BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13445_g2_i1 len=1189 path=[2191:0-90 1467:91-439 1816:440-468
25:469-1188]

Length=1189
                                                                      Score     E

ref|XP_004236090.1|  PREDICTED: strictosidine synthase 3-like           248   5e-75   
ref|XP_006345201.1|  PREDICTED: strictosidine synthase 3-like           245   8e-74   
ref|XP_004252261.1|  PREDICTED: strictosidine synthase 3-like           243   3e-73   
ref|XP_004236089.1|  PREDICTED: strictosidine synthase 1-like           234   7e-70   
ref|XP_010319099.1|  PREDICTED: strictosidine synthase 1-like           231   1e-68   
ref|XP_002274134.3|  PREDICTED: strictosidine synthase 3-like           222   6e-65   Vitis vinifera
ref|XP_006345203.1|  PREDICTED: strictosidine synthase 1-like           216   8e-63   
emb|CDO98507.1|  unnamed protein product                                215   2e-62   
emb|CBI15377.3|  unnamed protein product                                223   6e-62   
gb|KDO70174.1|  hypothetical protein CISIN_1g019290mg                   202   3e-57   
gb|AES93117.1|  strictosidine synthase                                  201   3e-57   
ref|XP_011071025.1|  PREDICTED: protein STRICTOSIDINE SYNTHASE-LI...    200   1e-56   
ref|XP_006437788.1|  hypothetical protein CICLE_v10032008mg             200   1e-56   
ref|XP_010663511.1|  PREDICTED: strictosidine synthase 1-like           200   1e-56   
emb|CDP10794.1|  unnamed protein product                                199   2e-56   
ref|XP_010663512.1|  PREDICTED: strictosidine synthase 3-like           199   4e-56   
ref|XP_008811198.1|  PREDICTED: strictosidine synthase 1-like           196   3e-55   
ref|XP_011071027.1|  PREDICTED: protein STRICTOSIDINE SYNTHASE-LI...    196   4e-55   
dbj|BAJ53159.1|  JHL10I11.5                                             195   1e-54   
ref|XP_010532262.1|  PREDICTED: strictosidine synthase 1-like           193   4e-54   
gb|AFK49369.1|  unknown                                                 193   5e-54   
ref|XP_010099019.1|  Strictosidine synthase 1                           192   8e-54   
emb|CAN78856.1|  hypothetical protein VITISV_013356                     198   2e-53   Vitis vinifera
ref|XP_002312353.2|  hypothetical protein POPTR_0008s10940g             191   7e-53   Populus trichocarpa [western balsam poplar]
emb|CAN77943.1|  hypothetical protein VITISV_044019                     188   1e-52   Vitis vinifera
ref|XP_003609164.1|  Strictosidine synthase                             189   2e-52   
gb|AES91361.2|  strictosidine synthase-like protein, putative           189   3e-52   
ref|XP_003635414.1|  PREDICTED: strictosidine synthase 1-like           187   6e-52   
emb|CBI18784.3|  unnamed protein product                                187   7e-52   
ref|XP_004298328.1|  PREDICTED: strictosidine synthase-like             187   9e-52   
gb|KDO65594.1|  hypothetical protein CISIN_1g048181mg                   186   1e-51   
ref|XP_010656041.1|  PREDICTED: strictosidine synthase 1-like           186   1e-51   
ref|XP_010110077.1|  Strictosidine synthase 1                           186   1e-51   
ref|XP_010099021.1|  Strictosidine synthase 1                           186   2e-51   
ref|XP_010099026.1|  Strictosidine synthase 1                           186   3e-51   
ref|XP_003576963.1|  PREDICTED: strictosidine synthase 3-like           186   4e-51   
emb|CBI28990.3|  unnamed protein product                                186   4e-51   
ref|XP_010110078.1|  Strictosidine synthase 1                           185   4e-51   
ref|XP_010655935.1|  PREDICTED: strictosidine synthase 1-like           185   5e-51   
emb|CBI28987.3|  unnamed protein product                                184   6e-51   
ref|XP_004508606.1|  PREDICTED: strictosidine synthase 1-like           185   7e-51   
emb|CAN59852.1|  hypothetical protein VITISV_000854                     184   8e-51   Vitis vinifera
ref|XP_011000464.1|  PREDICTED: strictosidine synthase 3-like           185   8e-51   
emb|CDP12339.1|  unnamed protein product                                185   9e-51   
emb|CDP21857.1|  unnamed protein product                                184   1e-50   
ref|XP_010110081.1|  Strictosidine synthase 1                           185   1e-50   
ref|XP_006485738.1|  PREDICTED: strictosidine synthase 1-like           184   1e-50   
ref|XP_003609162.1|  Strictosidine synthase                             184   2e-50   
ref|XP_006421116.1|  hypothetical protein CICLE_v10005245mg             184   2e-50   
ref|XP_006436700.1|  hypothetical protein CICLE_v10033919mg             184   2e-50   
emb|CBI28988.3|  unnamed protein product                                183   2e-50   
ref|XP_006436705.1|  hypothetical protein CICLE_v10033909mg             183   3e-50   
emb|CBI15378.3|  unnamed protein product                                192   5e-50   
ref|XP_002275622.2|  PREDICTED: strictosidine synthase 1-like           183   5e-50   Vitis vinifera
ref|XP_010655933.1|  PREDICTED: strictosidine synthase 1-like           184   6e-50   
ref|XP_006390480.1|  hypothetical protein EUTSA_v10018852mg             182   6e-50   
ref|XP_006436702.1|  hypothetical protein CICLE_v10033429mg             182   6e-50   
ref|XP_006440860.1|  hypothetical protein CICLE_v10023327mg             182   7e-50   
ref|XP_007037729.1|  Calcium-dependent phosphotriesterase superfa...    182   7e-50   
ref|XP_009597336.1|  PREDICTED: strictosidine synthase 1-like           180   8e-50   
emb|CAN77945.1|  hypothetical protein VITISV_044021                     182   8e-50   Vitis vinifera
emb|CBI40188.3|  unnamed protein product                                181   9e-50   
ref|XP_006494389.1|  PREDICTED: strictosidine synthase 1-like           182   1e-49   
ref|XP_006436612.1|  hypothetical protein CICLE_v10033527mg             181   2e-49   
ref|XP_010656040.1|  PREDICTED: strictosidine synthase 1-like           181   2e-49   
ref|XP_010658741.1|  PREDICTED: strictosidine synthase 1-like           180   3e-49   
emb|CBI35408.3|  unnamed protein product                                187   3e-49   
ref|XP_010428359.1|  PREDICTED: strictosidine synthase 3-like iso...    181   3e-49   
ref|XP_002273764.1|  PREDICTED: strictosidine synthase 1                181   3e-49   Vitis vinifera
ref|XP_010471490.1|  PREDICTED: strictosidine synthase 1-like           180   3e-49   
gb|KEH23600.1|  strictosidine synthase family protein                   180   4e-49   
ref|XP_003531955.1|  PREDICTED: strictosidine synthase 3-like           180   5e-49   
emb|CDP06823.1|  unnamed protein product                                180   6e-49   
ref|XP_002273580.1|  PREDICTED: strictosidine synthase 3                180   6e-49   Vitis vinifera
emb|CAN63240.1|  hypothetical protein VITISV_034462                     180   6e-49   Vitis vinifera
ref|XP_007045664.1|  Calcium-dependent phosphotriesterase superfa...    181   7e-49   
ref|XP_010412433.1|  PREDICTED: strictosidine synthase 1-like           179   1e-48   
emb|CBI24410.3|  unnamed protein product                                179   1e-48   
ref|XP_004493427.1|  PREDICTED: adipocyte plasma membrane-associa...    180   1e-48   
ref|XP_004308613.1|  PREDICTED: strictosidine synthase-like             178   1e-48   
gb|KDP29321.1|  hypothetical protein JCGZ_18242                         178   2e-48   
ref|XP_009106057.1|  PREDICTED: strictosidine synthase 1-like           178   2e-48   
ref|XP_006436697.1|  hypothetical protein CICLE_v10033295mg             179   2e-48   
ref|XP_007202861.1|  hypothetical protein PRUPE_ppa015510mg             178   2e-48   
ref|XP_011027270.1|  PREDICTED: strictosidine synthase 3-like iso...    180   2e-48   
emb|CDP14992.1|  unnamed protein product                                177   2e-48   
emb|CDP21322.1|  unnamed protein product                                179   3e-48   
ref|XP_006301516.1|  hypothetical protein CARUB_v10021942mg             178   4e-48   
emb|CDX73037.1|  BnaC06g34850D                                          177   4e-48   
ref|XP_010416232.1|  PREDICTED: strictosidine synthase 3-like           177   4e-48   
ref|XP_006390479.1|  hypothetical protein EUTSA_v10018851mg             177   5e-48   
gb|AFK33536.1|  unknown                                                 177   5e-48   
ref|XP_002532597.1|  strictosidine synthase, putative                   178   5e-48   Ricinus communis
gb|KHG17610.1|  Strictosidine synthase 1 -like protein                  177   9e-48   
gb|ACU23577.1|  unknown                                                 177   9e-48   Glycine max [soybeans]
ref|XP_006485325.1|  PREDICTED: strictosidine synthase 3-like           180   9e-48   
ref|XP_003609161.1|  Strictosidine synthase                             176   1e-47   
ref|XP_002323253.2|  strictosidine synthase family protein              177   1e-47   Populus trichocarpa [western balsam poplar]
ref|XP_002321516.2|  hypothetical protein POPTR_0015s04660g             176   1e-47   Populus trichocarpa [western balsam poplar]
ref|XP_007045667.1|  Calcium-dependent phosphotriesterase superfa...    180   1e-47   
ref|XP_002274235.1|  PREDICTED: strictosidine synthase 3-like           176   2e-47   Vitis vinifera
emb|CAN78855.1|  hypothetical protein VITISV_013355                     175   3e-47   Vitis vinifera
ref|XP_004298326.1|  PREDICTED: strictosidine synthase-like             176   3e-47   
ref|XP_004488398.1|  PREDICTED: strictosidine synthase 3-like           175   3e-47   
ref|XP_009400113.1|  PREDICTED: strictosidine synthase 1-like           176   4e-47   
ref|XP_006376714.1|  hypothetical protein POPTR_0012s04360g             174   4e-47   
ref|XP_003625042.1|  Adipocyte plasma membrane-associated protein       176   5e-47   
ref|XP_009106059.1|  PREDICTED: strictosidine synthase 1-like           174   5e-47   
ref|XP_009128019.1|  PREDICTED: strictosidine synthase 1-like           174   6e-47   
emb|CDY47728.1|  BnaA02g16670D                                          174   6e-47   
ref|XP_004237337.1|  PREDICTED: strictosidine synthase 3-like           175   7e-47   
ref|XP_011027271.1|  PREDICTED: strictosidine synthase 3-like iso...    175   8e-47   
emb|CDY47729.1|  BnaA02g16660D                                          174   8e-47   
ref|XP_009391266.1|  PREDICTED: strictosidine synthase 3-like           174   1e-46   
ref|XP_006351273.1|  PREDICTED: strictosidine synthase 1-like           175   1e-46   
ref|XP_007156378.1|  hypothetical protein PHAVU_003G281200g             174   1e-46   
emb|CDP21321.1|  unnamed protein product                                174   1e-46   
ref|XP_004305393.1|  PREDICTED: strictosidine synthase-like             173   2e-46   
ref|XP_008244844.1|  PREDICTED: strictosidine synthase 1                174   2e-46   
emb|CDP12401.1|  unnamed protein product                                172   3e-46   
ref|XP_009627580.1|  PREDICTED: strictosidine synthase 1-like           174   3e-46   
ref|XP_002452919.1|  hypothetical protein SORBIDRAFT_04g034960          173   3e-46   Sorghum bicolor [broomcorn]
ref|XP_009799719.1|  PREDICTED: strictosidine synthase 1-like           172   3e-46   
ref|XP_010257835.1|  PREDICTED: strictosidine synthase 3-like           172   3e-46   
ref|XP_006301859.1|  hypothetical protein CARUB_v10022329mg             172   4e-46   
ref|XP_002308895.2|  hypothetical protein POPTR_0006s03930g             174   4e-46   Populus trichocarpa [western balsam poplar]
ref|XP_010537421.1|  PREDICTED: strictosidine synthase 1-like           172   4e-46   
ref|XP_006291321.1|  hypothetical protein CARUB_v10017454mg             173   5e-46   
ref|XP_010922155.1|  PREDICTED: strictosidine synthase 3-like           173   5e-46   
emb|CDY45863.1|  BnaC02g22570D                                          172   5e-46   
ref|XP_010428361.1|  PREDICTED: strictosidine synthase 1-like           172   5e-46   
ref|XP_004249227.1|  PREDICTED: strictosidine synthase 1                173   5e-46   
ref|XP_003528253.1|  PREDICTED: strictosidine synthase 3-like iso...    172   5e-46   
ref|XP_002452976.1|  hypothetical protein SORBIDRAFT_04g035870          172   5e-46   Sorghum bicolor [broomcorn]
gb|EYU18642.1|  hypothetical protein MIMGU_mgv1a008518mg                172   6e-46   
ref|XP_009797408.1|  PREDICTED: strictosidine synthase 1-like           172   7e-46   
ref|XP_008243874.1|  PREDICTED: strictosidine synthase 3-like           172   7e-46   
emb|CDX73038.1|  BnaC06g34860D                                          171   7e-46   
ref|XP_010269382.1|  PREDICTED: strictosidine synthase 1-like           172   8e-46   
ref|XP_009106058.1|  PREDICTED: strictosidine synthase 3-like           171   8e-46   
emb|CDX73039.1|  BnaC06g34870D                                          171   9e-46   
ref|XP_009116408.1|  PREDICTED: strictosidine synthase 1                172   9e-46   
ref|XP_010416233.1|  PREDICTED: strictosidine synthase 3                171   1e-45   
ref|XP_004150130.1|  PREDICTED: strictosidine synthase 1-like           171   1e-45   
ref|XP_008244837.1|  PREDICTED: strictosidine synthase 1                172   1e-45   
ref|XP_004978210.1|  PREDICTED: strictosidine synthase 1-like           171   1e-45   
gb|EPS66876.1|  hypothetical protein M569_07898                         172   1e-45   
ref|XP_002888957.1|  strictosidine synthase family protein              170   2e-45   
ref|XP_010108510.1|  Strictosidine synthase 1                           172   2e-45   
ref|XP_008465977.1|  PREDICTED: strictosidine synthase 1-like           171   2e-45   
ref|XP_010430839.1|  PREDICTED: strictosidine synthase 1-like           170   2e-45   
ref|XP_009128018.1|  PREDICTED: strictosidine synthase 3-like           170   2e-45   
ref|XP_007204530.1|  hypothetical protein PRUPE_ppa017675mg             171   2e-45   
ref|XP_010655934.1|  PREDICTED: strictosidine synthase 1-like           169   2e-45   
ref|XP_010425613.1|  PREDICTED: strictosidine synthase 3-like           170   2e-45   
ref|XP_006344500.1|  PREDICTED: adipocyte plasma membrane-associa...    171   2e-45   
ref|XP_007146688.1|  hypothetical protein PHAVU_006G061000g             171   2e-45   
gb|KFK34942.1|  hypothetical protein AALP_AA5G213900                    171   3e-45   
emb|CDP09527.1|  unnamed protein product                                171   3e-45   
gb|EMT31336.1|  Strictosidine synthase 1                                171   3e-45   
ref|XP_011000438.1|  PREDICTED: strictosidine synthase 1                171   3e-45   
ref|XP_003576476.1|  PREDICTED: strictosidine synthase 3-like           171   3e-45   
ref|XP_004307669.1|  PREDICTED: strictosidine synthase 1-like iso...    171   3e-45   
ref|XP_002888956.1|  hypothetical protein ARALYDRAFT_476540             169   3e-45   
ref|XP_002452451.1|  hypothetical protein SORBIDRAFT_04g026050          170   4e-45   Sorghum bicolor [broomcorn]
ref|XP_006291448.1|  hypothetical protein CARUB_v10017585mg             170   4e-45   
ref|XP_009339573.1|  PREDICTED: strictosidine synthase 3-like           171   4e-45   
emb|CDP16919.1|  unnamed protein product                                170   4e-45   
ref|XP_010672985.1|  PREDICTED: strictosidine synthase 1-like           171   4e-45   
ref|XP_010471491.1|  PREDICTED: strictosidine synthase 1-like           169   4e-45   
ref|XP_004169880.1|  PREDICTED: LOW QUALITY PROTEIN: strictosidin...    170   5e-45   
ref|XP_002454704.1|  hypothetical protein SORBIDRAFT_04g035910          170   5e-45   Sorghum bicolor [broomcorn]
ref|NP_177541.1|  strictosidine synthase-like protein                   169   5e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002278088.1|  PREDICTED: strictosidine synthase 3                171   5e-45   Vitis vinifera
ref|XP_006390477.1|  hypothetical protein EUTSA_v10018854mg             169   5e-45   
ref|XP_010428362.1|  PREDICTED: strictosidine synthase 1-like           169   5e-45   
ref|NP_191262.2|  calcium-dependent phosphotriesterase superfamil...    170   5e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003554139.1|  PREDICTED: strictosidine synthase 1-like           170   6e-45   
emb|CAB72173.1|  putative protein                                       170   6e-45   Arabidopsis thaliana [mouse-ear cress]
emb|CDY22515.1|  BnaC03g23250D                                          169   6e-45   
ref|XP_010677108.1|  PREDICTED: strictosidine synthase 1-like           169   6e-45   
dbj|BAE99809.1|  hypothetical protein                                   170   6e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002438841.1|  hypothetical protein SORBIDRAFT_10g027060          169   6e-45   Sorghum bicolor [broomcorn]
gb|AFK49602.1|  unknown                                                 170   6e-45   
ref|XP_003625041.1|  Adipocyte plasma membrane-associated protein       170   8e-45   
gb|EPS65875.1|  hypothetical protein M569_08902                         170   8e-45   
ref|XP_010932965.1|  PREDICTED: strictosidine synthase 3-like           170   9e-45   
ref|NP_001063030.1|  Os09g0373200                                       169   9e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008392402.1|  PREDICTED: strictosidine synthase 1-like           169   9e-45   
ref|XP_009783664.1|  PREDICTED: strictosidine synthase 3-like           170   9e-45   
emb|CDP09529.1|  unnamed protein product                                169   1e-44   
ref|XP_003595639.1|  Strictosidine synthase-like protein                168   1e-44   
emb|CBI18783.3|  unnamed protein product                                168   1e-44   
emb|CDY35420.1|  BnaA03g19400D                                          169   1e-44   
ref|XP_002323255.1|  strictosidine synthase family protein              169   1e-44   Populus trichocarpa [western balsam poplar]
ref|XP_011075619.1|  PREDICTED: protein STRICTOSIDINE SYNTHASE-LI...    168   1e-44   
ref|NP_177540.3|  strictosidine synthase 3                              168   1e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004963976.1|  PREDICTED: strictosidine synthase-like             169   1e-44   
ref|XP_008453519.1|  PREDICTED: strictosidine synthase 3                169   2e-44   
ref|XP_009631158.1|  PREDICTED: strictosidine synthase 1-like           168   2e-44   
ref|XP_009142736.1|  PREDICTED: strictosidine synthase 3-like           169   2e-44   
ref|XP_010427563.1|  PREDICTED: strictosidine synthase 1-like           169   2e-44   
emb|CDX95058.1|  BnaC05g06130D                                          169   2e-44   
ref|XP_010471492.1|  PREDICTED: strictosidine synthase 1-like           167   2e-44   
ref|XP_004487437.1|  PREDICTED: adipocyte plasma membrane-associa...    169   3e-44   
ref|XP_004986966.1|  PREDICTED: strictosidine synthase 3-like           167   3e-44   
ref|XP_003564761.1|  PREDICTED: strictosidine synthase 3-like           167   3e-44   
ref|XP_008776219.1|  PREDICTED: adipocyte plasma membrane-associa...    168   3e-44   
emb|CDP07817.1|  unnamed protein product                                167   3e-44   
ref|XP_006582039.1|  PREDICTED: strictosidine synthase 3-like iso...    167   4e-44   
ref|XP_006494390.1|  PREDICTED: strictosidine synthase 1-like           168   4e-44   
gb|EEC84476.1|  hypothetical protein OsI_31134                          167   4e-44   Oryza sativa Indica Group [Indian rice]
ref|XP_002888958.1|  hypothetical protein ARALYDRAFT_476542             167   4e-44   
ref|XP_004986991.1|  PREDICTED: strictosidine synthase 3-like           167   4e-44   
ref|XP_004172338.1|  PREDICTED: adipocyte plasma membrane-associa...    168   5e-44   
ref|XP_004137361.1|  PREDICTED: adipocyte plasma membrane-associa...    168   5e-44   
ref|XP_009356499.1|  PREDICTED: strictosidine synthase 3-like           167   5e-44   
ref|XP_010554777.1|  PREDICTED: strictosidine synthase 3-like           167   5e-44   
ref|XP_009128020.1|  PREDICTED: strictosidine synthase 1 isoform X1     166   5e-44   
gb|KHN18404.1|  Strictosidine synthase 1                                166   6e-44   
ref|XP_010427562.1|  PREDICTED: strictosidine synthase 1-like           166   6e-44   
ref|XP_003549591.1|  PREDICTED: strictosidine synthase 1-like           166   6e-44   
emb|CDY45861.1|  BnaC02g22590D                                          166   6e-44   
ref|XP_009133478.1|  PREDICTED: strictosidine synthase 3                167   6e-44   
gb|EPS68312.1|  hypothetical protein M569_06455                         168   6e-44   
gb|EMT14932.1|  Strictosidine synthase 3                                167   6e-44   
ref|XP_003595643.1|  Strictosidine synthase-like protein                166   7e-44   
ref|XP_004971567.1|  PREDICTED: strictosidine synthase 1-like           166   8e-44   
ref|XP_008652645.1|  PREDICTED: strictosidine synthase 3-like           167   9e-44   
dbj|BAK06958.1|  predicted protein                                      167   9e-44   
ref|NP_177542.1|  strictosidine synthase 2                              166   1e-43   Arabidopsis thaliana [mouse-ear cress]
gb|AAB40593.1|  strictosidine synthase                                  166   1e-43   Arabidopsis thaliana [mouse-ear cress]
emb|CDP09528.1|  unnamed protein product                                167   1e-43   
emb|CDX79944.1|  BnaA05g02120D                                          167   1e-43   
ref|XP_010428364.1|  PREDICTED: strictosidine synthase 1-like           166   1e-43   
emb|CDP06820.1|  unnamed protein product                                164   1e-43   
ref|XP_008655524.1|  PREDICTED: strictosidine synthase 3-like           166   1e-43   
emb|CAN77942.1|  hypothetical protein VITISV_044018                     166   1e-43   Vitis vinifera
gb|KFK41838.1|  hypothetical protein AALP_AA2G178000                    165   1e-43   
gb|KFK36980.1|  hypothetical protein AALP_AA4G196900                    167   1e-43   
tpg|DAA45309.1|  TPA: hypothetical protein ZEAMMB73_979948              166   1e-43   
ref|XP_002878128.1|  strictosidine synthase family protein              166   1e-43   
gb|KHG24230.1|  Strictosidine synthase 3 -like protein                  165   1e-43   
ref|XP_007037730.1|  Calcium-dependent phosphotriesterase superfa...    166   1e-43   
ref|XP_007028511.1|  Calcium-dependent phosphotriesterase superfa...    166   1e-43   
tpg|DAA61232.1|  TPA: strictosidine synthase 3                          166   1e-43   
gb|EMT28724.1|  putative Strictosidine synthase                         166   1e-43   
ref|XP_002270060.2|  PREDICTED: strictosidine synthase 1-like           166   1e-43   Vitis vinifera
ref|XP_003547789.1|  PREDICTED: strictosidine synthase-like             166   2e-43   
ref|XP_003576994.1|  PREDICTED: LOW QUALITY PROTEIN: strictosidin...    166   2e-43   
ref|XP_006340100.1|  PREDICTED: strictosidine synthase 1-like iso...    166   2e-43   
ref|XP_004984421.1|  PREDICTED: strictosidine synthase-like             165   2e-43   
ref|XP_010504622.1|  PREDICTED: strictosidine synthase 1-like           166   2e-43   
gb|KEH23602.1|  strictosidine synthase family protein                   166   2e-43   
gb|ACU19372.1|  unknown                                                 165   2e-43   Glycine max [soybeans]
gb|KHF98782.1|  Adipocyte plasma membrane-associated                    167   2e-43   
ref|XP_006826427.1|  hypothetical protein AMTR_s00004p00163660          166   2e-43   
pdb|2V91|A  Chain A, Structure Of Strictosidine Synthase In Compl...    164   2e-43   
ref|XP_003524502.1|  PREDICTED: strictosidine synthase 1-like           165   2e-43   
emb|CDY23858.1|  BnaC04g01790D                                          166   2e-43   
ref|XP_010416234.1|  PREDICTED: strictosidine synthase 1                165   2e-43   
ref|XP_010504621.1|  PREDICTED: strictosidine synthase 1-like           165   3e-43   
ref|XP_004986993.1|  PREDICTED: strictosidine synthase 3-like           165   3e-43   
ref|XP_004967164.1|  PREDICTED: strictosidine synthase 1-like           165   3e-43   
pdb|2FP8|A  Chain A, Structure Of Strictosidine Synthase, The Bio...    164   3e-43   
gb|KHN15177.1|  Strictosidine synthase 1                                164   3e-43   
ref|XP_008655533.1|  PREDICTED: strictosidine synthase 3-like           164   3e-43   
ref|XP_010507098.1|  PREDICTED: uncharacterized protein LOC104783669    169   4e-43   
ref|XP_011013883.1|  PREDICTED: strictosidine synthase 3-like           163   4e-43   
sp|P68174.1|STSY_RAUMA  RecName: Full=Strictosidine synthase; Fla...    164   4e-43   Rauvolfia mannii
sp|P68175.1|STSY_RAUSE  RecName: Full=Strictosidine synthase; Fla...    164   4e-43   Rauvolfia serpentina [devilpepper]
ref|XP_011035620.1|  PREDICTED: strictosidine synthase 3-like           163   4e-43   
ref|XP_009599899.1|  PREDICTED: strictosidine synthase 3-like           165   5e-43   
ref|XP_003617474.1|  Strictosidine synthase                             164   5e-43   
ref|XP_008655507.1|  PREDICTED: strictosidine synthase 3-like           164   5e-43   
ref|XP_003575472.1|  PREDICTED: strictosidine synthase 1-like           164   6e-43   
ref|XP_010023798.1|  PREDICTED: strictosidine synthase 1-like           164   6e-43   
ref|XP_004967142.1|  PREDICTED: strictosidine synthase 1-like           164   7e-43   
ref|XP_008443273.1|  PREDICTED: strictosidine synthase 1                164   8e-43   
gb|KFK41840.1|  hypothetical protein AALP_AA2G178200                    163   8e-43   
ref|NP_001150769.1|  strictosidine synthase 3 precursor                 164   8e-43   
ref|XP_010031589.1|  PREDICTED: adipocyte plasma membrane-associa...    165   8e-43   
ref|XP_010042385.1|  PREDICTED: strictosidine synthase 1-like           164   9e-43   
gb|ABR18211.1|  unknown                                                 165   9e-43   
ref|XP_010031590.1|  PREDICTED: adipocyte plasma membrane-associa...    164   9e-43   
gb|KDP31453.1|  hypothetical protein JCGZ_11829                         162   9e-43   
ref|XP_004967140.1|  PREDICTED: strictosidine synthase 1-like           163   1e-42   
gb|ABK24858.1|  unknown                                                 165   1e-42   
ref|XP_009128022.1|  PREDICTED: strictosidine synthase 1 isoform X2     162   1e-42   
gb|ABZ79473.1|  strictosidine synthase                                  163   1e-42   
ref|XP_002532594.1|  strictosidine synthase, putative                   164   1e-42   
ref|XP_009412315.1|  PREDICTED: strictosidine synthase 3-like           164   1e-42   
gb|EAZ01723.1|  hypothetical protein OsI_23749                          163   2e-42   
emb|CDX72079.1|  BnaC08g27950D                                          162   2e-42   
ref|XP_002267323.1|  PREDICTED: strictosidine synthase 3                164   2e-42   
ref|XP_011075408.1|  PREDICTED: protein STRICTOSIDINE SYNTHASE-LI...    163   2e-42   
ref|XP_004974473.1|  PREDICTED: strictosidine synthase 1-like           162   2e-42   
emb|CBI30108.3|  unnamed protein product                                163   2e-42   
ref|XP_004506244.1|  PREDICTED: adipocyte plasma membrane-associa...    164   2e-42   
ref|XP_009803216.1|  PREDICTED: strictosidine synthase 1-like           163   2e-42   
dbj|BAD35676.1|  putative strictosidine synthase precursor              162   2e-42   
gb|EAZ01726.1|  hypothetical protein OsI_23752                          162   2e-42   
ref|XP_007132511.1|  hypothetical protein PHAVU_011G100400g             164   2e-42   
gb|EAZ01725.1|  hypothetical protein OsI_23751                          162   2e-42   
ref|XP_004970743.1|  PREDICTED: strictosidine synthase 3-like           162   2e-42   
ref|XP_008230556.1|  PREDICTED: strictosidine synthase 3                163   2e-42   
ref|XP_004974468.1|  PREDICTED: strictosidine synthase 1-like           162   2e-42   
ref|XP_002298158.2|  strictosidine synthase family protein              163   3e-42   
ref|XP_010516308.1|  PREDICTED: strictosidine synthase 1-like           163   3e-42   
ref|XP_006662726.1|  PREDICTED: strictosidine synthase 3-like           163   3e-42   
ref|XP_008382118.1|  PREDICTED: strictosidine synthase 3                164   3e-42   
ref|XP_007205319.1|  hypothetical protein PRUPE_ppa006884mg             163   3e-42   
gb|EAZ37681.1|  hypothetical protein OsJ_22019                          160   3e-42   
ref|XP_004956696.1|  PREDICTED: strictosidine synthase 3-like           162   4e-42   
ref|XP_010525478.1|  PREDICTED: strictosidine synthase 1-like           162   4e-42   
gb|KDP37825.1|  hypothetical protein JCGZ_06727                         162   4e-42   
ref|XP_003521146.1|  PREDICTED: strictosidine synthase 1-like           162   4e-42   
ref|XP_002443591.1|  hypothetical protein SORBIDRAFT_08g022130          161   5e-42   
ref|XP_009614698.1|  PREDICTED: strictosidine synthase 1-like           162   5e-42   
emb|CDY06143.1|  BnaA09g36370D                                          162   6e-42   
ref|XP_004956695.1|  PREDICTED: strictosidine synthase 3-like           161   6e-42   
gb|KHG24912.1|  Adipocyte plasma membrane-associated                    162   6e-42   
dbj|BAD35674.1|  putative strictosidine synthase                        160   6e-42   
gb|KHN41250.1|  Adipocyte plasma membrane-associated protein            161   7e-42   
ref|XP_004136643.1|  PREDICTED: strictosidine synthase 1-like           162   7e-42   
ref|XP_011044611.1|  PREDICTED: strictosidine synthase 3-like           162   7e-42   
ref|XP_006301702.1|  hypothetical protein CARUB_v10022158mg             165   7e-42   
gb|KEH29729.1|  strictosidine synthase family protein                   162   7e-42   
ref|XP_004981761.1|  PREDICTED: adipocyte plasma membrane-associa...    162   8e-42   
gb|EYU22112.1|  hypothetical protein MIMGU_mgv1a007437mg                162   9e-42   
ref|XP_010458085.1|  PREDICTED: strictosidine synthase 3-like           162   1e-41   
gb|KFK43153.1|  hypothetical protein AALP_AA1G086800                    162   1e-41   
emb|CDX93560.1|  BnaA06g04880D                                          162   1e-41   
ref|XP_010475646.1|  PREDICTED: strictosidine synthase 3-like           162   1e-41   
ref|XP_002467870.1|  hypothetical protein SORBIDRAFT_01g035660          160   1e-41   
ref|NP_001150008.1|  strictosidine synthase precursor                   162   1e-41   
ref|XP_003596929.1|  Adipocyte plasma membrane-associated protein       162   1e-41   
ref|XP_004974461.1|  PREDICTED: strictosidine synthase 1-like           160   1e-41   
ref|XP_004164012.1|  PREDICTED: strictosidine synthase 1-like           161   1e-41   
ref|XP_009378622.1|  PREDICTED: strictosidine synthase 3-like           162   1e-41   
ref|XP_010247897.1|  PREDICTED: strictosidine synthase 3-like           162   1e-41   
ref|XP_010529101.1|  PREDICTED: strictosidine synthase 3-like           161   1e-41   
gb|AES67180.2|  strictosidine synthase family protein                   162   1e-41   
ref|XP_002463871.1|  hypothetical protein SORBIDRAFT_01g007960          162   1e-41   
ref|XP_011037298.1|  PREDICTED: strictosidine synthase 3-like           161   1e-41   
ref|XP_004974462.1|  PREDICTED: strictosidine synthase 1-like           160   1e-41   
ref|XP_008677622.1|  PREDICTED: strictosidine synthase isoform X1       161   1e-41   
ref|XP_010686168.1|  PREDICTED: strictosidine synthase 3-like           160   2e-41   
ref|XP_003576475.1|  PREDICTED: strictosidine synthase 3-like           160   2e-41   
ref|XP_006424057.1|  hypothetical protein CICLE_v10028617mg             161   2e-41   
ref|XP_003580953.1|  PREDICTED: strictosidine synthase 1-like           160   2e-41   
gb|EMT05184.1|  Strictosidine synthase 1                                160   2e-41   
gb|ABA91449.1|  Strictosidine synthase family protein                   160   2e-41   
ref|XP_003527512.1|  PREDICTED: adipocyte plasma membrane-associa...    162   2e-41   
ref|XP_004974464.1|  PREDICTED: strictosidine synthase 1-like           160   2e-41   
gb|ADK91432.1|  strictosidine synthase                                  160   3e-41   
ref|XP_009148103.1|  PREDICTED: strictosidine synthase 3                160   3e-41   
ref|XP_003561520.1|  PREDICTED: strictosidine synthase 1-like           159   3e-41   
ref|XP_007162124.1|  hypothetical protein PHAVU_001G125900g             160   3e-41   
emb|CDX92388.1|  BnaA10g14270D                                          160   3e-41   
ref|XP_010672984.1|  PREDICTED: strictosidine synthase 1-like           160   3e-41   
gb|KDO48949.1|  hypothetical protein CISIN_1g015463mg                   160   3e-41   
ref|XP_010488915.1|  PREDICTED: strictosidine synthase 3-like           160   3e-41   
ref|XP_006657226.1|  PREDICTED: strictosidine synthase 1-like           159   4e-41   
gb|AGU43759.1|  strictosidine synthase                                  160   4e-41   
ref|XP_002460150.1|  hypothetical protein SORBIDRAFT_02g023460          159   5e-41   
ref|XP_006348919.1|  PREDICTED: strictosidine synthase 1-like           159   7e-41   
ref|XP_004493426.1|  PREDICTED: strictosidine synthase 1-like           159   7e-41   
dbj|BAC83125.1|  putative male fertility protein                        159   7e-41   
ref|XP_004307668.1|  PREDICTED: strictosidine synthase 1-like iso...    159   8e-41   
ref|XP_009394278.1|  PREDICTED: strictosidine synthase 1-like           159   9e-41   
ref|XP_002966382.1|  hypothetical protein SELMODRAFT_230896             159   9e-41   
ref|XP_010263076.1|  PREDICTED: adipocyte plasma membrane-associa...    159   9e-41   
dbj|BAD05221.1|  putative male fertility protein                        158   9e-41   
ref|XP_006487831.1|  PREDICTED: adipocyte plasma membrane-associa...    159   1e-40   
gb|EAZ40180.1|  hypothetical protein OsJ_24625                          158   1e-40   
ref|XP_006348986.1|  PREDICTED: strictosidine synthase 1-like           159   1e-40   
ref|XP_006340101.1|  PREDICTED: strictosidine synthase 1-like iso...    159   1e-40   
ref|XP_010685469.1|  PREDICTED: strictosidine synthase 3-like           159   1e-40   
ref|XP_010056146.1|  PREDICTED: strictosidine synthase 1                159   1e-40   
ref|XP_006660586.1|  PREDICTED: strictosidine synthase 3-like           158   1e-40   
gb|EAZ04232.1|  hypothetical protein OsI_26376                          158   1e-40   
gb|EAZ41691.1|  hypothetical protein OsJ_26224                          158   1e-40   
gb|EAY79903.1|  hypothetical protein OsI_35066                          158   1e-40   
ref|XP_008777477.1|  PREDICTED: strictosidine synthase 1-like           158   1e-40   
ref|XP_006411394.1|  hypothetical protein EUTSA_v10016811mg             158   1e-40   
ref|XP_002513740.1|  strictosidine synthase, putative                   159   2e-40   
pdb|2FPB|A  Chain A, Structure Of Strictosidine Synthase, The Bio...    157   2e-40   
gb|EAZ01722.1|  hypothetical protein OsI_23748                          157   2e-40   
ref|XP_004243243.1|  PREDICTED: strictosidine synthase 1-like           158   2e-40   
gb|EMT18390.1|  Strictosidine synthase 1                                157   2e-40   
ref|XP_006417683.1|  hypothetical protein EUTSA_v10007865mg             158   2e-40   
ref|XP_002456259.1|  hypothetical protein SORBIDRAFT_03g033070          157   2e-40   
ref|NP_001059909.2|  Os07g0543600                                       157   2e-40   
gb|KDP42972.1|  hypothetical protein JCGZ_23914                         158   2e-40   
ref|XP_002443589.1|  hypothetical protein SORBIDRAFT_08g022110          157   2e-40   
dbj|BAD35673.1|  putative strictosidine synthase precursor              157   3e-40   
ref|XP_007015611.1|  Strictosidine synthase-like 3                      158   3e-40   
gb|AES81258.2|  strictosidine synthase family protein                   157   3e-40   
ref|XP_011088992.1|  PREDICTED: protein STRICTOSIDINE SYNTHASE-LI...    157   3e-40   
ref|XP_006847661.1|  hypothetical protein AMTR_s00149p00021810          157   3e-40   
ref|XP_010056166.1|  PREDICTED: strictosidine synthase 1-like           157   4e-40   
gb|EEC84480.1|  hypothetical protein OsI_31139                          156   4e-40   
ref|XP_010108508.1|  Adipocyte plasma membrane-associated protein       159   4e-40   
ref|XP_009623916.1|  PREDICTED: strictosidine synthase 3-like           157   4e-40   
ref|XP_002438640.1|  hypothetical protein SORBIDRAFT_10g023490          156   4e-40   
dbj|BAC83776.1|  putative strictosidine synthase                        156   5e-40   
gb|ABA95780.1|  Strictosidine synthase family protein, expressed        157   5e-40   
gb|AEY82398.1|  strictosidine synthase                                  156   5e-40   
emb|CDP21347.1|  unnamed protein product                                157   6e-40   
gb|EAY82206.1|  hypothetical protein OsI_37409                          156   6e-40   
sp|P18417.2|STSY_CATRO  RecName: Full=Strictosidine synthase; Fla...    156   6e-40   
ref|XP_004955242.1|  PREDICTED: strictosidine synthase 1-like           156   6e-40   
ref|XP_002448962.1|  hypothetical protein SORBIDRAFT_05g002520          157   7e-40   
ref|XP_010091689.1|  Strictosidine synthase                             156   7e-40   
gb|EYU41103.1|  hypothetical protein MIMGU_mgv1a007213mg                157   7e-40   
ref|XP_002456721.1|  hypothetical protein SORBIDRAFT_03g041380          155   8e-40   
ref|XP_002460151.1|  hypothetical protein SORBIDRAFT_02g023470          156   8e-40   
ref|XP_006436707.1|  hypothetical protein CICLE_v10033463mg             153   8e-40   
ref|XP_010045161.1|  PREDICTED: strictosidine synthase 3-like           156   8e-40   
gb|ABA95779.2|  Strictosidine synthase family protein, expressed        157   9e-40   
emb|CDM83814.1|  unnamed protein product                                155   9e-40   
emb|CDM86638.1|  unnamed protein product                                155   9e-40   
ref|XP_010554776.1|  PREDICTED: LOW QUALITY PROTEIN: strictosidin...    156   1e-39   
emb|CAA37671.1|  strictosidine synthase precursor                       155   1e-39   
ref|XP_011090280.1|  PREDICTED: protein STRICTOSIDINE SYNTHASE-LI...    157   1e-39   
ref|NP_001063033.1|  Os09g0374900                                       155   1e-39   
ref|XP_006663808.1|  PREDICTED: strictosidine synthase 3-like           155   1e-39   
ref|XP_010420991.1|  PREDICTED: adipocyte plasma membrane-associa...    156   2e-39   
ref|XP_008657057.1|  PREDICTED: LOW QUALITY PROTEIN: strictosidin...    155   2e-39   
ref|XP_004241357.2|  PREDICTED: strictosidine synthase 3-like           156   2e-39   
gb|KDO41714.1|  hypothetical protein CISIN_1g046018mg                   154   2e-39   
ref|XP_008657058.1|  PREDICTED: strictosidine synthase 3-like           155   2e-39   
ref|XP_004986926.1|  PREDICTED: strictosidine synthase-like             155   2e-39   
ref|XP_010544326.1|  PREDICTED: strictosidine synthase 3                155   2e-39   
ref|XP_008657056.1|  PREDICTED: strictosidine synthase 3-like           154   2e-39   
ref|NP_001132695.1|  Strictosidine synthase 3 precursor                 155   2e-39   
gb|AFW84563.1|  hypothetical protein ZEAMMB73_589231                    154   3e-39   
ref|XP_010246302.1|  PREDICTED: strictosidine synthase 3-like           154   3e-39   
ref|XP_010454464.1|  PREDICTED: strictosidine synthase 3-like           155   3e-39   
emb|CDY16615.1|  BnaC09g36580D                                          155   3e-39   
ref|XP_002514533.1|  strictosidine synthase, putative                   154   3e-39   
ref|XP_006644568.1|  PREDICTED: strictosidine synthase 1-like           154   3e-39   
gb|EAY75495.1|  hypothetical protein OsI_03394                          154   4e-39   
gb|AAB40595.1|  strictosidine synthase                                  154   4e-39   
ref|XP_010647214.1|  PREDICTED: strictosidine synthase 1                154   4e-39   
dbj|BAJ89445.1|  predicted protein                                      155   4e-39   
dbj|BAJ91613.1|  predicted protein                                      155   5e-39   
ref|XP_006411395.1|  hypothetical protein EUTSA_v10016720mg             155   5e-39   
gb|EMT04951.1|  Strictosidine synthase 1                                160   5e-39   
ref|XP_009797832.1|  PREDICTED: strictosidine synthase 3-like           154   5e-39   
ref|XP_008657062.1|  PREDICTED: strictosidine synthase 3-like           153   6e-39   
ref|XP_006305032.1|  hypothetical protein CARUB_v10009397mg             154   6e-39   
ref|XP_002450243.1|  hypothetical protein SORBIDRAFT_05g002470          154   6e-39   
ref|XP_010090518.1|  Adipocyte plasma membrane-associated protein       154   6e-39   
ref|XP_004955258.1|  PREDICTED: strictosidine synthase 1-like           153   6e-39   
ref|XP_004974394.1|  PREDICTED: strictosidine synthase 3-like           153   6e-39   
ref|XP_003521147.1|  PREDICTED: strictosidine synthase 1-like           154   7e-39   
ref|XP_002978184.1|  hypothetical protein SELMODRAFT_108020             154   8e-39   
emb|CDM84363.1|  unnamed protein product                                152   8e-39   
ref|XP_006294436.1|  hypothetical protein CARUB_v10023450mg             154   8e-39   
ref|XP_009765833.1|  PREDICTED: strictosidine synthase 3                154   9e-39   
ref|XP_002881766.1|  hypothetical protein ARALYDRAFT_483200             153   9e-39   
gb|KHN31827.1|  Strictosidine synthase 3                                151   1e-38   
ref|XP_003581637.1|  PREDICTED: strictosidine synthase 1-like           152   1e-38   
ref|XP_010493259.1|  PREDICTED: strictosidine synthase 3-like           154   1e-38   
ref|XP_002456643.1|  hypothetical protein SORBIDRAFT_03g040000          152   1e-38   
ref|XP_010516303.1|  PREDICTED: strictosidine synthase 3-like           153   1e-38   
ref|XP_007222749.1|  hypothetical protein PRUPE_ppa006506mg             154   1e-38   
ref|XP_006361111.1|  PREDICTED: adipocyte plasma membrane-associa...    153   1e-38   
ref|XP_010253308.1|  PREDICTED: adipocyte plasma membrane-associa...    153   1e-38   
ref|XP_004977501.1|  PREDICTED: strictosidine synthase 1-like           152   2e-38   
ref|XP_004979009.1|  PREDICTED: strictosidine synthase 3-like           152   2e-38   
ref|XP_003559512.1|  PREDICTED: strictosidine synthase-like             153   2e-38   
ref|XP_008657012.1|  PREDICTED: strictosidine synthase 3-like           152   2e-38   
ref|XP_008657055.1|  PREDICTED: strictosidine synthase 3-like           152   2e-38   
emb|CBX24423.1|  hypothetical_protein                                   154   2e-38   
ref|XP_009120693.1|  PREDICTED: strictosidine synthase 3                153   2e-38   
ref|NP_001150945.1|  strictosidine synthase 1 precursor                 151   3e-38   
ref|XP_003572967.1|  PREDICTED: strictosidine synthase 1-like           151   3e-38   
ref|XP_004955245.1|  PREDICTED: strictosidine synthase 1-like           151   3e-38   
emb|CBX25468.1|  hypothetical_protein                                   152   3e-38   
ref|XP_004978641.1|  PREDICTED: strictosidine synthase 3-like iso...    152   3e-38   
gb|EMT00978.1|  Strictosidine synthase 1                                151   3e-38   
ref|XP_006287902.1|  hypothetical protein CARUB_v10001136mg             152   3e-38   
ref|XP_010230125.1|  PREDICTED: strictosidine synthase 1-like           151   3e-38   
ref|XP_010525477.1|  PREDICTED: strictosidine synthase 1-like           152   3e-38   
ref|XP_010508735.1|  PREDICTED: strictosidine synthase 3                152   4e-38   
gb|AFW84562.1|  hypothetical protein ZEAMMB73_589231                    154   4e-38   
ref|XP_011091642.1|  PREDICTED: protein STRICTOSIDINE SYNTHASE-LI...    152   4e-38   
ref|XP_010243901.1|  PREDICTED: strictosidine synthase 1                152   4e-38   
ref|XP_010431421.1|  PREDICTED: strictosidine synthase 3-like           150   5e-38   
emb|CDM84367.1|  unnamed protein product                                154   5e-38   
ref|XP_002874041.1|  strictosidine synthase family protein              152   5e-38   
gb|EAZ28597.1|  hypothetical protein OsJ_12584                          150   5e-38   
ref|XP_010517618.1|  PREDICTED: strictosidine synthase 3-like           151   5e-38   
gb|KFK26348.1|  hypothetical protein AALP_AA8G236100                    152   5e-38   
dbj|BAK04872.1|  predicted protein                                      151   5e-38   
ref|XP_009587970.1|  PREDICTED: strictosidine synthase 3-like           151   6e-38   
ref|NP_001234466.1|  uncharacterized protein LOC543656 precursor        150   6e-38   



>ref|XP_004236090.1| PREDICTED: strictosidine synthase 3-like [Solanum lycopersicum]
Length=332

 Score =   248 bits (633),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 145/341 (43%), Positives = 203/341 (60%), Gaps = 22/341 (6%)
 Frame = +3

Query  54    NMKSLTMFWISILMFISSPYVIHSQPGVDFPIILNLQ---HASGPEDTAIDPLDQGIYTG  224
             +++   +F    +M   SP +   +    FP    LQ      GPE +A D    G YTG
Sbjct  5     SIRKTVLFVQIWIMLNVSPSIAWCR----FPAFSKLQLPLQTIGPEASAFDRKGGGPYTG  60

Query  225   VTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYV  398
             + DGRI+KY      F DFA TSP RTK KCDG N   ++  CGRP GL F +  G LY+
Sbjct  61    IADGRIVKYQGPRVGFTDFAVTSPNRTKAKCDGKNGPELQQICGRPFGLGFYYRTGDLYI  120

Query  399   TDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYT  578
             TD FYGL+ V   +GGL T++  G  GRNF+F+DA+ +D+    VYF+D+G IF + N T
Sbjct  121   TDAFYGLVVVG-PSGGLVTRVP-GFQGRNFAFLDALDIDQSKGVVYFVDSGAIFLTGNRT  178

Query  579   QIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFIS  758
             +IV+SGDTSGRL KY  A  QVT++L+GLSGP G+A   D ++++++EYI +RI ++++ 
Sbjct  179   RIVESGDTSGRLFKYDIATKQVTLILSGLSGPVGVALSKDNSYVLVTEYIAQRIRRFWLK  238

Query  759   GPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqppppipMTDSIAVNFDMDG  938
             G KAN++  V  N++G PDN+KR  LG FWVA++            P T S+    +  G
Sbjct  239   GAKANSSD-VFANVDGIPDNIKRTVLGDFWVAIS--------NTKQPTTFSLGQRINQFG  289

Query  939   NIVNTKNVTDTF--PNSFSGYQEYSDIAYVGSLLSDFVAVY  1055
              +V T N T  +  PN  +  QEY    YVGSL  +F+ V+
Sbjct  290   KVVETCNFTAQYNSPNGITEVQEYKGKLYVGSLDQNFIGVF  330



>ref|XP_006345201.1| PREDICTED: strictosidine synthase 3-like [Solanum tuberosum]
Length=332

 Score =   245 bits (625),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 143/332 (43%), Positives = 199/332 (60%), Gaps = 21/332 (6%)
 Frame = +3

Query  90    LMFISSPYVIHSQPGV---DFPIILNLQ---HASGPEDTAIDPLDQGIYTGVTDGRILKY  251
             ++F+    +++  P V    FP    LQ      GPE +A D    G YTG+ DGRI+KY
Sbjct  10    VLFVQIWVMLNVSPSVALCRFPAFSKLQLPLQTIGPEASAFDRKGGGPYTGIADGRIVKY  69

Query  252   LNGN--FNDFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLK  425
                   F DFA TSP RTK KCDG N   ++  CGRP GL F +  G LY+TD FYGL+ 
Sbjct  70    QGPRVGFTDFAVTSPNRTKAKCDGKNGPELQQICGRPFGLGFYYKTGDLYITDAFYGLVV  129

Query  426   VERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTS  605
             V   +GGL T++ +   GRNF+F+DA+ +D+ T  VYF+D+G IF + N T+IV+SGD S
Sbjct  130   VG-PSGGLVTRVPS-FQGRNFAFLDALDIDQRTGVVYFVDSGAIFLTGNTTRIVESGDIS  187

Query  606   GRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQT  785
             GRL KY  A  QVT+LL+GLSGP G+A   D ++++I+E I +RI ++++ G KAN++  
Sbjct  188   GRLFKYDIATKQVTLLLSGLSGPIGVALSKDNSYVLITESIAQRIRRFWLKGAKANSSD-  246

Query  786   VMENLEGYPDNVKRGTLGGFWVALNipkpqqqppppipMTDSIAVNFDMDGNIVNTKNVT  965
             V  N++G PDN+KR  LG FWVA++              T S+    +  G +V T N T
Sbjct  247   VFANVDGIPDNIKRTVLGDFWVAIS--------NTKQRTTFSLGQRINRFGKVVETCNFT  298

Query  966   DTF--PNSFSGYQEYSDIAYVGSLLSDFVAVY  1055
               +  PN  +  QEY    YVGSL  +F+ V+
Sbjct  299   AQYKSPNGITEVQEYKGKLYVGSLDQNFIGVF  330



>ref|XP_004252261.1| PREDICTED: strictosidine synthase 3-like [Solanum lycopersicum]
Length=333

 Score =   243 bits (621),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 140/297 (47%), Positives = 188/297 (63%), Gaps = 9/297 (3%)
 Frame = +3

Query  174   GPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRAEC  347
             GPE  A D L  G YT V DGR+LKY      F DFATTSP RTKE C+G N  N+   C
Sbjct  41    GPEAIAFDLLGNGPYTSVADGRVLKYQGPRIGFIDFATTSPLRTKEVCNGKNDPNLLITC  100

Query  348   GRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTA  527
             GRPLGL F +  G LY+ D+ YGLL V R NGG A QL  G++G+ F+F +AV +D+L  
Sbjct  101   GRPLGLGFYYRSGDLYIADINYGLLVVGR-NGGPARQLVTGIDGKPFAFTNAVDIDQLNG  159

Query  528   DVYFIDAGDIFRSL-NYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQT  704
              VYF D+G +FR+  N T I++S DT+GRL KY     +VT+LL+GL+GP G+A  +D +
Sbjct  160   VVYFTDSGPLFRATRNITLILESKDTTGRLFKYDIRTNKVTLLLSGLAGPVGVAVSLDGS  219

Query  705   FIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqp  884
             +++++E I  RI ++++ G +ANT+Q    NL GYPDN+KR  LG +WVA+NI   Q   
Sbjct  220   YVLVTELIANRIKRFWVRGTRANTSQE-FTNLNGYPDNIKRTILGDYWVAVNIVNNQSMT  278

Query  885   pppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSFSGYQEYSDIAYVGSLLSDFVAVY  1055
             PP      S A   ++ GN+  + N++  + NS S  QE     Y+GSL  DFV VY
Sbjct  279   PPKF----SFAQKINVLGNVFVSLNLSTQYRNSISEVQEKFGRLYIGSLEEDFVGVY  331



>ref|XP_004236089.1| PREDICTED: strictosidine synthase 1-like [Solanum lycopersicum]
Length=336

 Score =   234 bits (598),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 145/334 (43%), Positives = 203/334 (61%), Gaps = 17/334 (5%)
 Frame = +3

Query  72    MFWI-SILMFI-SSPYVIHSQ-PGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRI  242
             MF I  IL+F+ +SPY++H     +  P+      A GP+ +A D    G YTGV DGR+
Sbjct  10    MFLILQILIFLNASPYLVHCAFSRLQLPL-----QAFGPDSSAFDTKGVGPYTGVGDGRV  64

Query  243   LKYLNGN--FNDFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYG  416
             +KY   N  F +FA TSP RTK+ C+G N    +  CGRP GL F +  G LY+TD +YG
Sbjct  65    MKYQGPNVGFTEFAITSPNRTKQICNGTNDPISQISCGRPYGLGFYNKTGDLYITDAYYG  124

Query  417   LLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSG  596
             LL V + +GGLAT L     G  FSF+D++ +D+    +YFID+G IFR+ N   I  SG
Sbjct  125   LL-VVKPSGGLATPLVTSFEGTPFSFLDSLDIDQEEGVIYFIDSGAIFRTGNRVLIALSG  183

Query  597   DTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANT  776
             DT+GRL KY  A  QVT+LLN LSGPAG+A   D++F+++SE IG+RI ++++ G KAN+
Sbjct  184   DTTGRLFKYDIATKQVTLLLNKLSGPAGIALSKDKSFLLVSEAIGKRIRRFWLKGAKANS  243

Query  777   TQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqppppipMTDSIAVNFDMDGNIVNTK  956
             +  V  N++G PDN+KR   G FWVA+   K +    P I  T       +  G +V T+
Sbjct  244   SD-VFANIDGNPDNIKRTVSGDFWVAVVTVKTKVLIIPTIISTGQ---RINQSGKLVETR  299

Query  957   NVTDTFP--NSFSGYQEYSDIAYVGSLLSDFVAV  1052
             + T  +   N  +  QEY+D  Y+GSL  +F+ V
Sbjct  300   DFTAQYMSFNGITEVQEYNDKLYIGSLDQNFIGV  333



>ref|XP_010319099.1| PREDICTED: strictosidine synthase 1-like [Solanum lycopersicum]
Length=336

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 135/321 (42%), Positives = 190/321 (59%), Gaps = 13/321 (4%)
 Frame = +3

Query  102   SSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYL--NGNFNDF  275
             +SPY++H      F  +      SGP+  A D    G YTGV DGR+ KY   N  F +F
Sbjct  22    ASPYLVHCA----FSRLQLPSRISGPDSAAFDTKGDGPYTGVGDGRVFKYQGPNTGFTEF  77

Query  276   ATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLAT  455
             A TSP RTK+ C+G N    +  CGRP GL F    G LY+TD +YGLL V + +GGLAT
Sbjct  78    AITSPNRTKQICNGTNDPISQISCGRPYGLGFYSKTGDLYITDAYYGLL-VVKPSGGLAT  136

Query  456   QLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAK  635
              L     GR F F+D++ +D+    +YF+DAG IFR+ N   I  SGDT+GRL KY  A 
Sbjct  137   PLVTSFEGRPFGFLDSLDIDQEMGIIYFVDAGAIFRTSNRFLIALSGDTTGRLFKYDIAT  196

Query  636   GQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPD  815
              QVT+LL+ LSGPAG+A   D++++++SE IG+RI ++++ G KAN++  V  N++G PD
Sbjct  197   KQVTLLLSKLSGPAGVALSKDKSYLLVSEAIGKRITRFWLEGTKANSSD-VFTNIDGNPD  255

Query  816   NVKRGTLGGFWVALNipkpqqqppppipMTDSIAVNFDMDGNIVNTKNVTDTF--PNSFS  989
             N+KR   G FWVA+      +     IP  +S     +  G +V T++ T  +   N  +
Sbjct  256   NIKRTVSGDFWVAV---VSVRIKLLIIPTLNSTGQRINQLGEVVETRDFTAQYTSANGIT  312

Query  990   GYQEYSDIAYVGSLLSDFVAV  1052
               QE +D  Y+GSL  +F+ V
Sbjct  313   EVQECNDKLYIGSLDQNFIGV  333



>ref|XP_002274134.3| PREDICTED: strictosidine synthase 3-like [Vitis vinifera]
Length=329

 Score =   222 bits (565),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 137/334 (41%), Positives = 192/334 (57%), Gaps = 17/334 (5%)
 Frame = +3

Query  72    MFWISILMFISSPYVIHSQPGVDFPIILNLQ-HASGPEDTAIDPLDQGIYTGVTDGRILK  248
             M  I +L+F S P+ + +   + F   L L  + +GPE  A D L  G YTGV+DGR+LK
Sbjct  1     MISIFLLLFFSVPHTVLT---LSFFTQLQLPPNVTGPEALAFDRLGGGPYTGVSDGRVLK  57

