BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13476_g1_i1 len=898 path=[876:0-371 1248:372-519 1396:520-530
1407:531-897]

Length=898
                                                                      Score     E

ref|XP_009604163.1|  PREDICTED: uncharacterized protein LOC104099005    213   2e-64   
ref|XP_009798735.1|  PREDICTED: uncharacterized protein LOC104244914    212   8e-64   
ref|XP_010049275.1|  PREDICTED: uncharacterized protein LOC104437926    206   2e-61   
ref|XP_008452780.1|  PREDICTED: uncharacterized protein LOC103493698    204   1e-60   
ref|XP_004141435.1|  PREDICTED: uncharacterized protein LOC101217656    201   4e-60   
ref|XP_004172555.1|  PREDICTED: uncharacterized protein LOC101231129    202   4e-60   
ref|XP_006366819.1|  PREDICTED: uncharacterized protein LOC102593240    199   8e-59   
ref|XP_008220560.1|  PREDICTED: uncharacterized protein LOC103320629    197   4e-58   
ref|XP_004242446.1|  PREDICTED: uncharacterized protein LOC101259949    196   9e-58   
ref|XP_002281227.1|  PREDICTED: uncharacterized protein LOC100257708    195   3e-57   Vitis vinifera
ref|XP_007227138.1|  hypothetical protein PRUPE_ppa026691mg             193   5e-57   
ref|XP_007012402.1|  Chaperone DnaJ-domain superfamily protein          189   5e-55   
gb|KDP34039.1|  hypothetical protein JCGZ_07610                         188   1e-54   
ref|XP_006453013.1|  hypothetical protein CICLE_v10009451mg             186   1e-53   
ref|XP_010261937.1|  PREDICTED: uncharacterized protein LOC104600594    185   2e-53   
gb|EYU20303.1|  hypothetical protein MIMGU_mgv1a013424mg                185   2e-53   
ref|XP_006849635.1|  hypothetical protein AMTR_s00024p00220440          184   6e-53   
ref|XP_006474477.1|  PREDICTED: uncharacterized protein LOC102613548    182   3e-52   
ref|XP_010520481.1|  PREDICTED: uncharacterized protein LOC104799581    181   9e-52   
ref|XP_010669327.1|  PREDICTED: uncharacterized protein LOC104886572    181   1e-51   
ref|XP_008797536.1|  PREDICTED: uncharacterized protein LOC103712714    177   3e-50   
ref|XP_003603201.1|  DnaJ domain family                                 175   9e-50   
gb|AFK38486.1|  unknown                                                 175   1e-49   
ref|XP_011081611.1|  PREDICTED: uncharacterized protein LOC105164...    174   2e-49   
ref|XP_002871975.1|  DNAJ heat shock N-terminal domain-containing...    175   2e-49   
emb|CDX92399.1|  BnaA10g14380D                                          174   3e-49   
ref|XP_009120711.1|  PREDICTED: uncharacterized protein LOC103845598    174   3e-49   
emb|CDY16601.1|  BnaC09g36720D                                          172   1e-48   
ref|XP_010454450.1|  PREDICTED: uncharacterized protein LOC104736199    171   3e-48   
ref|XP_010420975.1|  PREDICTED: uncharacterized protein LOC104706474    171   3e-48   
ref|NP_850862.1|  chaperone DnaJ-domain containing protein              171   3e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010493246.1|  PREDICTED: uncharacterized protein LOC104770511    171   4e-48   
ref|XP_011019363.1|  PREDICTED: uncharacterized protein LOC105122...    171   4e-48   
gb|KFK26359.1|  hypothetical protein AALP_AA8G238100                    171   5e-48   
ref|XP_008367633.1|  PREDICTED: uncharacterized protein LOC103431273    171   8e-48   
ref|XP_004501434.1|  PREDICTED: uncharacterized protein LOC101501920    170   1e-47   
ref|XP_002309471.2|  hypothetical protein POPTR_0006s23850g             170   1e-47   Populus trichocarpa [western balsam poplar]
ref|XP_009362607.1|  PREDICTED: uncharacterized protein LOC103952676    168   9e-47   
ref|XP_006400693.1|  hypothetical protein EUTSA_v10014636mg             167   1e-46   
ref|XP_009414809.1|  PREDICTED: uncharacterized protein LOC103995828    166   2e-46   
ref|XP_007136878.1|  hypothetical protein PHAVU_009G081500g             166   4e-46   
ref|NP_001031919.1|  chaperone DnaJ-domain containing protein           165   7e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288530.1|  hypothetical protein CARUB_v10001802mg             166   8e-46   
emb|CAN71794.1|  hypothetical protein VITISV_022108                     163   3e-45   Vitis vinifera
emb|CDP13457.1|  unnamed protein product                                163   5e-45   
ref|XP_004303470.1|  PREDICTED: uncharacterized protein LOC101302180    160   5e-44   
ref|XP_010936952.1|  PREDICTED: uncharacterized protein LOC105056450    158   3e-43   
ref|XP_011081609.1|  PREDICTED: uncharacterized protein LOC105164...    159   4e-43   
ref|XP_003526053.1|  PREDICTED: uncharacterized protein LOC100782990    157   7e-43   
ref|XP_003522295.1|  PREDICTED: uncharacterized protein LOC100793741    155   3e-42   
gb|KHN29682.1|  hypothetical protein glysoja_016304                     155   4e-42   
gb|EEC69321.1|  hypothetical protein OsI_38413                          154   3e-41   Oryza sativa Indica Group [Indian rice]
gb|ABA98601.1|  DnaJ domain containing protein, expressed               154   3e-41   Oryza sativa Japonica Group [Japonica rice]
gb|AFK37356.1|  unknown                                                 152   5e-41   
gb|AFK35491.1|  unknown                                                 152   1e-40   
dbj|BAK61863.1|  DNAJ heat shock N-terminal domain-containing pro...    149   5e-40   
ref|XP_011019364.1|  PREDICTED: uncharacterized protein LOC105122...    149   5e-40   
ref|XP_003576139.1|  PREDICTED: uncharacterized protein LOC100840040    149   2e-39   
ref|XP_002516125.1|  heat shock protein binding protein, putative       145   5e-38   Ricinus communis
dbj|BAJ98433.1|  predicted protein                                      145   6e-38   
dbj|BAK00016.1|  predicted protein                                      145   6e-38   
gb|EAZ20564.1|  hypothetical protein OsJ_36173                          137   3e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002443210.1|  hypothetical protein SORBIDRAFT_08g015440          130   2e-32   Sorghum bicolor [broomcorn]
ref|XP_008662578.1|  PREDICTED: uncharacterized protein LOC103640914    129   9e-32   
ref|XP_006664037.1|  PREDICTED: uncharacterized protein LOC102700481    121   3e-30   
gb|EMS46567.1|  hypothetical protein TRIUR3_30292                       106   7e-24   
gb|AFW56414.1|  hypothetical protein ZEAMMB73_090495                    100   2e-21   
ref|XP_001767272.1|  predicted protein                                94.4    3e-19   
ref|XP_001754379.1|  predicted protein                                93.6    5e-19   
emb|CCI55386.1|  NDH subunit NdhU                                     91.3    3e-18   
ref|NP_001066812.2|  Os12g0498500                                     83.6    8e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002992725.1|  hypothetical protein SELMODRAFT_448880           55.5    1e-05   
ref|XP_002993582.1|  hypothetical protein SELMODRAFT_163076           55.5    1e-05   
emb|CCI55385.1|  NDH subunit NdhT                                     50.1    3e-04   



>ref|XP_009604163.1| PREDICTED: uncharacterized protein LOC104099005 [Nicotiana tomentosiformis]
Length=225

 Score =   213 bits (543),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 131/230 (57%), Positives = 147/230 (64%), Gaps = 7/230 (3%)
 Frame = +1

Query  73   MAGTLGNAYLCAQNFLLSPTFKLEVGNGRNTISVPTTNLTYAANYSLYHPRKLVAAVRSS  252
            MA T    Y+ +QNFL SPT      N    I    T++ Y  N S    RKL+    S 
Sbjct  1    MAATGATPYISSQNFLSSPTITNHTSNNIPVI----TSIPYFGN-STKRIRKLLLVQNSG  55

Query  253  SGDDtaaatteteetPVGV-VSDGPPSLISALNAEKAIRGIAITDVDHYGILGLQRGCPY  429
            S D +    T T      V +  GPPS+ISALN EKA+ GIAITD+DHY  LGL R C Y
Sbjct  56   SSDASTETATATTNEISSVELPPGPPSIISALNVEKALLGIAITDIDHYDRLGLPRKCSY  115

Query  430  EQVLVAYNKKVEEAKNEGLEEEDLNNKLQLLQESYRILSTMEERRLYDWSLARSEMGDTY  609
             +V VAY KKVEE  NEGLEEEDLN KL LL+ESY ILST EERRLYDWSL RSE  D Y
Sbjct  116  NEVPVAYKKKVEEVMNEGLEEEDLNEKLGLLKESYSILSTPEERRLYDWSLVRSEAPDKY  175

Query  610  TWPFEVDITQtpkggtppprkpEDERPTRLVGYFILGWLVLAVVLSIAIA  759
             WPFEVD       GTPPP++PED  PTRLVGYF LGW VLAVVLS+A +
Sbjct  176  KWPFEVD-KSPMSTGTPPPQEPEDVEPTRLVGYFFLGWFVLAVVLSVAFS  224



>ref|XP_009798735.1| PREDICTED: uncharacterized protein LOC104244914 [Nicotiana sylvestris]
Length=221

 Score =   212 bits (539),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 130/225 (58%), Positives = 146/225 (65%), Gaps = 7/225 (3%)
 Frame = +1

Query  85   LGNAYLCAQNFLLSPTFKLEVGNGRNTISVPTTNLTYAANYSLYHPRKLVAAVRSSSGDD  264
            +   Y+ +QNFL SPT      +  N I V  T++ Y  N S    RKL     S S D 
Sbjct  1    MATRYISSQNFLSSPTI---TNHSSNNIPV-ITSIPYFGN-STKQIRKLFLVQNSGSSDA  55

Query  265  taaatteteetPVGV-VSDGPPSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVL  441
            +    T T      V +  GPPS+ISALN EKA+ GIAITD+DHY  LGL R C Y +V 
Sbjct  56   SIETATATTNEISSVELPPGPPSIISALNVEKALLGIAITDIDHYDRLGLPRKCSYNEVP  115

Query  442  VAYNKKVEEAKNEGLEEEDLNNKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPF  621
            VAY KKVEE  NEGLEEEDLN KL+LL+ESY ILST EERRLYDWSL RSE  D Y WPF
Sbjct  116  VAYKKKVEEVINEGLEEEDLNKKLELLKESYSILSTPEERRLYDWSLVRSEAPDKYKWPF  175

Query  622  EVDITQtpkggtppprkpEDERPTRLVGYFILGWLVLAVVLSIAI  756
            EVD T     GTPPP++PED  PTRLVGYF LGW VLA VLSIA 
Sbjct  176  EVDKTP-MSTGTPPPQEPEDVEPTRLVGYFFLGWFVLAAVLSIAF  219



>ref|XP_010049275.1| PREDICTED: uncharacterized protein LOC104437926 [Eucalyptus grandis]
 gb|KCW81794.1| hypothetical protein EUGRSUZ_C03150 [Eucalyptus grandis]
Length=221

 Score =   206 bits (523),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 121/144 (84%), Gaps = 1/144 (1%)
 Frame = +1

Query  325  PSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDLN  504
            PSLISALN E+A+RGIAITD DHYG LGL R CPYEQV  AY KKVEEAK+EGLEE++LN
Sbjct  77   PSLISALNVERALRGIAITDADHYGRLGLPRKCPYEQVAGAYRKKVEEAKSEGLEEDELN  136

Query  505  NKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpEDE  684
             KL+ L+ESYRILS+ EERRLYDWSLARS+  D Y WPFEVDI +     TPPP++PEDE
Sbjct  137  EKLEQLKESYRILSSAEERRLYDWSLARSQKPDRYMWPFEVDIAR-ATPDTPPPQEPEDE  195

Query  685  RPTRLVGYFILGWLVLAVVLSIAI  756
             PTRLVGYFILGW+VL+ VLSIA+
Sbjct  196  GPTRLVGYFILGWVVLSFVLSIAL  219



>ref|XP_008452780.1| PREDICTED: uncharacterized protein LOC103493698 [Cucumis melo]
Length=221

