BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13454_g1_i1 len=1152 path=[609:0-1151]

Length=1152
                                                                      Score     E

ref|XP_004236519.1|  PREDICTED: transcription factor MYB34              187   8e-52   
ref|XP_006344977.1|  PREDICTED: myb-related protein 330-like isof...    185   8e-51   
ref|XP_006344978.1|  PREDICTED: myb-related protein 330-like isof...    179   6e-49   
ref|XP_010663429.1|  PREDICTED: myb-related protein 315 isoform X2      177   7e-48   
ref|XP_007211249.1|  hypothetical protein PRUPE_ppa017571mg             177   9e-48   
ref|XP_010663428.1|  PREDICTED: myb-related protein 315 isoform X1      176   1e-47   
ref|XP_008239671.1|  PREDICTED: transcription factor MYB51              176   2e-47   
ref|XP_009800479.1|  PREDICTED: myb-related protein 315-like            175   3e-47   
emb|CAN75378.1|  hypothetical protein VITISV_027593                     174   4e-47   Vitis vinifera
emb|CDP14903.1|  unnamed protein product                                172   6e-46   
ref|XP_009631987.1|  PREDICTED: myb-related protein 315                 172   6e-46   
ref|XP_009369384.1|  PREDICTED: transcription factor MYB39-like         168   2e-44   
ref|XP_011071760.1|  PREDICTED: myb-related protein 308-like            166   3e-44   
ref|XP_008346824.1|  PREDICTED: transcription factor MYB39-like         166   1e-43   
emb|CBI15301.3|  unnamed protein product                                163   5e-43   
ref|XP_002318003.2|  putative MYB transcription factor family pro...    164   6e-43   Populus trichocarpa [western balsam poplar]
ref|XP_011042628.1|  PREDICTED: transcription repressor MYB6-like       161   8e-42   
ref|XP_002321544.1|  hypothetical protein POPTR_0015s07900g             160   2e-41   Populus trichocarpa [western balsam poplar]
ref|XP_010087748.1|  Myb-related protein Pp2                            158   7e-41   
gb|KDP31180.1|  hypothetical protein JCGZ_11556                         157   2e-40   
ref|XP_008453162.1|  PREDICTED: transcription factor MYB24-like         157   2e-40   
ref|XP_011028677.1|  PREDICTED: transcription factor RAX2-like          156   7e-40   
ref|XP_004301300.1|  PREDICTED: uncharacterized protein LOC101309551    154   3e-39   
ref|XP_007138144.1|  hypothetical protein PHAVU_009G183800g             150   4e-38   
ref|XP_008393090.1|  PREDICTED: transcription factor MYB39-like         149   2e-37   
ref|XP_010678637.1|  PREDICTED: transcription repressor MYB6-like       147   7e-37   
ref|XP_007099739.1|  Duplicated homeodomain-like superfamily prot...    148   7e-37   
ref|XP_006477532.1|  PREDICTED: transcription factor MYB39-like         147   1e-36   
ref|XP_004138294.1|  PREDICTED: uncharacterized protein LOC101212214    147   2e-36   
ref|XP_008374912.1|  PREDICTED: uncharacterized protein LOC103438153    146   1e-35   
ref|XP_006439694.1|  hypothetical protein CICLE_v10023930mg             143   3e-35   
gb|KHN19359.1|  Myb-related protein Zm38                                139   8e-34   
gb|KDO69866.1|  hypothetical protein CISIN_1g038824mg                   134   2e-33   
ref|XP_006581947.1|  PREDICTED: myb-related protein Pp2-like            137   3e-33   
ref|XP_010264963.1|  PREDICTED: transcription factor MYB76              135   3e-32   
ref|XP_010039154.1|  PREDICTED: myb-related protein 315-like            132   1e-31   
ref|XP_004513209.1|  PREDICTED: transcription factor MYB86-like i...    132   1e-31   
gb|EYU35908.1|  hypothetical protein MIMGU_mgv1a008388mg                131   8e-31   
emb|CBI35002.3|  unnamed protein product                                120   4e-27   
gb|KEH33532.1|  myb transcription factor                                116   4e-26   
ref|XP_009764550.1|  PREDICTED: transcription factor WER                116   9e-26   
emb|CAN74972.1|  hypothetical protein VITISV_001041                     115   1e-25   Vitis vinifera
ref|XP_004164901.1|  PREDICTED: myb-related protein Zm38-like           113   1e-25   
ref|XP_002276072.2|  PREDICTED: transcription repressor MYB4            115   2e-25   Vitis vinifera
ref|XP_004147487.1|  PREDICTED: myb-related protein Zm38-like           113   2e-25   
ref|XP_006842754.1|  hypothetical protein AMTR_s00133p00071910          114   4e-25   
gb|KDP45440.1|  hypothetical protein JCGZ_09689                         113   5e-25   
ref|XP_004513210.1|  PREDICTED: transcription factor MYB86-like i...    112   7e-25   
ref|XP_009606135.1|  PREDICTED: myb-related protein 315                 112   1e-24   
ref|XP_009335796.1|  PREDICTED: transcription factor MYB29              113   1e-24   
ref|XP_008340397.1|  PREDICTED: transcription repressor MYB6-like       111   1e-24   
ref|XP_008443447.1|  PREDICTED: myb-related protein Zm38                110   3e-24   
ref|XP_008341741.1|  PREDICTED: transcription factor MYB29-like         111   4e-24   
ref|XP_007217774.1|  hypothetical protein PRUPE_ppa015976mg             111   4e-24   
ref|XP_002324023.2|  hypothetical protein POPTR_0017s11140g             111   6e-24   Populus trichocarpa [western balsam poplar]
ref|XP_007032351.1|  Duplicated homeodomain-like superfamily prot...    110   7e-24   
ref|XP_011008372.1|  PREDICTED: myb-related protein 330                 110   8e-24   
gb|KHN34185.1|  Transcription factor MYB86                              110   9e-24   
ref|XP_010532300.1|  PREDICTED: transcription factor MYB29              109   1e-23   
ref|XP_007151175.1|  hypothetical protein PHAVU_004G024200g             109   2e-23   
gb|AGN52119.1|  MYB-related transcription factor                        107   2e-23   
gb|EYU34125.1|  hypothetical protein MIMGU_mgv1a022965mg                107   4e-23   
ref|XP_006342308.1|  PREDICTED: protein ODORANT1-like                   107   5e-23   
ref|XP_004234868.1|  PREDICTED: myb-related protein 308                 106   5e-23   
ref|XP_008230970.1|  PREDICTED: transcription repressor MYB6            107   6e-23   
ref|XP_006604956.1|  PREDICTED: protein ODORANT1-like                   107   8e-23   
ref|XP_011098554.1|  PREDICTED: transcription factor MYB86              107   9e-23   
gb|KHN16276.1|  Myb-related protein Zm38                                105   1e-22   
ref|XP_003543842.2|  PREDICTED: transcription factor MYB86-like         106   2e-22   
gb|KHN13255.1|  Transcription factor MYB86                              105   3e-22   
ref|XP_006416547.1|  hypothetical protein EUTSA_v10008283mg             103   1e-21   
ref|XP_006482661.1|  PREDICTED: transcription factor MYB86-like         103   2e-21   
gb|AGN52098.1|  MYB-related transcription factor                        102   2e-21   
gb|KDO72421.1|  hypothetical protein CISIN_1g043557mg                   103   2e-21   
ref|XP_006431044.1|  hypothetical protein CICLE_v10013340mg             102   2e-21   
ref|XP_010091926.1|  Transcription repressor                            103   3e-21   
ref|XP_006579290.1|  PREDICTED: transcription factor MYB34-like         100   6e-21   
ref|XP_010528297.1|  PREDICTED: transcription repressor MYB6            100   1e-20   
gb|EPS61416.1|  hypothetical protein M569_13382                       96.7    2e-20   
ref|XP_006395361.1|  hypothetical protein EUTSA_v10005502mg           99.4    3e-20   
ref|XP_010030787.1|  PREDICTED: myb-related protein Zm38              99.4    4e-20   
ref|XP_003618429.1|  Transcription factor-like protein                98.6    8e-20   
ref|XP_004304960.1|  PREDICTED: uncharacterized protein LOC101309179  98.6    9e-20   
ref|XP_010459549.1|  PREDICTED: transcription repressor MYB6-like     97.8    1e-19   
ref|XP_010498301.1|  PREDICTED: transcription repressor MYB6-like     97.1    2e-19   
gb|KFK33741.1|  hypothetical protein AALP_AA5G053900                  97.1    2e-19   
ref|XP_009151869.1|  PREDICTED: myb-related protein 330               96.7    3e-19   
ref|XP_008804161.1|  PREDICTED: transcription factor MYB34            96.7    4e-19   
ref|XP_010921545.1|  PREDICTED: transcription repressor MYB4          95.1    1e-18   
ref|XP_006291503.1|  hypothetical protein CARUB_v10017650mg           94.7    1e-18   
ref|XP_010477097.1|  PREDICTED: myb-related protein 315-like isof...  94.7    1e-18   
ref|XP_002877110.1|  hypothetical protein ARALYDRAFT_484622           94.0    2e-18   
ref|NP_173330.1|  myb-like HTH transcriptional regulator family p...  94.0    2e-18   Arabidopsis thaliana [mouse-ear cress]
emb|CDX85201.1|  BnaC07g25120D                                        96.7    2e-18   
ref|XP_004489482.1|  PREDICTED: myb-related protein 308-like          94.4    2e-18   
gb|AAC83599.1|  putative transcription factor                         92.4    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002511489.1|  hypothetical protein RCOM_1512980                92.4    4e-18   Ricinus communis
ref|XP_010514552.1|  PREDICTED: transcription repressor MYB6-like     92.8    7e-18   
emb|CDX83798.1|  BnaC08g18470D                                        92.4    8e-18   
ref|XP_010502849.1|  PREDICTED: transcription repressor MYB6-like...  92.4    8e-18   
ref|XP_010425627.1|  PREDICTED: transcription repressor MYB6-like     92.4    8e-18   
ref|XP_001779423.1|  predicted protein                                89.0    9e-18   
ref|XP_010502848.1|  PREDICTED: protein ODORANT1-like isoform X1      92.4    1e-17   
ref|NP_189488.1|  protein DEFECTIVE IN MERISTEM DEVELOPMENT AND F...  91.7    2e-17   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28578.1|  unknown                                               91.7    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010670356.1|  PREDICTED: protein ODORANT1                      90.9    3e-17   
emb|CDP20600.1|  unnamed protein product                              90.9    3e-17   
ref|XP_010928123.1|  PREDICTED: transcription factor MYB12            90.1    6e-17   
ref|XP_001759297.1|  predicted protein                                86.3    6e-17   
emb|CDY64987.1|  BnaA02g35490D                                        88.6    7e-17   
gb|KFK44043.1|  hypothetical protein AALP_AA1G208100                  89.4    1e-16   
ref|XP_009402030.1|  PREDICTED: myb-related protein Myb4              89.4    1e-16   
emb|CDY57424.1|  BnaCnng32030D                                        89.0    1e-16   
gb|AIT71167.1|  MYB80                                                 89.0    1e-16   
ref|NP_200422.1|  myb domain protein 103                              89.0    1e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CDY17391.1|  BnaA10g10250D                                        89.0    1e-16   
ref|XP_006281519.1|  hypothetical protein CARUB_v10027619mg           89.0    2e-16   
ref|XP_010450666.1|  PREDICTED: myb-related protein Zm38-like         89.0    2e-16   
ref|XP_010483078.1|  PREDICTED: myb-related protein Zm38-like         89.0    2e-16   
ref|XP_010443249.1|  PREDICTED: myb-related protein Zm38-like         89.0    2e-16   
ref|XP_009126966.1|  PREDICTED: transcription repressor MYB4-like     88.6    2e-16   
ref|XP_002864434.1|  AtMYB103/AtMYB80                                 89.0    2e-16   
ref|XP_008787076.1|  PREDICTED: myb-related protein 330-like          88.6    2e-16   
gb|AIT71165.1|  MYB80                                                 88.6    2e-16   
ref|XP_001780718.1|  predicted protein                                85.5    2e-16   
ref|XP_010092389.1|  Transcription factor                             88.2    3e-16   
ref|XP_008219084.1|  PREDICTED: transcription repressor MYB4          88.2    3e-16   
ref|XP_006401377.1|  hypothetical protein EUTSA_v10015622mg           88.2    3e-16   
ref|XP_007206619.1|  hypothetical protein PRUPE_ppa021719mg           88.2    3e-16   
ref|XP_006474780.1|  PREDICTED: myb-related protein 330-like isof...  87.8    4e-16   
ref|XP_007020342.1|  Myb domain protein 103                           87.8    5e-16   
ref|XP_008813758.1|  PREDICTED: transcription factor MYB12            87.4    5e-16   
ref|XP_010539349.1|  PREDICTED: myb-related protein Zm38              87.0    6e-16   
ref|XP_006474779.1|  PREDICTED: myb-related protein 330-like isof...  87.8    6e-16   
ref|XP_001781133.1|  predicted protein                                83.6    6e-16   
gb|AIT71168.1|  MYB80-1                                               87.4    6e-16   
gb|KFK27181.1|  hypothetical protein AALP_AA8G346300                  88.6    6e-16   
ref|XP_002268897.1|  PREDICTED: transcription repressor MYB4          87.0    7e-16   Vitis vinifera
ref|XP_009120123.1|  PREDICTED: protein ODORANT1                      87.0    7e-16   
emb|CBI39810.3|  unnamed protein product                              87.0    7e-16   
gb|AIS24254.1|  MYB80                                                 86.3    9e-16   
ref|XP_006452739.1|  hypothetical protein CICLE_v10008921mg           86.7    9e-16   
ref|XP_008349609.1|  PREDICTED: transcription factor MYB39-like       86.7    1e-15   
ref|XP_010244825.1|  PREDICTED: transcription factor MYB28            86.7    1e-15   
ref|XP_008449008.1|  PREDICTED: myb-related protein 308 isoform X1    86.3    1e-15   
ref|XP_002890308.1|  hypothetical protein ARALYDRAFT_472119           85.5    1e-15   
ref|XP_009110308.1|  PREDICTED: myb-related protein 308               86.3    1e-15   
ref|XP_004148287.1|  PREDICTED: transcription factor MYB32-like       86.3    1e-15   
gb|KHN01809.1|  Transcription factor MYB39                            86.3    1e-15   
ref|XP_007146695.1|  hypothetical protein PHAVU_006G061600g           86.3    1e-15   
ref|XP_003530827.1|  PREDICTED: myb-related protein 315-like          86.3    1e-15   
ref|XP_001761131.1|  predicted protein                                83.2    2e-15   
ref|XP_004500173.1|  PREDICTED: transcription repressor MYB4-like     85.9    2e-15   
gb|KEH34120.1|  myb transcription factor                              85.9    2e-15   
ref|XP_010676132.1|  PREDICTED: myb-related protein 315               85.9    2e-15   
gb|EPS72419.1|  hypothetical protein M569_02341                       83.2    2e-15   
ref|XP_009348787.1|  PREDICTED: transcription repressor MYB4          85.9    2e-15   
gb|KHN31714.1|  Transcription factor MYB39                            85.9    2e-15   
ref|XP_010063219.1|  PREDICTED: protein ODORANT1                      85.9    2e-15   
ref|XP_003552981.1|  PREDICTED: uncharacterized protein LOC100800764  85.9    2e-15   
ref|XP_008353730.1|  PREDICTED: transcriptional activator Myb         85.9    2e-15   
ref|XP_004294888.1|  PREDICTED: transcription repressor MYB4-like     85.5    3e-15   
ref|XP_009602016.1|  PREDICTED: transcription factor MYB3             85.1    4e-15   
gb|AIT52321.1|  MYB family protein                                    85.1    4e-15   
ref|XP_009767695.1|  PREDICTED: transcription repressor MYB4          84.7    4e-15   
ref|XP_011000363.1|  PREDICTED: transcription factor MYB32-like       84.7    5e-15   
ref|XP_011014679.1|  PREDICTED: transcription factor MYB32-like       84.7    5e-15   
ref|XP_006377995.1|  hypothetical protein POPTR_0011s17060g           84.7    5e-15   
gb|AIT71169.1|  MYB80-2                                               84.7    5e-15   
ref|XP_006352557.1|  PREDICTED: transcription factor MYB46-like       84.0    1e-14   
ref|XP_004248353.1|  PREDICTED: protein ODORANT1                      84.0    1e-14   
gb|EEE61165.1|  hypothetical protein OsJ_15134                        84.0    1e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003579943.1|  PREDICTED: myb-related protein Zm38              83.6    1e-14   
gb|EAY94488.1|  hypothetical protein OsI_16260                        84.0    2e-14   Oryza sativa Indica Group [Indian rice]
emb|CAH67046.1|  OSIGBa0124N08.8                                      84.0    2e-14   Oryza sativa [red rice]
emb|CAE03051.2|  OSJNBa0089K21.5                                      84.0    2e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006653511.1|  PREDICTED: myb-related protein 330-like          83.2    2e-14   
ref|XP_002299071.1|  hypothetical protein POPTR_0001s47430g           82.8    3e-14   Populus trichocarpa [western balsam poplar]
ref|XP_011039857.1|  PREDICTED: myb-related protein 308               82.4    3e-14   
ref|XP_009392068.1|  PREDICTED: transcription factor MYB3             82.4    3e-14   
gb|EAZ26586.1|  hypothetical protein OsJ_10483                        81.3    3e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004975922.1|  PREDICTED: transcription factor MYB12-like       82.8    4e-14   
emb|CDP13654.1|  unnamed protein product                              82.0    4e-14   
ref|XP_006649927.1|  PREDICTED: myb-related protein Zm38-like         81.6    4e-14   
gb|EYU33741.1|  hypothetical protein MIMGU_mgv1a019344mg              81.3    5e-14   
ref|XP_002448013.1|  hypothetical protein SORBIDRAFT_06g019650        82.4    5e-14   Sorghum bicolor [broomcorn]
emb|CDX96687.1|  BnaA08g22300D                                        81.6    5e-14   
gb|ACF84326.1|  unknown                                               82.0    6e-14   Zea mays [maize]
ref|NP_001146260.1|  uncharacterized protein LOC100279834             82.0    6e-14   Zea mays [maize]
dbj|BAK03933.1|  predicted protein                                    81.3    7e-14   
gb|EMT23269.1|  Transcription repressor MYB4                          81.3    7e-14   
ref|XP_006603478.1|  PREDICTED: myb-related protein 315-like          79.7    8e-14   
ref|XP_001776312.1|  predicted protein                                79.0    9e-14   
gb|AGN52106.1|  MYB-related transcription factor                      80.9    9e-14   
ref|NP_001173380.1|  Os03g0296000                                     80.9    1e-13   
ref|XP_004965547.1|  PREDICTED: myb-related protein Zm38-like         80.5    1e-13   
gb|AAL84759.1|AF474126_1  typical P-type R2R3 Myb protein             78.2    1e-13   Sorghum bicolor [broomcorn]
gb|EAY89620.1|  hypothetical protein OsI_11146                        80.5    1e-13   Oryza sativa Indica Group [Indian rice]
gb|ADR83568.1|  putative Myb103 transcription factor                  80.5    1e-13   
ref|XP_002465411.1|  hypothetical protein SORBIDRAFT_01g038250        80.5    1e-13   Sorghum bicolor [broomcorn]
ref|NP_001150470.1|  DNA binding protein                              80.1    2e-13   Zea mays [maize]
ref|XP_001771707.1|  predicted protein                                77.0    2e-13   
ref|XP_003558134.1|  PREDICTED: myb-related protein Zm38-like         79.3    4e-13   
gb|EPS66328.1|  hypothetical protein M569_08448                       75.9    4e-13   
gb|ADF57329.1|  R2R3 MYB transcription factor                         79.0    5e-13   
gb|AFD36431.1|  R2R3 MYB transcription factor                         79.0    6e-13   
gb|ABD60296.2|  R2R3-MYB transcription factor MYB1                    75.5    9e-13   
gb|ABD60289.2|  R2R3-MYB transcription factor MYB8                    77.0    9e-13   
gb|ABP04051.1|  R2R3MYB                                               78.2    1e-12   Ginkgo biloba [ginkgo]
gb|ABH02909.1|  MYB transcription factor MYB64                        75.5    2e-12   Glycine max [soybeans]
ref|XP_010105966.1|  Protein ODORANT1                                 77.4    2e-12   
ref|XP_009779196.1|  PREDICTED: myb-related protein Zm38-like         75.9    4e-12   
ref|XP_002864431.1|  predicted protein                                77.0    5e-12   
ref|XP_010032675.1|  PREDICTED: transcription factor MYB3-like        74.3    5e-12   
ref|XP_009398742.1|  PREDICTED: myb-related protein Hv33-like         75.1    5e-12   
gb|ABK23961.1|  unknown                                               74.7    6e-12   Picea sitchensis
gb|KDP28358.1|  hypothetical protein JCGZ_14129                       76.6    6e-12   
ref|XP_006444636.1|  hypothetical protein CICLE_v10020144mg           76.6    7e-12   
gb|ABQ51217.1|  R2R3-MYB transcription factor MYB1                    75.5    8e-12   Picea glauca
ref|XP_006492438.1|  PREDICTED: transcription factor MYB39-like       76.6    8e-12   
ref|XP_001784979.1|  predicted protein                                72.4    8e-12   
ref|XP_011040042.1|  PREDICTED: transcription factor MYB86-like       76.6    8e-12   
gb|ABQ51224.1|  R2R3-MYB transcription factor MYB8                    76.6    8e-12   Picea glauca
gb|ABK23245.1|  unknown                                               75.5    9e-12   Picea sitchensis
ref|XP_002320929.1|  hypothetical protein POPTR_0014s10680g           76.3    1e-11   Populus trichocarpa [western balsam poplar]
ref|XP_009629649.1|  PREDICTED: transcription factor MYB28-like       74.3    2e-11   
gb|AIA66961.1|  MYB055                                                75.5    2e-11   
gb|AAQ62541.1|  R2R3-MYB transcription factor                         74.7    2e-11   Pinus taeda
gb|ACA33839.1|  R2R3-Myb1 transcription factor                        74.7    2e-11   Pinus pinaster [cluster pine]
gb|ADL36768.1|  MYB domain class transcription factor                 75.1    2e-11   
gb|KHN14179.1|  Transcription factor MYB86                            75.1    2e-11   
gb|AGO03571.1|  MIXTA-like 7                                          73.6    2e-11   
ref|XP_003521624.1|  PREDICTED: transcription factor MYB86-like       75.1    2e-11   
gb|ACJ38663.1|  myb-like transcription factor                         75.1    2e-11   Betula luminifera [liang ye hua]
gb|KHN43402.1|  Transcription factor MYB86                            75.1    2e-11   
gb|KHG02253.1|  Transcription factor MYB86 -like protein              75.1    2e-11   
ref|XP_007145085.1|  hypothetical protein PHAVU_007G208400g           75.1    2e-11   
ref|XP_003519722.1|  PREDICTED: transcription factor MYB86-like       75.1    2e-11   
ref|XP_007051325.1|  Myb domain protein 55                            75.1    2e-11   
ref|NP_001242243.1|  MYB transcription factor MYB64                   75.1    2e-11   
ref|XP_004495851.1|  PREDICTED: protein ODORANT1-like                 75.1    2e-11   
ref|XP_004510807.1|  PREDICTED: protein ODORANT1-like                 73.6    2e-11   
gb|KEH43172.1|  myb transcription factor MYB64                        74.7    2e-11   
ref|XP_010936645.1|  PREDICTED: myb-related protein Hv33-like         73.9    2e-11   
gb|KHN14240.1|  Transcription factor MYB86                            74.7    3e-11   
emb|CBI17347.3|  unnamed protein product                              72.8    3e-11   
ref|XP_010920127.1|  PREDICTED: myb-related protein 308-like          72.8    3e-11   
ref|XP_006589090.1|  PREDICTED: transcription factor MYB86-like       74.7    3e-11   
emb|CDX93504.1|  BnaA06g05440D                                        73.6    3e-11   
ref|XP_003532377.1|  PREDICTED: myb-related protein 330-like          72.4    3e-11   
ref|XP_009335551.1|  PREDICTED: transcription factor MYB86-like       74.7    3e-11   
ref|XP_010477067.1|  PREDICTED: transcription factor MYB76-like       72.8    3e-11   
ref|XP_004974147.1|  PREDICTED: myb-related protein Zm38-like         72.8    3e-11   
gb|AIS35923.1|  MYB transcription factor 6                            72.8    3e-11   
gb|ADV29942.1|  MYB transcription factor MIXTA-like 5 protein         73.2    3e-11   
gb|KHF98976.1|  Transcription factor MYB86 -like protein              74.3    3e-11   
ref|XP_008653574.1|  PREDICTED: myb-related protein Hv1 isoform X3    72.0    3e-11   
gb|KHN37454.1|  Transcription factor MYB86                            74.3    3e-11   
ref|XP_010523735.1|  PREDICTED: transcription repressor MYB6          73.2    3e-11   
gb|ACA33851.1|  R2R3-Myb1 transcription factor                        73.9    3e-11   Pinus taeda
gb|AFX98073.1|  R2R3 transcription factor                             73.2    3e-11   
gb|ABH02891.1|  MYB transcription factor MYB89                        71.6    4e-11   Glycine max [soybeans]
ref|XP_003535308.1|  PREDICTED: transcription factor MYB86-like       74.3    4e-11   
ref|XP_007207615.1|  hypothetical protein PRUPE_ppa019718mg           74.3    4e-11   
ref|XP_010415030.1|  PREDICTED: transcription factor MYB86-like       73.2    4e-11   
ref|XP_010037524.1|  PREDICTED: transcription factor MYB46-like       73.9    4e-11   
gb|AGD80140.1|  mixta                                                 73.2    4e-11   
ref|XP_004301140.1|  PREDICTED: transcription factor MYB32-like       72.8    4e-11   
gb|KHG10399.1|  Myb-related protein                                   71.2    4e-11   
ref|XP_007031283.1|  Myb domain protein 61, putative isoform 1        74.3    4e-11   
ref|XP_004492711.1|  PREDICTED: protein ODORANT1-like                 73.2    4e-11   
ref|XP_007031284.1|  Myb domain protein 61, putative isoform 2        74.3    4e-11   
ref|XP_009148252.1|  PREDICTED: transcription repressor MYB6-like     73.6    4e-11   
ref|XP_010933337.1|  PREDICTED: myb-related protein Hv1-like          72.0    4e-11   
ref|XP_008783376.1|  PREDICTED: myb-related protein 308-like          72.4    4e-11   
gb|ABD60280.1|  R2R3-MYB transcription factor MYB8                    74.3    4e-11   Pinus taeda
gb|AAS19479.1|  MYB5                                                  71.2    5e-11   Tradescantia fluminensis [spiderwort]
ref|XP_004148106.1|  PREDICTED: transcription factor MYB39-like       72.8    5e-11   
emb|CBI37044.3|  unnamed protein product                              71.2    5e-11   
ref|XP_009396318.1|  PREDICTED: myb-related protein Hv33-like iso...  72.8    5e-11   
ref|XP_003626082.1|  R2R3-MYB transcription factor                    73.6    5e-11   
emb|CBM40481.1|  MYB8 transcription factor                            74.3    5e-11   
ref|XP_009365451.1|  PREDICTED: transcription factor MYB86-like       73.9    5e-11   
ref|XP_002452601.1|  hypothetical protein SORBIDRAFT_04g028850        70.9    5e-11   
gb|KHF99993.1|  Myb-related protein                                   70.9    5e-11   
gb|ADV30321.1|  MYB transcription factor MIXTA-like 1                 72.4    5e-11   
ref|XP_010266817.1|  PREDICTED: myb-related protein 308-like          71.6    5e-11   
ref|XP_010910804.1|  PREDICTED: myb-related protein 308-like          72.0    5e-11   
gb|ADV29944.1|  MYB transcription factor MIXTA-like 5 protein         72.8    5e-11   
emb|CDY45703.1|  BnaCnng13680D                                        72.4    5e-11   
ref|XP_007223871.1|  hypothetical protein PRUPE_ppa010846mg           71.6    6e-11   
ref|XP_006390813.1|  hypothetical protein EUTSA_v10019036mg           72.0    6e-11   
ref|XP_004957488.1|  PREDICTED: myb-related protein Hv1-like          71.6    6e-11   
ref|XP_010490115.1|  PREDICTED: transcription repressor MYB6-like     73.6    6e-11   
ref|NP_001267938.1|  R2R3 MYB 4b transcription factor                 71.6    6e-11   
ref|XP_009366014.1|  PREDICTED: transcription factor MYB86            73.6    6e-11   
ref|XP_010475791.1|  PREDICTED: transcription repressor MYB6-like     73.6    6e-11   
ref|XP_008243345.1|  PREDICTED: transcription repressor MYB4-like     71.6    6e-11   
emb|CDO96923.1|  unnamed protein product                              72.0    6e-11   
ref|XP_010556667.1|  PREDICTED: transcription repressor MYB6          73.2    6e-11   
ref|XP_006392397.1|  hypothetical protein EUTSA_v10023601mg           72.8    6e-11   
ref|XP_006663259.1|  PREDICTED: myb-related protein 330-like          72.0    6e-11   
ref|XP_010265977.1|  PREDICTED: myb-related protein 308-like          71.6    6e-11   
gb|ADL18407.1|  P1 transcription factor                               72.0    6e-11   
ref|XP_008459176.1|  PREDICTED: myb-related protein Hv1-like          72.8    6e-11   
gb|AFM91083.1|  myb-like transcription factor 2                       70.9    6e-11   
ref|XP_010458241.1|  PREDICTED: transcription repressor MYB6-like     73.2    6e-11   
gb|ADV29945.1|  MYB transcription factor MIXTA-like 5 protein         72.8    6e-11   
ref|XP_002960723.1|  hypothetical protein SELMODRAFT_437219           72.8    6e-11   
ref|NP_001234300.1|  myb-related transcription factor                 72.0    6e-11   
ref|XP_006305129.1|  hypothetical protein CARUB_v10009497mg           73.2    6e-11   
gb|AGT17220.1|  myb domain protein 4                                  72.0    6e-11   
ref|NP_001105949.1|  transcription factor MYB31                       72.0    6e-11   
gb|AFM91071.1|  myb-like transcription factor 2                       70.9    6e-11   
ref|XP_009414444.1|  PREDICTED: myb-related protein Zm38-like         71.2    6e-11   
gb|ABK25487.1|  unknown                                               71.6    7e-11   
ref|XP_003623894.1|  MYB transcription factor                         72.4    7e-11   
gb|AGD80138.1|  mixta                                                 72.4    7e-11   
emb|CDX81168.1|  BnaC03g04220D                                        72.8    7e-11   
ref|XP_009104296.1|  PREDICTED: protein ODORANT1-like                 72.0    7e-11   
gb|ACF83817.1|  unknown                                               72.0    7e-11   
ref|XP_006856762.1|  hypothetical protein AMTR_s00055p00057500        71.2    7e-11   
ref|XP_002462743.1|  hypothetical protein SORBIDRAFT_02g031190        72.0    7e-11   
gb|AHI18155.1|  Mixta                                                 72.0    7e-11   
ref|XP_009418701.1|  PREDICTED: myb-related protein Zm38-like         70.9    7e-11   
emb|CDY31082.1|  BnaA08g26320D                                        72.8    7e-11   
gb|AHI18157.1|  Mixta                                                 72.0    7e-11   
ref|XP_010522861.1|  PREDICTED: transcription repressor MYB6-like     72.8    7e-11   
ref|XP_004956764.1|  PREDICTED: myb-related protein 315-like          71.6    7e-11   
gb|AGD80142.1|  mixta                                                 72.0    7e-11   
ref|XP_008653572.1|  PREDICTED: myb-related protein Hv1 isoform X1    71.6    8e-11   
ref|XP_010480292.1|  PREDICTED: transcription factor MYB86-like       72.4    8e-11   
gb|AIE54279.1|  transcription factor                                  71.6    8e-11   
ref|XP_006302609.1|  hypothetical protein CARUB_v10020714mg           72.4    8e-11   
emb|CDX78374.1|  BnaA03g02860D                                        72.8    8e-11   
ref|XP_008653573.1|  PREDICTED: myb-related protein Hv1 isoform X2    71.6    8e-11   
ref|XP_009631098.1|  PREDICTED: myb-related protein 308-like          71.6    8e-11   
ref|XP_010061981.1|  PREDICTED: transcription repressor MYB6          72.4    8e-11   
gb|EYU22401.1|  hypothetical protein MIMGU_mgv1a023545mg              73.2    8e-11   
ref|XP_010312447.1|  PREDICTED: myb-related transcription factor ...  72.4    8e-11   
ref|XP_009131150.1|  PREDICTED: transcription factor MYB39-like       72.8    8e-11   
ref|XP_009357784.1|  PREDICTED: myb-related protein 308-like          71.2    8e-11   
gb|AEG64799.1|  R2R3 MYB transcriptional factor                       71.2    8e-11   
ref|XP_009396317.1|  PREDICTED: myb-related protein Hv33-like iso...  72.8    8e-11   
gb|KDP23325.1|  hypothetical protein JCGZ_23158                       73.2    8e-11   
gb|AEI83426.1|  transcription factor R2R3-MYB2                        70.9    8e-11   
ref|XP_010035368.1|  PREDICTED: transcription factor MYB86-like       73.2    9e-11   
ref|XP_008352913.1|  PREDICTED: myb-related protein 308-like          71.2    9e-11   
ref|XP_003591261.1|  R2R3-MYB transcription factor                    72.8    9e-11   
ref|XP_011043175.1|  PREDICTED: myb-related protein 308-like          71.2    9e-11   
emb|CDY58788.1|  BnaA07g38030D                                        71.6    9e-11   
ref|XP_006660900.1|  PREDICTED: myb-related protein Hv1-like          71.2    9e-11   
ref|NP_172425.2|  myb domain protein 61                               72.8    9e-11   
ref|XP_010088130.1|  Transcription factor                             72.8    9e-11   
ref|XP_010066635.1|  PREDICTED: myb-related protein 308-like          70.9    9e-11   
ref|XP_006423960.1|  hypothetical protein CICLE_v10028398mg           73.2    9e-11   
ref|XP_010914802.1|  PREDICTED: myb-related protein Myb4-like         73.2    9e-11   
ref|XP_003618988.1|  Myb-like transcription factor                    72.0    9e-11   
ref|NP_001131856.1|  uncharacterized protein LOC100193234             71.2    9e-11   
gb|AGS48990.1|  R2R3 MYB transcription factor 39                      70.9    9e-11   
ref|XP_006289596.1|  hypothetical protein CARUB_v10003148mg           72.4    9e-11   
ref|XP_008808618.1|  PREDICTED: myb-related protein Hv1               70.9    1e-10   
gb|AAN28271.1|  myb-like transcription factor 1                       71.2    1e-10   
ref|XP_007163255.1|  hypothetical protein PHAVU_001G219000g           72.8    1e-10   
gb|AAC33214.1|  Putative transcription factor                         72.8    1e-10   
ref|XP_006396364.1|  hypothetical protein EUTSA_v10028778mg           72.4    1e-10   
gb|AAN28273.1|  myb-like transcription factor 1                       71.2    1e-10   
gb|AHX24372.1|  R2R3-MYB anthocyanin repressor                        70.1    1e-10   
gb|AGD80141.1|  mixta                                                 71.6    1e-10   
gb|KHN20933.1|  Transcription repressor MYB4-like protein             70.5    1e-10   
gb|ABR25756.1|  myb related protein hv1                               70.9    1e-10   
gb|AGN52100.1|  MYB-related transcription factor                      70.9    1e-10   
gb|ADG46002.1|  MYB4                                                  70.9    1e-10   
gb|AHN60122.1|  MYB transcription factor 16                           72.0    1e-10   
ref|XP_006840401.1|  hypothetical protein AMTR_s00045p00146180        72.8    1e-10   
ref|XP_002889757.1|  hypothetical protein ARALYDRAFT_888197           72.4    1e-10   
gb|KHN42917.1|  Transcription factor MYB39                            70.5    1e-10   
gb|EAY82442.1|  hypothetical protein OsI_37656                        70.5    1e-10   
gb|AAN28272.1|  myb-like transcription factor 1                       71.2    1e-10   
ref|XP_010053687.1|  PREDICTED: myb-related protein 308               71.6    1e-10   
dbj|BAM71804.1|  R2R3-MYB transcription factor                        71.2    1e-10   
ref|XP_009414620.1|  PREDICTED: myb-related protein 308-like          70.9    1e-10   
ref|XP_010941310.1|  PREDICTED: myb-related protein Hv1-like          70.5    1e-10   
gb|AJD79907.1|  MYB1                                                  71.2    1e-10   
ref|NP_001063796.1|  Os09g0538400                                     70.9    1e-10   
ref|XP_011039057.1|  PREDICTED: transcription factor MYB86-like       72.8    1e-10   
ref|XP_006382251.1|  myb family transcription factor family protein   72.8    1e-10   
gb|AAN28270.1|  myb-like transcription factor 1                       71.6    1e-10   
gb|AAZ20432.1|  MYB13                                                 72.0    1e-10   
ref|XP_010043353.1|  PREDICTED: transcription repressor MYB4-like     72.8    1e-10   
gb|AIS35922.1|  MYB transcription factor 5                            69.7    1e-10   
ref|XP_004147038.1|  PREDICTED: myb-related protein 308-like          70.9    1e-10   
ref|XP_011087570.1|  PREDICTED: transcription factor MYB86-like       72.8    1e-10   
ref|XP_008246332.1|  PREDICTED: transcription factor MYB86-like       72.8    1e-10   
gb|AAK19619.1|AF336286_1  GHMYB9                                      70.9    1e-10   
gb|AGD80143.1|  mixta                                                 71.2    1e-10   
dbj|BAJ99931.1|  predicted protein                                    70.9    1e-10   
gb|AHZ96969.1|  MYB transcription factor 83                           69.3    1e-10   
ref|XP_010511327.1|  PREDICTED: transcription factor MYB86-like       71.6    1e-10   
ref|XP_006417564.1|  hypothetical protein EUTSA_v10008000mg           72.4    1e-10   
ref|XP_006653483.1|  PREDICTED: transcription factor MYB39-like       70.9    1e-10   
ref|XP_002302702.1|  hypothetical protein POPTR_0002s18700g           72.8    1e-10   
emb|CAA50221.1|  MybHv5                                               70.9    1e-10   
ref|XP_010922920.1|  PREDICTED: myb-related protein Hv33-like         71.6    1e-10   
gb|AGD80147.1|  mixta-like 3 protein                                  70.1    1e-10   
ref|XP_004133870.1|  PREDICTED: transcription repressor MYB6-like     71.6    1e-10   
ref|XP_011097799.1|  PREDICTED: transcription factor MYB29            71.2    1e-10   
ref|XP_010498280.1|  PREDICTED: transcription factor MYB28-like       70.5    1e-10   
dbj|BAJ89618.1|  predicted protein                                    70.5    2e-10   
emb|CDX89106.1|  BnaA04g00800D                                        71.2    2e-10   
gb|AAA33067.1|  MYB1                                                  71.2    2e-10   
ref|XP_009138782.1|  PREDICTED: myb-related protein Myb4-like iso...  71.2    2e-10   
ref|XP_010530893.1|  PREDICTED: transcription factor MYB32-like       70.9    2e-10   
gb|KHM99706.1|  Myb-related protein 308                               69.7    2e-10   
gb|AGD80146.1|  mixta-like 3 protein                                  70.1    2e-10   
ref|XP_004961985.1|  PREDICTED: myb-related protein Hv1-like          70.9    2e-10   
ref|XP_009138781.1|  PREDICTED: myb-related protein Myb4-like iso...  71.2    2e-10   
emb|CDY50901.1|  BnaCnng19930D                                        71.2    2e-10   
ref|XP_004956767.1|  PREDICTED: protein ODORANT1-like                 70.9    2e-10   
gb|AGN52045.1|  MYB-related transcription factor                      71.6    2e-10   
gb|ACJ84718.1|  unknown                                               70.9    2e-10   
ref|XP_011047816.1|  PREDICTED: protein ODORANT1-like                 72.0    2e-10   
gb|KFK43255.1|  hypothetical protein AALP_AA1G100100                  72.0    2e-10   
ref|XP_010459510.1|  PREDICTED: transcription factor MYB34-like       70.5    2e-10   
ref|XP_008377747.1|  PREDICTED: myb-related protein 308-like          70.5    2e-10   
ref|XP_003607200.1|  Myb-like transcription factor                    70.9    2e-10   
gb|AGO03569.1|  MIXTA-like 5                                          72.0    2e-10   
gb|EMT03036.1|  Myb-related protein Pp2                               70.1    2e-10   
gb|AHI18178.1|  Mixta-like3                                           70.1    2e-10   
tpg|DAA56596.1|  TPA: putative MYB DNA-binding domain superfamily...  71.6    2e-10   
gb|AHI18156.1|  Mixta                                                 70.9    2e-10   
ref|XP_009417090.1|  PREDICTED: myb-related protein Hv33-like         71.2    2e-10   
ref|XP_010546780.1|  PREDICTED: transcription factor MYB86            71.6    2e-10   
ref|XP_003559914.1|  PREDICTED: myb-related protein Hv33-like         71.2    2e-10   
ref|XP_010498279.1|  PREDICTED: transcription factor MYB34-like       70.5    2e-10   
ref|XP_004505789.1|  PREDICTED: myb-related protein 308-like          70.9    2e-10   
gb|AHG99473.1|  MYB16                                                 70.5    2e-10   
gb|ABK26515.1|  unknown                                               71.6    2e-10   
gb|ABH02902.1|  MYB transcription factor MYB179                       69.7    2e-10   
ref|XP_008791156.1|  PREDICTED: myb-related protein Hv33-like         71.2    2e-10   
gb|AIS35924.1|  MYB transcription factor 7                            70.1    2e-10   
gb|KDP34830.1|  hypothetical protein JCGZ_11192                       70.9    2e-10   
gb|AGD80151.1|  mixta-like 2.2 protein                                71.2    2e-10   
ref|XP_008439352.1|  PREDICTED: transcription factor MYB34-like       71.6    2e-10   
ref|XP_010525304.1|  PREDICTED: protein ODORANT1-like                 68.9    2e-10   
ref|NP_177259.1|  putative myb family transcription factor            69.3    2e-10   
ref|XP_003578527.1|  PREDICTED: myb-related protein Hv1               70.1    2e-10   
gb|AAO49419.1|AF485901_1  MYB10                                       69.7    2e-10   
ref|XP_008657016.1|  PREDICTED: myb-related protein 308               70.1    2e-10   
ref|NP_001176813.1|  Os12g0175400                                     70.5    2e-10   
ref|XP_002887540.1|  hypothetical protein ARALYDRAFT_476577           70.1    2e-10   
gb|AGN52028.1|  MYB-related transcription factor                      72.0    2e-10   
ref|XP_007131703.1|  hypothetical protein PHAVU_011G034900g           70.1    2e-10   
ref|XP_004231034.1|  PREDICTED: myb-related protein 308-like          70.1    2e-10   
gb|AHN60129.1|  MYB transcription factor 61                           71.2    2e-10   
ref|XP_011092988.1|  PREDICTED: myb-related protein 308-like          70.5    2e-10   
ref|XP_006344224.1|  PREDICTED: transcription factor MYB3-like        68.9    2e-10   
ref|XP_010528356.1|  PREDICTED: transcription factor MYB32-like       71.2    2e-10   
gb|AHI18172.1|  Mixta-like2                                           71.2    2e-10   
ref|XP_010240823.1|  PREDICTED: transcription factor MYB29            72.0    2e-10   
ref|XP_003621270.1|  MYB transcription factor                         70.9    2e-10   
gb|AGD80152.1|  mixta-like 2 protein                                  71.2    2e-10   
ref|XP_009418467.1|  PREDICTED: myb-related protein Hv33-like         71.2    2e-10   
ref|NP_176068.1|  myb domain protein 50                               71.2    2e-10   
ref|XP_003601199.1|  MYB transcription factor MYB160                  71.6    2e-10   
ref|XP_009804432.1|  PREDICTED: myb-related protein 308-like          70.1    2e-10   
ref|XP_004144840.1|  PREDICTED: myb-related protein 308-like          70.1    2e-10   
ref|XP_006383085.1|  hypothetical protein POPTR_0005s11410g           70.1    2e-10   
emb|CAA55725.1|  mixta                                                71.2    2e-10   
ref|XP_004495813.1|  PREDICTED: transcription factor MYB86-like       71.6    2e-10   
ref|XP_006434585.1|  hypothetical protein CICLE_v10002068mg           70.5    2e-10   
gb|AID23891.1|  R2R3-MYB                                              70.1    2e-10   
ref|XP_004977234.1|  PREDICTED: myb-related protein Zm38-like         69.3    2e-10   
gb|AGD80158.1|  mixta-like 2 protein                                  70.9    2e-10   
ref|XP_010070106.1|  PREDICTED: transcription factor MYB86-like       72.0    2e-10   
gb|KHN26209.1|  Transcription factor MYB86                            71.6    2e-10   
gb|ACT82838.1|  transcription factor MYB047                           69.3    2e-10   
ref|XP_008775654.1|  PREDICTED: transcription factor MYB86-like       71.6    2e-10   
ref|XP_006364618.1|  PREDICTED: protein ODORANT1-like                 70.9    2e-10   
ref|XP_006359691.1|  PREDICTED: myb-related protein 308-like          70.1    2e-10   
gb|AEV91152.1|  R2R3-MYB protein                                      70.1    2e-10   
ref|XP_006473170.1|  PREDICTED: myb-related protein 330-like          70.5    2e-10   
ref|XP_009418831.1|  PREDICTED: myb-related protein 308-like          69.7    2e-10   
ref|XP_010456465.1|  PREDICTED: transcription repressor MYB6-like     70.1    2e-10   
gb|ACN12955.1|  R2R3-MYB transcription factor MYB18                   69.3    2e-10   
ref|XP_007046021.1|  Myb domain protein 106, putative                 70.9    2e-10   
gb|KHG07216.1|  Myb-related protein                                   69.7    2e-10   
gb|KDP22654.1|  hypothetical protein JCGZ_02496                       69.7    2e-10   
ref|XP_004297358.1|  PREDICTED: transcription repressor MYB4-like     70.1    2e-10   
ref|XP_008807932.1|  PREDICTED: myb-related protein Hv33-like         71.6    2e-10   
ref|XP_010459511.1|  PREDICTED: transcription repressor MYB6-like     70.1    2e-10   
emb|CAA92280.1|  myb-related transcription factor                     69.3    2e-10   
gb|ACU19175.1|  unknown                                               69.7    2e-10   
ref|XP_002321627.1|  hypothetical protein POPTR_0015s09430g           71.6    2e-10   
ref|NP_001060383.2|  Os07g0634900                                     68.9    3e-10   
ref|XP_008799190.1|  PREDICTED: myb-related protein 308-like          70.1    3e-10   
ref|NP_001235092.1|  transcription factor MYBZ2                       69.7    3e-10   
ref|XP_006378038.1|  hypothetical protein POPTR_0010s00690g           70.1    3e-10   
ref|XP_003555168.1|  PREDICTED: transcription factor MYB86 isofor...  71.6    3e-10   
ref|XP_004289866.1|  PREDICTED: myb-related protein 308-like          70.1    3e-10   



