transcription factor 27 [Brassica rapa]
Length=344

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = +1

Query  502  KFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQV  681
            + ++RKN+ KR +  V  E L  D WAWRKYGQKPIKGSPYPR+YYRCSSSKGCLARKQV
Sbjct  148  RSRKRKNQQKRTICHVTQENLSSDMWAWRKYGQKPIKGSPYPRNYYRCSSSKGCLARKQV  207

Query  682  EQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAED  822
            E+SN    +FIVTYT EH+H +PT RNSLAG+ RNK  P       D
Sbjct  208  ERSNLDPNIFIVTYTGEHTHPRPTHRNSLAGSTRNKSQPVNPPPKPD  254



>emb|CDY27045.1| BnaA02g10650D [Brassica napus]
Length=344

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = +1

Query  502  KFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQV  681
            + ++RKN+ KR +  V  E L  D WAWRKYGQKPIKGSPYPR+YYRCSSSKGCLARKQV
Sbjct  148  RSRKRKNQQKRTICHVTQENLSSDMWAWRKYGQKPIKGSPYPRNYYRCSSSKGCLARKQV  207

Query  682  EQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAED  822
            E+SN    +FIVTYT EH+H +PT RNSLAG+ RNK  P       D
Sbjct  208  ERSNLDPNIFIVTYTGEHTHPRPTHRNSLAGSTRNKSQPVNPPPKPD  254



>gb|ACI14392.1| WRKY27-1 transcription factor [Brassica napus]
 gb|AGA37238.1| WRKY transcription factor 27.1 [Brassica napus]
Length=343

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +1

Query  502  KFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQV  681
            + ++RKN+ KR +  V  E L  D WAWRKYGQKPIKGSPYPR+YYRCSSSKGCLARKQV
Sbjct  148  RSRKRKNQQKRTICHVTQENLSSDMWAWRKYGQKPIKGSPYPRNYYRCSSSKGCLARKQV  207

Query  682  EQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPP  798
            E+SN    +FIVTYT EH+H +PT RNSLAG+ RNK  P
Sbjct  208  ERSNLDPNIFIVTYTGEHTHPRPTHRNSLAGSTRNKSQP  246



>ref|XP_002864197.1| hypothetical protein ARALYDRAFT_495347 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40456.1| hypothetical protein ARALYDRAFT_495347 [Arabidopsis lyrata subsp. 
lyrata]
Length=365

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = +1

Query  502  KFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQV  681
            + ++RKN+ KR +  V  E L  D WAWRKYGQKPIKGSPYPR+YYRCSSSKGCLARKQV
Sbjct  156  RSRKRKNQQKRTICHVTQENLSSDLWAWRKYGQKPIKGSPYPRNYYRCSSSKGCLARKQV  215

Query  682  EQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPA  801
            E+SN    +FIVTYT EH+H +PT RNSLAG+ RNK  P 
Sbjct  216  ERSNLDPNIFIVTYTGEHTHPRPTHRNSLAGSTRNKSQPV  255



>emb|CDX96157.1| BnaC02g14940D [Brassica napus]
Length=348

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = +1

Query  502  KFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQV  681
            + ++RKN+ KR +  V  E L  D WAWRKYGQKPIKGSPYPR+YYRCSSSKGCLARKQV
Sbjct  153  RSRKRKNQQKRTICHVTQENLSSDMWAWRKYGQKPIKGSPYPRNYYRCSSSKGCLARKQV  212

Query  682  EQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAED  822
            E+SN    +FIVTYT EH+H +PT RNSLAG+ RNK  P       D
Sbjct  213  ERSNLDPNIFIVTYTGEHTHPRPTHRNSLAGSTRNKSQPVNPPPKPD  259



>gb|KHN40435.1| WRKY transcription factor 22 [Glycine soja]
Length=319

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 77/96 (80%), Gaps = 1/96 (1%)
 Frame = +1

Query  496  VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
             P+ KRRKN+ K+V  QVP E L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGCLARK
Sbjct  137  TPRSKRRKNQLKKVC-QVPVENLSSDIWAWRKYGQKPIKGSPYPRGYYRCSSSKGCLARK  195

Query  676  QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIR  783
            QVE++ S   MFIVTYTAEH+H  PT RNSLAG+ R
Sbjct  196  QVERNRSDPTMFIVTYTAEHNHPAPTHRNSLAGSTR  231



>ref|XP_010427624.1| PREDICTED: WRKY transcription factor 22 [Camelina sativa]
Length=304

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 98/154 (64%), Gaps = 3/154 (2%)
 Frame = +1

Query  328  LEELYKPFIQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPNNYVPKF  507
            + +LYKPF+Q +   SF+     E       Q++   +  S    +S      N    + 
Sbjct  55   IRDLYKPFVQESVVSSFSCLNYPEEPRKTQNQKRPLSLSASSGSVTSKPTAGSN--TSRS  112

Query  508  KRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQ  687
            KRRK +HK+V   V AE L  D WAWRKYGQKPIKGSPYPR YYRCS+SKGCLARKQVE+
Sbjct  113  KRRKIQHKKVC-HVAAEALNSDVWAWRKYGQKPIKGSPYPRGYYRCSTSKGCLARKQVER  171

Query  688  SNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK  789
            + S   MFIVTYTAEH+H  PT RNSLAG+ R K
Sbjct  172  NRSDPKMFIVTYTAEHNHPAPTHRNSLAGSTRQK  205



>ref|XP_008452006.1| PREDICTED: probable WRKY transcription factor 29 [Cucumis melo]
Length=271

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 90/219 (41%), Positives = 119/219 (54%), Gaps = 14/219 (6%)
 Frame = +1

Query  166  DNWGLQAIVQQPPLMASSEFTLQSCHDYLFDFSQENVLNFDDFVRTAMVPDDALLEE-LY  342
            ++WGLQAIV+    +     T  +    +     E+  N   F+R+    D       +Y
Sbjct  2    EDWGLQAIVKGCNGIPIGSSTTAATTRLM-----EDTNNLYSFLRSDQEEDGGFFSSCVY  56

Query  343  KPFIQPAASIS--FTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPV---LEAPNNYVPKF  507
              +  P  S S  F  E +     +         +     D   P    L   N  +   
Sbjct  57   NNYYNPQISSSSIFHDEFEGLFGRNSSNNSAAASISHLLRDFKEPADQKLHHKNQIIQPT  116

Query  508  KR---RKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQ  678
            K+   +K+   RVV +V A+++C D W WRKYGQKPIKGSPYPRSYYRCSSSKGC ARKQ
Sbjct  117  KQKQSKKSRQNRVVKEVKADKVCSDSWGWRKYGQKPIKGSPYPRSYYRCSSSKGCSARKQ  176

Query  679  VEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFP  795
            VE+S S   +F+VTYTAEH+H++PTRRN+LAGT R KFP
Sbjct  177  VERSLSDPEVFVVTYTAEHNHAEPTRRNALAGTTRKKFP  215



>gb|EYU35112.1| hypothetical protein MIMGU_mgv1a009324mg [Erythranthe guttata]
Length=345

 Score =   118 bits (295),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 114/182 (63%), Gaps = 22/182 (12%)
 Frame = +1

Query  499   PKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQ  678
             P+ K+RKN  K+V   V AE L  D W+WRKYGQKPIKGSPYPR YY+CS+  GC+ARKQ
Sbjct  146   PRSKKRKNPLKKVC-HVSAEGLSSDMWSWRKYGQKPIKGSPYPRGYYKCSTLTGCMARKQ  204

Query  679   VEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAA  858
             VE++ S  GMF++TYTAEH+H  PT RNSLAG+ RNK  PA    +++      P+  A+
Sbjct  205   VERNKSDPGMFVITYTAEHNHPVPTHRNSLAGSSRNK--PAEAPNSDE------PKKAAS  256

Query  859   SSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFAGLEDL  1038
             SS+              ++D    +E+    + + +  D    S +A+D + FFAGL+DL
Sbjct  257   SSS------------EMLEDSSQPEEDFAAGVDLDDEDDDLSPSNMALD-DSFFAGLDDL  303

Query  1039  DG  1044
             DG
Sbjct  304   DG  305



>ref|XP_009768958.1| PREDICTED: WRKY transcription factor 22-like [Nicotiana sylvestris]
Length=363

 Score =   118 bits (296),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 109/185 (59%), Gaps = 18/185 (10%)
 Frame = +1

Query  499   PKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQ  678
             P+ KRRKN+ K+V  QVPAE L  D W+WRKYGQKPIKGSPYPR YYRCS+SKGC ARKQ
Sbjct  158   PRPKRRKNQLKKVC-QVPAEGLSSDMWSWRKYGQKPIKGSPYPRGYYRCSTSKGCSARKQ  216

Query  679   VEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAA  858
             VE++ S   MFIVTYT+EH+H  PT RNSLAG+ R K P   +A     +         +
Sbjct  217   VERNRSDPNMFIVTYTSEHNHPMPTHRNSLAGSTRQK-PVNSEAGTPSDSNKPTSSSPVS  275

Query  859   SSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDN-----EDFFA  1023
             S A +SP                D     ++    +  D+ G S + +DN     +DFF 
Sbjct  276   SPACNSPATG-----------KQDSSREEKEDIFEDDDDEFGSSNMGLDNMEPADDDFFE  324

Query  1024  GLEDL  1038
             GLE+L
Sbjct  325   GLEEL  329



>ref|XP_006280638.1| hypothetical protein CARUB_v10026599mg [Capsella rubella]
 gb|EOA13536.1| hypothetical protein CARUB_v10026599mg [Capsella rubella]
Length=377

 Score =   118 bits (296),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +1

Query  502  KFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQV  681
            + ++RKN+ KR +  V  E L  D WAWRKYGQKPIKGSPYPR+YYRCSSSKGCLARKQV
Sbjct  167  RSRKRKNQQKRTICHVTQENLSSDMWAWRKYGQKPIKGSPYPRNYYRCSSSKGCLARKQV  226

Query  682  EQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK  789
            E+SN    +FIVTYT EH+H +PT RNSLAG+ RNK
Sbjct  227  ERSNLDPNIFIVTYTGEHTHPRPTHRNSLAGSTRNK  262



>gb|ACQ76802.1| WRKY transcription factor 22 [Brassica napus]
Length=291

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 110/310 (35%), Positives = 152/310 (49%), Gaps = 41/310 (13%)
 Frame = +1

Query  166   DNWGLQAIVQQPPLMASSEFTLQSCHDYLFDFSQENVLNFDDFVRTAMVPDDALLEELYK  345
             D+W L A+V+    ++SS  T+ S            +  +++  +  +  D   +++ Y 
Sbjct  3     DDWDLHAVVRGCSAVSSSATTVFSG---AVSSHTNPMFTYEEQSKAVLFRD---IQDFYT  56

Query  346   PFIQPAASISFTG-EVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPNNYVPKFKRRKN  522
             PF Q +   SF+     +E    Q Q++       SG   S P      +   + KRRK 
Sbjct  57    PFTQESNVSSFSCLNYPEEPRQRQNQKRPLSLSASSGSVTSKPT----GSNTSRSKRRKI  112

Query  523   EHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNSAA  702
             +HK+V   V AE L  D WAWRKYGQKPIKGSPYPR YYRCS+SKGCLARKQVE++ S A
Sbjct  113   QHKKVC-HVAAEALNSDVWAWRKYGQKPIKGSPYPRGYYRCSTSKGCLARKQVERNRSDA  171

Query  703   GMFIVTYTAEHSHSQPTRRNSLAGTIRNK---FPPAVKAAAEDSTAHHVPELVAASSALS  873
              +FIVTYTAEH+H  P  RNSLAG+ R K    P    A    S      E V  +  L+
Sbjct  172   TIFIVTYTAEHNHPAPAHRNSLAGSTRQKSSDHPTTTIATYSSSPVTSTDEFVLPAEDLA  231

Query  874   SPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFAGLEDLDGLIS  1053
                                  +L     ++ +SD        + +EDFF GLE+  G  S
Sbjct  232   -------------------VGDLDGDEDLLSLSD-------TVVSEDFFEGLEEFAGGDS  265

Query  1054  YFSYSSQCNY  1083
             +   SS  ++
Sbjct  266   FSGNSSPASF  275



>emb|CDP08759.1| unnamed protein product [Coffea canephora]
Length=367

 Score =   118 bits (295),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 77/94 (82%), Gaps = 1/94 (1%)
 Frame = +1

Query  508  KRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQ  687
            KRRKN+ KRV  QVPAE    D W+WRKYGQKPIKGSPYPR YYRCS+SKGCLARKQVE+
Sbjct  166  KRRKNQLKRVC-QVPAEASSSDMWSWRKYGQKPIKGSPYPRGYYRCSTSKGCLARKQVER  224

Query  688  SNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK  789
            + S  G++IVTYT EH+H  PT RNSLAG+ RNK
Sbjct  225  NRSDPGIYIVTYTGEHNHPMPTHRNSLAGSTRNK  258



>ref|XP_010541208.1| PREDICTED: probable WRKY transcription factor 29 [Tarenaya hassleriana]
Length=290

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 118/217 (54%), Gaps = 10/217 (5%)
 Frame = +1

Query  142  MGECIGFEDNWGLQAIVQQPPLMASSEFTLQSCHDYLFDFSQENVLNFDDFVRTAMVPDD  321
            MGE + + D   LQAIV+       +     S     +    E  L    F  T     D
Sbjct  1    MGE-VAYMDEGDLQAIVRGYSGAGITSSGENSGEFLPYSLPHETAL----FYETESTGLD  55

Query  322  ALLEELYKPFIQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPNNYVP  501
             L  ELYKPF   +     T  V   +     +  +DG  + S     S   +A  N   
Sbjct  56   EL-GELYKPFYPFSTQTILTNSV---SVPEDSRSFRDGTKQLSHDCLFSDGSKADRNQES  111

Query  502  KFKR-RKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQ  678
            K K+ +KN+ KR+V QV  E L  D WAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQ
Sbjct  112  KAKKSKKNQQKRIVQQVKEENLLSDAWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQ  171

Query  679  VEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK  789
            VE++     +FIVTYT EH+H  PTRRNSLAG+ R K
Sbjct  172  VERNPQNPEIFIVTYTNEHNHGLPTRRNSLAGSTRTK  208