 Score =   204 bits (518),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 124/148 (84%), Gaps = 1/148 (1%)
 Frame = +1

Query  313  SDGPPSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEE  492
            SD  PSLISALN E+A+RGI ITDV+HYG LGL+RGCPY+QV +AYN KV+E K++GLEE
Sbjct  73   SDESPSLISALNVERALRGIPITDVNHYGRLGLRRGCPYDQVPIAYNIKVQELKSQGLEE  132

Query  493  EDLNNKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprk  672
            E+LN KL+LL+ESY ILS++EERR+YDWSLAR    D Y+WPFE DITQ  +   PPP++
Sbjct  133  EELNQKLELLKESYMILSSVEERRMYDWSLARIGEPDKYSWPFEADITQ-IQTQLPPPKE  191

Query  673  pEDERPTRLVGYFILGWLVLAVVLSIAI  756
            PEDE PTRLVGYF LGW VL++VLSIA+
Sbjct  192  PEDEGPTRLVGYFFLGWFVLSIVLSIAL  219



>ref|XP_004141435.1| PREDICTED: uncharacterized protein LOC101217656 [Cucumis sativus]
Length=176

 Score =   201 bits (510),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 122/144 (85%), Gaps = 1/144 (1%)
 Frame = +1

Query  325  PSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDLN  504
            PSLISALN E+A+RGI ITDV+HYG LGL+RGCPY+QV +AYN KVEE K++GLEEE+LN
Sbjct  32   PSLISALNVERALRGIPITDVNHYGRLGLRRGCPYDQVPIAYNIKVEELKSQGLEEEELN  91

Query  505  NKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpEDE  684
             KL+LL+ESY ILS++EERR+YDWSLAR    D Y+WPFE DITQ  +   PPP++PEDE
Sbjct  92   QKLELLKESYMILSSVEERRMYDWSLARIGEPDKYSWPFEADITQ-IQTQLPPPKEPEDE  150

Query  685  RPTRLVGYFILGWLVLAVVLSIAI  756
             PTRLVGYF LGW VL++VLSIA+
Sbjct  151  GPTRLVGYFFLGWFVLSIVLSIAL  174



>ref|XP_004172555.1| PREDICTED: uncharacterized protein LOC101231129 [Cucumis sativus]
 gb|KGN55375.1| hypothetical protein Csa_4G647480 [Cucumis sativus]
Length=221

 Score =   202 bits (514),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 122/144 (85%), Gaps = 1/144 (1%)
 Frame = +1

Query  325  PSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDLN  504
            PSLISALN E+A+RGI ITDV+HYG LGL+RGCPY+QV +AYN KVEE K++GLEEE+LN
Sbjct  77   PSLISALNVERALRGIPITDVNHYGRLGLRRGCPYDQVPIAYNIKVEELKSQGLEEEELN  136

Query  505  NKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpEDE  684
             KL+LL+ESY ILS++EERR+YDWSLAR    D Y+WPFE DITQ  +   PPP++PEDE
Sbjct  137  QKLELLKESYMILSSVEERRMYDWSLARIGEPDKYSWPFEADITQ-IQTQLPPPKEPEDE  195

Query  685  RPTRLVGYFILGWLVLAVVLSIAI  756
             PTRLVGYF LGW VL++VLSIA+
Sbjct  196  GPTRLVGYFFLGWFVLSIVLSIAL  219



>ref|XP_006366819.1| PREDICTED: uncharacterized protein LOC102593240 [Solanum tuberosum]
Length=210

 Score =   199 bits (505),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 138/198 (70%), Gaps = 10/198 (5%)
 Frame = +1

Query  178  TTNLTYAANYSLY-----HPRKLVAAVRSSSGDDtaaatteteetPVGVVSDGPPSLISA  342
            TT    A+N S +       RKLV  V +SS  DTA+A    E +PV +     PS+ISA
Sbjct  16   TTQNYIASNISCFISFRKQSRKLVLIVGNSSSSDTASAIGTDETSPVEIA----PSIISA  71

Query  343  LNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDLNNKLQLL  522
            LN EKA+ GIAITD+DHYGILGL R C Y +V VAY KKVEE  NEGL EE+LN KLQLL
Sbjct  72   LNVEKALLGIAITDIDHYGILGLSRKCSYAEVPVAYKKKVEEIMNEGLVEEELNKKLQLL  131

Query  523  QESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpEDERPTRLV  702
            +ESY ILST EERRLYDWSL RSE  D Y WPFEVD    P  GTPPP++PED  PT LV
Sbjct  132  KESYSILSTPEERRLYDWSLVRSEAPDDYKWPFEVD-PTPPSTGTPPPQEPEDVEPTILV  190

Query  703  GYFILGWLVLAVVLSIAI  756
            GYF LGW VLA VLSIA+
Sbjct  191  GYFFLGWFVLAAVLSIAL  208



>ref|XP_008220560.1| PREDICTED: uncharacterized protein LOC103320629 [Prunus mume]
Length=221

 Score =   197 bits (501),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 112/230 (49%), Positives = 154/230 (67%), Gaps = 13/230 (6%)
 Frame = +1

Query  67   VAMAGTLGNAYLCAQNFLLSPTFKLEVGNGRNTISVPTTNLTYAANYSLYHPRKLVAAVR  246
            +A++ +    ++  +NF ++PT K       N     + ++ +A+      PR+    +R
Sbjct  3    MAVSSSTSTIHIAQKNFPINPTSK-------NGCIFSSNSIRFAS-----KPRRF-CIIR  49

Query  247  SSSGDDtaaatteteetPVGVVSDGPPSLISALNAEKAIRGIAITDVDHYGILGLQRGCP  426
            SS       ATTE +      V   PPSLISALN E+A+RGI ITDVDHYG LGL+RGC 
Sbjct  50   SSRDVSAETATTEADSQSSIEVPQEPPSLISALNVERALRGIPITDVDHYGRLGLRRGCS  109

Query  427  YEQVLVAYNKKVEEAKNEGLEEEDLNNKLQLLQESYRILSTMEERRLYDWSLARSEMGDT  606
            Y++V VAY  K++E KN+GL+EE+LN  L  L+ESY ILS+ +ERRLYDWSLARSE  DT
Sbjct  110  YDEVSVAYKAKLDELKNQGLDEEELNKNLVPLKESYTILSSRDERRLYDWSLARSEKPDT  169

Query  607  YTWPFEVDITQtpkggtppprkpEDERPTRLVGYFILGWLVLAVVLSIAI  756
            Y WP+EV+ T+  +G  PP ++P+D  PTRLVGYFILGW +L+++LSIA+
Sbjct  170  YVWPYEVEKTRPAEGTPPPVQEPDDPGPTRLVGYFILGWFILSIILSIAL  219



>ref|XP_004242446.1| PREDICTED: uncharacterized protein LOC101259949 [Solanum lycopersicum]
Length=211

 Score =   196 bits (498),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 131/178 (74%), Gaps = 5/178 (3%)
 Frame = +1

Query  223  RKLVAAVRSSSGDDtaaatteteetPVGVVSDGPPSLISALNAEKAIRGIAITDVDHYGI  402
            RKL   V +SS  DTA+A    E +PV +    PPS+ISALN EKA+ GIAITD++HYGI
Sbjct  37   RKLALIVGNSSSSDTASAIDTDETSPVEI----PPSIISALNVEKALLGIAITDINHYGI  92

Query  403  LGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDLNNKLQLLQESYRILSTMEERRLYDWSL  582
            LGL R C Y +V VAY KK+EE  NEGL EE+LN KLQLL+ESY ILST EERRLYDWSL
Sbjct  93   LGLSRKCSYAEVPVAYKKKIEEITNEGLVEEELNKKLQLLKESYSILSTPEERRLYDWSL  152

Query  583  ARSEMGDTYTWPFEVDITQtpkggtppprkpEDERPTRLVGYFILGWLVLAVVLSIAI  756
             RSE  D Y WPFEVD    P  GTPPP++PED  PT LVGYF LGW VLA VLSI++
Sbjct  153  VRSEAPDDYKWPFEVD-PTPPSTGTPPPQEPEDVEPTILVGYFFLGWFVLAAVLSISL  209



>ref|XP_002281227.1| PREDICTED: uncharacterized protein LOC100257708 [Vitis vinifera]
 emb|CBI20710.3| unnamed protein product [Vitis vinifera]
Length=214

 Score =   195 bits (495),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 141/230 (61%), Gaps = 18/230 (8%)
 Frame = +1

Query  67   VAMAGTLGNAYLCAQNFLLSPTFKLEVGNGRNTISVPTTNLTYAANYSLYHPRKLVAAVR  246
            +A+  T   A L   NF  SP      G   N+I++             + PR+    +R
Sbjct  1    MAVTSTSATASLLRPNFRTSPP--RHGGQFSNSIAI------------AFKPRRF--RIR  44

Query  247  SSSGDDtaaatteteetPVGVVSDGPPSLISALNAEKAIRGIAITDVDHYGILGLQRGCP  426
            SS              +PV     GPPSLISALN EKA+RGIAITD DHYG LGLQR C 
Sbjct  45   SSGDAPLETTDESDSNSPVET-PKGPPSLISALNVEKALRGIAITDADHYGRLGLQRECS  103

Query  427  YEQVLVAYNKKVEEAKNEGLEEEDLNNKLQLLQESYRILSTMEERRLYDWSLARSEMGDT  606
            Y+QV VAY +KVEE K++ L+EE+ NNKL LL+ESY ILS+ +ERRLYDWSLARSE  D 
Sbjct  104  YDQVTVAYKRKVEELKSQELDEEEANNKLGLLKESYSILSSPKERRLYDWSLARSEKRDR  163

Query  607  YTWPFEVDITQtpkggtppprkpEDERPTRLVGYFILGWLVLAVVLSIAI  756
            Y WPFEV+  +      PP ++PED RPT LVGYF+  WL+L+  LSIA+
Sbjct  164  YAWPFEVEKAK-TPTEEPPAQEPEDVRPTILVGYFLFAWLILSFTLSIAL  212



>ref|XP_007227138.1| hypothetical protein PRUPE_ppa026691mg, partial [Prunus persica]
 gb|EMJ28337.1| hypothetical protein PRUPE_ppa026691mg, partial [Prunus persica]
Length=184

 Score =   193 bits (490),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 120/149 (81%), Gaps = 0/149 (0%)
 Frame = +1

Query  310  VSDGPPSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLE  489
            V   PPSLISALN E+A+RGI ITDVDHYG LGL+RGC Y++VLVAY  K +E KN+GL+
Sbjct  34   VPQEPPSLISALNVERALRGIPITDVDHYGRLGLRRGCSYDEVLVAYKAKRDELKNQGLD  93

Query  490  EEDLNNKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtpppr  669
            EE+LN  L  L+ESY ILS+ +ERRLYDWSLARSE  DTY WP+EV+ T+  +G  PP +
Sbjct  94   EEELNKNLVSLKESYTILSSGDERRLYDWSLARSEKPDTYVWPYEVEKTRPAEGTPPPVQ  153

Query  670  kpEDERPTRLVGYFILGWLVLAVVLSIAI  756
            +P+D  PTRLVGYFILGW +L+++LSIA+
Sbjct  154  EPDDPGPTRLVGYFILGWFILSIILSIAL  182



>ref|XP_007012402.1| Chaperone DnaJ-domain superfamily protein [Theobroma cacao]
 gb|EOY30021.1| Chaperone DnaJ-domain superfamily protein [Theobroma cacao]
Length=215

 Score =   189 bits (480),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 115/147 (78%), Gaps = 1/147 (1%)
 Frame = +1

Query  319  GPPSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEED  498
            GPPSLISALN E+A+RGIAITD DHYG LGLQR C YEQV VAY  KV+E   +GL+EE+
Sbjct  69   GPPSLISALNVERALRGIAITDADHYGRLGLQRKCSYEQVTVAYKNKVDELPKQGLDEEE  128

Query  499  LNNKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpE  678
            L+ K+ LL+ESY ILS+++ERR+YDWSLAR+E    Y WPFE DITQTP    PP     
Sbjct  129  LSKKMDLLKESYSILSSVKERRMYDWSLARTEEPGRYAWPFEEDITQTPTQEPPPQEPE-  187