Query  249   Y--LNGNFNDFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGLL  422
             Y   +  F DFA T+P R+K  CDG    N    CGRPLG+ F++  G LY+ D + GLL
Sbjct  58    YGGPSAGFTDFAYTTPTRSKAVCDGTTDPNSGPTCGRPLGVGFNNLTGQLYIADAYSGLL  117

Query  423   KVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDT  602
              V  +NGGLAT +A    G  F F++ + VD+LT +VYF DA  ++   + TQ V++ D 
Sbjct  118   VVG-SNGGLATPVATTAEGVPFRFLNGLDVDQLTGNVYFTDASSVYELRDITQGVENNDA  176

Query  603   SGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQ  782
             SGRLLKY  +  QVTVL+ GLSGPAG A   D +F+++SE+I  R  K+++ GPKANT++
Sbjct  177   SGRLLKYDPSTKQVTVLIRGLSGPAGAAVSRDGSFVLVSEFIANRTQKFWLRGPKANTSE  236

Query  783   TVMENLEGYPDNVKRGTLGGFWVALNipkpqqqppppipMTDSIAVNFDMDGNIVNTKNV  962
              +    +G PDN+K      FWVA+N           +P T       D  GN++ T N 
Sbjct  237   -LFFTFQGRPDNIKTSITDTFWVAVN-------IGKSVPTTVPTGQRMDAHGNVLQTVNF  288

Query  963   TDTFPNSF-SGYQEYSDI-AYVGSLLSDFVAVYT  1058
                + ++  S  Q   +I  YVGS  + +V VYT
Sbjct  289   EAEYGSTMISEVQGRGEIFLYVGSRDASYVGVYT  322



>ref|XP_006345203.1| PREDICTED: strictosidine synthase 1-like [Solanum tuberosum]
Length=337

 Score =   216 bits (551),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 126/304 (41%), Positives = 183/304 (60%), Gaps = 10/304 (3%)
 Frame = +3

Query  153   LNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINI  326
             L LQ  SGP+  A DP   G Y  V DGR++KY + N  F +FA TSP RTK++CDG N 
Sbjct  37    LKLQ-TSGPDSAAFDPKGDGPYACVGDGRVIKYKDPNVGFTEFAITSPNRTKKRCDGTND  95

Query  327   TNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAV  506
                +  CGRP GL F    G LY+TD +YGL+ + + +GGL T++A    G  F+F+D++
Sbjct  96    PISQPVCGRPYGLGFYDKTGDLYITDAYYGLV-MAKPSGGLVTRVATSFEGTPFAFLDSL  154

Query  507   AVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMA  686
              +D+    +YF+D+G IFR+ N   I  SGDT+GRL KY  A  QVT+LLN LSGPAG+A
Sbjct  155   DIDQEMGIIYFVDSGAIFRTGNRLLIALSGDTTGRLFKYDIATKQVTLLLNKLSGPAGIA  214

Query  687   TDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNip  866
                D++++++SE I ++  +++++G  AN++  V  N++G PDN+KR   G FWVA+   
Sbjct  215   LSKDKSYLLVSETIAKKNRRFWLTGANANSSD-VFANIDGNPDNIKRTESGDFWVAVVSI  273

Query  867   kpqqqppppipMTDSIAVNFDMDGNIVNTKNVTDTFP--NSFSGYQEYSDIAYVGSLLSD  1040
             K +    P I  T       +  G +V T++ T  +   N  +  QE+    YVGSL   
Sbjct  274   KLKYLIVPAIISTGQ---RMNEKGEVVETRDFTAQYKGINGITEVQEHKGKLYVGSLDQK  330

Query  1041  FVAV  1052
             F+ V
Sbjct  331   FIGV  334



>emb|CDO98507.1| unnamed protein product [Coffea canephora]
Length=331

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 138/339 (41%), Positives = 190/339 (56%), Gaps = 19/339 (6%)
 Frame = +3

Query  57    MKSLTMFWISILMFISSPYVIHSQPGVDFPIILNLQH-ASGPEDTAIDPLDQGIYTGVTD  233
             M +L++F I   +    P +I   P   F I LNL   A+GPE  A+D  ++G Y  ++D
Sbjct  1     MAALSIFVIVSFL----PSIIALDPYSKF-IQLNLPSGATGPESVALDSRNEGPYCAISD  55

Query  234   GRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDM  407
             GR+LKY++ N  F DFA TSP RTK+ CDG    N+   CGRPLG  FD+   VLY+ D 
Sbjct  56    GRVLKYIDSNTGFVDFAYTSPKRTKQLCDGTTDANLGPTCGRPLGFSFDNLINVLYIVDA  115

Query  408   FYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIV  587
             F GL KV  + GGLAT LA    G   +F+  + V+ +T DVY  DA   +   N TQ  
Sbjct  116   FLGLFKVGPD-GGLATLLANSAGGVKLNFLTGIDVNPITRDVYITDASLTYDLRNITQPN  174

Query  588   QSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPK  767
                D+SGRL+KY+  K +VTVL  GLS P G A   D +F++ SEY  +R++KY++ GPK
Sbjct  175   LVTDSSGRLIKYNPRKNEVTVLQEGLSVPIGPAVSFDGSFVLFSEYSAKRVVKYWLLGPK  234

Query  768   ANTTQTVMENLEGYPDNVKRGT-LGGFWVALNipkpqqqppppipMTDSIAVNFDMDGNI  944
             ANT++ V+ +L G P  VKR + +G FWVA++              T       D  GN+
Sbjct  235   ANTSE-VLRDLPGNPSKVKRASNVGEFWVAVD------INVQQPRFTTPYGYKIDSFGNL  287

Query  945   VNTKNVTDTFPN-SFSGYQEY-SDIAYVGSLLSDFVAVY  1055
             +  K++ D + N   S  QEY      VGS   +FV +Y
Sbjct  288   LFVKDLEDHYYNVPVSVVQEYFGTTLLVGSRGENFVGIY  326



>emb|CBI15377.3| unnamed protein product [Vitis vinifera]
Length=693

 Score =   223 bits (567),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 138/338 (41%), Positives = 194/338 (57%), Gaps = 17/338 (5%)
 Frame = +3

Query  60    KSLTMFWISILMFISSPYVIHSQPGVDFPIILNLQ-HASGPEDTAIDPLDQGIYTGVTDG  236
              ++ M  I +L+F S P+ + +   + F   L L  + +GPE  A D L  G YTGV+DG
Sbjct  11    STVAMISIFLLLFFSVPHTVLT---LSFFTQLQLPPNVTGPEALAFDRLGGGPYTGVSDG  67

Query  237   RILKY--LNGNFNDFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMF  410
             R+LKY   +  F DFA T+P R+K  CDG    N    CGRPLG+ F++  G LY+ D +
Sbjct  68    RVLKYGGPSAGFTDFAYTTPTRSKAVCDGTTDPNSGPTCGRPLGVGFNNLTGQLYIADAY  127

Query  411   YGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQ  590
              GLL V  +NGGLAT +A    G  F F++ + VD+LT +VYF DA  ++   + TQ V+
Sbjct  128   SGLLVVG-SNGGLATPVATTAEGVPFRFLNGLDVDQLTGNVYFTDASSVYELRDITQGVE  186

Query  591   SGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKA  770
             + D SGRLLKY  +  QVTVL+ GLSGPAG A   D +F+++SE+I  R  K+++ GPKA
Sbjct  187   NNDASGRLLKYDPSTKQVTVLIRGLSGPAGAAVSRDGSFVLVSEFIANRTQKFWLRGPKA  246

Query  771   NTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqppppipMTDSIAVNFDMDGNIVN  950
             NT++ +    +G PDN+K      FWVA+NI K           T       D  GN++ 
Sbjct  247   NTSE-LFFTFQGRPDNIKTSITDTFWVAVNIGKSVPT-------TVPTGQRMDAHGNVLQ  298

Query  951   TKNVTDTFPNSF-SGYQEYSDI-AYVGSLLSDFVAVYT  1058
             T N    + ++  S  Q   +I  YVGS  + +V VYT
Sbjct  299   TVNFEAEYGSTMISEVQGRGEIFLYVGSRDASYVGVYT  336


 Score =   166 bits (419),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 116/301 (39%), Positives = 165/301 (55%), Gaps = 15/301 (5%)
 Frame = +3

Query  168   ASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRA  341
             A+GPE  A D    G YTG++DGRILKY+NG+  F +FA TS   ++E C G     +  
Sbjct  393   ATGPESIAFDAAGGGPYTGISDGRILKYVNGSVGFVEFAITSSNSSEEFCVGNGSVALDF  452

Query  342   ECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDEL  521
              CGRP GL F +  G LY+ D +YGL+ V   NGG+ATQLA   +G  F F +A+ VD  
Sbjct  453   TCGRPFGLGFHYQTGDLYIADAYYGLMVVG-PNGGVATQLANAADGVPFGFTNALDVDTE  511

Query  522   TADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQ  701
             T  VY +D    F    ++  +Q+ D +GRL+KY     ++TVLL GL G AGMA   D 
Sbjct  512   TGMVYLVDYSSQFSVNEFSVSLQAHDMTGRLMKYDPESKELTVLLGGLGGAAGMAISKDG  571

Query  702   TFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqq  881
             +FI+I+E + +RI K+++ GPKA T++ +++     P N+KR   G FWVA        +
Sbjct  572   SFILITETVTKRIRKFWLQGPKATTSE-ILKEFTVRPANIKRNEEGEFWVAF---LVADE  627

Query  882   ppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSFSGYQE---YSDIAYVGSLLSDFVAV  1052
                      S  +    DG I+   ++     ++ SG  E   Y+   Y+GS    FV V
Sbjct  628   TGSCPSQQQSPGLRISGDGMILEAISL-----DTQSGISEVAVYNGKMYIGSPFLHFVDV  682

Query  1053  Y  1055
             Y
Sbjct  683   Y  683



>gb|KDO70174.1| hypothetical protein CISIN_1g019290mg [Citrus sinensis]
Length=343

 Score =   202 bits (513),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 125/349 (36%), Positives = 185/349 (53%), Gaps = 20/349 (6%)
 Frame = +3

Query  57    MKSLTMFWISILMFISSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDG  236
             MK L+ F I I   +  P VI S         L L    GPE  A D   +G Y GV+DG
Sbjct  1     MKLLSSFIIFIFPLVF-PCVILSSKSYQ---QLQLPGVVGPESLAFDCNGEGPYVGVSDG  56

Query  237   RILKY--LNGNFNDFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMF  410
             RILK+   N  + +FATT+P+R +E CDG   T +   CGRPLG+ F+     LY+ D +
Sbjct  57    RILKWKAANSGWTEFATTAPHRAREICDGSTNTTLEPLCGRPLGIKFNPVTCDLYIADAY  116

Query  411   YGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQ  590
             +GL+ V  N GG A QLA+   G  F F + + +D  T  VYF D+   F+   Y   + 
Sbjct  117   FGLMVVGPN-GGQAQQLASSAGGIPFRFTNDLDIDPNTGIVYFTDSSIYFQRRQYFMSIA  175

Query  591   SGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKA  770
             +GD SGRLLKY   K  VTV+ NGLS P G+A   + +F++++E    +I+++++ G + 
Sbjct  176   TGDRSGRLLKYDPLKKNVTVMYNGLSFPNGVALSNNNSFLLLAESATLKILRFWLQGERT  235

Query  771   NTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqppppip----------MTDSIAV  920
               T  +   +  +PDN+K  + G FW+A+N  + + +                + D + V
Sbjct  236   TYTPQLFAEMPRFPDNIKSDSKGEFWIAMNSARGKIESNKKTAFCEETAKPWFLRDPVGV  295

Query  921   NFDMDGNIVNT--KNVTDTFPNSFSGYQEYSDIAYVGSLLSDFVAVYTA  1061
              FD++GN+V+    N  +T  NS S  QEY +  Y GS +  +V V  A
Sbjct  296   KFDVNGNVVDVLDGNEGNTL-NSVSEVQEYGEYLYTGSSVQPYVVVIKA  343



>gb|AES93117.1| strictosidine synthase [Camptotheca acuminata]
Length=330

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 123/304 (40%), Positives = 171/304 (56%), Gaps = 22/304 (7%)
 Frame = +3

Query  168   ASGPEDTAID-PLDQG-IYTGVTDGRILKY--LNGNFNDFATTSPYRTKEKCDGINITNI  335
             A GP     D PL  G +YTG+ DGRI++Y  L   F ++  T+P R +  CDG N T +
Sbjct  39    APGPASFTFDLPLGIGALYTGLADGRIVRYQRLRSTFVNYGYTAPNRNQAFCDGTNNTFL  98

Query  336   RAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVD  515
                CGRPLGL F      LY  D  +GL+ +E   GG ATQLA GV+G  F +  AV VD
Sbjct  99    APICGRPLGLAFQFGTRRLYAADAAFGLVVIE-PYGGPATQLATGVDGVRFRYPAAVDVD  157

Query  516   ELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDI  695
             + +  VYF DA   F     +Q++++ DT+GRLLKY     QVTVLL GL+GP  +A   
Sbjct  158   QFSGTVYFTDASTRFNLSQLSQLIRTRDTTGRLLKYDPNTRQVTVLLRGLAGPFAVAISS  217

Query  696   DQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpq  875
             D+T+++ISE+I  RI KY+++GP ANT + V+ N+ G P N++R   G FWVA+N     
Sbjct  218   DRTYVLISEFIRNRIQKYWLTGPNANTAE-VLLNVAGSPGNIRRTIRGDFWVAIN-----  271

Query  876   qqppppipMTDSIAV---NFDMDGNIVNTKNVTDTFPNSF-SGYQEYSDIAYVGSLLSDF  1043
                      T ++ +     + DG I+ T+  +  F  +  +   EY    Y+GSL   F
Sbjct  272   -------VQTPTVVLRGQRINGDGTILQTETFSPDFNTTLITEVNEYGGALYLGSLYPKF  324

Query  1044  VAVY  1055
             V VY
Sbjct  325   VGVY  328



>ref|XP_011071025.1| PREDICTED: protein STRICTOSIDINE SYNTHASE-LIKE 12-like [Sesamum 
indicum]
Length=337

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 123/305 (40%), Positives = 179/305 (59%), Gaps = 13/305 (4%)
 Frame = +3

Query  168   ASGPEDTAIDPLDQGIYTGVTDGRILKYL--NGNFNDFATTSPYRTKEKCDGINITNIR-  338
             A G E  A D  + G YTG++DGRI+KY      F +FATTS  R+KE CDG +  +++ 
Sbjct  31    AVGSESYAFDSHNVGPYTGLSDGRIVKYQGPETGFVEFATTSANRSKELCDGTDGNDLKL  90

Query  339   -AECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVD  515
                CGR LG++FDH  G LY+ D  YGL+ V  + GGLATQLA G +G  F   DA+ +D
Sbjct  91    TETCGRALGMEFDHKTGELYLVDAVYGLMVV-GSGGGLATQLAGGKDGERFDEADALDID  149

Query  516   ELTADVYFIDAGDIF-RSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATD  692
               T ++Y  D G +  ++ N T+I+ S + +GRLLKY     ++TVLL GL+  AG+A  
Sbjct  150   PNTGEIYIGDLGTLLHKTNNLTEILLSEERTGRLLKYDPKTKKLTVLLKGLALAAGVAVS  209

Query  693   IDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkp  872
              D +F+++ EYI  RI +Y++ GPKA T++  +E L G PDN+KR   G FWVA+NI + 
Sbjct  210   KDGSFVLVGEYIACRITRYWLKGPKATTSEIFVE-LPGNPDNIKRTKSGDFWVAVNIQRL  268

Query  873   qqqppppipMTDSIAVNFDMDGNIVNTKNVTDTF-PNSFSGYQEYSDIAYVGSLLSDFVA  1049
             Q +P        ++      DG I+ T N    +   S +  QE+  + Y+ S  ++F  
Sbjct  269   QPKPSCF-----ALGQKIGADGQILETVNFYAEYNATSVAEVQEHHGLMYLSSTNANFAG  323

Query  1050  VYTAI  1064
             VY  +
Sbjct  324   VYEVL  328



>ref|XP_006437788.1| hypothetical protein CICLE_v10032008mg [Citrus clementina]
 ref|XP_006484567.1| PREDICTED: strictosidine synthase 3-like [Citrus sinensis]
 gb|ESR51028.1| hypothetical protein CICLE_v10032008mg [Citrus clementina]
Length=343

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 125/349 (36%), Positives = 184/349 (53%), Gaps = 20/349 (6%)
 Frame = +3

Query  57    MKSLTMFWISILMFISSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDG  236
             MK L+ F I I   +  P VI S         L L    GPE  A D   +G Y GV+DG
Sbjct  1     MKLLSSFIIFIFPLVF-PCVILSSKSYQ---QLQLPGVVGPESLAFDCNGEGPYVGVSDG  56

Query  237   RILKY--LNGNFNDFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMF  410
             RILK+   N  + +FATT+P+R +E CDG   T +   CGRPLG+ F+     LY+ D +
Sbjct  57    RILKWKAANSGWTEFATTAPHRAREICDGSTNTTLEPLCGRPLGIKFNPVTCDLYIADAY  116

Query  411   YGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQ  590
             +GL+ V  N GG A QLA+   G  F F + + +D  T  VYF D+   F+   Y   + 
Sbjct  117   FGLMVVGPN-GGQAQQLASSAGGIPFRFTNDLDIDPNTGIVYFTDSSIYFQRRQYFMSIA  175

Query  591   SGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKA  770
             +GD SGRLLKY   K  VTV+ NGLS P G+A   + +F++++E    +I+++++ G + 
Sbjct  176   TGDRSGRLLKYDPLKKNVTVMYNGLSFPNGVALSNNNSFLLLAESATLKILRFWLQGERT  235

Query  771   NTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqppppip----------MTDSIAV  920
               T  +   +  +PDN+K  + G FW+A+N  + + +                + D + V
Sbjct  236   TYTPQLFAEMPRFPDNIKSDSKGEFWIAMNSARGKIESNKKTAFCEETAKPWFLRDPVGV  295

Query  921   NFDMDGNIVNT--KNVTDTFPNSFSGYQEYSDIAYVGSLLSDFVAVYTA  1061
              FD++GN+V+    N  +T  NS S  QEY    Y GS +  +V V  A
Sbjct  296   KFDVNGNVVDVLDGNEGNTL-NSVSEVQEYGGYLYTGSSVQPYVVVIKA  343



>ref|XP_010663511.1| PREDICTED: strictosidine synthase 1-like [Vitis vinifera]
Length=330

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 121/302 (40%), Positives = 165/302 (55%), Gaps = 20/302 (7%)
 Frame = +3

Query  174   GPEDTAIDPLDQGIYTGVTDGRILKYL--NGNFNDFATTSPYRTKEKCDGINITNIRAEC  347
             GPE  A D    G Y  V DGR+LK+   +  F DF   SP R+K+ CDG +       C
Sbjct  41    GPEALAFDCSGAGPYASVADGRVLKWQAESAGFVDFTVASPSRSKQLCDGSSDPAKEPTC  100

Query  348   GRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTA  527
             GRPLG+ F++  G LY+ D +YGL  V   +GG ATQLA    G  F F++AV VD+ T 
Sbjct  101   GRPLGIGFNNKTGDLYIADAYYGLFVVG-PDGGRATQLATEAEGVPFRFLNAVDVDQETG  159

Query  528   DVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTF  707
              VYF DA   F+   +   V +GD +GRL+KY     QVTVLL GL    G+A + D +F
Sbjct  160   IVYFTDASARFQRREFQNAVLAGDMTGRLMKYDPRTKQVTVLLRGLGLAVGVAINKDGSF  219

Query  708   IMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqpp  887
             +++SE+I  RI +Y++ GPKANT++  ++   G PDN+KR   G FWVA NI        
Sbjct  220   VLVSEFIATRIQRYWLRGPKANTSELFLKP-TGTPDNIKRNARGEFWVAANIGAEMAAAA  278

Query  888   ppipMTDSIAVNFDMDGNIV-----NTKNVTDTFPNSFSGYQEYSDIAYVGSLLSDFVAV  1052
                     + +    +G I+     +T ++T T     S   EY+   YVGSL   FV V
Sbjct  279   -------PLGLRVSEEGKILQVVAFDTGDITRT----ISEVHEYNGALYVGSLALPFVGV  327

Query  1053  YT  1058
             +T
Sbjct  328   FT  329



>emb|CDP10794.1| unnamed protein product [Coffea canephora]
Length=331

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 125/304 (41%), Positives = 176/304 (58%), Gaps = 15/304 (5%)
 Frame = +3

Query  174   GPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGI---NITNIR  338
             G E  A DP   G YT ++DGRI+KY      F DFATT   R+K+ CDGI   +   + 
Sbjct  34    GSEACAFDPHGGGPYTSLSDGRIVKYQGSRIGFTDFATTVANRSKKLCDGIVPGDNVELA  93

Query  339   AECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDE  518
             A+CGRP+GL+FD   G LYV D F+G + V    GG+AT L + ++G      DA+ VD 
Sbjct  94    AKCGRPIGLEFDQKTGDLYVIDAFHGPMVVG-PKGGIATPLTS-MDGVPVDVPDAIDVDP  151

Query  519   LTADVYFIDAGD-IFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDI  695
             +T  V++ D G  I +  N T  + SGDT+GRLLKY     Q TVLL GLSGP G+A   
Sbjct  152   VTGTVFYTDIGPGILKIKNMTAFLLSGDTNGRLLKYDPKTRQRTVLLTGLSGPNGVAVSK  211

Query  696   DQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpq  875
             D +F++ISEY+  RI K+++ GPKAN+++ V+ NL G PDN+KR   G FWV +N     
Sbjct  212   DGSFVLISEYVAGRIRKFWVKGPKANSSE-VLVNLPGSPDNIKRTGSGDFWVPVN-----  265

Query  876   qqppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSF-SGYQEYSDIAYVGSLLSDFVAV  1052
              +   P   T  +A  F+  G I+ T N    + N + +   ++    YV S+ ++FV V
Sbjct  266   IENLLPRKTTFPLAQKFNSYGQILETVNFYAEYNNIYITEVHQHLGSLYVASVYANFVGV  325

Query  1053  YTAI  1064
             +  +
Sbjct  326   FRGV  329



>ref|XP_010663512.1| PREDICTED: strictosidine synthase 3-like [Vitis vinifera]
Length=335

 Score =   199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 115/298 (39%), Positives = 170/298 (57%), Gaps = 7/298 (2%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYLNG--NFNDFATTSPYRTKEKCDGINITNIRAE  344
             +GPE  A D   +G YTGV+DGR+LKY      F DFA TSP RT+E CDG     + A 
Sbjct  40    TGPESLAFDLKGEGPYTGVSDGRVLKYQGPAVGFTDFAVTSPNRTEEMCDGSIDPALEAT  99

Query  345   CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELT  524
             CGRPLGL F++  G LY+ D + GL+ V  ++GG+ATQLAA   G  F F+  + VD+  
Sbjct  100   CGRPLGLGFNYHTGDLYMVDAYLGLMVVG-SSGGIATQLAAAAEGIPFRFLAGLDVDQGN  158

Query  525   ADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQT  704
               VYF +A   F+  +  +++ S D++G L +Y     +V VLL GLS   G+A   D  
Sbjct  159   GMVYFTEASTRFQLRDMQELIASNDSTGSLFRYDPQSREVRVLLGGLSVAVGVAVSRDGM  218

Query  705   FIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqp  884
             F++++E    RI ++++ GPKANT++  ME L G P N+KR   G FWVA+N       P
Sbjct  219   FVLVAELTANRIRRFWLGGPKANTSEVFME-LLGKPSNIKRNERGEFWVAINNALGPPAP  277

Query  885   pppipMTDSIAVNFDMDGNIVNTKNVTDTFP-NSFSGYQEYSDIAYVGSLLSDFVAVY  1055
             P  + M   + +    DG ++    +   +  ++ S  QE +   YV SL++ + ++Y
Sbjct  278   PESLVM--PLGLRLSNDGRVLEVAPLVGAYQISAISEVQERNGELYVASLVAAYASIY  333



>ref|XP_008811198.1| PREDICTED: strictosidine synthase 1-like [Phoenix dactylifera]
Length=324

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 123/307 (40%), Positives = 169/307 (55%), Gaps = 15/307 (5%)
 Frame = +3

Query  168   ASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRA  341
             A GPE  A D L  G YTGV+DGRI+K+      + DFA  S YR +  C G N + + +
Sbjct  22    AVGPESLAFDHLGGGPYTGVSDGRIVKWQGQGLGWADFAVHSKYRER-VCHGSNDSMLES  80

Query  342   ECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDEL  521
              CGRPLGL F  A G LYV D ++GLL V   NGG+ATQLA G +G+ F+F + + VD+ 
Sbjct  81    ICGRPLGLQFYKATGDLYVADAYFGLLVVA-PNGGVATQLATGADGQPFNFANGLDVDQE  139

Query  522   TADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQ  701
             T  VYF D+   FR  +Y   V  GD +GRL+ Y      VTVL+ GL+ P G+A   D 
Sbjct  140   TGVVYFTDSSTRFRRRDYILAVIMGDATGRLMNYDPKAKNVTVLIRGLAFPNGLAISNDT  199

Query  702   TFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqq  881
             TF++I+E    R++KY++ GP+ N T  V   L GYPDN+KR   G FWVALN  K Q  
Sbjct  200   TFLLIAETGTCRVLKYWLQGPR-NGTFEVFAELPGYPDNIKRNPGGEFWVALNQDKVQLN  258

Query  882   ppppipMTDS--------IAVNFDMDGNIVNTKNVTDTFPNSFSGYQEYSDIAYVGSLLS  1037
                      +        +A+    +G ++    +      S S  +E +   ++GS+  
Sbjct  259   GQTASDFGKTGEPSEHHPVALRLSQEGKVLEV--LERRAATSVSEVEERNGTMWLGSVDM  316

Query  1038  DFVAVYT  1058
              +V VYT
Sbjct  317   PYVGVYT  323



>ref|XP_011071027.1| PREDICTED: protein STRICTOSIDINE SYNTHASE-LIKE 12-like [Sesamum 
indicum]
Length=335

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 124/302 (41%), Positives = 177/302 (59%), Gaps = 13/302 (4%)
 Frame = +3

Query  168   ASGPEDTAIDPLDQGIYTGVTDGRILKYL--NGNFNDFATTSPYRTKEKCDGINITN--I  335
             A G E  A D  + G YTG+ DGRI+KY      F +FATTS  R+KE CDG + T+  +
Sbjct  31    AVGSESYAFDSHNVGPYTGLNDGRIVKYQGPETGFVEFATTSANRSKEFCDGTDGTDPIV  90

Query  336   RAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVD  515
                CGR +G++F+H  G LY+ D  YGL+ V  + GGLATQLA G +   F  +D++A+D
Sbjct  91    TLICGRAIGMEFNHKTGELYLVDANYGLMVVG-SRGGLATQLAGGGDAERFDQVDSLAID  149

Query  516   ELTADVYFIDAGDIF-RSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATD  692
               T  VY  D G IF ++ N T+I+ SGDTSGRLLKY      +TVLL GL+   G+A  
Sbjct  150   PTTGAVYIGDIGTIFQKTKNMTEILLSGDTSGRLLKYDPKTKGLTVLLRGLAMANGVAVS  209

Query  693   IDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkp  872
              D +F+++SEYI  RI +Y++ GPKANT++  +E L G PDN++R   G FWV +NI K 
Sbjct  210   EDGSFVLVSEYITCRITRYWLKGPKANTSEIFVE-LPGNPDNIQRTESGDFWVVVNIQKL  268

Query  873   qqqppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSF-SGYQEYSDIAYVGSLLSDFVA  1049
               +         +       +G I+ T N    +  ++ +   E+    Y+ S+ ++FV 
Sbjct  269   YPKLTCF-----AFGQRISANGRILETLNFFAEYNTTYITEVHEHLGSLYLASVDTNFVG  323

Query  1050  VY  1055
             VY
Sbjct  324   VY  325



>dbj|BAJ53159.1| JHL10I11.5 [Jatropha curcas]
 gb|KDP20050.1| hypothetical protein JCGZ_05819 [Jatropha curcas]
Length=336

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 117/298 (39%), Positives = 165/298 (55%), Gaps = 13/298 (4%)
 Frame = +3

Query  174   GPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDG-INITNIRAE  344
             GPE  A D   QG YTGV DGR LKY   +  F D+A  SP R+K  CDG  N +     
Sbjct  45    GPEAFAFDLQGQGPYTGVLDGRTLKYQGPSLGFLDYAFDSPNRSKAACDGNTNPSAFGGI  104

Query  345   CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELT  524
             CGRPLG+ F +  G LY+ D   GLL V   NG LA  +A+   G+ F F+D + +  LT
Sbjct  105   CGRPLGIGFQYT-GELYIADANLGLL-VASTNGRLARAVASSAEGQPFKFLDGLDIYPLT  162

Query  525   ADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQT  704
               V+  DA   F      Q V + D++GR +KY       TVLL  LS PAG+A  +D +
Sbjct  163   KTVFLTDASSRFNFSELAQAVAANDSTGRFIKYEPNINTTTVLLRNLSAPAGVAVSLDGS  222

Query  705   FIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqp  884
             F++++EY+  R++KY++ GPKANT++ ++   +G PDN+KR  LG FWVA+N+ +    P
Sbjct  223   FVLVTEYLANRVLKYWLKGPKANTSEALV-TFQGRPDNIKRNPLGDFWVAVNVQETPTAP  281

Query  885   pppipMTDSIAVNFDMDGNIVNTKNVTDTF-PNSFSGYQEYSDIAYVGSLLSDFVAVY  1055
                       AV  +  G I+ +  ++D +   + S   EY    Y+GSL + FV  Y
Sbjct  282   IV------PTAVKINYSGKILASFPLSDQYNTTTISEVNEYDGNLYIGSLETKFVGKY  333



>ref|XP_010532262.1| PREDICTED: strictosidine synthase 1-like [Tarenaya hassleriana]
Length=328

 Score =   193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 119/297 (40%), Positives = 163/297 (55%), Gaps = 12/297 (4%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYL-NGNFNDFATTSPYRTKEKCDGINITNIRAEC  347
             SGPE  A D   +G YTGV+ G+ILKY     + DFA TS    K  C+G+  T +   C
Sbjct  38    SGPEAFAFDSTGKGFYTGVSGGKILKYTPETGYVDFAQTSKPANKIWCEGVLGTVLAQIC  97

Query  348   GRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTA  527
             GRP G+ FD   G LY+ D   GL  V +  GGLAT++A  V+G+ F F+D + VD  T 
Sbjct  98    GRPAGIAFDEKTGDLYIADAPLGLHVVSKA-GGLATKIADSVDGKPFKFLDGLDVDPTTG  156

Query  528   DVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTF  707
             DVYF      F        V   D SG+L KY AA  ++TVL+ GLSG AG A   D +F
Sbjct  157   DVYFTSFSSKFTPAQVYIAVGLKDASGKLFKYEAATKKITVLVEGLSGSAGCAVSSDGSF  216

Query  708   IMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKR-GTLGGFWVALNipkpqqqp  884
             +++ E+I  +I +++I GPKA  T+    N+   PDN+KR G+ G FWVA          
Sbjct  217   VLVGEFIKSKIQRHWIKGPKAGQTEEFTSNVTN-PDNIKRIGSTGNFWVA-------SVV  268

Query  885   pppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSF-SGYQEYSDIAYVGSLLSDFVAV  1052
                +  T+  AV  D +G ++ T  + DTF ++  S   E++   YVG+LL  F AV
Sbjct  269   NVGLKATNPSAVKIDSEGKVLQTVPLKDTFGDTLVSEANEFNGSLYVGTLLGPFAAV  325



>gb|AFK49369.1| unknown [Lotus japonicus]
Length=334

 Score =   193 bits (490),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 110/299 (37%), Positives = 171/299 (57%), Gaps = 8/299 (3%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGI-NITNIRA  341
             +GPE  A D    G Y   +DGRI KY+  N  F ++A TSP R K  CDG+ + + ++A
Sbjct  38    TGPEALAFDRNGSGPYVSSSDGRIFKYVGPNEGFQEYAYTSPNRNKITCDGLADFSTLQA  97

Query  342   ECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDEL  521
              CGRPLGL F+H  G LYV D ++GLLK+  N GG   QL     G +  F D + +D  
Sbjct  98    TCGRPLGLGFNHQTGELYVADAYFGLLKIGAN-GGPPIQLVGPAQGNSSMFADGLDIDPD  156

Query  522   TADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQ  701
             T  VYF +A   F+  + + I+ SGD++GRLLKY  +  Q TVLL+ L+ P G+A   D 
Sbjct  157   TGIVYFTEASANFQIKDISTILTSGDSTGRLLKYDPSTNQTTVLLSDLAVPNGVAVSRDG  216

Query  702   TFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqq  881
             +F+++SE++  RI ++++ GP+AN + T +  L G PDN+KR + G FWVA+N      +
Sbjct  217   SFVLVSEFMENRIQRFWLKGPRANLSDTFIR-LAGKPDNIKRNSRGQFWVAVNSYLGLPR  275

Query  882   ppppipMTDSIAVNFDMDGNIVNTKNVTDTF-PNSFSGYQEYSDIAYVGSLLSDFVAVY  1055
              P    +   + ++   +G ++   ++   +     S  QE++   Y GSL   + +++
Sbjct  276   RPIRRVLPSGVRIS--ENGLVLQVVSLAQEYGTEPASEVQEFNGTLYAGSLFVSYASIF  332



>ref|XP_010099019.1| Strictosidine synthase 1 [Morus notabilis]
 gb|EXB76377.1| Strictosidine synthase 1 [Morus notabilis]
Length=325

 Score =   192 bits (488),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 119/332 (36%), Positives = 179/332 (54%), Gaps = 14/332 (4%)
 Frame = +3

Query  72    MFWISILMFISSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKY  251
              F + IL+ + S  ++ SQ    F  +     + GPE    D L +G YTG++DGRI++Y
Sbjct  2     FFILLILLSVPSNCIVLSQKISTFRKLYLPTTSVGPESITFDSLGRGPYTGISDGRIVRY  61

Query  252   --LNGNFNDFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLK  425
                   F DFA TS  R+K  CDG N   +R  CGRPLG++F H + +L++ D F GL  
Sbjct  62    DEHTTGFVDFAYTSRNRSKALCDGTNDPALRPICGRPLGIEFFHRKNMLFIADAFLGLFV  121

Query  426   VERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTS  605
             V   NGGLAT LA    G  F F++ ++VD+ T DVYF D    F        + + D++
Sbjct  122   VG-PNGGLATGLATAAEGTPFRFLNGLSVDQHTGDVYFTDFSSKFLQSQILDAIAANDST  180

Query  606   GRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQT  785
             GRLLKY     +V VLL+GLSG  G+A   D+++++++E I  R  ++++ G +A T++ 
Sbjct  181   GRLLKYDCRSKKVRVLLSGLSGANGVAISSDRSYLLVAETIAYRTRRFWLRGTRAFTSE-  239

Query  786   VMENLEGYPDNVKRGTLGGFWVALNipkpqqqppppipMTDSIAVNFDMDGNIVNTKNVT  965
             V+    G PDN+KR   G FWVA+N         P   +  S+     ++G   N + + 
Sbjct  240   VVAKFPGRPDNIKRAPSGDFWVAVN--------IPRTEVPSSVPAEIRINGAGGNLQTLP  291

Query  966   -DTFPN-SFSGYQEYSDIAYVGSLLSDFVAVY  1055
              D + N + S   +     Y GS  +DFV V+
Sbjct  292   LDQYYNTTVSELLQRGSRYYAGSAQADFVGVF  323



>emb|CAN78856.1| hypothetical protein VITISV_013356 [Vitis vinifera]
Length=600

 Score =   198 bits (503),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 115/298 (39%), Positives = 170/298 (57%), Gaps = 7/298 (2%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYLNG--NFNDFATTSPYRTKEKCDGINITNIRAE  344
             +GPE  A D   +G YTGV+DGR+LKY      F DFA TSP RT+E CDG     + A 
Sbjct  305   TGPESLAFDLKGEGPYTGVSDGRVLKYQGPXVGFTDFAVTSPNRTEEMCDGSIDPALAAT  364

Query  345   CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELT  524
             CGRPLGL F++  G LY+ D + GL+ V  ++GG+ATQLAA   G  F F+  + VD+  
Sbjct  365   CGRPLGLGFNYHTGDLYMVDAYLGLMVVG-SSGGIATQLAAAAEGIPFRFLAGLDVDQGN  423

Query  525   ADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQT  704
               VYF +A   F+  +  +++ S D++G L +Y     +V VLL GLS   G+A   D  
Sbjct  424   GMVYFTEASTRFQLRDMQELIASNDSTGSLFRYDPQSREVRVLLGGLSVAVGVAVSRDGM  483

Query  705   FIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqp  884
             F++++E    RI ++++ GPKANT++  ME L G P N+KR   G FWVA+N       P
Sbjct  484   FVLVAELTANRIRRFWLGGPKANTSEVFME-LLGKPSNIKRNERGEFWVAINNALGPPAP  542

Query  885   pppipMTDSIAVNFDMDGNIVNTKNVTDTFP-NSFSGYQEYSDIAYVGSLLSDFVAVY  1055
             P  + M   + +    DG ++    +   +  ++ S  QE +   YV SL++ + ++Y
Sbjct  543   PESLVM--PLGLRLSNDGRVLEVAPLVGAYQISAISEVQERNGELYVASLVAAYASIY  598


 Score =   126 bits (316),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 93/269 (35%), Positives = 133/269 (49%), Gaps = 31/269 (12%)
 Frame = +3

Query  294   RTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGV  473
             R+K+ CDG     +   CGRPLGL F+      Y TD             G   QLA   
Sbjct  64    RSKKLCDGSTDPGLEPTCGRPLGLGFN------YRTD-------------GRIIQLATAA  104

Query  474   NGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVL  653
              G  F F++AV VD+ T  VYF DA   F+   +   VQ+GD +GRL+KY     +VT L
Sbjct  105   EGVPFLFLNAVDVDQETGIVYFTDASARFQRREFMLAVQTGDMTGRLMKYDPRTQEVTEL  164

Query  654   LNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGT  833
             L GL G  G+    D +FI+++E++  RI ++++ G KANT+Q  ++   G PDN+K   
Sbjct  165   LRGLGGAGGVTISKDGSFILVTEFVTNRIQRFWLKGRKANTSQLFLKP-PGTPDNIKSNA  223

Query  834   LGGFWVALNipkpqqqppppipMTDSIAVNFDMDGNIVNTKNV-TDTFPNSFSGYQEYSD  1010
              G FWVA+NI                + +    +G ++      T   P + S  QEY+ 
Sbjct  224   RGEFWVAVNIGAGTAVV--------PLGLRLSEEGKVLQMVAFGTGDIPKTISEVQEYNG  275

Query  1011  IAYVGSLLSDFVAV--YTAI*SLRLAAYI  1091
               Y+GSL   FV V  +T    L+L + I
Sbjct  276   ALYIGSLPLHFVGVLPFTLFNKLQLPSSI  304



>ref|XP_002312353.2| hypothetical protein POPTR_0008s10940g [Populus trichocarpa]
 gb|EEE89720.2| hypothetical protein POPTR_0008s10940g [Populus trichocarpa]
Length=357

 Score =   191 bits (484),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 123/342 (36%), Positives = 178/342 (52%), Gaps = 23/342 (7%)
 Frame = +3

Query  72    MFWISILMFISSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKY  251
             +F+   L  IS    +  Q G++    L L    GPE  A D   +G Y  V+DGRILK+
Sbjct  15    LFFFVSLDCISCTDKMLYQDGLENYFQLALPAVVGPESIAFDCNGKGPYVSVSDGRILKW  74

Query  252   LNGNFN--DFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLK  425
                     +F+ +SP R +  CDG   T +   CGRPLGL F+ A   LY+ D +YGLL 
Sbjct  75    QGAKLGWIEFSVSSPQRDRHMCDGSTNTKLEPVCGRPLGLKFNSATCDLYIADAYYGLLV  134

Query  426   VERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTS  605
             V    GG+ATQLAA   G  F F++A+ VD  T  VYF D+   F+   Y   + S D +
Sbjct  135   VG-PEGGVATQLAASAEGVPFRFMNALDVDSRTGVVYFTDSSIYFQRREYLLAIISADKT  193

Query  606   GRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQT  785
             GRL+KY     +VTVLL GL+ P G+A   D +FI+++E    RI+K+++ G + +  +T
Sbjct  194   GRLMKYDPNSKKVTVLLKGLAFPNGVAISKDNSFILVAESFTMRILKFYLVGSEIHGQET  253

Query  786   VMENLEGYPDNVKRGTLGGFWVALNipkpqqqppppipMT----------DSIAVNFDMD  935
              ++ L  +PDN+KR   G FWVALN  + + +      +           D +AV     
Sbjct  254   FIQ-LGRFPDNIKRTANGEFWVALNTGRGKIRRLDSTKLQQETSIDWFVDDPVAVRLTSG  312

Query  936   GNIVNT-----KNVTDTFPNSFSGYQEYSDIAYVGSLLSDFV  1046
             G +VN       N  D    S S  +EYS + ++GS +  +V
Sbjct  313   GKVVNVLDGNGGNALD----SVSEVEEYSGLLWLGSSMKPYV  350



>emb|CAN77943.1| hypothetical protein VITISV_044019 [Vitis vinifera]
Length=300

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 111/267 (42%), Positives = 154/267 (58%), Gaps = 11/267 (4%)
 Frame = +3

Query  264   FNDFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNG  443
             F DFA T+P R+K  CDG    N    CGRPLG+ F++  G LY+ D + GLL V  +NG
Sbjct  36    FTDFAYTTPTRSKAVCDGTTDPNSGPTCGRPLGVGFNNLTGQLYIADAYSGLLVVG-SNG  94

Query  444   GLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKY  623
             GLAT +A    G  F F++ + VD+LT +VYF DA  ++   + TQ V++ D SGRLLKY
Sbjct  95    GLATPVATTAEGVPFRFLNGLDVDQLTGNVYFTDASSVYELRDITQGVENNDASGRLLKY  154

Query  624   SAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLE  803
               +  QVTVL+ GLSGPAG A   D +F+++SE+I  R  K+++ GPKANT++ +    +
Sbjct  155   DPSTKQVTVLIRGLSGPAGAAVSRDGSFVLVSEFIANRTQKFWLRGPKANTSE-LFFTFQ  213

Query  804   GYPDNVKRGTLGGFWVALNipkpqqqppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNS  983
             G PDN+K      FWVA+N           +P T       D  GN++ T N    + ++
Sbjct  214   GRPDNIKTSITDTFWVAVN-------IGKSVPTTVPTGQRMDAHGNVLQTVNFEAEYGST  266

Query  984   F-SGYQEYSDI-AYVGSLLSDFVAVYT  1058
               S  Q    I  YVGS  + +V VYT
Sbjct  267   MISEVQXRGXIFLYVGSRDASYVGVYT  293



>ref|XP_003609164.1| Strictosidine synthase [Medicago truncatula]
Length=333

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 119/312 (38%), Positives = 174/312 (56%), Gaps = 12/312 (4%)
 Frame = +3

Query  147   IILN-LQHAS---GPEDTAIDPLDQGIYTGVTDGRILKYLNG---NFNDFATTSPYRTKE  305
             I+LN LQ  S   GPE  A D   +G Y G +DGRI KY NG    F ++A TSP R K 
Sbjct  23    ILLNKLQLPSPVTGPESLAFDKNGEGPYVGSSDGRIFKY-NGPDVGFKEYAYTSPNRNKT  81

Query  306   KCDGI-NITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGR  482
              CDG+ + + ++A CGRPLGL F+H  G LYV D + GL+KV  + GG  TQL       
Sbjct  82    VCDGLSDFSAVQATCGRPLGLGFNHQTGDLYVADAYLGLVKVSPD-GGNVTQLVGPAQAN  140

Query  483   NFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNG  662
             +  F D + VD  T  VYF  A   F+  +Y  +V SGD+SG LL+Y  +  Q TVLL+ 
Sbjct  141   STMFADGLDVDPDTGIVYFTVASTNFQLKDYQTLVTSGDSSGSLLRYDPSTNQTTVLLSN  200

Query  663   LSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGG  842
             LS P+G+A   D +F+++ EY+  RI + ++ GP+AN+++  M  L G P+N+KR + G 
Sbjct  201   LSMPSGVAVSKDGSFVLVGEYLSNRIQRVWLKGPRANSSELFML-LTGRPNNIKRNSAGQ  259

Query  843   FWVALNipkpqqqppppipMTDSIAVNFDMDGNIVNTKNVTDTFP-NSFSGYQEYSDIAY  1019
             FW++++       P  P        V    +  I+   ++   +     S  QEY+   Y
Sbjct  260   FWISVHSVLGLGLPISPRRTALPRGVRVSENRIILQIASLVAEYGIEPASEVQEYNGKLY  319

Query  1020  VGSLLSDFVAVY  1055
              GSLL+ + +++
Sbjct  320   AGSLLASYASIF  331



>gb|AES91361.2| strictosidine synthase-like protein, putative [Medicago truncatula]
Length=336

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 119/312 (38%), Positives = 174/312 (56%), Gaps = 12/312 (4%)
 Frame = +3

Query  147   IILN-LQHAS---GPEDTAIDPLDQGIYTGVTDGRILKYLNG---NFNDFATTSPYRTKE  305
             I+LN LQ  S   GPE  A D   +G Y G +DGRI KY NG    F ++A TSP R K 
Sbjct  26    ILLNKLQLPSPVTGPESLAFDKNGEGPYVGSSDGRIFKY-NGPDVGFKEYAYTSPNRNKT  84

Query  306   KCDGI-NITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGR  482
              CDG+ + + ++A CGRPLGL F+H  G LYV D + GL+KV  + GG  TQL       
Sbjct  85    VCDGLSDFSAVQATCGRPLGLGFNHQTGDLYVADAYLGLVKVSPD-GGNVTQLVGPAQAN  143

Query  483   NFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNG  662
             +  F D + VD  T  VYF  A   F+  +Y  +V SGD+SG LL+Y  +  Q TVLL+ 
Sbjct  144   STMFADGLDVDPDTGIVYFTVASTNFQLKDYQTLVTSGDSSGSLLRYDPSTNQTTVLLSN  203

Query  663   LSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGG  842
             LS P+G+A   D +F+++ EY+  RI + ++ GP+AN+++  M  L G P+N+KR + G 
Sbjct  204   LSMPSGVAVSKDGSFVLVGEYLSNRIQRVWLKGPRANSSELFML-LTGRPNNIKRNSAGQ  262

Query  843   FWVALNipkpqqqppppipMTDSIAVNFDMDGNIVNTKNVTDTFP-NSFSGYQEYSDIAY  1019
             FW++++       P  P        V    +  I+   ++   +     S  QEY+   Y
Sbjct  263   FWISVHSVLGLGLPISPRRTALPRGVRVSENRIILQIASLVAEYGIEPASEVQEYNGKLY  322

Query  1020  VGSLLSDFVAVY  1055
              GSLL+ + +++
Sbjct  323   AGSLLASYASIF  334



>ref|XP_003635414.1| PREDICTED: strictosidine synthase 1-like [Vitis vinifera]
Length=322

 Score =   187 bits (475),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 101/232 (44%), Positives = 138/232 (59%), Gaps = 4/232 (2%)
 Frame = +3

Query  171  SGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRAE  344
            SGPE  A D    G YTG++DGRILK+      + +FA TSP+R  E CDG     +   
Sbjct  38   SGPESIAFDCNRDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPEFCDGSANPAMEQV  97

Query  345  CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELT  524
            CGRPLGL F+ A   LY+ D ++GLL V RN GG+A Q+A  V G  F F +A+ +D+ T
Sbjct  98   CGRPLGLKFNEATCDLYIADAYFGLLVVGRN-GGVAKQVAISVEGVPFRFTNALDIDQNT  156

Query  525  ADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQT  704
              VYF D   IF+   Y   +Q+GD +GRLLKY     +VTVLL GLS   G+A   D+ 
Sbjct  157  GVVYFTDTSTIFQRWAYAIAMQTGDKTGRLLKYDPRTKEVTVLLRGLSFSNGVALSKDKD  216

Query  705  FIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            F++++E    ++ +Y++ G K+  + T    L G PDN++R   G FWVA N
Sbjct  217  FVLVTETTAAKVTRYWLQGQKSQLSDT-FTRLVGCPDNIQRNIHGEFWVAQN  267



>emb|CBI18784.3| unnamed protein product [Vitis vinifera]
Length=334

 Score =   187 bits (476),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 101/232 (44%), Positives = 138/232 (59%), Gaps = 4/232 (2%)
 Frame = +3

Query  171  SGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRAE  344
            SGPE  A D    G YTG++DGRILK+      + +FA TSP+R  E CDG     +   
Sbjct  50   SGPESIAFDCNRDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPEFCDGSANPAMEQV  109

Query  345  CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELT  524
            CGRPLGL F+ A   LY+ D ++GLL V RN GG+A Q+A  V G  F F +A+ +D+ T
Sbjct  110  CGRPLGLKFNEATCDLYIADAYFGLLVVGRN-GGVAKQVAISVEGVPFRFTNALDIDQNT  168

Query  525  ADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQT  704
              VYF D   IF+   Y   +Q+GD +GRLLKY     +VTVLL GLS   G+A   D+ 
Sbjct  169  GVVYFTDTSTIFQRWAYAIAMQTGDKTGRLLKYDPRTKEVTVLLRGLSFSNGVALSKDKD  228

Query  705  FIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            F++++E    ++ +Y++ G K+  + T    L G PDN++R   G FWVA N
Sbjct  229  FVLVTETTAAKVTRYWLQGQKSQLSDT-FTRLVGCPDNIQRNIHGEFWVAQN  279



>ref|XP_004298328.1| PREDICTED: strictosidine synthase-like [Fragaria vesca subsp. 
vesca]
Length=346

 Score =   187 bits (476),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 111/299 (37%), Positives = 164/299 (55%), Gaps = 11/299 (4%)
 Frame = +3

Query  174   GPEDTAIDPLDQGIYTGVTDGRILKY---LNGNFNDFATTSPYRTKEKCDGINITNIRAE  344
             GPE  A D   QG Y GV+DGRILK+   L G + +F+ TSP R ++ CDG         
Sbjct  50    GPESVAFDCRGQGPYVGVSDGRILKWEEPLKG-WTEFSYTSPNRQRKLCDGSTNKFNEPI  108

Query  345   CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELT  524
             CGRPLGL F+     LY+ D ++GLLK   N GG   QLA+   G  F F++A+ VD  +
Sbjct  109   CGRPLGLKFNPTTCELYIADAYFGLLKTGPN-GGRPHQLASSAGGVPFHFLNALDVDNES  167

Query  525   ADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQT  704
               VYF D   IF+   +   + S D +GRL++Y     + TVLL GL+ P G+A   D++
Sbjct  168   GMVYFTDTSLIFQRSVWILSIISADRTGRLMQYDPRTKKATVLLKGLAFPDGVALSKDKS  227

Query  705   FIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqp  884
             F+++ E    +I++ ++ GPKANT + +   L G+PDN+KR   G FWVA+N        
Sbjct  228   FLLLIETGTLKILRLWLRGPKANTLE-LFAQLVGFPDNIKRNDNGEFWVAIN--NGVGGS  284

Query  885   pppipMTDSIAVNFDMDGNIVNT---KNVTDTFPNSFSGYQEYSDIAYVGSLLSDFVAV  1052
                  + D +   FD DGN++     K+       S S  +E++ + ++GS  + +V V
Sbjct  285   ISATLLGDPVGAKFDEDGNVLEVLDGKDSAAALLQSVSEVEEHNGMLWIGSAQNSYVGV  343



>gb|KDO65594.1| hypothetical protein CISIN_1g048181mg [Citrus sinensis]
Length=310

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 109/262 (42%), Positives = 153/262 (58%), Gaps = 9/262 (3%)
 Frame = +3

Query  81   ISILMFI-SSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLN  257
            +S+ +F+ S P ++ S P   F  IL    A G E  A +P+    YTGV DGRILKY  
Sbjct  5    LSLFVFVFSLPRMVFSIP--TFTKILFPPKAFGGESIAFEPVGGAFYTGVADGRILKYQA  62

Query  258  GN-FNDFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVER  434
             + F DFA T+P R+K  CDG    ++   C R  GL   +A   LY+ D + GLL V  
Sbjct  63   PDGFTDFAFTTPTRSKAVCDGTTNLDLGPICRRTFGLALHYATRQLYIADAYSGLLVVG-  121

Query  435  NNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRL  614
             NG LATQLA G  G+ F F+D + VD+ T  VYF DA  ++      ++  + D++GRL
Sbjct  122  PNGRLATQLATGAEGQAFHFLDGLDVDQGTGVVYFTDASGVYDFRTIVKLNITNDSTGRL  181

Query  615  LKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVME  794
            L Y+    QVTVLL  L+GPAG+A  +D +F+++SE+ G R +KY++ GP+AN+   +  
Sbjct  182  LSYNPRSSQVTVLLRNLTGPAGVAISVDSSFLLVSEFTGNRTLKYWLRGPRANSFDII--  239

Query  795  NLEGYPDNVKR--GTLGGFWVA  854
            N +  P N+KR  G L  FW A
Sbjct  240  NFQAKPHNIKRNPGLLQTFWEA  261



>ref|XP_010656041.1| PREDICTED: strictosidine synthase 1-like [Vitis vinifera]
Length=309

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 108/298 (36%), Positives = 166/298 (56%), Gaps = 15/298 (5%)
 Frame = +3

Query  165   HASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIR  338
               SGPE  A D    G YTG++DGRILK+      + +FA TSP+R  + CDG     + 
Sbjct  23    RVSGPESIAFDCNGDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPKFCDGSLNPAME  82

Query  339   AECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDE  518
               CGRPLGL F+ A+  LY+ + ++GLL V RN GG+A Q+A    G  F F +A+ +D+
Sbjct  83    QVCGRPLGLKFNEAKCDLYIANAYFGLLVVGRN-GGVAKQVAISAEGVPFRFTNALDIDQ  141

Query  519   LTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDID  698
              T  VYF D   IF+   Y   +Q+GD +GRLLKY     +VTVLL GLS   G+A   D
Sbjct  142   NTGVVYFTDTSTIFQRWAYAIAMQTGDKTGRLLKYDPRSKEVTVLLRGLSFSNGVALSKD  201

Query  699   QTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqq  878
             + F++++E    ++ +Y++ G K+  + T  + L G PDN++R   G FWVA N     +
Sbjct  202   KDFVLVTETTTAKVTRYWLQGQKSQLSDTFTQ-LVGCPDNIQRNIHGEFWVAQNNCGRPE  260

Query  879   qppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSFSGYQEYSDIAYVGSLLSDFVAV  1052
                        I++  + +G I+  + +++ F    S  QE  +  ++GS+L  ++ +
Sbjct  261   LKV--------ISIKLNKEGKIM--EELSEDF-GPLSEVQEKDNDLWLGSVLLSYIGM  307



>ref|XP_010110077.1| Strictosidine synthase 1 [Morus notabilis]
 gb|EXC25144.1| Strictosidine synthase 1 [Morus notabilis]
Length=331

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 123/324 (38%), Positives = 181/324 (56%), Gaps = 10/324 (3%)
 Frame = +3

Query  81    ISILMFI-SSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKY--  251
             +SI++F+ S P ++  QP  +F        A GP   A D   +G +TG++DGR+L+Y  
Sbjct  2     LSIVIFLFSVPSLVFCQPFSNFQKYDLPSAAVGPFSIAFDSSGRGPFTGISDGRVLRYDP  61

Query  252   LNGNFNDFATTSPYRTKEKCDGI--NITNIR-AECGRPLGLDFDHARGVLYVTDMFYGLL  422
             +  +F DFA TSP R+K  CDG   N    R A CGRPLG+ F      LYVTD + GLL
Sbjct  62    VQNSFFDFAFTSPNRSKAVCDGTDNNDNPTRGAICGRPLGVSFHFRTNQLYVTDAYKGLL  121

Query  423   KVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDT  602
              V   NG LA  +A G  G  F F   + VD++T DVYF +    F+       +   D+
Sbjct  122   VVP-PNGRLAENVATGAEGVPFKFPFLLDVDQVTGDVYFTEFSSQFQLSQVQHAIDVRDS  180

Query  603   SGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQ  782
             +GRLLKY+   G+ TVLL GLSG AG+A   D+T+++I+E    R+ K ++SGP A TT 
Sbjct  181   TGRLLKYNPNTGETTVLLRGLSGAAGIALSYDRTYLLIAEMTANRVKKLWLSGPNAFTTV  240

Query  783   TVMENLEGYPDNVKRGTLGGFWVALNipkpqqqppppipMTDSIAVNFDMDGNIVNTKNV  962
              ++  + G P N+K+ +L  FWVA+N   P       I +  +I ++    G I+ T ++
Sbjct  241   DLI-TVRGRPSNIKKNSLADFWVAVNTWIPGPTVGSMIRVPSAIRIS-GTGGAILQTVDL  298

Query  963   TDTFPN-SFSGYQEYSDIAYVGSL  1031
             +  + N S S +Q +    Y+G+L
Sbjct  299   SSYYTNTSISEFQPFGLGGYIGAL  322



>ref|XP_010099021.1| Strictosidine synthase 1 [Morus notabilis]
 gb|EXB76379.1| Strictosidine synthase 1 [Morus notabilis]
Length=328

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/239 (42%), Positives = 144/239 (60%), Gaps = 5/239 (2%)
 Frame = +3

Query  153  LNLQHAS-GPEDTAIDPLDQGIYTGVTDGRILKY--LNGNFNDFATTSPYRTKEKCDGIN  323
            LNL + S GPE    D L +G YTG++DG+I++Y      F DFA TS  R+K  CDG N
Sbjct  29   LNLPNTSVGPESITFDSLGRGPYTGISDGKIVRYDRRTAGFVDFAFTSRNRSKALCDGTN  88

Query  324  ITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDA  503
               +R  CGRPLG++F   + +L++ D F GL KV  N GGLATQLA    G  F F++ 
Sbjct  89   NPALRPICGRPLGMEFFIRKNMLFIADAFLGLFKVGLN-GGLATQLANAAEGIPFRFLNG  147

Query  504  VAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGM  683
            ++VD+ T DVYF D    F      Q V + D++GRLLKY      VTVLL  LSG  G+
Sbjct  148  LSVDQHTGDVYFTDFSSRFLQTQIQQAVAANDSTGRLLKYDYRTKNVTVLLRRLSGANGV  207