>ref|XP_004236519.1| PREDICTED: transcription factor MYB34 [Solanum lycopersicum]
Length=355

 Score =   187 bits (476),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 150/310 (48%), Positives = 185/310 (60%), Gaps = 52/310 (17%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            +QD+F+PQEEELIIKLHATIGSRW+IIAQQL GRTDNDVKNLWNTKLKKKLSAMGIDPVT
Sbjct  69   KQDSFTPQEEELIIKLHATIGSRWSIIAQQLAGRTDNDVKNLWNTKLKKKLSAMGIDPVT  128

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQ------------KLS  344
            HKPFSQIL DYGNIGGFP + +R   F +LNR LK    MS   Q             L 
Sbjct  129  HKPFSQILTDYGNIGGFPKARTR---FVSLNRELKGA-FMSRPEQLQHSLQNFQNFNSLC  184

Query  345  ADQPSSRAAADCCFLHTTTNKIKSSEEDDSNQY---MDLLSELQAIKSITESTNYSSAAA  515
               P + A+ +C F         S+ +D SN     +DL SELQAIK +TE++NY+S  A
Sbjct  185  VKLPKTEASEECFF---------SNNQDSSNINQPPVDLFSELQAIKFVTEASNYNSPKA  235

Query  516  PDS---TIVVsppsslssltsplaaaaaaQEKAGFSWCDDFLLEDAFLPLNNVQQ-----  671
              S     +    +S    +S  ++A+ +      +WC D+LL+D FLP N   Q     
Sbjct  236  VFSHNPNPITDCSTSSPLSSSSSSSASHSLADNQVNWC-DYLLDDEFLPSNFKAQEDTLT  294

Query  672  ------SSDWEPNHNNNTSPQDIIKIssspsssnsnleaassssFVEAMLSREDHDMFLD  833
                      E   NN  S +D          ++ + +  SSSSFVEAML  E+ DMFL+
Sbjct  295  IEEKLVCGGAEDGSNNVPSTKDF--------ENSLSTKGTSSSSFVEAMLECEN-DMFLN  345

Query  834  FPGLSEEPFY  863
            FPGLSE+PFY
Sbjct  346  FPGLSEDPFY  355



>ref|XP_006344977.1| PREDICTED: myb-related protein 330-like isoform X1 [Solanum tuberosum]
Length=347

 Score =   185 bits (469),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 146/310 (47%), Positives = 181/310 (58%), Gaps = 55/310 (18%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            +QD+F+PQEEELIIKLHATIGSRW+IIAQQL GRTDNDVKNLWNTKLKKKLSAMGIDPVT
Sbjct  64   KQDSFTPQEEELIIKLHATIGSRWSIIAQQLAGRTDNDVKNLWNTKLKKKLSAMGIDPVT  123

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQ------------KLS  344
            HKPFSQIL DYGNIGGFP + +R   F +LNR LK    MS   Q             L 
Sbjct  124  HKPFSQILTDYGNIGGFPKARTR---FVSLNRELKGAF-MSRPEQLQHSLQNFQNFNSLC  179

Query  345  ADQPSSRAAADCCFLHTTTNKIKSSEEDDSNQY---MDLLSELQAIKSITESTNYSSAAA  515
               P + A+ +C F         S+ +D SN     +DL SELQAIK +TE++NY+   A
Sbjct  180  VKLPKTEASEECFF---------SNNQDSSNINQPPVDLFSELQAIKFVTEASNYNYPKA  230

Query  516  PDS---TIVVsppsslssltsplaaaaaaQEKAGFSWCDDFLLEDAFLPLNNVQQ-----  671
              S     +    +S    +S  ++A+ +  +   +WCD +LL+DAFLP N   Q     
Sbjct  231  VFSHHPIPITDCSTSSPLSSSSSSSASHSLAENQVNWCD-YLLDDAFLPSNFKDQEDTLT  289

Query  672  ------SSDWEPNHNNNTSPQDIIKIssspsssnsnleaassssFVEAMLSREDHDMFLD  833
                      E   NN  S +D                +   +SFVEAML  E+ +MFL+
Sbjct  290  IEEKLVCGGGEDGSNNVPSMKDF-----------ETSLSTKGTSFVEAMLECEN-EMFLN  337

Query  834  FPGLSEEPFY  863
            FPGLSE+PFY
Sbjct  338  FPGLSEDPFY  347



>ref|XP_006344978.1| PREDICTED: myb-related protein 330-like isoform X2 [Solanum tuberosum]
Length=317

 Score =   179 bits (454),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 141/298 (47%), Positives = 175/298 (59%), Gaps = 61/298 (20%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            +QD+F+PQEEELIIKLHATIGSRW+IIAQQL GRTDNDVKNLWNTKLKKKLSAMGIDPVT
Sbjct  64   KQDSFTPQEEELIIKLHATIGSRWSIIAQQLAGRTDNDVKNLWNTKLKKKLSAMGIDPVT  123

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSADQPSSRAAADC  380
            HKPFSQIL DYGNIGGFP + +R   F +LNR LK                    A+ +C
Sbjct  124  HKPFSQILTDYGNIGGFPKARTR---FVSLNRELK-------------------EASEEC  161

Query  381  CFLHTTTNKIKSSEEDDSNQY---MDLLSELQAIKSITESTNYSSAAAPDS---TIVVsp  542
             F         S+ +D SN     +DL SELQAIK +TE++NY+   A  S     +   
Sbjct  162  FF---------SNNQDSSNINQPPVDLFSELQAIKFVTEASNYNYPKAVFSHHPIPITDC  212

Query  543  psslssltsplaaaaaaQEKAGFSWCDDFLLEDAFLPLNNVQQ-----------SSDWEP  689
             +S    +S  ++A+ +  +   +WCD +LL+DAFLP N   Q               E 
Sbjct  213  STSSPLSSSSSSSASHSLAENQVNWCD-YLLDDAFLPSNFKDQEDTLTIEEKLVCGGGED  271

Query  690  NHNNNTSPQDIIKIssspsssnsnleaassssFVEAMLSREDHDMFLDFPGLSEEPFY  863
              NN  S +D                +   +SFVEAML  E+ +MFL+FPGLSE+PFY
Sbjct  272  GSNNVPSMKDF-----------ETSLSTKGTSFVEAMLECEN-EMFLNFPGLSEDPFY  317



>ref|XP_010663429.1| PREDICTED: myb-related protein 315 isoform X2 [Vitis vinifera]
Length=337

 Score =   177 bits (448),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 135/294 (46%), Positives = 182/294 (62%), Gaps = 34/294 (12%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + ++F+PQEEELI++LHATIGSRW+IIAQQLPGRTDNDVKN WNTKL+KKLS MGIDP+T
Sbjct  66   KHESFTPQEEELIVRLHATIGSRWSIIAQQLPGRTDNDVKNYWNTKLRKKLSEMGIDPIT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSS-KSQKLSADQPSSRAAAD  377
            HKPFSQILADYGNIGG P + +R    G+L R LK  +++ S +S  +++++ S   AA 
Sbjct  126  HKPFSQILADYGNIGGLPKNGTR---IGSLTRDLKNALMLKSDQSSAITSEEFSKPEAAQ  182

Query  378  CCFLHTTTNKIKSSEEDDSNQYMDLLSELQAIKSITESTNYSSAAAPDSTIVVsppssls  557
              FL    N          N  M+LL++L+AIK +TE+          S+ +     S  
Sbjct  183  EIFLTNNRN-------SHDNPSMNLLTQLKAIKLVTEA----------SSCIHHGNISSL  225

Query  558  sltsplaaaaaaQEKA--GFSWCDDFLLEDAFLPLNNVQQSS--------DWEPNHNNNT  707
            S  S  +     + K+   FSW  DFLLEDAFL  +  +Q +          EPN +   
Sbjct  226  SSPSSSSTCLTPKAKSLHTFSW-SDFLLEDAFLSSDPQEQENMSKGNLDLQSEPNADGQR  284

Query  708  SPQDIIKIsssp-sssnsnleaassssFVEAMLSREDHDMFLDFPGLSEEPFYY  866
                I +++++  S+  S   ++  SSF+EAML RE+ DMFL+FP L EEPFYY
Sbjct  285  QVDPIEEMTNTVLSNGASEASSSYDSSFLEAMLDREN-DMFLEFPSLLEEPFYY  337



>ref|XP_007211249.1| hypothetical protein PRUPE_ppa017571mg [Prunus persica]
 gb|EMJ12448.1| hypothetical protein PRUPE_ppa017571mg [Prunus persica]
Length=360

 Score =   177 bits (449),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 138/299 (46%), Positives = 181/299 (61%), Gaps = 21/299 (7%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + ++F+P EEELI++LHATIGSRW IIAQQLPGRTD DVKN WNTKLKKKLS MGID VT
Sbjct  66   KHESFTPHEEELIVRLHATIGSRWPIIAQQLPGRTDKDVKNYWNTKLKKKLSEMGIDHVT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSADQPSSRAAADC  380
            HKPFSQILADYGNIGG P +  R    G+LN+ LK  I+M  +     + Q  S   +  
Sbjct  126  HKPFSQILADYGNIGGLPKAGMR-MAIGSLNKDLKNAILMKPELPYSLSTQGFSNINSHL  184

Query  381  CFLHTTTNKIKS------SEEDDSNQYMDLLSELQAIKSITESTNYSSAAAPDSTIVVsp  542
              +     K++       S    SNQ  DLL++LQAI+ +TE++N ++  +    + +  
Sbjct  185  MPMTMIPIKMEPIQDSFLSNAQSSNQPFDLLTQLQAIRLVTEASNSTNLESSPPNLYI-H  243

Query  543  psslssltsplaaaaaaQEKA---GFSWCDDFLLEDAFLPLNNVQQSSDWEP-------N  692
              +LSS  S    ++AAQE+A    FSW  DFLLEDAF P ++ Q+  D          N
Sbjct  244  EGTLSSSPSSSTCSSAAQEQATLQAFSW-SDFLLEDAFFPTSDAQEHEDKAEHSSMDMLN  302

Query  693  HNNNTSPQDIIKIssspsssnsnleaa-ssssFVEAMLSREDHDMFLDFPGLSEEPFYY  866
             +    PQ  I+  +     N     +   SSFVEAM++RE+ +MFL+FP L EEPFYY
Sbjct  303  QSKAAIPQSQIEDQAGMQKYNEVEATSPCDSSFVEAMVAREN-EMFLEFPQLMEEPFYY  360



>ref|XP_010663428.1| PREDICTED: myb-related protein 315 isoform X1 [Vitis vinifera]
Length=347

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 135/294 (46%), Positives = 182/294 (62%), Gaps = 34/294 (12%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + ++F+PQEEELI++LHATIGSRW+IIAQQLPGRTDNDVKN WNTKL+KKLS MGIDP+T
Sbjct  76   KHESFTPQEEELIVRLHATIGSRWSIIAQQLPGRTDNDVKNYWNTKLRKKLSEMGIDPIT  135

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSS-KSQKLSADQPSSRAAAD  377
            HKPFSQILADYGNIGG P + +R    G+L R LK  +++ S +S  +++++ S   AA 
Sbjct  136  HKPFSQILADYGNIGGLPKNGTR---IGSLTRDLKNALMLKSDQSSAITSEEFSKPEAAQ  192

Query  378  CCFLHTTTNKIKSSEEDDSNQYMDLLSELQAIKSITESTNYSSAAAPDSTIVVsppssls  557
              FL    N          N  M+LL++L+AIK +TE+          S+ +     S  
Sbjct  193  EIFLTNNRN-------SHDNPSMNLLTQLKAIKLVTEA----------SSCIHHGNISSL  235

Query  558  sltsplaaaaaaQEKA--GFSWCDDFLLEDAFLPLNNVQQSS--------DWEPNHNNNT  707
            S  S  +     + K+   FSW  DFLLEDAFL  +  +Q +          EPN +   
Sbjct  236  SSPSSSSTCLTPKAKSLHTFSW-SDFLLEDAFLSSDPQEQENMSKGNLDLQSEPNADGQR  294

Query  708  SPQDIIKIsssp-sssnsnleaassssFVEAMLSREDHDMFLDFPGLSEEPFYY  866
                I +++++  S+  S   ++  SSF+EAML RE+ DMFL+FP L EEPFYY
Sbjct  295  QVDPIEEMTNTVLSNGASEASSSYDSSFLEAMLDREN-DMFLEFPSLLEEPFYY  347



>ref|XP_008239671.1| PREDICTED: transcription factor MYB51 [Prunus mume]
 ref|XP_008239672.1| PREDICTED: transcription factor MYB51 [Prunus mume]
Length=360

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 143/302 (47%), Positives = 182/302 (60%), Gaps = 27/302 (9%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + ++F+P EEELI++LHATIGSRW IIAQQLPGRTD DVKN WNTKLKKKLS MGID VT
Sbjct  66   KHESFTPHEEELIVRLHATIGSRWPIIAQQLPGRTDKDVKNYWNTKLKKKLSEMGIDHVT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSK-SQKLSADQPSSRAAAD  377
            HKPFSQILADYGNIGG P +  R    G+LN+ LK  I+M  +    LS    SS    +
Sbjct  126  HKPFSQILADYGNIGGLPKAGMR-MAIGSLNKDLKNAILMKPELPYSLSTHGFSS---IN  181

Query  378  CCFLHTTTNKIKS--------SEEDDSNQYMDLLSELQAIKSITESTNYSSAAAPDSTIV  533
               +  T   IK         S    SNQ  DLL++LQAI+ +TE++N ++  +    + 
Sbjct  182  SHLMPMTMTPIKREPIQDGFLSNAQSSNQPFDLLTQLQAIRLVTEASNSTNIESSPPNLY  241

Query  534  VsppsslssltsplaaaaaaQEKA---GFSWCDDFLLEDAFLPLNNVQQSSDWEP-----  689
            + P  +LSS  S    ++AAQE+A    FSW  DFLLEDAF P  + Q+  D        
Sbjct  242  I-PEGTLSSSPSSSTCSSAAQEQATLQAFSW-SDFLLEDAFFPTCDAQEHEDKAEHSSMD  299

Query  690  --NHNNNTSPQDIIKIssspsssnsnleaa-ssssFVEAMLSREDHDMFLDFPGLSEEPF  860
              N +    PQ  I+  +     N     +   SSFVEAM++RE+ +MFL+FP L EEPF
Sbjct  300  MLNQSKAAIPQSQIEDQAGMQKYNEVEATSPCDSSFVEAMVAREN-EMFLEFPQLMEEPF  358

Query  861  YY  866
            YY
Sbjct  359  YY  360



>ref|XP_009800479.1| PREDICTED: myb-related protein 315-like [Nicotiana sylvestris]
Length=350

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 143/300 (48%), Positives = 187/300 (62%), Gaps = 34/300 (11%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            ++D+F+PQEEELIIKLHATIGSRW+IIAQQ+PGRTDN+VK+LWNTKLKKKLSAMGIDPVT
Sbjct  66   KEDSFTPQEEELIIKLHATIGSRWSIIAQQIPGRTDNEVKSLWNTKLKKKLSAMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSADQPSSRAAADC  380
            HKPFSQIL DYGNIGGFP + +R   F +LNR LK    MS+  Q     +      + C
Sbjct  126  HKPFSQILTDYGNIGGFPKARTR---FVSLNRELKGA-FMSTPEQLQHPLERFPNFNSHC  181

Query  381  CFLHTTTNKIKSSEEDD----SNQY--------MDLLSELQAIKSITESTNYSSAAAPDS  524
                 TT +++ +E  +    SN Y        +DLLSELQAI+ +TE++N +S  A  S
Sbjct  182  ----VTTIRLQKTETSEDCFLSNNYDCSNNQPPVDLLSELQAIQFVTEASNNNSPKAIFS  237