Query  679  DERPTRLVGYFILGWLVLAVVLSIAIA  759
            D  PTRLVGYFILGW +L+VVLSIA+A
Sbjct  188  DVGPTRLVGYFILGWFILSVVLSIALA  214



>gb|KDP34039.1| hypothetical protein JCGZ_07610 [Jatropha curcas]
Length=218

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 114/231 (49%), Positives = 150/231 (65%), Gaps = 20/231 (9%)
 Frame = +1

Query  67   VAMAGTLGNAYLCAQNFLLSPTFKLEVGNGRNTISVPTTNLTYAANYSLYHPRKLVAAVR  246
            +A + T    Y+  Q+F + PT K          ++ T ++T+AA      PRK V  +R
Sbjct  1    MAASSTTATVYITRQSFPI-PTTK--------NATIFTNSVTFAA-----RPRKFV--IR  44

Query  247  SSSG---DDtaaatteteetPVGVVSDGPPSLISALNAEKAIRGIAITDVDHYGILGLQR  417
            SSS    +  A    E+E        +GPPSLISALN E+A+RGI ITDVD+YG LG+QR
Sbjct  45   SSSDGSTETAATVVEESETETSIEAPEGPPSLISALNVERALRGIPITDVDYYGRLGVQR  104

Query  418  GCPYEQVLVAYNKKVEEAKNEGLEEEDLNNKLQLLQESYRILSTMEERRLYDWSLARSEM  597
            GC YEQV VAY  KVEE  N+GL+EE++  K++ L+E+Y ILS+ EERR+YDWSL RSE 
Sbjct  105  GCSYEQVTVAYKNKVEELLNQGLDEEEVREKMEQLKETYSILSSPEERRMYDWSLGRSEN  164

Query  598  GDTYTWPFEVDITQtpkggtppprkpEDERPTRLVGYFILGWLVLAVVLSI  750
             D Y WPFE D ++      PPP++PED  PTR VGYF+LGW+VL++ LSI
Sbjct  165  PDRYAWPFETDKSR-TPTEPPPPQEPEDVGPTRFVGYFVLGWIVLSLALSI  214



>ref|XP_006453013.1| hypothetical protein CICLE_v10009451mg [Citrus clementina]
 gb|ESR66253.1| hypothetical protein CICLE_v10009451mg [Citrus clementina]
Length=215

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 120/145 (83%), Gaps = 1/145 (1%)
 Frame = +1

Query  322  PPSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDL  501
            P SLISALN E+A+RGIAITD DHYG LGL+RGC +++V +AY  K+E  K++GL+EE+ 
Sbjct  70   PSSLISALNVERALRGIAITDADHYGRLGLRRGCSFDEVALAYKNKLERLKDQGLDEEEE  129

Query  502  NNKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpED  681
            + K++LL+ESY ILS+ EERRLYDWSLAR+E  D Y WPFEVD+TQ    GTPPP++PED
Sbjct  130  SKKIKLLKESYSILSSEEERRLYDWSLARTENPDRYLWPFEVDVTQ-TPKGTPPPQEPED  188

Query  682  ERPTRLVGYFILGWLVLAVVLSIAI  756
              PTRLVGYF+LGWL+L+ VLSIA+
Sbjct  189  VGPTRLVGYFMLGWLILSFVLSIAL  213



>ref|XP_010261937.1| PREDICTED: uncharacterized protein LOC104600594 [Nelumbo nucifera]
Length=220

 Score =   185 bits (470),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 116/145 (80%), Gaps = 1/145 (1%)
 Frame = +1

Query  322  PPSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDL  501
            P SLISALN E+ +RGIAITD DHYG LGLQRGCPY+QV +AY  K EE  N+GL+EE+L
Sbjct  75   PYSLISALNVERVLRGIAITDADHYGRLGLQRGCPYDQVAIAYKAKSEELMNQGLDEEEL  134

Query  502  NNKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpED  681
              KL+LL+ESY ILS+ EERRLYDWSLARSE  + Y WPFEVDITQ      PPP++PED
Sbjct  135  GKKLELLKESYLILSSEEERRLYDWSLARSEKPERYVWPFEVDITQ-TPTQPPPPQEPED  193

Query  682  ERPTRLVGYFILGWLVLAVVLSIAI  756
              PTR+VGYF+LGWL+L+  LSIA+
Sbjct  194  VGPTRVVGYFLLGWLILSFTLSIAL  218



>gb|EYU20303.1| hypothetical protein MIMGU_mgv1a013424mg [Erythranthe guttata]
Length=221

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 114/144 (79%), Gaps = 1/144 (1%)
 Frame = +1

Query  325  PSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDLN  504
            PSLISALN EKA+RGIAITDVDHYG LGL+ GC Y+QV VA+  KV E  N GL  E+L+
Sbjct  77   PSLISALNVEKALRGIAITDVDHYGRLGLRSGCSYDQVNVAFKNKVTEVMNRGLAAEELD  136

Query  505  NKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpEDE  684
             +++LL+ES+ ILST+EERRLYDWSLARS   D Y WPFEVDITQ P    PPP++P+DE
Sbjct  137  KEVELLKESHSILSTVEERRLYDWSLARSGKPDKYVWPFEVDITQ-PPTEIPPPQEPDDE  195

Query  685  RPTRLVGYFILGWLVLAVVLSIAI  756
             PTRLVGYFIL WL L+V+L I I
Sbjct  196  GPTRLVGYFILSWLTLSVILFIVI  219



>ref|XP_006849635.1| hypothetical protein AMTR_s00024p00220440 [Amborella trichopoda]
 gb|ERN11216.1| hypothetical protein AMTR_s00024p00220440 [Amborella trichopoda]
Length=216

 Score =   184 bits (466),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 116/144 (81%), Gaps = 1/144 (1%)
 Frame = +1

Query  325  PSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDLN  504
            PSLISA+N EKA+RGIAITDVDHYG LG+ RG PY++V VAY +K E+ +++GL+EE+ +
Sbjct  73   PSLISAVNVEKALRGIAITDVDHYGRLGIARGTPYDRVTVAYKEKCEDLRSQGLDEEETD  132

Query  505  NKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpEDE  684
             +L+LL+ESY ILS+ EERRLYDWSLARSE    Y WPFEVDITQ      PPP++PED 
Sbjct  133  KELELLKESYAILSSEEERRLYDWSLARSENPGRYVWPFEVDITQ-ASNIPPPPKEPEDT  191

Query  685  RPTRLVGYFILGWLVLAVVLSIAI  756
             PT+LVGYF +GWLVL+  +SIA+
Sbjct  192  GPTKLVGYFFIGWLVLSFAMSIAL  215



>ref|XP_006474477.1| PREDICTED: uncharacterized protein LOC102613548 [Citrus sinensis]
 gb|KDO73609.1| hypothetical protein CISIN_1g028038mg [Citrus sinensis]
Length=215

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 119/145 (82%), Gaps = 1/145 (1%)
 Frame = +1

Query  322  PPSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDL  501
            P SLISALN E+A+RGIAITD DHYG L L+RGC +++V +AY  K+E  K++GL+EE+ 
Sbjct  70   PSSLISALNVERALRGIAITDADHYGRLELRRGCSFDEVALAYKNKLEGLKDQGLDEEEE  129

Query  502  NNKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpED  681
            + K++LL+ESY ILS+ EERRLYDWSLAR+E  D Y WPFEVD+TQ    GTPPP++PED
Sbjct  130  SKKIKLLKESYSILSSEEERRLYDWSLARTENPDRYVWPFEVDVTQ-TPKGTPPPQEPED  188

Query  682  ERPTRLVGYFILGWLVLAVVLSIAI  756
              PTRLVGYF+LGWL+L+ VLSIA+
Sbjct  189  VGPTRLVGYFMLGWLILSFVLSIAL  213



>ref|XP_010520481.1| PREDICTED: uncharacterized protein LOC104799581 [Tarenaya hassleriana]
Length=215

 Score =   181 bits (458),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 112/145 (77%), Gaps = 1/145 (1%)
 Frame = +1

Query  322  PPSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDL  501
            PPSLISALN E+A+RG+ ITD DHYG LGL RGC YEQV +AY  KV+E  ++GL++E L
Sbjct  70   PPSLISALNVERALRGLPITDADHYGTLGLPRGCSYEQVKIAYQDKVKELMDQGLDQEQL  129

Query  502  NNKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpED  681
            + + QLL+ESY ILS++EERR+YDWSLARSE+ D Y WPF+VDITQ      PPP +PED
Sbjct  130  SKESQLLKESYTILSSIEERRMYDWSLARSEIPDRYVWPFQVDITQ-APTQEPPPPEPED  188

Query  682  ERPTRLVGYFILGWLVLAVVLSIAI  756
              PT L+GYF LGW VL + L++ +
Sbjct  189  VGPTMLLGYFFLGWFVLGLTLTVVL  213



>ref|XP_010669327.1| PREDICTED: uncharacterized protein LOC104886572 [Beta vulgaris 
subsp. vulgaris]
Length=243

 Score =   181 bits (460),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 113/146 (77%), Gaps = 1/146 (1%)
 Frame = +1

Query  319  GPPSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEED  498
            GPPSLISALN EKA+RGIAITDVDHY  +GL+RGC Y+QV  AY  KV+E  ++GL+EE+
Sbjct  97   GPPSLISALNVEKALRGIAITDVDHYARMGLRRGCSYDQVGPAYQIKVQELSSQGLDEEE  156

Query  499  LNNKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpE  678
            LN + +LL+ESY ILS+  ERRLYDWSLARS   D Y WPFE DITQ    G PPPR+PE
Sbjct  157  LNKERELLKESYNILSSEVERRLYDWSLARSGAPDRYAWPFEADITQ-TPTGIPPPREPE  215

Query  679  DERPTRLVGYFILGWLVLAVVLSIAI  756
            D  PT  VGYF LGWLVLA  LSIA+
Sbjct  216  DVGPTIAVGYFFLGWLVLAFTLSIAL  241



>ref|XP_008797536.1| PREDICTED: uncharacterized protein LOC103712714 [Phoenix dactylifera]
Length=211

 Score =   177 bits (448),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 115/143 (80%), Gaps = 0/143 (0%)
 Frame = +1

Query  328  SLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDLNN  507
            SLIS+ N EKA+RGI IT+ DHYG LG+ RG  Y++V VAY KK EE +N+GL+EE+++ 
Sbjct  67   SLISSSNVEKALRGIPITNADHYGRLGVARGTSYDEVQVAYEKKCEELRNKGLDEEEVSK  126

Query  508  KLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpEDER  687
            +L+LL+ESY ILS+ +ERRLYDWSLAR E  D Y WPFE DITQTPK  +PPP++PEDE 
Sbjct  127  ELELLKESYGILSSEDERRLYDWSLARIENPDRYVWPFEADITQTPKWPSPPPQEPEDEG  186

Query  688  PTRLVGYFILGWLVLAVVLSIAI  756
            PT+LVGYF L WLVL+ VLS+ +
Sbjct  187  PTKLVGYFFLAWLVLSFVLSVTL  209



>ref|XP_003603201.1| DnaJ domain family [Medicago truncatula]
 gb|AES73452.1| DnaJ heat shock amino-terminal domain protein, putative [Medicago 
truncatula]
Length=211

 Score =   175 bits (444),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 143/195 (73%), Gaps = 8/195 (4%)
 Frame = +1

Query  181  TNLTYAAN---YSLYHPRKLVAAVRSSSGDDtaaatteteetPVGVVSDGPPSLISALNA  351
            + L ++AN   +S+  PRKL   +RSSS +++A +T    E+ + +  +   SLIS LN 
Sbjct  20   SKLGFSANNVVFSVKLPRKL--CIRSSS-ENSAGSTEVESESSIELPKESS-SLISVLNV  75

Query  352  EKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDLNNKLQLLQES  531
            E+A+RGI ITD DHYG LGL +GCPY+ V VAYN KV E +++GLEE+ LN KL+LL+ES
Sbjct  76   ERALRGIPITDADHYGRLGLPKGCPYDMVPVAYNNKVRELESQGLEEDILNKKLELLRES  135