Query  684  ATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            A   D ++++++E++  R  ++++ G KA T++ ++    G PDN++R   G F VA+N
Sbjct  208  AISSDSSYVLVAEFLANRTRRFWLHGTKAFTSE-IVATFRGMPDNIRRAPFGNFLVAVN  265



>ref|XP_010099026.1| Strictosidine synthase 1 [Morus notabilis]
 gb|EXB76384.1| Strictosidine synthase 1 [Morus notabilis]
Length=324

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 119/318 (37%), Positives = 172/318 (54%), Gaps = 17/318 (5%)
 Frame = +3

Query  108   PYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGNFNDFATTS  287
             P  I S   +D P+      + GPE    D    G YTG++DGR++K+    F +   TS
Sbjct  19    PLPISSFRRLDLPLT-----SVGPEAITFDRFGGGPYTGISDGRVVKHNGSTFIEIFITS  73

Query  288   PYRTKEKCDGIN-ITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLA  464
             P RT  +CDG N    +   CGRP G+ F      L++ D + GLL V      LA  +A
Sbjct  74    PNRTSLECDGTNNPATLGVTCGRPFGVGFYFRENQLFIADAYRGLL-VGVLGKKLAVPIA  132

Query  465   AGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQV  644
              G  G  F F +A+ VD+LT DVYF DA   F      + V + D++GRLLKY     QV
Sbjct  133   TGAEGVPFKFPNALDVDQLTGDVYFTDASARFSLSQIQEAVATNDSTGRLLKYDRRTQQV  192

Query  645   TVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVK  824
             TVLL  LSG AG+A + ++TF+++SE+I  RI K+++ GP A  +Q V+   +G PDN+K
Sbjct  193   TVLLKNLSGAAGVAINANRTFVLVSEFIANRITKFWLRGPNAFKSQ-VVATFQGMPDNIK  251

Query  825   RGTLGGFWVALNipkpqqqppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNS-FSGYQE  1001
             R   G FWVA+N+P P              A+  + +GNI+ T ++   + N+  S +Q+
Sbjct  252   RTPSGDFWVAVNVPGPGGVML-------PTAIRINGNGNILKTLHLEKYYKNTPISEFQQ  304

Query  1002  YS-DIAYVGSLLSDFVAV  1052
                   Y+GS + +FV V
Sbjct  305   RGFGTYYIGSRVGNFVGV  322



>ref|XP_003576963.1| PREDICTED: strictosidine synthase 3-like [Brachypodium distachyon]
Length=345

 Score =   186 bits (471),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 109/298 (37%), Positives = 167/298 (56%), Gaps = 7/298 (2%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYLNG--NFNDFATTSPYRTKEKCDGINITNIRAE  344
             +G E  A DP  QG Y GV+DGR+L++      +  FA  + YR    C      +   E
Sbjct  50    TGAESLAFDPRGQGPYAGVSDGRVLRWGGSAVGWTTFAHHADYRRIPLCTVPVAPSQETE  109

Query  345   --CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDE  518
               CGRPLGL F    G LY+ D + GLL+V  ++GG A  LA GV+G  F F++ + VD+
Sbjct  110   SICGRPLGLAFHRKSGDLYIADAYKGLLRVG-SDGGEAEVLATGVDGVPFHFVNGIDVDQ  168

Query  519   LTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDID  698
              T DVYF D+   +     T+I+ + D +GRLLKY A   QVTVL +GL  P G+A   D
Sbjct  169   ATGDVYFTDSSVTYSRRFNTEIMMNADATGRLLKYEARTKQVTVLKDGLPYPNGVAVSHD  228

Query  699   QTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqq  878
              T+++++  +  + ++Y++ GPKA   + +M +L GYPDNV+R + GGFWVALN  + + 
Sbjct  229   WTYVVVAHTVPCQALRYYLRGPKAGQYE-LMADLPGYPDNVRRDSKGGFWVALNQERARP  287

Query  879   qppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSFSGYQEYSDIAYVGSLLSDFVAV  1052
                    +T  + V   +DG+    + +T     + S   + S+  ++GS+  D++ V
Sbjct  288   DAAAAPAVTKHL-VGVRLDGDGAQLEELTAAKGVTLSEVTQRSNRLWLGSVELDYIGV  344



>emb|CBI28990.3| unnamed protein product [Vitis vinifera]
Length=343

 Score =   186 bits (471),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 109/298 (37%), Positives = 164/298 (55%), Gaps = 15/298 (5%)
 Frame = +3

Query  165   HASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIR  338
               SGPE  A D    G YTG++DGRILK+      + +FA TSP+R  + CDG     + 
Sbjct  57    RVSGPESIAFDCNGDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPKFCDGSINPVME  116

Query  339   AECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDE  518
               CGRPLGL F+ A   LY+ D ++GLL V RN GG+A Q+A    G  F F +A+ +D+
Sbjct  117   QVCGRPLGLKFNEATCDLYIADAYFGLLVVGRN-GGVAKQVAINAEGVPFRFTNALDIDQ  175

Query  519   LTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDID  698
              T  VYF D   IF+   Y   +Q+GD +GRLLKY     +VTVLL GLS   G+A   D
Sbjct  176   NTGVVYFTDTSTIFQRWAYAIAMQTGDKTGRLLKYDPRSKEVTVLLRGLSFSNGVALSKD  235

Query  699   QTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqq  878
             + F++++E    ++ +Y++ G K+  + T  + L G PDN++R   G FWVA N     +
Sbjct  236   KDFVLVTETTAAKVTRYWLQGQKSQLSDTFTQ-LVGCPDNIQRNIHGEFWVAQNNCGRPE  294

Query  879   qppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSFSGYQEYSDIAYVGSLLSDFVAV  1052
                         +V  + +G I+  + +++ F    S  QE  +  ++GS+L  ++ +
Sbjct  295   LKVR--------SVKLNKEGKIM--EELSEDF-GPLSEVQEKDNDLWLGSVLLSYIGL  341



>ref|XP_010110078.1| Strictosidine synthase 1 [Morus notabilis]
 gb|EXC25145.1| Strictosidine synthase 1 [Morus notabilis]
Length=332

 Score =   185 bits (470),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 121/331 (37%), Positives = 185/331 (56%), Gaps = 10/331 (3%)
 Frame = +3

Query  72    MFWISILMFISSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKY  251
             M +I I +F S P ++ SQP  +F        A GP   A D   +G +TG++DGRIL+Y
Sbjct  1     MLFIIIFLF-SIPSLVFSQPFSNFQRYDLPSTAVGPFSLAFDASGRGPFTGISDGRILRY  59

Query  252   --LNGNFNDFATTSPYRTKEKCDGINITNIR---AECGRPLGLDFDHARGVLYVTDMFYG  416
               +  +F DFA TSP  +K  CDG +  +     A CGRPLG+ F      LYVTD + G
Sbjct  60    DPVQNSFFDFAFTSPTGSKAVCDGTDNNDNPDRGAICGRPLGISFYFRTNQLYVTDAYKG  119

Query  417   LLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSG  596
             L+ V   NG LA  +A    G  F F   + VD++T DVYF D    F+     Q + + 
Sbjct  120   LVVVP-PNGRLAENVATSAEGVPFKFPFHLDVDQVTGDVYFTDFSSQFQLSQLLQAIDAR  178

Query  597   DTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANT  776
             D +GRLLKY+    + TVLL GL+G AG+A   D+T+++++E    R+ K ++SGP A T
Sbjct  179   DATGRLLKYNPNTRETTVLLRGLTGAAGVALSYDRTYLLVAEMNANRVKKLWLSGPNAFT  238

Query  777   TQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqppppipMTDSIAVNFDMDGNIVNTK  956
             T  ++   +G P+N+++ +L  FWV +N   P       I +  ++ ++  + G I+ T 
Sbjct  239   TVDLI-TFQGRPNNIEKNSLTDFWVVVNTRIPGTTAGSFIRIPSAVRIS-GIGGGILQTV  296

Query  957   NVTDTFPN-SFSGYQEYSDIAYVGSLLSDFV  1046
             +++  FPN + S +Q Y    Y+GSL +D++
Sbjct  297   DLSRYFPNMTISEFQPYGLGGYIGSLRTDYL  327



>ref|XP_010655935.1| PREDICTED: strictosidine synthase 1-like [Vitis vinifera]
Length=322

 Score =   185 bits (469),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 109/298 (37%), Positives = 164/298 (55%), Gaps = 15/298 (5%)
 Frame = +3

Query  165   HASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIR  338
               SGPE  A D    G YTG++DGRILK+      + +FA TSP+R  + CDG     + 
Sbjct  36    RVSGPESIAFDCNGDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPKFCDGSINPVME  95

Query  339   AECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDE  518
               CGRPLGL F+ A   LY+ D ++GLL V RN GG+A Q+A    G  F F +A+ +D+
Sbjct  96    QVCGRPLGLKFNEATCDLYIADAYFGLLVVGRN-GGVAKQVAINAEGVPFRFTNALDIDQ  154

Query  519   LTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDID  698
              T  VYF D   IF+   Y   +Q+GD +GRLLKY     +VTVLL GLS   G+A   D
Sbjct  155   NTGVVYFTDTSTIFQRWAYAIAMQTGDKTGRLLKYDPRSKEVTVLLRGLSFSNGVALSKD  214

Query  699   QTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqq  878
             + F++++E    ++ +Y++ G K+  + T  + L G PDN++R   G FWVA N     +
Sbjct  215   KDFVLVTETTAAKVTRYWLQGQKSQLSDTFTQ-LVGCPDNIQRNIHGEFWVAQNNCGRPE  273

Query  879   qppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSFSGYQEYSDIAYVGSLLSDFVAV  1052
                         +V  + +G I+  + +++ F    S  QE  +  ++GS+L  ++ +
Sbjct  274   LKVR--------SVKLNKEGKIM--EELSEDF-GPLSEVQEKDNDLWLGSVLLSYIGL  320



>emb|CBI28987.3| unnamed protein product [Vitis vinifera]
Length=315

 Score =   184 bits (468),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 111/296 (38%), Positives = 162/296 (55%), Gaps = 15/296 (5%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRAE  344
             SGPE  A D    G YTG++DGRILK+      + +FA TSP+R  + CDG     +   
Sbjct  31    SGPESIAFDCNGDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPKFCDGSLNPAMEQV  90

Query  345   CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELT  524
             CGRPLGL F+ A   LY+ D ++GLL V +N GG+A Q+A    G  F F +A+ +D+ T
Sbjct  91    CGRPLGLKFNEATCDLYIADAYFGLLVVGQN-GGVAKQVAISAEGVPFRFTNALDIDQNT  149

Query  525   ADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQT  704
               VYF D   IF+   Y   +Q GD +GRLLKY     +VTVLL GLS   G+A   D+ 
Sbjct  150   GVVYFTDTSTIFQRWAYAIAMQIGDKTGRLLKYDPRTKEVTVLLRGLSFSNGVALSEDKD  209

Query  705   FIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqp  884
             F++++E    ++ +Y++ G K+  + T  + L G PDN++R   G FWVA N     +  
Sbjct  210   FVLVTETTAAKVTRYWLQGQKSQLSDTFTQ-LVGCPDNIQRNIHGEFWVAQNNCGRPEVK  268

Query  885   pppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSFSGYQEYSDIAYVGSLLSDFVAV  1052
                        V  + +G IV   +V D  P   S  QE ++  ++GS++  ++ V
Sbjct  269   VR--------PVRLNKEGKIVEELSV-DVGP--LSEVQEKNNSLWLGSVILSYIGV  313



>ref|XP_004508606.1| PREDICTED: strictosidine synthase 1-like [Cicer arietinum]
Length=334

 Score =   185 bits (469),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 129/342 (38%), Positives = 195/342 (57%), Gaps = 17/342 (5%)
 Frame = +3

Query  57    MKSLTMFWISILMFISSPYVIHSQPGVDFPIILN-LQHAS---GPEDTAIDPLDQGIYTG  224
             M ++ +  +S  +FI   +++ S   V   I LN LQ  S   GPE  A D   +G Y  
Sbjct  1     MLNINIIIVSATLFI---FLLCSPSSVA--IFLNRLQLPSPVTGPESLAFDRNGEGPYVS  55

Query  225   VTDGRILKYLNGN--FNDFATTSPYRTKEKCDGI-NITNIRAECGRPLGLDFDHARGVLY  395
              +DGRILKYL  N  F ++A TSP R K  CDG+ + + I+A CGRPLGL F+H    LY
Sbjct  56    SSDGRILKYLGPNYGFKEYAVTSPNRNKTICDGLADFSAIQATCGRPLGLGFNHQTNDLY  115

Query  396   VTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNY  575
             V D ++GL+KV  N G   TQL       +  F D + VD+ T  VYF +A   F+  ++
Sbjct  116   VADAYFGLIKVGPN-GENVTQLVGPAKPNSTRFGDGLDVDQDTGIVYFTEASTNFQLKDF  174

Query  576   TQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFI  755
               ++ SGD+SG LL Y  +  Q TVLL+ L+ P+G+A  +D +F+++SEY+  RI + +I
Sbjct  175   QTLLNSGDSSGSLLSYDPSTNQTTVLLSNLALPSGVAVSLDGSFVLVSEYLANRIQRVWI  234

Query  756   SGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqppppipMTDSIAVNFDMD  935
              GP+ANT++  M+ L G PDN+KR + G FW+++N   P  + P    +   + V    +
Sbjct  235   KGPRANTSELFMQ-LPGRPDNIKRNSRGQFWISVNSFIPPPRFPRRSTLPAGVRVG--AN  291

Query  936   GNIVNTKNVTDTF-PNSFSGYQEYSDIAYVGSLLSDFVAVYT  1058
             G ++   ++   +     S  QE++   Y GSLL+ F +V+T
Sbjct  292   GLVLQIVSLVPEYGTEPVSEVQEFNGTLYGGSLLASFASVFT  333



>emb|CAN59852.1| hypothetical protein VITISV_000854 [Vitis vinifera]
Length=326

 Score =   184 bits (468),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 122/308 (40%), Positives = 164/308 (53%), Gaps = 21/308 (7%)
 Frame = +3

Query  162   QHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNI  335
             ++ + P   A D L  G YTGVTDGRI KY      F +FA T+P R+KE CDG    N+
Sbjct  28    KNVTSPYSFAFDQLGGGPYTGVTDGRIFKYGGPKVGFTEFAFTAPNRSKEVCDGTRDINL  87

Query  336   RAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVD  515
                CGRPLGL +DH+   LY+ D ++GLL V  +NGG ATQ A    G  F F+  + VD
Sbjct  88    GPICGRPLGLGYDHSSXXLYIADAYFGLLAVG-SNGGPATQAATSAEGVPFRFLSGLDVD  146

Query  516   ELTADVYFIDAGDIFRSLNYTQIVQSG------DTSGRLLKYSAAKGQVTVLLNGLSGPA  677
              +T  V   D    +   +  Q + SG      DT+GRLLKY     QVTVLL  LSG  
Sbjct  147   PVTGTVXITDFSTEYELRDIRQALVSGNATVLSDTTGRLLKYDPRTSQVTVLLRNLSGAV  206

Query  678   GMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVAL  857
               A   D++FI+++E+   RI K+++ G KA+T + ++  LEG P N+ R TL  FWVA+
Sbjct  207   XTALSTDRSFILVTEFNANRIQKFWLEGTKASTAE-ILVGLEGRPTNI-RTTLESFWVAV  264

Query  858   NipkpqqqppppipMTDSIAVNFDMDGNIVNTKNVTDTF-PNSFSGYQEYSDIAYVGSLL  1034
             +            P T   A   D  GNI+ + N    +  N  S  QEY    Y+G+  
Sbjct  265   S--------IQSTPTTVPTAQRIDPYGNILESLNFAAQYGSNLLSEVQEYHGALYIGAGP  316

Query  1035  S-DFVAVY  1055
             S DFV  +
Sbjct  317   SADFVGYF  324



>ref|XP_011000464.1| PREDICTED: strictosidine synthase 3-like, partial [Populus euphratica]
Length=352

 Score =   185 bits (470),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 103/240 (43%), Positives = 147/240 (61%), Gaps = 9/240 (4%)
 Frame = +3

Query  153  LNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINI  326
            L+L  A+GPE  A DPL QG Y G++DGRI+K+      + +FA TS  R  + C G + 
Sbjct  46   LSLDGATGPESFAFDPLGQGPYAGISDGRIIKWEEHERRWINFAITSQKR--DGCGGPH-  102

Query  327  TNIRAE--CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFID  500
             + R E  CGRPLG  FD  RG LY+ D + GLL+V    GGLAT++A    G  F F +
Sbjct  103  DHHRMEHVCGRPLGSCFDETRGDLYIADAYMGLLRVG-PQGGLATKIATHAQGIPFRFTN  161

Query  501  AVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAG  680
            ++ +D+    +YF D+   ++  +Y  +V SGD SGRL+KY AA  QVTVLL  L+ P G
Sbjct  162  SLDIDQSGGAIYFTDSSTQYQRRDYLSVVLSGDKSGRLMKYDAASKQVTVLLKNLTFPNG  221

Query  681  MATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            +A   D +F++++E    RI++Y+I   KA   + V   L+G+PDN+KR   GG+WV +N
Sbjct  222  VALSKDGSFVLLAETTSCRILRYWIKTSKAGALE-VFAQLQGFPDNIKRSPRGGYWVGIN  280



>emb|CDP12339.1| unnamed protein product [Coffea canephora]
Length=347

 Score =   185 bits (469),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 109/270 (40%), Positives = 150/270 (56%), Gaps = 14/270 (5%)
 Frame = +3

Query  84   SILMFISSPYVIHSQPGVDFPII--------LNLQHASGPEDTAIDPLDQGIYTGVTDGR  239
            +IL+F+ S   +HS      PI           +  ASGPE  A D    G YTGV+DGR
Sbjct  17   AILIFVGSLGTVHSGHEPRHPISQRKWSHEQFPIYGASGPESLAFDRHGGGPYTGVSDGR  76

Query  240  ILKY--LNGNFNDFATTSPYRTKEKCDG-INITNIRAECGRPLGLDFDHARGVLYVTDMF  410
            I+K+      + +FATT+P+R  + CDG  +  N  A CGRPLGL FDH  G LY+ D +
Sbjct  77   IIKWDRNQSRWINFATTTPFR--DGCDGSADHANTEARCGRPLGLSFDHKTGDLYIADAY  134

Query  411  YGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQ  590
             GLL V  + GGLAT +A  V+G  F F++ + +D+ +  +YF D    F    +  ++ 
Sbjct  135  MGLLAVG-SKGGLATPVAQEVDGFPFKFLNDLVIDQDSGAIYFTDTSTRFERREFANVMF  193

Query  591  SGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKA  770
            SGD SGRLLKY     +VTVLL+ L  P G+A   D  F++++E    RI++Y++     
Sbjct  194  SGDNSGRLLKYDPRNNEVTVLLHNLMFPNGVALSKDGDFLLVAETTNSRILRYWLEPSSK  253

Query  771  NTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
                 V  NL G PDN+KR   G FWVA N
Sbjct  254  LGKVEVFANLPGRPDNIKRNQNGEFWVAAN  283



>emb|CDP21857.1| unnamed protein product, partial [Coffea canephora]
Length=337

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 115/299 (38%), Positives = 165/299 (55%), Gaps = 12/299 (4%)
 Frame = +3

Query  174   GPEDTAIDPLDQGIYTGVTDGRILKYLNG--NFNDFATTSPYR--TKEKCDGINITNIRA  341
             GPE  A D    G YTGV DGRILKY      F ++  T   R  +K+ CD I+ T++  
Sbjct  43    GPESYAFDLAGHGPYTGVADGRILKYEGPILGFVEYGYTKENRQESKQLCDNIDTTDLAK  102

Query  342   ECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDEL  521
              CGRPLG+ F +  G L+  D   GL+ V    GG   QLA+G  G  F   D + VD+ 
Sbjct  103   ICGRPLGIGFYYKTGELHTADAGLGLVVVG-PEGGPGKQLASGAEGVPFGLPDGLEVDKK  161

Query  522   TADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQ  701
             T  ++F +A   +     +QI+ + D SGRLLKY     +VTVLL  L+GPAG+A   D 
Sbjct  162   TGVIFFTEASSRYNISQISQIISTRDASGRLLKYDPQTKKVTVLLRSLAGPAGVAISRDG  221

Query  702   TFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqq  881
             ++++++E++ +R++KY++ GP ANTT+ V+ NL G PD +KR + G +W+ LN      Q
Sbjct  222   SYLLVTEFLNQRVLKYWLKGPLANTTR-VLVNLSGSPDKIKRNSRGDYWIGLN-----VQ  275

Query  882   ppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNS-FSGYQEYSDIAYVGSLLSDFVAVY  1055
                P P T       +  G+I+ T   +  F  S  +  QEY    Y+GSL   +V VY
Sbjct  276   SQGPNPTTIIQGQRINGKGHILETITFSPDFNASVITEVQEYKGALYLGSLFVGYVGVY  334



>ref|XP_010110081.1| Strictosidine synthase 1 [Morus notabilis]
 gb|EXC25148.1| Strictosidine synthase 1 [Morus notabilis]
Length=353

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 126/340 (37%), Positives = 188/340 (55%), Gaps = 19/340 (6%)
 Frame = +3

Query  60    KSLTMFWISILMFISSP--YVIHSQPGVDFPIILNLQHAS-GPEDTAIDPLDQGIYTGVT  230
             +++TM  I +L+F+S P  Y++ SQ    F   LNL   S GPE    D L +G YTG++
Sbjct  23    ETVTMLLI-LLIFLSVPSNYIVLSQQISTFRK-LNLPTTSVGPEPIDFDALGRGPYTGIS  80

Query  231   DGRILKY--LNGNFNDFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTD  404
             DGRI++Y     +F DFA  S  R+K  CDG N   +R  CGRPLG++F H R +L++ D
Sbjct  81    DGRIVRYDKRTSSFVDFAFASQNRSKAVCDGTNSPALRPVCGRPLGIEFFHRRNLLFIAD  140

Query  405   MFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQI  584
              F GL  V   NGGLATQLA    G +  F++ ++VD+ T DVYF D    F      Q 
Sbjct  141   AFAGLCVVG-PNGGLATQLATTAEGISLRFLNGLSVDQHTGDVYFTDYSSRFLQTQIQQA  199

Query  585   VQSGDTSGRLLKYSAAKGQVTV-LLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISG  761
             + + D++GRLLKY      VTV LL GLSG  G+A   D T+++ +E I  R  ++++ G
Sbjct  200   IAANDSTGRLLKYDYRTKNVTVLLLRGLSGANGVAISSDGTYLLFAESIANRTQRFWLRG  259

Query  762   PKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqppppipMTDSIAVNFDMDGN  941
              +A T++ V+ N +G P N++R   G F V +++ +P              A+  +  G 
Sbjct  260   ARAFTSE-VVANFQGMPRNIRRTPSGDFLVGVSVQRPGAPSIV------PTAIRINGAGQ  312

Query  942   IVNTKNVTDTFPNS--FSGYQEYSDIAYVGSLLSDFVAVY  1055
             I+ T  + D + N+   S + +     Y GS  ++FV V+
Sbjct  313   ILQTLPL-DHYYNTTVISEFLQRGSRYYAGSAQANFVGVF  351



>ref|XP_006485738.1| PREDICTED: strictosidine synthase 1-like [Citrus sinensis]
Length=310

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 108/262 (41%), Positives = 152/262 (58%), Gaps = 9/262 (3%)
 Frame = +3

Query  81   ISILMFI-SSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLN  257
            +S+ +F+ S P ++ S P   F  I     A G E  A +P+    YTGV DGRILKY  
Sbjct  5    LSLFVFVFSLPRMVFSIP--TFTKIPFPPKAFGGESIAFEPVGGAFYTGVADGRILKYQA  62

Query  258  GN-FNDFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVER  434
             + F DFA T+P R+K  CDG    ++   C R  GL   +A   LY+ D + GLL V  
Sbjct  63   PDGFTDFAFTTPTRSKAVCDGTTNLDLGPICRRTFGLALHYATRQLYIADAYSGLLVVG-  121

Query  435  NNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRL  614
             NG LATQLA G  G+ F F+D + VD+ T  VYF DA  ++      ++  + D++GRL
Sbjct  122  PNGRLATQLATGAEGQAFHFLDGLDVDQGTGVVYFTDASGVYDFRTIVKLNITNDSTGRL  181

Query  615  LKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVME  794
            L Y+    QVTVLL  L+GPAG+A  +D +F+++SE+ G R +KY++ GP+AN+   +  
Sbjct  182  LSYNPRSSQVTVLLRNLTGPAGVAISVDSSFLLVSEFTGNRTLKYWLRGPRANSFDII--  239

Query  795  NLEGYPDNVKR--GTLGGFWVA  854
            N +  P N+KR  G L  FW A
Sbjct  240  NFQAKPHNIKRNPGLLQTFWEA  261



>ref|XP_003609162.1| Strictosidine synthase [Medicago truncatula]
 gb|AES91359.1| SMP-30/gluconolaconase/LRE-like region protein [Medicago truncatula]
Length=335

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 109/303 (36%), Positives = 173/303 (57%), Gaps = 10/303 (3%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGI-NITNIRA  341
             +GPE  A D    G Y   +DGRI KY+  N  F ++A T+P R +  CDG+ + + ++A
Sbjct  37    TGPESLAFDRNGGGPYVTSSDGRIFKYVGSNEGFKEYAYTAPNRNRTICDGLADFSVVQA  96

Query  342   ECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDEL  521
              CGRPLGL F+H    LYV D ++GL+KV  N GG ATQL       +  F D + VD  
Sbjct  97    ICGRPLGLGFNHQTNDLYVADAYFGLVKVGPN-GGNATQLVGPTQANSTMFADGLDVDPD  155

Query  522   TADVYFIDAGDIFRSLNYTQIVQSG--DTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDI  695
             T  VYF  A   ++  ++  ++ SG  D SG LL+Y  +  Q TVLL  L+ P+G+A   
Sbjct  156   TGIVYFTIASTNYKLKDFQTVLASGSGDNSGSLLRYDPSTNQTTVLLRNLTIPSGVAVSK  215

Query  696   DQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpq  875
             + +F+++SEY+  RI + ++ GP+AN+++  M  L G PDN+KR + G FW++++     
Sbjct  216   EGSFVLVSEYLANRIQRVWLKGPRANSSELFML-LAGRPDNIKRNSGGQFWISVSSFLGT  274

Query  876   qqppppipMTDSIAVNFDMDGNIVNTKNVTDTF-PNSFSGYQEYSDIAYVGSLLSDFVAV  1052
              + P    +   + VN   +G ++   ++ + + P + S  QEY+   Y GSLL+ +   
Sbjct  275   PRSPGCSTLPSGVRVN--ENGLVLQIVSLVEEYGPEAASEVQEYNGTLYGGSLLASYATS  332

Query  1053  YTA  1061
             +T+
Sbjct  333   FTS  335



>ref|XP_006421116.1| hypothetical protein CICLE_v10005245mg [Citrus clementina]
 gb|ESR34356.1| hypothetical protein CICLE_v10005245mg [Citrus clementina]
Length=360

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 112/274 (41%), Positives = 161/274 (59%), Gaps = 15/274 (5%)
 Frame = +3

Query  54   NMKSLTMFWISILMFISSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTD  233
            N  SL+    SI++F+   ++  S  GV   +   ++ A GPE  A D L +G YTGV+D
Sbjct  2    NSTSLSFIAKSIVIFL---FINSSTQGV---VQYQIEGAIGPESFAFDALGEGPYTGVSD  55

Query  234  GRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRAE---CGRPLGLDFDHARGVLYV  398
            GRI+K+      +  FA TSP R  + C+G    +  A+   CGRPLGL F+   G LY+
Sbjct  56   GRIIKWHQDQRRWLHFALTSPNR--DGCEGAYEYDHAAKEHICGRPLGLCFNKTNGDLYI  113

Query  399  TDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYT  578
             D ++GLLKV    GGLAT +A    G  F F +++ +D+ T  VYF D+   F+  N+ 
Sbjct  114  ADAYFGLLKVG-PEGGLATAVATQSEGIPFRFCNSLDIDQSTGIVYFTDSSSQFQRRNHI  172

Query  579  QIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFIS  758
             ++ SGD +GRL+KY  A  QVTVLL  LS P G+A   D  +I+++E    RI++Y++ 
Sbjct  173  SVILSGDKTGRLMKYDPATKQVTVLLGNLSFPNGVALSEDGNYILLAETTSCRILRYWLK  232

Query  759  GPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
              KA T + V + L G+PDNVKR   GGFWV ++
Sbjct  233  TSKAGTIEIVAQ-LPGFPDNVKRSPRGGFWVGIH  265



>ref|XP_006436700.1| hypothetical protein CICLE_v10033919mg [Citrus clementina]
 gb|ESR49940.1| hypothetical protein CICLE_v10033919mg [Citrus clementina]
Length=344

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 111/305 (36%), Positives = 166/305 (54%), Gaps = 21/305 (7%)
 Frame = +3

Query  174   GPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEK-CDGINITNIRAE  344
             GPE  A D   +G Y GV+DGRILK+ +    + +FA T+P+R   + CDG + T +   
Sbjct  52    GPESLAFDCNGEGPYAGVSDGRILKWQDSKLGWTEFAITTPFRRLRRICDGTSSTILEPL  111

Query  345   CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELT  524
             CGRPLG+ F+     LY+ D ++GL+ V RN GG A QLA+      F F +A+ +D  T
Sbjct  112   CGRPLGIKFNPVTCDLYIADAYFGLMVVGRN-GGPAKQLASSAERIPFRFTNALDIDPNT  170

Query  525   ADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQT  704
               VYF D+   F+   Y  +++SGD SGRLLKY     QVTVL  GL+ P G+    D++
Sbjct  171   GVVYFTDSSMYFQRRQYPMLIESGDRSGRLLKYDPRNKQVTVLRRGLAFPNGVTLSKDKS  230

Query  705   FIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqp  884
             F++++E   RRI+++++ G     +      +  +PDN++    G FWVALN  +   + 
Sbjct  231   FLLVAESDSRRILRFWVEGESVIYSPQPFAQVAQFPDNIETDRNGDFWVALNTKRGNDK-  289

Query  885   pppipMTDSIAVNFD-MDGNIV-----NTKNVTDTFPNSFSGYQEYSDIAYVGSLLSDFV  1046
                   TD +AV  D  +GN++     N +N  D    S S  +E+    Y GS +  +V
Sbjct  290   ------TDLVAVKLDGSNGNVLDVLEGNKQNALD----SVSEVEEHGGYLYAGSPVQPYV  339

Query  1047  AVYTA  1061
              V  A
Sbjct  340   VVIKA  344



>emb|CBI28988.3| unnamed protein product [Vitis vinifera]
Length=322

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 110/296 (37%), Positives = 162/296 (55%), Gaps = 15/296 (5%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRAE  344
             SGPE  A D    G YTG++DG+ILK+      + +FA TSP+R  + CDG     +   
Sbjct  38    SGPESIAFDCNGDGPYTGISDGKILKWQGSKHGWKEFAITSPFRIPKFCDGSLNPAMEQV  97

Query  345   CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELT  524
             CGRPLGL F+ A   LY+ D ++GLL V +N GG+A Q+A    G  F F +A+ +D+ T
Sbjct  98    CGRPLGLKFNEATCDLYIADAYFGLLVVGQN-GGVAKQVAISAEGVPFRFTNALDIDQNT  156

Query  525   ADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQT  704
               VYF D   IF+   Y  ++Q GD +GRLLKY     +VTVLL GLS   G+A   D+ 
Sbjct  157   GVVYFTDTSTIFQRWAYAIVMQIGDKTGRLLKYDPRTKEVTVLLRGLSFSNGVALSEDKY  216

Query  705   FIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqp  884
             F++++E    +I +Y++ G K+  + T  + L G PDN++R   G FWVA N     +  
Sbjct  217   FVLVTEMTAAKITRYWLQGQKSQLSDTFTQ-LVGCPDNIQRNIHGEFWVAQNNCGRPEVK  275

Query  885   pppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSFSGYQEYSDIAYVGSLLSDFVAV  1052
                        V  + +G IV   +V D  P   S  QE ++  ++G ++  ++ V
Sbjct  276   VR--------PVRLNKEGKIVEELSV-DVGP--LSEVQEKNNSLWLGYVILSYIGV  320



>ref|XP_006436705.1| hypothetical protein CICLE_v10033909mg [Citrus clementina]
 gb|ESR49945.1| hypothetical protein CICLE_v10033909mg [Citrus clementina]
Length=338

 Score =   183 bits (465),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 111/305 (36%), Positives = 166/305 (54%), Gaps = 21/305 (7%)
 Frame = +3

Query  174   GPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEK-CDGINITNIRAE  344
             GPE  A D   +G Y GV+DGRILK+ +    + +FA T+P+R   + CDG + T +   
Sbjct  46    GPESLAFDCNGEGPYAGVSDGRILKWQDSKLGWTEFAITTPFRRLRRICDGTSSTILEPL  105

Query  345   CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELT  524
             CGRPLG+ F+     LY+ D ++GL+ V RN GG A QLA+      F F +A+ +D  T
Sbjct  106   CGRPLGIKFNPVTCDLYIADAYFGLMVVGRN-GGPAKQLASSAERIPFRFTNALDIDPNT  164

Query  525   ADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQT  704
               VYF D+   F+   Y  +++SGD SGRLLKY     QVTVL  GL+ P G+    D++
Sbjct  165   GVVYFTDSSMYFQRRQYPMLIESGDRSGRLLKYDPRNKQVTVLRRGLAFPNGVTLSNDKS  224

Query  705   FIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqp  884
             F++++E   RRI+++++ G     +      +  +PDN++    G FWVALN  +   + 
Sbjct  225   FLLVAESDSRRILRFWVEGESVIYSPQPFAQVAQFPDNIETDRNGDFWVALNTKRGNDK-  283

Query  885   pppipMTDSIAVNFD-MDGNIV-----NTKNVTDTFPNSFSGYQEYSDIAYVGSLLSDFV  1046
                   TD +AV  D  +GN++     N +N  D    S S  +E+    Y GS +  +V
Sbjct  284   ------TDLVAVKLDGSNGNVLDVLEGNKQNALD----SVSEVEEHGGYLYAGSPVQPYV  333

Query  1047  AVYTA  1061
              V  A
Sbjct  334   VVIKA  338



>emb|CBI15378.3| unnamed protein product [Vitis vinifera]
Length=1075

 Score =   192 bits (487),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 121/312 (39%), Positives = 167/312 (54%), Gaps = 23/312 (7%)
 Frame = +3

Query  174   GPEDTAIDPLDQGIYTGVTDGRILKYL--NGNFNDFATTSPYRTKEKCDGINITNIRAEC  347
             GPE  A D    G Y  V DGR+LK+   +  F DF   SP R+K+ CDG +       C
Sbjct  41    GPEALAFDCSGAGPYASVADGRVLKWQAESAGFVDFTVASPSRSKQLCDGSSDPAKEPTC  100

Query  348   GRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTA  527
             GRPLG+ F++  G LY+ D +YGL  V   +GG ATQLA    G  F F++AV VD+ T 
Sbjct  101   GRPLGIGFNNKTGDLYIADAYYGLFVVG-PDGGRATQLATEAEGVPFRFLNAVDVDQETG  159

Query  528   DVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTF  707
              VYF DA   F+   +   V +GD +GRL+KY     QVTVLL GL    G+A + D +F
Sbjct  160   IVYFTDASARFQRREFQNAVLAGDMTGRLMKYDPRTKQVTVLLRGLGLAVGVAINKDGSF  219

Query  708   IMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqpp  887
             +++SE+I  RI +Y++ GPKANT++  ++   G PDN+KR   G FWVA NI        
Sbjct  220   VLVSEFIATRIQRYWLRGPKANTSELFLKP-TGTPDNIKRNARGEFWVAANIGAEMAAAA  278

Query  888   ppipMTDSIAVNFDMDGNIV-----NTKNVTDTFPNSFSGYQEYSDIAYVGSLLSDFVAV  1052
                     + +    +G I+     +T ++T T     S   EY+   YVG  +   +AV
Sbjct  279   -------PLGLRVSEEGKILQVVAFDTGDITRT----ISEVHEYNGALYVGEFM---LAV  324

Query  1053  YTAI*SLRLAAY  1088
              T   + RL  Y
Sbjct  325   QTGDMTGRLMKY  336


 Score =   190 bits (482),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/232 (44%), Positives = 142/232 (61%), Gaps = 4/232 (2%)
 Frame = +3

Query  171  SGPEDTAIDPLDQGIYTGVTDGRILKYLNG--NFNDFATTSPYRTKEKCDGINITNIRAE  344
            +GPE  A D   +G YTGV+DGR+LKY      F DFA TSP RT+E CDG     + A 
Sbjct  458  TGPESLAFDLKGEGPYTGVSDGRVLKYQGPAVGFTDFAVTSPNRTEEMCDGSIDPALEAT  517

Query  345  CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELT  524
            CGRPLGL F++  G LY+ D + GL+ V  ++GG+ATQLAA   G  F F+  + VD+  
Sbjct  518  CGRPLGLGFNYHTGDLYMVDAYLGLMVVG-SSGGIATQLAAAAEGIPFRFLAGLDVDQGN  576

Query  525  ADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQT  704
              VYF +A   F+  +  +++ S D++G L +Y     +V VLL GLS   G+A   D  
Sbjct  577  GMVYFTEASTRFQLRDMQELIASNDSTGSLFRYDPQSREVRVLLGGLSVAVGVAVSRDGM  636

Query  705  FIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            F++++E    RI ++++ GPKANT++  ME L G P N+KR   G FWVA+N
Sbjct  637  FVLVAELTANRIRRFWLGGPKANTSEVFME-LLGKPSNIKRNERGEFWVAIN  687


 Score =   176 bits (445),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 118/304 (39%), Positives = 165/304 (54%), Gaps = 14/304 (5%)
 Frame = +3

Query  165   HASGPEDTAIDPLDQGIYTGVTDGRILKY--LNGNFNDFATTSPYRTKEKCDGINITNIR  338
             + +GP   A D    G Y GV DGRI++Y   +  F DFA  +P R+K  CDG    +  
Sbjct  781   NVTGPVSLAFDLTVGGPYAGVNDGRIIRYGGTDVGFTDFAFCTPTRSKAVCDGTTDPDSG  840

Query  339   AECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDE  518
               CGRPLGL F++ R  +Y+ D + GL  V   NG LAT+LA    G  F F++ + VD 
Sbjct  841   PTCGRPLGLSFNNLRNQMYIADAYSGLF-VAGTNGRLATKLATSAEGVPFCFLNGLDVDP  899

Query  519   LTADVYFID-AGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDI  695
             L+  VYF D +  I  S N TQ   S D +GRLL+Y      VTVLL GLSG AG A   
Sbjct  900   LSGLVYFTDFSTTIQLSGNTTQF--SSDATGRLLRYDPETKNVTVLLRGLSGAAGTAVSN  957

Query  696   DQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpq  875
             D  F+++SE+   RI+K+++ GPKA+T +T + +  G P N+KR   G FWVA+N+P  Q
Sbjct  958   DGMFVLVSEFNANRILKFWLRGPKASTAETFV-SFRGRPVNIKRTASGNFWVAVNVPNNQ  1016

Query  876   qqppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNS--FSGYQEYSDIAYVGSLLSDFVA  1049
               P      T          G I+ T +  D +  S   +  Q++    Y+G+  ++FV 
Sbjct  1017  SPPT-----TILTGQRISYYGTILETVSFDDQYGGSTLITEVQQHLGALYIGANSANFVG  1071

Query  1050  VYTA  1061
             V+ A
Sbjct  1072  VHMA  1075


 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 70/124 (56%), Gaps = 14/124 (11%)
 Frame = +3

Query  528  DVYFIDAGDIFRSLN-------------YTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLS  668
             V   D GDI R+++             +   VQ+GD +GRL+KY     +VT LL GL 
Sbjct  292  QVVAFDTGDITRTISEVHEYNGALYVGEFMLAVQTGDMTGRLMKYDPRTQEVTELLRGLG  351

Query  669  GPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFW  848
            G  G+    D +FI+++E++  RI ++++ G KANT+Q  ++   G PDN+K    G FW
Sbjct  352  GAGGVTISKDGSFILVTEFVTNRIQRFWLKGRKANTSQLFLKP-PGTPDNIKSNARGEFW  410

Query  849  VALN  860
            VA+N
Sbjct  411  VAVN  414



>ref|XP_002275622.2| PREDICTED: strictosidine synthase 1-like [Vitis vinifera]
Length=359

 Score =   183 bits (465),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 110/296 (37%), Positives = 162/296 (55%), Gaps = 15/296 (5%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRAE  344
             SGPE  A D    G YTG++DG+ILK+      + +FA TSP+R  + CDG     +   
Sbjct  75    SGPESIAFDCNGDGPYTGISDGKILKWQGSKHGWKEFAITSPFRIPKFCDGSLNPAMEQV  134

Query  345   CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELT  524
             CGRPLGL F+ A   LY+ D ++GLL V +N GG+A Q+A    G  F F +A+ +D+ T
Sbjct  135   CGRPLGLKFNEATCDLYIADAYFGLLVVGQN-GGVAKQVAISAEGVPFRFTNALDIDQNT  193

Query  525   ADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQT  704
               VYF D   IF+   Y  ++Q GD +GRLLKY     +VTVLL GLS   G+A   D+ 
Sbjct  194   GVVYFTDTSTIFQRWAYAIVMQIGDKTGRLLKYDPRTKEVTVLLRGLSFSNGVALSEDKY  253

Query  705   FIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqp  884
             F++++E    +I +Y++ G K+  + T  + L G PDN++R   G FWVA N     +  
Sbjct  254   FVLVTEMTAAKITRYWLQGQKSQLSDTFTQ-LVGCPDNIQRNIHGEFWVAQNNCGRPEVK  312

Query  885   pppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSFSGYQEYSDIAYVGSLLSDFVAV  1052
                        V  + +G IV   +V D  P   S  QE ++  ++G ++  ++ V
Sbjct  313   VR--------PVRLNKEGKIVEELSV-DVGP--LSEVQEKNNSLWLGYVILSYIGV  357



>ref|XP_010655933.1| PREDICTED: strictosidine synthase 1-like [Vitis vinifera]
Length=411

 Score =   184 bits (468),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 111/296 (38%), Positives = 162/296 (55%), Gaps = 15/296 (5%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRAE  344
             SGPE  A D    G YTG++DGRILK+      + +FA TSP+R  + CDG     +   
Sbjct  127   SGPESIAFDCNGDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPKFCDGSLNPAMEQV  186

Query  345   CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELT  524
             CGRPLGL F+ A   LY+ D ++GLL V +N GG+A Q+A    G  F F +A+ +D+ T
Sbjct  187   CGRPLGLKFNEATCDLYIADAYFGLLVVGQN-GGVAKQVAISAEGVPFRFTNALDIDQNT  245

Query  525   ADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQT  704
               VYF D   IF+   Y   +Q GD +GRLLKY     +VTVLL GLS   G+A   D+ 
Sbjct  246   GVVYFTDTSTIFQRWAYAIAMQIGDKTGRLLKYDPRTKEVTVLLRGLSFSNGVALSEDKD  305

Query  705   FIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqp  884
             F++++E    ++ +Y++ G K+  + T  + L G PDN++R   G FWVA N     +  
Sbjct  306   FVLVTETTAAKVTRYWLQGQKSQLSDTFTQ-LVGCPDNIQRNIHGEFWVAQNNCGRPEVK  364

Query  885   pppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSFSGYQEYSDIAYVGSLLSDFVAV  1052
                        V  + +G IV   +V D  P   S  QE ++  ++GS++  ++ V
Sbjct  365   VR--------PVRLNKEGKIVEELSV-DVGP--LSEVQEKNNSLWLGSVILSYIGV  409



>ref|XP_006390480.1| hypothetical protein EUTSA_v10018852mg [Eutrema salsugineum]
 gb|ESQ27766.1| hypothetical protein EUTSA_v10018852mg [Eutrema salsugineum]
Length=328

 Score =   182 bits (462),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 123/332 (37%), Positives = 174/332 (52%), Gaps = 12/332 (4%)
 Frame = +3

Query  60    KSLTMFWISILMFISSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGR  239
             ++L +F +  L+ + S + + S       I L  Q  SGPE  A D    G YTGV+ G+
Sbjct  3     QTLRVFILCFLLILFSSHSLVSSLQTFQKIPLPPQ-ISGPEAFAFDSHGGGPYTGVSGGK  61

Query  240   ILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFY  413
             ILKY      F +FA  SP   K  CD    + +   CGRP+GL F+   G LY+ D F 
Sbjct  62    ILKYQGPKLGFAEFAYISPTANKSLCDKAIGSFLGNICGRPVGLAFNEKTGDLYIADAFL  121

Query  414   GLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQS  593
             GL  V  + GG A +LA    G  F F+D + VD +T  VYF      F        V  
Sbjct  122   GLYMVS-HRGGQAKRLADSAGGFPFRFLDGLDVDPVTGLVYFTSFSTRFGPSQLVLAVAV  180

Query  594   GDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKAN  773
              D +GRL +Y      VTVLL+GLSG AG A   D  F+++ E++  RI+KY+I GPKAN
Sbjct  181   KDATGRLFRYDPKMKTVTVLLSGLSGSAGCAVSSDGEFVLVGEFLRNRILKYWIKGPKAN  240

Query  774   TTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqppppipMTDSIAVNFDMDGNIVNT  953
             T + ++ ++ G PDN++R   G FWVA N  K    P      T+  AV    DG I+  
Sbjct  241   TWEILVPSIPG-PDNIRRTDGGDFWVASNSVKLIVVP------TEPTAVKISSDGEILRR  293

Query  954   KNVTDTFPNSF-SGYQEYSDIAYVGSLLSDFV  1046
              ++ + + ++  S   EY +I Y+G+L ++FV
Sbjct  294   ISLGEYYGDTLVSEVNEYKNIVYMGTLTTNFV  325



>ref|XP_006436702.1| hypothetical protein CICLE_v10033429mg [Citrus clementina]
 gb|ESR49942.1| hypothetical protein CICLE_v10033429mg [Citrus clementina]
Length=338

 Score =   182 bits (463),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 111/305 (36%), Positives = 165/305 (54%), Gaps = 21/305 (7%)
 Frame = +3

Query  174   GPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEK-CDGINITNIRAE  344
             GPE  A D   +G Y GV+DGRILK+ +    + +FA T+P+R   + CDG + T +   
Sbjct  46    GPESLAFDCNGEGPYAGVSDGRILKWQDSKLGWTEFAITTPFRRLRRICDGTSSTILEPL  105

Query  345   CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELT  524
             CGRPLG+ F+     LY+ D ++GL+ V RN GG A QLA+      F F +A+ +D  T
Sbjct  106   CGRPLGIKFNPVTCDLYIADAYFGLMVVGRN-GGPAKQLASSAERIPFRFTNALDIDPNT  164

Query  525   ADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQT  704
               VYF D+   F+   Y  +++SGD SGRLLKY     QVTVL  GL+ P G+    D++
Sbjct  165   GVVYFTDSSMYFQRRQYPMLIESGDRSGRLLKYDPRNKQVTVLRRGLAFPNGVTLSKDKS  224

Query  705   FIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqp  884
             F++++E   RRI++ ++ G     +      +  +PDN++    G FWVALN  +   + 
Sbjct  225   FLLVAESDSRRILRLWVEGESVIYSPQPFAQVAQFPDNIETDRNGDFWVALNTKRGNDK-  283

Query  885   pppipMTDSIAVNFD-MDGNIV-----NTKNVTDTFPNSFSGYQEYSDIAYVGSLLSDFV  1046
                   TD +AV  D  +GN++     N +N  D    S S  +E+    Y GS +  +V
Sbjct  284   ------TDLVAVKLDGSNGNVLDVLEGNKQNALD----SVSEVEEHGGYLYAGSPVQPYV  333

Query  1047  AVYTA  1061
              V  A
Sbjct  334   VVIKA  338



>ref|XP_006440860.1| hypothetical protein CICLE_v10023327mg, partial [Citrus clementina]
 gb|ESR54100.1| hypothetical protein CICLE_v10023327mg, partial [Citrus clementina]
Length=331

 Score =   182 bits (462),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 103/241 (43%), Positives = 141/241 (59%), Gaps = 6/241 (2%)
 Frame = +3

Query  141  FPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN-FNDFATTSPYRTKEKCDG  317
            F  IL    A G E  A +P+    YTGV DGRILKY   + F DFA T+P R+K  CDG
Sbjct  8    FTKILFPPKAFGGESIAFEPVGGAFYTGVADGRILKYQAPDGFTDFAFTTPTRSKAVCDG  67

Query  318  INITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFI  497
                ++   CGR  GL   +A   LY+ D + GLL V+  NG LATQLA G  G+ F F+
Sbjct  68   TTNLDLGPICGRTFGLALHYATRQLYIADAYSGLL-VDGPNGRLATQLATGAEGQAFHFL  126

Query  498  DAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPA  677
            D + VD+ T  VYF DA   +      ++  + D++GRLL Y+    QVTVLL  L+GP 
Sbjct  127  DGLDVDQGTGIVYFTDASGAYDFRTIVKLNITNDSTGRLLSYNPRSSQVTVLLRNLTGPV  186

Query  678  GMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKR--GTLGGFWV  851
            G+A  +D +F+++SE+   R +KY++ GP+AN+   +  N +  PDN+KR  G L  FW 
Sbjct  187  GVAISVDSSFLLVSEFTENRTLKYWLRGPRANSFDII--NFQAKPDNIKRNPGLLQTFWE  244

Query  852  A  854
            A
Sbjct  245  A  245



>ref|XP_007037729.1| Calcium-dependent phosphotriesterase superfamily protein, putative 
[Theobroma cacao]
 gb|EOY22230.1| Calcium-dependent phosphotriesterase superfamily protein, putative 
[Theobroma cacao]
Length=334

 Score =   182 bits (462),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 115/310 (37%), Positives = 159/310 (51%), Gaps = 12/310 (4%)
 Frame = +3

Query  135   VDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYL--NGNFNDFATTSPYRTKEK  308
             V F  I    +A+GPE  A         TG+ DGRILKY      F DF   +P R+K  
Sbjct  32    VSFSKIQLPPNATGPEALAFVSGTGQFCTGIADGRILKYQGPTTGFVDFGFAAPNRSKSV  91

Query  309   CDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNF  488
             CDG +  N +  CGRPLGL   HA   LYV D F+G   V    GG  T L+ G +G  F
Sbjct  92    CDGTDTANPKPVCGRPLGLALHHATNRLYVCDAFFGF-GVLGPKGGQVTILSTGADGEPF  150

Query  489   SFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLS  668
              F +AV V + T DVYF D+  ++        + + D++GRL+KY     QVTVL   LS
Sbjct  151   RFCNAVDVHQRTGDVYFTDSSAVYDIRQIETAISTNDSTGRLMKYDFKTEQVTVLFRNLS  210

Query  669   GPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFW  848
             G  G+A D +  F+++SE+I  R IK ++ G KAN  + +  NL+  PDN+KR     FW
Sbjct  211   GAVGVAVDEEAKFVLVSEFIINRTIKIWLQGTKANKFEII--NLQPMPDNIKRTASENFW  268

Query  849   VALNipkpqqqppppipMTDSIAVNFDMDGNIVNTKNVTDTFPN-SFSGYQEYSDIAYVG  1025
             +A  + K   Q          I    +  G ++ T N    + N S S  QE++ + +V 
Sbjct  269   LAAAMIKQGTQSLV------PIGQRINASGTVLQTVNFERWYGNKSISEVQEFNGLLHVA  322

Query  1026  SLLSDFVAVY  1055
             S L +F+ VY
Sbjct  323   SRLVNFIGVY  332



>ref|XP_009597336.1| PREDICTED: strictosidine synthase 1-like [Nicotiana tomentosiformis]
Length=270

 Score =   180 bits (457),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 131/331 (40%), Positives = 174/331 (53%), Gaps = 66/331 (20%)
 Frame = +3

Query  72    MFWISILMFISSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKY  251
             MF + +L+F SS       P + F  +   Q   GP+ TA D    G YT V DGR+LKY
Sbjct  1     MFSMLLLIFSSSLAYSSQLPPLQFKKLQLPQQTVGPDSTAFDLKGNGPYTSVADGRVLKY  60

Query  252   LNGN--FNDFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLK  425
                N  F DFATTSP RTKE+CDG N  N+    GRPLG+ F +  G LY+TD+ YGLL 
Sbjct  61    QGPNIGFIDFATTSPLRTKEECDGTNDPNLLITRGRPLGVGFYYKTGDLYITDINYGLLS  120

Query  426   VERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTS  605
             V  +NGGLATQL +G++G  F+F DA+ VD++   +YFID+G IFR+             
Sbjct  121   VG-SNGGLATQLVSGIDGVPFAFADALDVDQIGGVIYFIDSGLIFRT-------------  166

Query  606   GRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQT  785
              R+ ++             L GP                              KAN+T+ 
Sbjct  167   -RIRRF------------WLKGP------------------------------KANSTE-  182

Query  786   VMENLEGYPDNVKRGTLGGFWVALNipkpqqqppppipMTDSIAVNFDMDGNIVNTKNVT  965
             +  NL G+PDN+KR  LG + VA+NI K QQ P        ++A   D+ GN+V + N+T
Sbjct  183   IFANLTGHPDNIKRTILGDYCVAVNIVKQQQTPTIF-----ALAQRVDVLGNVVLSLNLT  237

Query  966   DTFPNSFSGYQEYSDIAYVGS-LLSDFVAVY  1055
               +PNSFS  QEY    Y+GS  L +FV VY
Sbjct  238   AQYPNSFSEVQEYFGRLYIGSFFLENFVGVY  268



>emb|CAN77945.1| hypothetical protein VITISV_044021 [Vitis vinifera]
Length=361

 Score =   182 bits (463),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 119/311 (38%), Positives = 172/311 (55%), Gaps = 16/311 (5%)
 Frame = +3

Query  147   IILNLQHAS---GPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKC  311
             ++L L+  S   GPE  A D    G Y  V DGR+LK+L+ +  F DFA  SP R+K+ C
Sbjct  61    VVLRLKLPSPTVGPEAIAFDYTGAGPYASVADGRVLKWLDASAGFVDFAFISPSRSKKLC  120

Query  312   DGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFS  491
             DG     +   CGRPLGL F++    LY+ D ++GL  V   +G +  QLA    G  F 
Sbjct  121   DGSTDPALEPTCGRPLGLGFNYRTVDLYIADAYHGLNVVGPKDGRI-IQLATAAEGVPFL  179

Query  492   FIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSG  671
             F++AV VD+ T  VYF DA   F+   +   VQ+GD +GRL+KY     +VTVLL GL G
Sbjct  180   FLNAVDVDQETGIVYFTDASARFQRREFMLAVQTGDMTGRLMKYDPRTQEVTVLLRGLGG  239

Query  672   PAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWV  851
               G+    D +FI+++E++  RI ++++ GPKANT++  ++   G PDN+KR   G FWV
Sbjct  240   AGGVTISKDGSFILVTEFVTNRIQRFWLKGPKANTSELFLKP-PGTPDNIKRNVRGEFWV  298

Query  852   ALNipkpqqqppppipMTDSIAVNFDMDGNIVNTKNV-TDTFPNSFSGYQEYSDIAYVGS  1028
             A+NI       P  + +++        +G ++      T   P + S  QEY    Y+GS
Sbjct  299   AVNIGAGTAVLPSGLRLSE--------EGKVLQVVAFGTGDIPKTISEVQEYYRALYIGS  350

Query  1029  LLSDFVAVYTA  1061
             L   FV VY +
Sbjct  351   LALPFVGVYRS  361



>emb|CBI40188.3| unnamed protein product [Vitis vinifera]
Length=291

 Score =   181 bits (458),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 97/232 (42%), Positives = 138/232 (59%), Gaps = 4/232 (2%)
 Frame = +3

Query  171  SGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRAE  344
            SGPE  A D    G YTG++DGRILK+      + +FA TSP+R  + C+G     +   
Sbjct  55   SGPESIAFDCNGDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPKFCNGSINPAMEQV  114

Query  345  CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELT  524
            CGRPLGL F+ A   LY+ D ++GLL V  +NGG+A Q+A    G  F F +A+ +D+ T
Sbjct  115  CGRPLGLKFNEATCDLYIADAYFGLLVVG-HNGGVAKQIAISAEGVPFRFTNALDIDQNT  173

Query  525  ADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQT  704
              VYF D   IF+   Y   +Q+GD +GRLLKY     +VTVLL GLS   G+A   D+ 
Sbjct  174  GIVYFTDTSTIFQRWAYAIAMQTGDKTGRLLKYDPRTKEVTVLLRGLSFSNGVALSKDKD  233

Query  705  FIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            F++++E    ++ +Y++ G K+  + T  + L G PDN++R   G FWVA N
Sbjct  234  FVLVTETTTAKVTRYWLQGQKSQLSDTFTQ-LVGCPDNIQRNIHGEFWVAQN  284



>ref|XP_006494389.1| PREDICTED: strictosidine synthase 1-like [Citrus sinensis]
 gb|KDO41713.1| hypothetical protein CISIN_1g018242mg [Citrus sinensis]
Length=359

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 109/271 (40%), Positives = 160/271 (59%), Gaps = 15/271 (6%)
 Frame = +3

Query  63   SLTMFWISILMFISSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRI  242
            SL+    SI++F+   ++  S  GV   +   ++ A GPE  A D L +G YTGV+DGRI
Sbjct  4    SLSFIAKSIVIFL---FINSSTQGV---VQYQIEGAIGPESLAFDALGEGPYTGVSDGRI  57

Query  243  LKYLNGN--FNDFATTSPYRTKEKCDGINITNIRAE---CGRPLGLDFDHARGVLYVTDM  407
            +K+      +  FA TSP R  + C+G    +  A+   CGRPLGL F+   G LY+ D 
Sbjct  58   IKWHQDQRRWLHFARTSPNR--DGCEGAYEYDHAAKEHICGRPLGLCFNKTNGDLYIADA  115

Query  408  FYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIV  587
            ++GLLKV    GGLAT +A    G  F F +++ +D+ T  +YF D+   F+  N+  ++
Sbjct  116  YFGLLKVG-PEGGLATAVATQSEGIPFRFCNSLDIDQSTGIIYFTDSSSQFQRRNHISVI  174