Query  525  TI--VVsppsslssltsplaaaaaaQEKAGFSWCDDFLLEDAFL--PLN---NVQQSSDW  683
                +     S    +S  ++A+ +  K   +WC D+LL+DAF    LN    +   +  
Sbjct  238  YTNPITDCSLSSPLSSSSSSSASHSLTKNHVNWC-DYLLDDAFQEDTLNIEEKLVSGAAQ  296

Query  684  EPNHNNNTSPQDIIKIssspsssnsnleaassssFVEAMLSREDHDMFLDFPGLSEEPFY  863
            E   NN  + +D        + S      +SSSSFVEAML  E+ +MFL+FPGLSE+PFY
Sbjct  297  EYRQNNAPTMEDF-----EATLSIKVTSPSSSSSFVEAMLECEN-EMFLNFPGLSEDPFY  350



>emb|CAN75378.1| hypothetical protein VITISV_027593 [Vitis vinifera]
Length=337

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 134/294 (46%), Positives = 181/294 (62%), Gaps = 34/294 (12%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + ++F+PQEEELI++LHATIGSRW+IIAQQLPGRTDNDVKN WNTKL+KKLS MGIDP+T
Sbjct  66   KHESFTPQEEELIVRLHATIGSRWSIIAQQLPGRTDNDVKNYWNTKLRKKLSEMGIDPIT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSS-KSQKLSADQPSSRAAAD  377
            HKPFSQILADYGNIGG P + +R    G+L R LK  +++ S +S  +++++ S   AA 
Sbjct  126  HKPFSQILADYGNIGGLPKNGTR---IGSLTRDLKNALMLKSDQSSAITSEEFSKPEAAQ  182

Query  378  CCFLHTTTNKIKSSEEDDSNQYMDLLSELQAIKSITESTNYSSAAAPDSTIVVsppssls  557
              FL    N          N  M+LL++L+AIK +TE+          S+ +     S  
Sbjct  183  EIFLTNNRN-------SHDNPSMNLLTQLKAIKLVTEA----------SSCIHHGNISSL  225

Query  558  sltsplaaaaaaQEKA--GFSWCDDFLLEDAFLPLNNVQQSS--------DWEPNHNNNT  707
            S  S  +     + K+   FSW  DFLLEDAFL  +  +Q +          EPN +   
Sbjct  226  SSPSSSSTCLTPKAKSLHTFSW-SDFLLEDAFLSSDPQEQENMSKGNLDLQSEPNADGQR  284

Query  708  SPQDIIKIsssp-sssnsnleaassssFVEAMLSREDHDMFLDFPGLSEEPFYY  866
                I +++++  S+  S   ++  SSF+EAML RE+ DM L+FP L EEPFYY
Sbjct  285  QVDPIEEMTNTVLSNGASEASSSYDSSFLEAMLDREN-DMLLEFPSLLEEPFYY  337



>emb|CDP14903.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   172 bits (436),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 133/303 (44%), Positives = 179/303 (59%), Gaps = 33/303 (11%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            EQ +F+P+EE+LIIKLHA IGSRW IIAQQLPGRTDNDVKN+WNTKLKKKLSA+GIDPVT
Sbjct  69   EQGSFTPEEEDLIIKLHAAIGSRWPIIAQQLPGRTDNDVKNVWNTKLKKKLSAIGIDPVT  128

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSADQPS-------  359
            H+PFSQILADYGNIGGFP + +R    G L+R +K   ++ S+  +   ++ S       
Sbjct  129  HRPFSQILADYGNIGGFPKARNRS---GCLSRDIKNAFVLKSEQSRGLPERSSHFDSHFG  185

Query  360  ---SRAAADCCFLH--TTTNKIKSSEEDDSNQYMDLLSELQAIKSITESTNYSSAAAPDS  524
               S  A +    H  +  N I ++     +Q ++LLS+LQAI  +TE++ Y++ AA   
Sbjct  186  TTISPLAVEPSKQHFMSNCNHISAAR----SQSLELLSQLQAITMVTEASTYTNTAA---  238

Query  525  TIVVsppsslssltsplaaaaaaQEKAG--FSWCDDFLLEDAFLPLNNVQQSSD------  680
             I     SS +S +     +A  Q  A   FSWCD FLLEDAF+P   +++  +      
Sbjct  239  QIPAECYSSSASSSPESPPSATNQAAASPSFSWCD-FLLEDAFVPTTYIEEKENEMKLPP  297

Query  681  -WEPNHNNNTSPQDIIKIssspsssnsnleaassssFVEAMLSREDHDMFLDFPGLSEEP  857
             ++P            +     S+      + S  SFVEAML  E+  M  DF GL E+P
Sbjct  298  SYDPKSKEMKLSVAAAEEEVDISAKTVEASSISCGSFVEAMLEGEN-GMLSDFHGLLEDP  356

Query  858  FYY  866
            F+Y
Sbjct  357  FFY  359



>ref|XP_009631987.1| PREDICTED: myb-related protein 315 [Nicotiana tomentosiformis]
Length=355

 Score =   172 bits (436),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 141/307 (46%), Positives = 184/307 (60%), Gaps = 43/307 (14%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            ++D+F+ QEEELIIKLHATIGSRW+IIAQQ+PGRTDN+VKNLWNTKLKKKLSAMGIDPVT
Sbjct  66   KEDSFTHQEEELIIKLHATIGSRWSIIAQQIPGRTDNEVKNLWNTKLKKKLSAMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSADQPSSRAAADC  380
            HKPFSQIL DYGNIGGFP + +R   F +LNR LK    MS+  Q     +      + C
Sbjct  126  HKPFSQILTDYGNIGGFPKARTR---FVSLNRELKGAF-MSTPEQLQHPLERFPNFNSHC  181

Query  381  CFLHTTTNKIKSSEEDD----SNQY--------MDLLSELQAIKSITESTNYSSAAAPDS  524
                 TT +++ +E  +    SN Y        +DLLSELQAIK +TE++N +S  A  S
Sbjct  182  ----VTTIRLQKTETSEDCFLSNNYDSSNNQPPVDLLSELQAIKFVTEASNNNSPKAIFS  237

Query  525  TI--VVsppsslssltsplaaaaaaQEKAGFSWCDDFLLEDAFLPLNNVQQ---------  671
                +     S    +S  ++A+ +      +WCD +LL+D  LP N  +Q         
Sbjct  238  YTNPITDCSLSSPLSSSSSSSASHSLTSNQVNWCD-YLLDDVLLPSNFKEQEETVNIEEK  296

Query  672  ---SSDWEPNHNNNTSPQDIIKIssspsssnsnleaassssFVEAMLSREDHDMFLDFPG  842
                +  E   NN  + +D         ++ S    + SSSFVE ML  E ++MFL+FPG
Sbjct  297  LVSGTAQEYRQNNAPATKDF-------ETTLSTKGTSPSSSFVEDMLECE-YEMFLNFPG  348

Query  843  LSEEPFY  863
            LSE+PFY
Sbjct  349  LSEDPFY  355



>ref|XP_009369384.1| PREDICTED: transcription factor MYB39-like [Pyrus x bretschneideri]
Length=356

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 135/309 (44%), Positives = 176/309 (57%), Gaps = 34/309 (11%)
 Frame = +3

Query  3    HHHHHQEQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAM  182
            H   + + ++F+P EEELI++LHATIGSRW  IAQQLPGRTDNDVKN WNTKLKKKLS M
Sbjct  61   HFKPNLKHESFTPHEEELIVRLHATIGSRWPAIAQQLPGRTDNDVKNYWNTKLKKKLSEM  120

Query  183  GIDPVTHKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSADQPSS  362
            GIDPVTHKPFSQ+LADYGNIGG      R    G+LN+ LK  ++M      L   Q  S
Sbjct  121  GIDPVTHKPFSQVLADYGNIGGVSKVGMR-IGIGSLNKDLKNAMLMKPAEPYLLPAQGFS  179

Query  363  RAAADCCFLHTTTNKIKS------SEEDDSNQYMDLLSELQAIKSITESTNYSSAAAPDS  524
               +    +     K +            S+Q  DLL++LQAIK +TE+   S +    S
Sbjct  180  NINSHLMPITMIPTKAEPILDSFLGHNQPSSQPPDLLTQLQAIKLVTEA---SKSMEFQS  236

Query  525  TIVVsppsslssltsplaaaaaaQEKA---GFSWCDDFLLEDAFLPLNNVQQSSDWEPNH  695
            +         +  +    +++AAQE+A    FSW  DFLLEDAF+P+ + Q+       H
Sbjct  237  SAPYFYSHEGTLSSPSSTSSSAAQEQATLQTFSW-SDFLLEDAFMPIGDTQE-------H  288

Query  696  NNNT--SPQDIIKIssspss----------snsnleaassssFVEAMLSREDHDMFLDFP  839
             N    S ++I +++   S                  A  SSFVEAM+SRE+ +MFL+FP
Sbjct  289  KNKAEYSSKNIAQVAVQQSQIDMDYAISSNEIEATSPACDSSFVEAMVSREN-EMFLEFP  347

Query  840  GLSEEPFYY  866
             L EEPFYY
Sbjct  348  ELLEEPFYY  356



>ref|XP_011071760.1| PREDICTED: myb-related protein 308-like [Sesamum indicum]
Length=315

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 124/286 (43%), Positives = 162/286 (57%), Gaps = 48/286 (17%)
 Frame = +3

Query  30   NFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKP  209
            +F+P+EEEL+I+LHA IGSRW IIAQQLPGRTDNDVK LWN+KL+KKLSAMGIDPVTHKP
Sbjct  71   SFTPEEEELVIQLHAAIGSRWPIIAQQLPGRTDNDVKVLWNSKLRKKLSAMGIDPVTHKP  130

Query  210  FSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSADQPSSRAAADCCFL  389
            FSQILADYGNIG FP + +R   F +L+R LK  I+          DQ    A A     
Sbjct  131  FSQILADYGNIGAFPKARTR---FSSLSRDLKNAIMS-------KPDQSQRHAQASSTPD  180

Query  390  HTTTNKIKSSEEDDSNQYMDLLSELQAIKSITESTNYSSA------AAPDSTIVVsppss  551
            H T++         +N  +DL S+L+AI  ++E++N++S        +P  T+       
Sbjct  181  HHTSS--------SANTTLDLYSQLEAINLVSEASNHASTDTCTRQVSPPLTV-------  225

Query  552  lssltsplaaaaaaQEKAGFSWCDDFLLEDAFLPLNNVQQSSDWEPNHNNNTSPQDIIKI  731
                          QE + FSW  DFLLEDAFLP    +Q +        N     +   
Sbjct  226  -------------NQEVSSFSWS-DFLLEDAFLPSEPDEQENKGIVLQGGNIQGNGVAN-  270

Query  732  ssspsssnsnleaassssFVEAMLSREDHDMFLDFP-GLSEEPFYY  866
             +    +     +++SSSFVEAM+  +D D+F   P    EEPFYY
Sbjct  271  -AMVIKNFEASSSSNSSSFVEAMVDSQDCDVFSQLPAAFYEEPFYY  315



>ref|XP_008346824.1| PREDICTED: transcription factor MYB39-like [Malus domestica]
Length=338

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 136/304 (45%), Positives = 174/304 (57%), Gaps = 36/304 (12%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + ++F+P EEELI++LHATIGSRW  IAQQLPGRTDNDVKN WNTKLKKKLS MGIDPVT
Sbjct  49   KHESFTPHEEELIVRLHATIGSRWPAIAQQLPGRTDNDVKNYWNTKLKKKLSEMGIDPVT  108

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSADQPSSRAAADC  380
            HKPFSQ+L DYGNIGG P    R    G+LN+ LK  ++M      L   Q  S   +  
Sbjct  109  HKPFSQVLXDYGNIGGLPKVGMRI-GIGSLNKDLKNAMLMEPAEPYLLTAQGFSNINSHL  167

Query  381  C---FLHTTTNKIKSS---EEDDSNQYMDLLSELQAIKSITE---STNYSSAAAPDSTIV  533
                 + T    I  S       S+Q  DLL++LQAIK +TE   ST + S+A P+    
Sbjct  168  MPITMIPTKEEPILDSFLGHNQPSSQPPDLLTQLQAIKLVTEASKSTEFQSSA-PN----  222

Query  534  VsppsslssltsplaaaaaaQEKAG---FSWCDDFLLEDAFLPLNNVQQSSDWEPNHNNN  704
                      +    +++AAQE+A    FSW  DFLLEDAF+P+ + Q     E  +   
Sbjct  223  -FYSHEGXLSSPSSTSSSAAQEQATLQTFSW-SDFLLEDAFMPIGDAQ-----EHKNKGE  275

Query  705  TSPQDIIKIssspss----------snsnleaassssFVEAMLSREDHDMFLDFPGLSEE  854
             S ++I +++   S                  A  SSFV AM+S E+ +MFL+FP L EE
Sbjct  276  YSSKNIAQVAVQQSQIDMDYAISSNEVEATSPACDSSFVXAMVSLEN-EMFLEFPELMEE  334

Query  855  PFYY  866
            PFYY
Sbjct  335  PFYY  338



>emb|CBI15301.3| unnamed protein product [Vitis vinifera]
Length=306

 Score =   163 bits (412),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 130/293 (44%), Positives = 168/293 (57%), Gaps = 63/293 (22%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + ++F+PQEEELI++LHATIGSRW+IIAQQLPGRTDNDVKN WNTKL+KKLS MGIDP+T
Sbjct  66   KHESFTPQEEELIVRLHATIGSRWSIIAQQLPGRTDNDVKNYWNTKLRKKLSEMGIDPIT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSADQPSSRAAADC  380
            HKPFSQILADYGNIGG P + +R    G+L R LK  +I          D PS       
Sbjct  126  HKPFSQILADYGNIGGLPKNGTR---IGSLTRDLKNALI---------HDNPS-------  166

Query  381  CFLHTTTNKIKSSEEDDSNQYMDLLSELQAIKSITESTNYSSAAAPDSTIVVsppsslss  560
                                 M+LL++L+AIK +TE+          S+ +     S  S
Sbjct  167  ---------------------MNLLTQLKAIKLVTEA----------SSCIHHGNISSLS  195

Query  561  ltsplaaaaaaQEKA--GFSWCDDFLLEDAFLPLNNVQQSS--------DWEPNHNNNTS  710
              S  +     + K+   FSW  DFLLEDAFL  +  +Q +          EPN +    
Sbjct  196  SPSSSSTCLTPKAKSLHTFSW-SDFLLEDAFLSSDPQEQENMSKGNLDLQSEPNADGQRQ  254

Query  711  PQDIIKIs-sspsssnsnleaassssFVEAMLSREDHDMFLDFPGLSEEPFYY  866
               I +++ +  S+  S   ++  SSF+EAML RE+ DMFL+FP L EEPFYY
Sbjct  255  VDPIEEMTNTVLSNGASEASSSYDSSFLEAMLDREN-DMFLEFPSLLEEPFYY  306



>ref|XP_002318003.2| putative MYB transcription factor family protein [Populus trichocarpa]
 gb|EEE96223.2| putative MYB transcription factor family protein [Populus trichocarpa]
Length=354

 Score =   164 bits (415),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 127/318 (40%), Positives = 166/318 (52%), Gaps = 65/318 (20%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + D+F+PQEEE+II+LHA IGSRW+IIAQQLPGRTDNDVKN WN +L+KKLS MGIDPVT
Sbjct  66   KHDSFTPQEEEMIIRLHAAIGSRWSIIAQQLPGRTDNDVKNYWNARLRKKLSEMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSK-------------SQKL  341
            HKPFS+ILADYGNIGG     SR    G+L+R LK    +  +             S  +
Sbjct  126  HKPFSKILADYGNIGGLIKYGSR---IGSLSRGLKNVFTLKPEQYPFTPEGMSNINSHLM  182

Query  342  SADQPSSRAAADCCFLHTTTNKIKSSEEDDSNQYMDLLSELQAIKSITESTNYSSA--AA  515
            +   P    +   CFL+   N      + +SN  +DLL +LQAIK +TE+++  +A    
Sbjct  183  TTTVPPKMESNQECFLNIMYNN-----DANSNHSLDLLDQLQAIKLVTEASSTCTAYQTI  237

Query  516  PDSTIVVsppsslssltsplaaaaaaQEKAGFSWCDDFLLEDAFLP-------------L  656
            P   I+                    +    FSWC DFLLED +LP             L
Sbjct  238  PAPCIL-------------------DESSTSFSWC-DFLLEDEYLPAEQENAAEFSSKDL  277

Query  657  NN--------VQQSSDWEPNHNNNTSPQDIIKIssspsssnsnleaassssFVEAMLSRE  812
             N        + QS       N   +  D+   S++ S       ++  SSFVE ++  E
Sbjct  278  TNQTQNPNVMIPQSFQSNTEVNAGVNGMDLALQSNTGSDDQVASSSSQHSSFVETIMDGE  337

Query  813  DHDMFLDFPGLSEEPFYY  866
               +FLDFP L EE FYY
Sbjct  338  SK-IFLDFPNLLEEIFYY  354



>ref|XP_011042628.1| PREDICTED: transcription repressor MYB6-like [Populus euphratica]
Length=377

 Score =   161 bits (408),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 133/325 (41%), Positives = 173/325 (53%), Gaps = 56/325 (17%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + D+F+PQEEE+II+LHA IGSRW+IIAQQLPGRTDNDVKN WN +++KKLS MGIDPVT
Sbjct  66   KHDSFTPQEEEMIIRLHAAIGSRWSIIAQQLPGRTDNDVKNYWNARIRKKLSEMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSK-------------SQKL  341
            HKPFS+ILADYGNIGG   S SR    G+L+R LK    +  +             S  +
Sbjct  126  HKPFSKILADYGNIGGIVKSGSR---IGSLSRGLKNVFTLKPEQYPVTPEGMSNINSHLM  182

Query  342  SADQPSSRAAADCCFLHTTTNKIKSSEEDDSNQYMDLLSELQAIKSITES----TNYSSA  509
            +   P        CFL+     IK +   + N  +DLL +LQAI+ +TE+    T Y + 
Sbjct  183  TTTVPPKTEPNQECFLN-----IKYNNNANDNHSLDLLDQLQAIRVVTEASSTCTAYQTI  237

Query  510  AAPDSTIVVsppsslssltsplaaaaaaQEKAGFSWCDDFLLEDAFLP------------  653
             AP    ++   S  SS +S  + AA  +    FSWC DFLLED +LP            
Sbjct  238  PAP---CILDEGSLSSSSSSTCSTAAQEKFPTSFSWC-DFLLEDEYLPGDHPHAEQENAA  293

Query  654  ------LNN--------VQQSSDWEPNHNNNTSPQDIIKIssspsssnsnleaassssFV  791
                  L N        + QS+          +  D+   S++ S     L +   SSFV
Sbjct  294  EFSSKDLTNQTQNPNVMIPQSAQSNTEVGAGVNGMDLALQSNTGSDDQVALSSPQHSSFV  353

Query  792  EAMLSREDHDMFLDFPGLSEEPFYY  866
            E M+  E   +FLDFP L EE  YY
Sbjct  354  ETMMDGESK-IFLDFPNLLEEISYY  377



>ref|XP_002321544.1| hypothetical protein POPTR_0015s07900g [Populus trichocarpa]
 gb|EEF05671.1| hypothetical protein POPTR_0015s07900g [Populus trichocarpa]
Length=385

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 134/227 (59%), Gaps = 27/227 (12%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + DNF+PQEEE+II+LHA IGSRW+IIAQQLPGRTDNDVKN WN +L+KKLS MGIDPVT
Sbjct  66   KHDNFTPQEEEMIIRLHAAIGSRWSIIAQQLPGRTDNDVKNCWNARLRKKLSEMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSK--------------SQK  338
            HKPFS+ILADYGNIGG   S SR    G+L+R LK    +  +              S  
Sbjct  126  HKPFSKILADYGNIGGLVKSGSR---IGSLSRDLKNVFALKPEQYNSILPEGISNINSHL  182

Query  339  LSADQPSSRAAADCCFLHTTTNKIKSSEEDDSNQYMDLLSELQAIKSITESTNYSSAAAP  518
            ++   P        CFL+   N     +  +SN  +DLL +LQAIK +TE++  S+ A  
Sbjct  183  MTRMVPRKMEPVQECFLNKFNN-----DSTNSNHSLDLLDQLQAIKLVTEAS--STCAEY  235

Query  519  DSTIVVsppsslssltsplaaaaaaQEK--AGFSWCDDFLLEDAFLP  653
             + +V +         S    +   QE     F WC DFLLED FLP
Sbjct  236  QTMLVPNYNILDEGSLSSSTCSTETQENLPTSFRWC-DFLLEDQFLP  281



>ref|XP_010087748.1| Myb-related protein Pp2 [Morus notabilis]
 gb|EXB29781.1| Myb-related protein Pp2 [Morus notabilis]
Length=348

 Score =   158 bits (400),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 144/230 (63%), Gaps = 30/230 (13%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            +Q +F+P+EEELIIKLHATIGSRW +IAQQLPGRTD DVKN WNTKL+KKLS MGIDPVT
Sbjct  56   DQISFTPKEEELIIKLHATIGSRWPLIAQQLPGRTDEDVKNYWNTKLRKKLSGMGIDPVT  115

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIM-----SSKSQKLSADQPSSR  365
            HKP+SQILADYGNIGG P S  R    G+LN+ LK  I+M     S+ + K +   P + 
Sbjct  116  HKPYSQILADYGNIGGVPKSGMR---IGSLNKDLKNAILMKREAFSTPNTKPNLVSPKTE  172

Query  366  AAADCCFLHTTTNKIKSSEEDDSNQYMDLLSELQAIKSITESTNY-------SSAAAPDS  524
               D  FL            +  NQ +DLL++LQAIK +TE++NY          A   S
Sbjct  173  PNQDSNFL------------NHRNQSLDLLAQLQAIKLVTEASNYPPPGLISKEPAFSFS  220

Query  525  TIVVsppsslssltsplaaaaaaQE--KAGFSWCDDFLLEDAFLPLNNVQ  668
                   S +SS +     ++AAQE     F+W +DFLLEDAFLP +  Q
Sbjct  221  FAFSPSSSPVSSSSDYSTCSSAAQELPPLAFNW-NDFLLEDAFLPSDEAQ  269



>gb|KDP31180.1| hypothetical protein JCGZ_11556 [Jatropha curcas]
 gb|AIT52311.1| MYB family protein [Jatropha curcas]
Length=343

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 131/293 (45%), Positives = 175/293 (60%), Gaps = 30/293 (10%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + D F+P EEELI++LHA IGSRW+IIAQQLPGRTDND+KN WNTKL+KKLS MGIDPVT
Sbjct  66   KHDTFTPHEEELIVRLHAAIGSRWSIIAQQLPGRTDNDIKNYWNTKLRKKLSEMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSADQPSSRAAADC  380
            HKPFSQI+ADYGNIG  P   +R     +L R LK   I S  ++ L+   P++      
Sbjct  126  HKPFSQIIADYGNIGCLPRYGNR---ISSLTRDLKNAFI-SKPAEGLTISNPNNYNTH--  179

Query  381  CFLHTTTNKIKSSEE------DDSNQYMDLLSELQAIKSITESTNYSSAAAPDSTIVVsp  542
               H    K++S +E         NQ +DLL +LQAIK +TE+TN+      D   + S 
Sbjct  180  ---HLVPPKMESIQECFLNNGASCNQSLDLLDQLQAIKLVTEATNFLR----DQGSLSSS  232

Query  543  psslssltsplaaaaaaQEKAG--FSWCDDFLLEDAFLPLNN----VQQSSDWEPNHNNN  704
             SS  S +S    + A QEK+   FSW  DFLL+DAF+  +N    VQ+  ++    +  
Sbjct  233  ASSSCSNSSSSTCSTAGQEKSALSFSW-RDFLLDDAFISNDNHNYQVQEQENFMELSSKG  291

Query  705  TSPQDIIKIsssp---sssnsnleaassssFVEAMLSREDHDMFLDFPGLSEE  854
                 I K+  +     + + +  + S +SF+EAML +E+ D FLDFP L EE
Sbjct  292  DFTGQIRKMDMAIPTPGTGHQDPSSCSDASFLEAMLDQENED-FLDFPNLLEE  343



>ref|XP_008453162.1| PREDICTED: transcription factor MYB24-like [Cucumis melo]
Length=369

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 128/309 (41%), Positives = 171/309 (55%), Gaps = 40/309 (13%)
 Frame = +3

Query  30   NFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKP  209
            NF+ QEEELII+LHA IGSRW IIAQQLPGRTDNDVKN WNTKL++KLS MGIDPVTHKP
Sbjct  69   NFTSQEEELIIRLHAAIGSRWAIIAQQLPGRTDNDVKNYWNTKLRRKLSEMGIDPVTHKP  128

Query  210  FSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSAD------QPSSRAA  371
            FSQILADYGNIGG P ST R    G+L+R LKT+  M  +    SA        PS    
Sbjct  129  FSQILADYGNIGGLPRSTKR---IGSLSRELKTSAYMKPEHHSNSAQGLVDLLTPSMLLP  185

Query  372  ADCCFLHTTTNKIKSSEEDDSNQYMDLLSELQAIKSITESTN--YSSAAAPDSTIVVspp  545
                 +  + N   +  + ++N  ++LL++LQA++ +TE+++  ++    P        P
Sbjct  186  ETGPVMDQSMN--ANVHQVNNNHPLNLLAQLQAMQRVTEASHCTFNEQIQPHFYTQSYLP  243

Query  546  sslssltsplaaaaaaQEKAGFSWCDDFLLEDAFLP-----LNNVQQSSDWEPNHN----  698
            SS SS +S           + FSW  DFLLEDAFLP     L NV    ++  N N    
Sbjct  244  SSSSSSSSSTTTVTCRNSSSTFSW-QDFLLEDAFLPSEPQELENV---GEFSLNQNGCQT  299

Query  699  -NNTSPQDIIKIssspsssn-------------snleaassssFVEAMLSREDHDMFLDF  836
             N  S +++ K       +                  +++ ++F+E +L +ED  +  DF
Sbjct  300  ENGISKEELNKERCDYQYNRFEATHCLVGNNDIEASSSSAENTFIETLLHQEDKIILFDF  359

Query  837  PGLSEEPFY  863
              L EEP Y
Sbjct  360  LNLLEEPLY  368



>ref|XP_011028677.1| PREDICTED: transcription factor RAX2-like [Populus euphratica]
Length=387

 Score =   156 bits (395),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 108/229 (47%), Positives = 136/229 (59%), Gaps = 29/229 (13%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + DNF+PQEEE+II+LHA IGSRW+IIAQQLPGRTDNDVKN WN +L+KKLS MGIDPVT
Sbjct  66   KHDNFTPQEEEMIIRLHAAIGSRWSIIAQQLPGRTDNDVKNCWNARLRKKLSEMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSK--------------SQK  338
            HKPFS+ILADYGNIGG   S SR    G+L+R LK+   +  +              S  
Sbjct  126  HKPFSKILADYGNIGGLVKSGSR---IGSLSRDLKSVFTLKPEQYNSILPEGISNINSHL  182

Query  339  LSADQPSSRAAADCCFLHTTTNKIKSSEEDDSNQYMDLLSELQAIKSITESTN----YSS  506
            ++   P        CFL+   N     +  +SN  +DLL +LQ+IK +TE+++    Y +
Sbjct  183  MTRMVPRKMEPVQECFLNRFNN-----DSTNSNHSLDLLDQLQSIKLVTEASSTCPEYQT  237

Query  507  AAAPDSTIVVsppsslssltsplaaaaaaQEKAGFSWCDDFLLEDAFLP  653
               P+    +    SLSS T    A         F WC DFLLED FLP
Sbjct  238  MLVPNPNYNILDEGSLSSSTCSTEAHENL--PTSFRWC-DFLLEDQFLP  283



>ref|XP_004301300.1| PREDICTED: uncharacterized protein LOC101309551 [Fragaria vesca 
subsp. vesca]
Length=366

 Score =   154 bits (389),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 114/227 (50%), Positives = 145/227 (64%), Gaps = 21/227 (9%)
 Frame = +3

Query  27   DNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHK  206
            + F+PQEEELI++LHATIGSRW IIAQQLPGRTDNDVK  WNTKLKKKL+ MGIDPVTH+
Sbjct  71   ETFTPQEEELIVRLHATIGSRWPIIAQQLPGRTDNDVKTYWNTKLKKKLTDMGIDPVTHR  130

Query  207  PFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSADQPSSRAAADCCF  386
            PFSQILADYGNI G P S  R    G+LN+ LK  ++M S         P +  +    F
Sbjct  131  PFSQILADYGNISGLPKSGMRIAIGGSLNKDLKNAMLMKS---------PEAYTSGLSNF  181

Query  387  LHT---TTNKIK-----SSEEDDSNQYMDLLSELQAIKSITESTNYSSAAAPD-STIVVs  539
             ++   +T KI+     SS   D  Q  DLL++LQA+K +TE +N ++   P  S     
Sbjct  182  NNSHLVSTTKIEQMQATSSTNFDYYQPYDLLTQLQAMKYVTEVSNSTTNTNPAPSPFNFY  241

Query  540  ppsslssltsplaaaaaaQEKA--GFSWCDDFLLEDAFLPLNNVQQS  674
               SLSS +S   ++AA QEK+   F W  DFLLE+AF+P  + +Q 
Sbjct  242  SECSLSSSSSSTCSSAAVQEKSPLAFGW-SDFLLEEAFVPTEDARQG  287



>ref|XP_007138144.1| hypothetical protein PHAVU_009G183800g [Phaseolus vulgaris]
 gb|ESW10138.1| hypothetical protein PHAVU_009G183800g [Phaseolus vulgaris]
Length=338

 Score =   150 bits (380),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 121/295 (41%), Positives = 169/295 (57%), Gaps = 31/295 (11%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + DNF+ QEE+LIIKLHA IGSRW+IIAQQLPGRTDNDVK  WNTKLKKKLS MGIDPVT
Sbjct  55   KHDNFTAQEEDLIIKLHAAIGSRWSIIAQQLPGRTDNDVKIYWNTKLKKKLSQMGIDPVT  114

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSA-------DQPS  359
            HKPFS+++ADYGNIGG    ++R    G++N+  K+ +++ S+  +          DQP 
Sbjct  115  HKPFSKLIADYGNIGGCQKPSAR---IGSINKEFKSAMMLKSEPHQTMPQGFTNINDQPK  171

Query  360  SRAAADCCFLHTTTNKIKSSEEDDSNQYMDLLSELQAIKSITESTNYSSAAAPDSTIVVs  539
                     + TT N    +     N  MDL+ + QAI  ++ ++N  S    + TI  S
Sbjct  172  LPPQ-----IETTGNNFLFNRNHGDNLSMDLV-QFQAIPKVSRASN--SIEFQNETIPGS  223

Query  540  ppsslssltsplaaaaaaQEKAGFSWCDDFLLEDAFLPLNNVQQSSDWEPNHNNNTSPQD  719
                     +   +  +    + FSW +DFLLEDAF PL+   Q  D   + N  +  ++
Sbjct  224  VFGEDRLSKTSSPSTPSTCSTSAFSW-NDFLLEDAFTPLD--YQEKDIIVSKNLVSQIEN  280