>ref|XP_003592183.1| WRKY transcription factor [Medicago truncatula]
 gb|AES62434.1| WRKY family transcription factor [Medicago truncatula]
Length=312

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +1

Query  496  VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
             P+ ++RK++  ++V  V A+ L  D WAWRKYGQKPIKGSPYPR+YYRCSSSKGC ARK
Sbjct  161  TPRSRKRKSQQGKMVCHVTADNLSTDLWAWRKYGQKPIKGSPYPRNYYRCSSSKGCTARK  220

Query  676  QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFP  795
            QVE+SN+ A MF VTYT +H+H++PT RNSLAG+ R K P
Sbjct  221  QVERSNTEADMFTVTYTGDHNHARPTHRNSLAGSTRTKSP  260



>ref|XP_008234823.1| PREDICTED: probable WRKY transcription factor 27 [Prunus mume]
Length=228

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +1

Query  499  PKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQ  678
            P+ ++RK + KR V QV AE L  D WAWRKYGQKPIKGSP+PR+YYRCSSSKGC ARKQ
Sbjct  6    PRPRKRKCQQKRQVCQVSAENLSADLWAWRKYGQKPIKGSPHPRNYYRCSSSKGCSARKQ  65

Query  679  VEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKF  792
            VE+S +   +F+VTYT +H+H +PT RNSLAG+ RNK 
Sbjct  66   VERSTADPNIFVVTYTGDHNHPRPTHRNSLAGSTRNKL  103



>gb|AIE16093.1| WRKY transcription factor 22-like protein, partial [Gossypium 
hirsutum]
Length=228

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = +1

Query  508  KRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQ  687
            KRRKN+ KRV   VP E L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGCLARKQVE+
Sbjct  126  KRRKNQLKRVC-HVPPEGLSSDVWAWRKYGQKPIKGSPYPRGYYRCSSSKGCLARKQVER  184

Query  688  SNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK  789
              S   MFIVTYTAEH+H  PT RNSLAG+ R K
Sbjct  185  HRSDPNMFIVTYTAEHNHPAPTHRNSLAGSTRQK  218



>ref|XP_009758175.1| PREDICTED: WRKY transcription factor 22-like [Nicotiana sylvestris]
Length=316

 Score =   117 bits (292),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 106/181 (59%), Gaps = 32/181 (18%)
 Frame = +1

Query  499   PKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQ  678
             P+ KRRKN+ K+V  QV A+ L  DKW+WRKYGQKPIKGSPYPR YY+CS+SKGCLARKQ
Sbjct  135   PRSKRRKNQMKKVC-QVAADALSSDKWSWRKYGQKPIKGSPYPRGYYKCSTSKGCLARKQ  193

Query  679   VEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAA  858
             VE++ S   MFI+TYTAEH+H  PT RNSLAG  R+          E ++         +
Sbjct  194   VERNRSDPNMFIITYTAEHNHPMPTHRNSLAGISRHN--------KETNSNKTTSSSPVS  245

Query  859   SSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFAGLEDL  1038
             S A +SP   N  +  +            EK  + E            +N+DFF GLE+L
Sbjct  246   SPATNSPAPENQESSRD------------EKEDIFE-----------DENDDFFEGLEEL  282

Query  1039  D  1041
             +
Sbjct  283   E  283



>ref|XP_009421224.1| PREDICTED: WRKY transcription factor 22-like [Musa acuminata 
subsp. malaccensis]
Length=361

 Score =   117 bits (293),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +1

Query  502  KFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQV  681
            + +RRK++ K+VV  VPA+ L  D WAWRKYGQKPIKGSPYPR YY+CSSSK CLARKQV
Sbjct  118  RSRRRKSQQKKVVCHVPADGLSSDTWAWRKYGQKPIKGSPYPRGYYKCSSSKACLARKQV  177

Query  682  EQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKF  792
            E+S +  G++I+TYT EH+H  PT R++LAG+ R+KF
Sbjct  178  ERSRTDPGIYIITYTGEHNHPMPTHRSALAGSTRHKF  214



>ref|XP_008347124.1| PREDICTED: WRKY transcription factor 22-like [Malus domestica]
Length=348

 Score =   117 bits (293),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 113/195 (58%), Gaps = 12/195 (6%)
 Frame = +1

Query  502   KFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQV  681
             + K+RKN+ K+V  QVPAE L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGC+ARKQV
Sbjct  149   RSKKRKNQLKKVC-QVPAEGLSSDIWAWRKYGQKPIKGSPYPRGYYRCSSSKGCMARKQV  207

Query  682   EQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAAS  861
             E++ S   +FIVTYTAEH+H  PT RNSLAG+ R K          DS     P   A+ 
Sbjct  208   ERNKSDPNIFIVTYTAEHNHPAPTHRNSLAGSTRQKPLSPQTTTGGDSAKPTSPTTSASV  267

Query  862   SALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFAGLEDLD  1041
                    A +    S  K+E        E+ +++ M         ++ ++DFF G   LD
Sbjct  268   DEEPIIAARSTTVESSCKEEKGSPLITDEEDELLGMCG-------SVVSDDFFVG---LD  317

Query  1042  GLI-SYFSYSSQCNY  1083
             GL   YFS  S  ++
Sbjct  318   GLAEDYFSDHSPVSF  332



>ref|XP_006580551.1| PREDICTED: probable WRKY transcription factor 29-like [Glycine 
max]
 gb|KHM99943.1| Putative WRKY transcription factor 29 [Glycine soja]
Length=288

 Score =   115 bits (289),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 98/211 (46%), Positives = 124/211 (59%), Gaps = 18/211 (9%)
 Frame = +1

Query  169  NWGLQAIVQQPPLMASSEFTLQSCHDYLFDFSQENVLNFDDFVRTAMVPDDALLEELYKP  348
            +W L+AIV+     A++         Y F    E + +F +F  T  V DD  LE+LYKP
Sbjct  9    DWDLEAIVRGNTGEATTMDDPNPDFSYFFSEQDELLDSFPEFSETTRVLDD--LEDLYKP  66

Query  349  F------IQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPNNYVPKFK  510
            F      + P   ++ +  +  E    Q+ +  +  V   GL     V  AP       K
Sbjct  67   FYPVFHPLSPHTIVTTSPPIPIEP--EQVIKASEEKVALQGLK----VTAAPKCK----K  116

Query  511  RRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQS  690
             +K+++K VV QV   E  +D WAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVE+S
Sbjct  117  SKKSQNKSVVKQVTTAEGLDDAWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVERS  176

Query  691  NSAAGMFIVTYTAEHSHSQPTRRNSLAGTIR  783
            +    +F+VTYTAEHSH  PTRRNSLAGT R
Sbjct  177  HLDPAVFLVTYTAEHSHPHPTRRNSLAGTTR  207



>ref|XP_010456229.1| PREDICTED: WRKY transcription factor 22-like [Camelina sativa]
Length=303

 Score =   115 bits (289),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 97/154 (63%), Gaps = 3/154 (2%)
 Frame = +1

Query  328  LEELYKPFIQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPNNYVPKF  507
            + +LYKPF+Q +   SF+     E       Q++   +  S    +S      N    + 
Sbjct  55   IRDLYKPFVQESVVSSFSCLNYPEEPRKTQNQKRPLSLSASSGSVTSKPTAGSN--TSRS  112

Query  508  KRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQ  687
            KRRK +HK+V   V AE L  D WAWRKYGQKPIKGSPYPR YYRCS+SKGCLARKQVE+
Sbjct  113  KRRKIQHKKVC-HVAAEALNSDVWAWRKYGQKPIKGSPYPRGYYRCSTSKGCLARKQVER  171

Query  688  SNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK  789
            + S   MFIVTYTAEH+H  P  RNSLAG+ R K
Sbjct  172  NRSDPKMFIVTYTAEHNHPAPIHRNSLAGSTRQK  205



>gb|AIE43847.1| WRKY transcription factor 61 [Gossypium hirsutum]
Length=300

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 116/190 (61%), Gaps = 22/190 (12%)
 Frame = +1

Query  319  DALLEELYKPFIQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPNN--  492
            D L+EELYKPF  P  +  +T  V ++ A            ++    K  P++ +  N  
Sbjct  59   DELMEELYKPFC-PELN-PYTTPVLEDHA------------EEPECQKQQPLVVSGTNKD  104

Query  493  -YVPKFKRRKNEHKRVVVQVPAEE-LCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCL  666
               PK   RK +  R+V  V  +  L  D W+WRKYGQKPIKGSPYPRSYYRCSSSKGCL
Sbjct  105  STKPKRSSRKKQQHRLVKHVTGDAGLQSDIWSWRKYGQKPIKGSPYPRSYYRCSSSKGCL  164

Query  667  ARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAH-HVP  843
            ARKQVE+S S   +FI+TYTAEH+H  PTRRNSLAG+ RNK   ++  A   + A+ + P
Sbjct  165  ARKQVERSCSDPRVFIITYTAEHNHGHPTRRNSLAGSTRNK---SLTVAKPKNLAYKNEP  221

Query  844  ELVAASSALS  873
              VA S+ LS
Sbjct  222  HEVAESTVLS  231



>ref|XP_010544418.1| PREDICTED: WRKY transcription factor 22 [Tarenaya hassleriana]
Length=309

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 119/313 (38%), Positives = 156/313 (50%), Gaps = 25/313 (8%)
 Frame = +1

Query  160   FEDNWGLQAIVQQPPLMASSEFTLQSCHDYLFD---FSQENVLNFDDFVRTAMVPDDALL  330
              ED+W L A+V+    + SS  T   C   L     FS  +    + F R A+  +   +
Sbjct  1     MEDDWDLHAVVRGCAAVCSSAATTV-CSAALQQNPIFSPVSAERQNGFSRNAVFGE---V  56

Query  331   EELYKPFIQ-PAASIS-FTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPNNYVPK  504
              +LY PF Q P  S+S F+     E    Q Q Q         +   S      ++   +
Sbjct  57    RDLYTPFRQDPNVSVSSFSCLNYTEDPRQQRQSQSQKRPLSVSVSSGSVTSRPASSNNSR  116

Query  505   FKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVE  684
              KRRK + KRV   V  E L  D WAWRKYGQKPIKGSPYPR YY+CS+SKGCLARKQVE
Sbjct  117   SKRRKTQQKRVC-HVAEEALNSDVWAWRKYGQKPIKGSPYPRGYYKCSTSKGCLARKQVE  175

Query  685   QSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAASS  864
             ++ S   +FIVTYTAEH+H  PT RNSLAG+ R K      AAAE + +   P + A S 
Sbjct  176   RNKSDPTVFIVTYTAEHNHPAPTHRNSLAGSTRQKLSDHPNAAAESAKS---PAISAVSP  232

Query  865   ALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFAGLEDLDG  1044
             +    +A++     E              M  ++  D        + ++DFF GLED   
Sbjct  233   SSPVTSADDLALPVE-----------DLAMGDLDGDDDLLSLSDTVVSDDFFEGLEDFAA  281

Query  1045  LISYFSYSSQCNY  1083
               S FS SS  N+
Sbjct  282   GDS-FSGSSPANF  293



>gb|AIE43841.1| WRKY transcription factor 19 [Gossypium hirsutum]
Length=264

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 100/156 (64%), Gaps = 5/156 (3%)
 Frame = +1

Query  328  LEELYKPFIQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPNNYVPKF  507
            LE+LYKPF       S    +     V       D   +K    +S  V ++  +  PK 
Sbjct  40   LEQLYKPFYPDLNPFSTQTIITSSIPV---PLHVDEPAEKRKKKQSFTVSQSDISASPKP  96

Query  508  KR--RKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQV  681
            +R  RK +  RVV  V A++L  D WAWRKYGQKPIKGSP+PRSYYRCSSSKGCLARKQV
Sbjct  97   RRFSRKKQQNRVVEHVTADDLPSDVWAWRKYGQKPIKGSPFPRSYYRCSSSKGCLARKQV  156

Query  682  EQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK  789
            E+S+S   +FI++YTAEH H  PTRR+SLAG+ R+K
Sbjct  157  ERSSSDPRVFIISYTAEHCHGHPTRRSSLAGSTRSK  192



>ref|XP_004248063.1| PREDICTED: WRKY transcription factor 22-like [Solanum lycopersicum]
Length=311

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 107/288 (37%), Positives = 142/288 (49%), Gaps = 51/288 (18%)
 Frame = +1

Query  274   VLNFDDFV--------RTAMVPDDALLEELYKPFI-QPAASISFTGEVKQEAAVHqmqqq  426
             V  F+D V        R  +  D   L +L KPFI QP+  ++          +   +  
Sbjct  44    VFCFEDLVLKQSLVLNRNKISDDFEELHQLCKPFINQPSEKLTVISSQSPSQQLTDTKSI  103

Query  427   qDGDVKKSGLDKSSPVLEAPNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKP  606
             Q        L   S  +          KRRKN H + V QV A+ L  D W+WRKYGQKP
Sbjct  104   QPNRTLSCNLHAQSQTI----------KRRKN-HLKKVCQVAADGLSSDMWSWRKYGQKP  152

Query  607   IKGspyprsyyrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRN  786
             IKGSPYPR YY+CS+SKGCLARKQVE++ S   MFIVTYTAEH+H  PT RNSLAG  R 
Sbjct  153   IKGSPYPRGYYKCSTSKGCLARKQVERNRSDPNMFIVTYTAEHNHPMPTHRNSLAGISRQ  212

Query  787   KFPPAVKAAAEDSTAHHVPELVAASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVE  966
             K    VK                 SS +SSP  N+    ++      +     ++    +
Sbjct  213   K---TVKP--------------TGSSPVSSPVTNSPAPENQ------ESSRDEKEDTFED  249

Query  967   MSDQSGVSQVAMDN----EDFFAGLEDLD----GLISYFSYSSQCNYP  1086
               D+ GVS V +D     +DFF GL++L+    G IS  ++ +   +P
Sbjct  250   DDDEFGVSDVGLDKMEPEDDFFDGLDELEIPATGDISPENFPANFQFP  297