Query  588  QSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPK  767
             SGD +GRL+KY  A  QVTVLL  LS P G+A   D  +I+++E    RI++Y++   K
Sbjct  175  LSGDKTGRLMKYDPATKQVTVLLGNLSFPNGVALSEDGNYILLAETTSCRILRYWLKTSK  234

Query  768  ANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            A T + V + L G+PDN+KR   GGFWV ++
Sbjct  235  AGTIEIVAQ-LPGFPDNIKRSPRGGFWVGIH  264



>ref|XP_006436612.1| hypothetical protein CICLE_v10033527mg [Citrus clementina]
 gb|ESR49852.1| hypothetical protein CICLE_v10033527mg [Citrus clementina]
Length=338

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 110/305 (36%), Positives = 165/305 (54%), Gaps = 21/305 (7%)
 Frame = +3

Query  174   GPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEK-CDGINITNIRAE  344
             GPE  A D   +G Y  V+DGRILK+ +    + +FA T+P+R   + CDG + T +   
Sbjct  46    GPESLAFDCNGEGPYASVSDGRILKWQDSKLGWTEFAITTPFRRLRRICDGTSSTILEPL  105

Query  345   CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELT  524
             CGRPLG+ F+     LY+ D ++GL+ V RN GG A QLA+      F F +A+ +D  T
Sbjct  106   CGRPLGIKFNPVTCDLYIADAYFGLMVVGRN-GGPAKQLASSAERIPFRFTNALDIDPNT  164

Query  525   ADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQT  704
               VYF D+   F+   Y  +++SGD SGRLLKY     QVTVL  GL+ P G+    D++
Sbjct  165   GVVYFTDSSMYFQRRQYPMLIESGDRSGRLLKYDPRNKQVTVLRRGLAFPNGVTLSNDKS  224

Query  705   FIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqp  884
             F++++E   RRI+++++ G     +      +  +PDN++    G FWVALN  +   + 
Sbjct  225   FLLVAESDSRRILRFWVEGESVVYSPQPFAQVAQFPDNIETDRNGDFWVALNTKRGNDK-  283

Query  885   pppipMTDSIAVNFD-MDGNIV-----NTKNVTDTFPNSFSGYQEYSDIAYVGSLLSDFV  1046
                   TD +AV  D  +GN++     N +N  D    S S  +E+    Y GS +  +V
Sbjct  284   ------TDLVAVKLDGSNGNVLDVLEGNKQNALD----SVSEVEEHGAYLYAGSPVQPYV  333

Query  1047  AVYTA  1061
              V  A
Sbjct  334   VVIKA  338



>ref|XP_010656040.1| PREDICTED: strictosidine synthase 1-like [Vitis vinifera]
Length=352

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/268 (38%), Positives = 150/268 (56%), Gaps = 4/268 (1%)
 Frame = +3

Query  63   SLTMFWISILMFISSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRI  242
             L+ F+I   + IS    ++S   + +  +      SGPE  A D    G YTG++DGRI
Sbjct  2    KLSQFFIFSFILISLFGCVNSHQALKYNTLELPSGVSGPESIAFDCNGDGPYTGISDGRI  61

Query  243  LKYLNGN--FNDFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYG  416
            LK+      + +FA TSP+R  + CDG     +   CGRPLGL F+ A   LY+ D ++G
Sbjct  62   LKWQGSKHGWKEFAITSPFRIPKFCDGSLNPAMEQVCGRPLGLKFNEATCDLYIADAYFG  121

Query  417  LLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSG  596
            LL V +N GG+A Q+A    G  F F +A+ +D+ T  VYF D   IF+   Y   +Q G
Sbjct  122  LLVVGQN-GGVAKQVAISAEGVPFRFTNALDIDQNTGVVYFTDTSTIFQRWAYAIAMQIG  180

Query  597  DTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANT  776
            D +GRLLKY     +VTVLL GLS   G+A   D+ F++++E    ++ +Y++   K+  
Sbjct  181  DKTGRLLKYDPRTKEVTVLLRGLSFSNGVALSEDKDFVLVTETTAAKVTRYWLQCQKSQL  240

Query  777  TQTVMENLEGYPDNVKRGTLGGFWVALN  860
            + T  + L G PDN++R   G FWVA N
Sbjct  241  SDTFTQ-LVGCPDNIQRNIHGEFWVAQN  267



>ref|XP_010658741.1| PREDICTED: strictosidine synthase 1-like [Vitis vinifera]
 emb|CBI40189.3| unnamed protein product [Vitis vinifera]
Length=322

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 97/232 (42%), Positives = 138/232 (59%), Gaps = 4/232 (2%)
 Frame = +3

Query  171  SGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRAE  344
            SGPE  A D    G YTG++DGRILK+      + +FA TSP+R  + C+G     +   
Sbjct  38   SGPESIAFDCNGDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPKFCNGSINPAMEQV  97

Query  345  CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELT  524
            CGRPLGL F+ A   LY+ D ++GLL V  +NGG+A Q+A    G  F F +A+ +D+ T
Sbjct  98   CGRPLGLKFNEATCDLYIADAYFGLLVVG-HNGGVAKQIAISAEGVPFRFTNALDIDQNT  156

Query  525  ADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQT  704
              VYF D   IF+   Y   +Q+GD +GRLLKY     +VTVLL GLS   G+A   D+ 
Sbjct  157  GIVYFTDTSTIFQRWAYAIAMQTGDKTGRLLKYDPRTKEVTVLLRGLSFSNGVALSKDKD  216

Query  705  FIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            F++++E    ++ +Y++ G K+  + T  + L G PDN++R   G FWVA N
Sbjct  217  FVLVTETTTAKVTRYWLRGQKSQLSDTFTQ-LVGCPDNIQRNIHGEFWVAQN  267



>emb|CBI35408.3| unnamed protein product [Vitis vinifera]
Length=653

 Score =   187 bits (474),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 108/298 (36%), Positives = 166/298 (56%), Gaps = 15/298 (5%)
 Frame = +3

Query  165   HASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIR  338
               SGPE  A D    G YTG++DGRILK+      + +FA TSP+R  + CDG     + 
Sbjct  367   RVSGPESIAFDCNGDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPKFCDGSLNPAME  426

Query  339   AECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDE  518
               CGRPLGL F+ A+  LY+ + ++GLL V RN GG+A Q+A    G  F F +A+ +D+
Sbjct  427   QVCGRPLGLKFNEAKCDLYIANAYFGLLVVGRN-GGVAKQVAISAEGVPFRFTNALDIDQ  485

Query  519   LTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDID  698
              T  VYF D   IF+   Y   +Q+GD +GRLLKY     +VTVLL GLS   G+A   D
Sbjct  486   NTGVVYFTDTSTIFQRWAYAIAMQTGDKTGRLLKYDPRSKEVTVLLRGLSFSNGVALSKD  545

Query  699   QTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqq  878
             + F++++E    ++ +Y++ G K+  + T  + L G PDN++R   G FWVA N     +
Sbjct  546   KDFVLVTETTTAKVTRYWLQGQKSQLSDTFTQ-LVGCPDNIQRNIHGEFWVAQNNCGRPE  604

Query  879   qppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSFSGYQEYSDIAYVGSLLSDFVAV  1052
                        I++  + +G I+  + +++ F    S  QE  +  ++GS+L  ++ +
Sbjct  605   LKV--------ISIKLNKEGKIM--EELSEDF-GPLSEVQEKDNDLWLGSVLLSYIGM  651


 Score =   184 bits (466),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 115/330 (35%), Positives = 173/330 (52%), Gaps = 15/330 (5%)
 Frame = +3

Query  63    SLTMFWISILMFISSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRI  242
              L+ F+I   + IS    ++S   + +  +      SGPE  A D    G YTG++DGRI
Sbjct  2     KLSQFFIFSFILISLFGCVNSHQALKYNTLELPSGVSGPESIAFDCNGDGPYTGISDGRI  61

Query  243   LKYLNGN--FNDFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYG  416
             LK+      + +FA TSP+R  + CDG     +   CGRPLGL F+ A   LY+ D ++G
Sbjct  62    LKWQGSKHGWKEFAITSPFRIPKFCDGSLNPAMEQVCGRPLGLKFNEATCDLYIADAYFG  121

Query  417   LLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSG  596
             LL V +N GG+A Q+A    G  F F +A+ +D+ T  VYF D   IF+   Y   +Q G
Sbjct  122   LLVVGQN-GGVAKQVAISAEGVPFRFTNALDIDQNTGVVYFTDTSTIFQRWAYAIAMQIG  180

Query  597   DTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANT  776
             D +GRLLKY     +VTVLL GLS   G+A   D+ F++++E    ++ +Y++   K+  
Sbjct  181   DKTGRLLKYDPRTKEVTVLLRGLSFSNGVALSEDKDFVLVTETTAAKVTRYWLQCQKSQL  240

Query  777   TQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqppppipMTDSIAVNFDMDGNIVNTK  956
             + T  + L G PDN++R   G FWVA N     +             V  + +G IV   
Sbjct  241   SDTFTQ-LVGCPDNIQRNIHGEFWVAQNNCGRPEVKVR--------PVRLNKEGKIVEEL  291

Query  957   NVTDTFPNSFSGYQEYSDIAYVGSLLSDFV  1046
             +V D  P   S  QE  +  ++GS++  ++
Sbjct  292   SV-DVGP--LSEVQEKDNSLWLGSVILSYI  318



>ref|XP_010428359.1| PREDICTED: strictosidine synthase 3-like isoform X1 [Camelina 
sativa]
 ref|XP_010428360.1| PREDICTED: strictosidine synthase 3-like isoform X2 [Camelina 
sativa]
Length=338

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 120/328 (37%), Positives = 168/328 (51%), Gaps = 14/328 (4%)
 Frame = +3

Query  72    MFWISILMFISSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKY  251
             +F   +++F S   V   Q     P+   +   +GPE  A DP   G YTGV+ G+ILKY
Sbjct  19    IFCCLLILFSSHSLVSALQTFQKIPLPPQI---TGPEAFAFDPQGGGPYTGVSGGKILKY  75

Query  252   LNGN--FNDFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLK  425
                   F +FA   P   K  C+    T +   CGRP+GL F+   G LY+ D + GL  
Sbjct  76    QGPTLGFTEFAYILPIANKSLCEKAIGTFLGNICGRPVGLAFNEKTGDLYIADAYLGLYV  135

Query  426   VERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTS  605
             V    GGLA +LA    G  F F+D + VD +T  VYF      F        V   DTS
Sbjct  136   VSYR-GGLAKRLADSAAGVPFRFLDGLDVDPVTGMVYFTSFSTRFGPSQLVLAVAVKDTS  194

Query  606   GRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQT  785
             GRL +Y      VTVLL+GLSG AG A   D  F+++ E++  RI++Y+I GPKANT + 
Sbjct  195   GRLFRYDPKTKTVTVLLSGLSGSAGCAVSSDGGFVLVGEFLRNRILRYWIKGPKANTFEI  254

Query  786   VMENLEGYPDNVKRGTLGGFWVALNipkpqqqppppipMTDSIAVNFDMDGNIVNTKNVT  965
              + ++ G PDN++R   G FWVA N  K    P      T+  AV    DG I+    + 
Sbjct  255   FVPSIPG-PDNIRRTESGDFWVASNSVKLIVVP------TEPSAVKISSDGEILQHMPLG  307

Query  966   DTFPNSF-SGYQEYSDIAYVGSLLSDFV  1046
             + + ++  S   EY ++ Y+G+L + FV
Sbjct  308   EYYGDTLVSEVNEYKNVVYLGTLTTTFV  335



>ref|XP_002273764.1| PREDICTED: strictosidine synthase 1 [Vitis vinifera]
Length=370

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 105/276 (38%), Positives = 158/276 (57%), Gaps = 12/276 (4%)
 Frame = +3

Query  57   MKSLTMFWISILMFISSPYVIH--SQPGVDFPI----ILNLQHASGPEDTAIDPLDQGIY  218
            + ++T+  ISI++ ++S ++    S PG    +    ++ +  A GPE  A DP  +G Y
Sbjct  7    LTAITLAAISIILAVNSNHLFKPPSIPGTHDLLHGSEVIQVTGAFGPESIAFDPKGEGPY  66

Query  219  TGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVL  392
            TGV DGR+LK+      + DFA T+  R  ++C       +   CGRPLGL FD   G L
Sbjct  67   TGVADGRVLKWEGDGRGWTDFAVTTSER--KECVRPFAPEMEHICGRPLGLRFDKKTGDL  124

Query  393  YVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLN  572
            Y+ D ++GL  VE  NGGLAT L   V GR   F + + +DE+   +YF D    F    
Sbjct  125  YIADAYFGLQVVE-PNGGLATPLVTEVEGRRLLFTNDMDIDEVEDVIYFTDTSTDFHRRQ  183

Query  573  YTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYF  752
            +   + SGD +GRL+KY  +  +VTVLL GL+   G+A   D++F++++E    +II+Y+
Sbjct  184  FMAALLSGDNTGRLMKYDKSSKEVTVLLRGLAFANGVAMSKDRSFVLVAETTTGKIIRYW  243

Query  753  ISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            + GP A  +    E + GYPDNV+R + G FWVAL+
Sbjct  244  LKGPNAGKSDVFAE-VPGYPDNVRRNSKGEFWVALH  278



>ref|XP_010471490.1| PREDICTED: strictosidine synthase 1-like [Camelina sativa]
Length=328

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 114/295 (39%), Positives = 156/295 (53%), Gaps = 11/295 (4%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYLNG--NFNDFATTSPYRTKEKCDGINITNIRAE  344
             +GPE  A DP   G YTGV+ G+ILKY      F +FA   P   K  C+    T +   
Sbjct  39    TGPEAFAFDPQGGGPYTGVSGGKILKYQGPALGFTEFAYILPVANKSLCEKAVGTFLGNI  98

Query  345   CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELT  524
             CGRP+GL F+   G LY+ D + GL  V    GGLA +LA    G  F F+D + VD +T
Sbjct  99    CGRPVGLAFNEKTGDLYIADAYLGLYVVSYR-GGLAKRLADSAAGIPFRFLDGLDVDPVT  157

Query  525   ADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQT  704
               VYF      F        V   DTSGRL +Y      VTVLL+GLSG AG A   D  
Sbjct  158   GMVYFTSFSTRFGPSQLVLAVAVKDTSGRLFRYDPKTKTVTVLLSGLSGSAGCAVSSDGG  217

Query  705   FIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqp  884
             F+++ E++  RI++Y+I GPKANT +  + ++ G PDN++R   G FWVA N  K    P
Sbjct  218   FVLVGEFLRNRILRYWIKGPKANTFEIFVPSIPG-PDNIRRTEGGDFWVASNSVKLIVVP  276

Query  885   pppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSF-SGYQEYSDIAYVGSLLSDFV  1046
                   T+  AV    DG I+    + + + ++  S   EY ++ Y+G+L + FV
Sbjct  277   ------TEPSAVKISSDGEILQHMPLGEYYGDTLVSEVHEYKNVVYLGTLTTTFV  325



>gb|KEH23600.1| strictosidine synthase family protein [Medicago truncatula]
Length=325

 Score =   180 bits (456),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 114/334 (34%), Positives = 172/334 (51%), Gaps = 25/334 (7%)
 Frame = +3

Query  66    LTMFWISILMFISSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRIL  245
             LT+F   I    S   V  S   +    +L++  A GPE    D    G YTGV DGRIL
Sbjct  13    LTLF--CIFTLFSPVLVAGSMHNLHSARLLHVTRAIGPESLVFDSHGGGPYTGVADGRIL  70

Query  246   KYLNGN--FNDFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGL  419
             K+      + +FA TS  R++  C       +   CGRPLGL FD   G LY+ D + GL
Sbjct  71    KWKGKKRGWTEFAVTSSNRSQ--CVRPFAPKLEHICGRPLGLRFDKKNGDLYIADAYLGL  128

Query  420   LKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGD  599
              KV    GGLATQ+A    G  F F + + +DE    +YF D+  ++    YT ++ SGD
Sbjct  129   -KVVGAAGGLATQVATEAEGHPFHFTNDLDIDENEGVIYFTDSSTVYERTQYTLLLVSGD  187

Query  600   TSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTT  779
              +GRL+KY  +  +V VLL GL+ P G+A   D +F++++E    RI++ ++ GPKA   
Sbjct  188   KTGRLMKYDKSTKEVKVLLRGLAFPNGVALSKDGSFLLVAETSNCRILRLWLHGPKAGKV  247

Query  780   QTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqppppipMTDSIAVNFDMDGNIVNT-K  956
              T + +L G+PDN++R + G FWVAL                 S AV    +G I+ T +
Sbjct  248   STFV-DLPGFPDNIRRNSYGQFWVALY----------------SSAVKLSDEGEILETLE  290

Query  957   NVTDTFPNSFSGYQEYSDIAYVGSLLSDFVAVYT  1058
             +       + S  +E     ++ S+++ ++ VY+
Sbjct  291   DFERKTMKNISEVEEKDGKLWIASIVTPYIGVYS  324



>ref|XP_003531955.1| PREDICTED: strictosidine synthase 3-like [Glycine max]
 gb|KHN37142.1| Strictosidine synthase [Glycine soja]
Length=349

 Score =   180 bits (457),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 114/315 (36%), Positives = 165/315 (52%), Gaps = 13/315 (4%)
 Frame = +3

Query  153   LNLQHAS-GPEDTAIDPLDQGIYTGVTDGRILKY--LNGNFNDFATTSPYRTKEKCDGIN  323
             L+L H+  G E  A D   +G Y GV+DGRILK+      + DFA TSP+R K+ CDG+ 
Sbjct  36    LDLPHSVFGSESVAFDCHGKGPYVGVSDGRILKWQETKREWIDFAVTSPHRNKKLCDGLQ  95

Query  324   ITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDA  503
                + + CGRPLGL F+     LY+ D ++GLL V   +GG+A QLA    G  F F +A
Sbjct  96    NDKMESMCGRPLGLKFNTVTCELYIADAYFGLLVVG-PSGGVAKQLATSAEGVPFRFTNA  154

Query  504   VAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGM  683
             + +D  T +VYF D+  +F+   Y  I+ SGD +GRLLKY  +   V VL+ GL+ P G+
Sbjct  155   LDIDTKTGEVYFTDSSILFQRRVYISIILSGDRTGRLLKYVPSTQSVHVLVKGLAFPNGV  214

Query  684   ATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTV--MENLEGYPDNVKRGTLGGFWVAL  857
             A   D +FI+++E    +I+K  +   K N    +     +   PDN+KR   G FWVA 
Sbjct  215   ALSKDNSFILVAESTTFKILKIQLRDSKTNNNNNIEPFAQVPRSPDNIKRNNKGEFWVAQ  274

Query  858   NipkpqqqppppipMT------DSIAVNFDMDGN-IVNTKNVTDTFPNSFSGYQEYSDIA  1016
             N  +   Q       T      D +A+ FD  G  IV          +S S  +E+    
Sbjct  275   NSGRGLIQKLGNEIETTLPWNADPVAIKFDEKGRAIVVLDGEYGRQLDSVSEVEEHEGSL  334

Query  1017  YVGSLLSDFVAVYTA  1061
             ++GS +  F+ +  A
Sbjct  335   WIGSAVQPFIGLIKA  349



>emb|CDP06823.1| unnamed protein product [Coffea canephora]
Length=335

 Score =   180 bits (456),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 128/342 (37%), Positives = 176/342 (51%), Gaps = 26/342 (8%)
 Frame = +3

Query  66    LTMFWISILMFISSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRIL  245
             + +F++  L F   PY   +   +D P       + GPE  A+D  +QG Y G++DGRIL
Sbjct  8     IVLFYLPKL-FALDPYTHFTS--LDLP-----PKSIGPESIALDRFNQGPYIGISDGRIL  59

Query  246   KYLNGN--FNDFATTSPYRTK------EKCDGINITNIRAECGRPLGLDFDHARGVLYVT  401
             KY   N  F  FA TSP R +      E CD +   N+   CGRP G  F++  GVLY+ 
Sbjct  60    KYKGPNVGFVLFAYTSPNRYERMKGFYELCDDVTDPNLGPTCGRPFGFSFNNFNGVLYIV  119

Query  402   DMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQ  581
             D   GL KV    GGLAT +A    G  F F++ + VD+LT DVY   A   F   N  Q
Sbjct  120   DALLGLFKVGPE-GGLATLIAKSAGGVPFKFLNGIDVDQLTGDVYLTVASQTFDLRNVIQ  178

Query  582   IVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISG  761
                  D++GRL+ Y+    ++ VLL+GLS PAG     D+TF++ SE+  + + KY ++G
Sbjct  179   GNYVLDSTGRLITYNPITKELKVLLDGLSIPAGPVVSTDRTFVLFSEFSTKTVKKYCLTG  238

Query  762   PKANTTQTVMENLEGYPDNVKRGT-LGGFWVALNipkpqqqppppipMTDSIAVNFDMDG  938
              KANTT+ ++ NL G P  +KR    G FWVA+N    QQ               FD  G
Sbjct  239   LKANTTEALL-NLPGNPVKIKRAPEPGKFWVAVNEIVQQQPRN-----ATPFGYKFDSFG  292

Query  939   NIVNTKNVTDTFPNSFSGY-QEYS-DIAYVGSLLSDFVAVYT  1058
              I+  KN+ D + N      QEY+     VGS    FV +Y+
Sbjct  293   EILLIKNLEDHYSNIIVNLVQEYNGGRVVVGSREVKFVGMYS  334



>ref|XP_002273580.1| PREDICTED: strictosidine synthase 3 [Vitis vinifera]
 emb|CBI35398.3| unnamed protein product [Vitis vinifera]
Length=340

 Score =   180 bits (456),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 112/295 (38%), Positives = 163/295 (55%), Gaps = 10/295 (3%)
 Frame = +3

Query  174   GPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRAEC  347
             GPE    D   +G YTGV+DGRILK+      + DFA TSP RT   CDG++ T+    C
Sbjct  47    GPETLVFDCNGEGPYTGVSDGRILKWHGSEVGWKDFAVTSPLRTSRLCDGLSDTSAEHVC  106

Query  348   GRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTA  527
             GRPLGL F+ A   LY+ D ++GLL V R  GGLA QLA    G  F F +AV +D+ T 
Sbjct  107   GRPLGLKFNQATCDLYIADAYFGLLVVGRK-GGLARQLATSAEGIPFLFANAVDIDQKTG  165

Query  528   DVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTF  707
              VYF D    FR   +   ++SGD +GRL++Y     +V VLL  L    G+A   + +F
Sbjct  166   TVYFTDTSTRFRRWEFGIAMESGDNTGRLMRYDPKTKKVKVLLKHLFFANGVALSRNGSF  225

Query  708   IMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqpp  887
             ++++E    R++++++ GP++  T+ V   L+G PDN++R   G FWVA N   P+    
Sbjct  226   LLVTETNANRVLRFWLEGPRSQ-TRDVFAKLDGCPDNIERNPKGEFWVAQN---PKFDSI  281

Query  888   ppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSFSGYQEYSDIAYVGSLLSDFVAV  1052
                  T+  A+  D +G ++   N  + F  S S   E  D  ++GS+L   V +
Sbjct  282   GTPLQTNISALKLDEEGKVLRVLN--EEF-GSLSDVIEKDDCMWLGSVLQSHVGM  333



>emb|CAN63240.1| hypothetical protein VITISV_034462 [Vitis vinifera]
Length=340

 Score =   180 bits (456),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 112/295 (38%), Positives = 163/295 (55%), Gaps = 10/295 (3%)
 Frame = +3

Query  174   GPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRAEC  347
             GPE    D   +G YTGV+DGRILK+      + DFA TSP RT   CDG++ T+    C
Sbjct  47    GPETLVFDCBGEGPYTGVSDGRILKWHGSEVGWKDFAVTSPLRTSRLCDGLSDTSAEHVC  106

Query  348   GRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTA  527
             GRPLGL F+ A   LY+ D ++GLL V R  GGLA QLA    G  F F +AV +D+ T 
Sbjct  107   GRPLGLKFNQATCDLYIADAYFGLLVVGRK-GGLARQLATSAEGIPFLFANAVDIDQKTG  165

Query  528   DVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTF  707
              VYF D    FR   +   ++SGD +GRL++Y     +V VLL  L    G+A   + +F
Sbjct  166   TVYFTDTSTRFRRWEFGIAMESGDNTGRLMRYDPKTKKVKVLLKHLFFANGVALSRNGSF  225

Query  708   IMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqpp  887
             ++++E    R++++++ GP++  T+ V   L+G PDN++R   G FWVA N   P+    
Sbjct  226   LLVTETNANRVLRFWLEGPRSQ-TRDVFAKLDGCPDNIERNPKGEFWVAQN---PKFDSI  281

Query  888   ppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSFSGYQEYSDIAYVGSLLSDFVAV  1052
                  T+  A+  D +G ++   N  + F  S S   E  D  ++GS+L   V +
Sbjct  282   GTPLQTNISALKLDEEGKVLRVLN--EEF-GSLSDVIEKDDCMWLGSVLQSHVGM  333



>ref|XP_007045664.1| Calcium-dependent phosphotriesterase superfamily protein, putative 
[Theobroma cacao]
 gb|EOY01496.1| Calcium-dependent phosphotriesterase superfamily protein, putative 
[Theobroma cacao]
Length=376

 Score =   181 bits (458),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 109/305 (36%), Positives = 162/305 (53%), Gaps = 7/305 (2%)
 Frame = +3

Query  153   LNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINI  326
             L+L   +GPE  A D  +QG Y GV+DGRILK+   +  + +FA  SP R ++ CDG   
Sbjct  71    LDLPQVTGPESIAFDCKNQGPYVGVSDGRILKWHGPHLGWKEFAIPSPVRDRKLCDGSTN  130

Query  327   TNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAV  506
              N+   CGRPLGL F++A   LY+ D ++GLL V   NGG+A QLA    G  F F + +
Sbjct  131   PNLEPICGRPLGLKFNYATCDLYIADAYFGLLVVG-PNGGVAQQLATSAEGVPFRFTNGL  189

Query  507   AVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMA  686
              +D  T  VYF D+   F+   +  +  + D SGRLLKY      VTV+  GL  P G+A
Sbjct  190   DIDSKTGMVYFTDSSIFFQRRYHLLLRITSDRSGRLLKYDPRTKDVTVMSRGLMFPNGVA  249

Query  687   TDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNi-  863
              + D ++++++E    RI+K+ + G   +    +   L   PDN++R   G FWV LN  
Sbjct  250   LNADNSYLLVAESTTMRILKFRLEGEANSYIPELFVQLSRTPDNIQRNKNGEFWVGLNSG  309

Query  864   pkpqqqppppipMTDSIAVNFDMDGNIVNT--KNVTDTFPNSFSGYQEYSDIAYVGSLLS  1037
                + Q      + D + V  + +G I+     N   TF NS S  QE +   Y+GS+  
Sbjct  310   RSGRIQDDAYAKLPDPVGVKLNQEGKILKQLDGNGGITF-NSISEVQELNGTLYIGSVTK  368

Query  1038  DFVAV  1052
              ++ +
Sbjct  369   PYLGI  373



>ref|XP_010412433.1| PREDICTED: strictosidine synthase 1-like [Camelina sativa]
Length=340

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 113/318 (36%), Positives = 162/318 (51%), Gaps = 13/318 (4%)
 Frame = +3

Query  108   PYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFAT  281
             P +  S+       ++NL  ASGPE  A DP  +G Y GV DGR+LK+   +  + DFA 
Sbjct  32    PKIPASRDVFSLAKVVNLAGASGPESIAFDPAGEGPYVGVADGRVLKWRGKSLGWTDFAY  91

Query  282   TSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQL  461
             TS  R  + C       +   CGRPLGL F    G LY+ D ++GLL V    GGLA  L
Sbjct  92    TSANR--QFCVRPFAPLLEPVCGRPLGLRFHKKTGDLYIADAYFGLLIVG-PAGGLAKPL  148

Query  462   AAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQ  641
                  G+ F F + + +D+    +YF DA   F+   Y     +GD +GR +KY  +  +
Sbjct  149   VTEAEGQPFRFTNDLDIDDQNDVIYFTDASSKFQRWEYIGSFLTGDKTGRFMKYDRSSKK  208

Query  642   VTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNV  821
              TVLL+GLS   G+A   DQ+F++++E    +I++ ++SGPKA  TQ V   L GYPDN+
Sbjct  209   ATVLLHGLSFANGVALSKDQSFVLVAETTNCKILRLWLSGPKAG-TQDVFVVLPGYPDNI  267

Query  822   KRGTLGGFWVALNipkpqqqppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSFSGYQE  1001
             +R + G FWVALN             +  + AV     G I+             S  +E
Sbjct  268   RRNSKGEFWVALN-------SLFNEEIRYTKAVKLSESGKILEVLGDKAKRLRFISDVEE  320

Query  1002  YSDIAYVGSLLSDFVAVY  1055
                  ++GS ++ FV VY
Sbjct  321   KDGKLWIGSSVAPFVGVY  338



>emb|CBI24410.3| unnamed protein product [Vitis vinifera]
Length=328

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 114/305 (37%), Positives = 169/305 (55%), Gaps = 10/305 (3%)
 Frame = +3

Query  159   LQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGNFNDFATTSPYRTKEKCDGIN--ITN  332
             L    GPE  A DPL +G YTGV DGRIL +    ++DFA TSP R+ E CD     ++ 
Sbjct  25    LNQVQGPESVAFDPLGRGPYTGVADGRILFWNGEAWSDFAYTSPNRS-ELCDPKPSPLSY  83

Query  333   IRAE--CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAV  506
             ++ E  CGRPLGL F+   G LY+ D + GL+KV    GGLAT L    +G    F + +
Sbjct  84    LKNEHICGRPLGLRFNKRTGDLYIADSYLGLMKVG-PEGGLATSLVTEADGVPLRFTNDL  142

Query  507   AVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMA  686
              +D+   ++YF D+   ++  N+ Q+V S + SGRLLKY     + TVLL GL  P G++
Sbjct  143   DIDD-AGNIYFTDSSSKYQRRNFMQLVFSSEDSGRLLKYDPLTKETTVLLRGLQFPNGVS  201

Query  687   TDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNip  866
                D +F+++ E    R++KY++ G KA T++ V   L GYPDNV+    G FWVA++  
Sbjct  202   LSKDGSFLVLCEGSPGRLVKYWLKGDKAGTSE-VFAILPGYPDNVRTNEKGEFWVAIHCR  260

Query  867   kpqqqppppi-pMTDSIAVNFDMDGNIVNT-KNVTDTFPNSFSGYQEYSDIAYVGSLLSD  1040
             +   Q    I     ++ V +  +G +V   ++       + S  +E     ++GS+L  
Sbjct  261   RTMYQYLLHIGGRLHAVVVKYSPEGKLVKILEDSEGKVVRAVSEVEEREGKLWMGSVLMP  320

Query  1041  FVAVY  1055
             FVAVY
Sbjct  321   FVAVY  325



>ref|XP_004493427.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Cicer arietinum]
Length=383

 Score =   180 bits (457),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/245 (38%), Positives = 146/245 (60%), Gaps = 6/245 (2%)
 Frame = +3

Query  138  DFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKY--LNGNFNDFATTSPYRTK-EK  308
             +  ++ +++  GPE  A DP  +G YTGV+DGRI+K+  +  ++ +FA TS +R   ++
Sbjct  42   QYETVIPIENGLGPESFAFDPHGEGPYTGVSDGRIIKWHRMRKSWTNFAATSSHRDNVDE  101

Query  309  CDGINITNIRAE--CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGR  482
            C G +  + + E  CGRPLGL F+ A G LYV D + GL+ ++ N G     ++  V G 
Sbjct  102  CGGPHKEHPKKEHICGRPLGLCFNVASGELYVADAYMGLVAIKPNGGTARKVISHEVEGE  161

Query  483  NFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNG  662
               F +++ +D+LT  VYF  +   ++  NY  ++ SG+ SGRL+KY    GQ++VLL  
Sbjct  162  PLPFTNSLDIDQLTGTVYFTSSSSKYQRRNYVSVIVSGEKSGRLIKYEPESGQISVLLKN  221

Query  663  LSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGG  842
            L+   G+A   D  +I+I E    R+++Y++   KA T + V  NL G+PDN+KR   GG
Sbjct  222  LTFANGVALSKDGEYILIVETTNCRVLRYWLETSKAGTLE-VFANLPGFPDNIKRSPRGG  280

Query  843  FWVAL  857
            FWV +
Sbjct  281  FWVGI  285



>ref|XP_004308613.1| PREDICTED: strictosidine synthase-like [Fragaria vesca subsp. 
vesca]
Length=321

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 110/298 (37%), Positives = 156/298 (52%), Gaps = 21/298 (7%)
 Frame = +3

Query  165   HASGPEDTAIDPLDQGIYTGVTDGRILKYLNGNF--NDFATTSPYRTKEKCDGINITNIR  338
             H   PE  A D  +   Y GV DGRI K+L   F   +F  T+P R +E CD        
Sbjct  38    HVPQPESIAFD-CNGAPYVGVADGRIFKWLGRPFGWTEFTVTAPNRPREVCDLSTSKGSE  96

Query  339   AECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDE  518
               CGRPLGL FD     LY+ D ++GLLK   N GG+A  LA    G  F F++ V VD+
Sbjct  97    PICGRPLGLKFDLNTCELYIADAYFGLLKTGPN-GGVAQTLATSAEGFPFRFLNGVDVDQ  155

Query  519   LTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDID  698
              T  VYF D   I++  N+   V +GD +GRL+ Y  +   VTVLL+GL+   G+A   D
Sbjct  156   ETGMVYFTDTSAIYQRRNWELSVSTGDKTGRLMLYDPSTKNVTVLLHGLAFANGVALSKD  215

Query  699   QTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqq  878
               F+++++   + I++Y++ GP+ANT  T   NL+G PDN+ R   G FWVA N     +
Sbjct  216   GDFVLVTQTTAKNILRYWLRGPRANTVDTFF-NLQGAPDNINRNLNGEFWVAENSAGRGK  274

Query  879   qppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSFSGYQEYSDIAYVGSLLSDFVAV  1052
                         AV  D  GN +   +V D   N  S  ++     ++GS++++FV V
Sbjct  275   ------------AVKLDAQGNFL---DVVDGL-NPVSHVEQRHGNLWIGSVVNNFVGV  316



>gb|KDP29321.1| hypothetical protein JCGZ_18242 [Jatropha curcas]
Length=319

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 122/319 (38%), Positives = 164/319 (51%), Gaps = 21/319 (7%)
 Frame = +3

Query  153   LNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINI  326
             L+L    GPE  A D    G Y GV+DGRILK+   N  + DFA +SP R K++CDG   
Sbjct  7     LDLPGVIGPESLAFDCNGNGPYVGVSDGRILKWHQSNQSWLDFAVSSPNRDKKECDGSTD  66

Query  327   TNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAV  506
              N   ECGR LGL F+ A   LY+ D +YGLL V    GG+ TQLAA   G  F F + +
Sbjct  67    PNKEPECGRALGLKFNPATCDLYIADAYYGLLVVGPM-GGVPTQLAASAEGVPFRFANGL  125

Query  507   AVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMA  686
              +D  T  VYF D+   F+   Y + + S D SGRLLKY     +VTVL  GL+ P G+A
Sbjct  126   DIDPKTGAVYFTDSSIFFQRREYLRAILSSDRSGRLLKYDPNSKKVTVLFKGLAFPNGVA  185

Query  687   TDIDQTFIMISEYIGRRIIKY-FISGPKANTTQ-TVMENLEGYPDNVKRGTLGGFWVALN  860
                D +F++++E    RI+K+  ++    N  Q  V   L   PDN+KR   G FWVALN
Sbjct  186   LSNDNSFVLVAEEGMLRILKFKLLNNDNHNEMQEEVFAELGRLPDNIKRNDNGEFWVALN  245

Query  861   ipkpqqqppppipM------TDSIAVNFDMDGNIV-----NTKNVTDTFPNSFSGYQEYS  1007
               + + Q      +       D++ + F  DG +V     N   + D    S S   EY 
Sbjct  246   SGRGKIQKYKEEMINEGWVFNDTVGIKFSEDGKVVKMLDGNGGEILD----SVSEVAEYD  301

Query  1008  DIAYVGSLLSDFVAVYTAI  1064
                + GS +  +V  YT I
Sbjct  302   GGLWFGSSVQPYVG-YTKI  319



>ref|XP_009106057.1| PREDICTED: strictosidine synthase 1-like [Brassica rapa]
 emb|CDX96505.1| BnaA07g31160D [Brassica napus]
Length=328

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 116/323 (36%), Positives = 165/323 (51%), Gaps = 14/323 (4%)
 Frame = +3

Query  87    ILMFISSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN-  263
             +++F S  +V   Q     P+      ASGPE  A D    G YTGV+ G+ILKY     
Sbjct  14    LILFTSHSFVSALQTFQKIPLP---PRASGPEAFAFDSHGGGPYTGVSGGKILKYQGPKL  70

Query  264   -FNDFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNN  440
              F +FA  +    K  CD    T +   CGRP+GL F+   G LY+ D F GL  V R  
Sbjct  71    GFTEFAYITSIANKSLCDKAVGTFLGNICGRPVGLAFNEITGDLYIADAFLGLYLVSRR-  129

Query  441   GGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLK  620
             GG A +LA    G  F F+D + VD +T  VYF      F        V   D +GR  +
Sbjct  130   GGQAKRLADSAGGSPFKFLDGLDVDPVTGSVYFTSFSTRFGPSQLVLAVAVNDATGRFFR  189

Query  621   YSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENL  800
             Y      VTVLL+GLSG AG A   D  F+++ E++  RI++Y+I GPKANT +  + ++
Sbjct  190   YDPKTKSVTVLLSGLSGSAGCAVSSDGEFVLVGEFLRNRILRYWIKGPKANTWEIFVPSI  249

Query  801   EGYPDNVKRGTLGGFWVALNipkpqqqppppipMTDSIAVNFDMDGNIVNTKNVTDTFPN  980
              G PDN+++   G FW+A N  K    P      T+  AV  +  G I+   ++ + + +
Sbjct  250   PG-PDNIRKTDGGDFWIASNSVKLIVVP------TEPSAVKVNAGGEIIRRMSLGEYYGD  302

Query  981   SF-SGYQEYSDIAYVGSLLSDFV  1046
             +  S   EY  + YVG+L ++FV
Sbjct  303   TLVSEVNEYKSVVYVGTLTTNFV  325



>ref|XP_006436697.1| hypothetical protein CICLE_v10033295mg [Citrus clementina]
 gb|ESR49937.1| hypothetical protein CICLE_v10033295mg [Citrus clementina]
Length=338

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 110/305 (36%), Positives = 165/305 (54%), Gaps = 21/305 (7%)
 Frame = +3

Query  174   GPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEK-CDGINITNIRAE  344
             GPE  A D   +G Y GV+DGRILK+ +    + +FA T+P+R   + CDG + T +   
Sbjct  46    GPESLAFDCNGKGPYAGVSDGRILKWQDSKLGWTEFAITTPFRRLRRICDGTSSTILEPL  105

Query  345   CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELT  524
             CGRPLG+ F+     LY+ D ++GL+ V RN GG A QLA+      F F +A+ +D  T
Sbjct  106   CGRPLGIKFNPVTCDLYIADAYFGLMVVGRN-GGPAKQLASSAERIPFRFTNALDIDPNT  164

Query  525   ADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQT  704
               VYF D+   F+   Y  +++SGD SGRLLKY     QVTVL  GL+ P G+    D++
Sbjct  165   GVVYFTDSSMYFQRRQYPMLIESGDRSGRLLKYDPRNKQVTVLRRGLAFPNGVTLSNDKS  224

Query  705   FIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqp  884
             F++++E   R I+++++ G     +      +  +PDN++    G FWVALN  +   + 
Sbjct  225   FLLVAESDSRTILRFWVEGESVIYSPQPFAQVAQFPDNIETDRNGDFWVALNTKRGNDK-  283

Query  885   pppipMTDSIAVNFD-MDGNIV-----NTKNVTDTFPNSFSGYQEYSDIAYVGSLLSDFV  1046
                   TD +AV  D  +GN++     N +N  D    S S  +E+    Y GS +  +V
Sbjct  284   ------TDLVAVKLDGSNGNVLDVLEGNKQNDLD----SVSEVEEHGGYLYAGSPVQPYV  333

Query  1047  AVYTA  1061
              V  A
Sbjct  334   VVIKA  338



>ref|XP_007202861.1| hypothetical protein PRUPE_ppa015510mg, partial [Prunus persica]
 gb|EMJ04060.1| hypothetical protein PRUPE_ppa015510mg, partial [Prunus persica]
Length=334

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/243 (41%), Positives = 143/243 (59%), Gaps = 7/243 (3%)
 Frame = +3

Query  141  FPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGNFN--DFATTSPYRTKEKCD  314
            F ++  ++ A GPE    DPL  G YTG++DGRI+K+     +  +FA TSP R  + C+
Sbjct  4    FEVVPIVEDAVGPESFVFDPLGGGPYTGISDGRIVKWDQDKHHWINFAVTSPNR--DGCE  61

Query  315  GINITNIRAE-CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFS  491
            G +  +     CGRPLGL F+   G LYV D + GLL V    GGLAT++    +G  F 
Sbjct  62   GSHEHDKTEHICGRPLGLCFNETSGDLYVADAYMGLLIVG-PQGGLATEVVTRAHGIPFG  120

Query  492  FIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSG  671
            F +A+ +D+    VYF D+   ++  NY  ++ SGD +GRL+KY     QV VLL  LS 
Sbjct  121  FTNALDIDQEPGAVYFTDSSSQYQRRNYISVILSGDKTGRLMKYDPESKQVQVLLGNLSF  180

Query  672  PAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWV  851
            P G+A   +  FI+++E    RI++Y++  PKA T Q V   L G+PDN+KR   GGFWV
Sbjct  181  PNGVALSKNGDFILLAETTHCRIMRYWLKTPKAGTFQ-VFAQLPGFPDNIKRSPRGGFWV  239

Query  852  ALN  860
             ++
Sbjct  240  GIH  242



>ref|XP_011027270.1| PREDICTED: strictosidine synthase 3-like isoform X1 [Populus 
euphratica]
Length=389

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/235 (43%), Positives = 139/235 (59%), Gaps = 9/235 (4%)
 Frame = +3

Query  168  ASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN---FNDFATTSPYRTKEKCDGI-NITNI  335
            A GPE  A D L QG YT ++DGRI+K+  GN   + DFA  SP R  + C G  +    
Sbjct  68   AFGPESFAFDSLGQGPYTSLSDGRIIKW-QGNRKGWTDFAVASPNR--DGCGGPQDHQQT  124

Query  336  RAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVD  515
               CGRPLGL FD   G LY+ D + GLL+V    GGLAT++     G   SF + + +D
Sbjct  125  EHICGRPLGLCFDETHGDLYIADAYMGLLRVG-AQGGLATKIVTHAQGIPLSFTNGLDID  183

Query  516  ELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDI  695
            +    +YF D+   ++  +Y  +V SGD SGRL+KY     QV+VLL+ L+ P G+A   
Sbjct  184  QSNGAIYFTDSSSQYQRRHYLSVVLSGDKSGRLMKYDPVNKQVSVLLSNLTFPNGVALSK  243

Query  696  DQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            D TFI+++E    RI++Y+I   KA T + V   L+G+PDN+KR   GG+WV LN
Sbjct  244  DGTFILLAETTRCRILRYWIKTSKAGTVE-VFAQLQGFPDNIKRSPRGGYWVGLN  297



>emb|CDP14992.1| unnamed protein product [Coffea canephora]
Length=310

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 108/257 (42%), Positives = 150/257 (58%), Gaps = 10/257 (4%)
 Frame = +3

Query  291   YRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAG  470
             +RTK+ CDG N ++  + CGRPLGL F+   G LYV D  +G L V    GGLATQLA G
Sbjct  60    FRTKQLCDGAN-SSAASTCGRPLGLGFNFKTGELYVLDFKFGFLVVSPG-GGLATQLATG  117

Query  471   VNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTV  650
             +NG  F F +A+ +D+    VYF DAG IF S N + I+QS DTSG+L KY A    +++
Sbjct  118   LNGTTFVFPNALDIDQANQIVYFTDAGAIFLSRNLSTIIQSNDTSGKLYKYDARTKTLSL  177

Query  651   LLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRG  830
             +LNGLSGP G+A      +++I EYI  R+ +Y+  GPKA +++ ++ NL G PDN+KR 
Sbjct  178   MLNGLSGPLGVAVSKCGAYVLIDEYIASRVRRYWARGPKAGSSE-ILVNLPGSPDNIKRT  236

Query  831   TLGGFWVALNipkpqqqppppipMTDSIAVNFDMDGNIVN-TKNVTDTFPNSF-SGYQEY  1004
                 F+ A+ I             T S+    + D  IV  T N+T  + N+  S  QE+
Sbjct  237   ISDDFFAAVTILNRHTFQT-----TSSLGQRINGDLGIVEATVNLTAQYTNNLISEVQEF  291

Query  1005  SDIAYVGSLLSDFVAVY  1055
                 Y+GS  + FV VY
Sbjct  292   LGKLYIGSSTASFVGVY  308



>emb|CDP21322.1| unnamed protein product [Coffea canephora]
Length=384

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 110/297 (37%), Positives = 160/297 (54%), Gaps = 10/297 (3%)
 Frame = +3

Query  174   GPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRAEC  347
             GPE  A D    G YT V DGR+LKY      F DF   S +  ++ CDG N T+I   C
Sbjct  92    GPESFAFDWAGGGPYTSVADGRVLKYEGPKVGFVDFQVLSSHMPRKFCDGTNRTDISQIC  151

Query  348   GRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTA  527
             GRP GL F +  G LY+ D   GL+ V    GG   QLA+   G  F F D + VD+ T 
Sbjct  152   GRPTGLGFYYKTGELYLADGGLGLV-VIGPKGGPGKQLASAAGGLRFGFPDGLEVDQRTG  210

Query  528   DVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTF  707
              VYF DA   +      ++V + D +GRLLKY     +VTVLL GL+G AG+A   D ++
Sbjct  211   IVYFTDASSRYNISQIAEVVANRDQTGRLLKYDPRTKKVTVLLRGLAGAAGVAISEDGSY  270

Query  708   IMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqpp  887
             ++++E++  R+ KY++ GP A+T+  V+ NL G PD +KR + G +W+A+ +   +  P 
Sbjct  271   LLVTEFVKARVSKYWLKGPLAHTSH-VIANLSGAPDKIKRNSAGDYWIAVTVQSQKPTPT  329

Query  888   ppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSF-SGYQEYSDIAYVGSLLSDFVAVY  1055
               +          + +G I+ T   +  F +S  +  QEY    Y+GS+   +V VY
Sbjct  330   LQLQ-----GQKINGNGKILETITFSPGFNSSLITEVQEYKRKLYLGSIYIGYVGVY  381



>ref|XP_006301516.1| hypothetical protein CARUB_v10021942mg, partial [Capsella rubella]
 gb|EOA34414.1| hypothetical protein CARUB_v10021942mg, partial [Capsella rubella]
Length=361

 Score =   178 bits (452),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 123/339 (36%), Positives = 171/339 (50%), Gaps = 19/339 (6%)
 Frame = +3

Query  66    LTMFWIS------ILMFISSPYVIHSQPGV--DFPIILNLQHASGPEDTAIDPLDQGIYT  221
             +T+ W+S      IL F+   +  HS       F  I   Q  +GPE  A D    G YT
Sbjct  29    VTLVWVSQFDVLSILCFLLILFSSHSLVSALQTFQKIPLPQRITGPEAFAFDSHGGGPYT  88

Query  222   GVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLY  395
             GV+ G+ILKY      F +FA   P   K  C+    T + + CGRP+GL F+   G LY
Sbjct  89    GVSGGKILKYQGPTLGFTEFAYILPIANKSLCEKAVGTFLGSICGRPVGLAFNEKTGDLY  148

Query  396   VTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNY  575
             + D + GL  V    GGLA +LA    G  F F+D + VD +T  VYF      F     
Sbjct  149   IADAYLGLYVVSYR-GGLAKRLADTAAGYPFRFLDGLDVDPVTGMVYFTSFSTRFGPSEL  207

Query  576   TQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFI  755
                V   DT+GRL +Y      VTVLL+GLSG AG A   D  F+++ E++  RI++Y+I
Sbjct  208   VLAVAVKDTTGRLFRYDPKTKTVTVLLSGLSGSAGCAVSSDGGFVLVGEFLRNRILRYWI  267

Query  756   SGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqppppipMTDSIAVNFDMD  935
              GPKANT    + ++ G PDN++R   G FWVA N  K    P      T+  AV    D
Sbjct  268   KGPKANTWDIFVPSIPG-PDNIRRTDGGDFWVASNSVKLIVLP------TEPSAVKISSD  320

Query  936   GNIVNTKNVTDTFPNSF-SGYQEYSDIAYVGSLLSDFVA  1049
             G I+    + + + ++  S   EY ++ Y+G+L + FV 
Sbjct  321   GEILRRMPLGEYYGDTLVSEVNEYKNVVYLGTLTTTFVG  359



>emb|CDX73037.1| BnaC06g34850D [Brassica napus]
Length=328

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 111/296 (38%), Positives = 153/296 (52%), Gaps = 11/296 (4%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRAE  344
             SGPE  A D    G YTGV+ G+ILKY      F +FA  +P   K  CD    T +   
Sbjct  39    SGPEAFAFDSHGGGPYTGVSGGKILKYQGSELGFTEFAYITPLANKSLCDKAVGTFLGNI  98

Query  345   CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELT  524
             CGRP+GL F+   G LY+ D F GL  V    GG A +LA    G  F F+D + VD +T
Sbjct  99    CGRPVGLAFNEITGDLYIADAFLGLYVVS-GRGGQAKRLADSAGGSPFKFLDGLDVDPVT  157

Query  525   ADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQT  704
               VYF      F        V   D +GR  +Y      VTVLL+GLSG AG A   D  
Sbjct  158   GSVYFTSFSTRFGPSQLVLAVAVNDATGRFFRYDPKTKSVTVLLSGLSGSAGCAVSSDGE  217

Query  705   FIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqp  884
             F+++ E++  RI++Y+I GPKANT +  + ++ G PDN++R   G FW+A N  K    P
Sbjct  218   FVLVGEFLRNRILRYWIKGPKANTWEIFVPSIPG-PDNIRRTDGGDFWIASNSLKLIVLP  276

Query  885   pppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSF-SGYQEYSDIAYVGSLLSDFVA  1049
                   T   AV  +  G I+   ++ + + ++  S   EY  + YVG+L ++FV 
Sbjct  277   ------TKPSAVKINAGGEIIRRMSLGEYYGDTLVSEVNEYKSVVYVGTLTTNFVG  326



>ref|XP_010416232.1| PREDICTED: strictosidine synthase 3-like [Camelina sativa]
Length=338

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 119/326 (37%), Positives = 168/326 (52%), Gaps = 13/326 (4%)
 Frame = +3

Query  78    WISILMFISSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLN  257
             +  +L+  SS Y++ +     F  I      +GPE  A D    G YTGV+ G+ILKY  
Sbjct  20    FCCLLILFSSHYLVSALQ--TFQKIPLPPQITGPEAFAFDSQGGGPYTGVSGGKILKYQG  77

Query  258   GN--FNDFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVE  431
                 F +FA   P   K  C+    T +   CGRP+GL F+   G LY+ D + GL  V 
Sbjct  78    PTLGFIEFAYILPIANKSLCEKAIGTFLGNICGRPVGLAFNEKTGDLYIADAYLGLYVVS  137

Query  432   RNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGR  611
              + GGLA +LA    G  F F+D + VD +T  VYF      F        V   DTSGR
Sbjct  138   -HRGGLAKRLADSAAGIPFRFLDGLDVDPVTGMVYFTSFSTRFGPSELVLAVAVKDTSGR  196

Query  612   LLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVM  791
             L +Y      VTVLL+GLSG AG A   D  F+++ E++  RI++Y+I GPKANT +  +
Sbjct  197   LFRYDPKTKTVTVLLSGLSGSAGCAVSSDGGFVLVGEFLRNRILRYWIKGPKANTFEIFV  256

Query  792   ENLEGYPDNVKRGTLGGFWVALNipkpqqqppppipMTDSIAVNFDMDGNIVNTKNVTDT  971
              ++ G PDN++R   G FWVA N  K    P      T+  AV    DG I+    + + 
Sbjct  257   PSIPG-PDNIRRTEGGDFWVASNSVKLIVVP------TEPSAVKISSDGEILRHMPLGEY  309

Query  972   FPNSF-SGYQEYSDIAYVGSLLSDFV  1046
             + ++  S   EY ++ Y+G+L + FV
Sbjct  310   YRDTLVSEVNEYKNVVYLGTLTTTFV  335



>ref|XP_006390479.1| hypothetical protein EUTSA_v10018851mg [Eutrema salsugineum]
 gb|ESQ27765.1| hypothetical protein EUTSA_v10018851mg [Eutrema salsugineum]
Length=329

 Score =   177 bits (449),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 109/297 (37%), Positives = 158/297 (53%), Gaps = 12/297 (4%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYL-NGNFNDFATTSPYRTKEKCDGINITNIRAEC  347
             SGPE  A D   +G YTGV+ G+ILKYL    + DF   +     + CDG   T    +C
Sbjct  37    SGPEAFAFDSTGKGFYTGVSGGKILKYLPQKGYVDFGYITESSKSQSCDGALGTANIGKC  96

Query  348   GRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTA  527
             GRP G+ F+   G LYV D   GL  + R  GGLA ++A  ++G+ F F+D + VD  T 
Sbjct  97    GRPAGIAFNDKTGELYVADAPLGLHVISRG-GGLAKKIADNIDGKPFLFLDGLDVDPTTG  155

Query  528   DVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTF  707
              VYF      F   +  + V S D +G+L KY  +K  VTVL+ GLSG AG A   D +F
Sbjct  156   VVYFTSFSSKFSPGDVLKAVASKDATGKLFKYDPSKKVVTVLMEGLSGSAGCAVSSDGSF  215

Query  708   IMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKR-GTLGGFWVALNipkpqqqp  884
             +++S++    I +Y+I GPKA +++    ++   PDN+KR G+ G FWVA          
Sbjct  216   VLVSQFTKSNIKRYWIKGPKAGSSEDFTNSVSN-PDNIKRIGSSGNFWVA-------SVV  267

Query  885   pppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSF-SGYQEYSDIAYVGSLLSDFVAV  1052
                   T+  AV  + DG +++T +V D F ++  S   E+    YVG+L   F  +
Sbjct  268   NTATGPTNPSAVKVNSDGKVLHTISVKDKFGDTLVSEVNEFKGQLYVGTLFGPFAGI  324



>gb|AFK33536.1| unknown [Medicago truncatula]
Length=310

 Score =   177 bits (448),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 103/266 (39%), Positives = 147/266 (55%), Gaps = 8/266 (3%)
 Frame = +3

Query  66   LTMFWISILMFISSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRIL  245
            LT+F   I    S   V  S   +    +L++  A GPE    D    G YTGV DGRIL
Sbjct  13   LTLF--CIFTLFSPVLVAGSMHNLHSARLLHVTRAIGPESLVFDSHGGGPYTGVADGRIL  70

Query  246  KYLNGN--FNDFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGL  419
            K+      + +FA TS  R++  C       +   CGRPLGL FD   G LY+ D + GL
Sbjct  71   KWKGKKRGWTEFAVTSSNRSQ--CVRPFAPKLEHICGRPLGLRFDKKNGDLYIADAYLGL  128

Query  420  LKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGD  599
             KV    GGLATQ+A    G  F F + + +DE    +YF D+  ++    YT ++ SGD
Sbjct  129  -KVVGAAGGLATQVATEAEGHPFHFTNDLDIDENEGVIYFTDSSTVYERTQYTLLLVSGD  187

Query  600  TSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTT  779
             +GRL+KY  +  +V VLL GL+ P G+A   D +F++++E    RI++ ++ GPKA   
Sbjct  188  KTGRLMKYDKSTKEVKVLLRGLAFPNGVALSKDGSFLLVAETSNCRILRLWLHGPKAGKV  247

Query  780  QTVMENLEGYPDNVKRGTLGGFWVAL  857
             T + +L G+PDN++R + G FWVAL
Sbjct  248  STFV-DLPGFPDNIRRNSYGQFWVAL  272



>ref|XP_002532597.1| strictosidine synthase, putative [Ricinus communis]
 gb|EEF29794.1| strictosidine synthase, putative [Ricinus communis]
Length=375

 Score =   178 bits (452),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 109/270 (40%), Positives = 160/270 (59%), Gaps = 10/270 (4%)
 Frame = +3

Query  69   TMFWISILMFISSPYVIHSQPGVDFPIILNL-QHASGPEDTAIDPLDQGIYTGVTDGRIL  245
            T+F I+   F   P+ I      D  ++L L + A+GPE  A D L +G YTG++DGRI+
Sbjct  19   TLFNINFTNFSYKPFNIERLLKDDSELLLPLARAATGPESFAFDGLGRGPYTGISDGRII  78

Query  246  KY--LNGNFNDFATTSPYRTKEKCDGINITNIRAE--CGRPLGLDFDHARGVLYVTDMFY  413
            ++      + DFA TS YR  + C+G ++   + E  CGRPLGL F+ + G LYV D + 
Sbjct  79   RWEEHEQRWIDFAVTSLYR--DGCEGPHVDQYQMEHICGRPLGLCFNESNGDLYVADAYM  136

Query  414  GLLKVERNNGGLATQLAA-GVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQ  590
            GLLKV R+ GGLAT +A  G +   F+F +++ VD  ++ +YF D+   ++   Y   + 
Sbjct  137  GLLKVGRD-GGLATTIATHGDDDIPFNFTNSLDVDPSSSALYFTDSSSRYQRREYIYAIL  195

Query  591  SGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKA  770
            SGD SGRLL+Y     +V +LL  LS P G+A   D  FI+I+E    R++KY+I   KA
Sbjct  196  SGDKSGRLLRYDPEDKKVRILLGNLSFPNGVALSKDGNFILIAETTTCRVLKYWIKTSKA  255

Query  771  NTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
               + V   + G+PDN+KR   GG+WVA+N
Sbjct  256  GILE-VFAQVPGFPDNIKRSPRGGYWVAIN  284



>gb|KHG17610.1| Strictosidine synthase 1 -like protein [Gossypium arboreum]
Length=332