Query  720  IIKIssspsssnsnlea---------assssFVEAMLSREDHDMFLDFPGLSEEP  857
            ++   S  +    + +A         +S +SF+EAML +E+ +MFL FP L EEP
Sbjct  281  VVTRQSWNNKEVKSQKALGSDFQFSSSSDTSFIEAMLDQEN-EMFLSFPHLMEEP  334



>ref|XP_008393090.1| PREDICTED: transcription factor MYB39-like [Malus domestica]
Length=357

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 132/304 (43%), Positives = 179/304 (59%), Gaps = 35/304 (12%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + ++F+P EEELI++LHATIGSRW  IAQ LPGRTDNDVKN WNTKLKKKLS MGID VT
Sbjct  67   KHESFTPHEEELIVRLHATIGSRWPTIAQHLPGRTDNDVKNYWNTKLKKKLSEMGIDHVT  126

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMS-SKSQKLSADQPSSRAAAD  377
            HKPFSQILADYGNIGG      R     +LN+ L+  + M  ++   L A   S+    +
Sbjct  127  HKPFSQILADYGNIGGVQKVGMR-IGISSLNKDLRNAMRMKPAEPYSLPAQGFSN---IN  182

Query  378  CCFLHTTTNKIKSSEEDDS--------NQYMDLLSELQAIKSITES--TNYSSAAAPDST  527
               +  T    K+    DS        +Q  DLL++L+AI  +TE+  +  S ++AP+  
Sbjct  183  SHLMPITMIPTKAEPILDSFLGHTQPGSQPPDLLTQLEAIXLVTEAFKSTESQSSAPN--  240

Query  528  IVVsppsslssltsplaaaaaaQEKA---GFSWCDDFLLEDAFLPLNNVQQSSDWEPNHN  698
                  S   +L S  + ++A QE+A    FSW  DFLLEDA +P+ + Q+  + +  ++
Sbjct  241  ----FYSHEGTLXSSSSTSSATQEQATLQAFSW-XDFLLEDAXMPIGDAQE-HEXKAEYS  294

Query  699  NNTSPQDIIKIsss--------psssnsnleaassssFVEAMLSREDHDMFLDFPGLSEE  854
            +N+  Q  + I  S          +      AA  SSFVEAM++RE+  MFL+FP L EE
Sbjct  295  SNSKDQAQVAIQQSQIDMDYAISXNEVEATSAACDSSFVEAMVAREN-XMFLEFPELMEE  353

Query  855  PFYY  866
            PFYY
Sbjct  354  PFYY  357



>ref|XP_010678637.1| PREDICTED: transcription repressor MYB6-like [Beta vulgaris subsp. 
vulgaris]
Length=356

 Score =   147 bits (372),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 119/297 (40%), Positives = 169/297 (57%), Gaps = 26/297 (9%)
 Frame = +3

Query  27   DNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHK  206
            + F+ QEEE IIKLHA +GSRW +IA QLPGRT+ND+K  WNTKL+KKL+ MGIDP+THK
Sbjct  68   EGFTQQEEERIIKLHAAVGSRWGLIAHQLPGRTENDIKIHWNTKLRKKLTEMGIDPITHK  127

Query  207  PFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSADQPSSRAAADC-C  383
            PFSQILADYGNIGG   S   P   GT+ R LK      S  +  S+  PS+   +D   
Sbjct  128  PFSQILADYGNIGGVSRSFDTPKYLGTIRRDLKKVTTTFSLPKPESSSSPSNTFLSDSQV  187

Query  384  FLHTTTNKIKSSEEDDSNQYMDLLSELQAIKSITESTNYSSAAAPDSTIVVsppsslssl  563
              + ++ +   +   +++  +DLLS+LQAI  +TE          D+T++++  +     
Sbjct  188  SQNMSSMQNNYANYSNNSHSLDLLSQLQAISLVTE------GPISDTTLLLNNNNYDFFS  241

Query  564  tsplaaaaaaQEK--------AG--------FSWCDDFLLEDAFLPLNNVQQSSDWEPNH  695
                 +++ +           AG        FSW  +FLLEDAF P  N  Q  + + N 
Sbjct  242  LPSPKSSSNSSTSACSSITNYAGQGTNASECFSW-HEFLLEDAFKPAQNQAQEQETKLND  300

Query  696  -NNNTSPQDIIKIssspsssnsnleaassssFVEAMLSREDHDMFLDFPGLSEEPFY  863
              ++ SP      +++  +S     ++ +SSF+EAML +E+ DMFL FPGL EEP Y
Sbjct  301  IGSDFSPMKSYNRNANQVASLPLSTSSDASSFLEAMLDQEN-DMFLSFPGLMEEPLY  356



>ref|XP_007099739.1| Duplicated homeodomain-like superfamily protein, putative [Theobroma 
cacao]
 gb|EOY20284.1| Duplicated homeodomain-like superfamily protein, putative [Theobroma 
cacao]
Length=384

 Score =   148 bits (374),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 117/236 (50%), Positives = 156/236 (66%), Gaps = 26/236 (11%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            ++++F+PQEEELII+LHA IGSRW+IIAQQLPGRTDNDVKN WNTKL+KKLS MGIDPVT
Sbjct  66   KRESFAPQEEELIIRLHAAIGSRWSIIAQQLPGRTDNDVKNYWNTKLRKKLSEMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSADQPSSRAAADC  380
            HKPFSQILADYGNIGG P S +R    G+LNR +K   ++ ++        PS  AAA+ 
Sbjct  126  HKPFSQILADYGNIGGLPKSRTR---IGSLNRDMKNAFLLKAEP------YPSPAAAAEG  176

Query  381  CFLHTTTNKIKSSEED-----------DSNQYMDLLSELQAIKS-ITESTNYSS--AAAP  518
                  ++ ++  +++           DS+  +DLLS+LQAIK+ +TE++NY+     +P
Sbjct  177  LMTTIASSGMEPIQDNFFANNSINHHADSDSSLDLLSQLQAIKALVTEASNYTGHQTISP  236

Query  519  DSTIVVsppsslssltsplaaaaaaQEKA--GFSWCDDFLLEDAFLPLNNVQQSSD  680
            D        SS  S ++    + AAQ+K+   FSW  DFLLEDAFLP ++ Q   D
Sbjct  237  DQFPNECSLSSSPSSSTCSTCSTAAQQKSALAFSW-RDFLLEDAFLPADHPQGQED  291



>ref|XP_006477532.1| PREDICTED: transcription factor MYB39-like [Citrus sinensis]
Length=385

 Score =   147 bits (372),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 134/323 (41%), Positives = 180/323 (56%), Gaps = 45/323 (14%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + ++F+PQEEE+II+LHA IGSRW+IIAQQLPGRTDNDVKN WNTKL+KKL+ MGIDPVT
Sbjct  66   KHESFTPQEEEMIIRLHAAIGSRWSIIAQQLPGRTDNDVKNYWNTKLRKKLTEMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRAL-KTTIIMSSKSQKLSADQPSSRAAAD  377
            HKPFSQILADYGNIGG P S +R    G LNR + K   +M    Q  S  Q  S  ++ 
Sbjct  126  HKPFSQILADYGNIGGLPKSGTR---IGCLNRDMSKNAFMMQKPEQHESPFQVFSNISSH  182

Query  378  C-CFLHTTTNKIKSS---EEDDSNQYMDLLSELQAIKSITE------STNYSSAAAPDST  527
                +      IK +     +D +  MDLL++LQA++ + E      +TN + + +P   
Sbjct  183  LMTMVSPNVEPIKDTLLNHYNDHSNSMDLLAQLQAVRLVAEASNNNCATNANESMSPPQI  242

Query  528  IVVsppsslssltsplaaaaaaQEKA--GFSWCDDFLLEDAFLPLNNVQQSSDWE-----  686
                  S  SS +S    + A QEK+   F+W D  L +D      ++ Q+ + E     
Sbjct  243  FFNEAGSLSSSSSSSSTCSTAGQEKSPPNFTWEDFLLDDDDAFLSADIPQAQEQEHDTHS  302

Query  687  ---------PNHNNNTSPQD-------IIKIssspsssn-----snleaassssFVEAML  803
                      NH  N  PQ+       I ++++           S   AA+SSSFVEAML
Sbjct  303  MVEFSSKDFTNHTRNVMPQNQNNNETAITQVNTGVDQRMDSGGPSYEVAAASSSFVEAML  362

Query  804  SREDHDMFLDFPGL--SEEPFYY  866
             RE+ DM L+FP L   +EP +Y
Sbjct  363  DREN-DMLLEFPNLLVLDEPHFY  384



>ref|XP_004138294.1| PREDICTED: uncharacterized protein LOC101212214 [Cucumis sativus]
 ref|XP_004155070.1| PREDICTED: uncharacterized protein LOC101230238 [Cucumis sativus]
 gb|KGN63635.1| hypothetical protein Csa_1G008430 [Cucumis sativus]
Length=367

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 121/314 (39%), Positives = 167/314 (53%), Gaps = 51/314 (16%)
 Frame = +3

Query  30   NFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKP  209
            NF+ QEEELII+LHA IGSRW IIAQQLPGRTDNDVKN WNTKL++KLS MGIDPVTHKP
Sbjct  69   NFTSQEEELIIRLHAAIGSRWAIIAQQLPGRTDNDVKNYWNTKLRRKLSEMGIDPVTHKP  128

Query  210  FSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSADQPSSRAAADCCFL  389
            FSQILADYGNIGG P ST R    G+L+R +KT+  M  +    SA Q           L
Sbjct  129  FSQILADYGNIGGLPRSTKR---IGSLSREMKTSAYMKPEHHSNSA-QGLVDLLTPSMLL  184

Query  390  HTTTNKIKSSEEDDSNQYMDLL-----SELQAIKSITESTN-----------YSSAAAPD  521
              T   +  S  D+ +Q  +       ++LQA++ +TE+++           Y+ +  P 
Sbjct  185  PETEPVMDKSMNDNVHQLNNNHPLNLLAQLQAMQRVTEASHCTFNEQIQPHFYTQSYLPS  244

Query  522  STIVVsppsslssltsplaaaaaaQEKAGFSWCDDFLLEDAFLPLNNVQQSSDWEPNHNN  701
            S+   S  ++++   +           + FSW  DFLLEDAFLP    +  +  E + N 
Sbjct  245  SSSSSSSTTTVTCRNTS----------STFSW-QDFLLEDAFLPSEPREHENVGECSLNQ  293

Query  702  N-------TSPQDIIKIssspsssn-------------snleaassssFVEAMLSREDHD  821
            N        S +++ K       +                  +++ ++F+E +L +ED  
Sbjct  294  NGCQTENEISKEELNKEICDYQYNRFEAMHCLVENNDIEASSSSAENTFIETLLHQEDKI  353

Query  822  MFLDFPGLSEEPFY  863
            +  DF  L EEP Y
Sbjct  354  ILFDFLNLLEEPLY  367



>ref|XP_008374912.1| PREDICTED: uncharacterized protein LOC103438153 [Malus domestica]
Length=519

 Score =   146 bits (369),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 112/235 (48%), Positives = 142/235 (60%), Gaps = 20/235 (9%)
 Frame = +3

Query  3    HHHHHQEQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAM  182
            H   + + ++F+P EEELI++LHATIGSRW  IAQQLPGRTDNDVKN WNTKLKKKLS M
Sbjct  43   HLKPNLKHESFTPHEEELIVRLHATIGSRWPAIAQQLPGRTDNDVKNYWNTKLKKKLSEM  102

Query  183  GIDPVTHKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSADQPSS  362
            GIDPVTHKPFSQ+L DYGNIGG P    R    G+LN+ LK  ++M      L   Q  S
Sbjct  103  GIDPVTHKPFSQVLXDYGNIGGLPKVGMRI-GIGSLNKDLKNAMLMEPAEPYLLXAQGFS  161

Query  363  RAAADCC---FLHTTTNKIKSS---EEDDSNQYMDLLSELQAIKSITE---STNYSSAAA  515
               +       + T    I  S       S+Q  DLL++LQAIK +TE   ST + S+A 
Sbjct  162  NINSHLMPITMIPTKEEPILDSFLGHNQPSSQPPDLLTQLQAIKLVTEASKSTEFQSSA-  220

Query  516  PDSTIVVsppsslssltsplaaaaaaQEKAG---FSWCDDFLLEDAFLPLNNVQQ  671
            P+              +    +++AAQE+A    FSW  DFLLEDAF+P+ + Q+
Sbjct  221  PN-----FYSHEGXLSSPSSTSSSAAQEQATLQTFSW-SDFLLEDAFMPIGDAQE  269



>ref|XP_006439694.1| hypothetical protein CICLE_v10023930mg [Citrus clementina]
 gb|ESR52934.1| hypothetical protein CICLE_v10023930mg [Citrus clementina]
Length=384

 Score =   143 bits (361),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 118/175 (67%), Gaps = 8/175 (5%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + ++F+PQEEE+II+LHA IGSRW+IIAQQLPGRTDNDVKN WNTKL+KKL+ MGIDPVT
Sbjct  66   KHESFTPQEEEMIIRLHAAIGSRWSIIAQQLPGRTDNDVKNYWNTKLRKKLTEMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRAL-KTTIIMSSKSQKLSADQPSSRAAAD  377
            HKPFSQILADYGNIGG P S +R    G LNR + K   +M    Q  S  Q  S  ++ 
Sbjct  126  HKPFSQILADYGNIGGLPKSGTR---IGCLNRDMSKNAFMMQKPEQHESPFQVFSNISSH  182

Query  378  C-CFLHTTTNKIKSS---EEDDSNQYMDLLSELQAIKSITESTNYSSAAAPDSTI  530
                +      IK +     +D +  MDLL++LQA++ + E++N + A   + +I
Sbjct  183  LMTMVSPNVEPIKDTLLNHYNDHSNSMDLLAQLQAVRLVAEASNNNCATNANESI  237



>gb|KHN19359.1| Myb-related protein Zm38 [Glycine soja]
Length=340

 Score =   139 bits (349),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 121/291 (42%), Positives = 160/291 (55%), Gaps = 36/291 (12%)
 Frame = +3

Query  27   DNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHK  206
            DNF+ QEE+LIIKLHA IGSRW+IIAQQLPGRTD DVKN WN+KLKKKLS +GIDPVTHK
Sbjct  68   DNFTTQEEDLIIKLHAAIGSRWSIIAQQLPGRTDTDVKNYWNSKLKKKLSQLGIDPVTHK  127

Query  207  PFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSA--------DQPSS  362
            PFS+++ADYGNIGG    ++R     ++N+  K  +++ S+S +           DQP  
Sbjct  128  PFSKLIADYGNIGGCQKPSTR---IASINKDFKNAMMLKSESHQTLPEGFITNINDQPKP  184

Query  363  RAAADCCFLHTTTNKIKSSEEDDSNQYMDLLSELQAIKSITESTNYSSAAAPDSTIV-Vs  539
                +     T  N + +    D     DLL  L   ++I+  +  S+    ++ I+ VS
Sbjct  185  PPKMET----TGNNFLFNRTHGD-----DLLMNLDQFQAISMKSGASNCIDFENEIMSVS  235

Query  540  ppsslssltsplaaaaaaQEKAGFSWCDDFLLEDAFLPLNN-----VQQSSDWEPNHNNN  704
                     +   +  +      FSW +DFLLEDAF PL N     V Q  D   N    
Sbjct  236  MFGEDCFSKTSSPSTPSTCSTTAFSW-NDFLLEDAFTPLANQEQDLVSQIEDLTWNKIEV  294

Query  705  TSPQDIIKIssspsssnsnleaassssFVEAMLSREDHDMFLDFPGLSEEP  857
             S Q         S S+    +AS  SF+EAML +E ++MFL FP L EEP
Sbjct  295  KSLQ--------ASGSDLQFSSASDISFMEAMLDQE-NEMFLSFPHLMEEP  336



>gb|KDO69866.1| hypothetical protein CISIN_1g038824mg, partial [Citrus sinensis]
Length=187

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 106/155 (68%), Gaps = 8/155 (5%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + ++F+PQEEE+II+LHA IGSRW+IIAQQLPGRTDNDVKN WNTKL+KKL+ MGIDPVT
Sbjct  36   KHESFTPQEEEMIIRLHAAIGSRWSIIAQQLPGRTDNDVKNYWNTKLRKKLTEMGIDPVT  95

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRAL-KTTIIMSSKSQKLSADQPSSRAAAD  377
            HKPFSQILADYGNIGG P S +R    G LNR + K   +M    Q  S  Q  S  ++ 
Sbjct  96   HKPFSQILADYGNIGGLPKSGTR---IGCLNRDMSKNAFMMQKPEQHESPFQVFSNISSH  152

Query  378  CC-FLHTTTNKIKSS---EEDDSNQYMDLLSELQA  470
                +      IK +     +D +  MDLL++LQA
Sbjct  153  LMTMVSPNVEPIKDTLLNHYNDHSNSMDLLAQLQA  187



>ref|XP_006581947.1| PREDICTED: myb-related protein Pp2-like [Glycine max]
Length=330

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 118/292 (40%), Positives = 155/292 (53%), Gaps = 38/292 (13%)
 Frame = +3

Query  27   DNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHK  206
            DNF+ QEE+LIIKLHA IGSRW+IIAQQLPGRTD DVKN WN+KLKKKLS +GIDPVTHK
Sbjct  58   DNFTTQEEDLIIKLHAAIGSRWSIIAQQLPGRTDTDVKNYWNSKLKKKLSQLGIDPVTHK  117

Query  207  PFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSA--------DQPSS  362
            PFS+++ADYGNIGG    ++R     ++N+  K  +++ S+S +           DQP  
Sbjct  118  PFSKLIADYGNIGGCQKPSTR---IASINKDFKNAMMLKSESHQTLPEGFITNINDQPKP  174

Query  363  RAAADCCFLHTTTNKI--KSSEEDDSNQYMDLLSELQAIKSITESTNYSSAAAPDSTIVV  536
                    + TT N      +  DD +  +D    +      +   ++ +   P     V
Sbjct  175  PPK-----METTGNNFLFNRTHGDDLSMNLDQFQAISMKSGASNCIDFENEIMP-----V  224

Query  537  sppsslssltsplaaaaaaQEKAGFSWCDDFLLEDAFLPLNN-----VQQSSDWEPNHNN  701
            S         +   +  +      FSW +DFLLEDAF PL N     V Q  D   N   
Sbjct  225  SMFGEDCFSKTSSPSTPSTCSTTAFSW-NDFLLEDAFTPLANQEQDLVSQIEDLTWNKIE  283

Query  702  NTSPQDIIKIssspsssnsnleaassssFVEAMLSREDHDMFLDFPGLSEEP  857
              S Q         S S+    +AS  SF+EAML +E ++MFL FP L EEP
Sbjct  284  VKSLQ--------ASGSDLQFSSASDISFMEAMLDQE-NEMFLSFPHLMEEP  326



>ref|XP_010264963.1| PREDICTED: transcription factor MYB76 [Nelumbo nucifera]
Length=394

 Score =   135 bits (340),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 111/173 (64%), Gaps = 23/173 (13%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + ++F+PQEEELII LH  IGSRW++IA QLPGRTDNDVKN WNTKL+KKL  MGIDPVT
Sbjct  66   KHESFTPQEEELIINLHQAIGSRWSLIAAQLPGRTDNDVKNYWNTKLRKKLYEMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSADQ---------  353
            HKPFSQILADYGNIGG P + +R    G+LNR L+   +  S+S  L  +          
Sbjct  126  HKPFSQILADYGNIGGLPRAGNR---IGSLNRDLRNAFMSKSESAPLPQEAILNASSHSI  182

Query  354  -----PSSRAAADCCFLHTTTNKIKSSEEDDSNQYMDLLSELQAIKSITESTN  497
                 P      DC   HT  N   S+    +N   DLL+ELQAIK +TE++N
Sbjct  183  MTIRTPKMEPIQDC---HTNNNGSSSNN---NNHCWDLLAELQAIKLVTEASN  229



>ref|XP_010039154.1| PREDICTED: myb-related protein 315-like [Eucalyptus grandis]
 gb|KCW49364.1| hypothetical protein EUGRSUZ_K02907 [Eucalyptus grandis]
Length=317

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 120/306 (39%), Positives = 161/306 (53%), Gaps = 62/306 (20%)
 Frame = +3

Query  3    HHHHHQEQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAM  182
            +H    + + F+PQEEELII+LH  IGSRW+IIAQQLPGRTDNDVKN WNTKL+KKL  M
Sbjct  55   YHQPDSKHEVFTPQEEELIIRLHVIIGSRWSIIAQQLPGRTDNDVKNHWNTKLRKKLKEM  114

Query  183  GIDPVTHKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSADQPSS  362
            GIDPVTHKPFSQ+L DYGNI G    T+R  Q G++                   D P  
Sbjct  115  GIDPVTHKPFSQVLRDYGNIDG----TTRESQIGSM-------------------DPP--  149

Query  363  RAAADCCFLHTTTNKIKSSEED--DSNQYMDLLSELQAIKSITESTNYSSAAAPDSTIVV  536
            +A +D     T  N    ++ D   +N  +DLL++L AIK +TE++  S+     +T + 
Sbjct  150  QAFSDLNTHQTPPNVTSRTDTDTAQNNHSLDLLAQLHAIKLVTEASTCSAHGK--ATFMP  207

Query  537  sppsslssltsplaaaaaaQEKAGFSWCDDFLLEDAFLPLNNVQQSSDWEPN--------  692
               SSL   +S    +AA Q    F W  DFL+ED  LP    ++     P         
Sbjct  208  LNTSSLPPTSSSSTRSAALQS---FRWS-DFLIEDPTLPAELSKEGIRMRPQSEIKNEGR  263

Query  693  ---------HNNNTSPQDIIKIssspsssnsnleaassssFVEAMLSREDHDMFLDFPGL  845
                     H N TS           +    +   +S  SFVE++L+ ++ +MF++FP L
Sbjct  264  EEGNETGGFHQNGTS-----------NGHKGSSIPSSDGSFVESILN-QNEEMFMEFPEL  311

Query  846  SEEPFY  863
             EEP Y
Sbjct  312  WEEPLY  317



>ref|XP_004513209.1| PREDICTED: transcription factor MYB86-like isoform X1 [Cicer 
arietinum]
Length=301

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 115/283 (41%), Positives = 147/283 (52%), Gaps = 49/283 (17%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + DNF+ QEE+LIIKLHA IGSRW+IIAQQLPGRTDNDVKN WNTKLKKKLS MGIDPVT
Sbjct  67   KHDNFTSQEEDLIIKLHAAIGSRWSIIAQQLPGRTDNDVKNNWNTKLKKKLSQMGIDPVT  126

Query  201  HKPFSQILADYGNIGGFPTSTSRP-PQFGTLNRALKTTIIMSSKSQKLSADQPSSRAAAD  377
            HKPFS+++ADYGNIG   TS  +P  Q    N+  +   I+          Q + +   +
Sbjct  127  HKPFSKLIADYGNIG---TSFHKPTTQIEVANKDFRNYAILLKSDPYQFNQQQTLQTTGN  183

Query  378  CCFLHTTTNKIKSSEEDDSNQYMDLLSELQAIKSITESTNYSSAAAPDSTIVVsppssls  557
              F+ T     KS  +DD             +K  +  TN  +   P  T+V        
Sbjct  184  SSFMVT-----KSHSDDD----------FSIVKGDSNCTNIKNETNP--TLV--------  218

Query  558  sltsplaaaaaaQEKAGFSWCDDFLLEDAFLPLNNVQQSSDWEPNHNNNTSPQDIIKIss  737
                             FSW +DFLLEDAF P  N Q+        N  +    +     
Sbjct  219  ------------DAFPPFSW-NDFLLEDAFAPPTNNQEQQILFSKENVMSQNGKM-----  260

Query  738  spsssnsnleaassssFVEAMLSREDHDMFLDFPGLSEEPFYY  866
               + +  + + S  SFVEA+L +E+ +MFL FP L EEP  Y
Sbjct  261  -KEAMSHQVSSCSDISFVEAILDQEN-EMFLSFPHLLEEPSNY  301



>gb|EYU35908.1| hypothetical protein MIMGU_mgv1a008388mg [Erythranthe guttata]
Length=375

 Score =   131 bits (329),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 112/166 (67%), Gaps = 17/166 (10%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            F+ QEEEL+I+LH+ IGSRW IIAQQLPGRTDNDVK LWN+KL+KKLSAMGIDPVTHKPF
Sbjct  77   FTTQEEELVIQLHSAIGSRWPIIAQQLPGRTDNDVKTLWNSKLRKKLSAMGIDPVTHKPF  136

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSADQPS-----------  359
            SQILADYGNIG FP + +R   F +L++ +K +I+  S + +L +  P+           
Sbjct  137  SQILADYGNIGAFPKARTR---FSSLSKDIKNSIVFKSSNSELISQNPNNNNNNNNINPH  193

Query  360  ---SRAAADCCFLHTTTNKIKSSEEDDSNQYMDLLSELQAIKSITE  488
               S    D  F  + +N    +  +++N  +DL S+LQ++  +T+
Sbjct  194  ENFSHYFHDHLFSPSPSNISDIAHYNNNNNPLDLYSQLQSVNFVTK  239



>emb|CBI35002.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   120 bits (301),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 104/287 (36%), Positives = 149/287 (52%), Gaps = 40/287 (14%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + D+F+PQEE+LI+ LH  IGSRW++IA++LPGRTDNDVKN WNTKL+KKL+ MGIDPVT
Sbjct  66   KHDSFTPQEEDLIVNLHKAIGSRWSLIAKELPGRTDNDVKNYWNTKLRKKLTKMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSADQPSSRAAADC  380
            HKPFSQIL DYGNI G P + +R    G+ +R L    +  S                  
Sbjct  126  HKPFSQILTDYGNISGLPNTATR---MGSFSRGLNNASVSVSG-----------------  165

Query  381  CFLHTTTNKIKSSEEDDSNQYMDLLSELQAIKSITESTNYSSAAAPDSTIVVsppsslss  560
               +T  N +K            L+ + Q +   T   ++ S     S+   S  +    
Sbjct  166  -LSYTNMNDLKP-----------LVEQFQVLNQETVQPHFFSEVPSSSSSSSSCSNVTQL  213

Query  561  ltsplaaaaaaQEK----AGFSWCDDFLLEDAFLPLNNVQQSSDWEPNHN-NNTSPQDII  725
             +        +Q +    + FSW +DFLL D FLP  ++QQ  + +P    ++TSP    
Sbjct  214  SSPQSFPCQPSQAQFTPSSPFSW-NDFLLGDPFLP-TDLQQQEECDPRGTFSSTSPSLYG  271

Query  726  KIssspsssnsnleaassssFVEAMLSREDHDMFLDFPGLSEEPFYY  866
              +     ++    ++ +SSFVE++L R D +M    P L  E F Y
Sbjct  272  ATTGDDMGNSHKASSSPASSFVESILDR-DSEMRAKLPELLGESFDY  317



>gb|KEH33532.1| myb transcription factor [Medicago truncatula]
Length=298

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 98/276 (36%), Positives = 140/276 (51%), Gaps = 56/276 (20%)
 Frame = +3

Query  27   DNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHK  206
            D F+ QEE+LI+KLHA IGSRW+IIAQQLPGRTDNDVKN WNTKLKKKLS MGIDPVTHK
Sbjct  69   DKFTSQEEDLIVKLHAAIGSRWSIIAQQLPGRTDNDVKNNWNTKLKKKLSQMGIDPVTHK  128

Query  207  PFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSADQPSSRAAADCCF  386
            PFS+++ DYGNIGG             +N+  +   ++ + +       P      + C 
Sbjct  129  PFSKLIVDYGNIGGANCH---------INQDFRNQRLIRNTNDLSKQLPPKMETVMNLCQ  179

Query  387  LHTTTNKIKSSEEDDSNQYMDLLSELQAIKSITESTNYSSAAAPDSTIVVsppsslsslt  566
              T+ N       + ++ +++      +   +   +  SS +  ++              
Sbjct  180  FQTSNN------NNPTSMFVEAFLSSSSSTPLPTLSPCSSTSTQETNF------------  221

Query  567  splaaaaaaQEKAGFSWCDDFLLEDAF---LPLNNVQQSSDWEPNHNNNTSPQDIIKIss  737
                        A FSW +DFLL+DAF    P NN+Q+              Q +  + S
Sbjct  222  -----------SAPFSW-NDFLLQDAFSQDAPTNNLQEQ-------------QILGGLLS  256

Query  738  spsssnsnleaassssFVEAMLSREDHDMFLDFPGL  845
                 +  + ++S  SFVE +L +E+ +MFL FP L
Sbjct  257  KKEVVSHQVSSSSDISFVETILDQEN-EMFLSFPEL  291



>ref|XP_009764550.1| PREDICTED: transcription factor WER [Nicotiana sylvestris]
Length=349

 Score =   116 bits (290),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 94/166 (57%), Gaps = 12/166 (7%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + DNF+PQEEE I++LH TIGSRW++IA+QLPGRTDNDVKN WNTKLKKKL  MGIDPVT
Sbjct  66   KHDNFTPQEEECILELHKTIGSRWSLIAKQLPGRTDNDVKNYWNTKLKKKLVNMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSADQPSSRAAADC  380
            HKPF+Q+ A+YG I G P   +R              I + + + ++S   P S      
Sbjct  126  HKPFAQVFAEYGKISGLPIQNTR------------NNICLPNNTTEISKQFPFSSGTPHD  173

Query  381  CFLHTTTNKIKSSEEDDSNQYMDLLSELQAIKSITESTNYSSAAAP  518
             F+H   N              DL  + Q I   T  TN  S  +P
Sbjct  174  KFVHNIMNDQLQENYSTQKYTWDLKPQYQVIHEETLQTNSFSEVSP  219



>emb|CAN74972.1| hypothetical protein VITISV_001041 [Vitis vinifera]
Length=333

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 77/94 (82%), Gaps = 3/94 (3%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + D+F+PQEE+LI+ LH  IGSRW++IA++LPGRTDNDVKN WNTKL+KKL+ MGIDPVT
Sbjct  66   KHDSFTPQEEDLIVNLHKAIGSRWSLIAKELPGRTDNDVKNYWNTKLRKKLTKMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRAL  302
            HKPFSQIL DYGNI G P + +R    G+ +R L
Sbjct  126  HKPFSQILTDYGNISGLPNTATR---MGSFSRGL  156



>ref|XP_004164901.1| PREDICTED: myb-related protein Zm38-like [Cucumis sativus]
Length=233

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 79/109 (72%), Gaps = 2/109 (2%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
              D+F+PQEE+LIIKLH  IGSRW++IA+QLPGRTDNDVKN WNTKL+KKL  MGIDP+T
Sbjct  66   RHDSFTPQEEDLIIKLHQAIGSRWSVIAKQLPGRTDNDVKNYWNTKLRKKLLKMGIDPIT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSA  347
            HKPFSQIL DYG+I    T+    P  G  N+ L  T  M+   Q  S+
Sbjct  126  HKPFSQILFDYGSISSLQTTPK--PLMGPFNKTLTPTTTMAKSQQPFSS  172



>ref|XP_002276072.2| PREDICTED: transcription repressor MYB4 [Vitis vinifera]
Length=370

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 77/94 (82%), Gaps = 3/94 (3%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + D+F+PQEE+LI+ LH  IGSRW++IA++LPGRTDNDVKN WNTKL+KKL+ MGIDPVT
Sbjct  93   KHDSFTPQEEDLIVNLHKAIGSRWSLIAKELPGRTDNDVKNYWNTKLRKKLTKMGIDPVT  152