Query  532  YRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpEDERPTRLVGYF  711
            Y I+S+ +ERR+YDWSL+R +  +TY WPFEVD++   + G PPP++PED  PTRLVGYF
Sbjct  136  YTIMSSPDERRMYDWSLSREDNTETYIWPFEVDVS-VLQEGDPPPQEPEDVGPTRLVGYF  194

Query  712  ILGWLVLAVVLSIAI  756
            + GW++LA VLSI +
Sbjct  195  LAGWILLAFVLSIGL  209



>gb|AFK38486.1| unknown [Medicago truncatula]
Length=211

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 143/195 (73%), Gaps = 8/195 (4%)
 Frame = +1

Query  181  TNLTYAAN---YSLYHPRKLVAAVRSSSGDDtaaatteteetPVGVVSDGPPSLISALNA  351
            + L ++AN   +S+  PRKL   +RSSS +++A +T    E+ + +  +   SLIS LN 
Sbjct  20   SKLGFSANNVVFSVKLPRKL--CIRSSS-ENSAGSTEVESESSIELPKESS-SLISVLNV  75

Query  352  EKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDLNNKLQLLQES  531
            E+A+RGI ITD DHYG LGL +GCPY+ V VAYN KV E +++GLEE+ LN KL+LL+ES
Sbjct  76   ERALRGIPITDADHYGRLGLPKGCPYDMVPVAYNNKVRELESQGLEEDILNKKLELLRES  135

Query  532  YRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpEDERPTRLVGYF  711
            Y I+S+ +ERR+YDWSL+R +  +TY WPFEVD++   + G PPP++PED  PTRLVGYF
Sbjct  136  YTIMSSPDERRMYDWSLSREDNTETYIWPFEVDVS-VLQEGDPPPQEPEDVGPTRLVGYF  194

Query  712  ILGWLVLAVVLSIAI  756
            + GW++LA VLSI +
Sbjct  195  LAGWILLAFVLSIGL  209



>ref|XP_011081611.1| PREDICTED: uncharacterized protein LOC105164617 isoform X2 [Sesamum 
indicum]
Length=216

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 98/195 (50%), Positives = 128/195 (66%), Gaps = 2/195 (1%)
 Frame = +1

Query  172  VPTTNLTYAANYSLYHPRKLVAAVRSSSGDDtaaatteteetPVGVVSDGPPSLISALNA  351
            V + N  +   Y     R+ +  +++SS +   A   E+ E P  +   GPPSLISALN 
Sbjct  22   VSSRNYRFPTYYGAIKQRRRLLVIKNSSDESATATNAESAEIPAEL-PRGPPSLISALNV  80

Query  352  EKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDLNNKLQLLQES  531
            EKA+RGIAI+D DHYG+LGL  GC Y+QV VAY  KV E  ++GL EE+L+ +L LL++S
Sbjct  81   EKALRGIAISDTDHYGMLGLGTGCSYDQVNVAYKNKVAEVMDKGLAEEELSKELDLLKQS  140

Query  532  YRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpEDERPTRLVGYF  711
            + ILS++EERRLYDWSLARS   D Y WPFEVDITQTP    PP    ++   T+LVGYF
Sbjct  141  HSILSSVEERRLYDWSLARSGKPDRYMWPFEVDITQTPTEEPPPREPEDEGP-TKLVGYF  199

Query  712  ILGWLVLAVVLSIAI  756
             + WL+L+  L I  
Sbjct  200  FISWLILSFTLFIVF  214



>ref|XP_002871975.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH48234.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
Length=218

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 110/144 (76%), Gaps = 1/144 (1%)
 Frame = +1

Query  325  PSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDLN  504
            PSLISALN E+A+RG+ ITDVDHYG LG+ R C Y+QV + Y  +V+E K +GL+EE L 
Sbjct  74   PSLISALNVERALRGLPITDVDHYGRLGISRNCSYDQVRIGYQDRVKELKEQGLDEEQLK  133

Query  505  NKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpEDE  684
            NK+ L++ESY ILST+EERR+YDWSLARSE  + Y WPFEVDI   P    PPP++PED 
Sbjct  134  NKMDLVKESYTILSTVEERRMYDWSLARSEKAERYVWPFEVDI-MEPSREEPPPQEPEDV  192

Query  685  RPTRLVGYFILGWLVLAVVLSIAI  756
             PTRL+GYFI  WLVL V LS+A 
Sbjct  193  GPTRLLGYFIGAWLVLGVALSVAF  216



>emb|CDX92399.1| BnaA10g14380D [Brassica napus]
Length=217

 Score =   174 bits (441),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 126/204 (62%), Gaps = 8/204 (4%)
 Frame = +1

Query  166  ISVPTTNLTYAANYSLYHPRKL-------VAAVRSSSGDDtaaatteteetPVGVVSDGP  324
            + +P  ++ +    +   PRKL        +  RSS    T   T     T V       
Sbjct  13   VHIPGESIPHHVPSTCSFPRKLTITKRIICSPARSSGETSTEGETDGGSSTAVDEAPKET  72

Query  325  PSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDLN  504
            PSLISALN E+A+RG+ ITDVDHYG LGL R C Y+QV + Y  +V+E   +GLEEE L 
Sbjct  73   PSLISALNVERALRGLPITDVDHYGRLGLPRNCSYDQVRIGYQDRVKELMEQGLEEEQLK  132

Query  505  NKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpEDE  684
            NK++L+++SY ILS+MEERR+YDWSLARSE  + Y WPFEVDI +  +   PP     D 
Sbjct  133  NKMELVKDSYTILSSMEERRMYDWSLARSEKAERYIWPFEVDIMEPSREEPPPQEPE-DV  191

Query  685  RPTRLVGYFILGWLVLAVVLSIAI  756
             PTR++GYFI  WLVL V LS+A+
Sbjct  192  GPTRILGYFIGAWLVLGVALSVAL  215



>ref|XP_009120711.1| PREDICTED: uncharacterized protein LOC103845598 [Brassica rapa]
Length=230

 Score =   174 bits (442),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 126/204 (62%), Gaps = 8/204 (4%)
 Frame = +1

Query  166  ISVPTTNLTYAANYSLYHPRKL-------VAAVRSSSGDDtaaatteteetPVGVVSDGP  324
            + +P  ++ +    +   PRKL        +  RSS    T   T     T V       
Sbjct  26   VHIPGESIPHHVPSTCSFPRKLTITKRIICSPARSSGETSTEGETDGGSSTAVDEAPKET  85

Query  325  PSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDLN  504
            PSLISALN E+A+RG+ ITDVDHYG LGL R C Y+QV + Y  +V+E   +GLEEE L 
Sbjct  86   PSLISALNVERALRGLPITDVDHYGRLGLPRNCSYDQVRIGYQDRVKELMEQGLEEEQLK  145

Query  505  NKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpEDE  684
            NK++L+++SY ILS+MEERR+YDWSLARSE  + Y WPFEVDI +  +   PP     D 
Sbjct  146  NKMELVKDSYTILSSMEERRMYDWSLARSEKAERYIWPFEVDIMEPSREEPPPQEPE-DV  204

Query  685  RPTRLVGYFILGWLVLAVVLSIAI  756
             PTR++GYFI  WLVL V LS+A+
Sbjct  205  GPTRILGYFIGAWLVLGVALSVAL  228



>emb|CDY16601.1| BnaC09g36720D [Brassica napus]
Length=217

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 100/219 (46%), Positives = 132/219 (60%), Gaps = 14/219 (6%)
 Frame = +1

Query  121  LSPTFKLEVGNGRNTISVPTTNLTYAANYSLYHPRKL-------VAAVRSSSGDDtaaat  279
            LSP  +L +      + +P  ++ +    +   PRKL        +  RSS    T   T
Sbjct  4    LSPMTQLSL------VHIPGESIPHHVPSTCSFPRKLTITKRIICSPARSSGETSTEGET  57

Query  280  teteetPVGVVSDGPPSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKK  459
                 T V       PSLISALN E+A+RG+ ITDVDHYG LGL R C Y+QV + Y  +
Sbjct  58   DGGSSTAVDEAPKETPSLISALNVERALRGLPITDVDHYGRLGLLRNCSYDQVRIGYQDR  117

Query  460  VEEAKNEGLEEEDLNNKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQ  639
            V+E   +GLEEE L NK++L+++SY ILS++EERR+YDWSLARSE  + Y WPFEVDI +
Sbjct  118  VKELMEQGLEEEQLKNKMELVKDSYTILSSVEERRMYDWSLARSEKAERYIWPFEVDIME  177

Query  640  tpkggtppprkpEDERPTRLVGYFILGWLVLAVVLSIAI  756
              +   PP     D  PTR++GYFI  WLVL V LS+A+
Sbjct  178  PSREEPPPQEPE-DVGPTRILGYFIGAWLVLGVALSVAL  215



>ref|XP_010454450.1| PREDICTED: uncharacterized protein LOC104736199 [Camelina sativa]
Length=219

 Score =   171 bits (434),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 109/144 (76%), Gaps = 1/144 (1%)
 Frame = +1

Query  325  PSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDLN  504
            PSLISALN E+A+RG+ ITDVDHYG LG+ R C Y+QV + Y  +V+E K +GL+EE L 
Sbjct  75   PSLISALNVERALRGLPITDVDHYGRLGVSRKCSYDQVRIGYQDRVKELKEQGLDEEQLK  134

Query  505  NKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpEDE  684
             KL L++ESY ILST+EERR+YDWSLARSE  + Y WPFEVDI   P    PPP++PED 
Sbjct  135  TKLDLVKESYTILSTVEERRMYDWSLARSEKAERYVWPFEVDI-MEPSREEPPPQEPEDV  193

Query  685  RPTRLVGYFILGWLVLAVVLSIAI  756
             PTR++GYFI  WLVL + LS+A 
Sbjct  194  GPTRVLGYFIGAWLVLGIALSVAF  217



>ref|XP_010420975.1| PREDICTED: uncharacterized protein LOC104706474 [Camelina sativa]
Length=219

 Score =   171 bits (434),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 109/144 (76%), Gaps = 1/144 (1%)
 Frame = +1

Query  325  PSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDLN  504
            PSLISALN E+A+RG+ ITDVDHYG LG+ R C Y+QV + Y  +V+E K +GL+EE L 
Sbjct  75   PSLISALNVERALRGLPITDVDHYGRLGVSRKCSYDQVRIGYQDRVKELKEQGLDEEQLK  134

Query  505  NKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpEDE  684
             KL L++ESY ILST+EERR+YDWSLARSE  + Y WPFEVDI   P    PPP++PED 
Sbjct  135  TKLDLVKESYTILSTVEERRMYDWSLARSEKAERYVWPFEVDI-MEPSREEPPPQEPEDV  193

Query  685  RPTRLVGYFILGWLVLAVVLSIAI  756
             PTR++GYFI  WLVL + LS+A 
Sbjct  194  GPTRVLGYFIGAWLVLGIALSVAF  217



>ref|NP_850862.1| chaperone DnaJ-domain containing protein [Arabidopsis thaliana]
 gb|AAO73883.1| DnaJ domain family [Arabidopsis thaliana]
 gb|AED92949.1| chaperone DnaJ-domain containing protein [Arabidopsis thaliana]
Length=218

 Score =   171 bits (434),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 110/144 (76%), Gaps = 1/144 (1%)
 Frame = +1

Query  325  PSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDLN  504
            PSLISALN E+A+RG+ ITDVDHYG LG+ R C Y+QV + Y ++V+E K +GL+EE L 
Sbjct  74   PSLISALNVERALRGLPITDVDHYGRLGIFRNCSYDQVTIGYKERVKELKEQGLDEEQLK  133

Query  505  NKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpEDE  684
             K+ L++ESY ILST+EERR+YDWSLARSE  + Y WPFEVDI   P    PPP++PED 
Sbjct  134  TKMDLIKESYTILSTVEERRMYDWSLARSEKAERYVWPFEVDI-MEPSREEPPPQEPEDV  192

Query  685  RPTRLVGYFILGWLVLAVVLSIAI  756
             PTR++GYFI  WLVL V LS+A 
Sbjct  193  GPTRILGYFIGAWLVLGVALSVAF  216



>ref|XP_010493246.1| PREDICTED: uncharacterized protein LOC104770511 [Camelina sativa]
Length=218