>ref|XP_010522946.1| PREDICTED: WRKY transcription factor 22-like [Tarenaya hassleriana]
Length=297

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 97/215 (45%), Positives = 123/215 (57%), Gaps = 13/215 (6%)
 Frame = +1

Query  160  FEDNWGLQAIVQQPPLMASSEFTLQSCHDYLFDFSQENVLNFDDFVRTAMVPDDALLEEL  339
             +D+W L A+V+    ++++  T+ S   +     Q  + +     R     D+A+  EL
Sbjct  1    MDDDWDLHAVVRGCAAISAASTTVFSAAPF-----QNPIFSPVSGERQHGYIDNAVFGEL  55

Query  340  ---YKPF-IQPAASIS-FTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPNNYVPK  504
               Y PF ++P  S+S FT     E    Q Q Q+            +  L + NN   +
Sbjct  56   RDIYTPFALEPNVSVSSFTCLNYAEDLRQQRQTQKRPLSVSVSSGSVTSKLASSNN--SR  113

Query  505  FKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVE  684
             KRRK + KRV   V AE L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGCLARKQVE
Sbjct  114  SKRRKIQQKRVC-HVAAEALNSDVWAWRKYGQKPIKGSPYPRGYYRCSSSKGCLARKQVE  172

Query  685  QSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK  789
            ++ S   MFIVTYTAEH+H  PT RNSLAG+ R K
Sbjct  173  RNKSDPAMFIVTYTAEHNHPAPTHRNSLAGSTRQK  207



>ref|XP_006584734.1| PREDICTED: probable WRKY transcription factor 29-like [Glycine 
max]
 gb|KHN16785.1| Putative WRKY transcription factor 29 [Glycine soja]
Length=292

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 97/211 (46%), Positives = 122/211 (58%), Gaps = 17/211 (8%)
 Frame = +1

Query  169  NWGLQAIVQQPPLMASSEFTLQSCHDYLFDFSQENVLNFDDFVRTAMVPDDALLEELYKP  348
            +W L+AIV+     A +     +   Y F    E + +F +F  T  V DD  LEELYKP
Sbjct  9    DWDLEAIVRGSTGEAITMDDPNADFSYFFSEQDELLDSFPEFSETTRVLDD--LEELYKP  66

Query  349  F------IQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPNNYVPKFK  510
            F      + P   ++ +  +  E      +Q      +K    +   V  AP       K
Sbjct  67   FYPVLHPLSPHTIVTTSLPINMEP-----KQVIKASEQKVAALQGLKVPAAPKCK----K  117

Query  511  RRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQS  690
             +K+++K VV QV   E  +D WAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVE+S
Sbjct  118  SKKSQNKSVVKQVTTAEGLDDAWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVERS  177

Query  691  NSAAGMFIVTYTAEHSHSQPTRRNSLAGTIR  783
            +    +F+VTYTAEHSH  PTRRNSLAGT R
Sbjct  178  HLDPAVFLVTYTAEHSHPHPTRRNSLAGTTR  208



>ref|XP_009419794.1| PREDICTED: WRKY transcription factor 22-like [Musa acuminata 
subsp. malaccensis]
Length=317

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 81/109 (74%), Gaps = 5/109 (5%)
 Frame = +1

Query  484  PNNYVPKFKRR-----KNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcs  648
            P +  P+ KRR     K + ++V   VP++ L  D WAWRKYGQKPIKGSPYPR YYRCS
Sbjct  108  PLSQTPRSKRRLGDSRKKQQQKVACHVPSDGLSSDAWAWRKYGQKPIKGSPYPRGYYRCS  167

Query  649  ssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFP  795
            SSK CLARKQVE+S +   MFI+TYTAEH+H  PT RN+LAG+ R+KFP
Sbjct  168  SSKACLARKQVERSRADPAMFIITYTAEHNHPVPTHRNALAGSTRHKFP  216



>gb|AFL91245.1| WRKY 5 transcription factor, partial [Helianthus annuus]
Length=89

 Score =   109 bits (272),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 65/89 (73%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +1

Query  517  KNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNS  696
            KN+ KRVVVQV A  L  D WAWRKYGQKPIKGS YPRSYYRCSSSK C+AR+QVEQS +
Sbjct  1    KNQQKRVVVQVTAAGLSSDPWAWRKYGQKPIKGSIYPRSYYRCSSSKACMARRQVEQSCT  60

Query  697  AAGMFIVTYTAEHSHSQPTRRNSLAGTIR  783
             + ++I+TYTAEH+H QPTRRNSLAG  R
Sbjct  61   DSSIYILTYTAEHNHPQPTRRNSLAGINR  89



>ref|XP_009790285.1| PREDICTED: WRKY transcription factor 22-like [Nicotiana sylvestris]
Length=266

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 117/200 (59%), Gaps = 11/200 (6%)
 Frame = +1

Query  328  LEELYKPF-IQPAASISFTGEVKQEAAVHqmqqqqDGDV--KKSGLDKSSPVLEAPNNYV  498
            L  LY+PF I     +S    +KQ+  +H  Q    G +  K     KSS      +  +
Sbjct  69   LHNLYEPFVIGELQDLSIHQTLKQQQKLHNHQLIT-GLIQPKHFTTSKSSASRRISHAQM  127

Query  499  -PKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
             P+ ++RKN+ K+V  QVPAE +  DKWAWRKYGQKPIKGSPYPR YY+CSSSKGCLARK
Sbjct  128  SPRIQKRKNKLKKVC-QVPAEAMSSDKWAWRKYGQKPIKGSPYPRGYYKCSSSKGCLARK  186

Query  676  QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVA  855
            QV+++ S   MF +TYT+EH+H  PT R+SLAG  R K P   KA++   T     +   
Sbjct  187  QVDRNRSDPNMFNITYTSEHNHPMPTHRSSLAGIARQK-PVNSKASSAGDTN----KPTT  241

Query  856  ASSALSSPTANNWRAGSEIK  915
            +S A  SP   N     E K
Sbjct  242  SSPACLSPVPENQECSKEDK  261



>ref|XP_010060266.1| PREDICTED: probable WRKY transcription factor 27 isoform X2 [Eucalyptus 
grandis]
Length=394

 Score =   116 bits (290),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 82/126 (65%), Gaps = 6/126 (5%)
 Frame = +1

Query  496  VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
             P+ ++RK++ K+ V  V AE L  D WAWRKYGQKPIKGSP+PR        KGC ARK
Sbjct  161  TPRSRKRKSQQKKSVCHVTAENLSSDPWAWRKYGQKPIKGSPFPRCSSS----KGCSARK  216

Query  676  QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDST--AHHVPEL  849
            QVE+SN+   +F++TYT +H+H +PT RNSLAG+ RNK+  +      DS   AH  P  
Sbjct  217  QVERSNADPNIFVITYTGDHTHPRPTHRNSLAGSTRNKYSTSSSLQKPDSICPAHSAPAA  276

Query  850  VAASSA  867
              ++S+
Sbjct  277  PCSTSS  282



>gb|AFL91251.1| WRKY 5 transcription factor, partial [Helianthus annuus]
Length=89

 Score =   108 bits (271),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 65/89 (73%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +1

Query  517  KNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNS  696
            KN+ KRVVVQV A  L  D WAWRKYGQKPIKGS YPRSYYRCSSSK C+AR+QVEQS +
Sbjct  1    KNQQKRVVVQVTAAGLSSDPWAWRKYGQKPIKGSIYPRSYYRCSSSKACMARRQVEQSCT  60

Query  697  AAGMFIVTYTAEHSHSQPTRRNSLAGTIR  783
             + ++I+TYTAEH+H QPTRRNSLAG  R
Sbjct  61   DSSIYILTYTAEHNHPQPTRRNSLAGXNR  89



>gb|AAO23324.1| WRKY transcription factor 22 [Capsella rubella]
 gb|AAO23325.1| WRKY transcription factor 22 [Capsella rubella]
Length=302

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 98/155 (63%), Gaps = 6/155 (4%)
 Frame = +1

Query  328  LEELYKPFIQPAASISFTG-EVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPNNYVPK  504
            + +LY PF Q +   SF+     +E    + Q++       SG   S P      +   +
Sbjct  55   IRDLYTPFTQESVVSSFSCLNYPEEPRKTKNQKRPLSLSASSGSVTSKPT----GSTTSR  110

Query  505  FKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVE  684
             KRRK +HK+V   V AE L  D WAWRKYGQKPIKGSPYPR YYRCS+SKGCLARKQVE
Sbjct  111  SKRRKIQHKKVC-HVAAEALNSDVWAWRKYGQKPIKGSPYPRGYYRCSTSKGCLARKQVE  169

Query  685  QSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK  789
            ++ S   MFIVTYTAEH+H  PT RNSLAG+ R K
Sbjct  170  RNRSDPKMFIVTYTAEHNHPAPTHRNSLAGSTRQK  204



>ref|XP_002872898.1| WRKY transcription factor 22 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49157.1| WRKY transcription factor 22 [Arabidopsis lyrata subsp. lyrata]
Length=300

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 104/176 (59%), Gaps = 18/176 (10%)
 Frame = +1

Query  265  QENVLNFDDFVRTAMVPDDALLEELYKPFIQPAASISFTG-EVKQEAAVHqmqqqqDGDV  441
            Q N ++F +F             +LY PF Q +   SF+     +E    Q Q++     
Sbjct  46   QSNAVSFGEF------------RDLYTPFTQESVVSSFSCLNYPEEPKKPQNQKRPLSLS  93

Query  442  KKSGLDKSSPVLEAPNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGsp  621
              SG   S P      +   + KRRK +HK+V   V AE L  D WAWRKYGQKPIKGSP
Sbjct  94   ASSGSVTSKPT----GSNTSRSKRRKIQHKKVC-HVAAEALNSDVWAWRKYGQKPIKGSP  148

Query  622  yprsyyrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK  789
            YPR YYRCS+SKGCLARKQVE++ S   MFIVTYTAEH+H  PT RNSLAG+ R K
Sbjct  149  YPRGYYRCSTSKGCLARKQVERNRSDPKMFIVTYTAEHNHPAPTHRNSLAGSTRQK  204



>ref|XP_010422786.1| PREDICTED: WRKY transcription factor 22-like [Camelina sativa]
Length=303

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 95/154 (62%), Gaps = 3/154 (2%)
 Frame = +1

Query  328  LEELYKPFIQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPNNYVPKF  507
            + +LY PF Q +   SF+     E       Q++   +  S    +S      N    + 
Sbjct  55   IRDLYTPFTQESVVSSFSCLNYPEEPRKTQNQKRPLSLSASSGSVTSKPTAGSN--TSRS  112

Query  508  KRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQ  687
            KRRK  HK+V   V AE L  D WAWRKYGQKPIKGSPYPR YYRCS+SKGCLARKQVE+
Sbjct  113  KRRKIHHKKVC-HVAAEALNSDVWAWRKYGQKPIKGSPYPRGYYRCSTSKGCLARKQVER  171

Query  688  SNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK  789
            + S   MFIVTYTAEH+H  PT RNSLAG+ R K
Sbjct  172  NRSDPKMFIVTYTAEHNHPAPTHRNSLAGSTRQK  205



>ref|XP_006288206.1| hypothetical protein CARUB_v10001446mg, partial [Capsella rubella]
 gb|EOA21104.1| hypothetical protein CARUB_v10001446mg, partial [Capsella rubella]
Length=326

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 98/155 (63%), Gaps = 6/155 (4%)
 Frame = +1

Query  328  LEELYKPFIQPAASISFTG-EVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPNNYVPK  504
            + +LY PF Q +   SF+     +E    Q Q++       SG   S P      +   +
Sbjct  79   IRDLYTPFTQESVVSSFSCLNYPEEPRKTQNQKRPLSLSASSGSVTSKPT----GSTTSR  134

Query  505  FKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVE  684
             KRRK +HK+V   V AE L  D WAWRKYGQKPIKGSPYPR YYRCS+SKGCLARKQVE
Sbjct  135  SKRRKIQHKKVC-HVAAEALNSDVWAWRKYGQKPIKGSPYPRGYYRCSTSKGCLARKQVE  193

Query  685  QSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK  789
            ++ S   MFIVTYTAEH+H  PT RNSLAG+ R K
Sbjct  194  RNRSDPKMFIVTYTAEHNHPAPTHRNSLAGSTRQK  228



>ref|XP_009400662.1| PREDICTED: probable WRKY transcription factor 27 [Musa acuminata 
subsp. malaccensis]
Length=356

 Score =   115 bits (287),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 80/122 (66%), Gaps = 17/122 (14%)
 Frame = +1

Query  508  KRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGs----------------pyprsyy  639
            KRRKN+ K+VV QVPA+ +  D WAWRKYGQKPIKGS                   R YY
Sbjct  122  KRRKNQQKKVVCQVPADGVQSDLWAWRKYGQKPIKGSPYPRCNFWTKVLIFVVVENRGYY  181

Query  640  rcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFP-PAVKAAA  816
            RCSSSKGC ARKQVEQS++  GM ++TYTAEH+H  PT R+SLAG+ R K P PA K   
Sbjct  182  RCSSSKGCQARKQVEQSSADPGMLLITYTAEHNHPVPTHRSSLAGSTRQKLPQPAAKGGD  241

Query  817  ED  822
             D
Sbjct  242  RD  243



>ref|XP_008345081.1| PREDICTED: WRKY transcription factor 22 [Malus domestica]
Length=349

 Score =   114 bits (286),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 104/178 (58%), Gaps = 11/178 (6%)
 Frame = +1

Query  532   RVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNSAAGMF  711
             + V QVP E L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGC+ARKQVE++ S   MF
Sbjct  159   KKVCQVPVEALSSDIWAWRKYGQKPIKGSPYPRGYYRCSSSKGCMARKQVERNRSDPNMF  218

Query  712   IVTYTAEHSHSQPTRRNSLAGTIRNK-FPPAVKAAAEDSTAHHVPELVAASSALSSPTAN  888
             IVTYT EH+H  PT RNSLAG+ R K F P   A   DS     P   A++         
Sbjct  219   IVTYTGEHNHPAPTHRNSLAGSTRQKPFSPQT-ATRGDSAKPASPTTSASADEEPVVAPQ  277