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRAL  302
            HKPFSQIL DYGNI G P + +R    G+ +R L
Sbjct  153  HKPFSQILTDYGNISGLPNTATR---MGSFSRGL  183



>ref|XP_004147487.1| PREDICTED: myb-related protein Zm38-like [Cucumis sativus]
Length=268

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 79/109 (72%), Gaps = 2/109 (2%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
              D+F+PQEE+LIIKLH  IGSRW++IA+QLPGRTDNDVKN WNTKL+KKL  MGIDP+T
Sbjct  66   RHDSFTPQEEDLIIKLHQAIGSRWSVIAKQLPGRTDNDVKNYWNTKLRKKLLKMGIDPIT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSA  347
            HKPFSQIL DYG+I    T+    P  G  N+ L  T  M+   Q  S+
Sbjct  126  HKPFSQILFDYGSISSLQTTPK--PLMGPFNKTLTPTTTMAKSQQPFSS  172



>ref|XP_006842754.1| hypothetical protein AMTR_s00133p00071910 [Amborella trichopoda]
 gb|ERN04429.1| hypothetical protein AMTR_s00133p00071910 [Amborella trichopoda]
Length=361

 Score =   114 bits (285),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 87/226 (38%), Positives = 122/226 (54%), Gaps = 32/226 (14%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + D F+PQEE+LI+ LHA IGSRW++IA  LPGRTDND+KN WNTKL+KKL  MGIDPVT
Sbjct  66   KHDRFTPQEEDLIVSLHAAIGSRWSLIAAHLPGRTDNDIKNYWNTKLRKKLREMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSAD-QPSSRAAAD  377
            H+P SQILADYGN+G              L   LK         +  S + +P ++   +
Sbjct  126  HRPISQILADYGNMG--------------LTNPLKYHGRRHHHYRHTSLNPEPENKLTPN  171

Query  378  CCFLH---TTTNKIKSSEE------DDSNQYMDLLSELQAIKSITESTNYSSA-------  509
               LH     TN + S++E      + +N   DLL+++ AIK  +E++N SS        
Sbjct  172  LGELHHFNQNTNNLPSTQEAAALPNNYNNHPWDLLAQIHAIKFASEASNCSSETPVIAEN  231

Query  510  AAPDSTIVVsppsslssltsplaaaaaaQEKAGFSWCDDFLLEDAF  647
            A P + I     +   +          +   +GF+W  +FLL+D  
Sbjct  232  ANPVTKISNEAATETETSQQVQDYPEYSSSNSGFTW-SEFLLDDEL  276



>gb|KDP45440.1| hypothetical protein JCGZ_09689 [Jatropha curcas]
 gb|AIT52312.1| MYB family protein [Jatropha curcas]
Length=325

 Score =   113 bits (283),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 85/109 (78%), Gaps = 5/109 (5%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + DNF+PQEEELII LH  IG+RW++IA+QLPGRTDNDVKN WNTKL+KKL+ MGIDPVT
Sbjct  66   KHDNFTPQEEELIINLHKAIGTRWSLIAKQLPGRTDNDVKNYWNTKLRKKLTKMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTL-NRALKTT---IIMSSKSQ  335
            HKPFSQIL+DYG I G  ++T+   Q G+  N AL  +   +IM SK +
Sbjct  126  HKPFSQILSDYGKISGISSNTTG-NQVGSFTNNALNNSSNDVIMISKPE  173



>ref|XP_004513210.1| PREDICTED: transcription factor MYB86-like isoform X2 [Cicer 
arietinum]
Length=274

 Score =   112 bits (280),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + DNF+ QEE+LIIKLHA IGSRW+IIAQQLPGRTDNDVKN WNTKLKKKLS MGIDPVT
Sbjct  67   KHDNFTSQEEDLIIKLHAAIGSRWSIIAQQLPGRTDNDVKNNWNTKLKKKLSQMGIDPVT  126

Query  201  HKPFSQILADYGNIGGF  251
            HKPFS+++ADYGNI  +
Sbjct  127  HKPFSKLIADYGNIDPY  143



>ref|XP_009606135.1| PREDICTED: myb-related protein 315 [Nicotiana tomentosiformis]
Length=333

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + DNF+PQEEE II+LH TIGSRW++IA+QLPGRTDNDVKN WNTKLKKKL  MGIDPVT
Sbjct  66   KHDNFTPQEEECIIELHKTIGSRWSLIAKQLPGRTDNDVKNYWNTKLKKKLVNMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFPTSTSR  269
            HKPF+Q+ A+YG I G P   +R
Sbjct  126  HKPFAQVFAEYGKISGLPIQNAR  148



>ref|XP_009335796.1| PREDICTED: transcription factor MYB29 [Pyrus x bretschneideri]
Length=359

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + DNF+PQEEE II LH  IGSRW+ IA+QLPGRTDNDVKN WNTKLKKKLS MGIDPVT
Sbjct  66   KHDNFTPQEEEHIINLHKAIGSRWSHIAKQLPGRTDNDVKNYWNTKLKKKLSKMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFPTSTS  266
            HKP+SQIL+DYGNI G PT+  
Sbjct  126  HKPYSQILSDYGNISGLPTAAG  147



>ref|XP_008340397.1| PREDICTED: transcription repressor MYB6-like, partial [Malus 
domestica]
Length=284

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 77/98 (79%), Gaps = 1/98 (1%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + DNF+PQEEE II LH  IGSRW+ IA++LPGRTDNDVKN WNTKLKKKLS MGIDPVT
Sbjct  42   KHDNFTPQEEEHIIDLHKAIGSRWSRIAKRLPGRTDNDVKNYWNTKLKKKLSKMGIDPVT  101

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTI  314
            HKP+SQIL+DYGNI G P++    P F +L +  K+  
Sbjct  102  HKPYSQILSDYGNISGLPSTDGNHP-FSSLFKQSKSAF  138



>ref|XP_008443447.1| PREDICTED: myb-related protein Zm38 [Cucumis melo]
Length=268

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 78/107 (73%), Gaps = 2/107 (2%)
 Frame = +3

Query  27   DNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHK  206
            D+F+PQEE+LIIKLH  IGSRW++IA+QLPGRTDNDVKN WNTKL+KKL  MGIDP+THK
Sbjct  68   DSFTPQEEDLIIKLHQAIGSRWSVIAKQLPGRTDNDVKNYWNTKLRKKLLKMGIDPITHK  127

Query  207  PFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSA  347
            PFSQIL DYG+I    T+    P     N+ L  T  M+   Q  S+
Sbjct  128  PFSQILFDYGSISSLRTTPK--PLMSPFNKTLTPTTTMAKTQQPFSS  172



>ref|XP_008341741.1| PREDICTED: transcription factor MYB29-like [Malus domestica]
Length=365

 Score =   111 bits (278),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + DNF+PQEE+ II LH  IGSRW+ IA+QLPGRTDNDVKN WNTKLKKKLS MGIDPVT
Sbjct  66   KHDNFTPQEEQHIINLHKAIGSRWSHIAKQLPGRTDNDVKNYWNTKLKKKLSKMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFPTSTS  266
            HKP+SQIL+DYGNI G PT+  
Sbjct  126  HKPYSQILSDYGNISGLPTAAG  147



>ref|XP_007217774.1| hypothetical protein PRUPE_ppa015976mg [Prunus persica]
 gb|EMJ18973.1| hypothetical protein PRUPE_ppa015976mg [Prunus persica]
Length=371

 Score =   111 bits (278),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 78/101 (77%), Gaps = 3/101 (3%)
 Frame = +3

Query  27   DNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHK  206
            D+F+PQEEE II LH  IGSRW++IA+ LPGRTDNDVKN WNTKLKKKLS MGIDPVTHK
Sbjct  68   DSFTPQEEEHIINLHEAIGSRWSLIAKLLPGRTDNDVKNYWNTKLKKKLSKMGIDPVTHK  127

Query  207  PFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSK  329
            PFSQIL+DYGNI   P+  +   QFG+  + L  T +  S+
Sbjct  128  PFSQILSDYGNISSLPSIDN---QFGSFLKNLNNTFVPKSE  165



>ref|XP_002324023.2| hypothetical protein POPTR_0017s11140g [Populus trichocarpa]
 gb|EEF04156.2| hypothetical protein POPTR_0017s11140g [Populus trichocarpa]
Length=380

 Score =   111 bits (277),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 80/109 (73%), Gaps = 7/109 (6%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + + F+P+EEELIIKLH  IGSRW++IA++LPGRTDNDVKN WNTKL+K L  MGIDPVT
Sbjct  66   KHERFAPEEEELIIKLHKAIGSRWSLIAKKLPGRTDNDVKNYWNTKLRKMLQKMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSA  347
            HKPFSQI +D+GNI G   +       G LN++L T+++     Q  SA
Sbjct  126  HKPFSQIFSDFGNISGISNT-------GNLNKSLNTSLMSEPDHQFSSA  167



>ref|XP_007032351.1| Duplicated homeodomain-like superfamily protein, putative [Theobroma 
cacao]
 gb|EOY03277.1| Duplicated homeodomain-like superfamily protein, putative [Theobroma 
cacao]
Length=368

 Score =   110 bits (276),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 97/150 (65%), Gaps = 8/150 (5%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + ++F+PQEEE+II LH  IGSRW++IA+ LPGRTDNDVKN WNTKL+KKLS MGIDP+T
Sbjct  66   KHESFTPQEEEVIINLHKHIGSRWSLIAKHLPGRTDNDVKNYWNTKLRKKLSKMGIDPIT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSADQPSSRAAADC  380
            HKP SQ+L+DYGNI   P + +    FG+  +  + T++  ++   +    P+     +C
Sbjct  126  HKPISQVLSDYGNINSLPNTEN---LFGSFGKNFRNTLMPKNEPSSIPIGLPN-----NC  177

Query  381  CFLHTTTNKIKSSEEDDSNQYMDLLSELQA  470
              +     +++ +    +N   D+L++ Q 
Sbjct  178  MIMKPVIEQVQDNSSAANNLSWDILAQGQV  207



>ref|XP_011008372.1| PREDICTED: myb-related protein 330 [Populus euphratica]
Length=380

 Score =   110 bits (276),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 80/109 (73%), Gaps = 7/109 (6%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + + F+P+EEELIIKLH  IGSRW++IA++LPGRTDNDVKN WNTKL+K L  MGIDPVT
Sbjct  66   KHERFAPEEEELIIKLHKAIGSRWSLIAKKLPGRTDNDVKNYWNTKLRKMLQKMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSA  347
            HKPFSQI +D+GNI G   +       G LN++L T+++     Q  SA
Sbjct  126  HKPFSQIFSDFGNIRGISNT-------GNLNKSLNTSLMSEPDHQFSSA  167



>gb|KHN34185.1| Transcription factor MYB86 [Glycine soja]
Length=344

 Score =   110 bits (274),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 81/105 (77%), Gaps = 2/105 (2%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + D F+PQEEELII LH  IGSRW+IIA++LPGRTDNDVKN WNTKL+KKL  MGIDPVT
Sbjct  66   KHDGFTPQEEELIINLHGAIGSRWSIIAKRLPGRTDNDVKNYWNTKLRKKLMKMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQ  335
            HKP SQ+L+D G+I G P +T+   Q   +N+ L + ++  +K++
Sbjct  126  HKPVSQVLSDLGSISGLPNTTTN--QIAFINKDLMSNMLPITKTE  168



>ref|XP_010532300.1| PREDICTED: transcription factor MYB29 [Tarenaya hassleriana]
Length=328

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 103/303 (34%), Positives = 160/303 (53%), Gaps = 59/303 (19%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + ++F+P+EE+LII++HA IGSRW +IAQQL G+T+NDVK  W +KLKKKL+ MGIDPVT
Sbjct  62   KHESFTPEEEDLIIRMHAAIGSRWPLIAQQLQGKTENDVKMFWKSKLKKKLTEMGIDPVT  121

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSADQPSSRAAADC  380
            H+PFS ILADYGNI G   + +   + G+L+R L+  +  S                   
Sbjct  122  HRPFSHILADYGNINGETLTPNPSARSGSLSRNLRHPLSFS-------------------  162

Query  381  CFLHTTTNKIKSSEEDDSNQY---MDLLSELQAIKSITESTNYSSAAAPDSTI-------  530
                      +S ++ D NQ     DLLS L+AIK +T +   S+   P++ +       
Sbjct  163  ----------RSEKDSDPNQVGEPGDLLSHLEAIKFMTVAA--SAQVKPETFLPDFYNGP  210

Query  531  ------VVsppsslssltsplaaaaaaQEKA--GFSWCDDFLLEDAFLPLNNVQQSSDWE  686
                       S  SS ++   ++A  QE     FSW  DFLL+    P N+ +     E
Sbjct  211  QVLLSSSALSDSFSSSSSTASTSSATPQENTDLNFSWS-DFLLDQEIFPENHQKP----E  265

Query  687  PNHNNNTSPQDIIKIssspsssnsnleaas----sssFVEAMLSREDHDMFLDFPGLSEE  854
               N+     + + +++S +S ++  +       S+ FVE+++++E  +M+L FP   E+
Sbjct  266  ELDNSFAYFSEAVTVTTSTASESNETKQKKDENPSNGFVESIIAKE-KEMYLGFPSYYEQ  324

Query  855  PFY  863
            P Y
Sbjct  325  PLY  327



>ref|XP_007151175.1| hypothetical protein PHAVU_004G024200g [Phaseolus vulgaris]
 gb|ESW23169.1| hypothetical protein PHAVU_004G024200g [Phaseolus vulgaris]
Length=332

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 82/105 (78%), Gaps = 1/105 (1%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + D+F+PQEEELII LH  IGSRW++IA++LPGRTDNDVKN WNTKL+KKL  MGIDPVT
Sbjct  66   KHDSFTPQEEELIINLHGAIGSRWSLIARRLPGRTDNDVKNYWNTKLRKKLMKMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQ  335
            HKP SQ+L+D G+I G P ST+   Q   +N+ L  + ++ +K++
Sbjct  126  HKPVSQVLSDLGSISGLPNSTTT-NQMAFVNKDLMMSNMVPTKTE  169



>gb|AGN52119.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52229.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=256

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  30   NFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKP  209
            +F+PQEEELII+LHA +GSRW IIAQQLP +T++DVK LWN+KLKKKLSAMGIDPVTHKP
Sbjct  69   SFTPQEEELIIQLHAVLGSRWPIIAQQLPEKTESDVKILWNSKLKKKLSAMGIDPVTHKP  128

Query  210  FSQILADYGNIGGF  251
            FSQILADYG++G F
Sbjct  129  FSQILADYGSMGAF  142



>gb|EYU34125.1| hypothetical protein MIMGU_mgv1a022965mg [Erythranthe guttata]
Length=290

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + DNF+P+EEE I++LH T+GSRW++IA++LPGRTDNDVKN WNTKLKKKL+ MGIDPVT
Sbjct  66   KHDNFTPEEEECILELHKTVGSRWSLIAKRLPGRTDNDVKNYWNTKLKKKLAKMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFPTSTS  266
            HKPFSQ+ ++YG I  FP +T+
Sbjct  126  HKPFSQVFSEYGKISCFPINTN  147



>ref|XP_006342308.1| PREDICTED: protein ODORANT1-like [Solanum tuberosum]
Length=293

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + DNF+PQEE+ I++LH TIGSRW++IA+QLPGRTDNDVKN WNTKLKKKL  MGIDPVT
Sbjct  66   KHDNFTPQEEDCILELHKTIGSRWSLIAKQLPGRTDNDVKNYWNTKLKKKLVNMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFP  254
            HKPF+Q+ A+YG I G P
Sbjct  126  HKPFAQVFAEYGKISGLP  143



>ref|XP_004234868.1| PREDICTED: myb-related protein 308 [Solanum lycopersicum]
Length=263

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + DNF+PQEE+ I++LH TIGSRW++IA+QLPGRTDNDVKN WNTKLKKKL  MGIDPVT
Sbjct  66   KHDNFTPQEEDCILELHKTIGSRWSLIAKQLPGRTDNDVKNYWNTKLKKKLVNMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFP  254
            HKPF+Q+ A+YG I G P
Sbjct  126  HKPFAQVFAEYGKISGLP  143



>ref|XP_008230970.1| PREDICTED: transcription repressor MYB6 [Prunus mume]
Length=371

 Score =   107 bits (268),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 77/103 (75%), Gaps = 3/103 (3%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + D+F+PQEEE II LH  IGSRW++IA+ LPGRTDNDVKN WNTKLKKKLS MGIDPVT
Sbjct  66   KHDSFTPQEEEHIINLHEAIGSRWSLIAKLLPGRTDNDVKNYWNTKLKKKLSKMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSK  329
            HKPFSQIL+DYGNI   P+  +   QFG   +    T +  S+
Sbjct  126  HKPFSQILSDYGNISSLPSIDN---QFGFFFKNSNNTFVPKSE  165



>ref|XP_006604956.1| PREDICTED: protein ODORANT1-like [Glycine max]
Length=320

 Score =   107 bits (266),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + D F+PQEEELII LH  IGSRW+IIA++LPGRTDNDVKN WNTKL+KKL  MGIDPVT
Sbjct  66   KHDGFTPQEEELIINLHGAIGSRWSIIAKRLPGRTDNDVKNYWNTKLRKKLMKMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFPTSTS  266
            HKP SQ+L+D G+I G P +T+
Sbjct  126  HKPVSQVLSDLGSISGLPNTTT  147



>ref|XP_011098554.1| PREDICTED: transcription factor MYB86 [Sesamum indicum]
Length=414

 Score =   107 bits (268),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + DNF+P+EEE I++LH TIGSRW++IA++LPGRTDNDVKN WNTKLKKKL+ MGIDPVT
Sbjct  128  KHDNFTPEEEECILELHRTIGSRWSLIAKRLPGRTDNDVKNYWNTKLKKKLTKMGIDPVT  187

Query  201  HKPFSQILADYGNIGGFPTS  260
            HKPFSQ+ ++YG I GFP++
Sbjct  188  HKPFSQLFSEYGKISGFPST  207



>gb|KHN16276.1| Myb-related protein Zm38 [Glycine soja]
Length=239

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 70/76 (92%), Gaps = 1/76 (1%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + DNF+ Q++ LI+KLHA IGSRW+I+AQQLPGRTDNDVKN WNTKLKKKLS MGIDPVT
Sbjct  55   KDDNFTTQKD-LIMKLHAAIGSRWSIVAQQLPGRTDNDVKNYWNTKLKKKLSQMGIDPVT  113

Query  201  HKPFSQILADYGNIGG  248
            HKPFS++++DYGNIGG
Sbjct  114  HKPFSKLISDYGNIGG  129



>ref|XP_003543842.2| PREDICTED: transcription factor MYB86-like [Glycine max]
Length=375

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 80/105 (76%), Gaps = 3/105 (3%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + D F+PQEE+LII LH  IGSRW++IA++LPGRTDNDVKN WNTKL+KKL  MGIDPVT
Sbjct  96   KHDGFTPQEEDLIINLHGAIGSRWSLIAKRLPGRTDNDVKNYWNTKLRKKLMKMGIDPVT  155

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQ  335
            HKP SQ+L+D G+I G P +T+   Q   +N+ L  + +  +K++
Sbjct  156  HKPVSQVLSDLGSISGLPNTTN---QMAFINKDLMMSNMPPTKTE  197



>gb|KHN13255.1| Transcription factor MYB86 [Glycine soja]
Length=345

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 80/105 (76%), Gaps = 3/105 (3%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + D F+PQEE+LII LH  IGSRW++IA++LPGRTDNDVKN WNTKL+KKL  MGIDPVT
Sbjct  66   KHDGFTPQEEDLIINLHGAIGSRWSLIAKRLPGRTDNDVKNYWNTKLRKKLMKMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQ  335
            HKP SQ+L+D G+I G P +T+   Q   +N+ L  + +  +K++
Sbjct  126  HKPVSQVLSDLGSISGLPNTTN---QMAFVNKDLMMSNMPPTKTE  167



>ref|XP_006416547.1| hypothetical protein EUTSA_v10008283mg [Eutrema salsugineum]
 gb|ESQ34900.1| hypothetical protein EUTSA_v10008283mg [Eutrema salsugineum]
Length=308

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 95/287 (33%), Positives = 151/287 (53%), Gaps = 42/287 (15%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + ++F+P+EE+LIIK+HA +GSRW +IAQ LPG+T+ +VK +WN+KLKKKLS MGID VT
Sbjct  59   KHESFTPEEEDLIIKMHAAMGSRWPLIAQHLPGKTEEEVKMIWNSKLKKKLSQMGIDHVT  118

Query  201  HKPFSQILADYGNIGGFPTSTSRP-PQFGTLNRALKTTIIMSSKSQKLSADQPSSRAAAD  377
            H+PFS +LA+YGNI G  T    P  Q G+L R                           
Sbjct  119  HRPFSHVLAEYGNINGGGTLNPNPLNQTGSLGRN--------------------------  152

Query  378  CCFLHTTTNKIKSSEEDDSNQYMDLLSELQAIKSITESTNYSSAAAPDSTIVVsppssls  557
                H+        + D S    DL+  LQAIK +TES+N      P+ST + +  SS +
Sbjct  153  ----HSLNEDPHQQQPDGSG---DLMFHLQAIKLMTESSN---QIKPESTFMYASSSSSN  202

Query  558  sltsplaaa----aaaQEKAGFSWCDDFLLEDAFLPLNNVQQSSDWEPNHNNNTSPQDII  725
            S     ++     A    +  F+W D  L +++F     +    + +    ++ S     
Sbjct  203  SSPPLFSSTCSTIAQENSEVNFTWSDFLLDQESFHENQQIHPDQELDNLFGSDFSEAAAS  262

Query  726  KIssspsssnsnleaassssFVEAMLSREDHDMFLDFPGLSEEPFYY  866
              +++   ++   E +SS+ FVE++L++E  ++FL +    E+PF++
Sbjct  263  TRANTSIPASQIEEESSSNGFVESILAKEK-ELFLGYNNYLEQPFHF  308



>ref|XP_006482661.1| PREDICTED: transcription factor MYB86-like [Citrus sinensis]
Length=334

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 79/112 (71%), Gaps = 6/112 (5%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            F+P EEE+II LH  IGSRW++IAQQLPGRTDNDVKN WNTKLKKKL  +GIDP+THKPF
Sbjct  70   FAPHEEEIIINLHKAIGSRWSLIAQQLPGRTDNDVKNFWNTKLKKKLMKLGIDPITHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFG-TLNRALKTT---IIMSSKSQKLSADQP  356
            SQI +DYGNI G   +T     FG  +N +L +     ++ +  Q  S D P
Sbjct  130  SQIFSDYGNISGLSINTGN--HFGKCINNSLMSKPEPYLVLNGVQNTSYDNP  179



>gb|AGN52098.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52208.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=300

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + D F+P+EE+ I+++H TIGSRW++IA++LPGRTDNDVKN WNTKLKKKL+ MGIDP+T
Sbjct  66   KHDGFTPEEEDCILEMHKTIGSRWSLIARRLPGRTDNDVKNYWNTKLKKKLTKMGIDPIT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPP  275
            HKPFSQ+ ++YG I G P + +R P
Sbjct  126  HKPFSQLFSEYGRISGSPITRNRNP  150



>gb|KDO72421.1| hypothetical protein CISIN_1g043557mg [Citrus sinensis]
Length=334

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 79/112 (71%), Gaps = 6/112 (5%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            F+P EEE+II LH  IGSRW++IAQQLPGRTDNDVKN WNTKLKKKL  +GIDP+THKPF
Sbjct  70   FAPHEEEIIINLHKAIGSRWSLIAQQLPGRTDNDVKNFWNTKLKKKLMKLGIDPITHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFG-TLNRALKTT---IIMSSKSQKLSADQP  356
            SQI +DYGNI G   +T     FG  +N +L +     ++ +  Q  S D P
Sbjct  130  SQIFSDYGNISGLSINTGN--HFGKCINNSLMSKPEPYLVLNGVQNTSYDNP  179



>ref|XP_006431044.1| hypothetical protein CICLE_v10013340mg [Citrus clementina]
 gb|ESR44284.1| hypothetical protein CICLE_v10013340mg [Citrus clementina]
Length=334

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 72/91 (79%), Gaps = 3/91 (3%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            F+P EEE+II LH  IGSRW++IAQQLPGRTDNDVKN WNTKLKKKL  +GIDP+THKPF
Sbjct  70   FAPHEEEIIINLHKAIGSRWSLIAQQLPGRTDNDVKNFWNTKLKKKLMKLGIDPITHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFG-TLNRAL  302
            SQI +DYGNI G   +T     FG ++N +L
Sbjct  130  SQIFSDYGNISGLSINTGN--HFGKSINNSL  158



>ref|XP_010091926.1| Transcription repressor [Morus notabilis]
 gb|EXB47706.1| Transcription repressor [Morus notabilis]
Length=392

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +3

Query  27   DNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHK  206
            ++F+PQEEE II LH  IGSRW++IA+QLPGRTDNDVKN WNTKL+KKLS MGIDP+THK
Sbjct  68   NDFTPQEEEHIINLHQAIGSRWSLIAKQLPGRTDNDVKNYWNTKLRKKLSKMGIDPITHK  127

Query  207  PFSQILADYGNIGGFPTS  260
            P SQIL++YGNI G   S
Sbjct  128  PISQILSEYGNISGLVNS  145



>ref|XP_006579290.1| PREDICTED: transcription factor MYB34-like [Glycine max]
Length=239

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 68/75 (91%), Gaps = 1/75 (1%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + DNF+ QE+ LI+KLHA IGSRW+I+AQQL GRTDNDVKN WNTKLKKKLS MGIDPVT
Sbjct  55   KDDNFTTQED-LIMKLHAAIGSRWSIVAQQLLGRTDNDVKNYWNTKLKKKLSQMGIDPVT  113

Query  201  HKPFSQILADYGNIG  245
            HKPFS++++DYGNIG
Sbjct  114  HKPFSKLISDYGNIG  128



>ref|XP_010528297.1| PREDICTED: transcription repressor MYB6 [Tarenaya hassleriana]
Length=344

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 77/103 (75%), Gaps = 7/103 (7%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + D FSP+EEELII+ H  IGSRW++IA++LPGRTDNDVKN WNTKLKKKL  MGIDPVT
Sbjct  66   KHDGFSPREEELIIQYHKAIGSRWSLIAKELPGRTDNDVKNYWNTKLKKKLIKMGIDPVT  125

Query  201  HKPFSQILADYGNIG--GFPTSTSRPPQFGTLNRALKTTIIMS  323
            HKP SQ+L+DYG+I   G P + S      T  R+  TT +++
Sbjct  126  HKPVSQVLSDYGHISSHGNPQNPSE-----TFVRSFNTTSVLN  163



>gb|EPS61416.1| hypothetical protein M569_13382, partial [Genlisea aurea]
Length=148

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + D F+P+EE+ I++LH TIGSRW++IA++LPGRTDNDVKN WNTKLKKKL+ MGIDPVT
Sbjct  66   KHDGFTPEEEQCIVELHRTIGSRWSLIARRLPGRTDNDVKNYWNTKLKKKLTKMGIDPVT  125

Query  201  HKPFSQILADYGNI  242
            HKPFSQ+ ++YG I
Sbjct  126  HKPFSQLFSEYGKI  139



>ref|XP_006395361.1| hypothetical protein EUTSA_v10005502mg [Eutrema salsugineum]
 gb|ESQ32647.1| hypothetical protein EUTSA_v10005502mg [Eutrema salsugineum]
Length=329

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + D+FSPQEEELII+ H  IGSRW+ IA++LPGRTDNDVKN WNTKLKK+L  MGIDPVT
Sbjct  66   KHDSFSPQEEELIIQCHGIIGSRWSSIARKLPGRTDNDVKNHWNTKLKKRLMKMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFPTST  263
            HKP SQ+L+++ NI G  TS+
Sbjct  126  HKPVSQLLSEFRNINGHGTSS  146



>ref|XP_010030787.1| PREDICTED: myb-related protein Zm38 [Eucalyptus grandis]
 gb|KCW56273.1| hypothetical protein EUGRSUZ_I02017 [Eucalyptus grandis]
Length=359

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + D FSP+EE+LII LH   GSRW++IA+ LPGRTDNDVKN WNTKLKKKL  MGIDP+T
Sbjct  66   KHDGFSPEEEDLIINLHKIFGSRWSLIAKHLPGRTDNDVKNYWNTKLKKKLQKMGIDPLT  125

Query  201  HKPFSQILADYGNIGGFPTSTSR  269
            HKPFSQI +D+ N+ G P +  R
Sbjct  126  HKPFSQIFSDFENMSGCPNARHR  148



>ref|XP_003618429.1| Transcription factor-like protein [Medicago truncatula]
 gb|AES74647.1| myb transcription factor [Medicago truncatula]
Length=336

 Score = 98.6 bits (244),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + D+F+P+EEELII LH  IGSRW+ IA++LPGRTDNDVKN WNTKL+KKL  MGIDPVT
Sbjct  66   KHDSFTPEEEELIITLHGAIGSRWSCIAKRLPGRTDNDVKNYWNTKLRKKLMKMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFPTSTSR  269
            HKP SQ+++D GNI     + S+
Sbjct  126  HKPVSQVISDLGNISSLTNTNSQ  148



>ref|XP_004304960.1| PREDICTED: uncharacterized protein LOC101309179 [Fragaria vesca 
subsp. vesca]
Length=363

 Score = 98.6 bits (244),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + D F+P+EEE II LH  IGSRW++IA+QLPGRTDNDVKN WNTKLKKKLS +GIDPVT
Sbjct  66   KHDTFTPEEEEHIINLHKAIGSRWSLIAKQLPGRTDNDVKNYWNTKLKKKLSKIGIDPVT  125

Query  201  HKPFSQILADYGNIGGFP  254
            HKP S +L+D+GNI   P
Sbjct  126  HKPISHVLSDFGNITCLP  143



>ref|XP_010459549.1| PREDICTED: transcription repressor MYB6-like [Camelina sativa]
Length=305

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 106/296 (36%), Positives = 156/296 (53%), Gaps = 55/296 (19%)
 Frame = +3

Query  9    HHHQEQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGI  188
            H   + ++F+ +EE+LIIK+HA +GSRW +IAQ LPG+T+ +VK  WNTKLKKKLS MGI
Sbjct  55   HSGTKHESFTSEEEDLIIKMHAAMGSRWQLIAQHLPGKTEEEVKMFWNTKLKKKLSEMGI  114

Query  189  DPVTHKPFSQILADYGNIGGFPTSTSRPP-QFGTLNRALKTTIIMSSKSQKLSADQPSSR  365
            D VTH+PFS +LA+YGNI G       P  Q G L R                       
Sbjct  115  DHVTHRPFSHVLAEYGNINGGGNLNPNPSNQGGPLGRN----------------------  152

Query  366  AAADCCFLHTTTNKIKSSEEDDSNQYMDLLSELQAIKSITESTNYSSAAAPDSTIVVspp  545
                    H+        + DDS    DL+  LQAIK +TES+N      P+ST V +  
Sbjct  153  --------HSLNEDTHQQQPDDSG---DLMFHLQAIKLMTESSN---QVKPESTFVYASS  198

Query  546  sslssltsplaa--aaaaQEKA--GFSWCDDFLLEDAFLPLNNVQQSSDWEPNHNNNTSP  713
            SS +S     ++  +  AQE +   F+W  DFL       L++  Q S   P   +N   
Sbjct  199  SSSNSSPPLFSSTCSTIAQESSELNFTW-SDFL-------LDHENQQSHHHPQELDNLFG  250