 Score =   177 bits (448),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 115/330 (35%), Positives = 175/330 (53%), Gaps = 18/330 (5%)
 Frame = +3

Query  81    ISILMFISS-PYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLN  257
             + I +F+S  P ++ SQ    F  +      +GPE  A +      Y GV DGRIL+Y N
Sbjct  14    VPIFIFVSCFPPLMLSQ---SFRSLQLPPKVTGPESIAFEFGTSRFYVGVADGRILQY-N  69

Query  258   G---NFNDFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKV  428
             G    F DF  T P R+K  CDG +  N+   CGRPLGL F ++   LY+ D ++GL+ V
Sbjct  70    GPRVGFRDFGFTGPNRSKRMCDGTSDPNLGPICGRPLGLAFHYSLNKLYICDAYFGLM-V  128

Query  429   ERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSG  608
               ++G  ATQ++A  +G  +   DA+ V + + +V F D+   +   N ++ V + D++G
Sbjct  129   LGSSGKQATQVSAAADGEPYRLCDALDVHQPSGNVIFADSSANYDLRNISKAVNANDSTG  188

Query  609   RLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTV  788
             RLL Y+    +VTVL+  LSGPAG+A   D  ++++S +I    I+Y++ GP ANT   +
Sbjct  189   RLLMYNPDTDRVTVLIKNLSGPAGVAVSQDGAYVLVSNFINNSTIRYWLRGPGANTYDVI  248

Query  789   MENLEGYPDNVKRGTLGGFWVALNipkpqqqppppipMTDSIAVNFDMDGNIVNTKNVTD  968
               NL+  PDN+KR   G FW A  + K   +          I    +  G ++ T N   
Sbjct  249   --NLQERPDNIKRTAFGDFWRAAALVKQPTRSLV------PIGQRINEFGRVLRTVNFEA  300

Query  969   TFPNSF-SGYQEYSDIAYVGSLLSDFVAVY  1055
              + N   S  QE+    Y+GSL + FV V+
Sbjct  301   WYGNQLISEVQEFGGELYLGSLSAPFVGVF  330



>gb|ACU23577.1| unknown [Glycine max]
Length=349

 Score =   177 bits (449),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 113/315 (36%), Positives = 163/315 (52%), Gaps = 13/315 (4%)
 Frame = +3

Query  153   LNLQHAS-GPEDTAIDPLDQGIYTGVTDGRILKY--LNGNFNDFATTSPYRTKEKCDGIN  323
             L+L H+  G E  A D   +G Y GV+DGRILK+      + DFA TSP+R K+ CDG+ 
Sbjct  36    LDLPHSVFGSESVAFDCHGKGPYVGVSDGRILKWQETKREWIDFAVTSPHRNKKLCDGLQ  95

Query  324   ITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDA  503
                + + CGRPLGL F+     LY+ D ++GLL V   +GG+A QLA    G  F F +A
Sbjct  96    NDKMESMCGRPLGLKFNTVTCELYIADAYFGLLVVG-PSGGVAKQLATSAEGVPFRFTNA  154

Query  504   VAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGM  683
             + +D  T +VYF D+  +F+   Y  I+ SGD +GRLLKY  +   V VL+ GL+ P G+
Sbjct  155   LDIDTKTGEVYFTDSSILFQRRVYISIILSGDRTGRLLKYVPSTQSVHVLVKGLAFPNGV  214

Query  684   ATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTV--MENLEGYPDNVKRGTLGGFWVAL  857
             A   D +FI+++E    +I+K  +   K N    +     +   PDN+KR   G FWVA 
Sbjct  215   ALSKDNSFILVAESTTFKILKIQLRDSKTNNNNNIEPFAQVPRSPDNIKRNNKGEFWVAQ  274

Query  858   NipkpqqqppppipMT------DSIAVNFDMDGN-IVNTKNVTDTFPNSFSGYQEYSDIA  1016
             N  +   Q       T      D +A+ FD  G  IV          +S S  +E+    
Sbjct  275   NSGRGLMQKLGNEIETTLPWNADPVAIKFDEKGRAIVVLDGEYGRQLDSVSEVEEHEGSL  334

Query  1017  YVGSLLSDFVAVYTA  1061
             ++G  +  F+    A
Sbjct  335   WIGFAVQPFIGFIKA  349



>ref|XP_006485325.1| PREDICTED: strictosidine synthase 3-like [Citrus sinensis]
Length=473

 Score =   180 bits (456),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 111/304 (37%), Positives = 163/304 (54%), Gaps = 22/304 (7%)
 Frame = +3

Query  174   GPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRAEC  347
             GPE  A D   +G Y GV+DGRILK+ +    + +FA T+P+R    CDG + T +   C
Sbjct  184   GPESLAFDCNGEGPYAGVSDGRILKWQDSKLGWTEFAITTPFR--RICDGTSSTILEPLC  241

Query  348   GRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTA  527
             GRPLG+ F+     LY+ D ++GL+ V RN GG A QLA+      F F +A+ +D  T 
Sbjct  242   GRPLGIKFNPVTCDLYIADAYFGLMVVGRN-GGPAKQLASSAERIPFRFTNALDIDPNTG  300

Query  528   DVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTF  707
              VYF D+   F+   Y  +++SGD SGRLLKY     QVTVL  GL+ P G+    D++F
Sbjct  301   VVYFTDSSMYFQRRQYPMLIESGDRSGRLLKYDPRNKQVTVLRRGLAFPNGVTLSNDKSF  360

Query  708   IMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqpp  887
             ++++E   RRI+++++ G     +      +  +PDN++    G FWVALN         
Sbjct  361   LLVAESDSRRILRFWVEGESVIYSPQPFAQVAQFPDNIETDRNGDFWVALN-------TK  413

Query  888   ppipMTDSIAVNFD-MDGNIV-----NTKNVTDTFPNSFSGYQEYSDIAYVGSLLSDFVA  1049
                  TD +AV  D  +GN++     N +N  D    S S  +E+    Y GS +  +V 
Sbjct  414   RGNDKTDLVAVKLDGSNGNVLDVLEGNKQNDLD----SVSEVEEHGGYLYAGSPVQPYVV  469

Query  1050  VYTA  1061
             V  A
Sbjct  470   VIKA  473



>ref|XP_003609161.1| Strictosidine synthase [Medicago truncatula]
 gb|AES91358.1| SMP-30/gluconolaconase/LRE-like region protein [Medicago truncatula]
Length=326

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 112/302 (37%), Positives = 163/302 (54%), Gaps = 21/302 (7%)
 Frame = +3

Query  174   GPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGI-NITNIRAE  344
             GPE  A D    G Y   +DGRI KY+  +  F ++A TSP R +  CDG  + +NI+A 
Sbjct  38    GPEALAFDRNGGGPYVTSSDGRIFKYVGPSEGFKEYAYTSPNRNRTICDGFSDFSNIQAI  97

Query  345   CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELT  524
             CGRPLGL F+H  G LY  D +YGL+KV  N GG ATQL       +  F + + VD  T
Sbjct  98    CGRPLGLGFNHQTGDLYAADGYYGLVKVGPN-GGKATQLVGPAQSNSTVFANGLDVDSNT  156

Query  525   ADVYFIDAGDIFRSLNYTQIVQSG---DTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDI  695
               VYF  A   F+  ++   + +G   D SG LL Y  +  Q TV L  L+  +G+A   
Sbjct  157   GIVYFTIASTKFQPKDFPTALLTGGIGDNSGSLLSYDPSNNQTTVFLRNLTFASGVAVSG  216

Query  696   DQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpq  875
             D +F+++SEY   RI + ++ GPKAN++   M  L G PDN+KR + G FW+A+N     
Sbjct  217   DGSFVLVSEYFANRIRRVWLKGPKANSSDLFML-LAGRPDNIKRNSRGQFWIAVN-----  270

Query  876   qqppppipMTDSIAVNFDMDGNIVNTKNVTDTFP-NSFSGYQEYSDIAYVGSLLSDFVAV  1052
                     +T S  V    +G ++   ++ + +   + S  QEY+   Y GSLL+ +  +
Sbjct  271   -------TVTLSSGVRVTENGIVLQIVSLVEEYGLEAASEVQEYNGTLYGGSLLASYAII  323

Query  1053  YT  1058
             +T
Sbjct  324   FT  325



>ref|XP_002323253.2| strictosidine synthase family protein [Populus trichocarpa]
 gb|EEF05014.2| strictosidine synthase family protein [Populus trichocarpa]
Length=349

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/234 (41%), Positives = 140/234 (60%), Gaps = 7/234 (3%)
 Frame = +3

Query  168  ASGPEDTAIDPLDQGIYTGVTDGRILKYL--NGNFNDFATTSPYRTKEKCDGINITN-IR  338
            A GPE  A D L +G YT ++DGRI+K+      + DFA TSP R  + C G +  + + 
Sbjct  28   AIGPESFAFDSLGEGPYTSLSDGRIIKWQGDKKRWIDFAVTSPNR--DGCGGPHDHHQME  85

Query  339  AECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDE  518
              CGRPLG  FD   G LY+ D + GL +V    GGLAT++A    G  F F +++ +D+
Sbjct  86   HVCGRPLGSCFDETHGDLYIADAYMGLFRVG-PEGGLATKIATHAQGIPFRFTNSLDIDQ  144

Query  519  LTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDID  698
             +  +YF D+   ++  +Y  +V SGD SGRL+KY  A  QVTVLL  L+ P G+A   D
Sbjct  145  SSGAIYFTDSSTQYQRRDYLSVVLSGDKSGRLMKYDTASKQVTVLLKNLTFPNGVALSTD  204

Query  699  QTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
             +F++++E    RI++Y+I   KA   + V   L+G+PDN+KR   GG+WV +N
Sbjct  205  GSFVLLAETTSCRILRYWIKTSKAGALE-VFAQLQGFPDNIKRSPRGGYWVGIN  257



>ref|XP_002321516.2| hypothetical protein POPTR_0015s04660g [Populus trichocarpa]
 gb|EEF05643.2| hypothetical protein POPTR_0015s04660g [Populus trichocarpa]
Length=336

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 109/299 (36%), Positives = 162/299 (54%), Gaps = 11/299 (4%)
 Frame = +3

Query  174   GPEDTAIDPLDQGIYTGVTDGRILKYL--NGNFNDFATTSPYRTKEKCDGINITNIRAEC  347
             GPE  A +      YTGV DGR+L+Y    G++  FA TSP RT   CDG    +    C
Sbjct  44    GPESLAFESPGGAFYTGVNDGRVLRYQPPTGSWTSFAITSPNRTIALCDGTTDPDKGPIC  103

Query  348   GRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTA  527
             GRPLGL +  +  +LY+ D +YGL  V  +NG LA Q+A    G+ F   +A+ +D +T 
Sbjct  104   GRPLGLAYSPSTKLLYIADAYYGLF-VADSNGRLAKQIATSAEGQRFVACNALDIDPITG  162

Query  528   DVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTF  707
             ++YF DA  ++   N ++ + + D++GRL+KY   K QVTVLL  LS   G+A   D  F
Sbjct  163   NIYFTDASAVYDLRNSSKALLANDSTGRLMKYDVRKNQVTVLLRNLSVAVGVAVSKDGGF  222

Query  708   IMISEYIGRRIIKYFISGPKANTTQTVMENLE-GYPDNVKRGTLGGFWVALNipkpqqqp  884
             +++SE++G RI +Y+++G  A T+   + NL    P+N+KR +LG F +A    +   Q 
Sbjct  223   VLVSEFVGNRIRRYWLTGRDAGTSDIFLSNLNIVRPNNIKRTSLGDFRIAAATVRQDSQT  282

Query  885   pppipMTDSIAVNFDMDGNIVNTKNVTDTFPNS-FSGYQEYSDIAYVGSLLSDFVAVYT  1058
                      I V  D  G I  T ++   + ++  S  Q+     YV S   +FV VYT
Sbjct  283   LV------PIRVRVDEHGRISETVSLEAQYGSTPISEVQQSGLSLYVSSRGVNFVGVYT  335



>ref|XP_007045667.1| Calcium-dependent phosphotriesterase superfamily protein, putative 
[Theobroma cacao]
 gb|EOY01499.1| Calcium-dependent phosphotriesterase superfamily protein, putative 
[Theobroma cacao]
Length=495

 Score =   180 bits (456),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 111/313 (35%), Positives = 167/313 (53%), Gaps = 14/313 (4%)
 Frame = +3

Query  153   LNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINI  326
             ++L   +GPE  A D  +QG Y GV+DGRILK+   N  + +FA  S  R ++ CDG   
Sbjct  181   IDLPQVTGPESIAFDCKNQGPYVGVSDGRILKWQGPNLGWKEFAIPSSDRDRKLCDGSTN  240

Query  327   TNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAV  506
              ++   CGRPLGL F+ A   L++ D ++GLL V R+ GG+A QLA    G  F F +A+
Sbjct  241   PDLEPTCGRPLGLKFNSATCDLFIADAYFGLLLVGRS-GGVAQQLATSAEGVPFKFTNAL  299

Query  507   AVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMA  686
              +D  T  VYF D+  IF+  +Y     + D SGRLLKY+    +VTVL  GL+ P G+A
Sbjct  300   DIDTNTGVVYFTDSSIIFQRRHYFLSTITFDRSGRLLKYNFRTKEVTVLYKGLAFPNGVA  359

Query  687   TDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNip  866
                D +F++++E    RI+K+ +     + T      L   PDN+KR   G FWVALN  
Sbjct  360   LSKDNSFLLVAETTKMRILKFNLDSTTDSYTPEQFAQLPKMPDNIKRNDKGEFWVALNSG  419

Query  867   kpqqqppppipMT----------DSIAVNFDMDGNIVNTKNVTDTFP-NSFSGYQEYSDI  1013
             + + Q      ++          D + V +D +G I+   +       +S S  +E +  
Sbjct  420   RGRIQNEGETKLSSETTIPWFTLDPVGVKYDQEGKIMKQLDGNGGIRFDSVSEVEELNGK  479

Query  1014  AYVGSLLSDFVAV  1052
              Y+GS++  +V V
Sbjct  480   LYIGSVVKPYVGV  492



>ref|XP_002274235.1| PREDICTED: strictosidine synthase 3-like [Vitis vinifera]
Length=342

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 115/310 (37%), Positives = 166/310 (54%), Gaps = 18/310 (6%)
 Frame = +3

Query  165   HASGPEDTAIDPLDQGIYTGVTDGRILKY--LNGNFNDFATTSPYRTKEKCDGINITNIR  338
             + +GP   A D    G Y GV DGRI++Y   +  F DFA  +P R+K  CDG    +  
Sbjct  40    NVTGPVSLAFDLTVGGPYAGVNDGRIIRYGGTDVGFTDFAFCTPTRSKAVCDGTTDPDSG  99

Query  339   AECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDE  518
               CGRPLGL F++ R  +Y+ D + GL  V   NG LAT+LA    G  F F++ + VD 
Sbjct  100   PTCGRPLGLSFNNLRNQMYIADAYSGLF-VAGTNGRLATKLATSAEGVPFCFLNGLDVDP  158

Query  519   LTADVYFIDAGDIFRSLNYTQIVQSGDTS-------GRLLKYSAAKGQVTVLLNGLSGPA  677
             L+  VYF D     +  N ++ + SG+T+       GRLL+Y      VTVLL GLSG A
Sbjct  159   LSGLVYFTDFSTTIQLRNISRALASGNTTQFSSDATGRLLRYDPETKNVTVLLRGLSGAA  218

Query  678   GMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVAL  857
             G A   D  F+++SE+   RI+K+++ GPKA+T +T + +  G P N+KR   G FWVA+
Sbjct  219   GTAVSNDGMFVLVSEFNANRILKFWLRGPKASTAETFV-SFRGRPVNIKRTASGNFWVAV  277

Query  858   NipkpqqqppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNS--FSGYQEYSDIAYVGSL  1031
             N+P  Q  P      T          G I+ T +  D +  S   +  Q++    Y+G+ 
Sbjct  278   NVPNNQSPPT-----TILTGQRISYYGTILETVSFDDQYGGSTLITEVQQHLGALYIGAN  332

Query  1032  LSDFVAVYTA  1061
              ++FV V+ A
Sbjct  333   SANFVGVHMA  342



>emb|CAN78855.1| hypothetical protein VITISV_013355 [Vitis vinifera]
Length=342

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 114/310 (37%), Positives = 166/310 (54%), Gaps = 18/310 (6%)
 Frame = +3

Query  165   HASGPEDTAIDPLDQGIYTGVTDGRILKY--LNGNFNDFATTSPYRTKEKCDGINITNIR  338
             + +GP   A D    G Y GV DGRI++Y   +  F DFA  +P R+K  CDG    +  
Sbjct  40    NVTGPVSLAFDLTVGGPYAGVNDGRIIRYGGTDVGFTDFAFCTPTRSKAVCDGTTDPDSG  99

Query  339   AECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDE  518
               CGRPLGL F++ R  +Y+ D + GL  V   NG LAT+LA    G  F F++ + VD 
Sbjct  100   PTCGRPLGLSFNNLRNQMYIADAYSGLF-VAGTNGRLATKLATSAEGVPFCFLNGLDVDP  158

Query  519   LTADVYFIDAGDIFRSLNYTQIVQSGDTS-------GRLLKYSAAKGQVTVLLNGLSGPA  677
             L+  VYF D     +  N ++ + SG+T+       GRLL+Y      VTVLL GLSG A
Sbjct  159   LSGLVYFTDFSTTIQLRNISRALASGNTTQFSSDATGRLLRYDPETKNVTVLLRGLSGAA  218

Query  678   GMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVAL  857
             G A   D  F+++SE+   RI+K+++ GPKA+T +T + +  G P N+KR   G FWVA+
Sbjct  219   GTAVSNDGMFVLVSEFNANRILKFWLRGPKASTAETFV-SFRGRPVNIKRTASGNFWVAV  277

Query  858   NipkpqqqppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNS--FSGYQEYSDIAYVGSL  1031
             N+P  Q  P      T          G I+ T +  D +  S   +  Q++    Y+G+ 
Sbjct  278   NVPNNQSPPT-----TILTGQRISYYGTILETVSFDDQYGGSTLITEVQQHLGALYIGAN  332

Query  1032  LSDFVAVYTA  1061
              ++FV ++ A
Sbjct  333   SANFVGIHMA  342



>ref|XP_004298326.1| PREDICTED: strictosidine synthase-like [Fragaria vesca subsp. 
vesca]
Length=346

 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 110/307 (36%), Positives = 163/307 (53%), Gaps = 12/307 (4%)
 Frame = +3

Query  174   GPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRAEC  347
             GPE  A D   +G Y GV+DGRILK+   +  + +FA TSP  T++ CD          C
Sbjct  45    GPESVAFDCAGKGPYVGVSDGRILKWQGPHRGWKEFAFTSP--TRKICDRSTDNATEPIC  102

Query  348   GRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTA  527
             GRPLGL F      LY+ D ++G+LK+ RN GG   QLA  +NG  F F +A+ +D  T 
Sbjct  103   GRPLGLKFHPKTCELYIADAYFGILKIGRN-GGHPQQLATSLNGVPFRFTNALEIDSHTG  161

Query  528   DVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTF  707
              VYF D   IF+   +   + +GD +GRLL+Y     +VTVLL+ L+   G+A   D +F
Sbjct  162   IVYFTDTSTIFQRRFWPLSIATGDKTGRLLQYDPCTKKVTVLLDKLAFANGVALSKDSSF  221

Query  708   IMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqpp  887
             ++++E    +I K ++ GP A   + +   L+   DN+KR   G FWVALN  +  Q   
Sbjct  222   LLVAESATSKIFKLWLRGPNAGDVE-LFTQLKRPADNIKRTDNGEFWVALNSRRALQGNQ  280

Query  888   ppipM---TDSIAVNFDMDGNIVNTKNVTDTFP--NSFSGYQEYSDIAYVGSLLSDFVAV  1052
                      D + V FD  GNIV   +  +  P   S S  +E++   ++GS++  +V V
Sbjct  281   TSSAFWLTKDPVGVKFDEQGNIVKVLD-GEGGPTLESVSEVEEHNGKLWIGSVVKPYVGV  339

Query  1053  YTAI*SL  1073
                + +L
Sbjct  340   LRLVSTL  346



>ref|XP_004488398.1| PREDICTED: strictosidine synthase 3-like [Cicer arietinum]
Length=340

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 102/240 (43%), Positives = 143/240 (60%), Gaps = 17/240 (7%)
 Frame = +3

Query  171  SGPEDTAIDPLDQGIYTGVTDGRILKY--LNGNFNDFATTSPYRTKEKCDGI-NITNIRA  341
            +GPE  A D +  G YTGV+DGRILKY   N  F +FA  SP R K  CDGI + + ++ 
Sbjct  42   TGPESLAFDSIGGGPYTGVSDGRILKYDGPNSCFLEFAHISPDRDKTMCDGISDFSELQE  101

Query  342  ECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAA-GVNGRNFSFIDAVAVDE  518
             CGRP+GL F++  G LY+ D +YGL+KV   +GG ATQL A    G  F F+  + VD 
Sbjct  102  TCGRPMGLSFNYKTGELYIADAYYGLVKVPY-DGGTATQLVANNEQGNPFGFLAGLDVDP  160

Query  519  LTADVYFIDAG------DIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAG  680
             T  VYF +A       D+ + LN TQ     D SGRL +Y     + T+LL+ L+  AG
Sbjct  161  QTGIVYFTEASSAYKIRDLHKLLNGTQ-----DYSGRLFRYDPTTNETTLLLSDLAVAAG  215

Query  681  MATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            +A   + +F+++SEY+  RI ++++ GP A T+   +  L G PDN+KR +   FWVA+N
Sbjct  216  VAVSNNGSFVLVSEYMANRIKRFWLKGPNAYTSDIFLR-LPGRPDNIKRNSANEFWVAVN  274



>ref|XP_009400113.1| PREDICTED: strictosidine synthase 1-like [Musa acuminata subsp. 
malaccensis]
Length=359

 Score =   176 bits (445),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 105/272 (39%), Positives = 156/272 (57%), Gaps = 10/272 (4%)
 Frame = +3

Query  63   SLTMFWISILMFISSPYV-IHSQPGVD---FPIILNLQHASGPEDTAIDPLDQGIYTGVT  230
            SL    +SI++ +  P+   H +  +D       L L   +GPE  A D   +G YTGV+
Sbjct  10   SLRPALLSIMLAVLLPFSSCHEEKAIDKLESVERLVLTTVAGPESLAFDRRGEGPYTGVS  69

Query  231  DGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTD  404
             GRILK+      +  FA  +  R KE CD  +++ + + CGRPLGL F  A GVLYV D
Sbjct  70   GGRILKWQGKGRGWTGFAVNAGNR-KECCDTSDVS-LESMCGRPLGLQFHKATGVLYVAD  127

Query  405  MFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQI  584
             ++GLL V    GG A +LAA  +G  F+F + V VD+ T +VYF D+   ++  +Y   
Sbjct  128  AYFGLLAVG-PKGGAARRLAASADGGRFNFTNGVDVDQGTGEVYFTDSSTRYQRPDYILS  186

Query  585  VQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGP  764
            V +GD++GRL+KY     +VTVL  GL  P G+A   D +F++ +E    R++K+++ GP
Sbjct  187  VITGDSTGRLMKYDPRTRKVTVLRRGLPFPNGVALSGDGSFLLFAETGSCRVLKHWLRGP  246

Query  765  KANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            +    + V   L GYPDN++R   G +W+ALN
Sbjct  247  RTGAME-VFAELPGYPDNIRRTARGEYWIALN  277



>ref|XP_006376714.1| hypothetical protein POPTR_0012s04360g, partial [Populus trichocarpa]
 gb|ERP54511.1| hypothetical protein POPTR_0012s04360g, partial [Populus trichocarpa]
Length=303

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 97/246 (39%), Positives = 136/246 (55%), Gaps = 11/246 (4%)
 Frame = +3

Query  120  HSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGNFNDFATTSPYRT  299
            H+  G  F  I     A GPE  A +      YTGV+DG I KY+         ++ Y  
Sbjct  46   HNVMGETFRQIFLPPPAFGPESIAFESPGGAFYTGVSDGHIFKYI---------STTYWV  96

Query  300  KEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNG  479
               CDG    N    CGRP GL ++    +LY+ D +YGLL V  +NG LA Q+A    G
Sbjct  97   DTFCDGTTDPNKGPICGRPFGLAYNSFTRLLYIADAYYGLL-VADSNGRLAKQIATSAEG  155

Query  480  RNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLN  659
            + F F +A+ +D +T +VYF DA  ++   N ++  Q  D++ RLLKY     QVTVLL 
Sbjct  156  QPFVFHNAIDIDPVTGNVYFTDASAVYDLRNSSKAAQVNDSTARLLKYDPRTSQVTVLLR  215

Query  660  GLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGY-PDNVKRGTL  836
             LS   G+A   D +F+++SE IG RI +Y+++GPKANT +  + N+    P N+KR   
Sbjct  216  NLSRAVGLAVSPDGSFLLVSEAIGNRIRRYWLTGPKANTAEIFLSNINVVRPQNIKRTPS  275

Query  837  GGFWVA  854
            GGFW+A
Sbjct  276  GGFWIA  281



>ref|XP_003625042.1| Adipocyte plasma membrane-associated protein [Medicago truncatula]
 gb|AES81260.1| strictosidine synthase family protein [Medicago truncatula]
Length=394

 Score =   176 bits (447),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 97/240 (40%), Positives = 141/240 (59%), Gaps = 10/240 (4%)
 Frame = +3

Query  168  ASGPEDTAIDPLDQGIYTGVTDGRILKYLN--GNFNDFA-TTSPYRTK----EKCDGINI  326
            A GPE  A DP  +G YTGV+DG I+K+ +    + DFA T+SP+R      E+C G   
Sbjct  56   AVGPESFAFDPHGEGPYTGVSDGHIIKWHHHQNRWEDFAVTSSPHRGDDDDVEECGGPYK  115

Query  327  TNIRAE--CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFID  500
             + + E  CGRPLGL F+ A G LYV D + GL+ +E   G     ++  V G+  +F +
Sbjct  116  EHPKKEHICGRPLGLCFNVASGQLYVADAYMGLVVIEPTGGIARKVISHAVEGQPLAFTN  175

Query  501  AVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAG  680
            ++ +D+ T  VYF  +   +   +Y  ++ +GD SGRL+KY     QV VLLN L+   G
Sbjct  176  SLDIDQRTGAVYFTSSSSKYERRDYVSLILTGDNSGRLIKYEPKSEQVNVLLNNLTFANG  235

Query  681  MATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            +A   +  +I+ISE    RI++Y++  PKA T + V  NL G+PDN+KR   GGFWV +N
Sbjct  236  VALSKNGNYILISETTKCRILRYWLETPKAGTLE-VFANLPGFPDNIKRSPRGGFWVGIN  294



>ref|XP_009106059.1| PREDICTED: strictosidine synthase 1-like [Brassica rapa]
 emb|CDX96507.1| BnaA07g31180D [Brassica napus]
Length=326

 Score =   174 bits (442),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 110/297 (37%), Positives = 157/297 (53%), Gaps = 12/297 (4%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKY-LNGNFNDFATTSPYRTKEKCDGINITNIRAEC  347
             SGPE  A D + +  +TGV+ G+ILKY  +  F DFA  +       C+GI  T +  +C
Sbjct  36    SGPEAFAFDTIGKAFFTGVSGGKILKYTADKGFEDFAEITTTSNSSWCNGIIGTALAGKC  95

Query  348   GRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTA  527
             GRP G+ F+   G LYV D   GL  V    GGLAT++A  V+G+ F F+D + VD  T 
Sbjct  96    GRPAGIAFNPKTGDLYVADAPLGL-HVIPPAGGLATKIADSVDGKPFKFLDGLDVDPTTG  154

Query  528   DVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTF  707
              VYF      F        V   D SG+L KY  A   VTVL+ G+SG AG A   D +F
Sbjct  155   VVYFTSFSSKFSPSEVLIAVGLKDASGKLFKYDPATKAVTVLMEGISGGAGCAVSSDGSF  214

Query  708   IMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKR-GTLGGFWVALNipkpqqqp  884
             ++++E+I   I +Y+I+GPKA +T+ V  ++   PDN+KR G  G FWVA          
Sbjct  215   VLVTEFIKSNIKRYWITGPKAGSTEDVTSSVSN-PDNIKRIGATGNFWVA-------SVK  266

Query  885   pppipMTDSIAVNFDMDGNIVNTKNVTDTFPNS-FSGYQEYSDIAYVGSLLSDFVAV  1052
                +  TD  AV  D +G ++ T ++ + F ++  S   E     Y+G+L   F  +
Sbjct  267   NKVVVPTDPSAVKIDYNGKVLQTISLKNEFGDTLLSEANELDGKLYIGTLTGPFAGI  323



>ref|XP_009128019.1| PREDICTED: strictosidine synthase 1-like [Brassica rapa]
Length=327

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 111/297 (37%), Positives = 152/297 (51%), Gaps = 11/297 (4%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYL-NGNFNDFATTSPYRTKEKCDGINITNIRAEC  347
             SGPE  A D   +  YTGV+ G+ILKY  +  F DFA  +   T   C G+  T +  +C
Sbjct  36    SGPESFAFDSTGKAFYTGVSGGKILKYTPDKGFVDFAQITKTSTSSWCKGVFGTALAKKC  95

Query  348   GRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTA  527
             GRP G+ F+   G LYV D   GL  V    GG+AT++A  V+G+ F F+D + VD  T 
Sbjct  96    GRPAGIAFNPKTGDLYVADAPLGL-HVIHPAGGVATKIADSVDGKPFKFLDGLDVDPTTG  154

Query  528   DVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTF  707
              VYF      F        V   D SG+L KY  A   VTVL+  LSG AG A   D +F
Sbjct  155   VVYFTSFSSKFSPSEVFIAVGVKDASGKLFKYDPATKAVTVLMEDLSGAAGCAVSSDGSF  214

Query  708   IMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKR-GTLGGFWVALNipkpqqqp  884
             +++SE+I   I +Y+I GPKA +T  +  +    PDN++R G+ G FWVA          
Sbjct  215   VLVSEFIKSNIKRYWIKGPKAGSTDDIFSSSVSNPDNIRRIGSTGNFWVA-------SVI  267

Query  885   pppipMTDSIAVNFDMDGNIVNTKNVTDTFPNS-FSGYQEYSDIAYVGSLLSDFVAV  1052
                +  TD  AV  D +G ++ T  + + F N+  S   E     Y+G+L   F  V
Sbjct  268   NKVVMPTDPSAVKIDSNGKVLQTIFLKNEFGNTLLSEANEVDGKLYIGTLTGPFAGV  324



>emb|CDY47728.1| BnaA02g16670D [Brassica napus]
Length=327

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 111/297 (37%), Positives = 152/297 (51%), Gaps = 11/297 (4%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYL-NGNFNDFATTSPYRTKEKCDGINITNIRAEC  347
             SGPE  A D   +  YTGV+ G+ILKY  +  F DFA  +   T   C G+  T +  +C
Sbjct  36    SGPESFAFDSTGKAFYTGVSGGKILKYTPDKGFVDFAQITKTSTSSWCKGVFGTALAKKC  95

Query  348   GRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTA  527
             GRP G+ F+   G LYV D   GL  V    GG+AT++A  V+G+ F F+D + VD  T 
Sbjct  96    GRPAGIAFNPKTGDLYVADAPLGL-HVIHPAGGVATKIADSVDGKPFKFLDGLDVDPTTG  154

Query  528   DVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTF  707
              VYF      F        V   D SG+L KY  A   VTVL+  LSG AG A   D +F
Sbjct  155   VVYFTSFSSKFSPSEVFIAVGVKDASGKLFKYDPATKAVTVLMEDLSGAAGCAVSSDGSF  214

Query  708   IMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKR-GTLGGFWVALNipkpqqqp  884
             +++SE+I   I +Y+I GPKA +T  +  +    PDN++R G+ G FWVA          
Sbjct  215   VLVSEFIKSNIKRYWIKGPKAGSTDDIFSSSVSNPDNIRRIGSTGNFWVA-------SVI  267

Query  885   pppipMTDSIAVNFDMDGNIVNTKNVTDTFPNS-FSGYQEYSDIAYVGSLLSDFVAV  1052
                +  TD  AV  D +G ++ T  + + F N+  S   E     Y+G+L   F  V
Sbjct  268   NKVVMPTDPSAVKIDSNGKVLQTIFLKNEFGNTLLSEANEVDGKLYIGTLTGPFAGV  324



>ref|XP_004237337.1| PREDICTED: strictosidine synthase 3-like [Solanum lycopersicum]
Length=377

 Score =   175 bits (444),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 97/233 (42%), Positives = 133/233 (57%), Gaps = 6/233 (3%)
 Frame = +3

Query  168  ASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRA  341
            A G E    DP  +G YTGV DGRI+K+L  N  + DFA TS  R  E C   +   +  
Sbjct  56   AFGAESVVFDPNGEGPYTGVADGRIIKWLQHNQTWVDFAVTSSQR--ENCTRASAPEMEH  113

Query  342  ECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDEL  521
             CGRPLGL FDH  G LY+ D + GL +V   NGGLAT L      +   F + + +D+ 
Sbjct  114  VCGRPLGLRFDHQTGDLYIADAYLGL-QVVGPNGGLATPLVQHFEDQPLLFTNDLDIDDH  172

Query  522  TADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQ  701
               +YF D+  I++   +     SGD +GRL+KY  +  QVT+LL GLS   G+A   D+
Sbjct  173  DHVIYFTDSSTIYQRRQFVNATASGDKTGRLMKYDKSTKQVTILLQGLSFANGVALSKDR  232

Query  702  TFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            TF+++SE    RI +Y++ GP   T  T  + L G+PDNV+  + G FWVAL+
Sbjct  233  TFVLVSETSACRITRYWLKGPNVGTHDTFAQ-LPGFPDNVRMNSRGEFWVALH  284



>ref|XP_011027271.1| PREDICTED: strictosidine synthase 3-like isoform X2 [Populus 
euphratica]
Length=373

 Score =   175 bits (444),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 94/237 (40%), Positives = 136/237 (57%), Gaps = 3/237 (1%)
 Frame = +3

Query  153  LNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGNFNDFATTSPYRTKEKCDG-INIT  329
            L L+ A GPE  A DPL  G Y G++DGR++K+          +   + ++ C G  +  
Sbjct  47   LQLEGAIGPESFAFDPLAGGPYAGISDGRVVKWEERERRWINFSFASQERDGCGGPQDHQ  106

Query  330  NIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVA  509
                 CGRPLGL FD   G LY+ D + GLL+V    GGLAT++     G   SF + + 
Sbjct  107  QTEHICGRPLGLCFDETHGDLYIADAYMGLLRVG-AQGGLATKIVTHAQGIPLSFTNGLD  165

Query  510  VDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMAT  689
            +D+    +YF D+   ++  +Y  +V SGD SGRL+KY     QV+VLL+ L+ P G+A 
Sbjct  166  IDQSNGAIYFTDSSSQYQRRHYLSVVLSGDKSGRLMKYDPVNKQVSVLLSNLTFPNGVAL  225

Query  690  DIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
              D TFI+++E    RI++Y+I   KA T + V   L+G+PDN+KR   GG+WV LN
Sbjct  226  SKDGTFILLAETTRCRILRYWIKTSKAGTVE-VFAQLQGFPDNIKRSPRGGYWVGLN  281



>emb|CDY47729.1| BnaA02g16660D [Brassica napus]
Length=325

 Score =   174 bits (440),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 111/297 (37%), Positives = 155/297 (52%), Gaps = 12/297 (4%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYLNGN-FNDFATTSPYRTKEKCDGINITNIRAEC  347
             SGPE  A D   +G YTGV+ G+I KYL G  + DF   +     + CDG       ++C
Sbjct  35    SGPEAFAFDSTGKGFYTGVSGGKIFKYLPGKGYVDFGYITVSSKSQWCDGALGIAYMSKC  94

Query  348   GRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTA  527
             GRP G+ F++  G LYV D   GL  V  + GG A ++A   +G+ F F+D + VD  T 
Sbjct  95    GRPAGIAFNNKTGELYVADAPLGL-HVIPSGGGYAKKIADSADGKPFLFLDGLDVDPTTG  153

Query  528   DVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTF  707
              VYF      F   +  + V S D SG+L KY  +K  VTVLL GLSGPAG A   D +F
Sbjct  154   VVYFTSFSSKFSPGDVLKAVASKDASGKLFKYDPSKRVVTVLLEGLSGPAGCAVSSDGSF  213

Query  708   IMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKR-GTLGGFWVALNipkpqqqp  884
             +++S++    I +Y+I G KA T++    N    PDN+KR G+ G FWVA          
Sbjct  214   VLVSQFTKSNIKRYWIKGSKAGTSED-FTNAVSNPDNIKRIGSSGNFWVA-------SVV  265

Query  885   pppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSF-SGYQEYSDIAYVGSLLSDFVAV  1052
                   T+  AV  + DG ++ T +V D F ++  S   E+    YVG+L   F  +
Sbjct  266   NTATGPTNPSAVKINSDGRVLQTISVKDKFGDTLVSEVNEFEGRLYVGTLSGPFAGI  322



>ref|XP_009391266.1| PREDICTED: strictosidine synthase 3-like [Musa acuminata subsp. 
malaccensis]
Length=334

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 117/305 (38%), Positives = 165/305 (54%), Gaps = 10/305 (3%)
 Frame = +3

Query  153   LNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINI  326
             L L+   GPE  A D   +G YTGV+ GRIL + +    +  +A  +  R +E C+G ++
Sbjct  34    LALRTVVGPESLAFDRHGRGPYTGVSGGRILMWQDKGRGWTGYAVNAANRRRE-CEGSDV  92

Query  327   TNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAV  506
             +  R  CGRPLGL F HA GVLYV D ++GLL V    GG A  LAA   G  F+F + V
Sbjct  93    SMERV-CGRPLGLQFHHATGVLYVADAYFGLLAVG-PTGGAAELLAASAEGVPFNFTNGV  150

Query  507   AVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMA  686
              VD+ T  VYF D+   ++  +Y   V +GD++GRL+KY     +VTVL  GL  P G+A
Sbjct  151   DVDQKTGVVYFTDSSTQYQRQDYILAVVTGDSTGRLMKYDPRTRKVTVLRRGLRFPNGVA  210

Query  687   TDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNip  866
                D +F++ +E    R+IKY++ GPKA TT+ V   L  YPDN++R   G +WVALN  
Sbjct  211   LSGDGSFLLFAETGTCRVIKYWLRGPKAATTE-VFAELPRYPDNIRRTPGGEYWVALNGE  269

Query  867   k--pqqqppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSFSGYQEYSDIAYVGSLLSD  1040
             K                +A+    +G +V   +  +    S S   E S   +VGS+   
Sbjct  270   KIDLNGAAKAEAATERPVAMRLSAEGKLVEALDGEEL--ASVSEVAEESGSVWVGSVEMP  327

Query  1041  FVAVY  1055
             +V VY
Sbjct  328   YVDVY  332



>ref|XP_006351273.1| PREDICTED: strictosidine synthase 1-like [Solanum tuberosum]
Length=372

 Score =   175 bits (443),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 101/256 (39%), Positives = 147/256 (57%), Gaps = 8/256 (3%)
 Frame = +3

Query  102  SSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN---FND  272
            S P +  S+  +    +++L+ A GPE  A DP  +G YTGV DGRILK+ NG+   + D
Sbjct  29   SPPSIPGSKDLLSKSEVIHLKGAVGPESVAFDPNGEGPYTGVADGRILKW-NGDSDGWVD  87

Query  273  FATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLA  452
            FA TS  R  ++C       +   CGRPLGL FD   G LYV D + GL  V   +GGLA
Sbjct  88   FAVTSSQR--KQCVHPFAPQMEHVCGRPLGLRFDTRTGDLYVADAYLGL-HVVGPSGGLA  144

Query  453  TQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAA  632
            T L   V G++  F + + +DE    +YF D    F+   +   V SGD +GRL+KY  +
Sbjct  145  TSLVTEVEGQHLRFTNDLDIDEQEDVIYFTDTSTQFQRRQFIASVVSGDKTGRLMKYDIS  204

Query  633  KGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYP  812
               VTVLL GL+   G+A   D++F++++E    R++++++ GP A    T   +L GYP
Sbjct  205  TKAVTVLLRGLAFANGVALSKDKSFVLVAETTTCRVVRHWLKGPHAGKHDT-FADLPGYP  263

Query  813  DNVKRGTLGGFWVALN  860
            DN++R + G FWV L+
Sbjct  264  DNIRRNSRGEFWVGLH  279



>ref|XP_007156378.1| hypothetical protein PHAVU_003G281200g [Phaseolus vulgaris]
 gb|ESW28372.1| hypothetical protein PHAVU_003G281200g [Phaseolus vulgaris]
Length=344

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 113/307 (37%), Positives = 171/307 (56%), Gaps = 21/307 (7%)
 Frame = +3

Query  174   GPEDTAIDPLDQGIYTGVTDGRILKY--LNGNFNDFATTSPYRTKEKCDGINITNIRAEC  347
             G E  A D   +G Y GV+DGRILK+   N ++ DFA TSP+R K+ CDG+   ++ + C
Sbjct  42    GSESAAFDCHGKGPYVGVSDGRILKWHPTNKHWIDFAVTSPHRDKKVCDGLTDESMESMC  101

Query  348   GRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTA  527
             GRPLGL F++    LY+ D ++GLL V    G +A QLA    G  F F +A+ +   T 
Sbjct  102   GRPLGLKFNNVTCDLYIADAYFGLLVVGPGGG-VAKQLATSAEGVPFRFTNALDIHPQTG  160

Query  528   DVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTF  707
             +VYF D+  +F+   Y  I+ SGD +GRLLKY  +  +V V++ GL+ P G+A   D +F
Sbjct  161   EVYFTDSSILFQRRVYLSIILSGDRTGRLLKYVPSSQRVYVMVKGLAFPNGVALSKDNSF  220

Query  708   IMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNi--------  863
             ++++E    +++K  + G   NT QT  E +   PDN+K  + G FWVALN         
Sbjct  221   LLLAESTTFKVLKVSLRG--RNTIQTFAE-VPRSPDNIKSNSKGEFWVALNSGRGRINGF  277

Query  864   pkpqqqppppipMTDSIAVNFDMDGNIVNTKNVTD----TFPNSFSGYQEYSDIAYVGSL  1031
              K ++        TD +A+ FD +G +V    V D    T  NS S  +E+    ++GS 
Sbjct  278   EKEREVETTVPWTTDPVAIKFDSEGKVV---EVLDGGYGTQLNSVSEVEEHDGSLWIGSA  334

Query  1032  LSDFVAV  1052
             +  ++A+
Sbjct  335   VQPYIAL  341



>emb|CDP21321.1| unnamed protein product [Coffea canephora]
Length=335

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 113/330 (34%), Positives = 168/330 (51%), Gaps = 17/330 (5%)
 Frame = +3

Query  75    FWISILMFISSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYL  254
             F++ +L F+ + +       +  P         GP+  A D   QG YTGV DGRI KY 
Sbjct  17    FYVFVLCFLPAVFCAGHLQKLHLP-------DPGPDSFAFDSAGQGPYTGVADGRIFKYK  69

Query  255   NGN--FNDFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKV  428
                  F ++  +   R+   CDG N T +   CGRP GL F +  G LYV D   GL+ V
Sbjct  70    GPKVGFVEYGYSKADRSARFCDGTNSTALAKSCGRPSGLGFYYKTGELYVADDGVGLV-V  128

Query  429   ERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSG  608
                 GG    LA+G     F   D + VD+ T  VYF DA   +      QI+ SGD++G
Sbjct  129   IGPKGGAGKVLASGAEKVPFGLPDGLDVDQNTGIVYFTDATARYTINEIPQIIASGDSTG  188

Query  609   RLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTV  788
             RLLKY+    +VTVLL  L+GPAG+A   D+++++++E++  R+ KY++ GPKANT   V
Sbjct  189   RLLKYNPRTKKVTVLLRRLAGPAGVAISKDRSYLLVTEFLKSRVWKYWLRGPKANTAH-V  247

Query  789   MENLEGYPDNVKRGTLGGFWVALNipkpqqqppppipMTDSIAVNFDMDGNIVNTKNVTD  968
             + N+ G P  + R  +G FW+A+ + +    P   +       +  +  G I+ T     
Sbjct  248   LLNVPGSPSKIVRNNVGDFWLAMTVKRQVPTPRIKLQ-----GLRINGYGKILETITFNP  302

Query  969   TFPNSF-SGYQEYSDIAYVGSLLSDFVAVY  1055
              F +S  +   E+    Y+GSL   +V VY
Sbjct  303   GFDSSMITEVHEHKGALYLGSLYVGYVGVY  332



>ref|XP_004305393.1| PREDICTED: strictosidine synthase-like [Fragaria vesca subsp. 
vesca]
Length=324

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 112/319 (35%), Positives = 162/319 (51%), Gaps = 30/319 (9%)
 Frame = +3

Query  102   SSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGNFN--DF  275
             S PY+ H +     PI     H   PE  A D  +   Y GV DGRI K+L   F   +F
Sbjct  29    SLPYLNHHE----IPI-----HVPQPESIAFD-CNGAPYVGVADGRIFKWLGSPFGWIEF  78

Query  276   ATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLAT  455
             A TS  R +E CD     +    CGRPLGL FD     LY+ D ++GLLK     GG+A 
Sbjct  79    AVTSANRPREVCDLSTSKDNEPICGRPLGLKFDLTTCELYIADAYFGLLKTGPY-GGVAQ  137

Query  456   QLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAK  635
              LA    G  F F++ V +D  +  VYF D   I++  N+   V +GD +GRL++Y  + 
Sbjct  138   VLATSAEGFPFRFLNGVDIDHQSGMVYFTDTSAIYQRRNWELSVSTGDKTGRLMRYDPST  197

Query  636   GQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPD  815
              +VTVLL+GL+   G+A   D  F+++++   + +++Y++ GP+ANT  T   NL G PD
Sbjct  198   KKVTVLLHGLAFANGVALSKDSDFVLVTQTTAKNVLRYWLQGPRANTVDTFF-NLRGAPD  256

Query  816   NVKRGTLGGFWVALNipkpqqqppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSFSGY  995
             N+     G FWVA N     +            AV  D  GN +   +V D         
Sbjct  257   NINININGEFWVAENSAGRGK------------AVKLDAQGNFL---DVVDGLNPVSHVE  301

Query  996   QEYSDIAYVGSLLSDFVAV  1052
             Q Y ++ ++GS+++ FV V
Sbjct  302   QRYGNL-WIGSVVNKFVGV  319



>ref|XP_008244844.1| PREDICTED: strictosidine synthase 1 [Prunus mume]
Length=389

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 100/251 (40%), Positives = 143/251 (57%), Gaps = 13/251 (5%)
 Frame = +3

Query  141  FPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGNFN--DFATTSP--------  290
            F ++  ++ A GPE  A DPL  G YTGV+DGRI+K+     +  +FA TSP        
Sbjct  49   FEVVPIVEGAVGPESFAFDPLGGGPYTGVSDGRIVKWDQDKHHWINFAVTSPNSASLCNP  108

Query  291  YRTKEKCDGINITNIRAE-CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAA  467
              ++  C+G +  +     CGRPLGL F+   G LY+ D + GLL V    GGLAT++  
Sbjct  109  IPSRGGCEGSHEHDKTEHICGRPLGLCFNQTSGDLYIADAYMGLLIVG-PQGGLATEVVT  167

Query  468  GVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVT  647
              +G  F F +A+ +D+    VYF D+   ++  NY  ++ SGD +GRL+KY     QV 
Sbjct  168  RAHGIPFGFTNALDIDQELGAVYFTDSSSQYQRRNYISVILSGDKTGRLMKYDPESKQVQ  227

Query  648  VLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKR  827
            VLL  LS P G+A   +  FI++ E    RI++Y++  PKA T Q V   L G+PDN+KR
Sbjct  228  VLLENLSFPNGVALSKNGDFILLVETTHCRIMRYWLKTPKAGTFQ-VFAQLPGFPDNIKR  286

Query  828  GTLGGFWVALN  860
               GGFWV ++
Sbjct  287  SPRGGFWVGIH  297



>emb|CDP12401.1| unnamed protein product [Coffea canephora]
Length=329

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 120/308 (39%), Positives = 159/308 (52%), Gaps = 14/308 (5%)
 Frame = +3

Query  153   LNLQHAS-GPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGIN  323
             +NL   S GPE  A+D  +QG Y GV DG ILKY   N  F   A TS  RT+E CD   
Sbjct  28    VNLPPGSIGPESVALDRFNQGPYVGVLDGTILKYKGPNIGFVFLAYTSRNRTRELCDVTT  87

Query  324   ITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDA  503
               N+   CG P G  F+   G LYV D+F GL KV    GG AT +A    G  F F++ 
Sbjct  88    DPNLGPICGWPFGFSFNVVTGFLYVVDVFLGLSKVG-TEGGNATLIANSAGGVPFQFLNG  146

Query  504   VAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGM  683
             V VD+ T DVYF DA       N T      D++GRLLKYS   G+V VL  G S P G 
Sbjct  147   VDVDQFTGDVYFTDASQTIDIRNITSGNYVPDSTGRLLKYSPITGEVKVLAGGFSLPGGP  206

Query  684   ATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGT-LGGFWVALN  860
                +D+ F++ +E+  RRI+KY+++G KANT + V+  L G P  +K+    G FWVA++
Sbjct  207   VISVDRKFVLFAEFSNRRIMKYWLTGNKANTVE-VLLYLPGNPIKIKKAPEPGEFWVAVD  265

Query  861   ipkpqqqppppipMTDSIAVNFDMDGNIVNTKNVTDTFPN-SFSGYQEY-SDIAYVGSLL  1034
             I   Q            +   F+  G I+  K     + N   +  QEY     Y+GS  
Sbjct  266   IIAQQPSS------VTPLGYKFNSTGGILLIKEFEGQYNNIRVNVVQEYIGGKLYIGSRE  319

Query  1035  SDFVAVYT  1058
             + FV +Y+
Sbjct  320   AKFVGIYS  327



>ref|XP_009627580.1| PREDICTED: strictosidine synthase 1-like [Nicotiana tomentosiformis]
Length=372

 Score =   174 bits (440),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 105/268 (39%), Positives = 153/268 (57%), Gaps = 12/268 (4%)
 Frame = +3

Query  81   ISILMFISSP--YVIHSQPG----VDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRI  242
            I++++ +SS   Y  HS  G    +    ++ L+ A GPE  A DP  +G YTGV DGRI
Sbjct  16   ITVILTLSSKNVYRPHSIAGSKDLLPKAKVIQLKGAVGPESLAFDPNGEGPYTGVADGRI  75

Query  243  LKYLNGN--FNDFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYG  416
            LK+   +  + DFA TS  R  ++C      ++   CGRPLGL FD   G LY+ D + G
Sbjct  76   LKWQGDSEGWVDFAVTSSQR--KECVRHFAPHMEHVCGRPLGLRFDTRTGDLYIADAYLG  133

Query  417  LLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSG  596
            L +V   +GGLAT L   V G+   F + + +DE    +YF D    F+   +   V SG
Sbjct  134  L-QVVGPSGGLATPLVTEVEGQPLHFTNDMDLDEQEDIIYFTDTSTQFQRRQFIASVVSG  192

Query  597  DTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANT  776
            D +GRL+KY  +   VTVLL GL+   G+A   D++F++++E    RI++Y++ GP A  
Sbjct  193  DKTGRLMKYDKSTKAVTVLLRGLAFANGVALSKDKSFVLVAETSTGRIVRYWLKGPDAGK  252

Query  777  TQTVMENLEGYPDNVKRGTLGGFWVALN  860
              T   +L GYPDN++R + G FWVAL+
Sbjct  253  HDT-FADLPGYPDNIRRNSRGEFWVALH  279



>ref|XP_002452919.1| hypothetical protein SORBIDRAFT_04g034960 [Sorghum bicolor]
 gb|EES05895.1| hypothetical protein SORBIDRAFT_04g034960 [Sorghum bicolor]
Length=346

 Score =   173 bits (438),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 111/299 (37%), Positives = 162/299 (54%), Gaps = 14/299 (5%)
 Frame = +3

Query  174   GPEDTAIDPLDQGIYTGVTDGRILKYLNGNFNDFATT--SPYRTKEKCDGINITN---IR  338
             GPE  A D    G Y+GV+DGR+LK+ NG    ++T   SP    E C            
Sbjct  52    GPESVAFDGAGAGPYSGVSDGRVLKW-NGFARGWSTYAYSPGYDAEACTASRTRPAELTE  110

Query  339   AECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDE  518
             + CGRPLGL F H  G LY+ D + GL++V    GG AT LAA V+G    F + V VD+
Sbjct  111   SRCGRPLGLRFHHRSGNLYIADAYKGLMRVG-PGGGEATVLAAEVDGVPLRFTNGVDVDQ  169

Query  519   LTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDID  698
             +T DV+F D+   +    + ++  +GD+SGRL+KY    GQVTVL  G++ P G+A   D
Sbjct  170   VTGDVFFTDSSMNYPRSQHERVTATGDSSGRLMKYDPKTGQVTVLQAGVTYPNGLAISAD  229

Query  699   QTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqq  878
             +T ++++     ++++Y+I GPKA T++  + +L GYPDNV+    GGFWVAL+  K + 
Sbjct  230   RTHLVVALTGPCKLLRYWIKGPKAGTSEH-LADLPGYPDNVRADGRGGFWVALHREKMEL  288

Query  879   qppppipMTDSIAVNFDMDGNIVNT-KNVTDTFPNSFSGYQEYSDIAYVGSLLSDFVAV  1052
                P   +   +AV    DG +V   K      P      +      Y+GS+   +VAV
Sbjct  289   PFGPDSHL---LAVRIGADGQVVQVMKGPKSVRPTEV--VERDGGKLYMGSVELPYVAV  342



>ref|XP_009799719.1| PREDICTED: strictosidine synthase 1-like [Nicotiana sylvestris]
Length=337

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 108/323 (33%), Positives = 164/323 (51%), Gaps = 19/323 (6%)
 Frame = +3

Query  96    FISSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNG--NFN  269
              +  P +  +Q  +    I+ L+ A GPE  A DP  +G YTGV DGRILK+      + 
Sbjct  28    MLKQPPIPSTQNLLRKAEIIQLKGAVGPESIAFDPNGEGPYTGVADGRILKWQEQAQTWA  87

Query  270   DFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGL  449
             +FA TS  R    C   +   +   CGRPLGL FD   G LY+ D ++GL +V    GGL
Sbjct  88    NFAVTSSERNN--CTRPSAPEMEHICGRPLGLRFDKKTGDLYIADAYFGL-QVVGPKGGL  144

Query  450   ATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSA  629
             AT L     G+   F + + +D+    +YF D+   ++   Y     SGDT+GRL+KY  
Sbjct  145   ATPLVHEFEGKPLIFTNDMDIDDQNNVIYFTDSSTKYQRRQYFAAFVSGDTTGRLMKYDK  204

Query  630   AKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGY  809
             +  +VTVLL GL+   G+A + DQ+F+++SE    RII+Y+I GP       +  ++ G+
Sbjct  205   STKKVTVLLRGLAFANGVALNKDQSFLLVSETANCRIIRYWIKGPYKG-RHDIFADVPGF  263

Query  810   PDNVKRGTLGGFWVALNipkpqqqppppipMTDSIAVNFDMDGNIVNT-KNVTDTFPNSF  986
             PDN++  + G FWVALN              T + A+    +G ++   ++         
Sbjct  264   PDNIRINSRGEFWVALNAK------------TSATAIKLSAEGQMLEVLEDEEGKTLRYI  311

Query  987   SGYQEYSDIAYVGSLLSDFVAVY  1055
             S  +E     + GS+   F+ VY
Sbjct  312   SQVEEKHGKLWFGSVTMPFLGVY  334



>ref|XP_010257835.1| PREDICTED: strictosidine synthase 3-like [Nelumbo nucifera]
Length=340

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 117/307 (38%), Positives = 166/307 (54%), Gaps = 12/307 (4%)
 Frame = +3

Query  153   LNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNG--NFNDFATTSPYRTKEKC-DGIN  323
             L +  A GPE  A D   +G YTGV+ GRILK+      + +FA+TSP R  + C +G N
Sbjct  36    LPIPSAVGPESFAFDCNGEGPYTGVSGGRILKWQGAARGWAEFASTSPPR--DICFNGAN  93

Query  324   ITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDA  503
                    CGRPLGL F+ A   LY+ D  +GL+ V R+ GG+A  LA    G  F F +A
Sbjct  94    DPETELVCGRPLGLQFNKATCELYIADSSFGLMVVGRD-GGVAKLLANSAEGVPFRFTNA  152

Query  504   VAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGM  683
             +  D+    VYF D+        +     SGD +GRL+KY     ++TVL  GLS P G 
Sbjct  153   LDFDQDNGIVYFTDSSIWIPRWEFLIEALSGDETGRLMKYDPKTEKLTVLWRGLSFPNGA  212

Query  684   ATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNi  863
             A   D +FI+I+E    RI++Y++ GPKA T +  ++ L G+PDNVK    G FWVALN 
Sbjct  213   ALSKDNSFILIAETSKARILRYWLRGPKAQTLEFFLQ-LPGFPDNVKSNGRGEFWVALNP  271

Query  864   pkpqqqppppipMTDSI-AVNFDMDGNI---VNTKNVTDTFPNSFSGYQEYSDIAYVGSL  1031
              KP             I A+ FD +GNI   +N++  T T     S  +E +   ++GS+
Sbjct  272   GKPSMGATFQPRFDGEIVALRFDEEGNILEVLNSRTGTSTL-TLVSEVEENNGNLWIGSV  330

Query  1032  LSDFVAV  1052
             +  +V++
Sbjct  331   VLPYVSL  337



>ref|XP_006301859.1| hypothetical protein CARUB_v10022329mg [Capsella rubella]
 gb|EOA34757.1| hypothetical protein CARUB_v10022329mg [Capsella rubella]
Length=311

 Score =   172 bits (435),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 110/318 (35%), Positives = 163/318 (51%), Gaps = 15/318 (5%)
 Frame = +3

Query  108   PYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN-FNDFATT  284
             P  I +Q     P+  N    +GPE  A D   +G YTGV+ G+ILK+L G  + DFA  
Sbjct  3     PKYIDNQSFQKLPVPGNR---TGPEAFAFDSTGKGFYTGVSGGKILKWLPGKGYVDFAHI  59