Query  889   NWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFAGLEDLDGLISYFS  1062
             +    S  K+E        E+ +++ M D       ++ ++DFF GL+ L G   YFS
Sbjct  278   STTVESSCKEEKGSPLITDEEDELLGMCD-------SVVSDDFFVGLDGLAG--DYFS  326



>ref|XP_010669828.1| PREDICTED: WRKY transcription factor 22 [Beta vulgaris subsp. 
vulgaris]
Length=379

 Score =   115 bits (287),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 87/197 (44%), Positives = 111/197 (56%), Gaps = 20/197 (10%)
 Frame = +1

Query  502   KFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQV  681
             + K+RKN  K+V   VPAE L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGCLARKQV
Sbjct  180   RTKKRKNLMKKVC-HVPAEGLSSDMWAWRKYGQKPIKGSPYPRGYYRCSSSKGCLARKQV  238

Query  682   EQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAAS  861
             E++ S   MFIVTYTAEH+H  PT RNSLAG+ R K         E  T         + 
Sbjct  239   ERNRSDPKMFIVTYTAEHNHPMPTHRNSLAGSTRQKPLSTAGTPPEQPTCSSPSAASLSP  298

Query  862   SALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFAGLEDL-  1038
                 S +      G ++  ++++D     +M + ++          M N+DF+ G E + 
Sbjct  299   LTEKSESKTE---GDDLLMKEEEDNNNNNEMGLSDL----------MLNDDFYVGFEQID  345

Query  1039  -----DGLISYFSYSSQ  1074
                  DG   +FS SS+
Sbjct  346   ASDGSDGFSDHFSPSSE  362



>ref|XP_007219641.1| hypothetical protein PRUPE_ppa025042mg [Prunus persica]
 gb|EMJ20840.1| hypothetical protein PRUPE_ppa025042mg [Prunus persica]
Length=402

 Score =   115 bits (288),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +1

Query  499  PKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQ  678
            P+ ++RK + KR V QV AE L  D WAWRKYGQKPIKGSP+PR+YYRCSSSKGC ARKQ
Sbjct  218  PRPRKRKCQQKRQVCQVSAENLSADLWAWRKYGQKPIKGSPHPRNYYRCSSSKGCSARKQ  277

Query  679  VEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKF  792
            VE+S +   +F+VTYT +H+H +PT RNSLAG+ RNK 
Sbjct  278  VERSTADPNIFVVTYTGDHTHPRPTHRNSLAGSTRNKL  315



>ref|XP_006490616.1| PREDICTED: probable WRKY transcription factor 27-like [Citrus 
sinensis]
Length=403

 Score =   115 bits (288),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +1

Query  454  LDKSSPVLEAPNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprs  633
            L  + P+  A  ++  + ++RK+  K++V QV  E+L  D WAWRKYGQKPIKGSPYPR+
Sbjct  171  LSSAIPLRPAMPSHAHRSRKRKSPIKKMVCQVTEEKLSADLWAWRKYGQKPIKGSPYPRN  230

Query  634  yyrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKF  792
            YYRCSSSKGC ARKQVE+SN+   ++IV+YT +H+H +PT RNSLAG+ RNKF
Sbjct  231  YYRCSSSKGCAARKQVERSNTDPNIYIVSYTGDHTHPRPTHRNSLAGSTRNKF  283



>ref|XP_007135139.1| hypothetical protein PHAVU_010G104200g [Phaseolus vulgaris]
 gb|ESW07133.1| hypothetical protein PHAVU_010G104200g [Phaseolus vulgaris]
Length=362

 Score =   114 bits (286),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 105/183 (57%), Gaps = 18/183 (10%)
 Frame = +1

Query  496   VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
              P+ KRRKN+ K+V  +V AE L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGCLARK
Sbjct  170   TPRTKRRKNQVKKVC-EVAAENLSSDIWAWRKYGQKPIKGSPYPRGYYRCSSSKGCLARK  228

Query  676   QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVA  855
             QVE+  S   MFIVTYT EH+H  PT ++SLAG+ R K       AA    +      VA
Sbjct  229   QVERKRSDPTMFIVTYTGEHNHPAPTHKSSLAGSTRYKPQTGGDTAATKPVSPATSSEVA  288

Query  856   ASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFAGLED  1035
               S  S  T  +                L + M+  E  ++   ++  +  +DFF GLE+
Sbjct  289   QHSTKSECTEED----------------LEDLMKDDEEPNEFDTTETVV-TDDFFEGLEE  331

Query  1036  LDG  1044
             L G
Sbjct  332   LTG  334



>gb|KDO56823.1| hypothetical protein CISIN_1g015616mg [Citrus sinensis]
Length=403

 Score =   115 bits (287),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +1

Query  454  LDKSSPVLEAPNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprs  633
            L  + P+  A  ++  + ++RK+  K++V QV  E+L  D WAWRKYGQKPIKGSPYPR+
Sbjct  171  LSSAIPLRPAMPSHAHRSRKRKSPIKKMVCQVTEEKLSADLWAWRKYGQKPIKGSPYPRN  230

Query  634  yyrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKF  792
            YYRCSSSKGC ARKQVE+SN+   ++IV+YT +H+H +PT RNSLAG+ RNKF
Sbjct  231  YYRCSSSKGCAARKQVERSNTDPNIYIVSYTGDHTHPRPTHRNSLAGSTRNKF  283



>ref|XP_006422058.1| hypothetical protein CICLE_v10005095mg [Citrus clementina]
 gb|ESR35298.1| hypothetical protein CICLE_v10005095mg [Citrus clementina]
Length=403

 Score =   115 bits (287),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +1

Query  454  LDKSSPVLEAPNNYVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprs  633
            L  + P+  A  ++  + ++RK+  K++V QV  E+L  D WAWRKYGQKPIKGSPYPR+
Sbjct  171  LSSAIPLRPAMPSHAHRSRKRKSPIKKMVCQVTEEKLSADLWAWRKYGQKPIKGSPYPRN  230

Query  634  yyrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKF  792
            YYRCSSSKGC ARKQVE+SN+   ++IV+YT +H+H +PT RNSLAG+ RNKF
Sbjct  231  YYRCSSSKGCAARKQVERSNTDPNIYIVSYTGDHTHPRPTHRNSLAGSTRNKF  283



>emb|CDY59336.1| BnaC01g15320D [Brassica napus]
Length=296

 Score =   113 bits (283),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = +1

Query  505  FKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVE  684
            +K RKN+ KRVV QV  E L  D WAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVE
Sbjct  110  WKSRKNQQKRVVGQVKEENLLSDAWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVE  169

Query  685  QSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK  789
            ++   +  F +TYT EH H  PTRRNSLAGT R K
Sbjct  170  RNPQNSEKFTITYTNEHDHEIPTRRNSLAGTTRAK  204



>ref|XP_006396285.1| hypothetical protein EUTSA_v10028843mg [Eutrema salsugineum]
 gb|ESQ37738.1| hypothetical protein EUTSA_v10028843mg [Eutrema salsugineum]
Length=300

 Score =   113 bits (283),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 75/94 (80%), Gaps = 1/94 (1%)
 Frame = +1

Query  508  KRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQ  687
            KRRK +HK+V   V AE L  D WAWRKYGQKPIKGSPYPR YYRCS+SKGCLARKQVE+
Sbjct  112  KRRKIQHKKVC-HVAAEALNSDVWAWRKYGQKPIKGSPYPRGYYRCSTSKGCLARKQVER  170

Query  688  SNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK  789
            + S   MFIVTYTAEH+H  PT RNSLAG+ R K
Sbjct  171  NRSDPTMFIVTYTAEHNHPAPTHRNSLAGSTRQK  204



>gb|AFL91247.1| WRKY 5 transcription factor, partial [Helianthus annuus]
 gb|AFL91249.1| WRKY 5 transcription factor, partial [Helianthus annuus]
Length=89

 Score =   107 bits (268),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 64/88 (73%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +1

Query  520  NEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNSA  699
            N+ KRVVVQV A  L  D WAWRKYGQKPIKGS YPRSYYRCSSSK C+AR+QVEQS + 
Sbjct  2    NQQKRVVVQVTAAGLSSDPWAWRKYGQKPIKGSIYPRSYYRCSSSKACMARRQVEQSCTD  61

Query  700  AGMFIVTYTAEHSHSQPTRRNSLAGTIR  783
            + ++I+TYTAEH+H QPTRRNSLAG  R
Sbjct  62   SSIYILTYTAEHNHPQPTRRNSLAGINR  89



>ref|XP_002305271.2| hypothetical protein POPTR_0004s07050g [Populus trichocarpa]
 gb|EEE85782.2| hypothetical protein POPTR_0004s07050g [Populus trichocarpa]
Length=430

 Score =   114 bits (286),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 89/124 (72%), Gaps = 1/124 (1%)
 Frame = +1

Query  508  KRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQ  687
            +++K+  KR++  V AE L  D WAWRKYGQKPIKGSPYPR+YYRCSSSKGC ARKQVE+
Sbjct  187  RKKKSNQKRLISHVTAENLSNDVWAWRKYGQKPIKGSPYPRNYYRCSSSKGCAARKQVER  246

Query  688  SNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKF-PPAVKAAAEDSTAHHVPELVAASS  864
            SN+   MFIV YT +H+H +PT RNSLAG+ RNK   PA K   ++S      +  + SS
Sbjct  247  SNTDPNMFIVCYTGDHTHPRPTHRNSLAGSTRNKVQQPAQKPENKESEHPISADRGSCSS  306

Query  865  ALSS  876
             LS+
Sbjct  307  PLSA  310



>gb|KFK30708.1| hypothetical protein AALP_AA6G017400 [Arabis alpina]
Length=291

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 75/94 (80%), Gaps = 1/94 (1%)
 Frame = +1

Query  508  KRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQ  687
            KRRK +HK+V   V AE L  D WAWRKYGQKPIKGSPYPR YYRCS+SKGCLARKQVE+
Sbjct  111  KRRKIQHKKVC-HVAAEALNSDVWAWRKYGQKPIKGSPYPRGYYRCSTSKGCLARKQVER  169

Query  688  SNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK  789
            + S   MFIVTYTAEH+H  PT RNSLAG+ R K
Sbjct  170  NRSDPTMFIVTYTAEHNHPAPTHRNSLAGSTRQK  203



>ref|XP_009590526.1| PREDICTED: WRKY transcription factor 22-like [Nicotiana tomentosiformis]
Length=315

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 77/96 (80%), Gaps = 1/96 (1%)
 Frame = +1

Query  499  PKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQ  678
            P+ KRRKN+ K++  QV A+ L  D W+WRKYGQKPIKGSPYPR YY+CS+SKGCLARKQ
Sbjct  134  PRSKRRKNQMKKIC-QVAADALSSDMWSWRKYGQKPIKGSPYPRGYYKCSTSKGCLARKQ  192

Query  679  VEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRN  786
            VE++ S   MFI+TYTAEH+H  PT RNSLAG  R+
Sbjct  193  VERNRSDPNMFIITYTAEHNHPMPTHRNSLAGISRH  228



>ref|XP_007152141.1| hypothetical protein PHAVU_004G105800g [Phaseolus vulgaris]
 gb|ESW24135.1| hypothetical protein PHAVU_004G105800g [Phaseolus vulgaris]
Length=401

 Score =   114 bits (284),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 82/115 (71%), Gaps = 1/115 (1%)
 Frame = +1

Query  460  KSSPVLEAPNN-YVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsy  636
            ++SPVL        P+ ++RK + K++V  V A+ L  D WAWRKYGQKPIKGSPYPR+Y
Sbjct  178  QTSPVLSPTTQPQTPRSRKRKTQQKKMVCHVTADNLSADSWAWRKYGQKPIKGSPYPRNY  237

Query  637  yrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPA  801
            YRCSS KGC ARKQVE+S +    FIVTYT +H H++P  RNSLAG+ R K  PA
Sbjct  238  YRCSSCKGCAARKQVERSTTEPNTFIVTYTGDHKHAKPVHRNSLAGSTRTKPSPA  292



>gb|AEO31492.1| WRKY transcription factor 23-2 [Dimocarpus longan]
Length=88

 Score =   106 bits (265),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 65/82 (79%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +1

Query  544  QVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNSAAGMFIVTY  723
            QVPAE L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGCLARKQVE++ S  GMFIVTY
Sbjct  1    QVPAEGLSSDVWAWRKYGQKPIKGSPYPRGYYRCSSSKGCLARKQVERNRSDPGMFIVTY  60

Query  724  TAEHSHSQPTRRNSLAGTIRNK  789
            TAEH+H  PT RNSLAG+ R K
Sbjct  61   TAEHNHPAPTHRNSLAGSTRQK  82



>ref|XP_011076091.1| PREDICTED: probable WRKY transcription factor 27 [Sesamum indicum]
Length=336

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +1

Query  508  KRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQ  687
            +RRKN+  ++V Q+  EEL  D WAWRKYGQKPIKGSPYPR+YYRCS+SKGC ARKQVE+
Sbjct  151  RRRKNQQMKMVRQMTQEELSADSWAWRKYGQKPIKGSPYPRNYYRCSTSKGCAARKQVER  210

Query  688  SNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKF  792
            S +  G+F+V+YT EH+H +P  R+SLAG+ R+KF
Sbjct  211  SPNDPGIFVVSYTGEHTHPRPAHRSSLAGSTRSKF  245



>ref|XP_008437536.1| PREDICTED: probable WRKY transcription factor 27 isoform X1 [Cucumis 
melo]
Length=347

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = +1

Query  496  VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
            +PK ++RKN+ KR V  V A+ L  D WAWRKYGQKPIKGSPYPR+YYRCSSSKGC ARK
Sbjct  155  IPKSRKRKNQQKRRVCHVTADNLSTDMWAWRKYGQKPIKGSPYPRNYYRCSSSKGCGARK  214

Query  676  QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAG  774
            QVE+SN     FI+TYT +HSH +PT RNSLAG
Sbjct  215  QVERSNVDPETFIITYTGDHSHPRPTHRNSLAG  247



>gb|AFL91252.1| WRKY 5 transcription factor, partial [Helianthus annuus]
Length=89