 Score =   171 bits (434),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 109/144 (76%), Gaps = 1/144 (1%)
 Frame = +1

Query  325  PSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDLN  504
            PSLISALN E+A+RG+ ITDVDHYG LG+ R C Y+QV + Y  +V+E K +GL++E L 
Sbjct  74   PSLISALNVERALRGLPITDVDHYGRLGVSRKCSYDQVRIGYQDRVKELKEQGLDDEQLK  133

Query  505  NKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpEDE  684
             KL L++ESY ILST+EERR+YDWSLARSE  + Y WPFEVDI   P    PPP++PED 
Sbjct  134  TKLDLVKESYTILSTVEERRMYDWSLARSEKAERYVWPFEVDI-MEPSREEPPPQEPEDV  192

Query  685  RPTRLVGYFILGWLVLAVVLSIAI  756
             PTRL+GYFI  WLVL + LS+A 
Sbjct  193  GPTRLLGYFIGAWLVLGIALSVAF  216



>ref|XP_011019363.1| PREDICTED: uncharacterized protein LOC105122133 isoform X1 [Populus 
euphratica]
Length=214

 Score =   171 bits (433),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 105/149 (70%), Gaps = 3/149 (2%)
 Frame = +1

Query  310  VSDGPPSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLE  489
            V  GPPSLISALN E+A+RGI ITDVDHYG LG+QR   YE+V VAY  KVEE  N+GL+
Sbjct  67   VPGGPPSLISALNVERALRGIPITDVDHYGRLGIQRRSSYEEVTVAYKNKVEELLNQGLD  126

Query  490  EEDLNNKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtpppr  669
            E ++  K++LL+ESY ILS+ +ERR+YDWSL RSE  + Y WP+EVD T T       P 
Sbjct  127  EAEVREKMELLKESYTILSSRDERRMYDWSLVRSEKPERYMWPYEVDFTPTAPPPPQEPE  186

Query  670  kpEDERPTRLVGYFILGWLVLAVVLSIAI  756
                   TRLVGYF L WLVLAV LS+ +
Sbjct  187  DEGP---TRLVGYFALAWLVLAVTLSVTL  212



>gb|KFK26359.1| hypothetical protein AALP_AA8G238100 [Arabis alpina]
Length=219

 Score =   171 bits (433),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 110/144 (76%), Gaps = 1/144 (1%)
 Frame = +1

Query  325  PSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDLN  504
            PSLISALN E+A+RG+ ITDVDHYG LG+ R C Y+QV + Y ++V+E   +GL+EE L 
Sbjct  75   PSLISALNVERALRGLPITDVDHYGRLGISRNCSYDQVRIGYQERVKEIMEQGLDEEQLK  134

Query  505  NKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpEDE  684
            NKL L+++SY ILST+EERR+YDWSLARSE  + Y WPFEVDI   P    PPP++PED 
Sbjct  135  NKLDLIKDSYTILSTVEERRMYDWSLARSEKAERYIWPFEVDI-MEPSREEPPPQEPEDV  193

Query  685  RPTRLVGYFILGWLVLAVVLSIAI  756
             PTRL+GYFI  WLVL V LS+A 
Sbjct  194  GPTRLLGYFIGAWLVLGVSLSVAF  217



>ref|XP_008367633.1| PREDICTED: uncharacterized protein LOC103431273 [Malus domestica]
Length=222

 Score =   171 bits (432),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 112/232 (48%), Positives = 153/232 (66%), Gaps = 17/232 (7%)
 Frame = +1

Query  67   VAMAGTLGNAYLCAQNF-LLSPTFKLEVGNGRNTISVPTTNLTYAANYSLYHPRKLVAAV  243
            +AM+ +    Y   ++F + +PT K+            + ++++A+      PR+L   +
Sbjct  1    MAMSSSTSTIYTAQKSFHITNPTPKIGCAF--------SNSISFASK-----PRRLC--I  45

Query  244  RSSSGDDtaaatteteetPVGV-VSDGPPSLISALNAEKAIRGIAITDVDHYGILGLQRG  420
              SSGD  A   T   +T   + V   PPSLISALN E+A+RGI ITDVDHYG LGLQRG
Sbjct  46   IRSSGDAPAETVTTEADTGSSIEVPKEPPSLISALNVERALRGIPITDVDHYGRLGLQRG  105

Query  421  CPYEQVLVAYNKKVEEAKNEGLEEEDLNNKLQLLQESYRILSTMEERRLYDWSLARSEMG  600
            C Y++V VAY   +++  ++GLEEE+LN  L+ L+ESY ILS+ +ERRLYDWSLARS   
Sbjct  106  CSYDEVSVAYKANLDKLMSQGLEEEELNKNLEPLKESYTILSSGDERRLYDWSLARSANP  165

Query  601  DTYTWPFEVDITQtpkggtppprkpEDERPTRLVGYFILGWLVLAVVLSIAI  756
            D Y WP+EV+ T+  +G  PP  +PED  PTRLVGYFILGWL+L++VLSIA+
Sbjct  166  DGYIWPYEVEKTRAAEGTPPPVGEPEDPGPTRLVGYFILGWLILSIVLSIAL  217



>ref|XP_004501434.1| PREDICTED: uncharacterized protein LOC101501920 [Cicer arietinum]
Length=215

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 110/141 (78%), Gaps = 1/141 (1%)
 Frame = +1

Query  328  SLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDLNN  507
            SLIS LN E+A+RGI ITD DHY  LG+ RGCPY+ V +AYN K+ E +++GLEE+ LNN
Sbjct  72   SLISTLNVERALRGIPITDADHYARLGIPRGCPYDMVPLAYNNKLRELESQGLEEDLLNN  131

Query  508  KLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpEDER  687
            KL+LL+ESY I+S+ EERR+YDWSLAR++  D Y WPFEVD+++  KG  PPP   +   
Sbjct  132  KLELLRESYTIMSSPEERRIYDWSLARADNTDKYIWPFEVDVSEIQKGDPPPPEPEDVGP  191

Query  688  PTRLVGYFILGWLVLAVVLSI  750
             TRLVGYF+LGW++LA VLSI
Sbjct  192  -TRLVGYFLLGWILLAFVLSI  211



>ref|XP_002309471.2| hypothetical protein POPTR_0006s23850g [Populus trichocarpa]
 gb|EEE92994.2| hypothetical protein POPTR_0006s23850g [Populus trichocarpa]
Length=214

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 105/149 (70%), Gaps = 3/149 (2%)
 Frame = +1

Query  310  VSDGPPSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLE  489
            V  GPPSLISALN E+A+RGI ITDVDHYG LG+QR   YE+V VAY  KV+E  N+GL+
Sbjct  67   VPGGPPSLISALNVERALRGIPITDVDHYGRLGIQRRSSYEEVTVAYKNKVDELLNQGLD  126

Query  490  EEDLNNKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtpppr  669
            E ++  K++LL+ESY ILS+ +ERR+YDWSL RSE  + Y WP+EVD T T       P 
Sbjct  127  EAEVREKMELLKESYTILSSRDERRMYDWSLVRSEKPERYMWPYEVDFTPTAPPPPQEPE  186

Query  670  kpEDERPTRLVGYFILGWLVLAVVLSIAI  756
                   TRLVGYF L WLVLAV LS+ +
Sbjct  187  DEGP---TRLVGYFALAWLVLAVTLSVTL  212



>ref|XP_009362607.1| PREDICTED: uncharacterized protein LOC103952676 [Pyrus x bretschneideri]
Length=222

 Score =   168 bits (425),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 115/145 (79%), Gaps = 0/145 (0%)
 Frame = +1

Query  322  PPSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDL  501
            PPSLISALN E+A+RGI ITDVDHYG LGLQRGC Y++V VAY  K+++  ++ LEEE+L
Sbjct  73   PPSLISALNVERALRGIPITDVDHYGRLGLQRGCSYDEVSVAYKAKLDKLMSQELEEEEL  132

Query  502  NNKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpED  681
            N  L+ L+ESY ILS+ +ERR YDWSLARS   D Y WP+EV+ T+  +G  PP  +PED
Sbjct  133  NKNLEPLKESYTILSSGDERRFYDWSLARSANPDGYIWPYEVEKTRPAEGTPPPVGEPED  192

Query  682  ERPTRLVGYFILGWLVLAVVLSIAI  756
              PTRLVGYFILGWL+L++VLSIA+
Sbjct  193  PGPTRLVGYFILGWLILSIVLSIAL  217



>ref|XP_006400693.1| hypothetical protein EUTSA_v10014636mg [Eutrema salsugineum]
 gb|ESQ42146.1| hypothetical protein EUTSA_v10014636mg [Eutrema salsugineum]
Length=217

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 109/144 (76%), Gaps = 1/144 (1%)
 Frame = +1

Query  325  PSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDLN  504
            PSLISALN E+A+RG+ ITDVDHYG LGL R C Y+QV   Y  +V++   +GL+EE L 
Sbjct  73   PSLISALNVERALRGLPITDVDHYGRLGLPRNCSYDQVRSGYQDRVKDLMGQGLDEELLK  132

Query  505  NKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpEDE  684
            NK++L+++SY ILS++EERR+YDWSLARSE  D Y WPFEVDI   P    PPP++PED 
Sbjct  133  NKMELIKDSYTILSSVEERRMYDWSLARSEKSDRYVWPFEVDI-MEPSREEPPPQEPEDV  191

Query  685  RPTRLVGYFILGWLVLAVVLSIAI  756
             PTR++GYFI  WLVL V LS+A 
Sbjct  192  GPTRILGYFIGAWLVLGVALSVAF  215



>ref|XP_009414809.1| PREDICTED: uncharacterized protein LOC103995828 [Musa acuminata 
subsp. malaccensis]
Length=204

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 106/143 (74%), Gaps = 1/143 (1%)
 Frame = +1

Query  328  SLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDLNN  507
            SLISA N +KA+RGIAITD DHYG LG+ R  PY+QV VAY KK EE  ++GL+EE  + 
Sbjct  61   SLISAANVQKALRGIAITDADHYGRLGIPRETPYDQVKVAYEKKCEELMSKGLDEEGTSK  120

Query  508  KLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpEDER  687
            +L+LL+ESY +LS+ EERRLYDWSLARSE  D Y WPFEVDITQTP    PP     D  
Sbjct  121  ELELLKESYVVLSSEEERRLYDWSLARSEKPDRYVWPFEVDITQTPTEPPPPQEPE-DVG  179

Query  688  PTRLVGYFILGWLVLAVVLSIAI  756
            PTRLVGYF L WL+L+  LS+ +
Sbjct  180  PTRLVGYFFLAWLILSFALSVTL  202



>ref|XP_007136878.1| hypothetical protein PHAVU_009G081500g [Phaseolus vulgaris]
 gb|ESW08872.1| hypothetical protein PHAVU_009G081500g [Phaseolus vulgaris]
Length=237

 Score =   166 bits (421),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 112/233 (48%), Positives = 141/233 (61%), Gaps = 17/233 (7%)
 Frame = +1

Query  70   AMAGTLGNAYLCAQNFLLSPTFKLEVGNGRNTISVPTTNLTYAANYSLYHPRKLVAAVRS  249
            AMA +   A LC           L   N   T  +P    +    ++L  PR L   +RS
Sbjct  20   AMAVSSTTAPLC-----------LPANNIPPTPQLPKFGFSSTIRFTLKPPRLL--RIRS  66

Query  250  SSGDDtaaatteteetPVGVVSDGPPSLISALNAEKAIRGIAITDVDHYGILGLQRGCPY  429
            SS + +              +   P SLISALN E+ +RG+ ITD DHYG LG+ RGCP+
Sbjct  67   SSAETSDTDVDSESSI---EIPKEPSSLISALNVERILRGLPITDTDHYGRLGVPRGCPF  123

Query  430  EQVLVAYNKKVEEAKNEGLEEEDLNNKLQLLQESYRILSTMEERRLYDWSLARSEMGDTY  609
            + V VAY+ K++E K++ LEE++L  KL+LL+ESY ILS+ EERR+YDWSLAR E  +T+
Sbjct  124  DMVGVAYSNKIQELKSQNLEEDELEKKLELLKESYIILSSEEERRIYDWSLARVENTETF  183