Query  714  QDIIKIsss-----psssnsnleaassssFVEAMLSREDHDMFLDFPGLSEEPFYY  866
             D  +++++      + ++   E +SS+ FVE+++++E  ++FL FPG  E PF++
Sbjct  251  NDFSEVAAATMPNTSTIASQIEEESSSNGFVESIIAKEK-ELFLGFPGYLENPFHF  305



>ref|XP_010498301.1| PREDICTED: transcription repressor MYB6-like [Camelina sativa]
Length=309

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 100/291 (34%), Positives = 147/291 (51%), Gaps = 42/291 (14%)
 Frame = +3

Query  9    HHHQEQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGI  188
            H   + ++F+ +EE+LIIK+HA +GSRW +IAQ LPG+T+ +VK  WNTKLKKKLS MGI
Sbjct  56   HSGTKHESFTSEEEDLIIKMHAAMGSRWQLIAQHLPGKTEEEVKMFWNTKLKKKLSEMGI  115

Query  189  DPVTHKPFSQILADYGNIGGFPTSTSRPP-QFGTLNRALKTTIIMSSKSQKLSADQPSSR  365
            D VTH+PFS +LA+YGNI G       P  Q G L R                       
Sbjct  116  DHVTHRPFSHVLAEYGNINGGGNLNPNPSNQGGPLGRN----------------------  153

Query  366  AAADCCFLHTTTNKIKSSEEDDSNQYMDLLSELQAIKSITESTNYSSAAAPDSTIVVspp  545
                    H+        + DDS    DL+  LQAIK +TES+N      P+ST V +  
Sbjct  154  --------HSLNEDTHQQQPDDSG---DLMFHLQAIKRMTESSN---QVKPESTFVYASS  199

Query  546  sslssltsplaaa----aaaQEKAGFSWCDDFLLEDAFLPLNNVQQSSDWEPNHNNNTSP  713
            SS +S     ++     A    +  F+W D  L ++ F          + +    N+ S 
Sbjct  200  SSSNSSPPLFSSTCSTIAQENSEVNFTWSDFLLNQENFHENQQNHHPQELDNLFGNDFSE  259

Query  714  QDIIKIssspsssnsnleaassssFVEAMLSREDHDMFLDFPGLSEEPFYY  866
                 + ++ + ++   E  SS+ FVE++L++E  ++FL FP   E PF++
Sbjct  260  VAAATMPNTSTIASQIEEETSSNGFVESILAKEK-ELFLGFPSYLENPFHF  309



>gb|KFK33741.1| hypothetical protein AALP_AA5G053900 [Arabis alpina]
Length=323

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + D+FSPQEEELII  H  IGSRW+ IAQ+LPGRTDNDVKN WNTKLKK+L  MGIDPVT
Sbjct  66   KHDSFSPQEEELIIHCHRIIGSRWSSIAQKLPGRTDNDVKNHWNTKLKKRLMKMGIDPVT  125

Query  201  HKPFSQILADYGNIGG  248
            HKP SQ+L+++ NI G
Sbjct  126  HKPVSQVLSEFRNISG  141



>ref|XP_009151869.1| PREDICTED: myb-related protein 330 [Brassica rapa]
 emb|CDX86430.1| BnaA06g31470D [Brassica napus]
Length=323

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + D+FSPQEEELII+ H  IGSRW+ IA++LPGRTDNDVKN WNTKLKK+L  MGIDPVT
Sbjct  66   KHDSFSPQEEELIIQCHRIIGSRWSSIARKLPGRTDNDVKNHWNTKLKKRLVKMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFPTST  263
            HKP SQ+L ++ NI G   S+
Sbjct  126  HKPVSQVLTEFRNISGHGNSS  146



>ref|XP_008804161.1| PREDICTED: transcription factor MYB34 [Phoenix dactylifera]
Length=354

 Score = 96.7 bits (239),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 77/113 (68%), Gaps = 14/113 (12%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + ++F+PQEEELII LHATIGSRW+IIA QLPGRTDNDVKN WNTKL KKL   GIDP+T
Sbjct  66   KHESFTPQEEELIITLHATIGSRWSIIANQLPGRTDNDVKNHWNTKLSKKLIQKGIDPIT  125

Query  201  HKPFSQILADYGNIGGFPTS----TSRPP-------QFGTLNRALKTTIIMSS  326
            H+P S+I+    +IGG PT+    TSR         +   LNR LK   +  S
Sbjct  126  HRPISEIIQ---SIGGLPTAATAGTSRGKYHSLHGTRISCLNRDLKNVFLSKS  175



>ref|XP_010921545.1| PREDICTED: transcription repressor MYB4 [Elaeis guineensis]
Length=339

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 67/82 (82%), Gaps = 3/82 (4%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + + F+P+EEELII LHATIGSRW+IIA QLPGRTDNDVKN WNTKL+KKL   GIDPVT
Sbjct  66   KHEGFTPEEEELIITLHATIGSRWSIIANQLPGRTDNDVKNYWNTKLRKKLIQKGIDPVT  125

Query  201  HKPFSQILADYGNIGGFPTSTS  266
            H+P S+I+    +IGG PTS +
Sbjct  126  HRPISEIIQ---SIGGLPTSAT  144



>ref|XP_006291503.1| hypothetical protein CARUB_v10017650mg [Capsella rubella]
 gb|EOA24401.1| hypothetical protein CARUB_v10017650mg [Capsella rubella]
Length=322

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + D+FSPQEEELII+ H  IGSRW+ IA++LPGRTDNDVKN WNTKLKKKL  MGIDPVT
Sbjct  66   KHDSFSPQEEELIIQCHRIIGSRWSTIARKLPGRTDNDVKNHWNTKLKKKLMKMGIDPVT  125

Query  201  HKPFSQILADYGNIGG  248
            HKP SQ+L+++ NI G
Sbjct  126  HKPVSQVLSEFRNISG  141



>ref|XP_010477097.1| PREDICTED: myb-related protein 315-like isoform X1 [Camelina 
sativa]
 ref|XP_010477099.1| PREDICTED: myb-related protein 315-like isoform X2 [Camelina 
sativa]
Length=308

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 93/290 (32%), Positives = 145/290 (50%), Gaps = 40/290 (14%)
 Frame = +3

Query  9    HHHQEQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGI  188
            H   + ++F+ +EE+LIIK+HA +GSRW +IAQ LPG+T+ +VK  WNTKLKKKLS MGI
Sbjct  55   HSGTKHESFTSEEEDLIIKMHAAMGSRWQLIAQHLPGKTEEEVKMFWNTKLKKKLSEMGI  114

Query  189  DPVTHKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSADQPSSRA  368
            D VTH+PFS +LA+Y                              + +   + +   S  
Sbjct  115  DHVTHRPFSHVLAEY-----------------------------GNINGGGNLNPNPSNQ  145

Query  369  AADCCFLHTTTNKIKSSEEDDSNQYMDLLSELQAIKSITESTNYSSAAAPDSTIVVspps  548
             A     H+        + DDS    DL+  LQAIK +TES+N      P+ST V +  S
Sbjct  146  GAPLGRNHSLNEDTHQQQPDDSG---DLMFHLQAIKLMTESSN---QVKPESTFVYASSS  199

Query  549  slssltsplaaa----aaaQEKAGFSWCDDFLLEDAFLPLNNVQQSSDWEPNHNNNTSPQ  716
            S +S     ++     A    +  F+W D  L ++ F          + +    N+ S  
Sbjct  200  SSNSSPPLFSSTCSTIAQENSEVNFTWSDFLLDQENFHENQQNHNPQELDNLFGNDFSEV  259

Query  717  DIIKIssspsssnsnleaassssFVEAMLSREDHDMFLDFPGLSEEPFYY  866
                + ++ + ++   E +SS+ FVE++L++E  ++FL FP   E PF++
Sbjct  260  AAATMPNTLTIASQFEEESSSNGFVESILAKEK-ELFLGFPSYLENPFHF  308



>ref|XP_002877110.1| hypothetical protein ARALYDRAFT_484622 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53369.1| hypothetical protein ARALYDRAFT_484622 [Arabidopsis lyrata subsp. 
lyrata]
Length=318

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + D+FSPQEEELII+ H  IGSRW+ IA++LPGRTDNDVKN WNTKLKKKL  MGIDPVT
Sbjct  66   KHDSFSPQEEELIIECHRIIGSRWSSIARKLPGRTDNDVKNHWNTKLKKKLMKMGIDPVT  125

Query  201  HKPFSQILADYGNIGG  248
            HKP SQ+L+++ NI G
Sbjct  126  HKPVSQVLSEFRNISG  141



>ref|NP_173330.1| myb-like HTH transcriptional regulator family protein [Arabidopsis 
thaliana]
 gb|AAF79285.1|AC068602_8 F14D16.11 [Arabidopsis thaliana]
 dbj|BAH30304.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29784.1| myb-like HTH transcriptional regulator family protein [Arabidopsis 
thaliana]
Length=307

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 99/291 (34%), Positives = 153/291 (53%), Gaps = 43/291 (15%)
 Frame = +3

Query  9    HHHQEQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGI  188
            H   + ++F+ ++E+LIIK+HA +GSRW +IAQ LPG+T+ +VK  WNTKLKKKLS MGI
Sbjct  55   HSGTKHESFTSEDEDLIIKMHAAMGSRWQLIAQHLPGKTEEEVKMFWNTKLKKKLSEMGI  114

Query  189  DPVTHKPFSQILADYGNIGGFPTSTSRPP-QFGTLNRALKTTIIMSSKSQKLSADQPSSR  365
            D VTH+PFS +LA+YGNI G       P  Q G+L R                       
Sbjct  115  DHVTHRPFSHVLAEYGNINGGGNLNPNPSNQAGSLGRN----------------------  152

Query  366  AAADCCFLHTTTNKIKSSEEDDSNQYMDLLSELQAIKSITESTNYSSAAAPDSTIVVspp  545
                    H+  +     + +DS    DL+  LQAIK +T+S+N      P+ST V +  
Sbjct  153  --------HSLNDDGHQQQPNDSG---DLMFHLQAIKLMTDSSN---QVKPESTFVYASS  198

Query  546  sslssltsplaa--aaaaQE--KAGFSWCDDFLLEDAFLPLNNVQQSSDWEPNHNNNTSP  713
            SS +S     ++  +  AQE  +  F+W  DFLL+      N      + +    N+ S 
Sbjct  199  SSSNSSPPLFSSTCSTIAQENSEVNFTW-SDFLLDQETFHENQQNHPQELDSLFGNDFSE  257

Query  714  QDIIKIssspsssnsnleaassssFVEAMLSREDHDMFLDFPGLSEEPFYY  866
                 ++++ +  +   E + S+ FVE+++++E  + FL FP   E+PF++
Sbjct  258  VTAATMANTSTVPSQIEEESLSNGFVESIIAKEK-EFFLGFPSYLEQPFHF  307



>emb|CDX85201.1| BnaC07g25120D [Brassica napus]
Length=654

 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + D+FSPQEEELII+ H  IGSRW+ IA++LPGRTDNDVKN WNTKLKK+L  MGIDPVT
Sbjct  417  KHDSFSPQEEELIIQCHRIIGSRWSSIARKLPGRTDNDVKNHWNTKLKKRLVKMGIDPVT  476

Query  201  HKPFSQILADYGNIGGFPTST  263
            HKP SQ+L ++ NI G   S+
Sbjct  477  HKPVSQVLTEFRNISGHGNSS  497



>ref|XP_004489482.1| PREDICTED: myb-related protein 308-like [Cicer arietinum]
Length=339

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + D+F+ QEEELII LH  IGSRW++IA++LPGRTDNDVKN WNTKL+KKL  MGIDP+T
Sbjct  66   KHDSFTLQEEELIISLHEAIGSRWSLIAKRLPGRTDNDVKNYWNTKLRKKLMKMGIDPIT  125

Query  201  HKPFSQILADYGNIGGF  251
            HKP SQ+L+D G+I   
Sbjct  126  HKPVSQVLSDLGSISSL  142



>gb|AAC83599.1| putative transcription factor, partial [Arabidopsis thaliana]
Length=237

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + D+FS QEEELII+ H  IGSRW+ IA++LPGRTDNDVKN WNTKLKKKL  MGIDPVT
Sbjct  13   KHDSFSTQEEELIIECHRAIGSRWSSIARKLPGRTDNDVKNHWNTKLKKKLMKMGIDPVT  72

Query  201  HKPFSQILADYGNIGG  248
            HKP SQ+LA++ NI G
Sbjct  73   HKPVSQLLAEFRNISG  88



>ref|XP_002511489.1| hypothetical protein RCOM_1512980 [Ricinus communis]
 gb|EEF52091.1| hypothetical protein RCOM_1512980 [Ricinus communis]
Length=266

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 98/275 (36%), Positives = 140/275 (51%), Gaps = 55/275 (20%)
 Frame = +3

Query  180  MGIDPVTHKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTII--------------  317
            MGIDPVTHKPFSQILADYGNIG  P   +R    G+L R LK   I              
Sbjct  1    MGIDPVTHKPFSQILADYGNIGCIPKYGTR---IGSLTRDLKNAFISRPEPHPSPPEGIP  57

Query  318  -MSSKSQKLSADQPSSRAAADCCFLHTTTNKIKSSEED-DSNQYMDLLSELQAIKSITES  491
             ++S+    +A           CFL+ T+N I  ++ + + +  +DL  +LQAIK  TE+
Sbjct  58   NINSQLATTTALMQPKVELIQECFLNYTSNNININDANTNPDPSLDLFDQLQAIKLATEA  117

Query  492  T---NYSSAAAPDSTIVVsppsslssltsplaaaaaaQEKAG--FSWCDDFLLEDAFLPL  656
            +   +Y   AA      ++  S  SS +S    + AAQE +   FSW  DFLLEDAFLP 
Sbjct  118  SRCADYEKIAAH----FLNEGSLSSSASSSSTCSTAAQENSALNFSW-RDFLLEDAFLPS  172

Query  657  N------------NVQQSSDWEPNHNNNTSPQD---------IIKIs----sspsssnsn  761
            +            N+   +D      N   PQ           +++     + PS+S+  
Sbjct  173  DHHPQEQEIDNAMNLSSKNDLTSQGQNVVIPQGETANARDNRQVRVEGMDLAMPSTSSFQ  232

Query  762  leaassssFVEAMLSREDHDMFLDFPGLSEEPFYY  866
            ++++S +SFVEAML++E+ ++FLDFP L EE F Y
Sbjct  233  VQSSSHTSFVEAMLNQEN-EIFLDFPNLLEEQFSY  266



>ref|XP_010514552.1| PREDICTED: transcription repressor MYB6-like [Camelina sativa]
Length=323

 Score = 92.8 bits (229),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + D+FSPQEEELII+ H  IGSRW+ IA++LPGRTDNDVKN WNTKLKKKL  MGIDPVT
Sbjct  66   KHDSFSPQEEELIIQCHRVIGSRWSSIARKLPGRTDNDVKNHWNTKLKKKLMKMGIDPVT  125

Query  201  HKPFSQILADYGNIGG  248
            HKP SQ++ ++ NI G
Sbjct  126  HKPVSQVVLEFRNISG  141



>emb|CDX83798.1| BnaC08g18470D [Brassica napus]
Length=314

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 99/293 (34%), Positives = 159/293 (54%), Gaps = 47/293 (16%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSR-WTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPV  197
            + ++F+P+EE+LIIK+HA +GSR W +IAQ LPG+T+ +VK +WN+KLKKKLS MGID V
Sbjct  58   KHESFTPEEEDLIIKMHAAMGSRLWPLIAQHLPGKTEEEVKMVWNSKLKKKLSQMGIDHV  117

Query  198  THKPFSQILADYGNIGGFPTSTSRP---PQFGTLNRALKTTIIMSSKSQKLSADQPSSRA  368
            TH+PFS +LA+YGNI G    T  P    Q G+L                     PS   
Sbjct  118  THRPFSHVLAEYGNINGGGGGTLNPNPMNQTGSL------------------GPNPS---  156

Query  369  AADCCFLHTTTNKIKSSEEDDSNQYMDLLSELQAIKSITESTNYSSAAAPDSTIVVspps  548
                  L+  +++ +  + +DS    DL+  LQAIK +TES+N      P+ST + +  S
Sbjct  157  ------LNEDSHQQQQQQSNDSG---DLMFHLQAIKLMTESSN---QVKPESTFMYASSS  204

Query  549  slssltspl----aaaaaaQEKAGFSWCDDFLLEDAFLPLNNVQQSSDWEPNH---NNNT  707
            S +S         +  A    +  F+W D  L ++ F    N Q   D E ++   N  +
Sbjct  205  SSNSSPPLFSSTCSTIAQENSEVNFTWSDFLLDQETF--NENQQNYPDQELDNLFGNEFS  262

Query  708  SPQDIIKIssspsssnsnleaassssFVEAMLSREDHDMFLDFPGLSEEPFYY  866
              + +  ++++ +      E + S+ FVE+++++E  ++FL FP   ++PF++
Sbjct  263  EAEAVATVANTSAPDARIEEESLSNGFVESIIAKEK-ELFLGFPSYLDQPFHF  314



>ref|XP_010502849.1| PREDICTED: transcription repressor MYB6-like isoform X2 [Camelina 
sativa]
Length=325

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + D+FSPQEEELII+ H  IGSRW+ IA++LPGRTDNDVKN WNTKLKKKL  MGIDPVT
Sbjct  66   KHDSFSPQEEELIIQCHRVIGSRWSSIARKLPGRTDNDVKNHWNTKLKKKLMKMGIDPVT  125

Query  201  HKPFSQILADYGNIGG  248
            HKP SQ++ ++ NI G
Sbjct  126  HKPVSQVVLEFRNISG  141



>ref|XP_010425627.1| PREDICTED: transcription repressor MYB6-like [Camelina sativa]
Length=329

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + D+FSPQEEELII+ H  IGSRW+ IA++LPGRTDNDVKN WNTKLKKKL  MGIDPVT
Sbjct  66   KHDSFSPQEEELIIQCHRAIGSRWSSIARKLPGRTDNDVKNHWNTKLKKKLMKMGIDPVT  125

Query  201  HKPFSQILADYGNIGG  248
            HKP SQ++ ++ NI G
Sbjct  126  HKPVSQVVLEFRNISG  141



>ref|XP_001779423.1| predicted protein [Physcomitrella patens]
 gb|EDQ55813.1| predicted protein [Physcomitrella patens]
Length=136

 Score = 89.0 bits (219),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            +   FS  EE+LI+ LHAT+GSRW++IA QLPGRTDNDVKN WN++LK+KL  MGIDP+T
Sbjct  66   KHGRFSEYEEQLIVHLHATLGSRWSLIAAQLPGRTDNDVKNYWNSRLKRKLCEMGIDPIT  125

Query  201  HKPFSQILAD  230
            HKP SQ+LAD
Sbjct  126  HKPISQLLAD  135



>ref|XP_010502848.1| PREDICTED: protein ODORANT1-like isoform X1 [Camelina sativa]
Length=355

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + D+FSPQEEELII+ H  IGSRW+ IA++LPGRTDNDVKN WNTKLKKKL  MGIDPVT
Sbjct  96   KHDSFSPQEEELIIQCHRVIGSRWSSIARKLPGRTDNDVKNHWNTKLKKKLMKMGIDPVT  155

Query  201  HKPFSQILADYGNIGG  248
            HKP SQ++ ++ NI G
Sbjct  156  HKPVSQVVLEFRNISG  171



>ref|NP_189488.1| protein DEFECTIVE IN MERISTEM DEVELOPMENT AND FUNCTION 1 [Arabidopsis 
thaliana]
 dbj|BAB02863.1| transcription factor-like protein [Arabidopsis thaliana]
 gb|AAS10061.1| MYB transcription factor [Arabidopsis thaliana]
 gb|ABE65977.1| myb family transcription factor [Arabidopsis thaliana]
 gb|AEE77449.1| myb domain protein 35 [Arabidopsis thaliana]
Length=317

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + D+FS QEEELII+ H  IGSRW+ IA++LPGRTDNDVKN WNTKLKKKL  MGIDPVT
Sbjct  66   KHDSFSTQEEELIIECHRAIGSRWSSIARKLPGRTDNDVKNHWNTKLKKKLMKMGIDPVT  125

Query  201  HKPFSQILADYGNIGG  248
            HKP SQ+LA++ NI G
Sbjct  126  HKPVSQLLAEFRNISG  141



>gb|ABK28578.1| unknown [Arabidopsis thaliana]
Length=318

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + D+FS QEEELII+ H  IGSRW+ IA++LPGRTDNDVKN WNTKLKKKL  MGIDPVT
Sbjct  66   KHDSFSTQEEELIIECHRAIGSRWSSIARKLPGRTDNDVKNHWNTKLKKKLMKMGIDPVT  125

Query  201  HKPFSQILADYGNIGG  248
            HKP SQ+LA++ NI G
Sbjct  126  HKPVSQLLAEFRNISG  141



>ref|XP_010670356.1| PREDICTED: protein ODORANT1 [Beta vulgaris subsp. vulgaris]
Length=331

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 73/98 (74%), Gaps = 4/98 (4%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + + F+ QEE+LII+ HA IGSRW++IA+ LPGRTDNDVKN WNTKLKKKL+ MGIDPVT
Sbjct  66   KHEEFTEQEEQLIIQYHAAIGSRWSLIAKHLPGRTDNDVKNYWNTKLKKKLTKMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTI  314
            HKP S+ L+DY +I    T+     Q  +L++ L T+ 
Sbjct  126  HKPISKCLSDYESISCLTTNH----QIRSLDQTLATSF  159



>emb|CDP20600.1| unnamed protein product [Coffea canephora]
Length=335

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 72/103 (70%), Gaps = 5/103 (5%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + DNF+P+EEE I++LH TIGSR     QQLPGRTDNDVKN WNTKLKKKL  MGIDPVT
Sbjct  66   KHDNFTPEEEECILELHRTIGSR-----QQLPGRTDNDVKNYWNTKLKKKLFNMGIDPVT  120

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSK  329
            HKPFSQI  ++G +G  P++ ++     T  R     +++  K
Sbjct  121  HKPFSQIFTEFGKLGNLPSTINQNALLNTEPRIKPEPLLLPQK  163



>ref|XP_010928123.1| PREDICTED: transcription factor MYB12 [Elaeis guineensis]
Length=331

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 66/89 (74%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE+ I+KLH+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSECEEQTIVKLHSVVGNRWSLIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T RPPQ   L  A
Sbjct  130  SHLMAEI-------ATTLRPPQVAHLAEA  151



>ref|XP_001759297.1| predicted protein [Physcomitrella patens]
 ref|XP_001764004.1| predicted protein [Physcomitrella patens]
 gb|EDQ71143.1| predicted protein [Physcomitrella patens]
 gb|EDQ75981.1| predicted protein [Physcomitrella patens]
Length=136

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            +   F+  EE+LI+ LHA +GSRW++IA QLPGRTDNDVKN WNT+LKKKL  MGIDP+T
Sbjct  66   KHGRFTDHEEQLIVNLHAALGSRWSLIAAQLPGRTDNDVKNYWNTRLKKKLCEMGIDPIT  125

Query  201  HKPFSQILAD  230
            HKP SQ+LAD
Sbjct  126  HKPISQLLAD  135



>emb|CDY64987.1| BnaA02g35490D, partial [Brassica napus]
Length=239

 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 65/89 (73%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE +I+K H+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSDAEEHIIVKFHSVLGNRWSLIAAQLPGRTDNDVKNYWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+        T+T  PPQ   L  A
Sbjct  130  SHLMAEI-------TTTLNPPQVSHLAEA  151



>gb|KFK44043.1| hypothetical protein AALP_AA1G208100 [Arabis alpina]
Length=314

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +3

Query  9    HHHQEQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGI  188
            H     ++F+ +EE+LIIK+HA +GSRW +IAQQLPG+T+ +VK  WN+KLKKKLS MGI
Sbjct  58   HSGTNNESFTAEEEDLIIKMHAAMGSRWPLIAQQLPGKTEEEVKMFWNSKLKKKLSEMGI  117

Query  189  DPVTHKPFSQILADY  233
            DPVTH+PFS ILA+Y
Sbjct  118  DPVTHRPFSHILAEY  132



>ref|XP_009402030.1| PREDICTED: myb-related protein Myb4 [Musa acuminata subsp. malaccensis]
Length=323

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 65/89 (73%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE+ I+KLHA +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSEAEEQTIVKLHAVVGNRWSLIAGQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PPQ   L  A
Sbjct  130  SHLMAEI-------ATTLAPPQVAHLAEA  151



>emb|CDY57424.1| BnaCnng32030D [Brassica napus]
Length=320

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 65/89 (73%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE +I+K H+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSEAEEHIIVKFHSVLGNRWSLIAAQLPGRTDNDVKNYWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+        T+T  PPQ   L  A
Sbjct  130  SHLMAEI-------TTTLNPPQVSHLAEA  151



>gb|AIT71167.1| MYB80 [Brassica oleracea]
Length=320

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 65/89 (73%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE +I+K H+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSEAEEHIIVKFHSVLGNRWSLIAAQLPGRTDNDVKNYWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+        T+T  PPQ   L  A
Sbjct  130  SHLMAEI-------TTTLNPPQVSHLAEA  151



>ref|NP_200422.1| myb domain protein 103 [Arabidopsis thaliana]
 gb|AAD40692.1|AF048839_1 Atmyb103 [Arabidopsis thaliana]
 dbj|BAB09293.1| Atmyb103 [Arabidopsis thaliana]
 gb|AAS10109.1| MYB transcription factor [Arabidopsis thaliana]
 dbj|BAH30631.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED96722.1| myb domain protein 103 [Arabidopsis thaliana]
Length=320

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 65/89 (73%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE +I+K H+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSEAEEHIIVKFHSVLGNRWSLIAAQLPGRTDNDVKNYWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+        T+T  PPQ   L  A
Sbjct  130  SHLMAEI-------TTTLNPPQVSHLAEA  151



>emb|CDY17391.1| BnaA10g10250D [Brassica napus]
Length=320

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 65/89 (73%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE +I+K H+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSEAEEHIIVKFHSVLGNRWSLIAAQLPGRTDNDVKNYWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+        T+T  PPQ   L  A
Sbjct  130  SHLMAEI-------TTTLNPPQVSHLAEA  151



>ref|XP_006281519.1| hypothetical protein CARUB_v10027619mg [Capsella rubella]
 gb|EOA14417.1| hypothetical protein CARUB_v10027619mg [Capsella rubella]
Length=325

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 65/89 (73%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE +I+K H+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSEAEEHIIVKFHSVLGNRWSLIAAQLPGRTDNDVKNYWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+        T+T  PPQ   L  A
Sbjct  130  SHLMAEI-------TTTLNPPQVSHLAEA  151



>ref|XP_010450666.1| PREDICTED: myb-related protein Zm38-like [Camelina sativa]
Length=327

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 65/89 (73%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE +I+K H+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSEAEEHIIVKFHSVLGNRWSLIAAQLPGRTDNDVKNYWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+        T+T  PPQ   L  A
Sbjct  130  SHLMAEI-------TTTLNPPQVSHLAEA  151



>ref|XP_010483078.1| PREDICTED: myb-related protein Zm38-like [Camelina sativa]
Length=322

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 65/89 (73%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE +I+K H+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSEAEEHIIVKFHSVLGNRWSLIAAQLPGRTDNDVKNYWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+        T+T  PPQ   L  A
Sbjct  130  SHLMAEI-------TTTLNPPQVSHLAEA  151



>ref|XP_010443249.1| PREDICTED: myb-related protein Zm38-like [Camelina sativa]
Length=328

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 65/89 (73%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE +I+K H+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSEAEEHIIVKFHSVLGNRWSLIAAQLPGRTDNDVKNYWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+        T+T  PPQ   L  A
Sbjct  130  SHLMAEI-------TTTLNPPQVSHLAEA  151



>ref|XP_009126966.1| PREDICTED: transcription repressor MYB4-like [Brassica rapa]
Length=320

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 65/89 (73%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE +I+K H+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSDAEEHIIVKFHSVLGNRWSLIAAQLPGRTDNDVKNYWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+        T+T  PPQ   L  A
Sbjct  130  SHLMAEI-------TTTLNPPQVSHLAEA  151



>ref|XP_002864434.1| AtMYB103/AtMYB80 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40693.1| AtMYB103/AtMYB80 [Arabidopsis lyrata subsp. lyrata]
Length=324

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 65/89 (73%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE +I+K H+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSETEEHIIVKFHSVLGNRWSLIAGQLPGRTDNDVKNYWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+        T+T  PPQ   L  A
Sbjct  130  SHLMAEI-------TTTLNPPQVSHLAEA  151



>ref|XP_008787076.1| PREDICTED: myb-related protein 330-like [Phoenix dactylifera]
Length=309

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 66/88 (75%), Gaps = 3/88 (3%)
 Frame = +3

Query  3    HHHHHQEQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAM  182
            H +   + + F+PQEEE IIKLHAT+GSRW++IA QLPGRTDNDVKN WNTKLKKKL   
Sbjct  60   HLNPDLKHERFTPQEEEEIIKLHATLGSRWSMIASQLPGRTDNDVKNYWNTKLKKKLLEE  119

Query  183  GIDPVTHKPFSQILADYGNIGGFPTSTS  266
            GIDP TH+P S I+     IGGFP + +
Sbjct  120  GIDPFTHRPISDIIQ---IIGGFPATAT  144



>gb|AIT71165.1| MYB80 [Brassica napus]
 gb|AIT71166.1| MYB80 [Brassica juncea]
Length=320

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 65/89 (73%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE +I+K H+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSDAEEHIIVKFHSVLGNRWSLIAAQLPGRTDNDVKNYWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+        T+T  PPQ   L  A
Sbjct  130  SHLMAEI-------TTTLNPPQVSHLAEA  151



>ref|XP_001780718.1| predicted protein [Physcomitrella patens]
 gb|EDQ54502.1| predicted protein [Physcomitrella patens]
Length=154

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = +3

Query  30   NFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKP  209
            +F+PQEE+LI+KLHA  GSRW++IA Q+PGRTDND+KN WNT+LKKKL  MGIDPVTHKP
Sbjct  68   SFTPQEEDLIVKLHAAHGSRWSLIAAQMPGRTDNDIKNHWNTRLKKKLCDMGIDPVTHKP  127

Query  210  FSQILADY-GNIG  245
             + +L D  G +G
Sbjct  128  IADLLRDLAGTMG  140



>ref|XP_010092389.1| Transcription factor [Morus notabilis]
 gb|EXB51065.1| Transcription factor [Morus notabilis]
Length=325

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 65/89 (73%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE+ I+KLH+ +G+RW+IIA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSDAEEQTIVKLHSIVGNRWSIIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PPQ   L  A
Sbjct  130  SHLMAEI-------ATTLEPPQVAHLAEA  151



>ref|XP_008219084.1| PREDICTED: transcription repressor MYB4 [Prunus mume]
Length=325

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 65/89 (73%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE+ I+KLH+ +G+RW+IIA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSDAEEQTIVKLHSVVGNRWSIIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PPQ   L  A
Sbjct  130  SHLMAEI-------ATTLAPPQVAHLAEA  151