 Score =   106 bits (264),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 63/88 (72%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +1

Query  520  NEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNSA  699
            N+ KRVVVQV    L  D WAWRKYGQKPIKGS YPRSYYRCSSSK C+AR+QVEQS + 
Sbjct  2    NQQKRVVVQVTXAGLSSDPWAWRKYGQKPIKGSIYPRSYYRCSSSKACMARRQVEQSCTD  61

Query  700  AGMFIVTYTAEHSHSQPTRRNSLAGTIR  783
            + ++I+TYTAEH+H QPTRRNSLAG  R
Sbjct  62   SSIYILTYTAEHNHPQPTRRNSLAGINR  89



>ref|XP_009588575.1| PREDICTED: WRKY transcription factor 22-like isoform X1 [Nicotiana 
tomentosiformis]
Length=256

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 89/131 (68%), Gaps = 6/131 (5%)
 Frame = +1

Query  499  PKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQ  678
            P+  +RKN+ K+V  QVPAE L  DKWAWRKYGQKPIKGSPYPR YY+CSSSKGCLARKQ
Sbjct  127  PRIHKRKNKLKKVC-QVPAEALSLDKWAWRKYGQKPIKGSPYPRGYYKCSSSKGCLARKQ  185

Query  679  VEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAA  858
            V+++ S   MF +TYT+EH+H  PT R+SLAG  R K        ++ S+A    +   +
Sbjct  186  VDRNRSDPNMFNITYTSEHNHPMPTHRSSLAGIARQK-----PVNSKSSSAGETNKPTTS  240

Query  859  SSALSSPTANN  891
            S A  SP   N
Sbjct  241  SPACLSPVPEN  251



>gb|KHN09281.1| Putative WRKY transcription factor 27 [Glycine soja]
Length=408

 Score =   112 bits (281),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 94/139 (68%), Gaps = 3/139 (2%)
 Frame = +1

Query  460  KSSPVLEAPNN-YVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsy  636
            ++SP+L        P+ ++RK+  K++V  V A+ L  D WAWRKYGQKPIKGSPYPR+Y
Sbjct  161  QTSPILSPTTQPQTPRSRKRKSHQKKMVCHVTADNLSSDLWAWRKYGQKPIKGSPYPRNY  220

Query  637  yrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAA  816
            YRCSS KGC+ARKQVE+S +    FIVTYT +H H++P +RNSLAG+ R K  P+    +
Sbjct  221  YRCSSCKGCVARKQVERSTTEPNTFIVTYTGDHKHAKPVQRNSLAGSTRTK--PSTTRLS  278

Query  817  EDSTAHHVPELVAASSALS  873
            E + +   P+   A S+ S
Sbjct  279  EPNESVTCPKRENACSSNS  297



>ref|XP_003549016.1| PREDICTED: probable WRKY transcription factor 27-like [Glycine 
max]
Length=408

 Score =   112 bits (281),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 94/139 (68%), Gaps = 3/139 (2%)
 Frame = +1

Query  460  KSSPVLEAPNN-YVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsy  636
            ++SP+L        P+ ++RK+  K++V  V A+ L  D WAWRKYGQKPIKGSPYPR+Y
Sbjct  161  QTSPILSPTTQPQTPRSRKRKSHQKKMVCHVTADNLSSDLWAWRKYGQKPIKGSPYPRNY  220

Query  637  yrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAA  816
            YRCSS KGC+ARKQVE+S +    FIVTYT +H H++P +RNSLAG+ R K  P+    +
Sbjct  221  YRCSSCKGCVARKQVERSTTEPNTFIVTYTGDHKHAKPVQRNSLAGSTRTK--PSTTRLS  278

Query  817  EDSTAHHVPELVAASSALS  873
            E + +   P+   A S+ S
Sbjct  279  EPNESVTCPKRENACSSNS  297



>gb|KHN09277.1| WRKY transcription factor 22 [Glycine soja]
Length=403

 Score =   112 bits (281),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 93/138 (67%), Gaps = 3/138 (2%)
 Frame = +1

Query  463  SSPVLEAPNN-YVPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyy  639
            +SP+L        P+ ++RK++ K++V  V A+ L  D WAWRKYGQKPIKGSPYPR+YY
Sbjct  163  TSPILSPTTQPQTPRSRKRKSQQKKMVCHVTADNLSSDLWAWRKYGQKPIKGSPYPRNYY  222

Query  640  rcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAE  819
            RCSS KGC+ARKQVE+S +    FIVTYT +H H++P  RNSLAG+ R K  P+    +E
Sbjct  223  RCSSCKGCVARKQVERSTTEPNTFIVTYTGDHKHAKPVHRNSLAGSTRTK--PSTTRLSE  280

Query  820  DSTAHHVPELVAASSALS  873
             + +   P+   A S+ S
Sbjct  281  PNESVSCPKKENACSSNS  298



>gb|EYU25159.1| hypothetical protein MIMGU_mgv1a023144mg [Erythranthe guttata]
Length=385

 Score =   112 bits (280),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +1

Query  508  KRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQ  687
            +RRKN+  ++V Q+  EEL  D WAWRKYGQKPIKGSPYPR+YYRCS+SKGC ARKQVE+
Sbjct  162  RRRKNQQMKMVRQMTQEELSADSWAWRKYGQKPIKGSPYPRNYYRCSTSKGCAARKQVER  221

Query  688  SNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKF  792
            S +  G+F+V+YT EH+H +PT R+SLAG+ R+K 
Sbjct  222  SPNDPGIFVVSYTGEHTHPRPTHRSSLAGSTRSKL  256



>gb|AFL91250.1| WRKY 5 transcription factor, partial [Helianthus annuus]
Length=89

 Score =   105 bits (262),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 64/89 (72%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +1

Query  517  KNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNS  696
            KN+ KRVVVQV A  L  D WAWRKYGQKPIKGS YPRSYYRCSSSK C+AR+QVEQS +
Sbjct  1    KNQQKRVVVQVTAAGLSSDPWAWRKYGQKPIKGSIYPRSYYRCSSSKACMARRQVEQSCT  60

Query  697  AAGMFIVTYTAEHSHSQPTRRNSLAGTIR  783
             + ++I+TYTAEH+  QPTRRNSLAG  R
Sbjct  61   DSSIYILTYTAEHNLPQPTRRNSLAGINR  89



>ref|XP_009137157.1| PREDICTED: probable WRKY transcription factor 29 [Brassica rapa]
Length=296

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = +1

Query  505  FKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVE  684
            +K +KN+ KRVV QV  E L  D WAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVE
Sbjct  110  WKSKKNQQKRVVEQVNEENLLSDAWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVE  169

Query  685  QSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK  789
            ++      F +TYT EH H  PTRRNSLAGT R K
Sbjct  170  RNPQKPEKFTITYTNEHDHEIPTRRNSLAGTTRAK  204



>gb|ADN33775.1| WRKY transcription factor [Cucumis melo subsp. melo]
Length=347

 Score =   111 bits (278),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = +1

Query  496  VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
            +PK ++R+N+ KR V  V A+ L  D WAWRKYGQKPIKGSPYPR+YYRCSSSKGC ARK
Sbjct  155  IPKSRKRQNQQKRRVCHVTADNLSTDMWAWRKYGQKPIKGSPYPRNYYRCSSSKGCGARK  214

Query  676  QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAG  774
            QVE+SN     FI+TYT +HSH +PT RNSLAG
Sbjct  215  QVERSNVDPETFIITYTGDHSHPRPTHRNSLAG  247



>emb|CDY44115.1| BnaA01g13230D [Brassica napus]
Length=296

 Score =   110 bits (275),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = +1

Query  505  FKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVE  684
            +K +KN+ KRVV QV  E L  D WAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVE
Sbjct  110  WKSKKNQQKRVVEQVNEENLLSDAWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVE  169

Query  685  QSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK  789
            ++      F +TYT EH H  PTRRNSLAGT R K
Sbjct  170  RNPQNPEKFTITYTNEHDHEIPTRRNSLAGTTRAK  204



>ref|XP_010676412.1| PREDICTED: WRKY transcription factor 22-like [Beta vulgaris subsp. 
vulgaris]
Length=281

 Score =   109 bits (273),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 105/184 (57%), Gaps = 23/184 (13%)
 Frame = +1

Query  508   KRRKNEHK--RVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQV  681
             KRRKN+HK  +VV Q   + +  DKW WRKYG+K IKGSPYPRSYYRCS   GC ARKQV
Sbjct  111   KRRKNKHKIIKVVQQEGGDRVLCDKWNWRKYGEKVIKGSPYPRSYYRCSYPGGCSARKQV  170

Query  682   EQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPP--AVKAAAEDSTAHHVPELVA  855
             EQS S  G+F++TY  EH+H  PTRR+S AG    +F    A   A   + + +   LV 
Sbjct  171   EQSTSDPGLFLITYMEEHNHPYPTRRHSQAGRSARRFNNNHATSKAITTNESQNTLNLVR  230

Query  856   ASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFAGLED  1035
             +S+ L  P+ NN                  + +  +   D  G +    +N+DFFAGL+ 
Sbjct  231   SSTNL-EPSLNN------------------DGVFALRGDDDDGSAGFVGENDDFFAGLDY  271

Query  1036  LDGL  1047
             L+GL
Sbjct  272   LEGL  275



>gb|KHN42469.1| Putative WRKY transcription factor 27 [Glycine soja]
Length=374

 Score =   111 bits (277),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = +1

Query  496  VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
             P+ ++RK++ K++V  V A+ L  D WAWRKYGQKPIKGSPYPR+YYRCSS KGC ARK
Sbjct  182  TPRSRKRKSQQKKMVCHVTAQNLSSDLWAWRKYGQKPIKGSPYPRNYYRCSSCKGCAARK  241

Query  676  QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKF  792
            QVE+S S    FIVTYT +H H++P  RNSLAG  R K 
Sbjct  242  QVERSTSEPNTFIVTYTGDHKHAKPVHRNSLAGNTRTKL  280



>ref|XP_003533143.1| PREDICTED: probable WRKY transcription factor 27-like [Glycine 
max]
Length=372

 Score =   111 bits (277),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = +1

Query  496  VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
             P+ ++RK++ K++V  V A+ L  D WAWRKYGQKPIKGSPYPR+YYRCSS KGC ARK
Sbjct  180  TPRSRKRKSQQKKMVCHVTAQNLSSDLWAWRKYGQKPIKGSPYPRNYYRCSSCKGCAARK  239

Query  676  QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKF  792
            QVE+S S    FIVTYT +H H++P  RNSLAG  R K 
Sbjct  240  QVERSTSEPNTFIVTYTGDHKHAKPVHRNSLAGNTRTKL  278



>ref|XP_004145903.1| PREDICTED: WRKY transcription factor 22-like [Cucumis sativus]
 ref|XP_004160353.1| PREDICTED: WRKY transcription factor 22-like [Cucumis sativus]
Length=344

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = +1

Query  496  VPKFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
            +PK ++R+N+ KR V  V A+ L  D WAWRKYGQKPIKGSPYPR+YYRCSSSKGC ARK
Sbjct  151  IPKSRKRQNQQKRRVCHVTADNLSTDMWAWRKYGQKPIKGSPYPRNYYRCSSSKGCGARK  210

Query  676  QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAG  774
            QVE+SN     F +TYT +HSH +PT RNSLAG
Sbjct  211  QVERSNDDPETFTITYTGDHSHPRPTHRNSLAG  243



>ref|XP_010537133.1| PREDICTED: LOW QUALITY PROTEIN: probable WRKY transcription factor 
27 [Tarenaya hassleriana]
Length=371

 Score =   110 bits (275),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 83/128 (65%), Gaps = 2/128 (2%)
 Frame = +1

Query  502  KFKRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQV  681
            + ++RKN+ KR +  V  E L  D WAWRKYGQKPIKGSPYPR+YYRCSSSKGC ARKQV
Sbjct  164  RSRKRKNQQKRTICHVTQENLSSDMWAWRKYGQKPIKGSPYPRNYYRCSSSKGCSARKQV  223

Query  682  EQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAAS  861
            E+SN    + +VTYT EH+H +PT RNSLAG+ R K  P          A   P   A  
Sbjct  224  ERSNLDPNILVVTYTGEHTHPRPTHRNSLAGSTRIK--PQTVNPELPGQAKPGPNDAAKP  281

Query  862  SALSSPTA  885
            S + SPT 
Sbjct  282  SEILSPTT  289



>gb|KFK28904.1| hypothetical protein AALP_AA7G063500 [Arabis alpina]
Length=303

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 80/119 (67%), Gaps = 4/119 (3%)
 Frame = +1

Query  520  NEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNSA  699
            N+ KRVV QV  E L  D WAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVE++   
Sbjct  119  NQQKRVVEQVKEENLLSDAWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVERNPQN  178

Query  700  AGMFIVTYTAEHSHSQPTRRNSLAGTIRNKF----PPAVKAAAEDSTAHHVPELVAASS  864
               F +TYT EH+H  PTRRNSLAG+ R K     PP  K   ++  +     L+  S+
Sbjct  179  PEKFTITYTNEHNHEVPTRRNSLAGSTRAKTSQPKPPVTKKPGKEMVSSPTSNLMITSA  237



>ref|NP_194086.3| putative WRKY transcription factor 29 [Arabidopsis thaliana]
 sp|Q9SUS1.1|WRK29_ARATH RecName: Full=Probable WRKY transcription factor 29; AltName: 
Full=WRKY DNA-binding protein 29 [Arabidopsis thaliana]
 gb|AAL35287.1|AF442394_1 WRKY transcription factor 29 [Arabidopsis thaliana]
 emb|CAA23021.1| putative protein [Arabidopsis thaliana]
 emb|CAB79310.1| putative protein [Arabidopsis thaliana]
 gb|ABG48427.1| At4g23550 [Arabidopsis thaliana]
 dbj|BAH30532.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE84774.1| putative WRKY transcription factor 29 [Arabidopsis thaliana]
Length=304

 Score =   108 bits (270),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 82/125 (66%), Gaps = 14/125 (11%)
 Frame = +1

Query  520  NEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNSA  699
            N+ KRVV QV  E L  D WAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVE++   
Sbjct  118  NQQKRVVEQVKEENLLSDAWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVERNPQN  177