Query  610  TWPFEVDITQtpkggt-ppprkpEDERPTRLVGYFILGWLVLAVVLSIAIASN  765
             WPFEVDITQT      PP    ED  PTR+VGYF LGWLVL VVLSIAIA N
Sbjct  184  IWPFEVDITQTKIPEEDPPQLDTEDVGPTRVVGYFTLGWLVLGVVLSIAIALN  236



>ref|NP_001031919.1| chaperone DnaJ-domain containing protein [Arabidopsis thaliana]
 gb|AAU15180.1| At5g21430 [Arabidopsis thaliana]
 gb|AED92950.1| chaperone DnaJ-domain containing protein [Arabidopsis thaliana]
Length=217

 Score =   165 bits (418),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 109/144 (76%), Gaps = 2/144 (1%)
 Frame = +1

Query  325  PSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDLN  504
            PSLISALN E+A+RG+ ITDVDHYG LG+ R C Y+QV + Y ++V+E K +GL+EE L 
Sbjct  74   PSLISALNVERALRGLPITDVDHYGRLGIFRNCSYDQVTIGYKERVKELKEQGLDEEQLK  133

Query  505  NKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpEDE  684
             K+ L++ SY ILST+EERR+YDWSLARSE  + Y WPFEVDI   P    PPP++PED 
Sbjct  134  TKMDLIK-SYTILSTVEERRMYDWSLARSEKAERYVWPFEVDI-MEPSREEPPPQEPEDV  191

Query  685  RPTRLVGYFILGWLVLAVVLSIAI  756
             PTR++GYFI  WLVL V LS+A 
Sbjct  192  GPTRILGYFIGAWLVLGVALSVAF  215



>ref|XP_006288530.1| hypothetical protein CARUB_v10001802mg [Capsella rubella]
 gb|EOA21428.1| hypothetical protein CARUB_v10001802mg [Capsella rubella]
Length=250

 Score =   166 bits (420),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 107/144 (74%), Gaps = 1/144 (1%)
 Frame = +1

Query  325  PSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDLN  504
            PSLISALN E+A+RG+ ITDVDHYG LG+ R C Y++V   Y + V++ K +GL EE L 
Sbjct  106  PSLISALNVERALRGLPITDVDHYGRLGVSRKCSYDEVRTGYQEIVKKLKEQGLAEEQLK  165

Query  505  NKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpEDE  684
             K+ L++ESY ILST+EERR+YDWSLARSE  + Y WPFEVDI   P    PPP++PED 
Sbjct  166  TKMDLVKESYTILSTVEERRMYDWSLARSEKAERYVWPFEVDI-MEPSTEEPPPQEPEDV  224

Query  685  RPTRLVGYFILGWLVLAVVLSIAI  756
             PTRL+GYFI  WLVL + LS+A 
Sbjct  225  GPTRLLGYFIGAWLVLGIALSVAF  248



>emb|CAN71794.1| hypothetical protein VITISV_022108 [Vitis vinifera]
Length=202

 Score =   163 bits (412),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 92/188 (49%), Positives = 112/188 (60%), Gaps = 17/188 (9%)
 Frame = +1

Query  67   VAMAGTLGNAYLCAQNFLLSPTFKLEVGNGRNTISVPTTNLTYAANYSLYHPRKLVAAVR  246
            +A+  T   A L   NF  SP      G   N+I++             + PR+    +R
Sbjct  1    MAVTSTSATASLLRPNFRTSP--PQHGGQFSNSIAI------------AFKPRRF--RIR  44

Query  247  SSSGDDtaaatteteetPVGVVSDGPPSLISALNAEKAIRGIAITDVDHYGILGLQRGCP  426
            SS              +PV     GPPSLISALN EKA+RGIAITD DHYG LGLQR C 
Sbjct  45   SSGDAPXETTDESDSXSPVET-PKGPPSLISALNVEKALRGIAITDADHYGRLGLQRECS  103

Query  427  YEQVLVAYNKKVEEAKNEGLEEEDLNNKLQLLQESYRILSTMEERRLYDWSLARSEMGDT  606
            Y+QV  AY +KVEE K++ L+EE+ NNKL LL+ESY ILS+ +ERRLYDWSL RSE  D 
Sbjct  104  YDQVTFAYERKVEELKSQELDEEEANNKLGLLKESYSILSSPKERRLYDWSLTRSEKXDR  163

Query  607  YTWPFEVD  630
            Y WPFEV+
Sbjct  164  YAWPFEVE  171



>emb|CDP13457.1| unnamed protein product [Coffea canephora]
Length=220

 Score =   163 bits (413),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = +1

Query  310  VSDGPPSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLE  489
            V  GPPSLIS LN +KA+RGIAITD DHYG LGL+RGC Y+QV +AY KKV+E  ++GL 
Sbjct  84   VPQGPPSLISPLNVDKALRGIAITDADHYGRLGLRRGCSYDQVFLAYKKKVDELLSQGLS  143

Query  490  EEDLNNKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDI  633
            EE+LN  L+LL+ESY ILS++EERRLYDWSLAR+E  D Y WPFEVDI
Sbjct  144  EEELNTNLELLKESYSILSSVEERRLYDWSLARTEKPDRYMWPFEVDI  191



>ref|XP_004303470.1| PREDICTED: uncharacterized protein LOC101302180 [Fragaria vesca 
subsp. vesca]
Length=221

 Score =   160 bits (406),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 138/206 (67%), Gaps = 7/206 (3%)
 Frame = +1

Query  157  RNTISVPTTNLTYAANYSL---YHPRKLVAAVRSSSGDDtaaatteteetPVGVVSDGP-  324
            + T  +PT    +A + S+   + P      +RSS G D +AA T T     G   + P 
Sbjct  13   QKTFRIPTPKDGFAFSNSMTISFAPNLRKFCIRSS-GSDVSAAETATATENDGSSIEVPE  71

Query  325  --PSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEED  498
              PSLISALN E+A+RGI ITDV+HYG LGLQRGC  +Q+  AY  K++E K++GLEEE+
Sbjct  72   ESPSLISALNVERALRGIPITDVNHYGRLGLQRGCTSDQIRAAYKTKLDELKSQGLEEEE  131

Query  499  LNNKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpE  678
            LN KL+ L+ESY ILS+ +E+RLYDWSL R+   DTY WPFEV+ T+      PP  +PE
Sbjct  132  LNKKLEPLKESYTILSSADEKRLYDWSLGRTANPDTYLWPFEVETTRATPDTPPPVMEPE  191

Query  679  DERPTRLVGYFILGWLVLAVVLSIAI  756
            D  PTRLVGY  LGW++L++VLSIA+
Sbjct  192  DFGPTRLVGYVGLGWIILSLVLSIAL  217



>ref|XP_010936952.1| PREDICTED: uncharacterized protein LOC105056450 [Elaeis guineensis]
Length=209

 Score =   158 bits (400),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 108/143 (76%), Gaps = 1/143 (1%)
 Frame = +1

Query  328  SLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDLNN  507
            SLIS+ N EKA+RGI IT+ DHYG LG+ R    ++V VAY KK ++ +N+GL+EE+++ 
Sbjct  66   SLISSSNVEKALRGIPITNADHYGRLGIPRSTSSDEVKVAYEKKCDQLRNKGLDEEEVSK  125

Query  508  KLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpEDER  687
            +L+LL+ESY +LS+ EERRLYDWSLARSE  D Y WPFEVDITQTPK   PP    ++  
Sbjct  126  ELELLKESYGVLSSEEERRLYDWSLARSENPDRYVWPFEVDITQTPKWPPPPQEPEDEGP  185

Query  688  PTRLVGYFILGWLVLAVVLSIAI  756
             T+LVGYF L WL+L+ VLS+ +
Sbjct  186  -TKLVGYFFLAWLILSFVLSVTL  207



>ref|XP_011081609.1| PREDICTED: uncharacterized protein LOC105164617 isoform X1 [Sesamum 
indicum]
Length=231

 Score =   159 bits (401),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 107/156 (69%), Gaps = 1/156 (1%)
 Frame = +1

Query  172  VPTTNLTYAANYSLYHPRKLVAAVRSSSGDDtaaatteteetPVGVVSDGPPSLISALNA  351
            V + N  +   Y     R+ +  +++SS +   A   E+ E P   +  GPPSLISALN 
Sbjct  22   VSSRNYRFPTYYGAIKQRRRLLVIKNSSDESATATNAESAEIP-AELPRGPPSLISALNV  80

Query  352  EKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDLNNKLQLLQES  531
            EKA+RGIAI+D DHYG+LGL  GC Y+QV VAY  KV E  ++GL EE+L+ +L LL++S
Sbjct  81   EKALRGIAISDTDHYGMLGLGTGCSYDQVNVAYKNKVAEVMDKGLAEEELSKELDLLKQS  140

Query  532  YRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQ  639
            + ILS++EERRLYDWSLARS   D Y WPFEVDITQ
Sbjct  141  HSILSSVEERRLYDWSLARSGKPDRYMWPFEVDITQ  176



>ref|XP_003526053.1| PREDICTED: uncharacterized protein LOC100782990 [Glycine max]
 gb|KHN32175.1| hypothetical protein glysoja_035268 [Glycine soja]
Length=215

 Score =   157 bits (398),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 113/144 (78%), Gaps = 1/144 (1%)
 Frame = +1

Query  328  SLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDLNN  507
            SLISALN EK +RG+ ITD DHYG LG+ RGCP+E V  AYN KV+E K++ LEE++L  
Sbjct  70   SLISALNVEKILRGLPITDADHYGRLGIPRGCPFELVGGAYNIKVQELKSQNLEEDELEK  129

Query  508  KLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggt-ppprkpEDE  684
            KL+LL+ESY ILS+ EERR+YDWSLAR+E  D + WPFEVDITQ+      PP   PED 
Sbjct  130  KLELLKESYTILSSEEERRIYDWSLARAENADKFVWPFEVDITQSKISEEDPPQLDPEDV  189

Query  685  RPTRLVGYFILGWLVLAVVLSIAI  756
             PTR+VGYF+LGW++L++VLSIA+
Sbjct  190  GPTRVVGYFLLGWIMLSIVLSIAL  213



>ref|XP_003522295.1| PREDICTED: uncharacterized protein LOC100793741 [Glycine max]
Length=215

 Score =   155 bits (393),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 113/144 (78%), Gaps = 1/144 (1%)
 Frame = +1

Query  328  SLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDLNN  507
            SLISALN EK +RG+ ITD DHYG LG+ RGCP++ V  AYN KV+E K++ LEE++L  
Sbjct  70   SLISALNVEKILRGLPITDADHYGRLGIPRGCPFDLVGGAYNIKVQELKSQNLEEDELEK  129

Query  508  KLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggt-ppprkpEDE  684
            KL+LL+ESY ILS+ EERR+YDWSLAR+E  D + WPFEVDITQ+      PP   PED 
Sbjct  130  KLELLKESYTILSSEEERRIYDWSLARAENTDKFVWPFEVDITQSKISKEDPPQLDPEDV  189

Query  685  RPTRLVGYFILGWLVLAVVLSIAI  756
             PTR+VGYF+LGW++L++VLSIA+
Sbjct  190  GPTRVVGYFLLGWIMLSIVLSIAL  213



>gb|KHN29682.1| hypothetical protein glysoja_016304 [Glycine soja]
Length=215

 Score =   155 bits (393),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 114/144 (79%), Gaps = 1/144 (1%)
 Frame = +1

Query  328  SLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDLNN  507
            SLISALN EK +RG+ ITD DHYG LG+ RGCP++ V  AYN KV+E K++ LEE++L  
Sbjct  70   SLISALNVEKILRGLPITDADHYGRLGIPRGCPFDLVGGAYNIKVQELKSQNLEEDELEK  129

Query  508  KLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtpppr-kpEDE  684
            KL+LL+ESY ILS+ EERR+YDWSLAR+E  D + WPFEVDITQ+      PP+  PED 
Sbjct  130  KLELLKESYTILSSEEERRIYDWSLARAENTDKFVWPFEVDITQSKISKEDPPQLDPEDV  189

Query  685  RPTRLVGYFILGWLVLAVVLSIAI  756
             PTR+VGYF+LGW++L++VLSIA+
Sbjct  190  GPTRVVGYFLLGWIMLSIVLSIAL  213



>gb|EEC69321.1| hypothetical protein OsI_38413 [Oryza sativa Indica Group]
Length=235