Query  285   SPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLA  464
             +   T   CDG   T    +CGRP G+ F+   G LYV D   GL  + R  GGLA ++A
Sbjct  60    TNSSTSSLCDGALATANAEKCGRPAGIAFNGKTGDLYVADAPLGLHVISRG-GGLAKKIA  118

Query  465   AGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQV  644
               V+G+ F F+D + +D  T  VYF      F   +  + V S D++G+L +Y  +K  V
Sbjct  119   DSVDGKPFLFLDGLDIDPTTGVVYFTSFSSAFGPRDVLKAVASKDSTGKLFRYDPSKKVV  178

Query  645   TVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVK  824
              VL+ GLSG AG A   D +F+++S++    I +Y+I G KA +++    ++   PDN+K
Sbjct  179   NVLMEGLSGSAGCAVSSDGSFVLVSQFTKSNIKRYWIKGSKAGSSEDFTNSVSN-PDNIK  237

Query  825   R-GTLGGFWVALNipkpqqqppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSF-SGYQ  998
             R G+ G FWVA                T+  AV    DG ++ T  + D F ++  S   
Sbjct  238   RIGSSGNFWVA-------SVVNSATGPTNPSAVKVSSDGKVLQTIPLKDKFGDTLVSEVN  290

Query  999   EYSDIAYVGSLLSDFVAV  1052
             E+    Y+G+L   F  +
Sbjct  291   EFKGKLYIGALFGPFAGI  308



>ref|XP_002308895.2| hypothetical protein POPTR_0006s03930g [Populus trichocarpa]
 gb|EEE92418.2| hypothetical protein POPTR_0006s03930g [Populus trichocarpa]
Length=387

 Score =   174 bits (440),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 95/234 (41%), Positives = 133/234 (57%), Gaps = 8/234 (3%)
 Frame = +3

Query  168  ASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN---FNDFATTSPYRTKEKCDGINITNIR  338
            A GPE  A D L +G Y  ++DGRI+K+  GN   + DFA  SP R    C      +  
Sbjct  67   AFGPESFAFDSLGKGPYASLSDGRIVKW-QGNRKGWTDFAVASPNRYA--CKQQPFAHTE  123

Query  339  AECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDE  518
              CGRPLGL FD   G LY+ D + GLL+V    GGLAT++     G    F + + +D+
Sbjct  124  HICGRPLGLCFDETHGDLYIADAYMGLLRVG-TQGGLATKIVTHAQGIPLRFTNGLDIDQ  182

Query  519  LTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDID  698
             +  +YF D+   ++   Y  +V SGD SGRL+KY     QV VLL+ L+ P G+A   D
Sbjct  183  SSGAIYFTDSSSQYQRRQYLSVVLSGDKSGRLMKYDPVNKQVRVLLSNLTFPNGVALSKD  242

Query  699  QTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
              FI+++E    RI++Y+I   KA T + V   L+G+PDN+KR   GG+WV +N
Sbjct  243  GNFILLAETTRCRILRYWIKTSKAGTVE-VFAQLQGFPDNIKRSPRGGYWVGMN  295



>ref|XP_010537421.1| PREDICTED: strictosidine synthase 1-like [Tarenaya hassleriana]
Length=333

 Score =   172 bits (436),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 110/307 (36%), Positives = 155/307 (50%), Gaps = 13/307 (4%)
 Frame = +3

Query  147   IILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNG---NFNDFATTSPYRTKEKCDG  317
             I L     +GPE  A DP  +G YTGV+ G+ILKY NG    F  F+ TSP      CD 
Sbjct  35    IELPPPRTTGPEAFAFDPRGEGPYTGVSGGKILKY-NGPLLGFVHFSFTSPLANTSVCDK  93

Query  318   INITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFI  497
                T +   CGRP+G+ F+   G LY+ D + GL  V    GG A +LA    G  F F+
Sbjct  94    AVGTFLGKVCGRPVGIAFNPRTGYLYIADAYLGLY-VASPRGGRAKRLADSAEGSPFRFL  152

Query  498   DAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPA  677
             D + VD +T +VYF      F        V   D +G+L +Y      V VL+ GLSG A
Sbjct  153   DGLDVDPVTGNVYFTSFSSRFGPSELLLAVAVKDATGKLFRYDPKTKNVAVLMTGLSGSA  212

Query  678   GMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVAL  857
             G A   D +F+++ E +  RI++Y+I G KA T +  +  + G PDN++R   G FWVA 
Sbjct  213   GCAVSSDGSFVLVGEVLRNRILRYWIKGSKAATWEVFVPWIPG-PDNIRRTDGGDFWVA-  270

Query  858   NipkpqqqppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSF-SGYQEYSDIAYVGSLL  1034
                         +  T+  AV  +  G IV    + + + N+  S   E++ + Y G+L 
Sbjct  271   -----SVVMKLAVVPTEPSAVKLNTSGGIVRRIPLGEYYGNTLVSEANEHNGVIYFGTLT  325

Query  1035  SDFVAVY  1055
             SDF+ VY
Sbjct  326   SDFIGVY  332



>ref|XP_006291321.1| hypothetical protein CARUB_v10017454mg [Capsella rubella]
 gb|EOA24219.1| hypothetical protein CARUB_v10017454mg [Capsella rubella]
Length=374

 Score =   173 bits (438),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 96/239 (40%), Positives = 137/239 (57%), Gaps = 6/239 (3%)
 Frame = +3

Query  150  ILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGIN  323
            ++NL  ASGPE  A DP  +G Y GV+DGR+LK+   +  + DFA TS  R  E C    
Sbjct  48   VVNLTGASGPESIAFDPSGEGPYVGVSDGRVLKWRGESLGWTDFAYTSANR--EMCVRPF  105

Query  324  ITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDA  503
               +   CGRPLGL FD   G LY+ D ++GLL V    GGLA  L     G+ F F + 
Sbjct  106  APELEHVCGRPLGLRFDKKSGDLYIADAYFGLL-VAGPAGGLAKPLVTEAEGQTFRFTND  164

Query  504  VAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGM  683
            + +DE    +YF D   IF+   +   V + D +GR +KY  +  + TVLL GL+   G+
Sbjct  165  LDIDEQDDVIYFTDTSAIFQRRQFLAAVLNVDKTGRFIKYDRSSKKATVLLQGLAFANGV  224

Query  684  ATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            A   D++F+++ E    +I++ ++SGP A  TQ V   L G+PDN++R + G FWVAL+
Sbjct  225  ALSKDRSFVLVVETTTCKILRLWLSGPNAG-TQDVFAELPGFPDNIRRNSKGEFWVALH  282



>ref|XP_010922155.1| PREDICTED: strictosidine synthase 3-like [Elaeis guineensis]
Length=370

 Score =   173 bits (438),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 99/262 (38%), Positives = 144/262 (55%), Gaps = 7/262 (3%)
 Frame = +3

Query  81   ISILMFISSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNG  260
            +S+L+ + S +     P ++   +L L  A+GPE  A D   +G YTG++DGRILK+   
Sbjct  18   LSVLLSLDSVFHDSKNPDIE---MLPLDAATGPESIAFDAKGEGPYTGISDGRILKWQGK  74

Query  261  NFN--DFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVER  434
                 ++A         KC G    N+   CGRPLGL F    G L+V D + GLL V  
Sbjct  75   EHGWLEYAAVHAPHLLSKCRGSQDPNLEHVCGRPLGLRFSDKTGELFVADAYLGLLVVGP  134

Query  435  NNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRL  614
            ++   AT +A    G  F   + + +D  +  VYF D+   F+   Y   V +GD +GRL
Sbjct  135  DDK-FATPIAKQAQGVEFHVTNGLDIDPDSGAVYFTDSSMRFQRRQYISAVIAGDKTGRL  193

Query  615  LKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVME  794
            +KY     +V VLL+ LS P G+A   D + ++I E I  RI++Y++  PKANT + V+ 
Sbjct  194  MKYDPQSKEVQVLLDSLSFPNGVALSQDGSHLLIVETITCRILRYWLRTPKANTVE-VIA  252

Query  795  NLEGYPDNVKRGTLGGFWVALN  860
             L G+PDN+KR   GGFWVAL+
Sbjct  253  QLPGFPDNIKRSPRGGFWVALH  274



>emb|CDY45863.1| BnaC02g22570D [Brassica napus]
Length=325

 Score =   172 bits (435),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 111/297 (37%), Positives = 155/297 (52%), Gaps = 12/297 (4%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYLNGN-FNDFATTSPYRTKEKCDGINITNIRAEC  347
             SGPE  A D   +G YTGV+ G+I KYL G  F DF   +     + CDG       ++C
Sbjct  35    SGPEAFAFDSTGKGFYTGVSGGKIFKYLPGKGFVDFGYITVSSKSQWCDGALGIAYMSKC  94

Query  348   GRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTA  527
             GRP G+ F++  G LYV D   GL  V  + GG A ++A   +G++F F+D + VD  T 
Sbjct  95    GRPAGIAFNNKTGELYVADAPLGL-HVIPSGGGYAKKIADRADGKSFLFLDGLDVDPTTG  153

Query  528   DVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTF  707
              VYF      F   +  + V S D SG+L KY  +K  VTVLL GLSG AG A   D +F
Sbjct  154   VVYFTSFSSKFSPGDVLKAVASKDASGKLFKYDPSKRVVTVLLEGLSGSAGCAVSSDGSF  213

Query  708   IMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKR-GTLGGFWVALNipkpqqqp  884
             +++S++    I +Y+I G KA T++    N    PDN+KR G+ G FWVA          
Sbjct  214   VLVSQFTKSNIKRYWIKGSKAGTSED-FTNAVSNPDNIKRIGSSGNFWVA-------SVV  265

Query  885   pppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSF-SGYQEYSDIAYVGSLLSDFVAV  1052
                   T+  AV  + DG ++ T +V D F ++  S   E+    YVG+L   F  +
Sbjct  266   NTATGPTNPSAVKINSDGRVLQTISVKDKFGDTLVSEVNEFEGRLYVGTLSGPFAGI  322



>ref|XP_010428361.1| PREDICTED: strictosidine synthase 1-like [Camelina sativa]
Length=326

 Score =   172 bits (435),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 113/297 (38%), Positives = 156/297 (53%), Gaps = 12/297 (4%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYLNGN-FNDFATTSPYRTKEKCDGINITNIRAEC  347
             SGPE  A DP  +G YTGV+ G+ILKY   N F DFA  +     + C+G   T    +C
Sbjct  36    SGPESFAFDPTGKGFYTGVSGGKILKYTPENGFVDFAQMTKSSNSKWCNGALGTAFAGKC  95

Query  348   GRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTA  527
             GRP G+  +   G LYV D   GL  V    GGLAT++A  ++G+ F F+D + VD  T 
Sbjct  96    GRPSGIALNSKTGDLYVADAPLGL-HVISPAGGLATKIADSLDGKPFKFLDGLDVDPTTG  154

Query  528   DVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTF  707
              VYF      F        V   D SG+L KY  A   VT L+ GLSG AG A   D +F
Sbjct  155   VVYFTSFSSKFGPREVLIAVGLKDASGKLFKYDPATKTVTQLMEGLSGAAGCAVSSDGSF  214

Query  708   IMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKR-GTLGGFWVALNipkpqqqp  884
             +++SE+I   I +Y+I+GPKA T++    NL   PDN++R  + G FWVA  + K     
Sbjct  215   VLVSEFIKSNIKRYWITGPKAGTSED-FSNLVSNPDNIRRSASTGNFWVASVVNKVVVP-  272

Query  885   pppipMTDSIAVNFDMDGNIVNTKNVTDTFPNS-FSGYQEYSDIAYVGSLLSDFVAV  1052
                   TD  AV  D +G ++ T ++ + F N+  S   E +   Y+G+L   F  +
Sbjct  273   ------TDPKAVKIDSNGQVLQTISLNNEFGNTLLSEVNELNGHLYIGTLTGSFAGI  323



>ref|XP_004249227.1| PREDICTED: strictosidine synthase 1 [Solanum lycopersicum]
Length=372

 Score =   173 bits (438),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 97/240 (40%), Positives = 140/240 (58%), Gaps = 8/240 (3%)
 Frame = +3

Query  150  ILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN---FNDFATTSPYRTKEKCDGI  320
            +++L+ A GPE  A DP  +G YTGV DGRILK+ NG+   + DFA TS  R  ++C   
Sbjct  45   VIHLKGAVGPESIAFDPNGEGPYTGVADGRILKW-NGDSDGWVDFAVTSSQR--KECVHP  101

Query  321  NITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFID  500
                +   CGRPLGL FD   G LY+ D + GL  V   +GGLAT L   V G+   F +
Sbjct  102  FAPQMEHVCGRPLGLRFDTRTGDLYIADAYLGL-HVVGPSGGLATPLVTEVEGQPLRFTN  160

Query  501  AVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAG  680
             + +DE    +YF D    F+   +   V SGD +GRL+KY  +   VTVLL GL+   G
Sbjct  161  DLDIDEQEDVIYFTDTSTQFQRRQFVASVVSGDKTGRLMKYDKSTKSVTVLLRGLAFANG  220

Query  681  MATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            +A   D++F++++E    R++++++ GP A    T   +L GYPDN++R + G FWV L+
Sbjct  221  VALSKDKSFVLVAETSTCRVVRHWLKGPHAGKHDT-FADLPGYPDNIRRNSRGEFWVGLH  279



>ref|XP_003528253.1| PREDICTED: strictosidine synthase 3-like isoform X1 [Glycine 
max]
 gb|KHN23081.1| Strictosidine synthase 3 [Glycine soja]
Length=337

 Score =   172 bits (435),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 112/301 (37%), Positives = 170/301 (56%), Gaps = 10/301 (3%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYLN--GNFNDFATTSPYRTKEKCDGI-NITNIRA  341
             +GP+  A D +  G YTGV+DGRILKY      F +FA T   R K  CDGI + + ++ 
Sbjct  39    TGPQSLAFDSIGGGPYTGVSDGRILKYEETYSGFVEFAYTWQDRNKTICDGISDFSTLQE  98

Query  342   ECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRN-FSFIDAVAVDE  518
              CGRPLGL F +  G L++ D + GL+KV    GG ATQL A   G N F F+  V V+ 
Sbjct  99    TCGRPLGLSFYYQTGELFIADAYLGLVKVPY-YGGAATQLVAHAQGSNPFGFLSGVDVEP  157

Query  519   LTADVYFIDAGDIFRSLNYTQIVQ-SGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDI  695
              T  VYF +A   F+  +  ++++ + D SG L KY  +  Q ++LL+ L+  AG+A   
Sbjct  158   DTGTVYFTEASSGFKLRDIRELLKNTDDYSGNLYKYDPSTNQTSLLLSNLAVAAGVAVSG  217

Query  696   DQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpq  875
             + +F+++SE    RI +++++GPKANT++  ++ L G P+N+KR +   FWVA+N P   
Sbjct  218   NGSFVLVSECNAHRIRRFWLAGPKANTSEVFLQ-LPGRPENIKRNSKNEFWVAMNYPFGT  276

Query  876   qqppppipMTDSIAVNFDMDGNIVNTKNVTDTF-PNSFSGYQEYSDIAYVGSLLSDFVAV  1052
               PP P  +   + VN   DG ++    + D F   S S  QE++   Y  SL   +  +
Sbjct  277   PPPPRPPVLPLGLRVN--EDGEVLEAVPLVDEFGTESVSEIQEFNGTLYASSLHVSYANI  334

Query  1053  Y  1055
             +
Sbjct  335   F  335



>ref|XP_002452976.1| hypothetical protein SORBIDRAFT_04g035870 [Sorghum bicolor]
 gb|EES05952.1| hypothetical protein SORBIDRAFT_04g035870 [Sorghum bicolor]
Length=346

 Score =   172 bits (436),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 111/299 (37%), Positives = 163/299 (55%), Gaps = 14/299 (5%)
 Frame = +3

Query  174   GPEDTAIDPLDQGIYTGVTDGRILKYLNGNFNDFATT--SPYRTKEKCDGINITN---IR  338
             GPE  A D    G Y+GV+DGR+LK+ NG    ++T   SP    E C            
Sbjct  52    GPESVAFDGAGAGPYSGVSDGRVLKW-NGFARGWSTYAYSPGYDAEACTASRARPAELTE  110

Query  339   AECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDE  518
             ++CGRPLGL F    G LY+ D + GL++V R  GG AT LAA V+G    F + V VD+
Sbjct  111   SKCGRPLGLRFHRRSGNLYIADAYKGLMRV-RPGGGEATVLAAEVDGVPLRFTNGVDVDQ  169

Query  519   LTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDID  698
             +T DV+F D+   +    + ++  +GD+SGRL+KY    GQVTVL  G++ P G+A   D
Sbjct  170   VTGDVFFTDSSMNYPRSQHERVTATGDSSGRLMKYDPRTGQVTVLQAGITYPNGLAISAD  229

Query  699   QTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqq  878
             +T ++++     ++++Y+I GPKA T++  + +L GYPDNV+    GGFWVAL+  K + 
Sbjct  230   RTHLVVALTGPCKLMRYWIEGPKAGTSEH-LADLPGYPDNVRADGRGGFWVALHREKMEL  288

Query  879   qppppipMTDSIAVNFDMDGNIVNT-KNVTDTFPNSFSGYQEYSDIAYVGSLLSDFVAV  1052
                P   +   +AV    DG +V   K      P      +      Y+GS+   +VAV
Sbjct  289   PFGPDSHL---LAVRVGADGQMVQVMKGPKSVRPTEV--VERDGGKLYMGSVELPYVAV  342



>gb|EYU18642.1| hypothetical protein MIMGU_mgv1a008518mg [Erythranthe guttata]
Length=371

 Score =   172 bits (437),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 92/236 (39%), Positives = 135/236 (57%), Gaps = 4/236 (2%)
 Frame = +3

Query  153  LNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGNFNDFATTSPYRTKEKCDGINITN  332
            ++L  A GPE    DP   G YTGV DGRILK+   N+ +F+ TS  R  E+C       
Sbjct  47   IHLPGAVGPESLVFDPSGGGPYTGVADGRILKWNGKNWLEFSVTSSQR--EECSEAFNPT  104

Query  333  IRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAV  512
            +   CGRPLGL F    G LY+ D + GL +V    GG+A+ L   V+G  F F + + +
Sbjct  105  MEHVCGRPLGLRFHRKSGDLYIADAYLGL-QVVGPRGGMASPLVTHVHGNKFLFTNDIDI  163

Query  513  DELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATD  692
            DE    +YF D+  +F    +   + + D +G+L+KY  +  QVT+LL GL+   G+A  
Sbjct  164  DEEDNAIYFTDSSTVFHRREFMPSILTMDKTGKLMKYDISSKQVTILLQGLAFANGVALS  223

Query  693  IDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
             D++F++++E   RRI++Y++ GP      T +E L G PDNV+R   G FWVAL+
Sbjct  224  KDRSFVLVAETTNRRILRYWLQGPNIGKHDTFVE-LPGLPDNVRRNQEGEFWVALH  278



>ref|XP_009797408.1| PREDICTED: strictosidine synthase 1-like [Nicotiana sylvestris]
Length=372

 Score =   172 bits (437),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 103/268 (38%), Positives = 152/268 (57%), Gaps = 12/268 (4%)
 Frame = +3

Query  81   ISILMFISS------PYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRI  242
            I++++ +SS      P +  S+  +    ++ L+ A GPE  A DP  +G YTGV DGRI
Sbjct  16   ITVILTLSSKNVYRPPSIAGSKDLLSKAEVIQLKGAVGPESLAFDPNGEGPYTGVADGRI  75

Query  243  LKYL--NGNFNDFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYG  416
            LK+   +  + DFA TS  R  ++C      ++   CGRPLGL FD   G LY+ D + G
Sbjct  76   LKWQGDSQGWVDFAVTSSQR--KECVRPFAPHMEHVCGRPLGLRFDTRTGDLYIADAYLG  133

Query  417  LLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSG  596
            L +V   +GGLAT L   V G+   F + + +DE    +YF D    F+   +   V  G
Sbjct  134  L-QVVGPSGGLATPLVTEVEGQPLRFTNDMDLDEQEDIIYFTDTSTQFQRRQFIASVVIG  192

Query  597  DTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANT  776
            D +GRL+KY  +   VTVLL GL+   G+A   D++F++++E    RI+KY++ GP A  
Sbjct  193  DKTGRLMKYDKSTKAVTVLLRGLAFANGVALSKDKSFVLVAETSTGRIVKYWLKGPDAGK  252

Query  777  TQTVMENLEGYPDNVKRGTLGGFWVALN  860
              T   +L GYPDN++R + G FWVAL+
Sbjct  253  HAT-FADLPGYPDNIRRNSRGEFWVALH  279



>ref|XP_008243874.1| PREDICTED: strictosidine synthase 3-like [Prunus mume]
Length=357

 Score =   172 bits (436),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 114/311 (37%), Positives = 162/311 (52%), Gaps = 15/311 (5%)
 Frame = +3

Query  153   LNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGNFN--DFATTSPYRTKEKCDG-IN  323
             + L    GPE  A D   QG Y GV+DG ILK+   +    +FA TSP R ++ CDG  N
Sbjct  48    IELARVVGPESIAFDCHGQGPYVGVSDGTILKWQGPSLGWIEFAFTSPDRPRKLCDGSTN  107

Query  324   ITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDA  503
              TN    CGRPLGL F+     LY+ D ++GLLK    NGG    LA+ + G    F +A
Sbjct  108   ATN-EPICGRPLGLKFNPKTCDLYIADAYFGLLKTG-PNGGKPEVLASSLGGVPLMFTNA  165

Query  504   VAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGM  683
             + VDE T  VYF D   +F+   + Q + +GD +GRLLKY     +VTVLL+ L+   G+
Sbjct  166   LDVDEETGIVYFTDTSTVFQRRVWMQSILAGDKTGRLLKYDPCTKEVTVLLHDLAFANGV  225

Query  684   ATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNi  863
             A   D++FI+++E     I + ++ GPKA   + +   LE  PDN+K    G FWVALN 
Sbjct  226   ALSKDKSFILVAESAPFTIHRLWLRGPKAPAFE-LFAQLERPPDNIKSNNRGEFWVALNS  284

Query  864   ------pkpqqqppppipMTDSIAVNFDMDGNIVNTKNVTDTFP--NSFSGYQEYSDIAY  1019
                             + + D +A  FD  G +V   +  +  P   S S  +E +   +
Sbjct  285   GRGVKEVVNIATSDKWLNVNDPVAAKFDEQGTVVQVLD-GEGGPALESVSEVEEQNGNLW  343

Query  1020  VGSLLSDFVAV  1052
             VGS++  +V V
Sbjct  344   VGSVVKPYVGV  354



>emb|CDX73038.1| BnaC06g34860D [Brassica napus]
Length=325

 Score =   171 bits (434),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 106/297 (36%), Positives = 155/297 (52%), Gaps = 11/297 (4%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYLNGN-FNDFATTSPYRTKEKCDGINITNIRAEC  347
             SGPE  AID   +G +TGV+ G+IL Y  G  + +FA  +     + CDG   T    +C
Sbjct  34    SGPEAFAIDSTGKGFFTGVSGGKILSYTPGKGYIEFAYMTESSKSQWCDGALGTANAGKC  93

Query  348   GRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTA  527
             GRP GL F+     LYV D   GL  V    G +A ++A  V+G+ F F+D + VD  T 
Sbjct  94    GRPAGLAFNDITRELYVADAVLGLHVVHAVFGSMAKKIADSVDGKPFVFLDGLDVDNTTG  153

Query  528   DVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTF  707
              VYF      F + +  + V S D +G+L KY  +K +VTVLL GLSG AG A   D +F
Sbjct  154   VVYFTSFSSKFSAGDVLKAVASKDATGKLFKYDPSKKKVTVLLEGLSGSAGCAVSSDGSF  213

Query  708   IMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKR-GTLGGFWVALNipkpqqqp  884
             +++ ++    I +Y+I GPKA +++    N    PDN+KR G+ G FWVA          
Sbjct  214   VLVGQFTKSNIKRYWIKGPKAGSSED-FTNAVSNPDNIKRIGSTGNFWVA-------SVV  265

Query  885   pppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSF-SGYQEYSDIAYVGSLLSDFVAV  1052
                  +T+  AV  + DG ++ T ++ D F ++  S   E     Y+G+L   F  +
Sbjct  266   NTATGITNPSAVKVNSDGKVLQTISLKDKFGDTLVSEVNESQGKLYIGTLFGPFAGI  322



>ref|XP_010269382.1| PREDICTED: strictosidine synthase 1-like [Nelumbo nucifera]
Length=371

 Score =   172 bits (437),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 91/239 (38%), Positives = 138/239 (58%), Gaps = 6/239 (3%)
 Frame = +3

Query  150  ILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLN--GNFNDFATTSPYRTKEKCDGIN  323
            ++ L  A GPE  A DP  +G YTGV DGRILK+      + +FA TSP R  + C    
Sbjct  44   VIPLVGAVGPESLAFDPNGEGPYTGVADGRILKWQGEGQGWTEFAVTSPQR--KDCVQPQ  101

Query  324  ITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDA  503
              ++   CGRPLG+ F    G LY+ D + G  +V    GGLAT+L     G   +F + 
Sbjct  102  APHMEHVCGRPLGIRFHPTTGDLYIADSYLGFHRVG-PAGGLATRLITEAEGEPLTFTND  160

Query  504  VAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGM  683
            + +DE    +YF D    F+   +  ++ SGD +GRL+KY  ++ +V VLL GL+   G+
Sbjct  161  LDIDEHEDVIYFTDTSTKFQRRQFISVILSGDKTGRLMKYDRSRNEVKVLLRGLAFANGV  220

Query  684  ATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            A   D++F++++E    R++++++ GPKA  T  V   L G+PDN++R + G FWVAL+
Sbjct  221  ALSKDRSFVLVAETTNCRVLRFWLQGPKAG-THDVFAELPGFPDNIRRNSKGEFWVALH  278



>ref|XP_009106058.1| PREDICTED: strictosidine synthase 3-like [Brassica rapa]
 emb|CDX96506.1| BnaA07g31170D [Brassica napus]
Length=325

 Score =   171 bits (433),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 116/333 (35%), Positives = 168/333 (50%), Gaps = 15/333 (5%)
 Frame = +3

Query  63    SLTMFWISILMFISSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRI  242
             +L++F IS+L    SP V        F  +    + SG E  AID   +G YTGV+ G+I
Sbjct  2     TLSIFLISLLSL--SPVVFSDD--ASFQKLPVPGNRSGTEAFAIDSTGKGFYTGVSGGKI  57

Query  243   LKYLNGN-FNDFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGL  419
             L Y  G  + +FA  +     + CDG   T    +CGRP GL F+     LYV D   GL
Sbjct  58    LSYTPGKGYIEFAYMTKSSKSQWCDGALGTANAGKCGRPAGLAFNDITRELYVADAVLGL  117

Query  420   LKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGD  599
               V    G +A ++A  V+G+ F F+D + VD  T  VYF      F + +  + V S D
Sbjct  118   HVVHAVFGSMAKKIADSVDGKPFVFLDGLDVDNTTGVVYFTSFSSKFSAGDVLKAVASKD  177

Query  600   TSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTT  779
              +G+L KY  AK  VTVLL GLSG AG A   D +F+++ ++    I +Y+I GPKA ++
Sbjct  178   ATGKLFKYDPAKKVVTVLLEGLSGSAGCAVSSDGSFVLVGQFTKSNIKRYWIKGPKAGSS  237

Query  780   QTVMENLEGYPDNVKR-GTLGGFWVALNipkpqqqppppipMTDSIAVNFDMDGNIVNTK  956
             +    N    PDN+KR G+ G FWVA               +T+  AV  + DG ++ T 
Sbjct  238   ED-FTNAVSNPDNIKRIGSTGNFWVA-------SVVSTATGITNPSAVKVNSDGKVLQTI  289

Query  957   NVTDTFPNSF-SGYQEYSDIAYVGSLLSDFVAV  1052
             ++ D F ++  S   E     Y+G+L   F  +
Sbjct  290   SLKDEFGDTLVSEVNESQGKLYIGTLFGPFSGI  322



>emb|CDX73039.1| BnaC06g34870D [Brassica napus]
Length=326

 Score =   171 bits (433),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 110/297 (37%), Positives = 152/297 (51%), Gaps = 12/297 (4%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKY-LNGNFNDFATTSPYRTKEKCDGINITNIRAEC  347
             SGPE  A D   +  +TGV+ G+ILKY  +  F DFA  +       CDGI  T +  +C
Sbjct  36    SGPEAFAFDTTGKAFFTGVSGGKILKYTADKGFEDFAEITTTSNSSWCDGIAGTALAGKC  95

Query  348   GRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTA  527
             GRP G+ F+   G LYV D   GL  V    GGLAT++A  V+G  F F+D + VD  T 
Sbjct  96    GRPAGIAFNPKTGDLYVADAPLGL-HVIPPAGGLATKIADSVDGTPFKFLDGLDVDPTTG  154

Query  528   DVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTF  707
              VYF      F        V   D SG+L KY  A   VTVL+ G+SG AG A   D +F
Sbjct  155   VVYFTSFSSKFSPSEVLIAVGLKDASGKLFKYDPATKAVTVLMEGISGGAGCAVSSDGSF  214

Query  708   IMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKR-GTLGGFWVALNipkpqqqp  884
             ++++E+I   I KY+I+GPKA +T+    ++   PDN+KR G  G FWVA          
Sbjct  215   VLVTEFIKSNIKKYWITGPKAGSTEDFTSSVSN-PDNIKRIGATGNFWVA-------SVK  266

Query  885   pppipMTDSIAVNFDMDGNIVNTKNVTDTFPNS-FSGYQEYSDIAYVGSLLSDFVAV  1052
                +  TD  AV  D  G ++   ++ + F ++  S   E     Y+G+L   F  +
Sbjct  267   NKVVVPTDPSAVKIDYSGKVLQAISLKNEFGDTLLSEANELDGKLYIGTLTGPFAGI  323



>ref|XP_009116408.1| PREDICTED: strictosidine synthase 1 [Brassica rapa]
Length=374

 Score =   172 bits (436),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 95/239 (40%), Positives = 139/239 (58%), Gaps = 6/239 (3%)
 Frame = +3

Query  150  ILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGIN  323
            +LNL  ASGPE  A DP  +G Y GV+DGR+LK+   +  ++DFA TS  R  EKC    
Sbjct  48   VLNLTGASGPESIAFDPSGEGPYVGVSDGRVLKWRGESLGWSDFAYTSANR--EKCVRPF  105

Query  324  ITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDA  503
               +   CGRPLGL FD   G LY+ D ++GL+ V    GGLA  L     G+ F F + 
Sbjct  106  APELEHVCGRPLGLRFDEKTGDLYIADAYFGLMIVG-PAGGLAKSLVTEAEGQPFRFTND  164

Query  504  VAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGM  683
            + +DE    +YF D    F+   +   V + D +GRL+KY     +VTVL+ G++   G+
Sbjct  165  LDIDEHQDVIYFTDTSTRFQRRQFLAAVLNVDKTGRLIKYDRTSKKVTVLVQGIAFANGV  224

Query  684  ATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            A   D++F++++E    +I++ ++SGP A   Q V   L G+PDN++R + G FWVAL+
Sbjct  225  ALSKDRSFVLVAETTTCKILRLWLSGPNAG-AQDVFAELPGFPDNIRRNSNGEFWVALH  282



>ref|XP_010416233.1| PREDICTED: strictosidine synthase 3 [Camelina sativa]
Length=327

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 107/297 (36%), Positives = 157/297 (53%), Gaps = 12/297 (4%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYLNGN-FNDFATTSPYRTKEKCDGINITNIRAEC  347
             +GPE  A D   +G YTGV+ G+ILK+L G  + DFA  +       CDG   T    +C
Sbjct  37    TGPEAFAFDSTGKGFYTGVSGGKILKWLPGKGYVDFAQITGSSKSSLCDGALGTVNAGKC  96

Query  348   GRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTA  527
             GRP G+ F+   G LYV+D   GL  V  + GGLA ++A  VNG+ F F+D + +D  T 
Sbjct  97    GRPAGIAFNGKTGDLYVSDAPLGL-HVISSGGGLAKKIADSVNGKPFLFLDGLDIDPTTG  155

Query  528   DVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTF  707
              VYF      F   +  + V + D++G+L KY  +K  VTVL+ GLSG AG A   D +F
Sbjct  156   VVYFTSFSSTFGPRDVLKAVATKDSTGKLFKYDPSKKVVTVLMEGLSGSAGCAVSSDGSF  215

Query  708   IMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKR-GTLGGFWVALNipkpqqqp  884
             +++S++    I +Y+I G KA T++    ++   PDN+KR G+ G FWVA          
Sbjct  216   VLVSQFTKSNIKRYWIKGSKAGTSEDFTNSVSS-PDNIKRIGSSGNFWVA-------SVV  267

Query  885   pppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSF-SGYQEYSDIAYVGSLLSDFVAV  1052
                   T+  AV    DG ++ T    D F ++  S   E++   Y+G+L   F  +
Sbjct  268   NSATGPTNPSAVKVRSDGKVLQTIPFKDKFGDTLVSEVNEFNGKIYIGALFGPFAGI  324



>ref|XP_004150130.1| PREDICTED: strictosidine synthase 1-like [Cucumis sativus]
 gb|KGN50870.1| hypothetical protein Csa_5G305760 [Cucumis sativus]
Length=350

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/231 (41%), Positives = 136/231 (59%), Gaps = 6/231 (3%)
 Frame = +3

Query  174  GPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRAEC  347
            GPE  A D   +G Y  V+DGRILK+   +  +  FA TSP R  ++CDG   +   A C
Sbjct  38   GPESIAFDCRGEGPYASVSDGRILKWKGPHLGWTQFALTSPNREGKECDGQPQSE--AAC  95

Query  348  GRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTA  527
            GRPLG+ F      LY+ D ++GLL V    GGLA QLA    G    F +A+ +D    
Sbjct  96   GRPLGIKFHPTTCDLYIADAYFGLLAVG-PKGGLARQLATSAQGVPLRFTNALDIDPQNG  154

Query  528  DVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTF  707
             VYF D+  +F+   +   + +GD +GRLLKY      VTVL NGL+ P G+A + D +F
Sbjct  155  IVYFTDSSILFQRRVWLLSIMNGDKTGRLLKYDPRTQNVTVLRNGLAFPNGVALNADSSF  214

Query  708  IMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            ++++E    +++K+++ GPKANT + +   LE +PDN+KR   G FW+A+N
Sbjct  215  LLMAETGTLQVLKFWLKGPKANTME-IFAQLERFPDNIKRTDNGDFWIAMN  264



>ref|XP_008244837.1| PREDICTED: strictosidine synthase 1 [Prunus mume]
Length=375

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/239 (41%), Positives = 139/239 (58%), Gaps = 6/239 (3%)
 Frame = +3

Query  150  ILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGIN  323
            ++ +  A GPE  A DP   G YTGV DGRILK+   +  + DFA TS  R  ++C    
Sbjct  49   LIQVPGALGPESLAFDPNGGGPYTGVADGRILKWDQNDRRWTDFAVTSSQR--KECIRPF  106

Query  324  ITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDA  503
               +   CGRPLGL FD   G LY+ D + GL +V    GGLA+Q+   V G+   F + 
Sbjct  107  APELEHVCGRPLGLKFDTKTGDLYIADAYLGL-QVVGPAGGLASQVVREVEGQPLRFTND  165

Query  504  VAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGM  683
            + +DE    +YF D+  IF    +   V +GD +GRLLKY+ +  +VTVLL GL+   G+
Sbjct  166  MDIDEHKDVIYFTDSSTIFHRRQFMSSVLNGDRTGRLLKYNKSNKEVTVLLRGLAFANGV  225

Query  684  ATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            A   D +F++++E    RI++ ++ GP A  T T  E L G+PDN++R + G FWVAL+
Sbjct  226  ALSKDHSFVLVAETTTCRILRLWLHGPNAGNTDTFAE-LPGFPDNIRRNSKGEFWVALH  283



>ref|XP_004978210.1| PREDICTED: strictosidine synthase 1-like [Setaria italica]
Length=346

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 108/305 (35%), Positives = 170/305 (56%), Gaps = 20/305 (7%)
 Frame = +3

Query  174   GPEDTAIDPLDQGIYTGVTDGRILKYLNGNFNDFATT--SPYRTKEKCDGINITN---IR  338
             GPE  A D    G Y+GV+DGR+LK+ NG+   ++T   SP    + C    +       
Sbjct  53    GPESVAFDGAGAGPYSGVSDGRVLKW-NGHARGWSTYAYSPGYNAKACTASRVRPAEVTE  111

Query  339   AECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDE  518
             + CGRPLGL F +  G LY+ D + GL++V    GG AT +A  V+G+   F + V VD+
Sbjct  112   SMCGRPLGLRFHYGSGDLYIADAYKGLMRVG-PGGGEATVVATMVDGKPLRFTNGVDVDQ  170

Query  519   LTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDID  698
             +T +VYF D+   +    + ++  +GD++GRL+KY      VTVL +G++ P G+A   D
Sbjct  171   VTGEVYFTDSSMKYSRSQHERVTATGDSTGRLMKYDPKTDHVTVLQSGITYPNGLAISAD  230

Query  699   QTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqq  878
             +T ++++     ++++Y+I+GPK  T++T + +L GYPDNV+    GGFWVAL+  K + 
Sbjct  231   RTHLVVALTGPCKLMRYWITGPKVGTSET-LADLPGYPDNVRPDGRGGFWVALHREKMEL  289

Query  879   qppppipMTDSIAVNFDMDGNIVNT----KNVTDTFPNSFSGYQEYSDIAYVGSLLSDFV  1046
                P   +   +AV  D DG ++      KNV  T      G +      Y+GS+   +V
Sbjct  290   PFGPDRHL---LAVRIDADGKVLQVMRGPKNVRPTEVVERKGGK-----LYMGSVELPYV  341

Query  1047  AVYTA  1061
             AV +A
Sbjct  342   AVVSA  346



>gb|EPS66876.1| hypothetical protein M569_07898, partial [Genlisea aurea]
Length=383

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/237 (41%), Positives = 132/237 (56%), Gaps = 7/237 (3%)
 Frame = +3

Query  159  LQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGNFNDFATTSPYRTKEKCDG----INI  326
            L    GPE  A DP+ +G YTGV DGRIL +    +  FA TSP R++  CD      + 
Sbjct  60   LDQVQGPESLAFDPIGRGPYTGVADGRILFWDGQKWTHFAHTSPNRSQGLCDPKPSITDY  119

Query  327  TNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAV  506
            ++    CGRPLGL FD   G LY+ D + GL+KV    GGLAT LA    G    F + +
Sbjct  120  SDNEHICGRPLGLRFDKRNGDLYIADAYLGLMKVG-PRGGLATSLATEAEGIPLGFTNDL  178

Query  507  AVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMA  686
             +DE   +VYF D+   +R  NY Q++ + D +GRL+KY     Q  VL+  L  P G++
Sbjct  179  DIDE-HGNVYFSDSSTNYRRRNYMQLIYTADNTGRLIKYDPTTKQTRVLVRNLQFPNGVS  237

Query  687  TDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVAL  857
               D +F    E+   R+ KY++ G KA TT+ +M  L GYPDNV+    G FWVA+
Sbjct  238  LSKDGSFFAYCEFSRARLSKYWLKGEKAGTTE-IMAALPGYPDNVRTNEEGEFWVAV  293



>ref|XP_002888957.1| strictosidine synthase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65216.1| strictosidine synthase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=326

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 112/297 (38%), Positives = 152/297 (51%), Gaps = 12/297 (4%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYL-NGNFNDFATTSPYRTKEKCDGINITNIRAEC  347
             SGPE  A D    G YTGV+ G+ILKY+ +  + DFA  +       C+G   T    +C
Sbjct  36    SGPESFAFDSTGNGFYTGVSGGKILKYVPDKGYVDFAQITESSNSAWCNGALGTAFAGKC  95

Query  348   GRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTA  527
             GRP G+  +   G LYV D   GL  V    GGLAT+LA  V+G+ F F+D + VD  T 
Sbjct  96    GRPAGIALNSKTGDLYVADAPLGL-HVIPPAGGLATKLADSVDGKPFKFLDGLDVDPTTG  154

Query  528   DVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTF  707
              VYF      F        V   D SG+L KY  A   VT L+ GLSG AG A   D +F
Sbjct  155   VVYFTSFSSKFGPREVLIAVGLKDASGKLFKYDPATKAVTELMQGLSGAAGCAVSSDGSF  214

Query  708   IMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKR-GTLGGFWVALNipkpqqqp  884
             +++SE+I   I +Y+I GPKA T +    +L   PDN++R G+ G FWVA          
Sbjct  215   VVVSEFIKSNIKRYWIKGPKAGTIED-FSSLVSNPDNIRRVGSTGNFWVA-------SVV  266

Query  885   pppipMTDSIAVNFDMDGNIVNTKNVTDTFPNS-FSGYQEYSDIAYVGSLLSDFVAV  1052
                +  TD  AV  D +G ++ T  + + F N+  S   E++   Y+G+L   F  V
Sbjct  267   NKVVMPTDPKAVKLDANGKVLQTIFLKNEFGNTLLSEVNEFNGHLYIGTLTGPFAGV  323



>ref|XP_010108510.1| Strictosidine synthase 1 [Morus notabilis]
 gb|EXC19610.1| Strictosidine synthase 1 [Morus notabilis]
Length=386

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/234 (41%), Positives = 137/234 (59%), Gaps = 7/234 (3%)
 Frame = +3

Query  168  ASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRA  341
            A GPE  A D L  G YTGV+DGRI+K+      + DFA TSP R+   C+G +  ++  
Sbjct  61   ALGPESYAFDSLGDGPYTGVSDGRIIKWQEDQRRWIDFAVTSPNRSS--CEGSHDHHLTE  118

Query  342  E-CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDE  518
              CGRPLGL F    G LY+ D + GLL V    GGLAT++     G  F+F + + +++
Sbjct  119  HICGRPLGLSFHKTSGDLYIADAYMGLLVVG-AEGGLATRVVTQAQGVPFAFPNGLDIND  177

Query  519  LTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDID  698
                VYF D+   ++  NY  ++ SGDT+GRL+ Y     QV VLL  LS P G+A   +
Sbjct  178  ENGLVYFTDSSSRYQRRNYLSVILSGDTTGRLMSYDPQSKQVDVLLENLSFPNGVALSQN  237

Query  699  QTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
              F++I+E    RI++Y++  PKA T + V   L G+PDN+K    GGFWVA++
Sbjct  238  GDFLLIAETTSCRIMRYWLRTPKAGTFE-VFSQLPGFPDNIKGSPRGGFWVAIH  290



>ref|XP_008465977.1| PREDICTED: strictosidine synthase 1-like [Cucumis melo]
Length=371

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 95/231 (41%), Positives = 136/231 (59%), Gaps = 6/231 (3%)
 Frame = +3

Query  174  GPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRAEC  347
            GPE  A D   +G Y  V+DGRILK+   +  +  FA TSP R  ++CDG   +   A C
Sbjct  58   GPESIAFDCRGEGPYASVSDGRILKWKGPDLGWTQFALTSPNREGKECDGQPQSE--AAC  115

Query  348  GRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTA  527
            GRPLG+ F      LY+ D ++GLL V    GGLA QLA    G    F +A+ +D    
Sbjct  116  GRPLGIKFHPTTCDLYIADAYFGLLAVG-PKGGLARQLATSAQGVPLRFTNALDIDPQNG  174

Query  528  DVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTF  707
             VYF D+  +F+   +   + +GD +GRLLKY      VTVL NGL+ P G+A + D +F
Sbjct  175  VVYFTDSSILFQRRVWLLSIMNGDKTGRLLKYDPRTQNVTVLRNGLAFPNGVALNADSSF  234

Query  708  IMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            ++++E    +I+K+++ GPKANT + +   LE +PDN+KR   G FW+A+N
Sbjct  235  LLMAETGTLQILKFWLKGPKANTME-IFAQLERFPDNIKRTDNGDFWIAMN  284



>ref|XP_010430839.1| PREDICTED: strictosidine synthase 1-like [Camelina sativa]
Length=315

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 107/304 (35%), Positives = 155/304 (51%), Gaps = 13/304 (4%)
 Frame = +3

Query  150   ILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNG--NFNDFATTSPYRTKEKCDGIN  323
             ++NL   SGPE  A DP  +G Y GV DGR+LK+      + DFA T   R  + C    
Sbjct  21    VVNLVGTSGPESIAFDPAGEGPYVGVADGRVLKWRGKLLGWTDFAYTMANR--QICVLPF  78

Query  324   ITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDA  503
                +   CGRPLGL F    G LY+ D ++GLL V    GGLA  L     G+ F F + 
Sbjct  79    APELEHVCGRPLGLRFHKKTGDLYIADAYFGLLIVG-PAGGLAKPLVTEAEGQPFRFTND  137

Query  504   VAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGM  683
             + +DE    VYF DA   F+   Y +   + D +GR +KY  +  + TVLL+G+S   G+
Sbjct  138   LDIDEENDVVYFTDASSKFQRWEYFRSFLNVDKTGRFIKYDRSSKKATVLLHGISFANGV  197

Query  684   ATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNi  863
             A   D++F++++E    +I++ ++SGPKA  TQ V   L GYPDN++R + G FWVALN 
Sbjct  198   ALSKDRSFVLVAETTNCKILRLWLSGPKAG-TQDVFVVLPGYPDNIRRNSKGEFWVALN-  255

Query  864   pkpqqqppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSFSGYQEYSDIAYVGSLLSDF  1043
                         +  + AV     G ++             S  +E     ++GS ++ F
Sbjct  256   ------SLINEEIRYTKAVKLSESGKVLEALGDKANRLQFISDVEEKDGKIWIGSSVAPF  309

Query  1044  VAVY  1055
             V VY
Sbjct  310   VGVY  313



>ref|XP_009128018.1| PREDICTED: strictosidine synthase 3-like [Brassica rapa]
Length=325

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 110/297 (37%), Positives = 154/297 (52%), Gaps = 12/297 (4%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYLNGN-FNDFATTSPYRTKEKCDGINITNIRAEC  347
             SGPE  A D   +G YTGV+ G+I KYL G  + DF   +     + CDG       ++C
Sbjct  35    SGPEAFAFDSTGKGFYTGVSGGKIFKYLPGKGYVDFGYITVSSKSQWCDGALGIAYMSKC  94

Query  348   GRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTA  527
             GRP G+ F++  G LYV D   GL  V  + GG A ++A   +G+ F F+D + VD  T 
Sbjct  95    GRPAGIAFNNKTGELYVADAPLGL-HVIPSGGGYAKKIADSADGKPFLFLDGLDVDPTTG  153

Query  528   DVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTF  707
              VYF      F   +  + V S D SG+L KY  +K  VTVLL GLSG AG A   D +F
Sbjct  154   VVYFTSFSSKFSPGDVLKAVASKDASGKLFKYDPSKRVVTVLLEGLSGSAGCAVSSDGSF  213

Query  708   IMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKR-GTLGGFWVALNipkpqqqp  884
             +++S++    I +Y+I G KA T++    N    PDN+KR G+ G FWVA          
Sbjct  214   VLVSQFTKSNIKRYWIKGSKAGTSED-FTNAVSNPDNIKRIGSSGNFWVA-------SVV  265

Query  885   pppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSF-SGYQEYSDIAYVGSLLSDFVAV  1052
                   T+  AV  + DG ++ T +V D F ++  S   E+    YVG+L   F  +
Sbjct  266   NTATGPTNPSAVKINSDGRVLQTISVKDKFGDTLVSEVNEFEGRLYVGTLSGPFAGI  322



>ref|XP_007204530.1| hypothetical protein PRUPE_ppa017675mg, partial [Prunus persica]
 gb|EMJ05729.1| hypothetical protein PRUPE_ppa017675mg, partial [Prunus persica]
Length=340

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 95/239 (40%), Positives = 139/239 (58%), Gaps = 6/239 (3%)
 Frame = +3

Query  150  ILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGIN  323
            ++ +  A GPE  A DP   G YTGV DGRILK+   +  + DFA TS  R  ++C    
Sbjct  14   LIQVPGALGPESLAFDPNGGGPYTGVADGRILKWDQNDRRWTDFAVTSSQR--KECIRPF  71

Query  324  ITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDA  503
               +   CGRPLGL FD   G LY+ D + GL +V    GGLA+Q+   V G+   F + 
Sbjct  72   APELEHVCGRPLGLKFDTETGDLYIADAYLGL-QVVGPAGGLASQVVREVEGQPLRFTND  130

Query  504  VAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGM  683
            + +DE    +YF D+  +F    +   + +GD +GRLLKY+ +  +VTVLL GL+   G+
Sbjct  131  MDIDEHKDVIYFTDSSTVFHRRQFMSSILNGDRTGRLLKYNKSNKEVTVLLRGLAFANGV  190

Query  684  ATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            A   D +F++++E    RI++ ++ GP A  T T  E L G+PDN++R + G FWVAL+
Sbjct  191  ALSKDHSFVLVAETTTCRILRLWLHGPNAGNTDTFAE-LPGFPDNIRRNSKGEFWVALH  248



>ref|XP_010655934.1| PREDICTED: strictosidine synthase 1-like [Vitis vinifera]
 emb|CBI28989.3| unnamed protein product [Vitis vinifera]
Length=273

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/227 (41%), Positives = 130/227 (57%), Gaps = 4/227 (2%)
 Frame = +3

Query  171  SGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRAE  344
            SGPE  A D    G YTG++DG+ILK+      + +FA TSP R  + CDG     +   
Sbjct  38   SGPESIAFDCNGDGPYTGISDGKILKWQGSKHGWKEFAITSPLRIPKFCDGSANPAMEQV  97

Query  345  CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELT  524
            CGRPLGL F+ A   LY+ D ++GLL V RN GG+A Q+A    G  F F +A+ +D+ T
Sbjct  98   CGRPLGLKFNEATCDLYIADAYFGLLVVRRN-GGVAKQVAISAEGVPFRFTNALDIDQNT  156

Query  525  ADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQT  704
              VYF D   IF+   Y   +Q+GD + RLLKY     +VT+LL GLS   G+A   D  
Sbjct  157  GVVYFTDTSTIFQRWAYAIAMQTGDKTRRLLKYDPRSKEVTMLLRGLSFSNGVALSQDND  216

Query  705  FIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGF  845
            F++++E    ++ +Y++ G K+  + T    L G PDN++R   G F
Sbjct  217  FVLVTETTAAKVTRYWLQGQKSQLSDT-FTRLVGCPDNIQRNIHGEF  262



>ref|XP_010425613.1| PREDICTED: strictosidine synthase 3-like [Camelina sativa]
Length=340

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 107/304 (35%), Positives = 155/304 (51%), Gaps = 13/304 (4%)
 Frame = +3

Query  150   ILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNG--NFNDFATTSPYRTKEKCDGIN  323
             ++NL   SGPE  A DP  +G Y GV DGR+LK+      + DFA T+  R  + C    
Sbjct  46    VVNLVGTSGPESIAFDPAGEGPYVGVADGRVLKWRGKLLGWTDFAYTTANR--QICVLPF  103

Query  324   ITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDA  503
                +   CGRPLGL F    G LY+ D ++GLL V    GGLA  L     G+ F F + 
Sbjct  104   APELEHVCGRPLGLRFHKKTGDLYIADAYFGLLIVG-PAGGLAKPLVTEAEGQPFRFTND  162

Query  504   VAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGM  683
             + +DE    VYF DA   F+   Y +   + D +GR +KY  +  + TVLL+G+S   G+
Sbjct  163   LDIDEQNDVVYFTDASSKFQRWEYFRSFLNVDKTGRFIKYDRSSKKATVLLHGISFANGV  222

Query  684   ATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNi  863
             A   D +F++++E    +I++ ++SGPKA  TQ V   L GYPDN++R + G FWVALN 
Sbjct  223   ALSKDWSFVLVAETTNCKILRLWLSGPKAG-TQDVFVVLPGYPDNIRRNSKGEFWVALN-  280

Query  864   pkpqqqppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSFSGYQEYSDIAYVGSLLSDF  1043
                         +  + AV     G ++             S  +E     ++GS ++ F
Sbjct  281   ------SLINEEIRYTKAVKLSESGKVLEVLGDKANRLQFISDVEEKDGKLWIGSSVAPF  334

Query  1044  VAVY  1055
             V VY
Sbjct  335   VGVY  338



>ref|XP_006344500.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Solanum tuberosum]
Length=388

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 104/279 (37%), Positives = 152/279 (54%), Gaps = 14/279 (5%)
 Frame = +3

Query  54   NMKSLTMFWISI----LMFISSPYVIHSQPGVD---FPIILNLQHASGPEDTAIDPLDQG  212
            N  S    WI+I    ++ I S +     P +D     +I  +  A GPE  A DP   G
Sbjct  7    NSSSTFKVWIAIGATIIVVIWSFFRFEENPLIDRRFVEVIRIVGGAVGPESFAFDPHGDG  66

Query  213  IYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGIN-ITNIRAECGRPLGLDFDHAR  383
             YTGV+DGRI+K+L     + DFA TSP R  + C+G +  +    +CGRPLGL+FD   
Sbjct  67   PYTGVSDGRIIKWLQNETRWFDFALTSPNR--DGCEGFHDHSTSEHKCGRPLGLEFDENS  124

Query  384  GVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFR  563
            G L++ D + GLL V   NGGLATQ+A    G  F F +++ +D+    +YF D+   + 
Sbjct  125  GDLFIADAYLGLLVVG-PNGGLATQVAKFAQGVPFGFTNSLCIDQNHGVLYFTDSSTTYS  183

Query  564  SLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRII  743
              ++  ++ SGD +GRL+KY     QV++LL  L  P G+A      F++  E    +I 
Sbjct  184  RRSHISVIVSGDDTGRLMKYDMKNKQVSILLKNLKFPNGIAISKHGDFLLFVETTTCKIF  243

Query  744  KYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            K ++   KA + + V E L G+PDN+KR   G FWV +N
Sbjct  244  KLWLKTSKAGSVEVVSE-LPGFPDNIKRNKKGEFWVGVN  281



>ref|XP_007146688.1| hypothetical protein PHAVU_006G061000g, partial [Phaseolus vulgaris]
 gb|ESW18682.1| hypothetical protein PHAVU_006G061000g, partial [Phaseolus vulgaris]
Length=346

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 100/304 (33%), Positives = 164/304 (54%), Gaps = 11/304 (4%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYLNGN-FNDFATTSPYRTKEKCDGI-NITNIRAE  344
             +GP+    D    G Y GV+DGRILKY+    F ++  TSP R K  C+G+ + + +++E
Sbjct  44    TGPDSLEFDRNGGGPYVGVSDGRILKYVGPKGFEEYGYTSPNRNKTLCNGLADFSELQSE  103

Query  345   CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGG-----LATQLAAGVNGRNFSFIDAVA  509
             CGRPLGL F+H    LYV D ++GL+K+  N G       A Q     +     F+D + 
Sbjct  104   CGRPLGLRFNHQTNELYVADAYFGLVKIGPNGGAPIQSFKALQPQEHSDNSTLEFLDGID  163

Query  510   VDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMAT  689
             +D  T  VYF  A   F   +   +  S D SG L        +  VL+ GL+  +G+A 
Sbjct  164   IDVDTGIVYFTQASTNFHFKDGQALENSRDKSGSLFSLDPKTNETRVLMRGLALASGVAV  223

Query  690   DIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipk  869
               D +F+++SEY+G RI ++++ GP+AN+++  M+ L G PDN++R + G FWVA+N   
Sbjct  224   SRDGSFVLVSEYLGNRIQRFWVKGPRANSSEIFMQ-LTGRPDNIRRNSRGQFWVAVNGVL  282

Query  870   pqqqppppipMTDSIAVNFDMDGNIVNTKNVTDTF-PNSFSGYQEYSDIAYVGSLLSDFV  1046
              +  P  P  +   + +   ++G ++  +++   F     S   E++   Y GSL + +V
Sbjct  283   GRNPPSRPTILPGGVRIG--VNGVVLQIRSLGREFGSEGVSEVHEHNGTLYSGSLRASYV  340

Query  1047  AVYT  1058
             ++ T
Sbjct  341   SIST  344



>gb|KFK34942.1| hypothetical protein AALP_AA5G213900 [Arabis alpina]
Length=373

 Score =   171 bits (433),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/239 (40%), Positives = 139/239 (58%), Gaps = 6/239 (3%)
 Frame = +3

Query  150  ILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGNFN--DFATTSPYRTKEKCDGIN  323
            ++N+  ASGPE  A DP  +G Y GV+DGR+LK+   +    DFA TS  R  EKC    
Sbjct  47   VVNVTGASGPESVAFDPSGEGPYVGVSDGRVLKWRGESLGWIDFAHTSTNR--EKCVRPF  104

Query  324  ITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDA  503
               +   CGRPLGL FD   G LY+ D ++GLL V    GGLA  L    +G  F F + 
Sbjct  105  APELEHVCGRPLGLRFDKKTGDLYIADAYFGLLVVG-PAGGLAKPLVTEADGVPFRFTND  163

Query  504  VAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGM  683
            + +DE    +YF D    F+   +   V + D +GRL+KY  +  +VTVLL G++   G+
Sbjct  164  LDIDEEEDVIYFTDTSTRFQRRQFLAAVLNFDKTGRLMKYDRSSKKVTVLLQGIAFANGV  223

Query  684  ATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            A   D++F++++E    +I++ ++SGP A  TQ V   L G+PDNV++ + G FWVAL+
Sbjct  224  ALSKDRSFVLVAETTTCKILRLWLSGPNAG-TQDVFAELPGFPDNVRKNSNGEFWVALH  281



>emb|CDP09527.1| unnamed protein product [Coffea canephora]
Length=374

 Score =   171 bits (433),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 95/238 (40%), Positives = 135/238 (57%), Gaps = 6/238 (3%)
 Frame = +3

Query  153  LNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGNFN--DFATTSPYRTKEKCDGINI  326
            +NL  A GPE  A DP  +G YTGV DGRILK+        DFA TS  R  + C     
Sbjct  48   VNLTGAVGPESLAFDPNGEGPYTGVADGRILKWQGHQLGWVDFAVTSSQR--KDCFHPFA  105

Query  327  TNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAV  506
             ++   CGRPLGL FD   G LY+ D + GL +V    GGLAT L   V G    F + +
Sbjct  106  PHMEHICGRPLGLRFDRKNGDLYIADAYLGL-QVVGPTGGLATPLVTEVEGAVLRFTNDM  164