Query  700  AGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAAS--SALS  873
               F +TYT EH+H  PTRRNSLAG+ R K            T+   P L   S    +S
Sbjct  178  PEKFTITYTNEHNHELPTRRNSLAGSTRAK------------TSQPKPTLTKKSEKEVVS  225

Query  874  SPTAN  888
            SPT+N
Sbjct  226  SPTSN  230



>ref|XP_009137359.1| PREDICTED: probable WRKY transcription factor 29 [Brassica rapa]
Length=299

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 102/189 (54%), Gaps = 14/189 (7%)
 Frame = +1

Query  328  LEELYKPFIQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPNNYVPKF  507
            L ELYKPF   +     T  +     +   +  +        L   S V +         
Sbjct  51   LGELYKPFYPFSTQTILTSSISVPEDLRSFRDDKKQRTHGCLLSNGSRVDQIRITESKSK  110

Query  508  KRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQ  687
            K +KN+ KRVV QV  E L  D WAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVE+
Sbjct  111  KSKKNQQKRVVEQVKEENLLSDAWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVER  170

Query  688  SNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAASSA  867
            +      F +TYT EH+H  PTRRNSLAG+ R K            ++   P +   S  
Sbjct  171  NPQNPEKFTITYTNEHNHELPTRRNSLAGSTRAK------------SSQPKPSITKKSGK  218

Query  868  L--SSPTAN  888
            L  SSPT+N
Sbjct  219  LVVSSPTSN  227



>emb|CDY10943.1| BnaA03g46020D [Brassica napus]
Length=299

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 102/189 (54%), Gaps = 14/189 (7%)
 Frame = +1

Query  328  LEELYKPFIQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPNNYVPKF  507
            L ELYKPF   +     T  +     +   +  +        L   S V +         
Sbjct  51   LGELYKPFYPFSTQTILTSSISVPEDLRSFRDDKKQRTHGCLLSNGSRVDQIRITESKSK  110

Query  508  KRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQ  687
            K +KN+ KRVV QV  E L  D WAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVE+
Sbjct  111  KSKKNQQKRVVEQVKEENLLSDAWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVER  170

Query  688  SNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAASSA  867
            +      F +TYT EH+H  PTRRNSLAG+ R K            ++   P +   S  
Sbjct  171  NPQNPEKFTITYTNEHNHELPTRRNSLAGSTRAK------------SSQPKPSITKKSGK  218

Query  868  L--SSPTAN  888
            L  SSPT+N
Sbjct  219  LVVSSPTSN  227



>ref|XP_010439158.1| PREDICTED: probable WRKY transcription factor 29 [Camelina sativa]
Length=308

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 83/123 (67%), Gaps = 4/123 (3%)
 Frame = +1

Query  520  NEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNSA  699
            N+ KRVV QV  E L  D WAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVE++   
Sbjct  124  NQQKRVVEQVKEENLLSDAWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVERNPQN  183

Query  700  AGMFIVTYTAEHSHSQPTRRNSLAGTIRNKF----PPAVKAAAEDSTAHHVPELVAASSA  867
               F +TYT EH+H  PTRRNSLAG+ R K     P   K + ++  +     L+ AS+ 
Sbjct  184  PDKFTITYTNEHNHELPTRRNSLAGSTRAKSSQTKPTLTKKSGKEVVSSPTSNLMIASAD  243

Query  868  LSS  876
             SS
Sbjct  244  ESS  246



>ref|XP_008347128.1| PREDICTED: WRKY transcription factor 22-like [Malus domestica]
Length=238

 Score =   105 bits (263),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 104/186 (56%), Gaps = 11/186 (6%)
 Frame = +1

Query  529   KRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNSAAGM  708
             +R    VPAE L  D WAWRKYGQKPIKGSPYPR YYRCSSSKGC+ARKQVE++ S   +
Sbjct  47    RRSPNLVPAEGLSSDIWAWRKYGQKPIKGSPYPRGYYRCSSSKGCMARKQVERNKSDPNI  106

Query  709   FIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAASSALSSPTAN  888
             FIVTYTAEH+H  PT RNSLAG+ R K          DS     P   A+        A 
Sbjct  107   FIVTYTAEHNHPAPTHRNSLAGSTRQKPLSPQTTTGGDSAKPTSPTTSASVDEEPIXAAR  166

Query  889   NWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFAGLEDLDGLI-SYFSY  1065
             +    S  K+E        E+ +++ M         ++ ++DFF G   LDGL   YFS 
Sbjct  167   STTVESSCKEEKGSPLITDEEDELLGMCG-------SVVSDDFFVG---LDGLAEDYFSD  216

Query  1066  SSQCNY  1083
              S  ++
Sbjct  217   HSPVSF  222



>ref|XP_010433890.1| PREDICTED: probable WRKY transcription factor 29 [Camelina sativa]
Length=308

 Score =   107 bits (267),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 96/166 (58%), Gaps = 21/166 (13%)
 Frame = +1

Query  520   NEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNSA  699
             N+ KRVV QV  E L  D WAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVE++   
Sbjct  124   NQQKRVVEQVNEENLLSDAWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVERNPQN  183

Query  700   AGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAASS--ALS  873
                F +TYT EH+H  PTRRNSLAG+ R K            ++   P L   S    +S
Sbjct  184   PDKFTITYTNEHNHELPTRRNSLAGSTRAK------------SSQTKPTLTKKSGKEVVS  231

Query  874   SPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQV-AMDN  1008
             SPT+N   A ++            ++M V EMS      ++  M N
Sbjct  232   SPTSNPMIASADETSVAV------QEMCVAEMSTHQAAGEIEGMSN  271



>ref|XP_006644388.1| PREDICTED: WRKY transcription factor 22-like [Oryza brachyantha]
Length=348

 Score =   107 bits (268),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 95/162 (59%), Gaps = 8/162 (5%)
 Frame = +1

Query  340  YKPFIQPAASISFTGEVKQEA-----AVHqmqqqqDGDVKKSGLDKSSPVLEAPNNYVPK  504
            +KPF  P +S SF    +        +   M          SG    SP    P    P+
Sbjct  97   HKPFFLPGSSSSFRAVARTRGEDDSKSHEVMISFPAAAASTSGAQPRSPSGRKPGIRTPR  156

Query  505  FKR-RKNEHKRVVVQVPAEE--LCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARK  675
             KR +K++ K+VV +VP  +  +  D WAWRKYGQKPIKGSPYPR YY+CSS KGC+ARK
Sbjct  157  PKRSKKSQLKKVVYEVPVADGGVSSDLWAWRKYGQKPIKGSPYPRGYYKCSSMKGCMARK  216

Query  676  QVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPA  801
             VE+S +  GM +VTY A+H H  PT+ N+LAGT R+K  PA
Sbjct  217  MVERSPAKPGMLVVTYMADHCHPVPTQLNALAGTTRHKCTPA  258



>ref|XP_010105730.1| putative WRKY transcription factor 27 [Morus notabilis]
 gb|EXC05950.1| putative WRKY transcription factor 27 [Morus notabilis]
Length=429

 Score =   108 bits (271),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +1

Query  508  KRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQ  687
            ++RKN+ K+ V QV AE L  D WAWRKYGQKPIKGSPYPR+YYRCSSSKGC ARKQVE+
Sbjct  226  RKRKNQLKKQVCQVTAENLNSDLWAWRKYGQKPIKGSPYPRNYYRCSSSKGCAARKQVER  285

Query  688  SNSAAGMFIVTYTAEHSHSQPTRRNSLAGT  777
            SN    +FIVTYT EH+H +P  RNSLAG+
Sbjct  286  SNVDPDLFIVTYTGEHTHPRPAHRNSLAGS  315



>ref|XP_010448687.1| PREDICTED: probable WRKY transcription factor 29 [Camelina sativa]
Length=343

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 82/125 (66%), Gaps = 14/125 (11%)
 Frame = +1

Query  520  NEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNSA  699
            N+ KRVV QV  E L  D WAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVE++   
Sbjct  159  NQQKRVVEQVKEENLLSDAWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVERNPQN  218

Query  700  AGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAASSA--LS  873
               F +TYT EH+H  PTRRNSLAG+ R K            ++   P L   S    +S
Sbjct  219  PDKFTITYTNEHNHELPTRRNSLAGSTRAK------------SSQTKPTLTKKSGKELVS  266

Query  874  SPTAN  888
            SPT+N
Sbjct  267  SPTSN  271



>gb|AAT84155.1| transcription factor WRKY03 [Oryza sativa Indica Group]
Length=336

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 82/122 (67%), Gaps = 5/122 (4%)
 Frame = +1

Query  448  SGLDKSSPVLEAPNNYVPKFKRR---KNEHKRVVVQVPAEE--LCEDKWAWRKYGQKPIK  612
            SG    SP    P    P+ KRR   K++ K+VV +VP  +  +  D WAWRKYGQKPIK
Sbjct  120  SGAQPRSPSGRKPGIRTPRPKRRSSKKSQLKKVVYEVPVADGGVSSDLWAWRKYGQKPIK  179

Query  613  GspyprsyyrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKF  792
            GSPYPR YY+CSS KGC+ARK VE+S +  GM +VTY AEH H  PT+ N+LAGT R+K 
Sbjct  180  GSPYPRGYYKCSSMKGCMARKMVERSPAKPGMLVVTYMAEHCHPVPTQLNALAGTTRHKS  239

Query  793  PP  798
             P
Sbjct  240  AP  241



>gb|AAQ54543.1| transcription factor [Malus domestica]
Length=92

 Score =   100 bits (250),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 62/83 (75%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +1

Query  553  AEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNSAAGMFIVTYTAE  732
            AE+L  D WAWRKYGQKPIKGSP+PRSYYRCSSSKGC ARKQVE+S S    FI+TYTAE
Sbjct  1    AEDLFSDVWAWRKYGQKPIKGSPHPRSYYRCSSSKGCSARKQVERSCSNPETFIITYTAE  60

Query  733  HSHSQPTRRNSLAGTIRNKFPPA  801
            H+H  PTRRNSLAG+ R+KFP +
Sbjct  61   HNHVHPTRRNSLAGSTRSKFPSS  83



>ref|XP_006284033.1| hypothetical protein CARUB_v10005155mg [Capsella rubella]
 gb|EOA16931.1| hypothetical protein CARUB_v10005155mg [Capsella rubella]
Length=351

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 82/125 (66%), Gaps = 14/125 (11%)
 Frame = +1

Query  520  NEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNSA  699
            N+ KRVV QV  E L  D WAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVE++   
Sbjct  167  NQQKRVVEQVKEENLLSDAWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVERNPQN  226

Query  700  AGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAASS--ALS  873
               F +TYT EH+H  PTRRNSLAG+ R K            ++   P +   S    +S
Sbjct  227  PDKFTITYTNEHNHELPTRRNSLAGSTRAK------------SSQTKPTITKKSGKEVVS  274

Query  874  SPTAN  888
            SPT+N
Sbjct  275  SPTSN  279



>ref|XP_006413542.1| hypothetical protein EUTSA_v10025799mg [Eutrema salsugineum]
 gb|ESQ54995.1| hypothetical protein EUTSA_v10025799mg [Eutrema salsugineum]
Length=309

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 81/125 (65%), Gaps = 14/125 (11%)
 Frame = +1

Query  520  NEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNSA  699
            N+ KRVV QV  E L  D WAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVE++   
Sbjct  125  NQQKRVVEQVKEENLLSDAWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVERNPQN  184

Query  700  AGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAASS--ALS  873
               F +TYT +H+H  PTRRNSLAG+ R K            ++   P L   S    +S
Sbjct  185  PEKFTITYTNDHNHELPTRRNSLAGSTRAK------------SSQPKPSLTKKSGKQVVS  232

Query  874  SPTAN  888
            SPT N
Sbjct  233  SPTTN  237



>gb|AGA37241.1| WRKY transcription factor 29.2 [Brassica napus]
Length=292

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +1

Query  520  NEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNSA  699
            N+ KRVV QV  E L  D WAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVE++   
Sbjct  108  NQQKRVVEQVKEENLLLDAWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVERNPQN  167

Query  700  AGMFIVTYTAEHSHSQPTRRNSLAGTIRNK  789
               F +TYT EH+H  PTRRNSLAG+ R K
Sbjct  168  PEKFTITYTNEHNHELPTRRNSLAGSTRAK  197



>gb|ACI14394.1| WRKY29-1 transcription factor [Brassica napus]
Length=302

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 80/123 (65%), Gaps = 10/123 (8%)
 Frame = +1

Query  520  NEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNSA  699
            N+ KRVV QV  E L  D WAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVE++   
Sbjct  118  NQLKRVVEQVKEENLLSDAWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVERNPQN  177

Query  700  AGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAASSALSSP  879
               F +TYT EH+H  PTRRNSLAG+ R K      A  + S    V          SSP
Sbjct  178  PEKFTITYTNEHNHELPTRRNSLAGSTRAKSSQTKPAVTKKSVKQVV----------SSP  227

Query  880  TAN  888
            T+N
Sbjct  228  TSN  230



>emb|CDX94201.1| BnaC07g38350D [Brassica napus]
Length=299

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 82/125 (66%), Gaps = 14/125 (11%)
 Frame = +1

Query  520  NEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNSA  699
            N+ KRVV QV  E L  D WAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVE++   
Sbjct  115  NQQKRVVEQVKEENLLLDAWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVERNPQN  174

Query  700  AGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAASS--ALS  873
               F +TYT EH+H  PTRRNSLAG+ R K            ++   P +   S    +S
Sbjct  175  PEKFTITYTNEHNHELPTRRNSLAGSTRAK------------SSQPKPSITKKSGKQVVS  222

Query  874  SPTAN  888
            SPT+N
Sbjct  223  SPTSN  227



>emb|CDY41375.1| BnaC03g65200D [Brassica napus]
Length=308

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 80/123 (65%), Gaps = 10/123 (8%)
 Frame = +1

Query  520  NEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNSA  699
            N+ KRVV QV  E L  D WAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVE++   
Sbjct  124  NQLKRVVEQVKEENLLSDAWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVERNPQN  183