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 105/152 (69%), Gaps = 4/152 (3%)
 Frame = +1

Query  304  GVVSDGPP-SLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNE  480
               S  PP SLISA N +KA+RG+AIT+ DHYG LG+ R    ++V  AY KK EE  ++
Sbjct  85   AATSTRPPYSLISADNVQKAMRGLAITECDHYGRLGITRSASTDEVKAAYEKKCEELNSK  144

Query  481  GLEEEDLNNKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtp  660
            GLEEE++N +  LL+ES+ IL T EERRLYDWSLARS   + Y WPFEVD  +       
Sbjct  145  GLEEEEINKEHDLLKESFTILWTEEERRLYDWSLARSGKPERYVWPFEVDPME---LAPD  201

Query  661  pprkpEDERPTRLVGYFILGWLVLAVVLSIAI  756
            PP++PEDE PT+LVGYF L W +L+V LS+ +
Sbjct  202  PPKEPEDEFPTKLVGYFFLAWFILSVALSVTL  233



>gb|ABA98601.1| DnaJ domain containing protein, expressed [Oryza sativa Japonica 
Group]
Length=235

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 105/152 (69%), Gaps = 4/152 (3%)
 Frame = +1

Query  304  GVVSDGPP-SLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNE  480
               S  PP SLISA N +KA+RG+AIT+ DHYG LG+ R    ++V  AY KK EE  ++
Sbjct  85   AATSTRPPYSLISADNVQKAMRGLAITECDHYGRLGITRSASTDEVKAAYEKKCEELNSK  144

Query  481  GLEEEDLNNKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtp  660
            GLEEE++N +  LL+ES+ IL T EERRLYDWSLARS   + Y WPFEVD  +       
Sbjct  145  GLEEEEINKEHDLLKESFTILWTEEERRLYDWSLARSGKPERYVWPFEVDPME---LAPD  201

Query  661  pprkpEDERPTRLVGYFILGWLVLAVVLSIAI  756
            PP++PEDE PT+LVGYF L W +L+V LS+ +
Sbjct  202  PPKEPEDEFPTKLVGYFFLAWFILSVALSVTL  233



>gb|AFK37356.1| unknown [Lotus japonicus]
Length=212

 Score =   152 bits (385),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 111/149 (74%), Gaps = 1/149 (1%)
 Frame = +1

Query  310  VSDGPPSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLE  489
            V   PPSLISALN E+A+RG+ ITD DHYG LG+ RG P  +V VAYN KV E +++GLE
Sbjct  63   VPKEPPSLISALNVERALRGLPITDADHYGRLGIPRGYPSNKVAVAYNNKVRELESQGLE  122

Query  490  EEDLNNKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtpppr  669
            EE+L  +L+LL+ESY I+S++EERRLYDWSLAR+E    Y WP+E DIT        PP 
Sbjct  123  EEELKKQLELLRESYTIMSSVEERRLYDWSLARTENTGRYNWPYEADITP-LTTEESPPE  181

Query  670  kpEDERPTRLVGYFILGWLVLAVVLSIAI  756
             PED  PTR+VG+  LGW+V++VVLSI++
Sbjct  182  DPEDVGPTRVVGFVFLGWIVISVVLSISL  210



>gb|AFK35491.1| unknown [Lotus japonicus]
 gb|AFK36382.1| unknown [Lotus japonicus]
Length=213

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 111/149 (74%), Gaps = 1/149 (1%)
 Frame = +1

Query  310  VSDGPPSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLE  489
            V   PPSLISALN E+A+RG+ ITD DHYG LG+ RG P  +V VAYN KV E +++GLE
Sbjct  64   VPKEPPSLISALNVERALRGLPITDADHYGRLGIPRGYPSNKVAVAYNNKVRELESQGLE  123

Query  490  EEDLNNKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtpppr  669
            EE+L  +L+LL+ESY I+S++EERRLYDWSLAR+E    Y WP+E DIT        PP 
Sbjct  124  EEELKKQLELLRESYTIMSSVEERRLYDWSLARTENTGRYNWPYEADITP-LTTEESPPE  182

Query  670  kpEDERPTRLVGYFILGWLVLAVVLSIAI  756
             PED  PTR+VG+  LGW+V++VVLSI++
Sbjct  183  DPEDVGPTRVVGFVFLGWIVISVVLSISL  211



>dbj|BAK61863.1| DNAJ heat shock N-terminal domain-containing protein [Citrus 
unshiu]
Length=192

 Score =   149 bits (377),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +1

Query  322  PPSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDL  501
            P SLISALN E+A+RGIAITD DHYG L L+RGC +++V +AY  K+E  K++GL+EE+ 
Sbjct  70   PSSLISALNVERALRGIAITDADHYGRLELRRGCSFDEVALAYKNKLEGLKDQGLDEEEE  129

Query  502  NNKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQ  639
            + K++LL+ESY ILS+ EERRLYDWSLAR+E  D Y WPFEVD+TQ
Sbjct  130  SKKIKLLKESYSILSSEEERRLYDWSLARTENPDRYVWPFEVDVTQ  175



>ref|XP_011019364.1| PREDICTED: uncharacterized protein LOC105122133 isoform X2 [Populus 
euphratica]
Length=190

 Score =   149 bits (376),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = +1

Query  310  VSDGPPSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLE  489
            V  GPPSLISALN E+A+RGI ITDVDHYG LG+QR   YE+V VAY  KVEE  N+GL+
Sbjct  67   VPGGPPSLISALNVERALRGIPITDVDHYGRLGIQRRSSYEEVTVAYKNKVEELLNQGLD  126

Query  490  EEDLNNKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDIT  636
            E ++  K++LL+ESY ILS+ +ERR+YDWSL RSE  + Y WP+EVD T
Sbjct  127  EAEVREKMELLKESYTILSSRDERRMYDWSLVRSEKPERYMWPYEVDFT  175



>ref|XP_003576139.1| PREDICTED: uncharacterized protein LOC100840040 [Brachypodium 
distachyon]
Length=235

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 104/146 (71%), Gaps = 4/146 (3%)
 Frame = +1

Query  322  PP-SLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEED  498
            PP SLISA N +KA+RG+AITD DHYG LG+ R    ++V  AY K+ E+  ++GLEEE+
Sbjct  90   PPYSLISAANVQKAMRGLAITDADHYGRLGITRLASTDEVKAAYEKRCEQLNSQGLEEEE  149

Query  499  LNNKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpE  678
            ++ +  LL+ES+ ILST EERRLYDWSLAR+   + Y WPFEVD  +       PP++PE
Sbjct  150  ISKEHDLLKESFTILSTEEERRLYDWSLARNGQPERYVWPFEVDPME---LAPDPPKEPE  206

Query  679  DERPTRLVGYFILGWLVLAVVLSIAI  756
            DE PT+LVGYF L W +++V  S+ +
Sbjct  207  DELPTKLVGYFFLAWFIISVACSLIL  232



>ref|XP_002516125.1| heat shock protein binding protein, putative [Ricinus communis]
 gb|EEF46127.1| heat shock protein binding protein, putative [Ricinus communis]
Length=213

 Score =   145 bits (365),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 119/195 (61%), Gaps = 26/195 (13%)
 Frame = +1

Query  67   VAMAGTLGNAYLCAQNFLLSPTFKLEVGNGRNTISVPTTNLTYAANYSLYHPRKLVAAVR  246
            +A++ T    Y+  QNF +S T        +NT    +  L +A   +  H       +R
Sbjct  1    MAVSSTSATIYILRQNFPISTT--------KNT----SVLLNFAPRKTCRH------VIR  42

Query  247  SSSGDDtaaatteteetPVGV-------VSDGPPSLISALNAEKAIRGIAITDVDHYGIL  405
            SSS D TA +T  T+             V +GP SLISALN E+A+RGI ITDVD+YG L
Sbjct  43   SSSSDGTAESTAATKVQEEEEESETLMEVPEGP-SLISALNVERALRGIPITDVDYYGRL  101

Query  406  GLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDLNNKLQLLQESYRILSTMEERRLYDWSLA  585
            G++RGC  E+V VAY  KVEE   +GL+EED+  +++LL+ESY ILS+ +ERR+YDWSLA
Sbjct  102  GVKRGCSNEEVTVAYKNKVEELLKQGLDEEDVRKEMELLKESYAILSSEDERRMYDWSLA  161

Query  586  RSEMGDTYTWPFEVD  630
            RSE  D Y WP+E D
Sbjct  162  RSENPDRYAWPYETD  176



>dbj|BAJ98433.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90844.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=228

 Score =   145 bits (365),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 101/145 (70%), Gaps = 3/145 (2%)
 Frame = +1

Query  322  PPSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDL  501
            P SLISA N +KA+RG+AIT  DHYG LG+ R    ++V  AY K+ E+   +GLEEE++
Sbjct  84   PYSLISAANVQKAMRGLAITGADHYGRLGITRLASTDEVKAAYEKRCEQLNKQGLEEEEI  143

Query  502  NNKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpED  681
            + +  LL+ES+ ILST EERRLYDWSLAR+   + Y WPFEVD  +       PP++ ED
Sbjct  144  SKEHDLLKESFTILSTEEERRLYDWSLARNGQPERYVWPFEVDPME---LAPDPPKERED  200

Query  682  ERPTRLVGYFILGWLVLAVVLSIAI  756
            E PT+LVGYF+L W +++V  S+ +
Sbjct  201  EFPTKLVGYFLLTWFIISVACSLIL  225



>dbj|BAK00016.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=228

 Score =   145 bits (365),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 101/145 (70%), Gaps = 3/145 (2%)
 Frame = +1

Query  322  PPSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDL  501
            P SLISA N +KA+RG+AIT  DHYG LG+ R    ++V  AY K+ E+   +GLEEE++
Sbjct  84   PYSLISAANVQKAMRGLAITGADHYGRLGITRLASTDEVKAAYEKRCEQLNKQGLEEEEI  143

Query  502  NNKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpED  681
            + +  LL+ES+ ILST EERRLYDWSLAR+   + Y WPFEVD  +       PP++ ED
Sbjct  144  SKEHDLLKESFTILSTEEERRLYDWSLARNGQPERYVWPFEVDPME---LAPDPPKERED  200

Query  682  ERPTRLVGYFILGWLVLAVVLSIAI  756
            E PT+LVGYF+L W +++V  S+ +
Sbjct  201  EFPTKLVGYFLLTWFIISVACSLIL  225



>gb|EAZ20564.1| hypothetical protein OsJ_36173 [Oryza sativa Japonica Group]
Length=131

 Score =   137 bits (346),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 93/132 (70%), Gaps = 3/132 (2%)
 Frame = +1

Query  361  IRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDLNNKLQLLQESYRI  540
            +RG+AIT+ DHYG LG+ R    ++V  AY KK EE  ++GLEEE++N +  LL+ES+ I
Sbjct  1    MRGLAITECDHYGRLGITRSASTDEVKAAYEKKCEELNSKGLEEEEINKEHDLLKESFTI  60

Query  541  LSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpEDERPTRLVGYFILG  720
            L T EERRLYDWSLARS   + Y WPFEVD  +       PP++PEDE PT+LVGYF L 
Sbjct  61   LWTEEERRLYDWSLARSGKPERYVWPFEVDPME---LAPDPPKEPEDEFPTKLVGYFFLA  117

Query  721  WLVLAVVLSIAI  756
            W +L+V LS+ +
Sbjct  118  WFILSVALSVTL  129



>ref|XP_002443210.1| hypothetical protein SORBIDRAFT_08g015440 [Sorghum bicolor]
 gb|EES17048.1| hypothetical protein SORBIDRAFT_08g015440 [Sorghum bicolor]
Length=234

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 104/145 (72%), Gaps = 3/145 (2%)
 Frame = +1

Query  322  PPSLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDL  501
            P S+ISA N +KA+RG+AITD DHYG LG+ R    ++V  AY KK EE  ++ LEEE+L
Sbjct  91   PYSIISADNVQKAMRGLAITDADHYGRLGVTRLASTDEVKAAYEKKCEELNSKELEEEEL  150

Query  502  NNKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpED  681
            + +  L++ES+ ILST EERRLYDWSL+RS   + Y WPF+VD  +       PP++PED
Sbjct  151  HKEYDLIKESFTILSTEEERRLYDWSLSRSGQPERYVWPFQVDPLE---MAPDPPQEPED  207