Query  507  AVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMA  686
             +DE    +YF D+  +F    +   V S D +GRL+KY  +  +V++LL GL+   G++
Sbjct  165  DIDEHEDTIYFTDSSTVFLRRQFISSVLSADRTGRLMKYDKSSKEVSILLRGLAFANGVS  224

Query  687  TDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
               DQ+F++++E    RI+++++ GP A    T  E L G+PDN++R + G FWVAL+
Sbjct  225  LSKDQSFVLVAESTTCRIVRFWLRGPNAGKHDTFTE-LPGFPDNIRRNSKGEFWVALH  281



>gb|EMT31336.1| Strictosidine synthase 1 [Aegilops tauschii]
Length=359

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 95/239 (40%), Positives = 141/239 (59%), Gaps = 11/239 (5%)
 Frame = +3

Query  168  ASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN-----FNDFATTSPYRTKEKCDGIN-IT  329
            A GPE  A D    G YTGV++GRIL++  GN     + +FA    +RT  +C     + 
Sbjct  53   AFGPESLAFDHRGGGPYTGVSNGRILQW-KGNRRHLGWTEFAHNYKHRTVVECAAKKKLV  111

Query  330  NIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVA  509
                 CGRPLGL F  A G +Y+ D + GL++V R  GGLA  +A    G  F F++ V 
Sbjct  112  EPDGSCGRPLGLQFHRASGDMYIADAYLGLMRVGRG-GGLAEVVATEAGGVPFKFLNGVD  170

Query  510  VDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMAT  689
            +D+ T DVYF D+  I++   Y  +V SGD +GRL++Y    G +TVL +GL+ P G+A 
Sbjct  171  IDQETGDVYFTDSSTIYQRSEYLLVVLSGDATGRLMRYDPRTGDITVLRSGLAFPNGVAI  230

Query  690  DIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKR--GTLGGFWVALN  860
              D+T ++++E    R++++++ GP A  T+ ++E L GYPDNV+   G  GG+WV  N
Sbjct  231  STDRTHLIVAETSPCRLLRHWLHGPMAGETEVLVE-LPGYPDNVRPDGGDRGGYWVGFN  288



>ref|XP_011000438.1| PREDICTED: strictosidine synthase 1 [Populus euphratica]
Length=375

 Score =   171 bits (433),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 99/270 (37%), Positives = 149/270 (55%), Gaps = 14/270 (5%)
 Frame = +3

Query  81   ISILM-----FISSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRIL  245
            +SIL+      +  P +  S   +    IL++  A GPE    DP  +G YTGV DGR+L
Sbjct  18   VSILLTSPTKLLGPPTIPTSHDYLHSAKILHVSGAVGPESLVFDPNGEGPYTGVADGRVL  77

Query  246  KYL-----NGNFNDFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMF  410
            K++     +G++ DFATTS  R K  C       +   CGRPLGL FD   G LY+ D +
Sbjct  78   KWIAGDDGSGSWTDFATTSSNRNK--CVRPFAPEMEHVCGRPLGLRFDKKTGNLYIADAY  135

Query  411  YGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQ  590
             GL +V    GGLAT +   + G+   F + + +DE    +YF D   +F+   +   + 
Sbjct  136  LGL-QVVGPTGGLATPVVTELEGQPMRFTNDLDIDEQEDVIYFTDTSMVFQRRQFMLSLL  194

Query  591  SGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKA  770
            + D +GRLLKY  +  +VTVL  GL+   G+A   D TF++++E    RI+++++ GP A
Sbjct  195  TKDKTGRLLKYDRSSKEVTVLARGLAFANGVALSKDSTFLLVAETTSCRILRFWLHGPNA  254

Query  771  NTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
              +  V   L G+PDN++R + G FWVAL+
Sbjct  255  GKSD-VFSELPGFPDNIRRNSKGEFWVALH  283



>ref|XP_003576476.1| PREDICTED: strictosidine synthase 3-like [Brachypodium distachyon]
Length=366

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/243 (37%), Positives = 142/243 (58%), Gaps = 6/243 (2%)
 Frame = +3

Query  141  FPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLN--GNFNDFATTSPYRTKEKCD  314
             P+ L  + A GPE  A D   +G YTGV++GR+L++      + +FA    + T E+C 
Sbjct  52   LPVRLG-RPAFGPESLAFDHRGRGPYTGVSNGRVLRWRGRPSGWTEFAHNHKHATVEECA  110

Query  315  GIN-ITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFS  491
                     + CGRPLGL F    G +Y+ D + GL++V R  GGLA  +A    G  F+
Sbjct  111  AKKKAVEPESACGRPLGLQFHRKTGDMYIADAYLGLMRVGRR-GGLAEVVATEAAGGPFN  169

Query  492  FIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSG  671
            F++ V VD+ T  VYF D+  +++  +Y  +V +GD +GRL++Y    G VTVL + L+ 
Sbjct  170  FLNGVDVDQDTGHVYFTDSSTVYQRSDYMLVVLTGDATGRLMRYEPRTGNVTVLRSRLAF  229

Query  672  PAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWV  851
            P G+A   D T ++++E    R++++++ GP+A  T+ VM  L GYPDNV+    GG+WV
Sbjct  230  PNGVAVSADGTHLVVAETSSCRLLRHWLRGPRAGETE-VMAELPGYPDNVRPDGRGGYWV  288

Query  852  ALN  860
             +N
Sbjct  289  GVN  291



>ref|XP_004307669.1| PREDICTED: strictosidine synthase 1-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=364

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 93/239 (39%), Positives = 138/239 (58%), Gaps = 6/239 (3%)
 Frame = +3

Query  150  ILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKY--LNGNFNDFATTSPYRTKEKCDGIN  323
            IL L  A GPE  A DP   G YTGV DGRILK+   +  + DFA T+  R  ++C    
Sbjct  38   ILQLTGAVGPESLAFDPNGDGPYTGVADGRILKWDPNHHRWTDFAVTTSQR--KECVRPF  95

Query  324  ITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDA  503
               +   CGRPLGL F+   G LY+ D + GL +V    GGLA+Q+   V G+   F + 
Sbjct  96   APELEHVCGRPLGLRFNKKTGDLYIADAYLGL-QVVGPAGGLASQVVKEVEGQQLHFTND  154

Query  504  VAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGM  683
            + +DE    +YF D+  +F    +   + +GD +GRLLKY+ +  +V VLL GL+   G+
Sbjct  155  IDIDEKKDVIYFTDSSTVFHRRQFMSSILNGDKTGRLLKYNISSQEVVVLLQGLAFANGV  214

Query  684  ATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            A   D +F++++E    RI+++++ GP A  T  +   L G+PDN++R + G FWVAL+
Sbjct  215  ALSKDHSFVLVAETTNCRILRHWLYGPNAGDTD-IFTKLPGFPDNIRRNSKGEFWVALH  272



>ref|XP_002888956.1| hypothetical protein ARALYDRAFT_476540 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65215.1| hypothetical protein ARALYDRAFT_476540 [Arabidopsis lyrata subsp. 
lyrata]
Length=327

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 108/298 (36%), Positives = 157/298 (53%), Gaps = 14/298 (5%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYL-NGNFNDFATTSPYRTKEKCDG-INITNIRAE  344
             +GPE  A D   +G YTGV+ G+ILKYL    + DFA  +       CDG +  TN+  +
Sbjct  37    TGPEAFAFDSTGKGFYTGVSGGKILKYLPRKGYVDFAQITNSSKSSLCDGALGTTNV-GK  95

Query  345   CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELT  524
             CGRP G+ F+   G LYV D   GL  V R  GGLA ++A  V+G+ F F+D + VD  T
Sbjct  96    CGRPAGIAFNRKTGDLYVADAPLGLHVVSRG-GGLAKKIADSVDGKPFLFLDGLDVDPTT  154

Query  525   ADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQT  704
               VYF      F   +  + V + D++G+L KY  +K  VTVL+ GLSG AG A   D +
Sbjct  155   GVVYFTSFSSTFGPSDVLKAVATKDSTGKLFKYDPSKKVVTVLMEGLSGSAGCAVSSDGS  214

Query  705   FIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKR-GTLGGFWVALNipkpqqq  881
             F+++S++    I +Y+I G KA + +    ++   PDN+KR G+ G FWVA         
Sbjct  215   FVLVSQFTKSNIKRYWIKGAKAGSFEDFTNSVSS-PDNIKRIGSSGNFWVA-------SV  266

Query  882   ppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSF-SGYQEYSDIAYVGSLLSDFVAV  1052
                    T+  AV    DG ++ T  + D F ++  S   E+    Y+G+L   F  +
Sbjct  267   VNSATGPTNPSAVKVSSDGKVIQTIPLKDKFGDTLVSEVNEFRGRLYIGALFGPFAGI  324



>ref|XP_002452451.1| hypothetical protein SORBIDRAFT_04g026050 [Sorghum bicolor]
 gb|EES05427.1| hypothetical protein SORBIDRAFT_04g026050 [Sorghum bicolor]
Length=344

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 110/302 (36%), Positives = 162/302 (54%), Gaps = 20/302 (7%)
 Frame = +3

Query  174   GPEDTAIDPLDQGIYTGVTDGRILKYLNGNFNDFATTSPYRTKEKCDGINITNIRA----  341
             GPE  A D    G Y+GV+DGR+LK+ NG    ++T   Y      D    T  RA    
Sbjct  51    GPESVAFDGAGAGPYSGVSDGRVLKW-NGFARGWST---YAYGPGYDAAACTASRARPAE  106

Query  342   ----ECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVA  509
                 +CGRPLGL F HA G LY+ D + GL++V    GG AT LAA  +G    F + V 
Sbjct  107   LTESKCGRPLGLRFHHASGNLYIADAYKGLMRVG-PGGGEATVLAAEADGVPLRFTNGVD  165

Query  510   VDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMAT  689
             VD++T DV+F D+   +    + ++  +GD+SGR++KY    GQV VLL G++ P G+A 
Sbjct  166   VDQVTGDVFFTDSSMNYPRSQHERVTATGDSSGRIMKYDPKTGQVRVLLAGVTYPNGLAI  225

Query  690   DIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipk  869
               D+T ++++     ++++Y+I GPKA T +  + +L GYPDNV+    GGFWVAL+  K
Sbjct  226   SADRTHLVVALTGPCKLLRYWIEGPKAGTAEH-LADLPGYPDNVRADGRGGFWVALHREK  284

Query  870   pqqqppppipMTDSIAVNFDMDGNIVNT-KNVTDTFPNSFSGYQEYSDIAYVGSLLSDFV  1046
              +    P   +   +AV    DG +V   +      P      +      Y+GS+   +V
Sbjct  285   MELPFGPDSHL---LAVRVGADGQVVQVMRGPKSVRPTEV--VERGGGKLYMGSVELPYV  339

Query  1047  AV  1052
             AV
Sbjct  340   AV  341



>ref|XP_006291448.1| hypothetical protein CARUB_v10017585mg [Capsella rubella]
 gb|EOA24346.1| hypothetical protein CARUB_v10017585mg [Capsella rubella]
Length=339

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 107/320 (33%), Positives = 158/320 (49%), Gaps = 12/320 (4%)
 Frame = +3

Query  102   SSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDF  275
             S P +  S+       ++NL  ASGPE  A DP   G Y GV+DGR+LK+      + DF
Sbjct  28    SPPKIPRSRNVFPSAKVVNLTRASGPESIAFDPSGGGPYVGVSDGRVLKWRGKKLGWTDF  87

Query  276   ATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLAT  455
             A T+  R  + C       +   CGRPLGL F    G LY+ D ++GLL V    GG+A 
Sbjct  88    AYTAANR--KMCVRSFAPELEHVCGRPLGLRFHKKTGDLYIADAYFGLLVVG-PAGGVAK  144

Query  456   QLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAK  635
              L     G+   F + + +DE    +YF D+   F+  +Y     + D +GR +KY  + 
Sbjct  145   PLVTEAEGKPIRFTNDLDIDEQNDVIYFTDSSSRFQRWDYFGSFMTVDKTGRFIKYDRSS  204

Query  636   GQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPD  815
              + TVLL+GLS P G+    D++F+++ E    +I++ ++SGPKA  TQ V   L GYPD
Sbjct  205   KKATVLLHGLSFPNGVTLSKDRSFVLVDETTNFKILRLWLSGPKAG-TQDVFAVLPGYPD  263

Query  816   NVKRGTLGGFWVALNipkpqqqppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSFSGY  995
             N++R + G FWVA+N                + AV     G ++             S  
Sbjct  264   NIRRNSNGEFWVAIN------YSIFNGERPHTKAVKLSESGEVLEVLEDKGKRLRYISEV  317

Query  996   QEYSDIAYVGSLLSDFVAVY  1055
             +E     ++GS +  FV VY
Sbjct  318   EEKDGKLWIGSSVMPFVGVY  337



>ref|XP_009339573.1| PREDICTED: strictosidine synthase 3-like [Pyrus x bretschneideri]
Length=375

 Score =   171 bits (432),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 95/239 (40%), Positives = 140/239 (59%), Gaps = 6/239 (3%)
 Frame = +3

Query  150  ILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGIN  323
            ++ +  A GPE  A DP   G YTGV DGR+LK+   N  + DFA T+  R  ++C    
Sbjct  49   VIPVPGALGPESLAFDPTGDGPYTGVADGRVLKWDRNNRRWTDFAVTTSQR--KECVRPF  106

Query  324  ITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDA  503
               +   CGRPLGL FD   G LY+ D + GL +V    GGLA+Q+   V G+   F + 
Sbjct  107  APEMEHVCGRPLGLKFDKKNGDLYIADAYLGL-QVVGPAGGLASQVVREVEGQPLLFTND  165

Query  504  VAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGM  683
            + +DE    +YF D+  IF+   +   V +GD +GRLLKY+ +  +VTVLL GL+   G+
Sbjct  166  LDIDEHKDVIYFTDSSTIFQRRQFMSSVFNGDRTGRLLKYNKSSKEVTVLLRGLAFANGV  225

Query  684  ATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            A   D++F++++E    RI++ ++ GP A  T    E L G+PDN++R + G FWVAL+
Sbjct  226  ALSKDRSFVLVAESTTCRILRVWLDGPNAGNTDVFAE-LPGFPDNIRRNSNGEFWVALH  283



>emb|CDP16919.1| unnamed protein product [Coffea canephora]
Length=368

 Score =   170 bits (431),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 106/298 (36%), Positives = 156/298 (52%), Gaps = 15/298 (5%)
 Frame = +3

Query  174   GPEDTAIDPLDQGIYTGVTDGRILKYLNGNFNDFATTSPYRTKEK---CDGINITNIRAE  344
             GPE  A D   +G Y  + DGR+ +YL G    F     +++++    CDG N T+I   
Sbjct  81    GPESYAFDSAGRGPYASLADGRVFRYL-GPAVGFRCIHFFKSRKPRRFCDGTNRTDISQI  139

Query  345   CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELT  524
             CGRP GL F +  G L++ D   GL+ +  + GG   QLA+   G  F F D + VD+ T
Sbjct  140   CGRPTGLGFYYKTGELFLGDADLGLVVIP-SGGGPGIQLASSAEGVRFGFPDGLEVDQAT  198

Query  525   ADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQT  704
               VYF DA   +       IV + D +GRLLKY      VTVLL GLSG AG+A   D +
Sbjct  199   GIVYFTDASSRYNLSQINNIVSNRDATGRLLKYDPRTKNVTVLLRGLSGAAGVAISEDGS  258

Query  705   FIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqp  884
             ++++++++  ++ KY++ GP ANT + V+ N+ G PD +KR T G +W+A+ +       
Sbjct  259   YLLVTQFVIGQVSKYWLKGPLANTAE-VLVNMTGMPDKIKRNTKGEYWIAVTVTSKNS--  315

Query  885   pppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSF-SGYQEYSDIAYVGSLLSDFVAVY  1055
                   T       D DGN + T   +  F +S  +  QEY    Y+ SL   +V VY
Sbjct  316   ------TQLQGQRIDGDGNSLETLTFSPDFDSSLITEVQEYKGALYLASLYVGYVGVY  367



>ref|XP_010672985.1| PREDICTED: strictosidine synthase 1-like [Beta vulgaris subsp. 
vulgaris]
Length=377

 Score =   171 bits (432),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 95/238 (40%), Positives = 138/238 (58%), Gaps = 5/238 (2%)
 Frame = +3

Query  153  LNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYL--NGNFNDFATTSPYRTKEKCDGINI  326
            + LQ A GPE  A DP   G YTGV DGRILK+   + ++ DFA TS    KE C     
Sbjct  50   IQLQAAFGPESLAFDPSGGGPYTGVADGRILKWDPDSNSWLDFAFTSSSSRKE-CTRAFA  108

Query  327  TNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAV  506
              +   CGRPLGL F+   G LY+ D ++GL +V    GGLA+ +A    G    F + +
Sbjct  109  PELEHVCGRPLGLRFEQKSGDLYIADAYFGLQRVG-PEGGLASNVATQAEGVPLYFTNDM  167

Query  507  AVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMA  686
             +DE    +YF D    FR  ++   + SGD +GR +KY+    +VTVLL GL+   G+A
Sbjct  168  DIDEENDIIYFTDTSTKFRRRHFMPSILSGDQTGRFIKYNKLTKEVTVLLRGLAFANGVA  227

Query  687  TDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
               D++F++++E    RI++Y++ GP A   +T +  L G+PDN++R + G FWVAL+
Sbjct  228  LSKDRSFVLVAETSTCRILRYWLQGPNAGQVETFVV-LPGFPDNIRRNSKGEFWVALH  284



>ref|XP_010471491.1| PREDICTED: strictosidine synthase 1-like [Camelina sativa]
Length=326

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 112/297 (38%), Positives = 156/297 (53%), Gaps = 12/297 (4%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYLNGN-FNDFATTSPYRTKEKCDGINITNIRAEC  347
             SGPE  A DP  +G YTGV+ G+ILKY   N F DFA  +     + C+G+       +C
Sbjct  36    SGPESFAFDPTGKGFYTGVSGGKILKYTPENGFVDFAQMTKSSNSKWCNGVLGAAFAGKC  95

Query  348   GRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTA  527
             GRP G+  +   G LYV D   GL  V    GGLAT++A  ++G+ F F+D + VD  T 
Sbjct  96    GRPSGIALNSKTGDLYVADAPLGL-HVISPAGGLATKIADSLDGKPFKFLDGLDVDPTTG  154

Query  528   DVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTF  707
              VYF      F        V   D SG+L KY  A   VT L++GLSG AG A   D +F
Sbjct  155   VVYFTSFSSKFGPREVLIAVGLKDASGKLFKYDPATKTVTQLMDGLSGGAGCAVSSDGSF  214

Query  708   IMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKR-GTLGGFWVALNipkpqqqp  884
             +++SE+I   I +Y+I+GPKA T +    NL   PDN++R  + G FWVA  + K     
Sbjct  215   VLVSEFIKSNIKRYWITGPKAGTFED-FSNLVSNPDNIRRSASTGNFWVASVVNKVVVP-  272

Query  885   pppipMTDSIAVNFDMDGNIVNTKNVTDTFPNS-FSGYQEYSDIAYVGSLLSDFVAV  1052
                   TD  AV  D +G ++ T ++ + F N+  S   E +   Y+G+L   F  +
Sbjct  273   ------TDPKAVKIDSNGKVLQTISLKNEFGNTLLSEVNELNGHLYIGTLTGPFAGI  323



>ref|XP_004169880.1| PREDICTED: LOW QUALITY PROTEIN: strictosidine synthase 1-like 
[Cucumis sativus]
Length=350

 Score =   170 bits (430),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 94/231 (41%), Positives = 135/231 (58%), Gaps = 6/231 (3%)
 Frame = +3

Query  174  GPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRAEC  347
            GPE  A D   +G Y  V+DGRILK+   +  +  FA TSP R  ++CDG   +   A C
Sbjct  38   GPESIAFDCRGEGPYASVSDGRILKWKGPHLGWTQFALTSPNREGKECDGQPQSE--AAC  95

Query  348  GRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTA  527
            GRPLG+ F      LY+ D + GLL V    GGLA QLA    G    F +A+ +D    
Sbjct  96   GRPLGIKFHPTTCDLYIADAYXGLLAVG-PKGGLARQLATSAQGVPLRFTNALDIDPQNG  154

Query  528  DVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTF  707
             VYF D+  +F+   +   + +GD +GRLLKY      VTVL NGL+ P G+A + D +F
Sbjct  155  IVYFTDSSILFQRRVWLLSIMNGDKTGRLLKYDPRTQNVTVLRNGLAFPNGVALNADSSF  214

Query  708  IMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            ++++E    +++K+++ GPKANT + +   LE +PDN+KR   G FW+A+N
Sbjct  215  LLMAETGTLQVLKFWLKGPKANTME-IFAQLERFPDNIKRTDNGDFWIAMN  264



>ref|XP_002454704.1| hypothetical protein SORBIDRAFT_04g035910 [Sorghum bicolor]
 gb|EES07680.1| hypothetical protein SORBIDRAFT_04g035910 [Sorghum bicolor]
Length=346

 Score =   170 bits (430),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 109/298 (37%), Positives = 164/298 (55%), Gaps = 12/298 (4%)
 Frame = +3

Query  174   GPEDTAIDPLDQGIYTGVTDGRILKYLNGNFNDFATT--SPYRTKEKCDGINITN---IR  338
             GPE  A D    G Y+GV+DGR+LK+ NG    ++T   SP    E C            
Sbjct  52    GPESVAFDGAGAGPYSGVSDGRVLKW-NGFARGWSTYAYSPGYDAEACTASRARPAELTE  110

Query  339   AECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDE  518
             ++CGRPLGL F    G LY+ D + GL++V    GG AT LAA V+G    F + V VD+
Sbjct  111   SKCGRPLGLRFHRRSGNLYIADAYKGLMRVG-PGGGEATVLAAEVDGVPLRFTNGVDVDQ  169

Query  519   LTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDID  698
             +T DV+F D+   +    + ++  +GD+SGRL+KY    GQVTVL  G++ P G+A   D
Sbjct  170   VTGDVFFTDSSMNYPRSQHERVTATGDSSGRLMKYDPRTGQVTVLQAGITYPNGLAISAD  229

Query  699   QTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqq  878
             +T ++++     ++++Y+I GPKA T++  + +L GYPDNV+    GGFWVAL+  K + 
Sbjct  230   RTHLVVALTGPCKLMRYWIKGPKAGTSEH-LADLPGYPDNVRADGRGGFWVALHREKMEL  288

Query  879   qppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSFSGYQEYSDIAYVGSLLSDFVAV  1052
                P   +   +AV    DG +V       +   +    +E   + Y+GS+   +VAV
Sbjct  289   PFGPDSHL---LAVRVGADGQVVQVMRGPKSVRPTEVVEREGGKL-YMGSVELPYVAV  342



>ref|NP_177541.1| strictosidine synthase-like protein [Arabidopsis thaliana]
 gb|AAG52516.1|AC016662_10 putative strictosidine synthase; 39161-40746 [Arabidopsis thaliana]
 gb|AAM62921.1| putative strictosidine synthase [Arabidopsis thaliana]
 gb|AAN17441.1| putative strictosidine synthase [Arabidopsis thaliana]
 gb|AAP42735.1| At1g74010 [Arabidopsis thaliana]
 gb|AEE35537.1| strictosidine synthase-like protein [Arabidopsis thaliana]
Length=325

 Score =   169 bits (428),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 114/297 (38%), Positives = 152/297 (51%), Gaps = 13/297 (4%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYLNGN-FNDFATTSPYRTKEKCDGINITNIRAEC  347
             SGPE  A D    G YTGV+ G+ILKY+ G  + DFA  +       C+G   T    +C
Sbjct  36    SGPESFAFDSTG-GFYTGVSGGKILKYVPGKGYVDFAQITDSSNSAWCNGALGTAFAGKC  94

Query  348   GRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTA  527
             GRP G+  +   G LYV D   GL  V    GGLAT+LA  V+G+ F F+D + VD  T 
Sbjct  95    GRPAGIALNSKTGDLYVADAPLGL-HVISPAGGLATKLADSVDGKPFKFLDGLDVDPTTG  153

Query  528   DVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTF  707
              VYF      F        V   D SG+L KY  A   VT L+ GLSG AG A   D +F
Sbjct  154   VVYFTSFSSKFGPREVLIAVGLKDASGKLFKYDPATKAVTELMEGLSGAAGCAVSSDGSF  213

Query  708   IMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKR-GTLGGFWVALNipkpqqqp  884
             +++SE+I   I KY+I GPKA T +    +L   PDN++R G+ G FWVA          
Sbjct  214   VLVSEFIKSNIKKYWIKGPKAGTIED-FSSLVSNPDNIRRVGSTGNFWVA-------SVV  265

Query  885   pppipMTDSIAVNFDMDGNIVNTKNVTDTFPNS-FSGYQEYSDIAYVGSLLSDFVAV  1052
                +  TD  AV  D +G ++ T  + + F N+  S   E++   Y+G+L   F  V
Sbjct  266   NKVVMPTDPRAVKLDANGKVLQTIFLKNEFGNTLLSEVNEFNGHLYIGTLTGPFAGV  322



>ref|XP_002278088.1| PREDICTED: strictosidine synthase 3 [Vitis vinifera]
Length=391

 Score =   171 bits (432),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 99/238 (42%), Positives = 141/238 (59%), Gaps = 8/238 (3%)
 Frame = +3

Query  159  LQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGNFNDFATTSPYRTKEKCDGIN--ITN  332
            L    GPE  A DPL +G YTGV DGRIL +    ++DFA TSP R+ E CD     ++ 
Sbjct  65   LNQVQGPESVAFDPLGRGPYTGVADGRILFWNGEAWSDFAYTSPNRS-ELCDPKPSPLSY  123

Query  333  IRAE--CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAV  506
            ++ E  CGRPLGL F+   G LY+ D + GL+KV    GGLAT L    +G    F + +
Sbjct  124  LKNEHICGRPLGLRFNKRTGDLYIADSYLGLMKVG-PEGGLATSLVTEADGVPLRFTNDL  182

Query  507  AVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMA  686
             +D+   ++YF D+   ++  N+ Q+V S + SGRLLKY     + TVLL GL  P G++
Sbjct  183  DIDD-AGNIYFTDSSSKYQRRNFMQLVFSSEDSGRLLKYDPLTKETTVLLRGLQFPNGVS  241

Query  687  TDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
               D +F+++ E    R++KY++ G KA T++ V   L GYPDNV+    G FWVA++
Sbjct  242  LSKDGSFLVLCEGSPGRLVKYWLKGDKAGTSE-VFAILPGYPDNVRTNEKGEFWVAIH  298



>ref|XP_006390477.1| hypothetical protein EUTSA_v10018854mg [Eutrema salsugineum]
 dbj|BAJ34366.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ27763.1| hypothetical protein EUTSA_v10018854mg [Eutrema salsugineum]
Length=328

 Score =   169 bits (428),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 105/300 (35%), Positives = 155/300 (52%), Gaps = 12/300 (4%)
 Frame = +3

Query  162   QHASGPEDTAIDPLDQGIYTGVTDGRILKYL-NGNFNDFATTSPYRTKEKCDGINITNIR  338
             ++ SGPE  A D   +G YT V+ G+ILKY     + DFA  +       CDG+  T + 
Sbjct  35    ENRSGPEAFAFDSTGKGFYTSVSGGKILKYTPETGYVDFAQITESSNSSWCDGVLGTALA  94

Query  339   AECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDE  518
               CGRP G+ F+   G LYV D   GL  V   NGGLA ++A  V+G+ F F+D + VD 
Sbjct  95    GRCGRPAGIAFNEKTGDLYVADAPLGL-HVVSPNGGLAVKIADSVDGKPFKFLDGLDVDP  153

Query  519   LTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDID  698
              T  VYF      F  L     +   D +G+L KY  +   VTVL+ GLSG AG A   D
Sbjct  154   TTGVVYFTSFSSRFTPLQVVIALGLKDATGKLYKYDPSTKVVTVLMEGLSGSAGCAVSSD  213

Query  699   QTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKR-GTLGGFWVALNipkpq  875
              +F+++S++    I +Y+I GPKA +++    ++   PDN++R G+ G FWVA       
Sbjct  214   GSFVLVSQFTKSNIKRYWIKGPKAGSSEDFTNSVSN-PDNIRRIGSTGNFWVA-------  265

Query  876   qqppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNS-FSGYQEYSDIAYVGSLLSDFVAV  1052
                   +  T+  AV  + DG ++ T  + D F ++  S   E+    Y+G+L   F  +
Sbjct  266   SVVNKIVVPTNPSAVKVNSDGEVLQTIPLKDQFGDTLLSEVNEFDGSLYIGTLTGPFAGI  325



>ref|XP_010428362.1| PREDICTED: strictosidine synthase 1-like [Camelina sativa]
Length=326

 Score =   169 bits (428),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 115/309 (37%), Positives = 159/309 (51%), Gaps = 12/309 (4%)
 Frame = +3

Query  135   VDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN-FNDFATTSPYRTKEKC  311
             V F  +L     SGPE  A DP  +G YTGV+ G+ILKY   N F DFA  +     + C
Sbjct  24    VAFQKLLVPGKRSGPESFAFDPTGKGFYTGVSGGKILKYTPENGFVDFAQMTKSSNSKWC  83

Query  312   DGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFS  491
             +G        +CGRP G+  +   G LYV D   GL  V    GGLAT++A  ++G+ F 
Sbjct  84    NGALGFAFAGKCGRPSGIALNSKTGDLYVADAPLGL-HVISPAGGLATKIADSLDGKPFK  142

Query  492   FIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSG  671
             F+D + VD  T  VYF      F        V   D SG+L KY  A   VT L+ GLSG
Sbjct  143   FLDGLDVDPTTGVVYFTSFSSKFGPREVLIAVGLKDASGKLFKYEPATKTVTQLMEGLSG  202

Query  672   PAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKR-GTLGGFW  848
              AG A   D +F+++SE+I   I +Y+I+GPKA T++    NL   PDN++R  + G FW
Sbjct  203   GAGCAVSSDGSFVLVSEFIKSNIKRYWITGPKAGTSED-FSNLVSNPDNIRRSASTGNFW  261

Query  849   VALNipkpqqqppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNS-FSGYQEYSDIAYVG  1025
             VA  + K           TD  AV  D +G ++ T ++ + F N+  S   E +   Y+G
Sbjct  262   VASVVNKVVVP-------TDPKAVKIDSNGQVLQTISLKNEFGNTLLSEVNELNGNLYIG  314

Query  1026  SLLSDFVAV  1052
             +L   F  +
Sbjct  315   TLTGPFAGI  323



>ref|NP_191262.2| calcium-dependent phosphotriesterase superfamily protein [Arabidopsis 
thaliana]
 sp|Q4V3D9.1|SSL10_ARATH RecName: Full=Protein STRICTOSIDINE SYNTHASE-LIKE 10; Short=AtSSL10; 
AltName: Full=Strictosidine synthase 8; Short=AtSS8; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAY56408.1| At3g57030 [Arabidopsis thaliana]
 gb|ABH04571.1| At3g57030 [Arabidopsis thaliana]
 gb|AEE79601.1| strictosidine synthase family protein [Arabidopsis thaliana]
Length=374

 Score =   170 bits (431),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 95/239 (40%), Positives = 137/239 (57%), Gaps = 6/239 (3%)
 Frame = +3

Query  150  ILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNG--NFNDFATTSPYRTKEKCDGIN  323
            ++NL  ASGPE  A DP  +G Y GV+DGRILK+      ++DFA TS  R  ++C    
Sbjct  48   VVNLTGASGPESIAFDPAGEGPYVGVSDGRILKWRGEPLGWSDFAHTSSNR--QECARPF  105

Query  324  ITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDA  503
               +   CGRPLGL FD   G LY+ D ++GLL V    GGLA  L     G+ F F + 
Sbjct  106  APELEHVCGRPLGLRFDKKTGDLYIADAYFGLLVVG-PAGGLAKPLVTEAEGQPFRFTND  164

Query  504  VAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGM  683
            + +DE    +YF D    F+   +   V + D +GR +KY  +  + TVLL GL+   G+
Sbjct  165  LDIDEQEDVIYFTDTSARFQRRQFLAAVLNVDKTGRFIKYDRSSKKATVLLQGLAFANGV  224

Query  684  ATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            A   D++F+++ E    +I++ ++SGP A T Q V   L G+PDN++R + G FWVAL+
Sbjct  225  ALSKDRSFVLVVETTTCKILRLWLSGPNAGTHQ-VFAELPGFPDNIRRNSNGEFWVALH  282



>ref|XP_003554139.1| PREDICTED: strictosidine synthase 1-like [Glycine max]
 gb|KHN14916.1| Strictosidine synthase 1 [Glycine soja]
Length=371

 Score =   170 bits (431),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 99/257 (39%), Positives = 145/257 (56%), Gaps = 6/257 (2%)
 Frame = +3

Query  96   FISSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FN  269
              S P+V  S+  +    +L++  A GPE    D    G YTGV DGRILK+      + 
Sbjct  27   LFSPPHVPGSKDHLHAARLLHVTGAVGPESLVFDADGGGPYTGVADGRILKWEGEERGWT  86

Query  270  DFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGL  449
            +FA TS  R+   C       +   CGRPLGL FD   G LY+ D + GL KV  + GGL
Sbjct  87   EFAVTSSNRSD--CVRPFAPELEHICGRPLGLRFDKKNGDLYIADAYLGL-KVVGSAGGL  143

Query  450  ATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSA  629
            AT++   V G+   F + + + E    +YF D+  IF+   +  ++ SGD +GRL+KY+ 
Sbjct  144  ATEVVTEVEGQPLQFTNDMDISEDEEVIYFTDSTTIFQRRQFMLVLLSGDKTGRLMKYNK  203

Query  630  AKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGY  809
            +  +VTVLL GL+ P G+A   D +F++++E    RI++ ++ GPKA    T    L G+
Sbjct  204  STKEVTVLLRGLAFPNGVALSKDGSFVLVAETTTCRILQLWLRGPKAGHVDT-FAVLPGF  262

Query  810  PDNVKRGTLGGFWVALN  860
            PDNV+R + G FWVAL+
Sbjct  263  PDNVRRNSQGHFWVALH  279



>emb|CAB72173.1| putative protein [Arabidopsis thaliana]
Length=372

 Score =   170 bits (431),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 95/239 (40%), Positives = 137/239 (57%), Gaps = 6/239 (3%)
 Frame = +3

Query  150  ILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNG--NFNDFATTSPYRTKEKCDGIN  323
            ++NL  ASGPE  A DP  +G Y GV+DGRILK+      ++DFA TS  R  ++C    
Sbjct  46   VVNLTGASGPESIAFDPAGEGPYVGVSDGRILKWRGEPLGWSDFAHTSSNR--QECARPF  103

Query  324  ITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDA  503
               +   CGRPLGL FD   G LY+ D ++GLL V    GGLA  L     G+ F F + 
Sbjct  104  APELEHVCGRPLGLRFDKKTGDLYIADAYFGLLVVG-PAGGLAKPLVTEAEGQPFRFTND  162

Query  504  VAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGM  683
            + +DE    +YF D    F+   +   V + D +GR +KY  +  + TVLL GL+   G+
Sbjct  163  LDIDEQEDVIYFTDTSARFQRRQFLAAVLNVDKTGRFIKYDRSSKKATVLLQGLAFANGV  222

Query  684  ATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            A   D++F+++ E    +I++ ++SGP A T Q V   L G+PDN++R + G FWVAL+
Sbjct  223  ALSKDRSFVLVVETTTCKILRLWLSGPNAGTHQ-VFAELPGFPDNIRRNSNGEFWVALH  280



>emb|CDY22515.1| BnaC03g23250D [Brassica napus]
Length=349

 Score =   169 bits (429),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 115/352 (33%), Positives = 181/352 (51%), Gaps = 25/352 (7%)
 Frame = +3

Query  57    MKSLTMFWISILMFIS-------SPYVIHSQPGVDFP--IILNLQHASGPEDTAIDPLDQ  209
             MK   +  I + +F+S       SP    S   V FP   ++    ASGPE    D   +
Sbjct  2     MKLFLVVAICVALFLSLTDFSGKSPKHGESMLTVHFPEFRLIPTTGASGPESFVFDISGE  61

Query  210   GIYTGVTDGRILKYL--NGNFNDFATTSPYRTKEKCDGINITNIRAE--CGRPLGLDFDH  377
             G YTG++DGRI+K++     + DFA T+P  T++ C+G +  + R E  CGRPLGL F+ 
Sbjct  62    GPYTGLSDGRIVKWIANESRWIDFAVTTP--TRKGCEGPH-EHQRTEHVCGRPLGLAFEK  118

Query  378   ARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDI  557
             + G LY+ D + G+LKV R  GGLA Q+          F + + VD  T  VYF D+  +
Sbjct  119   STGDLYIADAYMGVLKVGRE-GGLANQMLTRQLDEPLRFTNGLDVDPRTGVVYFTDSSSV  177

Query  558   FRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRR  737
             ++  NY  ++ SGD +GRL+KY     QVT LL+ L+ P G+    +  +++++E    R
Sbjct  178   YQRRNYIGVMMSGDRTGRLMKYDPNTKQVTTLLSNLAFPNGVVLSHNGEYLLVAETAKCR  237

Query  738   IIKYFISGPKANTTQTVME----NLEGYPDNVKRGTLGGFWVALNipkpqqqppppipM-  902
             I++Y+++   A+ ++   E     L G+PDN+KR   GGFW+ +N    +        + 
Sbjct  238   ILRYWLNDTSASKSRQTYEIFSDRLPGFPDNIKRSPRGGFWIGVNTKHTKLTKFAMSNVW  297

Query  903   TDSIAVNFDMDG-NIVNTKNVTDTFPNSFSGYQEYSDIAYVGSLLSDFVAVY  1055
                 A+   +D   +   KN       S S  +E     +VGS+ + FV +Y
Sbjct  298   LGRAALGLSVDWMKVFEGKNGNKWM--SISEVEERDRTLWVGSVNTPFVGMY  347



>ref|XP_010677108.1| PREDICTED: strictosidine synthase 1-like [Beta vulgaris subsp. 
vulgaris]
Length=334

 Score =   169 bits (428),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 102/252 (40%), Positives = 142/252 (56%), Gaps = 13/252 (5%)
 Frame = +3

Query  123  SQPGV----DFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNG--NFNDFATT  284
            SQP V      P+ LN   A  PE  A D    G Y GV+DGRILK+      +  FA  
Sbjct  41   SQPHVRQYHHLPLGLN---AVAPESIAFDCQGGGPYVGVSDGRILKWQGPLLGWTVFAVI  97

Query  285  SPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLA  464
            SPYR+   CDG+N +     CGRPLGL F+     LY+ D  +GL+KV  +NGG+AT +A
Sbjct  98   SPYRSN-SCDGLNDSPAEQYCGRPLGLKFNIVTCELYIADSSFGLVKVG-SNGGIATSVA  155

Query  465  AGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQV  644
                G  F F++A+ +D  + DVYF D+        YT I  S D SGRL++Y+   G+ 
Sbjct  156  TSAEGILFRFLNALDIDSESGDVYFTDSSSHHHRWEYTAI-DSTDRSGRLMRYNPKTGRT  214

Query  645  TVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVK  824
             VLL GLS   G+A    + F++++E    R+ +Y+++GP A T++  ++ L G PDN+ 
Sbjct  215  IVLLKGLSFANGVALSKKRDFVLVAETTLHRVQRYWLTGPGAGTSEEFIK-LTGQPDNIN  273

Query  825  RGTLGGFWVALN  860
            R   G FWVA N
Sbjct  274  RNGNGDFWVAQN  285



>dbj|BAE99809.1| hypothetical protein [Arabidopsis thaliana]
Length=374

 Score =   170 bits (431),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 95/239 (40%), Positives = 137/239 (57%), Gaps = 6/239 (3%)
 Frame = +3

Query  150  ILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNG--NFNDFATTSPYRTKEKCDGIN  323
            ++NL  ASGPE  A DP  +G Y GV+DGRILK+      ++DFA TS  R  ++C    
Sbjct  48   VVNLTGASGPESIAFDPAGEGPYVGVSDGRILKWRGEPLGWSDFAHTSSNR--QECARPF  105

Query  324  ITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDA  503
               +   CGRPLGL FD   G LY+ D ++GLL V    GGLA  L     G+ F F + 
Sbjct  106  APELEHVCGRPLGLRFDKKTGDLYIADAYFGLLVVG-PAGGLAKPLVTEAEGQPFRFTND  164

Query  504  VAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGM  683
            + +DE    +YF D    F+   +   V + D +GR +KY  +  + TVLL GL+   G+
Sbjct  165  LDIDEQEDVIYFTDTSARFQRRQFLAAVLNVDKTGRFIKYDRSSKKATVLLQGLAFANGV  224

Query  684  ATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            A   D++F+++ E    +I++ ++SGP A T Q V   L G+PDN++R + G FWVAL+
Sbjct  225  ALSKDRSFVLVVETTTCKILRLWLSGPNAGTHQ-VFAELPGFPDNIRRNSNGEFWVALH  282



>ref|XP_002438841.1| hypothetical protein SORBIDRAFT_10g027060 [Sorghum bicolor]
 gb|EER90208.1| hypothetical protein SORBIDRAFT_10g027060 [Sorghum bicolor]
Length=346

 Score =   169 bits (429),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 109/298 (37%), Positives = 164/298 (55%), Gaps = 12/298 (4%)
 Frame = +3

Query  174   GPEDTAIDPLDQGIYTGVTDGRILKYLNGNFNDFATT--SPYRTKEKCDGINITN---IR  338
             GPE  A D    G Y+GV+DGR+LK+ NG    ++T   SP    E C            
Sbjct  52    GPESVAFDGAGAGPYSGVSDGRVLKW-NGFARGWSTYAYSPGYDAEACTASRARPAELTE  110

Query  339   AECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDE  518
             ++CGRPLGL F    G LY+ D + GL++V    GG AT LAA V+G    F + V VD+
Sbjct  111   SKCGRPLGLRFHRRSGNLYIADAYKGLMRVG-PGGGEATVLAAEVDGVPLRFTNGVDVDQ  169

Query  519   LTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDID  698
             +T DV+F D+   +    + ++  +GD+SGRL+KY    GQVTVL  G++ P G+A   D
Sbjct  170   VTGDVFFTDSSMNYPRSQHERVTATGDSSGRLMKYDPKTGQVTVLQAGITYPNGLAISAD  229

Query  699   QTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqq  878
             +T ++++     ++++Y+I GPKA T++  + +L GYPDNV+    GGFWVAL+  K + 
Sbjct  230   RTHLVVALTGPCKLMRYWIKGPKAGTSEH-LADLPGYPDNVRFDGRGGFWVALHREKMEL  288

Query  879   qppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSFSGYQEYSDIAYVGSLLSDFVAV  1052
                P   +   +AV    DG +V       +   +    +E   + Y+GS+   +VAV
Sbjct  289   PFGPDSHL---LAVRVGADGQVVQVMRGPKSVRPTEVVEREGGKL-YMGSVELPYVAV  342



>gb|AFK49602.1| unknown [Medicago truncatula]
Length=376

 Score =   170 bits (431),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 145/240 (60%), Gaps = 11/240 (5%)
 Frame = +3

Query  168  ASGPEDTAIDPLDQGIYTGVTDGRILKYL--NGNFNDFA-TTSPYRTKE---KCDGINIT  329
            A GPE  A DP  +G YTG+++G I+K+      + DFA T+S +R  +   +C G    
Sbjct  56   AVGPESLAFDPNGEGPYTGISNGHIIKWHRHENRWVDFAVTSSSHRGDDDVDECRGPYKE  115

Query  330  NIRAE--CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQ-LAAGVNGRNFSFID  500
            + + E  CGRPLGL F+ A G LYV D + GL+ +E + GG+A + ++  V G+  +F +
Sbjct  116  HPKKEHICGRPLGLCFNVASGQLYVADAYMGLVVIE-STGGIARKVISHAVEGQPLAFTN  174

Query  501  AVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAG  680
            ++ +D+ T  VYF  +   +   NY  ++ +GD+SGRL+KY     QV VLLN L+   G
Sbjct  175  SLDIDQRTGAVYFTSSSSKYERRNYVSLILTGDSSGRLIKYEPKSEQVNVLLNNLTFANG  234

Query  681  MATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            +A   +  +I+ISE    RI++Y++  PKA T + V  NL G+PDN+KR   GGFWV +N
Sbjct  235  VALSKNGNYILISETTKCRILRYWLETPKAGTLE-VFANLPGFPDNIKRSPRGGFWVGIN  293



>ref|XP_003625041.1| Adipocyte plasma membrane-associated protein [Medicago truncatula]
 gb|AES81259.1| strictosidine synthase family protein [Medicago truncatula]
Length=393

 Score =   170 bits (431),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 145/240 (60%), Gaps = 11/240 (5%)
 Frame = +3

Query  168  ASGPEDTAIDPLDQGIYTGVTDGRILKYL--NGNFNDFA-TTSPYRTKE---KCDGINIT  329
            A GPE  A DP  +G YTG+++G I+K+      + DFA T+S +R  +   +C G    
Sbjct  56   AVGPESLAFDPNGEGPYTGISNGHIIKWHRHENRWVDFAVTSSSHRGDDDVDECRGPYKE  115

Query  330  NIRAE--CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQ-LAAGVNGRNFSFID  500
            + + E  CGRPLGL F+ A G LYV D + GL+ +E + GG+A + ++  V G+  +F +
Sbjct  116  HPKKEHICGRPLGLCFNVASGQLYVADAYMGLVVIE-STGGIARKVISHAVEGQPLAFTN  174

Query  501  AVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAG  680
            ++ +D+ T  VYF  +   +   NY  ++ +GD+SGRL+KY     QV VLLN L+   G
Sbjct  175  SLDIDQRTGAVYFTSSSSKYERRNYVSLILTGDSSGRLIKYEPKSEQVNVLLNNLTFANG  234

Query  681  MATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            +A   +  +I+ISE    RI++Y++  PKA T + V  NL G+PDN+KR   GGFWV +N
Sbjct  235  VALSKNGNYILISETTKCRILRYWLETPKAGTLE-VFANLPGFPDNIKRSPRGGFWVGIN  293



>gb|EPS65875.1| hypothetical protein M569_08902 [Genlisea aurea]
Length=391

 Score =   170 bits (431),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 98/238 (41%), Positives = 135/238 (57%), Gaps = 7/238 (3%)
 Frame = +3

Query  159  LQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGNFNDFATTSPYRTKEKCDG----INI  326
            L    GPE  A DP  +G YTGV DGRIL +   ++ DFA TSP R+   CD     ++ 
Sbjct  65   LNQLQGPESLAFDPSGRGPYTGVADGRILFWNGVDWTDFAYTSPNRSDGLCDPKPSILDY  124

Query  327  TNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAV  506
                  CGRPLGL FD   G LY+ D ++GL+KV R  GGLAT LA    G    F + +
Sbjct  125  LKNEHICGRPLGLRFDRKNGDLYIADAYFGLMKVGRE-GGLATSLATEAEGIPLGFTNDL  183

Query  507  AVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMA  686
             VD+   +VYF D+   +R  N+ Q+V + + SGRLLKY     + +VL+  L  P G++
Sbjct  184  DVDD-EGNVYFTDSSTRYRRRNFLQLVFTAENSGRLLKYDPKTRETSVLVRNLQFPNGVS  242

Query  687  TDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
               D +FI+  E    R+ KY++ G K  T++ VM  L G+PDNV+    G FWVA++
Sbjct  243  LSKDGSFIVYCESSKGRLSKYWLKGKKGGTSE-VMAVLPGFPDNVRTNEEGEFWVAVH  299



>ref|XP_010932965.1| PREDICTED: strictosidine synthase 3-like [Elaeis guineensis]
Length=391

 Score =   170 bits (431),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 98/238 (41%), Positives = 141/238 (59%), Gaps = 8/238 (3%)
 Frame = +3

Query  159  LQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGNFNDFATTSPYRTKEKCDGIN--ITN  332
            L    GPE  A DPL +G YTGV DGR+L +   +++DFA TSP R+ E CD     ++ 
Sbjct  68   LGQIQGPESVAFDPLGRGPYTGVADGRVLFWNGHSWSDFAYTSPIRS-ELCDPKPSALSY  126

Query  333  IRAE--CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAV  506
            +R E  CGRPLGL FD   G LY+ D ++GLLKV    GGLAT L+    G   +F + +
Sbjct  127  LRNEHICGRPLGLRFDKKTGDLYIADAYFGLLKVG-PEGGLATPLSTEAEGVPLNFTNDL  185

Query  507  AVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMA  686
             +DE   ++YF D+   ++  N+ Q+V SG+ SGRLLKY+    +  VLL  L  P G++
Sbjct  186  DIDE-EGNIYFTDSSTNYQRRNFMQLVFSGEPSGRLLKYNPVTKETIVLLRNLQFPNGVS  244

Query  687  TDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
               D +F +  E    R+ +Y++ G KA T++ +   L G+PDNV+    G FWVA++
Sbjct  245  LSKDGSFFVFCEGSRGRLTRYWLKGEKAGTSE-IFAILPGFPDNVRTNEKGEFWVAIH  301



>ref|NP_001063030.1| Os09g0373200 [Oryza sativa Japonica Group]
 dbj|BAD26370.1| putative strictosidine synthase [Oryza sativa Japonica Group]
 dbj|BAF24944.1| Os09g0373200 [Oryza sativa Japonica Group]
 dbj|BAG98853.1| unnamed protein product [Oryza sativa Japonica Group]
Length=364

 Score =   169 bits (429),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 95/233 (41%), Positives = 138/233 (59%), Gaps = 5/233 (2%)
 Frame = +3

Query  171  SGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDG-INITNIRA  341
            +GPE  A D    G YTG +DGRIL++  G   + +FA  S +++   C     +    +
Sbjct  64   TGPESLAFDGRGDGPYTGGSDGRILRWRGGRLGWTEFAYNSRHKSVGVCSPEKKLVVPES  123

Query  342  ECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDEL  521
             CGRPLGL F HA G LYV D + GLL+V    GGLA  +A    G  F+F++ + VD+ 
Sbjct  124  VCGRPLGLQFHHASGDLYVADAYLGLLRVP-ARGGLAEVVATEAAGVPFNFLNGLDVDQR  182

Query  522  TADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQ  701
            T DVYF D+   +R   Y  +V  GD +GRLL+Y A + +VTVL +GL  P G+A   D 
Sbjct  183  TGDVYFTDSSTTYRRSQYLLVVAMGDETGRLLRYDARRRRVTVLHSGLPYPNGVAVSDDG  242

Query  702  TFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            T ++++      + +Y++ GP+A  ++T  E + GYPDNV+R   GG+WVAL+
Sbjct  243  THVVVAHTGLCELRRYWLRGPRAGKSETFAE-VPGYPDNVRRDGDGGYWVALS  294



>ref|XP_008392402.1| PREDICTED: strictosidine synthase 1-like [Malus domestica]
 ref|XP_008360679.1| PREDICTED: strictosidine synthase 1-like [Malus domestica]
Length=375

 Score =   169 bits (429),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 94/239 (39%), Positives = 139/239 (58%), Gaps = 6/239 (3%)
 Frame = +3

Query  150  ILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGIN  323
            ++ +  A GPE  A DP   G YTGV DGR+LK+   +  + DFA T+  R  ++C    
Sbjct  49   VIPVPGALGPESLAFDPTGDGPYTGVADGRVLKWDRNDRRWTDFAVTTSQR--KECVRPF  106

Query  324  ITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDA  503
               +   CGRPLGL FD   G LY+ D + GL +V    GGLA+Q+   V G+   F + 
Sbjct  107  APEMEHVCGRPLGLKFDKKNGDLYIADAYLGL-QVVGPAGGLASQVVREVEGQPLRFTND  165

Query  504  VAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGM  683
            + +DE    +YF D+  IF+   +   V +GD +GRLLKY  +  +VTVLL GL+   G+
Sbjct  166  MDIDEHKDVIYFTDSSTIFQRRQFMSSVLNGDRTGRLLKYDKSSKEVTVLLRGLAFANGV  225

Query  684  ATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            A   D++F++++E    RI++ ++ GP A  T    E L G+PDN++R + G FWVAL+
Sbjct  226  ALSKDRSFVLVAETTTCRILRIWLDGPNAGNTDVFAE-LPGFPDNIRRNSNGEFWVALH  283



>ref|XP_009783664.1| PREDICTED: strictosidine synthase 3-like [Nicotiana sylvestris]
Length=385

 Score =   170 bits (430),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 136/240 (57%), Gaps = 7/240 (3%)
 Frame = +3

Query  150  ILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYL--NGNFNDFATTSPYRTKEKCDGIN  323
            I+ +  A GPE  A D    G Y GV+DGRI+K+L     + DFA TSP R    C+G +
Sbjct  54   IIGIVGAVGPESFAFDRHGDGPYAGVSDGRIIKWLRNESRWLDFAVTSPERNG--CEGFH  111

Query  324  -ITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFID  500
              T+    CGRPLG+DFD   G LYV D + GLL V   NGGLAT++A    G  F F +
Sbjct  112  DHTDTEHRCGRPLGMDFDENSGDLYVADAYLGLLVVG-PNGGLATKVAKMAEGVPFGFTN  170

Query  501  AVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAG  680
            ++ +D+    +YF D+   F   +Y  ++ SGD +GRL+KY      V+VLL  L  P G
Sbjct  171  SLCIDQTHGVLYFTDSSTTFSRRSYISVIVSGDNTGRLMKYDMQSKLVSVLLKNLKFPNG  230

Query  681  MATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            +A      F++ +E    +I K+++   +A + + V E L G+PDN+KR   G FWV +N
Sbjct  231  VAMSKHGDFLLFAETTTCKIFKFWLKTSQAGSVEVVSE-LPGFPDNIKRNKNGEFWVGVN  289



>emb|CDP09529.1| unnamed protein product [Coffea canephora]
Length=360

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 98/240 (41%), Positives = 138/240 (58%), Gaps = 7/240 (3%)
 Frame = +3

Query  150  ILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGI-  320
            +L +  A GPE  A D   +G YTGV+DGRI+K+      + +FA T+P+R    C+G  
Sbjct  43   VLPILDAVGPESLAFDKHGEGPYTGVSDGRIIKWQRNENRWINFAVTTPHR--HGCEGAQ  100

Query  321  NITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFID  500
            +  +    CGR LGL F+H  G LY+ D + GLL V    GGLAT LA    G  F F +
Sbjct  101  DHDDTEFRCGRTLGLSFNHKTGDLYIADAYMGLLVVGPK-GGLATPLAKEAQGVPFKFTN  159

Query  501  AVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAG  680
             V VD+ +  VYF D+   F+  +Y  I+ SGD SGRL+K+     +VTVLL+ L  P G
Sbjct  160  GVVVDQRSGVVYFTDSSTKFQRKDYMSIIFSGDNSGRLMKFDPTAKKVTVLLHNLMFPNG  219

Query  681  MATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            +A   +  F++I+E    R++K+++   KA   + V  NL G PDN+ R   G FWVA+N
Sbjct  220  VALSKNGDFLLITETTNCRVLKFWLDPSKAGGVE-VFANLPGIPDNINRNQKGEFWVAIN  278



>ref|XP_003595639.1| Strictosidine synthase-like protein [Medicago truncatula]
Length=333

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 103/272 (38%), Positives = 154/272 (57%), Gaps = 9/272 (3%)
 Frame = +3

Query  57   MKSLTMFWISILMFISSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDG  236
            M  +T   IS++++ SS  V + +      +  +L   +GPE  A D +  G YTGV+DG
Sbjct  1    MAVITGILISLILYNSSSIVAYCKLLDRLYLPPSL---TGPESLAFDSIGGGPYTGVSDG  57

Query  237  RILKY--LNGNFNDFATTSPYRTKEKCDGI-NITNIRAECGRPLGLDFDHARGVLYVTDM  407
            RILKY      F +FA  SPYR K  CDGI + + ++  CGRP+GL F++    LY+ D 
Sbjct  58   RILKYDEECSCFLEFAHISPYRNKTNCDGISDFSELQETCGRPMGLSFNYKTKELYIADA  117

Query  408  FYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIV  587
            +YGL+KV  + GG ATQL + V G  F F+    VD  T  VYF +A    +  +   ++
Sbjct  118  YYGLVKVPYD-GGAATQLVSNVLGNPFGFLAGADVDPNTGIVYFTEASYYHKIRDLRNLL  176

Query  588  QSGDT-SGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGP  764
             S D  SG L +Y+      T+LL  L+   G+A   + +F+++SEY   RI +++++GP
Sbjct  177  NSRDIFSGSLFRYNPTTKVTTLLLRNLAMATGVAVSSNGSFVLVSEYKANRIRRFWLTGP  236

Query  765  KANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
             A T+   +  L G PDN+KR +   FWVA+N
Sbjct  237  NAYTSDIFLW-LPGRPDNIKRTSKNEFWVAVN  267



>emb|CBI18783.3| unnamed protein product [Vitis vinifera]
Length=312

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/231 (41%), Positives = 128/231 (55%), Gaps = 14/231 (6%)
 Frame = +3

Query  174  GPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRAEC  347
            GPE  A D    G YTG++DGRILK+      + +FA TSP+R    CDG     I   C
Sbjct  39   GPESIAFDCNGDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPNFCDGSLNLAIEQVC  98

Query  348  GRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTA  527
            GRPLGL F+ A   LY+ D ++GLL V +N GG+A Q+A    G  F F +A+ +D+ T 
Sbjct  99   GRPLGLKFNEATCDLYIADAYFGLLVVGQN-GGVAKQVAISAEGVPFRFTNALDIDQNTG  157

Query  528  DVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTF  707
             VYF D   IF+   Y   +Q GD +GRLLKY     +VTVLL GLS   G+A   D+ F
Sbjct  158  VVYFTDTSTIFQRWAYAIAMQIGDKTGRLLKYDPRTKEVTVLLRGLSFSNGVALSEDKDF  217

Query  708  IMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            ++++E    ++ +Y+               L G PDN++R   G FWVA N
Sbjct  218  VLVTETTAAKVTRYW-----------TFTQLVGCPDNIQRNINGEFWVAQN  257



>emb|CDY35420.1| BnaA03g19400D [Brassica napus]
Length=350

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 117/353 (33%), Positives = 181/353 (51%), Gaps = 26/353 (7%)
 Frame = +3