>ref|XP_006401377.1| hypothetical protein EUTSA_v10015622mg [Eutrema salsugineum]
 gb|ESQ42830.1| hypothetical protein EUTSA_v10015622mg [Eutrema salsugineum]
Length=325

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 65/89 (73%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            F+  EE +I+K H+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FTEAEEHIIVKFHSVLGNRWSLIAAQLPGRTDNDVKNYWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+        T+T  PPQ   L  A
Sbjct  130  SHLMAEI-------TTTLNPPQVSHLAEA  151



>ref|XP_007206619.1| hypothetical protein PRUPE_ppa021719mg [Prunus persica]
 gb|EMJ07818.1| hypothetical protein PRUPE_ppa021719mg [Prunus persica]
Length=325

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 65/89 (73%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE+ I+KLH+ +G+RW+IIA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSDAEEQTIVKLHSVVGNRWSIIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PPQ   L  A
Sbjct  130  SHLMAEI-------ATTLAPPQVAHLAEA  151



>ref|XP_006474780.1| PREDICTED: myb-related protein 330-like isoform X2 [Citrus sinensis]
Length=323

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 66/93 (71%), Gaps = 7/93 (8%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
             +  FS  EE+ IIKLH+ +G+RW++IA QLPGRTDNDVKN WNTKLKK+LS MGIDPVT
Sbjct  66   RRGQFSDTEEQTIIKLHSVVGNRWSLIAAQLPGRTDNDVKNHWNTKLKKRLSGMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            HKPFS ++A+         +T  PPQ   L  A
Sbjct  126  HKPFSHLMAEI-------ATTLAPPQVAHLAEA  151



>ref|XP_007020342.1| Myb domain protein 103 [Theobroma cacao]
 gb|EOY11867.1| Myb domain protein 103 [Theobroma cacao]
Length=331

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 65/89 (73%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE+ I+KLH+ +G+RW++IA QLPGRTDNDVKN WNTKLKK+LS MGIDPVTHKPF
Sbjct  70   FSEAEEQTIVKLHSVVGNRWSLIAAQLPGRTDNDVKNHWNTKLKKRLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PPQ   L  A
Sbjct  130  SHLMAEI-------ATTLAPPQVAHLAEA  151



>ref|XP_008813758.1| PREDICTED: transcription factor MYB12 [Phoenix dactylifera]
Length=334

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 65/89 (73%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE+ I+KLH+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSESEEQTIVKLHSVVGNRWSLIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PPQ   L  A
Sbjct  130  SHLMAEI-------ATTLAPPQVAHLAEA  151



>ref|XP_010539349.1| PREDICTED: myb-related protein Zm38 [Tarenaya hassleriana]
Length=298

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 64/89 (72%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE  I+K H+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSEAEEHTIVKYHSVLGNRWSLIAAQLPGRTDNDVKNYWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+        T+T  PPQ   L  A
Sbjct  130  SHLMAEI-------TTTLNPPQVSHLAEA  151



>ref|XP_006474779.1| PREDICTED: myb-related protein 330-like isoform X1 [Citrus sinensis]
Length=354

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 66/93 (71%), Gaps = 7/93 (8%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
             +  FS  EE+ IIKLH+ +G+RW++IA QLPGRTDNDVKN WNTKLKK+LS MGIDPVT
Sbjct  97   RRGQFSDTEEQTIIKLHSVVGNRWSLIAAQLPGRTDNDVKNHWNTKLKKRLSGMGIDPVT  156

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            HKPFS ++A+         +T  PPQ   L  A
Sbjct  157  HKPFSHLMAEI-------ATTLAPPQVAHLAEA  182



>ref|XP_001781133.1| predicted protein [Physcomitrella patens]
 gb|EDQ54081.1| predicted protein [Physcomitrella patens]
Length=127

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  30   NFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKP  209
            +FS +EE+LI+KLH + GSRW++IA QLPGRTDND+KN WNT+LKKKL  MGIDPVTHKP
Sbjct  60   SFSEEEEDLIVKLHTSHGSRWSLIAAQLPGRTDNDIKNHWNTRLKKKLCDMGIDPVTHKP  119

Query  210  FSQILAD  230
             +Q+L D
Sbjct  120  IAQLLRD  126



>gb|AIT71168.1| MYB80-1 [Gossypium hirsutum]
Length=336

 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 65/89 (73%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE+ I+KLH+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSNAEEQTIVKLHSVVGNRWSLIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PPQ   L  A
Sbjct  130  SHLMAEI-------ATTLAPPQVAHLAEA  151



>gb|KFK27181.1| hypothetical protein AALP_AA8G346300 [Arabis alpina]
Length=434

 Score = 88.6 bits (218),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 65/89 (73%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE +I+K H+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  177  FSEAEEHIIVKFHSVLGNRWSLIAAQLPGRTDNDVKNYWNTKLKKKLSGMGIDPVTHKPF  236

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+        T+T  PPQ   L  A
Sbjct  237  SHLMAEI-------TTTLNPPQVSHLAEA  258



>ref|XP_002268897.1| PREDICTED: transcription repressor MYB4 [Vitis vinifera]
Length=325

 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 65/89 (73%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE+ I+KLH+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSDAEEQTIVKLHSVVGNRWSLIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PPQ   L  A
Sbjct  130  SHLMAEI-------ATTLAPPQVAHLAEA  151



>ref|XP_009120123.1| PREDICTED: protein ODORANT1 [Brassica rapa]
Length=320

 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 65/89 (73%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE +I+K H+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS +GIDPVTHKPF
Sbjct  70   FSEAEEHIIVKFHSVLGNRWSLIAAQLPGRTDNDVKNYWNTKLKKKLSGIGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+        T+T  PPQ   L  A
Sbjct  130  SHLMAEI-------TTTLNPPQVSHLAEA  151



>emb|CBI39810.3| unnamed protein product [Vitis vinifera]
Length=330

 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 65/89 (73%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE+ I+KLH+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  75   FSDAEEQTIVKLHSVVGNRWSLIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPF  134

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PPQ   L  A
Sbjct  135  SHLMAEI-------ATTLAPPQVAHLAEA  156



>gb|AIS24254.1| MYB80 [Lilium hybrid division VII]
Length=302

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 64/89 (72%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE+ I+KLHA +G+RW++I  QLPGRTDNDVKN WNTKLKKKLS+MGIDPVTHKPF
Sbjct  70   FSKSEEQTIVKLHAVVGNRWSLITAQLPGRTDNDVKNYWNTKLKKKLSSMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+       P     PPQ   L  A
Sbjct  130  SHLMAEIAT--ALP-----PPQMANLTDA  151



>ref|XP_006452739.1| hypothetical protein CICLE_v10008921mg [Citrus clementina]
 gb|ESR65979.1| hypothetical protein CICLE_v10008921mg [Citrus clementina]
Length=323

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 66/93 (71%), Gaps = 7/93 (8%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
             +  FS  EE+ I+KLH+ +G+RW++IA QLPGRTDNDVKN WNTKLKK+LS MGIDPVT
Sbjct  66   RRGQFSDTEEQTIMKLHSVVGNRWSLIAAQLPGRTDNDVKNHWNTKLKKRLSGMGIDPVT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            HKPFS ++A+         +T  PPQ   L  A
Sbjct  126  HKPFSHLMAEI-------ATTLAPPQVAHLAEA  151



>ref|XP_008349609.1| PREDICTED: transcription factor MYB39-like [Malus domestica]
 ref|XP_008359028.1| PREDICTED: transcription factor MYB39-like [Malus domestica]
Length=331

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 66/89 (74%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE++I+KLH+ +G+RW++IA +LPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSDAEEQIIVKLHSIVGNRWSLIAARLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PPQ   L  A
Sbjct  130  SHLMAEI-------ATTLEPPQAAHLAEA  151



>ref|XP_010244825.1| PREDICTED: transcription factor MYB28 [Nelumbo nucifera]
Length=335

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 65/89 (73%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE+ I+KLH+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSESEEQTIVKLHSVVGNRWSLIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PPQ   L  A
Sbjct  130  SHLMAEI-------ATTLPPPQVAHLAEA  151



>ref|XP_008449008.1| PREDICTED: myb-related protein 308 isoform X1 [Cucumis melo]
Length=320

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 65/89 (73%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE+ I+KLH+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSDIEEQTIVKLHSVVGNRWSLIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PPQ   L  A
Sbjct  130  SHLMAEI-------ATTLAPPQVAHLAEA  151



>ref|XP_002890308.1| hypothetical protein ARALYDRAFT_472119 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66567.1| hypothetical protein ARALYDRAFT_472119 [Arabidopsis lyrata subsp. 
lyrata]
Length=262

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 99/176 (56%), Gaps = 36/176 (20%)
 Frame = +3

Query  9    HHHQEQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGI  188
            H   + ++F+ +EE+LIIK+HA +GSRW +IAQ LPG+T+ +VK  WNTKLKKKLS MGI
Sbjct  55   HSGTKHESFTSEEEDLIIKMHAAMGSRWQLIAQHLPGKTEEEVKMFWNTKLKKKLSEMGI  114

Query  189  DPVTHKPFSQILADYGNIGGFPTSTSRP-PQFGTLNRALKTTIIMSSKSQKLSADQPSSR  365
            D VTH+PFS +LA+YGNI G       P  Q G+L R           +  L+ D     
Sbjct  115  DHVTHRPFSHVLAEYGNINGGGNINPNPLNQAGSLGR-----------NHSLNDDAH---  160

Query  366  AAADCCFLHTTTNKIKSSEEDDSNQYMDLLSELQAIKSITESTNYSSAAAPDSTIV  533
                           +  + DDS    DL+  LQAIK +TES+N      P+ST V
Sbjct  161  ---------------QQQQPDDSG---DLMFHLQAIKLMTESSN---QVKPESTFV  195



>ref|XP_009110308.1| PREDICTED: myb-related protein 308 [Brassica rapa]
Length=317

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 97/283 (34%), Positives = 152/283 (54%), Gaps = 46/283 (16%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + ++F+P+EE+LIIK+HA +GSRW +IAQ LPG+T+ +VK +WN+KLKKKLS MGID VT
Sbjct  62   KHESFTPEEEDLIIKMHAAMGSRWPLIAQHLPGKTEEEVKMVWNSKLKKKLSQMGIDHVT  121

Query  201  HKPFSQILADYGNIGGFPTSTSRPP---QFGTLNRALKTTIIMSSKSQKLSADQPSSRAA  371
            H+PFS +LA+YGNI G       P    Q G+L                     PS    
Sbjct  122  HRPFSHVLAEYGNINGGGGGNLNPNPMNQTGSL------------------GPNPS----  159

Query  372  ADCCFLHTTTNKIKSSEEDDSNQYMDLLSELQAIKSITESTNYSSAAAPDSTIVVsppss  551
                 L+  +++ +  + +DS    DL+  LQAIK +TES+N      PDST + +  SS
Sbjct  160  -----LNEDSHQQQQQQSNDSG---DLMFHLQAIKLMTESSN---QVKPDSTFMYASSSS  208

Query  552  lssltspl----aaaaaaQEKAGFSWCDDFLLEDAFLPLNNVQQSSDWEPNH---NNNTS  710
             +S         +  A    +  F+W D  L ++ F    N Q   D E ++   N  + 
Sbjct  209  SNSSPPLFSSTCSTIAQENSEVNFTWSDFLLDQETF--NENQQNFPDQELDNLFGNEFSE  266

Query  711  PQDIIKIssspsssnsnleaassssFVEAMLSREDHDMFLDFP  839
             + +  ++++ +      E + S+ FVE+++++E  ++FL FP
Sbjct  267  AEAVATMANTSAPDAQMEEESLSNGFVESIIAKEK-ELFLGFP  308



>ref|XP_004148287.1| PREDICTED: transcription factor MYB32-like [Cucumis sativus]
 ref|XP_004162790.1| PREDICTED: transcription factor MYB32-like [Cucumis sativus]
Length=320

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 65/89 (73%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE+ I+KLH+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSDIEEQTIVKLHSVVGNRWSLIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PPQ   L  A
Sbjct  130  SHLMAEI-------ATTLAPPQVAHLAEA  151



>gb|KHN01809.1| Transcription factor MYB39 [Glycine soja]
Length=325

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 64/89 (72%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE+ I+KLH+  G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSDSEEQTIVKLHSVFGNRWSLIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PPQ   L  A
Sbjct  130  SHLMAEIA-------TTLAPPQAAHLAEA  151



>ref|XP_007146695.1| hypothetical protein PHAVU_006G061600g [Phaseolus vulgaris]
 gb|ESW18689.1| hypothetical protein PHAVU_006G061600g [Phaseolus vulgaris]
Length=325

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 64/89 (72%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE+ I+KLH+  G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSDSEEQTIVKLHSVFGNRWSLIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PPQ   L  A
Sbjct  130  SHLMAEIA-------TTLAPPQAAHLAEA  151



>ref|XP_003530827.1| PREDICTED: myb-related protein 315-like [Glycine max]
Length=325

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 64/89 (72%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE+ I+KLH+  G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSDSEEQTIVKLHSVFGNRWSLIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PPQ   L  A
Sbjct  130  SHLMAEIA-------TTLAPPQAAHLAEA  151



>ref|XP_001761131.1| predicted protein [Physcomitrella patens]
 gb|EDQ74198.1| predicted protein [Physcomitrella patens]
Length=163

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            F P+EE+LI+KLHA  GSRW++IA Q+PGRTDND+KN WNT+LKKKL  MGIDPVTHKP 
Sbjct  69   FDPEEEDLIVKLHAAHGSRWSLIAAQMPGRTDNDIKNHWNTRLKKKLCDMGIDPVTHKPI  128

Query  213  SQILAD  230
            + +L D
Sbjct  129  ADLLRD  134



>ref|XP_004500173.1| PREDICTED: transcription repressor MYB4-like [Cicer arietinum]
Length=325

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 64/89 (72%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE+ I+KLH+  G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSDAEEQTIVKLHSVFGNRWSLIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PPQ   L  A
Sbjct  130  SHLMAEIA-------TTLAPPQAAHLAEA  151



>gb|KEH34120.1| myb transcription factor [Medicago truncatula]
Length=325

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 64/89 (72%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE+ I+KLH+  G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSDGEEQTIVKLHSVFGNRWSLIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PPQ   L  A
Sbjct  130  SHLMAEIA-------TTLAPPQAAHLAEA  151



>ref|XP_010676132.1| PREDICTED: myb-related protein 315 [Beta vulgaris subsp. vulgaris]
Length=316

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 64/89 (72%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EEE I+KLHA +G+RW++IA QLPGRTDNDVKN WNTKLKKKL+ MGIDPVTHK F
Sbjct  70   FSQPEEETIMKLHAVVGNRWSLIAAQLPGRTDNDVKNHWNTKLKKKLTGMGIDPVTHKSF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PPQ   L  A
Sbjct  130  SHLMAEI-------ATTLGPPQVANLTEA  151



>gb|EPS72419.1| hypothetical protein M569_02341, partial [Genlisea aurea]
Length=169

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 63/89 (71%), Gaps = 8/89 (9%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EEE I+ LH+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSEAEEETIVTLHSVLGNRWSVIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++ +   I   P     PPQ   L  A
Sbjct  130  SHLITE---IATLP-----PPQAPNLAEA  150



>ref|XP_009348787.1| PREDICTED: transcription repressor MYB4 [Pyrus x bretschneideri]
Length=327

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 63/82 (77%), Gaps = 7/82 (9%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE++I+KLH+ +G+RW++IA +LPGRTDNDVKN WN KLKKKLS MGIDPVTHKPF
Sbjct  70   FSDAEEQIIVKLHSIVGNRWSLIAARLPGRTDNDVKNHWNIKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQ  278
            S ++A+         +T  PPQ
Sbjct  130  SHLMAEI-------ATTLEPPQ  144



>gb|KHN31714.1| Transcription factor MYB39 [Glycine soja]
Length=326

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 64/89 (72%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE+ I+KLH+  G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSDSEEQTIVKLHSVFGNRWSLIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PPQ   L  A
Sbjct  130  SHLMAEIA-------TTLAPPQAAHLAEA  151



>ref|XP_010063219.1| PREDICTED: protein ODORANT1 [Eucalyptus grandis]
 gb|KCW70426.1| hypothetical protein EUGRSUZ_F03656 [Eucalyptus grandis]
Length=326

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE+ I++LHA +G+RW+IIA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSEAEEQTIMRLHAVLGNRWSIIAAQLPGRTDNDVKNYWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILAD  230
            S ++A+
Sbjct  130  SHLMAE  135



>ref|XP_003552981.1| PREDICTED: uncharacterized protein LOC100800764 [Glycine max]
Length=326

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 64/89 (72%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE+ I+KLH+  G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSDSEEQTIVKLHSVFGNRWSLIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PPQ   L  A
Sbjct  130  SHLMAEIA-------TTLAPPQAAHLAEA  151



>ref|XP_008353730.1| PREDICTED: transcriptional activator Myb [Malus domestica]
Length=329

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 64/89 (72%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE+ I+K H+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSDAEEQTIVKYHSVVGNRWSLIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PPQ   L  A
Sbjct  130  SHLMAEI-------ATTLAPPQVAHLAEA  151



>ref|XP_004294888.1| PREDICTED: transcription repressor MYB4-like [Fragaria vesca 
subsp. vesca]
Length=326

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 63/89 (71%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE+ I+KLH+ +G+RW +IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSDAEEQTIVKLHSVVGNRWYLIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PP    L  A
Sbjct  130  SHLMAEI-------ATTLAPPNVANLAEA  151



>ref|XP_009602016.1| PREDICTED: transcription factor MYB3 [Nicotiana tomentosiformis]
Length=324

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 64/89 (72%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE+ I+ LH+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSEAEEQTIVTLHSVLGNRWSVIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++++  N       T  PPQ   L  A
Sbjct  130  SHLISEIAN-------TLSPPQVPHLAEA  151



>gb|AIT52321.1| MYB family protein [Jatropha curcas]
Length=329

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 63/89 (71%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE  I+KLH+  G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSDAEEHTIVKLHSVFGNRWSLIANQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PPQ   L  A
Sbjct  130  SHLMAEI-------ATTLAPPQVTHLAEA  151



>ref|XP_009767695.1| PREDICTED: transcription repressor MYB4 [Nicotiana sylvestris]
Length=322

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 64/89 (72%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE+ I+ LH+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSEAEEQTIVTLHSVLGNRWSVIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++++  N       T  PPQ   L  A
Sbjct  130  SHLISEIAN-------TLSPPQVPHLAEA  151



>ref|XP_011000363.1| PREDICTED: transcription factor MYB32-like [Populus euphratica]
Length=327

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE  I+KLH+ +G+RW++IA QLPGRTDNDVKN WNTKLK+KLS MGIDPVTHKPF
Sbjct  70   FSDAEEHTIVKLHSVVGNRWSLIAAQLPGRTDNDVKNHWNTKLKRKLSGMGIDPVTHKPF  129

Query  213  SQILAD  230
            S ++A+
Sbjct  130  SHLMAE  135



>ref|XP_011014679.1| PREDICTED: transcription factor MYB32-like [Populus euphratica]
Length=327

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE  I+KLH+ +G+RW++IA QLPGRTDNDVKN WNTKLK+KLS MGIDPVTHKPF
Sbjct  70   FSDAEEHTIVKLHSVVGNRWSLIAAQLPGRTDNDVKNHWNTKLKRKLSGMGIDPVTHKPF  129

Query  213  SQILAD  230
            S ++A+
Sbjct  130  SHLMAE  135



>ref|XP_006377995.1| hypothetical protein POPTR_0011s17060g [Populus trichocarpa]
 gb|ERP55792.1| hypothetical protein POPTR_0011s17060g [Populus trichocarpa]
Length=327

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE  I+KLH+ +G+RW++IA QLPGRTDNDVKN WNTKLK+KLS MGIDPVTHKPF
Sbjct  70   FSDAEEHTIVKLHSVVGNRWSLIAAQLPGRTDNDVKNHWNTKLKRKLSGMGIDPVTHKPF  129

Query  213  SQILAD  230
            S ++A+
Sbjct  130  SHLMAE  135



>gb|AIT71169.1| MYB80-2 [Gossypium hirsutum]
Length=336

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 64/89 (72%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE+ I+KLH+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS  GIDPVTHKPF
Sbjct  70   FSDAEEQTIVKLHSVVGNRWSLIAAQLPGRTDNDVKNHWNTKLKKKLSGTGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PPQ   L  A
Sbjct  130  SHLMAEI-------ATTLAPPQVAHLAEA  151



>ref|XP_006352557.1| PREDICTED: transcription factor MYB46-like [Solanum tuberosum]
Length=328

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 64/89 (72%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE+ I+ LH+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSEGEEQTIVTLHSVLGNRWSVIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++++         +T  PPQ   L  A
Sbjct  130  SHLISEI-------ATTLSPPQVPHLAEA  151



>ref|XP_004248353.1| PREDICTED: protein ODORANT1 [Solanum lycopersicum]
Length=336

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 64/89 (72%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE+ I+ LH+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSEAEEQTIVTLHSVLGNRWSVIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++++         +T  PPQ   L  A
Sbjct  130  SHLISEI-------ATTLSPPQVPHLAEA  151



>gb|EEE61165.1| hypothetical protein OsJ_15134 [Oryza sativa Japonica Group]
Length=355

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 64/89 (72%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            F+  EE+ IIKLH+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHK F
Sbjct  70   FTDAEEQTIIKLHSVVGNRWSVIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKSF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PPQ   L  A
Sbjct  130  SHLMAEI-------ATTLAPPQVAHLAEA  151



>ref|XP_003579943.1| PREDICTED: myb-related protein Zm38 [Brachypodium distachyon]
Length=351

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 64/89 (72%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            F+  EE+ IIKLH+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHK F
Sbjct  70   FTDAEEQTIIKLHSVVGNRWSVIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKSF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PPQ   L  A
Sbjct  130  SHLMAEI-------ATTLAPPQVAHLAEA  151



>gb|EAY94488.1| hypothetical protein OsI_16260 [Oryza sativa Indica Group]
Length=369

 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 64/89 (72%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            F+  EE+ IIKLH+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHK F
Sbjct  70   FTDAEEQTIIKLHSVVGNRWSVIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKSF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PPQ   L  A
Sbjct  130  SHLMAEI-------ATTLAPPQVAHLAEA  151



>emb|CAH67046.1| OSIGBa0124N08.8 [Oryza sativa Indica Group]
 emb|CAH67208.1| H0418A01.1 [Oryza sativa Indica Group]
Length=372

 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 64/89 (72%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            F+  EE+ IIKLH+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHK F
Sbjct  70   FTDAEEQTIIKLHSVVGNRWSVIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKSF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PPQ   L  A
Sbjct  130  SHLMAEI-------ATTLAPPQVAHLAEA  151



>emb|CAE03051.2| OSJNBa0089K21.5 [Oryza sativa Japonica Group]
Length=372

 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 64/89 (72%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            F+  EE+ IIKLH+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHK F
Sbjct  70   FTDAEEQTIIKLHSVVGNRWSVIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKSF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PPQ   L  A
Sbjct  130  SHLMAEI-------ATTLAPPQVAHLAEA  151



>ref|XP_006653511.1| PREDICTED: myb-related protein 330-like [Oryza brachyantha]
Length=367

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 64/89 (72%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            F+  EE+ IIKLH+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHK F
Sbjct  70   FTDAEEQTIIKLHSVVGNRWSVIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKSF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PPQ   L  A
Sbjct  130  SHLMAEI-------ATTLAPPQVAHLAEA  151



>ref|XP_002299071.1| hypothetical protein POPTR_0001s47430g [Populus trichocarpa]
 gb|EEE83876.1| hypothetical protein POPTR_0001s47430g [Populus trichocarpa]
Length=327

 Score = 82.8 bits (203),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE+ I+KLH+ +G+RW++IA QL GRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSDAEEQTIVKLHSVVGNRWSLIAAQLTGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTST  263
            S ++A+       P  T
Sbjct  130  SHLMAEIATTLATPQVT  146



>ref|XP_011039857.1| PREDICTED: myb-related protein 308 [Populus euphratica]
Length=327

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE+ I+KLH+ +G+RW++IA QL GRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSDAEEQTIVKLHSVVGNRWSLIAAQLTGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTST  263
            S ++A+       P  T
Sbjct  130  SHLMAEIATTLATPQVT  146



>ref|XP_009392068.1| PREDICTED: transcription factor MYB3 [Musa acuminata subsp. malaccensis]
Length=320

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + + F+ +EEE I+ LHATIGSRW+IIA QLPGRTDNDVKN WNTKL KKL   GIDPVT
Sbjct  66   KHEGFTLEEEERIVALHATIGSRWSIIANQLPGRTDNDVKNYWNTKLSKKLCQKGIDPVT  125

Query  201  HKPFSQIL  224
            H+P S+I+
Sbjct  126  HRPISEII  133



>gb|EAZ26586.1| hypothetical protein OsJ_10483 [Oryza sativa Japonica Group]
Length=241

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + +NF+ +EEELI+ LHA +GSRW++IA QLPGRTDNDVKN WNTKL KKL   GIDP+T
Sbjct  66   KHENFTQEEEELIVTLHAMLGSRWSLIANQLPGRTDNDVKNYWNTKLSKKLRQRGIDPIT  125

Query  201  HKPFSQILADYGNI  242
            H+P + ++   G +
Sbjct  126  HRPIADLMQSIGTL  139



>ref|XP_004975922.1| PREDICTED: transcription factor MYB12-like [Setaria italica]
Length=368

 Score = 82.8 bits (203),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 64/89 (72%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            F+  EE+ IIKLH+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHK F
Sbjct  70   FTDAEEQTIIKLHSVVGNRWSVIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKSF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PPQ   L  A
Sbjct  130  SHLMAEI-------ATTLAPPQVAHLAEA  151



>emb|CDP13654.1| unnamed protein product [Coffea canephora]
Length=323

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 63/89 (71%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE+ I+ LH+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSDAEEQTIVTLHSVLGNRWSVIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++ +         +T  PPQ   L  A
Sbjct  130  SHLITEI-------ATTLAPPQVPHLAEA  151



>ref|XP_006649927.1| PREDICTED: myb-related protein Zm38-like [Oryza brachyantha]
Length=308

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + +NF+ +EEELI+ LHA +GSRW++IA QLPGRTDNDVKN WNTKL KKL   GIDP+T
Sbjct  66   KHENFTQEEEELIVTLHAMLGSRWSLIANQLPGRTDNDVKNYWNTKLSKKLRQRGIDPIT  125

Query  201  HKPFSQILADYGNIGGFPTSTS  266
            H+P + ++   G +   P  T+
Sbjct  126  HRPIADLMQSIGTLAIRPPPTA  147



>gb|EYU33741.1| hypothetical protein MIMGU_mgv1a019344mg, partial [Erythranthe 
guttata]
Length=284

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 64/89 (72%), Gaps = 8/89 (9%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE+ I+ LH+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  25   FSDTEEQTIVTLHSVLGNRWSVIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPF  84

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++++         +T  PPQ   L  A
Sbjct  85   SHLISE--------IATLPPPQAPNLAEA  105



>ref|XP_002448013.1| hypothetical protein SORBIDRAFT_06g019650 [Sorghum bicolor]
 gb|EES12341.1| hypothetical protein SORBIDRAFT_06g019650 [Sorghum bicolor]
Length=371

 Score = 82.4 bits (202),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 64/89 (72%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            F+  EE+ IIKLH+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHK F
Sbjct  70   FTDAEEQTIIKLHSVVGNRWSVIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKSF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PPQ   L  A
Sbjct  130  SHLMAEI-------ATTLAPPQVAHLAEA  151



>emb|CDX96687.1| BnaA08g22300D [Brassica napus]
Length=318

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 97/284 (34%), Positives = 152/284 (54%), Gaps = 47/284 (17%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSR-WTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPV  197
            + ++F+P+EE+LIIK+HA +GSR W +IAQ LPG+T+ +VK +WN+KLKKKLS MGID V
Sbjct  62   KHESFTPEEEDLIIKMHAAMGSRLWPLIAQHLPGKTEEEVKMVWNSKLKKKLSQMGIDHV  121

Query  198  THKPFSQILADYGNIGGFPTSTSRPP---QFGTLNRALKTTIIMSSKSQKLSADQPSSRA  368
            TH+PFS +LA+YGNI G       P    Q G+L                     PS   
Sbjct  122  THRPFSHVLAEYGNINGGGGGNLNPNPMNQTGSL------------------GPNPS---  160

Query  369  AADCCFLHTTTNKIKSSEEDDSNQYMDLLSELQAIKSITESTNYSSAAAPDSTIVVspps  548
                  L+  +++ +  + +DS    DL+  LQAIK +TES+N      PDST + +  S
Sbjct  161  ------LNEDSHQQQQQQSNDSG---DLMFHLQAIKLMTESSN---QVKPDSTFMYASSS  208

Query  549  slssltspl----aaaaaaQEKAGFSWCDDFLLEDAFLPLNNVQQSSDWEPNH---NNNT  707
            S +S         +  A    +  F+W D  L ++ F    N Q   D E ++   N  +
Sbjct  209  SSNSSPPLFSSTCSTIAQENSEVNFTWSDFLLDQETF--NENQQNFPDQELDNLFGNEFS  266

Query  708  SPQDIIKIssspsssnsnleaassssFVEAMLSREDHDMFLDFP  839
              + +  ++++ +      E + S+ FVE+++++E  ++FL FP
Sbjct  267  EAEAVATMANTSAPDAQMEEESLSNGFVESIIAKEK-ELFLGFP  309



>gb|ACF84326.1| unknown [Zea mays]
 gb|AIB05069.1| MYB transcription factor, partial [Zea mays]
Length=356

 Score = 82.0 bits (201),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 64/89 (72%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            F+  EE+ IIKLH+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDP+THK F
Sbjct  70   FTDTEEQTIIKLHSVVGNRWSVIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPITHKSF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PPQ   L  A
Sbjct  130  SHLMAEI-------ATTLAPPQVAHLAEA  151



>ref|NP_001146260.1| uncharacterized protein LOC100279834 [Zea mays]
 gb|ACF79243.1| unknown [Zea mays]
 gb|ACF84427.1| unknown [Zea mays]
 gb|ACF85675.1| unknown [Zea mays]
 gb|ACF88245.1| unknown [Zea mays]
 gb|ACL53595.1| unknown [Zea mays]
 gb|AFW58553.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
Length=356

 Score = 82.0 bits (201),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 64/89 (72%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            F+  EE+ IIKLH+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDP+THK F
Sbjct  70   FTDTEEQTIIKLHSVVGNRWSVIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPITHKSF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++A+         +T  PPQ   L  A
Sbjct  130  SHLMAEI-------ATTLAPPQVAHLAEA  151



>dbj|BAK03933.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=307

 Score = 81.3 bits (199),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + +NF+ +EEELI+ LHA +GSRW++IA QLPGRTDNDVKN WNTKL KKL   GIDP+T
Sbjct  66   KHENFTQEEEELIVTLHAMLGSRWSLIANQLPGRTDNDVKNYWNTKLSKKLRQRGIDPIT  125

Query  201  HKPFSQILADYGNI  242
            H+P + ++   G +
Sbjct  126  HRPIADLMQSIGTL  139



>gb|EMT23269.1| Transcription repressor MYB4 [Aegilops tauschii]
Length=308

 Score = 81.3 bits (199),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + +NF+ +EEELI+ LHA +GSRW++IA QLPGRTDNDVKN WNTKL KKL   GIDP+T
Sbjct  66   KHENFTQEEEELIVTLHAMLGSRWSLIANQLPGRTDNDVKNYWNTKLSKKLRQRGIDPIT  125