Query  700  AGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAASSALSSP  879
               F +TYT EH+H  PTRRNSLAG+ R K      A  + S    V          SSP
Sbjct  184  PEKFTITYTNEHNHELPTRRNSLAGSTRAKSSQTKPAVTKKSVKQVV----------SSP  233

Query  880  TAN  888
            T+N
Sbjct  234  TSN  236



>ref|NP_001288936.1| probable WRKY transcription factor 29 [Brassica rapa]
 gb|AHB33835.1| WRKY transcription factor 29 [Brassica rapa]
 emb|CDX76334.1| BnaA08g10660D [Brassica napus]
Length=308

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 80/123 (65%), Gaps = 10/123 (8%)
 Frame = +1

Query  520  NEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNSA  699
            N+ KRVV QV  E L  D WAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVE++   
Sbjct  124  NQLKRVVEQVKEENLLSDAWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVERNPQN  183

Query  700  AGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAASSALSSP  879
               F +TYT EH+H  PTRRNSLAG+ R K      A  + S    V          SSP
Sbjct  184  PEKFTITYTNEHNHELPTRRNSLAGSTRAKSSQTKPAVTKKSVKQVV----------SSP  233

Query  880  TAN  888
            T+N
Sbjct  234  TSN  236



>emb|CDP05130.1| unnamed protein product [Coffea canephora]
Length=270

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +1

Query  508  KRRKNEHKRVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQ  687
            +RRKN+  + + Q+  EEL  D WAWRKYGQKPIK SPYPR+YYRCS+SKGC ARKQVE+
Sbjct  165  RRRKNQQAKRIQQMTQEELSADSWAWRKYGQKPIKDSPYPRNYYRCSTSKGCTARKQVER  224

Query  688  SNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK  789
              +   M++V+Y+ EHSH +PT R+SLAGT R+K
Sbjct  225  CPADPSMYVVSYSGEHSHPRPTHRSSLAGTTRSK  258



>ref|NP_001043621.1| Os01g0624700 [Oryza sativa Japonica Group]
 dbj|BAD61141.1| DNA-binding protein WRKY3-like [Oryza sativa Japonica Group]
 gb|AAW63710.1| WRKY12 [Oryza sativa Japonica Group]
 dbj|BAF05535.1| Os01g0624700 [Oryza sativa Japonica Group]
 dbj|BAG99251.1| unnamed protein product [Oryza sativa Japonica Group]
Length=348

 Score =   105 bits (263),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 82/120 (68%), Gaps = 3/120 (3%)
 Frame = +1

Query  448  SGLDKSSPVLEAPNNYVPKFKR-RKNEHKRVVVQVPAEE--LCEDKWAWRKYGQKPIKGs  618
            SG    SP    P    P+ KR +K++ K+VV +VP  +  +  D WAWRKYGQKPIKGS
Sbjct  134  SGAQPRSPSGRKPGIRTPRPKRSKKSQLKKVVYEVPVADGGVSSDLWAWRKYGQKPIKGS  193

Query  619  pyprsyyrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPP  798
            PYPR YY+CSS KGC+ARK VE+S +  GM +VTY AEH H  PT+ N+LAGT R+K  P
Sbjct  194  PYPRGYYKCSSMKGCMARKMVERSPAKPGMLVVTYMAEHCHPVPTQLNALAGTTRHKSAP  253



>gb|EEE55013.1| hypothetical protein OsJ_02664 [Oryza sativa Japonica Group]
Length=334

 Score =   105 bits (262),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 82/120 (68%), Gaps = 3/120 (3%)
 Frame = +1

Query  448  SGLDKSSPVLEAPNNYVPKFKR-RKNEHKRVVVQVPAEE--LCEDKWAWRKYGQKPIKGs  618
            SG    SP    P    P+ KR +K++ K+VV +VP  +  +  D WAWRKYGQKPIKGS
Sbjct  120  SGAQPRSPSGRKPGIRTPRPKRSKKSQLKKVVYEVPVADGGVSSDLWAWRKYGQKPIKGS  179

Query  619  pyprsyyrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPP  798
            PYPR YY+CSS KGC+ARK VE+S +  GM +VTY AEH H  PT+ N+LAGT R+K  P
Sbjct  180  PYPRGYYKCSSMKGCMARKMVERSPAKPGMLVVTYMAEHCHPVPTQLNALAGTTRHKSAP  239



>ref|XP_004308041.1| PREDICTED: uncharacterized protein LOC101304426 [Fragaria vesca 
subsp. vesca]
Length=430

 Score =   106 bits (265),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 82/110 (75%), Gaps = 2/110 (2%)
 Frame = +1

Query  463  SSPVLEAPNNYVPKFKRRKNEHKRVVVQVPAEELCE-DKWAWRKYGQKPIKGspyprsyy  639
            S P L+ P + + + ++RK+  K++V  + AE L   D WAWRKYGQKPIKGSP+PR+YY
Sbjct  194  SMPTLQVPAHLI-RPRKRKSPVKKMVCHLTAENLSSSDLWAWRKYGQKPIKGSPHPRNYY  252

Query  640  rcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNK  789
            RCSSSKGC ARKQVE+SN    MF+VTY  +H+H +PT RNSLAG+ R K
Sbjct  253  RCSSSKGCSARKQVERSNEDPNMFVVTYCGDHTHPRPTHRNSLAGSTRTK  302



>ref|XP_008380237.1| PREDICTED: probable WRKY transcription factor 27 [Malus domestica]
Length=288

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 78/109 (72%), Gaps = 4/109 (4%)
 Frame = +1

Query  532  RVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNSAAGMF  711
            + V +V AE+L  D WAWRKYGQKPIKGSP+PR+YYRCS+SKGC ARK VE+S +   +F
Sbjct  56   KKVCEVKAEDLTADLWAWRKYGQKPIKGSPHPRNYYRCSTSKGCAARKHVERSTTDPNIF  115

Query  712  IVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAE----DSTAHHVPE  846
             VTY+ +H+H++PT RNSLAGT RNK   A K   +    DS +  VP 
Sbjct  116  TVTYSGDHTHARPTHRNSLAGTSRNKLSAASKCQKQPINNDSGSAAVPN  164



>ref|XP_006662643.1| PREDICTED: probable WRKY transcription factor 35-like [Oryza 
brachyantha]
Length=294

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 81/113 (72%), Gaps = 10/113 (9%)
 Frame = +1

Query  472  VLEAPNNYVPKFKRRKNEHKRVVVQVPA---------EELCEDKWAWRKYGQKPIKGspy  624
            +  A +++VP  KRRK++ K+VV  +PA         E +  D WAWRKYGQKPIKGSPY
Sbjct  97   LFAAHHHHVPPIKRRKSQTKKVVC-IPAASGRAGTSGEVVPSDLWAWRKYGQKPIKGSPY  155

Query  625  prsyyrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIR  783
            PR YYRCSSSKGC ARKQVE+S +   M +VTYT++H+H  PT RN+LAG+ R
Sbjct  156  PRGYYRCSSSKGCSARKQVERSRADPSMLVVTYTSDHNHPWPTHRNALAGSTR  208



>ref|XP_002458190.1| hypothetical protein SORBIDRAFT_03g028440 [Sorghum bicolor]
 gb|EES03310.1| hypothetical protein SORBIDRAFT_03g028440 [Sorghum bicolor]
Length=413

 Score =   103 bits (258),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 88/243 (36%), Positives = 126/243 (52%), Gaps = 22/243 (9%)
 Frame = +1

Query  340   YKPFIQPAASISFTGEVKQEAAVHqmqqqqDGDVKKSGLD-KSSPVLEAPNNYVPKFKR-  513
             +KPF+ P  + S             M     G    SG+  ++SP    P    P+ KR 
Sbjct  163   HKPFLMPVVAPSPRAGDNGRGEREVMISFPAGAASTSGMQQRASPPGRKPGARTPRPKRS  222

Query  514   RKNEHKRVVVQVPAEE---LCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVE  684
             +K++ K+VV ++P  +      D WAWRKYGQKPIKGSPYPR YY+CSS KGC+ARK VE
Sbjct  223   KKSQLKKVVREMPVADGGSSSSDPWAWRKYGQKPIKGSPYPRGYYKCSSMKGCMARKLVE  282

Query  685   QSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAASS  864
             +S +  G+ IVTY AEH H  PT+ N+LAGT R+K   +   AA    +H   + V  ++
Sbjct  283   RSPAKPGVLIVTYMAEHCHPVPTQLNALAGTTRHKT--SSSGAASSPKSHEQGQAVEKAA  340

Query  865   ALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQVAMDNEDFFAGLEDLDG  1044
                   A +   G+         E  GE++             VA+D+++F+    DLD 
Sbjct  341   GRG---AGDREHGNNETSSSMAGEFGGEEI------------AVAIDDDEFWPAGMDLDE  385

Query  1045  LIS  1053
             L++
Sbjct  386   LLA  388



>ref|XP_003549012.1| PREDICTED: probable WRKY transcription factor 27-like [Glycine 
max]
Length=216

 Score =   100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 78/113 (69%), Gaps = 2/113 (2%)
 Frame = +1

Query  535  VVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNSAAGMFI  714
            +V  V A+ L  D WAWRKYGQKPIKGSPYPR+YYRCSS KGC+ARKQVE+S +    FI
Sbjct  1    MVCHVTADNLSSDLWAWRKYGQKPIKGSPYPRNYYRCSSCKGCVARKQVERSTTEPNTFI  60

Query  715  VTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAASSALS  873
            VTYT +H H++P  RNSLAG+ R K  P+    +E + +   P+   A S+ S
Sbjct  61   VTYTGDHKHAKPVHRNSLAGSTRTK--PSTTRLSEPNESVSCPKKENACSSNS  111



>ref|XP_004983519.1| PREDICTED: probable WRKY transcription factor 14-like [Setaria 
italica]
Length=421

 Score =   103 bits (257),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 82/224 (37%), Positives = 118/224 (53%), Gaps = 31/224 (14%)
 Frame = +1

Query  490   NYVPKFKRRKNEHKRVVV---------------QVPAEELCEDKWAWRKYGQKPIKGspy  624
             ++ P  KRRK++ K+VV                    E +  D WAWRKYGQKPIKGSPY
Sbjct  138   DHAPSIKRRKSQTKKVVCIPAPVAPPPGVGGRPSTSGEVVPSDLWAWRKYGQKPIKGSPY  197

Query  625   prsyyrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAV  804
             PR YYRCSSSKGC ARKQVE+S +   M ++TYT++H+H  PT RN+LAG+IR       
Sbjct  198   PRGYYRCSSSKGCSARKQVERSRTDPSMLVITYTSDHNHPWPTHRNALAGSIRPAAAATS  257

Query  805   KAAAEDST-AHHVPELVAASSALSSPTANNWRAGSEIKdeddddeeLGE-----------  948
              +++  +  +HH     AA++A++ PT  + R  S++   D+     G            
Sbjct  258   SSSSPSAKQSHHHQRRSAAAAAVTDPTPPH-RHASDVVVADNSTTPAGSITASIHNHQLL  316

Query  949   -KMQVVEMSDQSGVSQVAMDNEDFFAG--LEDLDGLISYFSYSS  1071
              K +V++M       + A    D   G  + D+DG ++    SS
Sbjct  317   LKKEVLDMDSLEPAQEDAAAGHDLVVGGMIADMDGALNVLCASS  360



>ref|XP_002269170.1| PREDICTED: probable WRKY transcription factor 14 [Vitis vinifera]
Length=438

 Score =   103 bits (257),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 79/202 (39%), Positives = 113/202 (56%), Gaps = 21/202 (10%)
 Frame = +1

Query  454   LDKSSPVLEAPNNYVPKFKRRKNEHKRVVVQVPA----------EELCEDKWAWRKYGQK  603
             +D ++  + +P N  P  KRRK++ K+VV  +PA          E +  D WAWRKYGQK
Sbjct  174   MDSTALQISSPRN--PGIKRRKSQAKKVVC-IPAPAAANSRPSGEVVPSDLWAWRKYGQK  230

Query  604   PIKGspyprsyyrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIR  783
             PIKGSPYPR YYRCSSSKGC ARKQVE+S +   M ++TYT+EH+H  PT+RN+LAG+ R
Sbjct  231   PIKGSPYPRGYYRCSSSKGCSARKQVERSRTDPNMLVITYTSEHNHPWPTQRNALAGSTR  290

Query  784   NKFPPAVKAAAEDSTAHHVPELVAASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVV  963
             ++ P     A+++S +    +        +  + NN      +         + E+M  V
Sbjct  291   SQ-PSKNNGASKNSGSCQSTQKATGLKEENKESYNNDDMSPIVGGSSTTGASVKEEMGNV  349

Query  964   EMSDQSGVSQVAMDNEDFFAGL  1029
             E        Q+ MD+ +F  G 
Sbjct  350   E-------KQLEMDDSEFSEGF  364



>emb|CBI31090.3| unnamed protein product [Vitis vinifera]
Length=421

 Score =   103 bits (256),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 79/202 (39%), Positives = 113/202 (56%), Gaps = 21/202 (10%)
 Frame = +1

Query  454   LDKSSPVLEAPNNYVPKFKRRKNEHKRVVVQVPA----------EELCEDKWAWRKYGQK  603
             +D ++  + +P N  P  KRRK++ K+VV  +PA          E +  D WAWRKYGQK
Sbjct  157   MDSTALQISSPRN--PGIKRRKSQAKKVVC-IPAPAAANSRPSGEVVPSDLWAWRKYGQK  213

Query  604   PIKGspyprsyyrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIR  783
             PIKGSPYPR YYRCSSSKGC ARKQVE+S +   M ++TYT+EH+H  PT+RN+LAG+ R
Sbjct  214   PIKGSPYPRGYYRCSSSKGCSARKQVERSRTDPNMLVITYTSEHNHPWPTQRNALAGSTR  273

Query  784   NKFPPAVKAAAEDSTAHHVPELVAASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVV  963
             ++ P     A+++S +    +        +  + NN      +         + E+M  V
Sbjct  274   SQ-PSKNNGASKNSGSCQSTQKATGLKEENKESYNNDDMSPIVGGSSTTGASVKEEMGNV  332