Query  682  ERPTRLVGYFILGWLVLAVVLSIAI  756
            E PT+LVGYF+L W +L+V LS+ +
Sbjct  208  ELPTKLVGYFLLAWFILSVALSVTL  232



>ref|XP_008662578.1| PREDICTED: uncharacterized protein LOC103640914 [Zea mays]
 gb|AFW56413.1| hypothetical protein ZEAMMB73_090495 [Zea mays]
Length=237

 Score =   129 bits (323),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 107/152 (70%), Gaps = 4/152 (3%)
 Frame = +1

Query  304  GVVSDGPP-SLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNE  480
               S  PP SLISA N +KA+RG+AITD DHYG LG+ R    ++V  AY K  EE  ++
Sbjct  87   AATSTRPPYSLISADNVQKAMRGLAITDADHYGRLGVTRLASTDEVKAAYEKMCEELNSK  146

Query  481  GLEEEDLNNKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtp  660
             LEEE+LN + +LL+ES+ ILST EERRLYDWSL+RS   + Y WPFEVD  +       
Sbjct  147  ELEEEELNKEHELLKESFTILSTEEERRLYDWSLSRSGQPERYVWPFEVDPLE---LAPD  203

Query  661  pprkpEDERPTRLVGYFILGWLVLAVVLSIAI  756
            PP++PEDE PT+LVGYF+L W +L+V LS+A+
Sbjct  204  PPKEPEDEFPTKLVGYFLLAWFILSVGLSVAL  235



>ref|XP_006664037.1| PREDICTED: uncharacterized protein LOC102700481 [Oryza brachyantha]
Length=131

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 86/132 (65%), Gaps = 3/132 (2%)
 Frame = +1

Query  361  IRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDLNNKLQLLQESYRI  540
            +RG+AITD DHYG LG+ R    ++V  AY KK EE  ++GLEEE++  +  L++ES+ I
Sbjct  1    MRGLAITDADHYGRLGITRLASTDEVKAAYEKKCEELNSKGLEEEEIIKEHDLIKESFTI  60

Query  541  LSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpEDERPTRLVGYFILG  720
            L+T EERRLYDWSL+RS   + Y WPFEVD  +        P       PT+LVGYF L 
Sbjct  61   LATEEERRLYDWSLSRSGQPERYVWPFEVDPLELAPEPPKEPEDE---FPTKLVGYFFLA  117

Query  721  WLVLAVVLSIAI  756
            W +L+V LS+ +
Sbjct  118  WFMLSVALSVTL  129



>gb|EMS46567.1| hypothetical protein TRIUR3_30292 [Triticum urartu]
Length=184

 Score =   106 bits (264),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 76/108 (70%), Gaps = 3/108 (3%)
 Frame = +1

Query  433  QVLVAYNKKVEEAKNEGLEEEDLNNKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYT  612
            +V  AY K+ E+   +GLEEE+++ +  LL+ES+ ILST EERRLYDWSLAR+   + Y 
Sbjct  77   EVKAAYEKRCEQLNKQGLEEEEISKEHDLLKESFTILSTEEERRLYDWSLARNGQPERYV  136

Query  613  WPFEVDITQtpkggtppprkpEDERPTRLVGYFILGWLVLAVVLSIAI  756
            WPFEVD  +       PP++PEDE PT+LVGYF+L W +++V  S+ +
Sbjct  137  WPFEVDPME---LAPDPPKEPEDEFPTKLVGYFLLTWFIISVACSLIL  181



>gb|AFW56414.1| hypothetical protein ZEAMMB73_090495, partial [Zea mays]
Length=224

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 78/110 (71%), Gaps = 1/110 (1%)
 Frame = +1

Query  304  GVVSDGPP-SLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNE  480
               S  PP SLISA N +KA+RG+AITD DHYG LG+ R    ++V  AY K  EE  ++
Sbjct  87   AATSTRPPYSLISADNVQKAMRGLAITDADHYGRLGVTRLASTDEVKAAYEKMCEELNSK  146

Query  481  GLEEEDLNNKLQLLQESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVD  630
             LEEE+LN + +LL+ES+ ILST EERRLYDWSL+RS   + Y WPFEVD
Sbjct  147  ELEEEELNKEHELLKESFTILSTEEERRLYDWSLSRSGQPERYVWPFEVD  196



>ref|XP_001767272.1| predicted protein [Physcomitrella patens]
 gb|EDQ67953.1| predicted protein [Physcomitrella patens]
Length=229

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 69/200 (35%), Positives = 94/200 (47%), Gaps = 6/200 (3%)
 Frame = +1

Query  178  TTNLTYAANYSLYHPRKLVAAVRSSSGDDtaaatteteetP---VGVVSDGPPS--LISA  342
            T  LT  A    +  R L  AVR+ S   + +        P   V +    PPS  LI+ 
Sbjct  23   TRRLTCNAARISHSRRGLGLAVRAESKSASTSTVEPAGPAPTEEVTLTPTAPPSKSLINE  82

Query  343  LNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDLNNKLQLL  522
             N   AI G  I   DHYG L +       +++ AY ++  E + + L E +    L  L
Sbjct  83   ENILSAISGRNIIVEDHYGRLRVNPEASSSEIVKAYQERCAEVRQQNLGESEAQEILNKL  142

Query  523  QESYRILSTMEERRLYDWSLARSEMGDT-YTWPFEVDITQtpkggtppprkpEDERPTRL  699
            ++S  +L++ EERRLYDW L R       Y WP+E D+TQ  +  T     PED+     
Sbjct  143  KDSVDLLTSEEERRLYDWCLLRKATHTVDYAWPYEADLTQRLQDPTTLVVPPEDDGVNDQ  202

Query  700  VGYFILGWLVLAVVLSIAIA  759
            VG F  GW VL+ VLSI I 
Sbjct  203  VGLFFAGWFVLSCVLSIVIG  222



>ref|XP_001754379.1| predicted protein [Physcomitrella patens]
 gb|EDQ80829.1| predicted protein [Physcomitrella patens]
Length=229

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 75/144 (52%), Gaps = 1/144 (1%)
 Frame = +1

Query  328  SLISALNAEKAIRGIAITDVDHYGILGLQRGCPYEQVLVAYNKKVEEAKNEGLEEEDLNN  507
            SLI+  N   AI G  I   DHYG LG+       +++  Y ++  E + + L E +   
Sbjct  78   SLINEENILSAITGQNIIVEDHYGRLGVNPEASSSEIVKTYQERCAEVRQKNLSESETEE  137

Query  508  KLQLLQESYRILSTMEERRLYDWSLARSEMGDT-YTWPFEVDITQtpkggtppprkpEDE  684
             L  L++S  +L++ EERRLYDW L R       Y WP+E DITQ  +  T     PED+
Sbjct  138  ILNKLKDSVDLLTSEEERRLYDWCLLRKATHTVDYAWPYEADITQRLQDPTSLVVPPEDD  197

Query  685  RPTRLVGYFILGWLVLAVVLSIAI  756
                 VG F  GW VL+ +LSI I
Sbjct  198  GVNDKVGLFFAGWFVLSCILSIVI  221



>emb|CCI55386.1| NDH subunit NdhU [Marchantia polymorpha]
Length=211

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 96/182 (53%), Gaps = 8/182 (4%)
 Frame = +1

Query  223  RKLVAAVRSSSGDDtaaatteteetPVGVVSDGPPSLISALNAEKAIRGIA-ITDVDHYG  399
            R+L A  R+ S D   A  T   + P   V + P SL+S      ++ G A +  V+HY 
Sbjct  24   RRLGA--RACSADSPTAFETNPVDAPA--VENLPTSLVSRTPQLDSLEGTAGVLKVNHYS  79

Query  400  ILGLQRGCPYEQVLVAYNKKVEEA-KNEGLEEEDLNNKLQLLQESYRILSTMEERRLYDW  576
            +L +  G    Q+  A+ ++ EE  +N  +++E    +L+ LQ S+  LST EERR+YDW
Sbjct  80   VLRVPIGASTSQIAQAFKERCEEVMQNRAVDDEASKAELRALQASFETLSTTEERRVYDW  139

Query  577  SLARSEMGD-TYTWPFEVDITQtpkggtppprkpE-DERPTRLVGYFILGWLVLAVVLSI  750
            +L R E  +  Y WP+E DITQ   G   P      DE     V  F+LGWL ++V+ S+
Sbjct  140  ALQRYENREGGYIWPYETDITQKYTGKDTPAVMRSFDEEGNNKVAAFLLGWLAISVLFSV  199

Query  751  AI  756
             +
Sbjct  200  TM  201



>ref|NP_001066812.2| Os12g0498500 [Oryza sativa Japonica Group]
 dbj|BAF29831.2| Os12g0498500, partial [Oryza sativa Japonica Group]
Length=80

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 55/78 (71%), Gaps = 3/78 (4%)
 Frame = +1

Query  523  QESYRILSTMEERRLYDWSLARSEMGDTYTWPFEVDITQtpkggtppprkpEDERPTRLV  702
            +ES+ IL T EERRLYDWSLARS   + Y WPFEVD  +       PP++PEDE PT+LV
Sbjct  4    EESFTILWTEEERRLYDWSLARSGKPERYVWPFEVDPME---LAPDPPKEPEDEFPTKLV  60

Query  703  GYFILGWLVLAVVLSIAI  756
            GYF L W +L+V LS+ +
Sbjct  61   GYFFLAWFILSVALSVTL  78



>ref|XP_002992725.1| hypothetical protein SELMODRAFT_448880 [Selaginella moellendorffii]
 gb|EFJ06206.1| hypothetical protein SELMODRAFT_448880 [Selaginella moellendorffii]
Length=252

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 47/88 (53%), Gaps = 5/88 (6%)
 Frame = +1

Query  391  HYGILGLQRGCPYEQVLVAYNK--KVEEAKNEGLEEEDLNNKLQLLQESYRILSTMEERR  564
            HY  LG+      E++ VAY K  K     +  L  E    K   L+E+Y +LS+ ++R+
Sbjct  104  HYEFLGITPEADTEEIKVAYRKLSKQYHPDSTTLPLEVAGKKFLRLKEAYNVLSSEDDRK  163

Query  565  LYDWSLAR---SEMGDTYTWPFEVDITQ  639
            LYDW LA+      G  + WP+EVD +Q
Sbjct  164  LYDWHLAQEASKARGGRFIWPYEVDRSQ  191



>ref|XP_002993582.1| hypothetical protein SELMODRAFT_163076 [Selaginella moellendorffii]
 gb|EFJ05357.1| hypothetical protein SELMODRAFT_163076 [Selaginella moellendorffii]
Length=252

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 47/88 (53%), Gaps = 5/88 (6%)
 Frame = +1

Query  391  HYGILGLQRGCPYEQVLVAYNK--KVEEAKNEGLEEEDLNNKLQLLQESYRILSTMEERR  564
            HY  LG+      E++ VAY K  K     +  L  E    K   L+E+Y +LS+ ++R+
Sbjct  104  HYEFLGITPEADTEEIKVAYRKLSKQYHPDSTTLPLEVAGKKFLRLKEAYNVLSSEDDRK  163

Query  565  LYDWSLAR---SEMGDTYTWPFEVDITQ  639
            LYDW LA+      G  + WP+EVD +Q
Sbjct  164  LYDWHLAQEASKARGGRFIWPYEVDRSQ  191



>emb|CCI55385.1| NDH subunit NdhT [Marchantia polymorpha]
Length=162

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 39/84 (46%), Gaps = 5/84 (6%)
 Frame = +1

Query  391  HYGILGLQRGCPYEQVLVAYNK--KVEEAKNEGLEEEDLNNKLQLLQESYRILSTMEERR  564
            HY  LGL      E +  AY +  K        L  E    K   L+E+Y +LS+ +ERR
Sbjct  11   HYRYLGLTPDADTEDIKAAYRRLSKTYHPDTTALPLEVAAQKFVRLKEAYTVLSSEQERR  70

Query  565  LYDWSLAR---SEMGDTYTWPFEV  627
             YDW LA+      G  + WP+E 
Sbjct  71   FYDWQLAQEVSKRQGGRFIWPYEA  94



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1838885864684