Query  201  HKPFSQILADYGNIG  245
            H+P + ++   G + 
Sbjct  126  HRPIADLMQSIGTLA  140



>ref|XP_006603478.1| PREDICTED: myb-related protein 315-like [Glycine max]
Length=214

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 63/82 (77%), Gaps = 3/82 (4%)
 Frame = +3

Query  87   RWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPFSQILADYGNIGGFPTSTS  266
            RW+IIAQQL GRTD DVKN WNTKLKKKLS +GID VTHKPFS+++ADYGNIGG    ++
Sbjct  10   RWSIIAQQLLGRTDTDVKNYWNTKLKKKLSQLGIDLVTHKPFSKLIADYGNIGGCQKPST  69

Query  267  RPPQFGTLNRALKTTIIMSSKS  332
            R     ++N+  K  +++ S+S
Sbjct  70   R---IASINKDFKNAMMLKSES  88



>ref|XP_001776312.1| predicted protein [Physcomitrella patens]
 gb|EDQ58811.1| predicted protein [Physcomitrella patens]
Length=179

 Score = 79.0 bits (193),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            F+ +EE LI+KLHA  GSRW++IA Q+PGRTDND+KN WNT+LKKKL  +GIDPVTHKP 
Sbjct  69   FTQEEENLIVKLHAAHGSRWSLIAAQMPGRTDNDIKNHWNTRLKKKLCDLGIDPVTHKPI  128

Query  213  SQILAD  230
            + +L D
Sbjct  129  ADLLRD  134



>gb|AGN52106.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52216.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=318

 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 61/89 (69%), Gaps = 8/89 (9%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE  I+ LH+ +G+RW +IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVTHKPF
Sbjct  70   FSEAEEHTIVTLHSVLGNRWAVIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++ +         +T  PPQ   L  A
Sbjct  130  SHLITE--------IATLPPPQVPNLAEA  150



>ref|NP_001173380.1| Os03g0296000 [Oryza sativa Japonica Group]
 gb|ABF95439.1| Myb-like DNA-binding domain containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAH92108.1| Os03g0296000 [Oryza sativa Japonica Group]
Length=306

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + +NF+ +EEELI+ LHA +GSRW++IA QLPGRTDNDVKN WNTKL KKL   GIDP+T
Sbjct  66   KHENFTQEEEELIVTLHAMLGSRWSLIANQLPGRTDNDVKNYWNTKLSKKLRQRGIDPIT  125

Query  201  HKPFSQILADYGNI  242
            H+P + ++   G +
Sbjct  126  HRPIADLMQSIGTL  139



>ref|XP_004965547.1| PREDICTED: myb-related protein Zm38-like [Setaria italica]
Length=303

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 62/86 (72%), Gaps = 6/86 (7%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + +NF+ +EE+LI+ LHA +GSRW++IA QLPGRTDNDVKN WNTKL KKL   GIDP+T
Sbjct  66   KHENFTQEEEDLIVTLHAMLGSRWSLIANQLPGRTDNDVKNYWNTKLSKKLRQRGIDPIT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQ  278
            H+P + ++   G +        RPPQ
Sbjct  126  HRPIADLMHSIGAL------AIRPPQ  145



>gb|AAL84759.1|AF474126_1 typical P-type R2R3 Myb protein [Sorghum bicolor]
Length=166

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            F+  EE+ IIKLH+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKL  MGIDPVTHK F
Sbjct  70   FTDAEEQTIIKLHSVVGNRWSVIAAQLPGRTDNDVKNHWNTKLKKKLFGMGIDPVTHKFF  129

Query  213  SQILAD  230
            S ++A+
Sbjct  130  SHLMAE  135



>gb|EAY89620.1| hypothetical protein OsI_11146 [Oryza sativa Indica Group]
Length=306

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + +NF+ +EEELI+ LHA +GSRW++IA QLPGRTDNDVKN WNTKL KKL   GIDP+T
Sbjct  66   KHENFTQEEEELIVTLHAMLGSRWSLIANQLPGRTDNDVKNYWNTKLSKKLRQRGIDPIT  125

Query  201  HKPFSQILADYGNI  242
            H+P + ++   G +
Sbjct  126  HRPIADLMQSIGTL  139



>gb|ADR83568.1| putative Myb103 transcription factor [Lycium barbarum]
Length=324

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 63/89 (71%), Gaps = 7/89 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE+ I+ LH+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVT KPF
Sbjct  70   FSEAEEQTIVTLHSVLGNRWSVIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTRKPF  129

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRA  299
            S ++++         +T  PPQ   L  A
Sbjct  130  SHLISEI-------ATTLSPPQVPHLAEA  151



>ref|XP_002465411.1| hypothetical protein SORBIDRAFT_01g038250 [Sorghum bicolor]
 gb|EER92409.1| hypothetical protein SORBIDRAFT_01g038250 [Sorghum bicolor]
Length=328

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 62/86 (72%), Gaps = 6/86 (7%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + +NF+ +EE+LI+ LHA +GSRW++IA QLPGRTDNDVKN WNTKL KKL   GIDP+T
Sbjct  66   KHENFTQEEEDLIVTLHAMLGSRWSLIANQLPGRTDNDVKNYWNTKLSKKLRQRGIDPIT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQ  278
            H+P + ++   G +        RPPQ
Sbjct  126  HRPIADLMHSIGAL------AIRPPQ  145



>ref|NP_001150470.1| DNA binding protein [Zea mays]
 gb|ACG39207.1| DNA binding protein [Zea mays]
 tpg|DAA44885.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
Length=319

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 63/89 (71%), Gaps = 6/89 (7%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + +NF+ +EE+LI+ LHA +GSRW++IA QLPGRTDNDVKN WNTKL KKL   GIDP+T
Sbjct  66   KHENFTQEEEDLIVTLHAMLGSRWSLIANQLPGRTDNDVKNYWNTKLSKKLRQRGIDPLT  125

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGT  287
            H+P + ++   G +        RPPQ  T
Sbjct  126  HRPIADLMHSIGAL------AIRPPQPAT  148



>ref|XP_001771707.1| predicted protein [Physcomitrella patens]
 gb|EDQ63490.1| predicted protein [Physcomitrella patens]
Length=156

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = +3

Query  30   NFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKP  209
            +FS +EE LI+KLH   GSRW++IA Q+PGRTDND+KN WNT+LKKKL  MGIDPVTHK 
Sbjct  68   SFSSEEENLIVKLHEAHGSRWSLIAAQMPGRTDNDIKNHWNTRLKKKLCDMGIDPVTHKR  127

Query  210  FSQILADYGNIGGFPTS  260
             + +L +       PT 
Sbjct  128  IADVLKELAGTMAHPTG  144



>ref|XP_003558134.1| PREDICTED: myb-related protein Zm38-like [Brachypodium distachyon]
Length=318

 Score = 79.3 bits (194),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            + ++F+ +EEELI+ LHA +GSRW++IA QLPGRTDNDVKN WNTKL KKL   GIDP+T
Sbjct  66   KHESFTQEEEELIVTLHAMLGSRWSLIANQLPGRTDNDVKNYWNTKLSKKLRQRGIDPLT  125

Query  201  HKPFSQILADYGNI  242
            H+P + ++   G +
Sbjct  126  HRPIADLMQSIGTL  139



>gb|EPS66328.1| hypothetical protein M569_08448, partial [Genlisea aurea]
Length=131

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            ++  FSP+EE LII+LH+ +G+RW+ IA QLPGRTDN++KNLWN+ +KKK+  MGIDP T
Sbjct  66   KRGTFSPEEESLIIELHSVLGNRWSQIAAQLPGRTDNEIKNLWNSSIKKKMRNMGIDPST  125

Query  201  HKPFSQ  218
            HKP S+
Sbjct  126  HKPLSE  131



>gb|ADF57329.1| R2R3 MYB transcription factor [Ginkgo biloba]
Length=346

 Score = 79.0 bits (193),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
             S  EE+LII+LHA IG+RW+ IA QLPGRTDN++KN WNT++KKKL  MGIDPVTHKP 
Sbjct  70   LSESEEKLIIELHAAIGNRWSRIAAQLPGRTDNEIKNYWNTRIKKKLRQMGIDPVTHKPL  129

Query  213  SQILADY  233
            +Q+  DY
Sbjct  130  NQMQMDY  136



>gb|AFD36431.1| R2R3 MYB transcription factor [Ginkgo biloba]
 gb|AFD36432.1| R2R3 MYB transcription factor [Ginkgo biloba]
Length=346

 Score = 79.0 bits (193),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
             S  EE+LII+LHA IG+RW+ IA QLPGRTDN++KN WNT++KKKL  MGIDPVTHKP 
Sbjct  70   LSESEEKLIIELHAAIGNRWSRIAAQLPGRTDNEIKNYWNTRIKKKLRQMGIDPVTHKPL  129

Query  213  SQILADY  233
            +Q+  DY
Sbjct  130  NQMQMDY  136



>gb|ABD60296.2| R2R3-MYB transcription factor MYB1 [Picea glauca]
Length=154

 Score = 75.5 bits (184),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
             S  EE+LII LHA IG+RW+ IA QLPGRTDN++KN WNT++KKKL  MGIDPVTHKP 
Sbjct  70   LSESEEKLIIDLHAAIGNRWSRIAAQLPGRTDNEIKNYWNTRIKKKLRQMGIDPVTHKPL  129

Query  213  SQI  221
            SQ+
Sbjct  130  SQM  132



>gb|ABD60289.2| R2R3-MYB transcription factor MYB8 [Picea glauca]
Length=235

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            ++  FSPQEE LII+LHA +G+RW+ IA  LPGRTDN++KNLWN+ +KKKL   GIDP T
Sbjct  66   KRGTFSPQEENLIIELHAVLGNRWSQIATHLPGRTDNEIKNLWNSCIKKKLRQRGIDPST  125

Query  201  HKPFSQILADYGN  239
            H+P S++ A+ G+
Sbjct  126  HRPLSEVNAEAGD  138



>gb|ABP04051.1| R2R3MYB [Ginkgo biloba]
Length=346

 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
             S  EE+LII LHA IG+RW+ IA QLPGRTDN++KN WNT++KKKL  MGIDPVTHKP 
Sbjct  70   LSESEEKLIIDLHAAIGNRWSRIAAQLPGRTDNEIKNYWNTRIKKKLRQMGIDPVTHKPL  129

Query  213  SQILADY  233
            +Q+  DY
Sbjct  130  NQMQMDY  136



>gb|ABH02909.1| MYB transcription factor MYB64 [Glycine max]
Length=185

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  24   QDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTH  203
            +  FS +EE LII+LHA +G+RW+ IA QLPGRTDN++KNLWN+ LKKKL   GIDPVTH
Sbjct  67   RGTFSQEEETLIIELHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLRQRGIDPVTH  126

Query  204  KPFSQI  221
            KP S++
Sbjct  127  KPLSEV  132



>ref|XP_010105966.1| Protein ODORANT1 [Morus notabilis]
 gb|EXC06848.1| Protein ODORANT1 [Morus notabilis]
Length=324

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 74/120 (62%), Gaps = 13/120 (11%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            F+ +EE+LII+LH  +G+RW  IA QLPGRTDN++KNLWNT LKK+L  MGIDP+TH+PF
Sbjct  71   FTQEEEKLIIQLHGMLGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLCMGIDPLTHEPF  130

Query  213  SQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMS-----SKSQKLSADQPSSRAAAD  377
            S           +PT+ S PP   T + A   +  +      S+   L   QP ++A +D
Sbjct  131  SS--------NHYPTTKSCPPSPSTRHMAQWESARLEAEARLSRESSLFGPQPHTKANSD  182



>ref|XP_009779196.1| PREDICTED: myb-related protein Zm38-like [Nicotiana sylvestris]
Length=298

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 60/78 (77%), Gaps = 6/78 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FSP+EE+L+I+LH  +G+RW  IA QLPGRTDN++KNLWNT LKK+L +MGIDP+TH+P 
Sbjct  70   FSPEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLFSMGIDPLTHEPS  129

Query  213  SQILADYGNIGGFPTSTS  266
            + +L         PTSTS
Sbjct  130  NGLLRR------LPTSTS  141



>ref|XP_002864431.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40690.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=407

 Score = 77.0 bits (188),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            +   FS  EE +I+K H+ +G+RW++IA QLPGRTDNDVKN WNTKLKKKLS MGIDPVT
Sbjct  66   KHGQFSETEEHIIVKFHSVLGNRWSLIAAQLPGRTDNDVKNYWNTKLKKKLSGMGIDPVT  125

Query  201  HKPFSQILADYG  236
            HKP S  +   G
Sbjct  126  HKPSSHRMWGRG  137



>ref|XP_010032675.1| PREDICTED: transcription factor MYB3-like [Eucalyptus grandis]
 gb|KCW83992.1| hypothetical protein EUGRSUZ_B00865 [Eucalyptus grandis]
Length=213

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            ++ NF   EE+LIIKLHA +G+RW++IA +LPGRTDN+VKN WNT L++KL  MGIDP  
Sbjct  66   KRGNFGEDEEDLIIKLHALLGNRWSLIAGRLPGRTDNEVKNYWNTHLRRKLMQMGIDPNN  125

Query  201  HKPFSQILADYGNIGGFPTSTSRP  272
            H+P   +     ++G   +ST +P
Sbjct  126  HRPRPAVSVPNKSVGSDHSSTCKP  149



>ref|XP_009398742.1| PREDICTED: myb-related protein Hv33-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009398743.1| PREDICTED: myb-related protein Hv33-like [Musa acuminata subsp. 
malaccensis]
Length=262

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 62/87 (71%), Gaps = 2/87 (2%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            ++  FS QEE+LII+LHA +G+RW+ IA QLPGRTDN++KN WN+ +KKKL   GIDP T
Sbjct  66   KRGTFSQQEEKLIIELHAAVGNRWSQIAAQLPGRTDNEIKNYWNSCIKKKLRQSGIDPST  125

Query  201  HKPFSQILA--DYGNIGGFPTSTSRPP  275
            H+P S++    D   +    +STS PP
Sbjct  126  HRPLSEVEGGDDKEAMASGRSSTSAPP  152



>gb|ABK23961.1| unknown [Picea sitchensis]
Length=242

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 69/102 (68%), Gaps = 13/102 (13%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            ++ NFS  E++LI+KLHA +G+RW++IA +LPGRTDN++KN WN+ LK+KL +MG+DP+ 
Sbjct  66   KRGNFSEDEDDLILKLHALLGNRWSLIAGRLPGRTDNEIKNYWNSYLKRKLISMGVDPLN  125

Query  201  HKPFSQ----ILADYGNIGGFPTSTSR---------PPQFGT  287
            H+PF +      +  GN+G   T+ SR         PP+  T
Sbjct  126  HRPFQKNSRHRPSASGNVGEPGTAQSREIVPDFFHCPPELST  167



>gb|KDP28358.1| hypothetical protein JCGZ_14129 [Jatropha curcas]
 gb|AIT52238.1| MYB family protein [Jatropha curcas]
Length=437

 Score = 76.6 bits (187),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            ++  FS QEE LII+LHA +G+RW+ IA QLPGRTDN++KNLWN+ LKKKL   GIDPVT
Sbjct  66   KRGTFSQQEENLIIELHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLRQRGIDPVT  125

Query  201  HKPFSQI  221
            HKP S+I
Sbjct  126  HKPLSEI  132



>ref|XP_006444636.1| hypothetical protein CICLE_v10020144mg [Citrus clementina]
 gb|ESR57876.1| hypothetical protein CICLE_v10020144mg [Citrus clementina]
Length=446

 Score = 76.6 bits (187),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            ++  FS QEE LII+LHA +G+RW+ IA QLPGRTDN++KNLWN+ LKKKL   GIDPVT
Sbjct  66   KRGTFSQQEENLIIELHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLRQRGIDPVT  125

Query  201  HKPFSQI  221
            HKP S++
Sbjct  126  HKPLSEV  132



>gb|ABQ51217.1| R2R3-MYB transcription factor MYB1 [Picea glauca]
Length=332

 Score = 75.5 bits (184),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
             S  EE+LII LHA IG+RW+ IA QLPGRTDN++KN WNT++KKKL  MGIDPVTHKP 
Sbjct  70   LSESEEKLIIDLHAAIGNRWSRIAAQLPGRTDNEIKNYWNTRIKKKLRQMGIDPVTHKPL  129

Query  213  SQI  221
            SQ+
Sbjct  130  SQM  132



>ref|XP_006492438.1| PREDICTED: transcription factor MYB39-like [Citrus sinensis]
 gb|KDO86760.1| hypothetical protein CISIN_1g013300mg [Citrus sinensis]
Length=446

 Score = 76.6 bits (187),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            ++  FS QEE LII+LHA +G+RW+ IA QLPGRTDN++KNLWN+ LKKKL   GIDPVT
Sbjct  66   KRGTFSQQEENLIIELHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLRQRGIDPVT  125

Query  201  HKPFSQI  221
            HKP S++
Sbjct  126  HKPLSEV  132



>ref|XP_001784979.1| predicted protein [Physcomitrella patens]
 gb|EDQ50200.1| predicted protein [Physcomitrella patens]
Length=130

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            ++  F+  EE LI+ LHAT+G+RW+ IA QLPGRTDN++KN WNT LKKKL +MG+DPVT
Sbjct  66   KRGGFTDAEENLILDLHATLGNRWSKIAMQLPGRTDNEIKNYWNTHLKKKLCSMGLDPVT  125

Query  201  HKPF  212
            HKP 
Sbjct  126  HKPV  129



>ref|XP_011040042.1| PREDICTED: transcription factor MYB86-like [Populus euphratica]
Length=465

 Score = 76.6 bits (187),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            ++  FS QEE+LII+LHA +G+RW+ IA QLPGRTDN++KNLWN+ LKKKL   GIDPVT
Sbjct  66   KRGTFSQQEEKLIIELHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLRQGGIDPVT  125

Query  201  HKPFSQI  221
            HKP S++
Sbjct  126  HKPLSEV  132



>gb|ABQ51224.1| R2R3-MYB transcription factor MYB8 [Picea glauca]
Length=526

 Score = 76.6 bits (187),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            ++  FSPQEE LII+LHA +G+RW+ IA  LPGRTDN++KNLWN+ +KKKL   GIDP T
Sbjct  66   KRGTFSPQEENLIIELHAVLGNRWSQIATHLPGRTDNEIKNLWNSCIKKKLRQRGIDPST  125

Query  201  HKPFSQILADYGN  239
            H+P S++ A+ G+
Sbjct  126  HRPLSEVNAEAGD  138



>gb|ABK23245.1| unknown [Picea sitchensis]
Length=331

 Score = 75.5 bits (184),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
             S  EE+LII LHA IG+RW+ IA QLPGRTDN++KN WNT++K+KL  MGIDPVTHKP 
Sbjct  70   LSESEEKLIIDLHAAIGNRWSRIAAQLPGRTDNEIKNYWNTRIKEKLRQMGIDPVTHKPL  129

Query  213  SQI  221
            SQ+
Sbjct  130  SQM  132



>ref|XP_002320929.1| hypothetical protein POPTR_0014s10680g [Populus trichocarpa]
 gb|EEE99244.1| hypothetical protein POPTR_0014s10680g [Populus trichocarpa]
Length=464

 Score = 76.3 bits (186),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            ++  FS QEE LII+LHA +G+RW+ IA QLPGRTDN++KNLWN+ LKKKL   GIDPVT
Sbjct  66   KRGTFSQQEENLIIELHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLRQRGIDPVT  125

Query  201  HKPFSQI  221
            HKP S++
Sbjct  126  HKPLSEV  132



>ref|XP_009629649.1| PREDICTED: transcription factor MYB28-like [Nicotiana tomentosiformis]
Length=298

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 60/78 (77%), Gaps = 6/78 (8%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FSP+EE+L+I+LH  +G+RW  IA QLPGRTDN++KNLWNT LKK+L +MGIDP+TH+P 
Sbjct  70   FSPEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLFSMGIDPLTHEPS  129

Query  213  SQILADYGNIGGFPTSTS  266
            + +L         PTSTS
Sbjct  130  NGLLRRP------PTSTS  141



>gb|AIA66961.1| MYB055 [Populus tomentosa]
Length=464

 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            ++  FS QEE LII LHA +G+RW+ IA QLPGRTDN++KNLWN+ LKKKL   GIDPVT
Sbjct  66   KRGTFSQQEENLIIDLHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLRQRGIDPVT  125

Query  201  HKPFSQI  221
            HKP S++
Sbjct  126  HKPLSEV  132



>gb|AAQ62541.1| R2R3-MYB transcription factor [Pinus taeda]
Length=340

 Score = 74.7 bits (182),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
             S  EE+LII LHA IG+RW+ IA QLPGRTDN++KN WNT++KKKL  MGIDPVTHKP 
Sbjct  70   LSESEEKLIIDLHAAIGNRWSRIAAQLPGRTDNEIKNYWNTRIKKKLRQMGIDPVTHKPL  129

Query  213  SQI  221
            +Q+
Sbjct  130  TQM  132



>gb|ACA33839.1| R2R3-Myb1 transcription factor [Pinus pinaster]
Length=340

 Score = 74.7 bits (182),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
             S  EE+LII LHA IG+RW+ IA QLPGRTDN++KN WNT++KKKL  MGIDPVTHKP 
Sbjct  70   LSESEEKLIIDLHAAIGNRWSRIAAQLPGRTDNEIKNYWNTRIKKKLRQMGIDPVTHKPL  129

Query  213  SQI  221
            +Q+
Sbjct  130  TQM  132



>gb|ADL36768.1| MYB domain class transcription factor [Malus domestica]
Length=414

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 56/71 (79%), Gaps = 2/71 (3%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS QEE LII+LHA +G+RW+ IA QLPGRTDN++KNLWN+ +KKKL   GIDP THKP 
Sbjct  70   FSQQEENLIIELHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCIKKKLRLRGIDPNTHKPL  129

Query  213  SQILADYGNIG  245
            S++L    NIG
Sbjct  130  SEVLDQ--NIG  138



>gb|KHN14179.1| Transcription factor MYB86 [Glycine soja]
Length=419

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            ++  FS +EE LII+LHA +G+RW+ IA QLPGRTDN++KNLWN+ LKKKL   GIDPVT
Sbjct  66   KRGTFSQEEENLIIELHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLRQRGIDPVT  125

Query  201  HKPFSQI  221
            HKP S++
Sbjct  126  HKPLSEV  132



>gb|AGO03571.1| MIXTA-like 7 [Erythranthe lewisii]
Length=276

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            F+P+EE+L+I+LHA +G+RW  IA QLPGRTDN++KNLWNT LKK+L  MG+DP TH+P+
Sbjct  70   FTPEEEKLVIQLHAILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLQMGVDPQTHEPY  129

Query  213  SQI  221
            S +
Sbjct  130  STL  132



>ref|XP_003521624.1| PREDICTED: transcription factor MYB86-like [Glycine max]
Length=418

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            ++  FS +EE LII+LHA +G+RW+ IA QLPGRTDN++KNLWN+ LKKKL   GIDPVT
Sbjct  66   KRGTFSQEEENLIIELHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLRQRGIDPVT  125

Query  201  HKPFSQI  221
            HKP S++
Sbjct  126  HKPLSEV  132



>gb|ACJ38663.1| myb-like transcription factor [Betula luminifera]
Length=395

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            ++  FS +EE LII+LHA +G+RW+ IA QLPGRTDN++KNLWN+ LKKKL   GIDPVT
Sbjct  66   KRGTFSQEEENLIIELHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLRQRGIDPVT  125

Query  201  HKPFSQI  221
            HKP S++
Sbjct  126  HKPISEV  132



>gb|KHN43402.1| Transcription factor MYB86 [Glycine soja]
Length=415

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            ++  FS +EE LII+LHA +G+RW+ IA QLPGRTDN++KNLWN+ LKKKL   GIDPVT
Sbjct  66   KRGTFSQEEETLIIELHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLRQRGIDPVT  125

Query  201  HKPFSQI  221
            HKP S++
Sbjct  126  HKPLSEV  132



>gb|KHG02253.1| Transcription factor MYB86 -like protein [Gossypium arboreum]
Length=408

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            ++  FS +EE LII+LHA +G+RW+ IA QLPGRTDN++KNLWN+ LKKKL   GIDPVT
Sbjct  66   KRGTFSQEEENLIIELHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLRQRGIDPVT  125

Query  201  HKPFSQI  221
            HKP S++
Sbjct  126  HKPLSEV  132



>ref|XP_007145085.1| hypothetical protein PHAVU_007G208400g [Phaseolus vulgaris]
 gb|ESW17079.1| hypothetical protein PHAVU_007G208400g [Phaseolus vulgaris]
Length=445

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            ++  FS +EE LII+LHA +G+RW+ IA QLPGRTDN++KNLWN+ LKKKL   GIDPVT
Sbjct  66   KRGTFSQEEENLIIELHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLRQKGIDPVT  125

Query  201  HKPFSQI  221
            HKP S++
Sbjct  126  HKPLSEV  132



>ref|XP_003519722.1| PREDICTED: transcription factor MYB86-like [Glycine max]
 gb|KHN00250.1| Transcription factor MYB86 [Glycine soja]
Length=434

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            ++  FS +EE LII+LHA +G+RW+ IA QLPGRTDN++KNLWN+ LKKKL   GIDPVT
Sbjct  66   KRGTFSQEEENLIIELHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLRQKGIDPVT  125

Query  201  HKPFSQI  221
            HKP S++
Sbjct  126  HKPLSEV  132



>ref|XP_007051325.1| Myb domain protein 55 [Theobroma cacao]
 gb|EOX95482.1| Myb domain protein 55 [Theobroma cacao]
Length=452

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            ++  FS +EE LII+LHA +G+RW+ IA QLPGRTDN++KNLWN+ LKKKL   GIDPVT
Sbjct  66   KRGTFSQEEENLIIELHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLRQRGIDPVT  125

Query  201  HKPFSQI  221
            HKP S++
Sbjct  126  HKPLSEV  132



>ref|NP_001242243.1| MYB transcription factor MYB64 [Glycine max]
 gb|ACU21500.1| unknown [Glycine max]
Length=415

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            ++  FS +EE LII+LHA +G+RW+ IA QLPGRTDN++KNLWN+ LKKKL   GIDPVT
Sbjct  66   KRGTFSQEEETLIIELHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLRQRGIDPVT  125

Query  201  HKPFSQI  221
            HKP S++
Sbjct  126  HKPLSEV  132



>ref|XP_004495851.1| PREDICTED: protein ODORANT1-like [Cicer arietinum]
Length=428

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS  EE LII+LHA +G+RW+ IA QLPGRTDN++KNLWN+ LKKKL   GIDPVTHKP 
Sbjct  70   FSQDEENLIIELHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLRQKGIDPVTHKPL  129

Query  213  SQI  221
            S++
Sbjct  130  SEV  132



>ref|XP_004510807.1| PREDICTED: protein ODORANT1-like [Cicer arietinum]
Length=293

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            F+P+EE+L+I+LHA +G+RW  IA QLPGRTDN++KNLWNT LKK+L +MGIDP TH+P 
Sbjct  71   FTPEEEKLVIQLHAILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLISMGIDPQTHEPI  130

Query  213  S  215
            S
Sbjct  131  S  131



>gb|KEH43172.1| myb transcription factor MYB64 [Medicago truncatula]
Length=388

 Score = 74.7 bits (182),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FS +EE LI++LHA +G+RW+ IA QLPGRTDN++KNLWN+ LKK+L   GIDPVTHKP 
Sbjct  70   FSQEEENLIVELHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKRLRQKGIDPVTHKPL  129

Query  213  SQI  221
            S++
Sbjct  130  SEV  132



>ref|XP_010936645.1| PREDICTED: myb-related protein Hv33-like [Elaeis guineensis]
Length=316

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            ++ NF+ QEE+LII LH  +G+RW+ IA QLPGRTDN++KN WN+ LKKKL   GIDP+T
Sbjct  66   KRGNFTQQEEDLIISLHEVLGNRWSQIAAQLPGRTDNEIKNFWNSSLKKKLKQRGIDPIT  125

Query  201  HKPFSQILA  227
            HKP S+  A
Sbjct  126  HKPLSETGA  134



>gb|KHN14240.1| Transcription factor MYB86 [Glycine soja]
Length=455

 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            ++  FS +EE LII+LHA +G+RW+ IA QLPGRTDN++KNLWN+ LKKKL   GIDPVT
Sbjct  66   KRGTFSQEEENLIIELHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLRQKGIDPVT  125

Query  201  HKPFSQI  221
            HKP S++
Sbjct  126  HKPLSEV  132



>emb|CBI17347.3| unnamed protein product [Vitis vinifera]
Length=242

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            ++ NF+ +E+ELIIKLH+ +G++W++IA +LPGRTDN++KN WNT +++KL + GIDP+T
Sbjct  66   KRGNFTDEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRGIDPLT  125

Query  201  HKPFSQILADYGNI  242
            H+P ++   D   +
Sbjct  126  HRPINEAAVDVATV  139



>ref|XP_010920127.1| PREDICTED: myb-related protein 308-like [Elaeis guineensis]
Length=237

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            ++ NF+ +E+ELIIKLH+ +G++W++IA +LPGRTDN++KN WNT +++KL + GIDP T
Sbjct  66   KRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRGIDPAT  125

Query  201  HKPFSQILADY  233
            H+P    L+D+
Sbjct  126  HRPIHAPLSDF  136



>ref|XP_006589090.1| PREDICTED: transcription factor MYB86-like [Glycine max]
Length=456

 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            ++  FS +EE LII+LHA +G+RW+ IA QLPGRTDN++KNLWN+ LKKKL   GIDPVT
Sbjct  66   KRGTFSQEEENLIIELHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLRQKGIDPVT  125

Query  201  HKPFSQI  221
            HKP S++
Sbjct  126  HKPLSEV  132



>emb|CDX93504.1| BnaA06g05440D [Brassica napus]
Length=294

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  33   FSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVTHKPF  212
            FSP+EE LI++LHA +G+RW+ IA +LPGRTDN++KNLWN+ +KKKL   GIDP THKP 
Sbjct  70   FSPEEENLIVELHAVLGNRWSQIAARLPGRTDNEIKNLWNSNIKKKLRQRGIDPNTHKPI  129

Query  213  SQILAD  230
            S++  D
Sbjct  130  SEVDKD  135



>ref|XP_003532377.1| PREDICTED: myb-related protein 330-like [Glycine max]
 gb|KHN16908.1| Transcription repressor MYB4 [Glycine soja]
Length=218

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 69/119 (58%), Gaps = 4/119 (3%)
 Frame = +3

Query  21   EQDNFSPQEEELIIKLHATIGSRWTIIAQQLPGRTDNDVknlwntklkkklSAMGIDPVT  200
            ++ NF+ +E  LII LH+ +G++W+ IA  LPGRTDN++KN W + LK+ L A+GIDPVT
Sbjct  67   KKGNFTEEESNLIIHLHSLLGNKWSQIATSLPGRTDNEIKNYWKSHLKRYLYALGIDPVT  126

Query  201  HKPFSQILADYGNIGGFPTSTSRPPQFGTLNRALKTTIIMSSKSQKLSADQPSSRAAAD  377
            HKPF +      N    P + S      T+ R     + ++SK    + D  S+   AD
Sbjct  127  HKPFKEDT----NTTSTPPNNSMATTTSTIPRIYYFNVFLNSKVHISADDDYSADGGAD  181



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2862874383393