Query  964   EMSDQSGVSQVAMDNEDFFAGL  1029
             E        Q+ MD+ +F  G 
Sbjct  333   E-------KQLEMDDSEFSEGF  347



>gb|EMS55675.1| putative WRKY transcription factor 27 [Triticum urartu]
Length=194

 Score = 99.4 bits (246),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 81/114 (71%), Gaps = 3/114 (3%)
 Frame = +1

Query  496  VPKFKR-RKNEHKRVVVQVPAEE--LCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCL  666
             P+ KR +K++ K+VV +VP  +  +  D WAWRKYGQKPIKGSPYPR YY+CSS KGC+
Sbjct  5    TPRPKRSKKSQLKKVVCEVPVADGGVSSDLWAWRKYGQKPIKGSPYPRGYYKCSSMKGCM  64

Query  667  ARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDST  828
            ARK VE+S +  G+ ++TY A+H H  PT+ N+LAGT R+K  PA   A   +T
Sbjct  65   ARKLVERSPAKPGVLVITYMADHCHPVPTQINALAGTTRHKTTPADGHAGTTTT  118



>ref|XP_006597676.1| PREDICTED: probable WRKY transcription factor 35-like isoform 
X2 [Glycine max]
Length=499

 Score =   103 bits (258),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 91/143 (64%), Gaps = 11/143 (8%)
 Frame = +1

Query  388  VKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPNNYVPKFKRRKNEHKRVV-VQVPA---  555
            +K  A V           K+  +D +   + +P N  P  KRRKN+ K+VV +  PA   
Sbjct  221  IKPPAVVSPNIMLNANTSKECLVDTTGMQISSPRN--PGLKRRKNQAKKVVCIPAPAATN  278

Query  556  -----EELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNSAAGMFIVT  720
                 E +  D WAWRKYGQKPIKGSPYPR YYRCSSSKGC ARKQVE+S +   M ++T
Sbjct  279  SRQTGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSKGCSARKQVERSRNDPNMLVIT  338

Query  721  YTAEHSHSQPTRRNSLAGTIRNK  789
            YT+EH+H  PT+RN+LAG+ R++
Sbjct  339  YTSEHNHPWPTQRNALAGSTRSQ  361



>ref|XP_009399434.1| PREDICTED: probable WRKY transcription factor 14 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=410

 Score =   102 bits (255),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 85/202 (42%), Positives = 112/202 (55%), Gaps = 37/202 (18%)
 Frame = +1

Query  496   VPKFKRRKNEHKRVV-VQVPA--------EELCEDKWAWRKYGQKPIKGspyprsyyrcs  648
              P  KRRK++ K+VV +  PA        E +  D WAWRKYGQKPIKGSPYPR YYRCS
Sbjct  186   TPGIKRRKSQAKKVVCIPAPAASSNRSSGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCS  245

Query  649   ssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDST  828
             SSKGC ARKQVE+  +   M ++TYT+EH+H  PT+RN+LAG+IR  F P+ K A+  S 
Sbjct  246   SSKGCSARKQVERCRTDPNMLVITYTSEHNHPWPTQRNALAGSIR--FHPS-KTASRSS-  301

Query  829   AHHVPELVAASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQV----  996
                        S L+SPTA       E ++      E  E  +  E ++ +G  Q+    
Sbjct  302   ---------GGSILNSPTAPK----EETQEAATMSSEADEMGKTTEQAEDTGFHQIIHPS  348

Query  997   -------AMDNEDFFAGLEDLD  1041
                    A   +D FA L +L+
Sbjct  349   YEPTIPEADQPDDLFAYLAELE  370



>ref|XP_010036633.1| PREDICTED: probable WRKY transcription factor 14 isoform X2 [Eucalyptus 
grandis]
Length=440

 Score =   103 bits (256),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 86/123 (70%), Gaps = 11/123 (9%)
 Frame = +1

Query  454  LDKSSPVLEAPNNYVPKFKRRKNEHKRVV-VQVPA--------EELCEDKWAWRKYGQKP  606
            +D S+  + +P N  P  KRRK++ K+VV +  PA        E +  D WAWRKYGQKP
Sbjct  167  VDNSAMQISSPRN--PGIKRRKSQAKKVVCIPAPAAANSRAGGEVVPSDLWAWRKYGQKP  224

Query  607  IKGspyprsyyrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRN  786
            IKGSPYPR YYRCSSSKGC ARKQVE+S +   M ++TYT+EH+H  PT+RN+LAG+ R+
Sbjct  225  IKGSPYPRGYYRCSSSKGCSARKQVERSRTDPNMLVITYTSEHNHPWPTQRNALAGSTRS  284

Query  787  KFP  795
              P
Sbjct  285  TQP  287



>ref|XP_009399433.1| PREDICTED: probable WRKY transcription factor 14 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=415

 Score =   102 bits (255),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 85/202 (42%), Positives = 112/202 (55%), Gaps = 37/202 (18%)
 Frame = +1

Query  496   VPKFKRRKNEHKRVV-VQVPA--------EELCEDKWAWRKYGQKPIKGspyprsyyrcs  648
              P  KRRK++ K+VV +  PA        E +  D WAWRKYGQKPIKGSPYPR YYRCS
Sbjct  191   TPGIKRRKSQAKKVVCIPAPAASSNRSSGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCS  250

Query  649   ssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDST  828
             SSKGC ARKQVE+  +   M ++TYT+EH+H  PT+RN+LAG+IR  F P+ K A+  S 
Sbjct  251   SSKGCSARKQVERCRTDPNMLVITYTSEHNHPWPTQRNALAGSIR--FHPS-KTASRSS-  306

Query  829   AHHVPELVAASSALSSPTANNWRAGSEIKdeddddeeLGEKMQVVEMSDQSGVSQV----  996
                        S L+SPTA       E ++      E  E  +  E ++ +G  Q+    
Sbjct  307   ---------GGSILNSPTAPK----EETQEAATMSSEADEMGKTTEQAEDTGFHQIIHPS  353

Query  997   -------AMDNEDFFAGLEDLD  1041
                    A   +D FA L +L+
Sbjct  354   YEPTIPEADQPDDLFAYLAELE  375



>ref|XP_010036632.1| PREDICTED: probable WRKY transcription factor 14 isoform X1 [Eucalyptus 
grandis]
 gb|KCW48244.1| hypothetical protein EUGRSUZ_K01971 [Eucalyptus grandis]
Length=450

 Score =   103 bits (256),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 86/123 (70%), Gaps = 11/123 (9%)
 Frame = +1

Query  454  LDKSSPVLEAPNNYVPKFKRRKNEHKRVV-VQVPA--------EELCEDKWAWRKYGQKP  606
            +D S+  + +P N  P  KRRK++ K+VV +  PA        E +  D WAWRKYGQKP
Sbjct  177  VDNSAMQISSPRN--PGIKRRKSQAKKVVCIPAPAAANSRAGGEVVPSDLWAWRKYGQKP  234

Query  607  IKGspyprsyyrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRN  786
            IKGSPYPR YYRCSSSKGC ARKQVE+S +   M ++TYT+EH+H  PT+RN+LAG+ R+
Sbjct  235  IKGSPYPRGYYRCSSSKGCSARKQVERSRTDPNMLVITYTSEHNHPWPTQRNALAGSTRS  294

Query  787  KFP  795
              P
Sbjct  295  TQP  297



>ref|XP_002869775.1| WRKY DNA-binding protein 29 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46034.1| WRKY DNA-binding protein 29 [Arabidopsis lyrata subsp. lyrata]
Length=303

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 78/119 (66%), Gaps = 9/119 (8%)
 Frame = +1

Query  532  RVVVQVPAEELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNSAAGMF  711
            RVV QV  E L  D W WRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVE++      F
Sbjct  122  RVVEQVKEENLLSDAWGWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVERNPQNPEKF  181

Query  712  IVTYTAEHSHSQPTRRNSLAGTIRNKFPPAVKAAAEDSTAHHVPELVAASSALSSPTAN  888
             +TYT EH+H  PTRRNSLAG+ R K     ++  + S    V         +SSPT+N
Sbjct  182  TITYTNEHNHELPTRRNSLAGSTRAKTSQTKQSLTKKSGKEVV---------VSSPTSN  231



>gb|KHN44673.1| Putative WRKY transcription factor 14 [Glycine soja]
Length=499

 Score =   103 bits (257),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 87/125 (70%), Gaps = 11/125 (9%)
 Frame = +1

Query  442  KKSGLDKSSPVLEAPNNYVPKFKRRKNEHKRVV-VQVPA--------EELCEDKWAWRKY  594
            K+  +D +   + +P N  P  KRRKN+ K+VV +  PA        E +  D WAWRKY
Sbjct  212  KECLVDTTGVQISSPRN--PGLKRRKNQAKKVVCIPAPAAANSRQTGEVVPSDLWAWRKY  269

Query  595  GQKPIKGspyprsyyrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAG  774
            GQKPIKGSPYPR YYRCSSSKGC ARKQVE+S +   M ++TYT+EH+H  PT+RN+LAG
Sbjct  270  GQKPIKGSPYPRGYYRCSSSKGCSARKQVERSRNDPNMLVITYTSEHNHPWPTQRNALAG  329

Query  775  TIRNK  789
            + R++
Sbjct  330  STRSQ  334



>ref|XP_006597675.1| PREDICTED: probable WRKY transcription factor 35-like isoform 
X1 [Glycine max]
 gb|KHN14283.1| Putative WRKY transcription factor 14 [Glycine soja]
Length=523

 Score =   103 bits (257),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 91/143 (64%), Gaps = 11/143 (8%)
 Frame = +1

Query  388  VKQEAAVHqmqqqqDGDVKKSGLDKSSPVLEAPNNYVPKFKRRKNEHKRVV-VQVPA---  555
            +K  A V           K+  +D +   + +P N  P  KRRKN+ K+VV +  PA   
Sbjct  221  IKPPAVVSPNIMLNANTSKECLVDTTGMQISSPRN--PGLKRRKNQAKKVVCIPAPAATN  278

Query  556  -----EELCEDKWAWRKYGQKPIKGspyprsyyrcsssKGCLARKQVEQSNSAAGMFIVT  720
                 E +  D WAWRKYGQKPIKGSPYPR YYRCSSSKGC ARKQVE+S +   M ++T
Sbjct  279  SRQTGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSKGCSARKQVERSRNDPNMLVIT  338

Query  721  YTAEHSHSQPTRRNSLAGTIRNK  789
            YT+EH+H  PT+RN+LAG+ R++
Sbjct  339  YTSEHNHPWPTQRNALAGSTRSQ  361



>ref|XP_007211832.1| hypothetical protein PRUPE_ppa004535mg [Prunus persica]
 gb|EMJ13031.1| hypothetical protein PRUPE_ppa004535mg [Prunus persica]
Length=504

 Score =   103 bits (257),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 93/145 (64%), Gaps = 11/145 (8%)
 Frame = +1

Query  454  LDKSSPVLEAPNNYVPKFKRRKNEHKRVV-VQVPA--------EELCEDKWAWRKYGQKP  606
            L+ +   + +P N  P  KRRK++ K+VV +  PA        E +  D WAWRKYGQKP
Sbjct  232  LENTGVQISSPRN--PGIKRRKSQAKKVVCIPAPAAANSRPTGEVVPSDLWAWRKYGQKP  289

Query  607  IKGspyprsyyrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRN  786
            IKGSPYPR YYRCSSSKGC ARKQVE+S +   M ++TYT+EH+H  PT+RN+LAG+ R+
Sbjct  290  IKGSPYPRGYYRCSSSKGCSARKQVERSRTDPNMLVITYTSEHNHPWPTQRNALAGSTRS  349

Query  787  KFPPAVKAAAEDSTAHHVPELVAAS  861
            +   +   +   S + H P    AS
Sbjct  350  QPSKSSAGSKTSSNSSHQPHQKPAS  374



>ref|XP_007147420.1| hypothetical protein PHAVU_006G123000g [Phaseolus vulgaris]
 gb|ESW19414.1| hypothetical protein PHAVU_006G123000g [Phaseolus vulgaris]
Length=495

 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 85/122 (70%), Gaps = 13/122 (11%)
 Frame = +1

Query  454  LDKSSPVLEAPNNYVPKFKRRKNEHKRVVVQVPA----------EELCEDKWAWRKYGQK  603
            +D +   + +P N  P  KRRKN+ K+VV  +PA          E +  D WAWRKYGQK
Sbjct  219  VDTTGVQISSPRN--PGLKRRKNQAKKVVC-IPAPAAANSRQTGEVVPSDLWAWRKYGQK  275

Query  604  PIKGspyprsyyrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIR  783
            PIKGSPYPR YYRCSSSKGC ARKQVE+S +   M ++TYT+EH+H  PT+RN+LAG+ R
Sbjct  276  PIKGSPYPRGYYRCSSSKGCSARKQVERSRTDPNMLVITYTSEHNHPWPTQRNALAGSTR  335

Query  784  NK  789
            ++
Sbjct  336  SQ  337



>ref|XP_004293685.1| PREDICTED: probable WRKY transcription factor 14-like [Fragaria 
vesca subsp. vesca]
Length=497

 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 90/133 (68%), Gaps = 16/133 (12%)
 Frame = +1

Query  475  LEAPNNYVPKFKRRKNEHKRVVVQVPA----------EELCEDKWAWRKYGQKPIKGspy  624
            + +P N  P  KRRK++ K+VV  +PA          E +  D WAWRKYGQKPIKGSPY
Sbjct  209  ISSPRN--PGIKRRKSQAKKVVC-IPAPAAANSRPTGEVVPSDLWAWRKYGQKPIKGSPY  265

Query  625  prsyyrcsssKGCLARKQVEQSNSAAGMFIVTYTAEHSHSQPTRRNSLAGTIRNKFPPAV  804
            PR YYRCSSSKGC ARKQVE+S +   M ++TYT+EH+H  PT+RN+LAG+ R++ P   
Sbjct  266  PRGYYRCSSSKGCSARKQVERSRTDPNMLVITYTSEHNHPWPTQRNALAGSTRSQ-PSKA  324

Query  805  KAAAEDS--TAHH  837
             A ++ S  T HH
Sbjct  325  GAGSKTSPNTGHH  337



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3452581238476