Query  57    MKSLTMFWISILMFIS-------SPYVIHSQPGVDFP--IILNLQHASGPEDTAIDPLDQ  209
             MK   +  I + +F+S       SP    S   V FP   ++    ASGPE    D   +
Sbjct  2     MKLFLVVAICVALFLSLTDFSGKSPKHGESMLTVHFPEFRLIPTTGASGPESFVFDISGE  61

Query  210   GIYTGVTDGRILKYL--NGNFNDFATTSPYRTKEKCDGINITNIRAE--CGRPLGLDFDH  377
             G YTG++DGRI+K++     + DFA T+P  T+E C+G +  + R E  CGRPLGL F+ 
Sbjct  62    GPYTGLSDGRIVKWIANESRWIDFAVTTP--TREGCEGPH-EHQRTEDVCGRPLGLAFEK  118

Query  378   ARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDI  557
             + G LY+ D + GLLKV R  GGLA Q+          F + + VD  T  VYF D+  +
Sbjct  119   STGDLYIADAYMGLLKVGRE-GGLANQMLTRQLDEPLRFTNGLDVDPRTRVVYFTDSSSV  177

Query  558   FRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRR  737
             ++  NY  ++ SGD +GRL+KY     QVT LL+ L+ P G+    +  +++++E    R
Sbjct  178   YQRRNYIGVMMSGDRTGRLMKYDPNTKQVTTLLSNLAFPNGVVLSQNGEYLLVAETAKCR  237

Query  738   IIKYFI----SGPKANTTQTVM-ENLEGYPDNVKRGTLGGFWVALNipkpqqqppppipM  902
             I++Y++    S  K+  +  +  + L G+PDN+KR   GGFW+ +N    +        +
Sbjct  238   ILRYWLNDTTSASKSRESYEIFSDRLPGFPDNIKRSPRGGFWIGVNTKHTKLTKFAMSNV  297

Query  903   -TDSIAVNFDMDG-NIVNTKNVTDTFPNSFSGYQEYSDIAYVGSLLSDFVAVY  1055
                  A+   +D   +   KN       S S  +E     +VGS+ + FV +Y
Sbjct  298   WLGRAALGLSVDWMKVFEGKNGNRWM--SISEVEERDRTLWVGSVNTPFVGMY  348



>ref|XP_002323255.1| strictosidine synthase family protein [Populus trichocarpa]
 gb|EEF05016.1| strictosidine synthase family protein [Populus trichocarpa]
Length=375

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 98/270 (36%), Positives = 149/270 (55%), Gaps = 14/270 (5%)
 Frame = +3

Query  81   ISILM-----FISSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRIL  245
            +SIL+      +  P +  S   +    IL++  A GPE    DP  +G YTGV DGR+L
Sbjct  18   VSILLTSPTKLLGPPTIPTSNDHLHSAKILHVSGAVGPESLVFDPNGEGPYTGVADGRVL  77

Query  246  KYL-----NGNFNDFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMF  410
            K++     +G++ DFATTS  R +  C       +   CGRPLGL FD   G LY+ D +
Sbjct  78   KWIAGDDGSGSWTDFATTSSNRNE--CVRPFAPEMEHVCGRPLGLRFDKKTGNLYIADAY  135

Query  411  YGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQ  590
             GL +V    GGLAT +   + G+   F + + +DE    +YF D   +F+   +   + 
Sbjct  136  LGL-QVVGPTGGLATPVVTELEGQPMRFTNDLDIDEQEDVIYFTDTSMVFQRRQFILSLL  194

Query  591  SGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKA  770
            + D +GRLLKY  +  +VTVL  GL+   G+A   D TF++++E    RI+++++ GP A
Sbjct  195  TKDKTGRLLKYDKSSKEVTVLARGLAFANGVALSKDSTFLLVAETTTCRILRFWLHGPNA  254

Query  771  NTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
              +    E L G+PDN++R + G FWVAL+
Sbjct  255  GKSDVFTE-LPGFPDNIRRNSKGEFWVALH  283



>ref|XP_011075619.1| PREDICTED: protein STRICTOSIDINE SYNTHASE-LIKE 11 [Sesamum indicum]
Length=331

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/234 (41%), Positives = 138/234 (59%), Gaps = 7/234 (3%)
 Frame = +3

Query  168  ASGPEDTAIDPLDQGIYTGVTDGRILKYL--NGNFNDFATTSPYRTKEKCDGINITNIRA  341
            A GPE  + D    G YTGV+DGRI+++      + DFA TSP R  + C+G +  + + 
Sbjct  48   AIGPESFSFDGNGDGPYTGVSDGRIIRWRANESQWVDFAVTSPMR--DGCEGPHDHSQKE  105

Query  342  E-CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDE  518
              CGRPLGL F+   G LY+TD + GLL V  N GGLA+ LA  ++G  F F +++ +D 
Sbjct  106  HICGRPLGLRFNEKTGDLYITDAYMGLLVVGPN-GGLASPLAQQLDGLAFGFTNSLDIDH  164

Query  519  LTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDID  698
             T  VYF D+   F   NY  ++ SGD +GRL+K+     + T+LLN L  P G+A   +
Sbjct  165  NTGVVYFTDSSTRFPRRNYVSVIISGDDTGRLMKFDPRTKKTTLLLNNLKFPNGVALSKN  224

Query  699  QTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
              F++  E    R+ K+++  PKA   + V+  L G+PDNVKR ++G FWV +N
Sbjct  225  GDFLLFVETTTCRLFKFWLKPPKAGNVE-VLAQLPGFPDNVKRNSIGEFWVGIN  277



>ref|NP_177540.3| strictosidine synthase 3 [Arabidopsis thaliana]
 sp|P92976.2|SSL11_ARATH RecName: Full=Protein STRICTOSIDINE SYNTHASE-LIKE 11; Short=AtSSL11; 
AltName: Full=Strictosidine synthase 12; Short=AtSS12; 
AltName: Full=Strictosidine synthase 3; Short=SS-3; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG52519.1|AC016662_13 putative strictosidine synthase; 41777-43912 [Arabidopsis thaliana]
 dbj|BAF02041.1| strictosidine synthase AtSS-3 [Arabidopsis thaliana]
 gb|AEE35536.1| strictosidine synthase 3 [Arabidopsis thaliana]
Length=329

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 107/298 (36%), Positives = 154/298 (52%), Gaps = 14/298 (5%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYL-NGNFNDFATTSPYRTKEKCDG-INITNIRAE  344
             +GPE  A D   +G YTGVT G+ILKYL    + DFA  +       CDG +  TN+  +
Sbjct  39    TGPEAFAFDSTGKGFYTGVTGGKILKYLPKKGYVDFAQITNSSKSSLCDGALGTTNVE-K  97

Query  345   CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELT  524
             CGRP G+ F+   G LYV D   GL  + R  GGLA ++A  V G+ F F+D + VD  T
Sbjct  98    CGRPAGIAFNTKTGDLYVADAALGLHVIPRR-GGLAKKIADSVGGKPFLFLDGLDVDPTT  156

Query  525   ADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQT  704
               VYF      F   +  + V + D++G+  KY  +K  VTVL+ GLSG AG A   D +
Sbjct  157   GVVYFTSFSSTFGPRDVLKAVATKDSTGKFFKYDPSKKVVTVLMEGLSGSAGCAVSSDGS  216

Query  705   FIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKR-GTLGGFWVALNipkpqqq  881
             F+++ ++    I +Y+I G KA T++    ++   PDN+KR G+ G FWVA         
Sbjct  217   FVLVGQFTKSNIKRYWIKGSKAGTSEDFTNSVSN-PDNIKRIGSTGNFWVA-------SV  268

Query  882   ppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSF-SGYQEYSDIAYVGSLLSDFVAV  1052
                    T+  AV     G ++ T  + D F ++  S   EY    Y+G+L   F  +
Sbjct  269   VNSATGPTNPSAVKVSSAGKVLQTIPLKDKFGDTLVSEVNEYKGQLYIGALFGPFAGI  326



>ref|XP_004963976.1| PREDICTED: strictosidine synthase-like [Setaria italica]
Length=352

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/246 (39%), Positives = 144/246 (59%), Gaps = 12/246 (5%)
 Frame = +3

Query  153  LNLQH------ASGPEDTAIDPLDQGIYTGVTDGRILKY--LNGNFNDFATTSPYRTKEK  308
            L L+H       +G E  A D   QG YTGV+DGRIL++   + ++  FA  + Y+ K  
Sbjct  48   LALEHIPLPYGVTGAESLAFDRRGQGPYTGVSDGRILRWDGSSNSWTTFAYNANYKNKPI  107

Query  309  CDGI--NITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGR  482
            C        ++ + CGRPLGL F    G LY+ D + GL+KV  +NGG A  LAA  +G 
Sbjct  108  CTAPARRQEDVESICGRPLGLQFYAKTGDLYIADAYLGLMKVG-SNGGEAEVLAAEADGV  166

Query  483  NFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNG  662
             F+F + + VD++T D+YF D+   +     TQI+   D +GRLL+Y+A  G+VTVL  G
Sbjct  167  PFTFTNGIDVDQVTGDIYFTDSSTTYTRARNTQIMIHRDVTGRLLRYNARAGRVTVLKAG  226

Query  663  LSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGG  842
            L  P G+A   D+T ++++     +  +Y+I GPKA   + ++ +L GY DN++R T GG
Sbjct  227  LPYPNGVALSTDRTHVVVAHTGPCQAFRYWIRGPKAGRYE-LLADLPGYADNIRRDTRGG  285

Query  843  FWVALN  860
            +W ALN
Sbjct  286  YWFALN  291



>ref|XP_008453519.1| PREDICTED: strictosidine synthase 3 [Cucumis melo]
Length=402

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 102/273 (37%), Positives = 149/273 (55%), Gaps = 8/273 (3%)
 Frame = +3

Query  54   NMKSLTMFWISILMFISSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTD  233
            N      +++ +  +   P    S+  +    I+      GPE  A D L +G YTGV D
Sbjct  41   NFPDFETYYVELPSWSQIPTERDSENLLQKSTIMFKDQVQGPESVAFDSLGRGPYTGVAD  100

Query  234  GRILKYLNGNFNDFATTSPYRTKEKCDG----INITNIRAECGRPLGLDFDHARGVLYVT  401
            GR+L +   ++ DFA TSP R+ E CD     +        CGRPLGL FD   G LY+ 
Sbjct  101  GRVLFWNGESWTDFAYTSPNRS-EICDPKPSILGYAKNEHICGRPLGLRFDKKTGNLYIA  159

Query  402  DMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQ  581
            D ++GL+KV    GGLAT L+    G  F FI+ + +D+   +VYF D+   +   N+ Q
Sbjct  160  DAYFGLMKV-GPEGGLATSLSTEAEGVPFKFINDLDLDD-EGNVYFTDSSTKYHRRNFIQ  217

Query  582  IVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISG  761
            +V S + +GRLLKY+AA G+ TVL+  L  P G++   D +F +  E    R+ KY++ G
Sbjct  218  VVFSAENTGRLLKYNAATGETTVLVRDLYFPNGVSLSKDGSFFLFCEGGKGRLRKYWLKG  277

Query  762  PKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
             KA TT+ +   L G+PDNV+    G FWVA++
Sbjct  278  EKAGTTE-LFAILPGFPDNVRTNDKGDFWVAVH  309



>ref|XP_009631158.1| PREDICTED: strictosidine synthase 1-like [Nicotiana tomentosiformis]
Length=337

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 103/305 (34%), Positives = 157/305 (51%), Gaps = 19/305 (6%)
 Frame = +3

Query  150   ILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNG--NFNDFATTSPYRTKEKCDGIN  323
             I+ L+ A GPE  A DP  +G YTGV DGRILK+      + DFA TS  R    C   +
Sbjct  46    IIQLKGAVGPESIAFDPNGEGPYTGVADGRILKWQEQAQTWADFAVTSSERNN--CTQPS  103

Query  324   ITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDA  503
                +   CGRPLG+ FD   G LY+ D + GL +V    GGL T L     G+   F + 
Sbjct  104   APEMEHICGRPLGIRFDKKTGDLYIADAYLGL-QVVGPKGGLTTPLVQKFEGKPLIFTND  162

Query  504   VAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGM  683
             + +D     +YF D+   ++   Y     SGDT+GRL+KY  +  +VTV+L GL+   G+
Sbjct  163   MDIDNQNNVIYFTDSSTKYQRRQYFAAFVSGDTTGRLMKYDKSTKKVTVVLRGLAFANGV  222

Query  684   ATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNi  863
             A + D++F++++E    RII+Y+I GP A     +  ++ G+PDN++  + G FWVAL+ 
Sbjct  223   ALNKDRSFVLVAETANCRIIRYWIKGPYAG-RHDIFADVPGFPDNIRINSRGEFWVALHA  281

Query  864   pkpqqqppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSF-SGYQEYSDIAYVGSLLSD  1040
                          T + A+    +G ++      D     + S  +E     + GS++  
Sbjct  282   K------------TSATAIKLSANGRMLEVLEDEDGKTLRYISEVEEKHGKLWFGSVMMP  329

Query  1041  FVAVY  1055
             F+ VY
Sbjct  330   FLGVY  334



>ref|XP_009142736.1| PREDICTED: strictosidine synthase 3-like [Brassica rapa]
Length=375

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 103/284 (36%), Positives = 154/284 (54%), Gaps = 19/284 (7%)
 Frame = +3

Query  57   MKSLTMFWISILMFIS-------SPYVIHSQPGVDFP--IILNLQHASGPEDTAIDPLDQ  209
            MK   +  IS  + +S       SP    S   V FP   ++    A GPE  A D    
Sbjct  2    MKLFFVLAISFALLLSLFDSSGESPKHGESMLTVHFPDFHLIPTTGALGPESFAFDFYGD  61

Query  210  GIYTGVTDGRILKYL--NGNFNDFATTSPYRTKEKCDGIN-ITNIRAECGRPLGLDFDHA  380
            G +TG++DGRI+K++     + DFA T+P  T+E C+G +       ECGRPLGL F+ +
Sbjct  62   GPFTGLSDGRIVKWIANESRWMDFAVTTP--TREGCEGPHEHQRTEHECGRPLGLAFEKS  119

Query  381  RGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIF  560
             G LY+ D + GLLKV R  GGLA Q++     +   F +AV +D  T  VYF D+  ++
Sbjct  120  TGDLYIADAYMGLLKVGRQ-GGLANQVSTRQLDKPLRFTNAVEIDPRTGVVYFTDSSSVY  178

Query  561  RSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRI  740
            +  NY   + SGD +GRL+KY     QVT L++ LS   G+    +  +++++E    RI
Sbjct  179  QRRNYIGAIMSGDRTGRLMKYDPKTNQVTTLVSNLSFANGVVMSQNGDYLLVAETATSRI  238

Query  741  IKYFISGPKANTT----QTVMENLEGYPDNVKRGTLGGFWVALN  860
            ++Y+++    + +    +   E L G+PDN+KR   GGFWV LN
Sbjct  239  LRYWLNDTSVSKSHEKYEIFAEGLPGFPDNIKRSPRGGFWVGLN  282



>ref|XP_010427563.1| PREDICTED: strictosidine synthase 1-like [Camelina sativa]
Length=374

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/239 (40%), Positives = 136/239 (57%), Gaps = 6/239 (3%)
 Frame = +3

Query  150  ILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGIN  323
            ++NL  ASGPE  A DP  +G Y GV+DGR+LK+   +  + DFA TS  R  E C    
Sbjct  48   VVNLTGASGPESIAFDPAGEGPYAGVSDGRVLKWRGESLGWTDFAFTSANR--EMCVRPF  105

Query  324  ITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDA  503
               +   CGRPLGL FD   G LY+ D ++GLL V    GGLA  L     G+ F F + 
Sbjct  106  APELEHVCGRPLGLRFDKKSGDLYIADAYFGLLIVG-PAGGLARPLVTEAEGQPFRFTND  164

Query  504  VAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGM  683
            + +DE    +YF D    F+   +   V + D +GR +KY  +  + TVLL GL+   G+
Sbjct  165  LDIDEQDDVIYFTDTSAKFQRRQFLAAVLNVDKTGRFIKYDRSSKKATVLLQGLAFANGV  224

Query  684  ATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            A   D++F+++ E    +I++ ++SGP A  TQ V   L G+PDN++R + G FWVAL+
Sbjct  225  ALSKDRSFVLVVETTTCKILRLWLSGPNAG-TQDVFAELPGFPDNIRRNSNGEFWVALH  282



>emb|CDX95058.1| BnaC05g06130D [Brassica napus]
Length=374

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 107/309 (35%), Positives = 164/309 (53%), Gaps = 14/309 (5%)
 Frame = +3

Query  159   LQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGNFNDFATTSPYRTKEKCDGIN--ITN  332
             L    GPE  A DPL +G YTGV DGRIL +    + DFA TS  R+ E CD  +  +  
Sbjct  67    LNEVQGPESIAFDPLGRGPYTGVADGRILFWDGTRWTDFAYTSNNRS-ELCDTKSSLLAY  125

Query  333   IRAE--CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAV  506
             ++ E  CGRPLGL F    G LYV D ++G++KV    GGLAT L    +G    F + +
Sbjct  126   LKNEHICGRPLGLRFHKRTGDLYVADAYFGIMKVG-PEGGLATSLTTEGDGVPLRFTNDL  184

Query  507   AVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMA  686
              VD+   +VYF D+  +F+  N+  ++ SG+ +GR+LKY+    + T LL  L  P G++
Sbjct  185   DVDD-EGNVYFTDSSSVFQRRNFMHLIVSGEDTGRVLKYNPETKETTTLLRNLQFPNGLS  243

Query  687   TDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNip  866
                D +F +  E    R+ KY++ G KA T++ V+  L G+PDN++    G FWVA++  
Sbjct  244   LGKDGSFFIFCEGSIGRLRKYWLKGEKAGTSE-VVALLHGFPDNIRTNKDGDFWVAVHCH  302

Query  867   kpqqqppppip-----MTDSIAVNFDMDGNIVNT-KNVTDTFPNSFSGYQEYSDIAYVGS  1028
             +                  ++AV +  DG ++   ++       + S  +E     ++GS
Sbjct  303   RNIFTHVMAHHPNVGGWPHAVAVKYSKDGKVLKVLEDKQGKVVKAVSEIEEKDGKLWMGS  362

Query  1029  LLSDFVAVY  1055
             +L  F+AVY
Sbjct  363   VLMSFIAVY  371



>ref|XP_010471492.1| PREDICTED: strictosidine synthase 1-like [Camelina sativa]
Length=337

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 108/297 (36%), Positives = 155/297 (52%), Gaps = 12/297 (4%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYL-NGNFNDFATTSPYRTKEKCDGINITNIRAEC  347
             SGPE  A D   +G YTGV+ G+ILK+L    + +FA  +       CDG   T +   C
Sbjct  36    SGPEAFAFDSTGKGFYTGVSGGKILKWLPETGYVNFAQITESSNSSWCDGNIGTALAGRC  95

Query  348   GRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTA  527
             GRP G+ F+   G LYV D   GL  V   NGGLAT++A  V+G+ F F+D + VD  T 
Sbjct  96    GRPAGIAFNENTGDLYVGDAPLGL-HVISPNGGLATKIADSVDGKPFKFLDGLDVDPTTG  154

Query  528   DVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTF  707
              VYF      F  +     +   D +G+L KY  +   VTVL+ GLSG AG A   D +F
Sbjct  155   VVYFTSFSSRFSPIQVLIALGLKDATGKLYKYDPSTKVVTVLMEGLSGSAGCAVSSDGSF  214

Query  708   IMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKR-GTLGGFWVALNipkpqqqp  884
             +++S++    I +Y+I GPKA T++    ++   PDN+KR G+ G FWVA          
Sbjct  215   VLVSQFTKSNIKRYWIKGPKAGTSEDFTNSVSN-PDNIKRVGSTGNFWVA-------SVV  266

Query  885   pppipMTDSIAVNFDMDGNIVNTKNVTDTFPNS-FSGYQEYSDIAYVGSLLSDFVAV  1052
                I  T+  AV  + DG ++ T  + D F ++  S   E+    Y+G+L   F  +
Sbjct  267   NKFIVPTNPSAVKVNSDGEVLQTIPLKDKFGDTLLSEVNEFEGNLYIGTLTGPFAGI  323



>ref|XP_004487437.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Cicer arietinum]
Length=393

 Score =   169 bits (427),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 95/242 (39%), Positives = 139/242 (57%), Gaps = 8/242 (3%)
 Frame = +3

Query  150  ILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGNFNDFATTSPYRT-----KEKCD  314
            ++ +    GPE  A DPL  G YTGV DG+IL +   ++ DFA TSP R+     KE   
Sbjct  62   LMFVNQVQGPESIAFDPLGHGPYTGVADGKILFWNGLSWIDFAYTSPNRSELCNSKESAS  121

Query  315  GINITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSF  494
             ++       CGRPLGL FD   G LY+ D ++GL+KV    GGLAT LA    G    F
Sbjct  122  PLSYAETEHICGRPLGLRFDKKTGDLYIADAYFGLMKVG-PQGGLATSLATEAEGVPLRF  180

Query  495  IDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGP  674
             + V +D    +VYF D+ + F+  N+  +V SG+ SGR+L+YS+A  +  VL+  +  P
Sbjct  181  TNDVDIDA-EGNVYFTDSSNKFQRRNFVHLVFSGEDSGRVLRYSSATKETVVLVRNIQFP  239

Query  675  AGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVA  854
             G++   D +F + SE I  R+ KY++ G KA T++ ++  L G+PDNV+    G FWV 
Sbjct  240  NGISLSKDGSFFVFSEGITGRLRKYWLKGDKAGTSE-ILAILPGFPDNVRVNENGDFWVG  298

Query  855  LN  860
            ++
Sbjct  299  IH  300



>ref|XP_004986966.1| PREDICTED: strictosidine synthase 3-like [Setaria italica]
Length=342

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 107/298 (36%), Positives = 160/298 (54%), Gaps = 10/298 (3%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRAE  344
             +G E  A D L QG Y GV+DGR+LK+      +  FA +  YR    C    + +   E
Sbjct  49    TGAESLAFDRLGQGPYAGVSDGRVLKWGGSTLGWTTFAHSPNYRKIPLCTASVVPSEETE  108

Query  345   --CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDE  518
               CGRPLGL F    G LY+ D ++GL+KV   +GG A  LA   +G  F F++ + VD+
Sbjct  109   SICGRPLGLQFFAKTGDLYIADAYHGLMKVG-PDGGEAEVLATQADGVPFHFVNGLDVDQ  167

Query  519   LTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDID  698
              T DVYF D+   +     T+I+ + D +GRLLKY A   QVTVL  GL  P G+A   D
Sbjct  168   ATGDVYFTDSSITYPRRFNTEIMMNADATGRLLKYDARAKQVTVLRAGLPYPNGVAVSGD  227

Query  699   QTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqq  878
             +T ++++  +  +  +Y++ G KA   + +M +L GYPDNV+R   GG+WVALN  + + 
Sbjct  228   RTHVVVAHTVPCQAFRYWLKGSKAGQYE-LMADLPGYPDNVRRDAKGGYWVALN--QEKA  284

Query  879   qppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSFSGYQEYSDIAYVGSLLSDFVAV  1052
             +     P+   + V    DG  V  + +T     + S   E     ++GS+  D+V +
Sbjct  285   RLDAAAPVKHLVGVRLGSDG--VEVEELTAAKGVTLSDVAEKDGQLWLGSVELDYVGL  340



>ref|XP_003564761.1| PREDICTED: strictosidine synthase 3-like [Brachypodium distachyon]
Length=341

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 108/314 (34%), Positives = 168/314 (54%), Gaps = 13/314 (4%)
 Frame = +3

Query  123   SQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKY--LNGNFNDFATTSPYR  296
             +Q G+  P+   +   +G E  A D    G YTGV+DGR+LK+      +  FA  + YR
Sbjct  35    TQWGLHLPLPSGV---TGAESLAFDANGAGPYTGVSDGRVLKWGGSAAGWTTFAHNANYR  91

Query  297   TKEKCDGINITNIRAE--CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAG  470
                 C    + +   E  CGRPLGL F  + G LY+ D + GL+KV  + GG A  LA G
Sbjct  92    KLPLCVWSVVPSEETESLCGRPLGLAFHKSSGNLYIADAYKGLMKVGPD-GGEAEVLATG  150

Query  471   VNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTV  650
              +G  F+F++ + VD+ T DVYF D+   +      +I+ + D +GRLLKY A   QV V
Sbjct  151   ADGTAFNFVNGIDVDQSTGDVYFTDSSLTYPRRFNIEIMMNADATGRLLKYDAKTKQVMV  210

Query  651   LLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRG  830
             L +GL+ P G+A   D ++++++  +  +  KY++ GP A   + +  +L GYPDNV+R 
Sbjct  211   LKDGLAYPNGVAVSHDMSYVVVAHTVPCQAFKYYLKGPNAGRYE-LFADLPGYPDNVRRD  269

Query  831   TLGGFWVALNipkpqqqppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSFSGYQEYSD  1010
                G+WVALN  + +  P    P+   + V  + DG  V  + +T     + S  QE   
Sbjct  270   GHNGYWVALN--QEKAHPNATAPVKHLVGVRLNADG--VEVEELTAAKGVTLSEVQEQDS  325

Query  1011  IAYVGSLLSDFVAV  1052
               ++GS+  D+V +
Sbjct  326   KLWLGSVELDYVGI  339



>ref|XP_008776219.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Phoenix dactylifera]
Length=389

 Score =   168 bits (426),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 97/234 (41%), Positives = 139/234 (59%), Gaps = 8/234 (3%)
 Frame = +3

Query  171  SGPEDTAIDPLDQGIYTGVTDGRILKYLNGNFNDFATTSPYRTKEKCDGIN--ITNIRAE  344
             GPE  A DPL +G YTGV DGR+L +   +++DFA TSP R+ E CD     ++ ++ E
Sbjct  70   QGPESVAFDPLGRGPYTGVADGRVLFWNGHSWSDFAYTSPIRS-ELCDPKPSPLSYLKNE  128

Query  345  --CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDE  518
              CGRPLGL FD   G LY+ D ++GLLKV    GGLAT L     G   +F + + +DE
Sbjct  129  HICGRPLGLRFDKKTGDLYIADAYFGLLKVG-PEGGLATPLTTEAEGVQLNFTNDLDIDE  187

Query  519  LTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDID  698
               ++YF D+   ++  N+ Q+V SG+ SGRLLKY+    + TVLL  L  P G++   D
Sbjct  188  -EGNIYFTDSSTNYQRRNFMQLVFSGEPSGRLLKYNPVTNETTVLLRNLQFPNGVSLSKD  246

Query  699  QTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
             +F +  E    R+ +Y++ G KA T+  +   L G+PDNV+    G FWVA++
Sbjct  247  GSFFVFCEGSRGRLSRYWLKGEKAGTSD-IFAILPGFPDNVRTNEKGEFWVAIH  299



>emb|CDP07817.1| unnamed protein product [Coffea canephora]
Length=331

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 107/268 (40%), Positives = 142/268 (53%), Gaps = 13/268 (5%)
 Frame = +3

Query  69   TMFWISILMFISSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILK  248
            T+F ++ L++         +    FPI      A+GPE  A D    G YTGV+DGRI+K
Sbjct  12   TLFLLATLIYNVGIVGCQIKRSETFPIF----GATGPESLAFDRNGGGPYTGVSDGRIIK  67

Query  249  YLNGNFN---DFATTSPYRTKEKCDG-INITNIRAECGRPLGLDFDHARGVLYVTDMFYG  416
            +   N N   DFATT+PYR    C G  +     A CGRPLGL F+H  G LY+ D + G
Sbjct  68   W-QANVNRWVDFATTTPYRFG--CQGPFDHVLTEARCGRPLGLSFNHRTGDLYIADAYMG  124

Query  417  LLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSG  596
            LL V    GGLA  LA    G  F F + V VD+ +  VYF D         Y  ++ SG
Sbjct  125  LLVVG-PEGGLARPLAKEAGGVPFRFTNDVVVDQNSGIVYFTDTSTRLPRSAYAYVILSG  183

Query  597  DTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANT  776
            D SGRLLKY     QVTVL++ L  P G+A   +  F++++E    R+++Y++   +  T
Sbjct  184  DNSGRLLKYDLRTNQVTVLMDHLMFPNGVALSKNGDFLLVTETTNSRVLRYWLEPSRVGT  243

Query  777  TQTVMENLEGYPDNVKRGTLGGFWVALN  860
                 E L G PDN+KR   G FWVA N
Sbjct  244  VDVFAE-LPGRPDNIKRNQQGEFWVAAN  270



>ref|XP_006582039.1| PREDICTED: strictosidine synthase 3-like isoform X2 [Glycine 
max]
Length=342

 Score =   167 bits (423),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 112/306 (37%), Positives = 170/306 (56%), Gaps = 15/306 (5%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYLN--GNFNDFATT-----SPYRTKEKCDGI-NI  326
             +GP+  A D +  G YTGV+DGRILKY      F +FA T        R K  CDGI + 
Sbjct  39    TGPQSLAFDSIGGGPYTGVSDGRILKYEETYSGFVEFAYTWQDSHCWCRNKTICDGISDF  98

Query  327   TNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRN-FSFIDA  503
             + ++  CGRPLGL F +  G L++ D + GL+KV    GG ATQL A   G N F F+  
Sbjct  99    STLQETCGRPLGLSFYYQTGELFIADAYLGLVKVPY-YGGAATQLVAHAQGSNPFGFLSG  157

Query  504   VAVDELTADVYFIDAGDIFRSLNYTQIVQ-SGDTSGRLLKYSAAKGQVTVLLNGLSGPAG  680
             V V+  T  VYF +A   F+  +  ++++ + D SG L KY  +  Q ++LL+ L+  AG
Sbjct  158   VDVEPDTGTVYFTEASSGFKLRDIRELLKNTDDYSGNLYKYDPSTNQTSLLLSNLAVAAG  217

Query  681   MATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
             +A   + +F+++SE    RI +++++GPKANT++  ++ L G P+N+KR +   FWVA+N
Sbjct  218   VAVSGNGSFVLVSECNAHRIRRFWLAGPKANTSEVFLQ-LPGRPENIKRNSKNEFWVAMN  276

Query  861   ipkpqqqppppipMTDSIAVNFDMDGNIVNTKNVTDTF-PNSFSGYQEYSDIAYVGSLLS  1037
              P     PP P  +   + VN   DG ++    + D F   S S  QE++   Y  SL  
Sbjct  277   YPFGTPPPPRPPVLPLGLRVN--EDGEVLEAVPLVDEFGTESVSEIQEFNGTLYASSLHV  334

Query  1038  DFVAVY  1055
              +  ++
Sbjct  335   SYANIF  340



>ref|XP_006494390.1| PREDICTED: strictosidine synthase 1-like [Citrus sinensis]
Length=381

 Score =   168 bits (426),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 97/257 (38%), Positives = 141/257 (55%), Gaps = 6/257 (2%)
 Frame = +3

Query  96   FISSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FN  269
               +P +  S   ++   I+ +  A GPE  A DP   G YTGV DGRILK+      + 
Sbjct  34   LFCAPCIEGSNNNLEGSKIIQVTGALGPESIAFDPNGDGPYTGVADGRILKWQGDELGWT  93

Query  270  DFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGL  449
            +FA T+  R  ++C      +I   CGRPLG+ FD   G LY+ D + G  +V    GGL
Sbjct  94   EFAVTTSQR--KECVRPFAPDIEHICGRPLGIRFDKKTGDLYIADAYLGF-QVVGPEGGL  150

Query  450  ATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSA  629
            ATQL     G+   F + + +DE    +YF D+   F+   +   + SGD +GRLLKY  
Sbjct  151  ATQLVTEAAGQPLRFTNDLDIDEHKGVIYFTDSSTSFQRRQFMSSILSGDKTGRLLKYEK  210

Query  630  AKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGY  809
               +VT+LL GL+   G+A   D+TFI+I+E    RI+++++ GP +   Q V   L G+
Sbjct  211  TTKEVTILLQGLAFANGVALSRDRTFILIAETSNCRILRFWLHGPNSG-KQDVFAELPGF  269

Query  810  PDNVKRGTLGGFWVALN  860
            PDNV+  + G FWVAL+
Sbjct  270  PDNVRSNSNGEFWVALH  286



>gb|EEC84476.1| hypothetical protein OsI_31134 [Oryza sativa Indica Group]
Length=364

 Score =   167 bits (424),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 95/233 (41%), Positives = 137/233 (59%), Gaps = 5/233 (2%)
 Frame = +3

Query  171  SGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDG-INITNIRA  341
            +GPE  A D    G YTG +DGRIL++  G   + +FA  S +++   C     +    +
Sbjct  64   TGPESLAFDGRGDGPYTGGSDGRILRWRGGRLGWTEFAYNSRHKSVGVCSPEKKLVVPES  123

Query  342  ECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDEL  521
             CGRPLGL F HA G LYV D + GLL+V    GGLA  +A    G  F+F++ + VD+ 
Sbjct  124  VCGRPLGLQFHHASGDLYVADAYLGLLRVP-ARGGLAELVATEAAGVPFNFLNGLDVDQR  182

Query  522  TADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQ  701
            T DVYF D+   +R   Y  +V  GD +GRLL+Y A + +VTVL +GL  P G+A   D 
Sbjct  183  TGDVYFTDSSTTYRRSQYLLVVAMGDETGRLLRYDARRRRVTVLHSGLPYPNGVAVSDDG  242

Query  702  TFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            T ++++      +  Y++ GP+A  ++T  E + GYPDNV+R   GG+WVAL+
Sbjct  243  THVVVAHTGLCELRCYWLRGPRAGMSETFAE-VPGYPDNVRRDGDGGYWVALS  294



>ref|XP_002888958.1| hypothetical protein ARALYDRAFT_476542 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65217.1| hypothetical protein ARALYDRAFT_476542 [Arabidopsis lyrata subsp. 
lyrata]
Length=335

 Score =   167 bits (422),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 107/300 (36%), Positives = 155/300 (52%), Gaps = 12/300 (4%)
 Frame = +3

Query  162   QHASGPEDTAIDPLDQGIYTGVTDGRILKYL-NGNFNDFATTSPYRTKEKCDGINITNIR  338
             +  SGPE  A D   +G YTGV+ G+ILKYL    + DFA  +       CDG   T + 
Sbjct  34    ESRSGPEAFAFDSTGKGFYTGVSGGKILKYLPETGYVDFAQITESSNSSWCDGNIGTALA  93

Query  339   AECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDE  518
               CGRP G+ F+   G LYV D   GL  V    GGLAT++A  V+G+ F F+D + VD 
Sbjct  94    GRCGRPAGIAFNEKTGDLYVADAPLGL-HVISPAGGLATKIADSVDGKPFKFLDGLDVDP  152

Query  519   LTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDID  698
              T  VYF      F  +     +   D +G+L KY  +   VTVL+ GLSG AG A   D
Sbjct  153   TTGVVYFTSFSSRFTPIQVLIALGLKDATGKLYKYDPSTKVVTVLMEGLSGSAGCAVSSD  212

Query  699   QTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKR-GTLGGFWVALNipkpq  875
              +F+++S++    I +Y+I GPKA +++    ++   PDN+KR G+ G FWVA       
Sbjct  213   GSFVLVSQFTKSNIKRYWIKGPKAGSSEDFTNSVSN-PDNIKRIGSTGNFWVA-------  264

Query  876   qqppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNS-FSGYQEYSDIAYVGSLLSDFVAV  1052
                   I  T+  AV  + +G ++ T  + D F ++  S   E+    Y+G+L   F  +
Sbjct  265   SVVNKIIVPTNPSAVKVNSNGEVLQTIPLKDKFGDTLLSEVNEFEGNLYIGTLTGPFAGI  324



>ref|XP_004986991.1| PREDICTED: strictosidine synthase 3-like [Setaria italica]
Length=346

 Score =   167 bits (423),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 109/302 (36%), Positives = 160/302 (53%), Gaps = 14/302 (5%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYLNG--NFNDFATTSPYRTKEKCDGINITNIRAE  344
             +G E  A D   QG Y GV+DGR+LK+      +  FA +  YR    C    + +   E
Sbjct  49    TGAESLAFDRRGQGPYAGVSDGRVLKWGGSALGWTTFAYSPNYRKIPLCTASVVPSEETE  108

Query  345   --CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGG---LATQLAAGVNGRNFSFIDAVA  509
               CGRPLGL F    G LY+ D ++GL+KV  + G    LATQ   GV    F F++ + 
Sbjct  109   SICGRPLGLQFFAKTGDLYIADAYHGLMKVGPDGGEAEVLATQADDGV---TFHFVNGLD  165

Query  510   VDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMAT  689
             VD+ T DVYF D+   +     T+I+ + D +GRLLKY A   QVTVL  GL  P G+A 
Sbjct  166   VDQATGDVYFTDSSTTYPRRFNTEIMMNADATGRLLKYDARTKQVTVLKAGLPYPNGVAV  225

Query  690   DIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipk  869
               D+T ++++  +  +  +Y++ GPKA   + +M +L GYPDNV+R   GG+WVALN  K
Sbjct  226   SNDRTHVVVAHTVPCQTFRYWLKGPKAGQYE-LMADLPGYPDNVRRDAKGGYWVALNQEK  284

Query  870   pqq-qppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSFSGYQEYSDIAYVGSLLSDFV  1046
              +        P+   + V   +DG  V  + +T     + S   E     ++GS+  D+V
Sbjct  285   ARLDVAASAAPVKHLVGVRLSVDG--VEVEELTAAKGVTLSDVAEKDGQLWLGSVELDYV  342

Query  1047  AV  1052
              +
Sbjct  343   GL  344



>ref|XP_004172338.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Cucumis sativus]
Length=402

 Score =   168 bits (426),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 110/331 (33%), Positives = 163/331 (49%), Gaps = 33/331 (10%)
 Frame = +3

Query  150   ILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGNFNDFATTSPYRTKEKCDG----  317
             I+      GPE  A D L +G YTGV DGR+L +   ++ DFA TSP R+ E CD     
Sbjct  73    IMFKDQVQGPESVAFDSLGRGPYTGVADGRVLFWNGESWTDFAYTSPNRS-EICDPKPSI  131

Query  318   INITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFI  497
                      CGRPLGL FD   G LY+ D ++GL+KV    GGLAT L+    G  F FI
Sbjct  132   FGYAKNEHICGRPLGLRFDKKTGDLYIADAYFGLMKV-GPEGGLATSLSTEAEGVPFKFI  190

Query  498   DAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPA  677
             + + +D+   +VYF D+   +   N+ Q+V S + +GRLLKY+AA G+ TVL+  L  P 
Sbjct  191   NDLDLDD-EGNVYFTDSSTKYERRNFIQVVFSAENTGRLLKYNAATGETTVLVRDLHFPN  249

Query  678   GMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVAL  857
             G++   D +F +  E    R+ KY++ G KA T + +   L G+PDNV+    G FWVA+
Sbjct  250   GVSLSKDGSFFLFCEGGKGRLRKYWLKGEKAGTNE-LFAILPGFPDNVRTNDKGDFWVAV  308

Query  858   Nipkpqqqppppip------------------------MTDSIAVNFDMDGNIVNT-KNV  962
             +                                        ++AV +  +G ++   ++ 
Sbjct  309   HSRHSTLAHLEAKYPKLRKILLKLPISAKIQFLLHVGGRPHAVAVKYSPEGKLLQILEDT  368

Query  963   TDTFPNSFSGYQEYSDIAYVGSLLSDFVAVY  1055
                   + S  +E     ++GS+L  F+AVY
Sbjct  369   QGKVVKAVSEVEEKDGKLWIGSVLMSFIAVY  399



>ref|XP_004137361.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Cucumis sativus]
 gb|KGN63897.1| hypothetical protein Csa_1G025790 [Cucumis sativus]
Length=402

 Score =   168 bits (426),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 110/331 (33%), Positives = 163/331 (49%), Gaps = 33/331 (10%)
 Frame = +3

Query  150   ILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGNFNDFATTSPYRTKEKCDG----  317
             I+      GPE  A D L +G YTGV DGR+L +   ++ DFA TSP R+ E CD     
Sbjct  73    IMFKDQVQGPESVAFDSLGRGPYTGVADGRVLFWNGESWTDFAYTSPNRS-EICDPKPSI  131

Query  318   INITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFI  497
                      CGRPLGL FD   G LY+ D ++GL+KV    GGLAT L+    G  F FI
Sbjct  132   FGYAKNEHICGRPLGLRFDKKTGDLYIADAYFGLMKV-GPEGGLATSLSTEAEGVPFKFI  190

Query  498   DAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPA  677
             + + +D+   +VYF D+   +   N+ Q+V S + +GRLLKY+AA G+ TVL+  L  P 
Sbjct  191   NDLDLDD-EGNVYFTDSSTKYERRNFIQVVFSAENTGRLLKYNAATGETTVLVRDLHFPN  249

Query  678   GMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVAL  857
             G++   D +F +  E    R+ KY++ G KA T + +   L G+PDNV+    G FWVA+
Sbjct  250   GVSLSKDGSFFLFCEGGKGRLRKYWLKGEKAGTNE-LFAILPGFPDNVRTNDKGDFWVAV  308

Query  858   Nipkpqqqppppip------------------------MTDSIAVNFDMDGNIVNT-KNV  962
             +                                        ++AV +  +G ++   ++ 
Sbjct  309   HSRHSTLAHLEAEYPKLRKILLKLPISAKIQFLLHVGGRPHAVAVKYSPEGKLLQILEDT  368

Query  963   TDTFPNSFSGYQEYSDIAYVGSLLSDFVAVY  1055
                   + S  +E     ++GS+L  F+AVY
Sbjct  369   QGKVVKAVSEVEEKDGKLWIGSVLMSFIAVY  399



>ref|XP_009356499.1| PREDICTED: strictosidine synthase 3-like [Pyrus x bretschneideri]
Length=357

 Score =   167 bits (423),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 106/318 (33%), Positives = 165/318 (52%), Gaps = 21/318 (7%)
 Frame = +3

Query  153   LNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDG-IN  323
             + L    GPE  A D   +G Y GV+DG ILK+      + +FA TSP R +++CDG  N
Sbjct  40    IELARVVGPESIAFDCRGKGPYVGVSDGTILKWQGPRLGWTEFAFTSPNRARKQCDGSTN  99

Query  324   ITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDA  503
             +TN    CGRPLG+ F      LY  D ++GL+K    NGG A  LA  + G  F F+++
Sbjct  100   VTN-EPICGRPLGMMFHPKTCDLYFADAYFGLMKTG-PNGGKAEVLANSIGGVPFLFVNS  157

Query  504   VAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGM  683
             + +DE T  VYF D   +F+   + Q V +GD +GRLL+Y     +V VLL+GL    G+
Sbjct  158   LDIDEETGIVYFTDTSTVFQRRVWVQSVLAGDKTGRLLQYDPRTKKVKVLLHGLGFANGV  217

Query  684   ATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNi  863
             A   D++F+++ E    RI + ++ GPKA+  + +   L+  PDN+KR   G FWV LN 
Sbjct  218   ALSGDKSFVLVVESAEFRIHRLWLRGPKAHVLE-LFTQLQRPPDNIKRTKKGEFWVGLNS  276

Query  864   pkpqqqppppip--------------MTDSIAVNFDMDGNIVNTKNVTDTFP-NSFSGYQ  998
              +  +     +               + D + V  D  G ++   +        + S  +
Sbjct  277   GRGVKGVQNKVQNMMNNNESSGELLNVNDPVGVKLDEQGGVLQVLDGEGGKSLQAVSEVE  336

Query  999   EYSDIAYVGSLLSDFVAV  1052
             E++ I ++GS ++ +V V
Sbjct  337   EHNGILWIGSAVAPYVGV  354



>ref|XP_010554777.1| PREDICTED: strictosidine synthase 3-like [Tarenaya hassleriana]
Length=367

 Score =   167 bits (424),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 86/233 (37%), Positives = 136/233 (58%), Gaps = 7/233 (3%)
 Frame = +3

Query  168  ASGPEDTAIDPLDQGIYTGVTDGRILKYLN--GNFNDFATTSPYRTKEKCDGINITNIRA  341
              GPE    DP  +G Y GV+DGR+LK+L     ++DFA TSP R  E C G ++     
Sbjct  48   GEGPESLDWDPQGEGPYVGVSDGRVLKWLGYGRGWSDFAFTSPDR--ENCSG-HVPEREH  104

Query  342  ECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDEL  521
             CGRPLG+ F+   G LY+ D ++G++KV    GGLA ++    +GR F+F + + +DE+
Sbjct  105  ICGRPLGVHFEKKSGDLYIADCYFGIMKV-GPEGGLAQKVVDEADGRKFTFTNHMDIDEV  163

Query  522  TADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQ  701
               +YF D+ D ++     ++  +GD +GRL++Y     +  VL+ GL    G+    D+
Sbjct  164  DDVIYFTDSSDTYQIRTVLEVFVTGDKTGRLIRYDMKTKETKVLMTGLGFANGVTLSKDR  223

Query  702  TFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            +F++++E    +I +Y++ GPKA T    +E L GYPDN++R   G  W AL+
Sbjct  224  SFVLVAEPPAAKIHRYWLRGPKAGTHDVFVE-LPGYPDNIRRNEKGEIWAALH  275



>ref|XP_009128020.1| PREDICTED: strictosidine synthase 1 isoform X1 [Brassica rapa]
Length=328

 Score =   166 bits (421),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 103/300 (34%), Positives = 155/300 (52%), Gaps = 12/300 (4%)
 Frame = +3

Query  162   QHASGPEDTAIDPLDQGIYTGVTDGRILKYL-NGNFNDFATTSPYRTKEKCDGINITNIR  338
             ++ SGPE  A D   +G YTGV+ G+ILKY     + DFA  +       CDG+  T + 
Sbjct  35    ENRSGPEAFAFDSTGKGFYTGVSGGKILKYTPETGYVDFAQITESSNSSWCDGVVGTALA  94

Query  339   AECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDE  518
               CGRP G+ F+   G LYV D   GL  V    GGLA ++A  V+G+ F F+D + VD 
Sbjct  95    GRCGRPAGIAFNEKTGELYVADAPLGL-HVVSPAGGLAVKIADSVDGKPFKFLDGLDVDP  153

Query  519   LTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDID  698
              T  VYF      +  +     +   D +G+L KY  +   VTVL+ GLSG AG A   D
Sbjct  154   TTGVVYFTSFSSRYTPIQVLIALGLKDATGKLFKYDPSTKVVTVLMEGLSGSAGCAVSSD  213

Query  699   QTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKR-GTLGGFWVALNipkpq  875
              +F+++S++    I +Y+I GPKA +++    ++   PDN+KR G+ G FW+A       
Sbjct  214   GSFVLVSQFTKSNIKRYWIKGPKAGSSEDFTNSVSN-PDNIKRIGSTGNFWIA-------  265

Query  876   qqppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNS-FSGYQEYSDIAYVGSLLSDFVAV  1052
                   +  T+  AV  + +G ++ T  + D F ++  S   E+    Y+G+L   F  V
Sbjct  266   SVVNKIVVPTNPSAVKVNSNGEVLQTIPLKDQFGDTLLSEVNEFDGSLYIGTLTGPFAGV  325



>gb|KHN18404.1| Strictosidine synthase 1 [Glycine soja]
Length=327

 Score =   166 bits (421),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 105/308 (34%), Positives = 163/308 (53%), Gaps = 14/308 (5%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGI-NITNIRA  341
             +GPE  A D    G Y GV+DGRILKY      F ++A TSP R K  CDG+ + + ++A
Sbjct  24    TGPESVAFDRNGGGPYVGVSDGRILKYAGPTEGFKEYAFTSPNRNKTICDGLADFSELQA  83

Query  342   ECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRN------FSFIDA  503
              CGRPLGL F+H    LYV D + GL+K+   NGG  TQ    +  +         F+D 
Sbjct  84    TCGRPLGLRFNHQTNELYVADAYSGLIKIG-PNGGAPTQCFKDIQPQQENVNTTLGFLDG  142

Query  504   VAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGM  683
             + VD  +  VYF  A   +R  +   +  S D SG L        Q  VL+ GL+  +G+
Sbjct  143   LDVDVNSGVVYFTQASANYRFKDAQALQSSRDQSGSLFSLDPKTNQTRVLMRGLALASGV  202

Query  684   ATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNi  863
             A   D +F+++SEY+  RI ++++ GP+AN+++  ++ L G PDN++    G FWVA+N 
Sbjct  203   AVSRDGSFVLVSEYLANRIQRFWLRGPRANSSELFLQ-LTGRPDNIRSNQRGQFWVAVNG  261

Query  864   pkpqqqppppipMTDSIAVNFDMDGNIVNTKNVTDTF-PNSFSGYQEYSDIAYVGSLLSD  1040
                   PP P  +   + ++   +G I+   ++   F   + S   E++   Y GSL + 
Sbjct  262   ALGPNPPPRPTILPGGLRIS--ENGVILQILSLVKEFGSEAASEVHEHNGTLYSGSLRAS  319

Query  1041  FVAVYTAI  1064
             +V + + I
Sbjct  320   YVPISSMI  327



>ref|XP_010427562.1| PREDICTED: strictosidine synthase 1-like [Camelina sativa]
Length=338

 Score =   166 bits (421),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 107/309 (35%), Positives = 158/309 (51%), Gaps = 16/309 (5%)
 Frame = +3

Query  141   FPI--ILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEK  308
             FP+  ++NL  ASGPE  A DP  +G Y GV DGR+LK+   +  +  FA TS  R  + 
Sbjct  40    FPLAKVVNLTGASGPESIAFDPAGEGPYVGVADGRVLKWRGKSLGWTVFAYTSANR--QM  97

Query  309   CDGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNF  488
             C       +   CGRPLGL F    G LY+ D ++GLL V    GGLA  L     G+  
Sbjct  98    CVHSFAPELEHVCGRPLGLRFHKKTGDLYIADAYFGLLIVG-PAGGLAKPLVTEAEGQPL  156

Query  489   SFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLS  668
              F + + +DE    +YF DA   F+   Y     + D +GR +KY     + TVLL+G+S
Sbjct  157   CFTNDLDIDEQDDVIYFTDASSKFQRWEYFSSFLNVDKTGRFIKYDILSKKATVLLHGIS  216

Query  669   GPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFW  848
                G+A   D++F+++ E    +I++ ++SGPKA  TQ V   L GYPDN++R   G FW
Sbjct  217   FANGVALSKDRSFVLVDETTNCKILRLWLSGPKAG-TQDVFAVLPGYPDNIRRNLNGEFW  275

Query  849   VALNipkpqqqppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSFSGYQEYSDIAYVGS  1028
             VALN    +      + ++ S  V   ++      + ++D         +E     ++GS
Sbjct  276   VALNSLLYETPYTKAVKLSASGEVLVVLEDKGKRLRYISDV--------EENDGKLWIGS  327

Query  1029  LLSDFVAVY  1055
              +  FV VY
Sbjct  328   SVMPFVGVY  336



>ref|XP_003549591.1| PREDICTED: strictosidine synthase 1-like [Glycine max]
Length=336

 Score =   166 bits (421),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 105/308 (34%), Positives = 163/308 (53%), Gaps = 14/308 (5%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGI-NITNIRA  341
             +GPE  A D    G Y GV+DGRILKY      F ++A TSP R K  CDG+ + + ++A
Sbjct  33    TGPESVAFDRNGGGPYVGVSDGRILKYAGPTEGFKEYAFTSPNRNKTICDGLADFSELQA  92

Query  342   ECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRN------FSFIDA  503
              CGRPLGL F+H    LYV D + GL+K+   NGG  TQ    +  +         F+D 
Sbjct  93    TCGRPLGLRFNHQTNELYVADAYSGLIKIG-PNGGAPTQCFKDIQPQQENVNTTLGFLDG  151

Query  504   VAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGM  683
             + VD  +  VYF  A   +R  +   +  S D SG L        Q  VL+ GL+  +G+
Sbjct  152   LDVDVNSGVVYFTQASANYRFKDAQALQSSRDQSGSLFSLDPKTNQTRVLMRGLALASGV  211

Query  684   ATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNi  863
             A   D +F+++SEY+  RI ++++ GP+AN+++  ++ L G PDN++    G FWVA+N 
Sbjct  212   AVSRDGSFVLVSEYLANRIQRFWLRGPRANSSELFLQ-LTGRPDNIRSNQRGQFWVAVNG  270

Query  864   pkpqqqppppipMTDSIAVNFDMDGNIVNTKNVTDTF-PNSFSGYQEYSDIAYVGSLLSD  1040
                   PP P  +   + ++   +G I+   ++   F   + S   E++   Y GSL + 
Sbjct  271   ALGPNPPPRPTILPGGLRIS--ENGVILQILSLVKEFGSEAASEVHEHNGTLYSGSLRAS  328

Query  1041  FVAVYTAI  1064
             +V + + I
Sbjct  329   YVPISSMI  336



>emb|CDY45861.1| BnaC02g22590D [Brassica napus]
Length=330

 Score =   166 bits (421),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 106/301 (35%), Positives = 153/301 (51%), Gaps = 12/301 (4%)
 Frame = +3

Query  162   QHASGPEDTAIDPLDQGIYTGVTDGRILKYL-NGNFNDFATTSPYRTKEKCDGINITNIR  338
             ++ SGPE  A D   +G YTGV+ G+ILKY     + DFA  +       CDG+  T + 
Sbjct  35    ENRSGPEAFAFDSTGKGFYTGVSGGKILKYTPETGYVDFAQITESSNSSWCDGVVGTALA  94

Query  339   AECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDE  518
               CGRP G+ F+   G LYV D   GL  V    GGLA ++A  V+G+ F F+D + VD 
Sbjct  95    GRCGRPAGIAFNEKTGELYVADAPLGL-HVVSPAGGLAVKIADSVDGKPFKFLDGLDVDP  153

Query  519   LTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDID  698
              T  VYF      +  +     +   D +G+L KY  +   VTVL+ GLSG AG A   D
Sbjct  154   TTGVVYFTSFSSRYTPIQVLIALGLKDATGKLFKYDPSTKVVTVLMEGLSGSAGCAVSSD  213

Query  699   QTFIMISEYIGRRIIKYFISGPK-ANTTQTVMENLEGYPDNVKR-GTLGGFWVALNipkp  872
              +F+++S++    I +Y+I GPK A +T  +  +    PDN++R G+ G FWVA      
Sbjct  214   GSFVLVSQFTKSNIKRYWIKGPKAAGSTDDIFSSSVSNPDNIRRIGSTGNFWVA------  267

Query  873   qqqppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNS-FSGYQEYSDIAYVGSLLSDFVA  1049
                    +  TD  AV  D +G ++ T  + + F N+  S   E     Y+G+L   F  
Sbjct  268   -SVINKVVMPTDPSAVKIDSNGKVLQTIFLKNEFGNTLLSEANEVDGKLYIGTLTGPFAG  326

Query  1050  V  1052
             V
Sbjct  327   V  327



>ref|XP_009133478.1| PREDICTED: strictosidine synthase 3 [Brassica rapa]
Length=376

 Score =   167 bits (424),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 104/286 (36%), Positives = 158/286 (55%), Gaps = 22/286 (8%)
 Frame = +3

Query  57   MKSLTMFWISILMFIS-------SPYVIHSQPGVDFP--IILNLQHASGPEDTAIDPLDQ  209
            MK   +  I + +F+S       SP    S   V FP   ++    ASGPE    D   +
Sbjct  2    MKLFLVVAICVALFLSLTDFSGKSPKHGESMLTVHFPEFRLIPTTGASGPESFVFDISGE  61

Query  210  GIYTGVTDGRILKYL--NGNFNDFATTSPYRTKEKCDGINITNIRAE--CGRPLGLDFDH  377
            G YTG++DGRI+K++     + DFA T+P  T+E C+G +  + R E  CGRPLGL F+ 
Sbjct  62   GPYTGLSDGRIVKWIANESRWIDFAVTTP--TREGCEGPH-EHQRTEDVCGRPLGLAFEK  118

Query  378  ARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDI  557
            + G LY+ D + GLLKV R  GGLA Q+          F + + VD  T  VYF D+  +
Sbjct  119  STGDLYIADAYMGLLKVGRE-GGLANQMLTRQLDEPLRFTNGLDVDPRTRVVYFTDSSSV  177

Query  558  FRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRR  737
            ++  NY  ++ SGD +GRL+KY     QVT LL+ L+ P G+    +  +++++E    R
Sbjct  178  YQRRNYIGVMMSGDRTGRLMKYDPNTKQVTTLLSNLAFPNGVVLSQNGEYLLVAETAKCR  237

Query  738  IIKYFI----SGPKANTTQTVM-ENLEGYPDNVKRGTLGGFWVALN  860
            I++Y++    S  K+  +  +  + L G+PDN+KR   GGFW+ +N
Sbjct  238  ILRYWLNDTTSASKSRESYEIFSDRLPGFPDNIKRSPRGGFWIGVN  283



>gb|EPS68312.1| hypothetical protein M569_06455, partial [Genlisea aurea]
Length=394

 Score =   168 bits (425),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 99/240 (41%), Positives = 132/240 (55%), Gaps = 9/240 (4%)
 Frame = +3

Query  159  LQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGNFNDFATTSPYRTKEKCD--GINITN  332
            L+   GPE  A DP+ +G YTGV DGRIL +    ++DFA TS  R+   CD    +I  
Sbjct  65   LKEVQGPESLAFDPMGRGPYTGVADGRILFWNGQKWSDFAYTSANRSGANCDERKASIAE  124

Query  333  IRAE---CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDA  503
             R     CGRPLGL FD   G LY+ D ++GL+KV    GGLA  L     G    F + 
Sbjct  125  YREREHICGRPLGLRFDKRNGDLYIADAYFGLMKVG-PEGGLAASLVTEAEGVPLGFTND  183

Query  504  VAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGM  683
            + +D    +VYF D+   +R  NY Q++ SGD SGR+LKY     +  VL+  L  P G+
Sbjct  184  LDIDR-QGNVYFTDSSSNYRRRNYLQLLLSGDASGRVLKYDPQTNETRVLVRNLQFPNGI  242

Query  684  ATDIDQ-TFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            +   D  +F +  E    R+ KY++ G +A T Q VM  L GYPDNV+    G FWVAL+
Sbjct  243  SLSKDSASFFVYCELSRGRLSKYWLEGDRAGTWQ-VMAVLPGYPDNVRTNERGNFWVALH  301



>gb|EMT14932.1| Strictosidine synthase 3 [Aegilops tauschii]
Length=364

 Score =   167 bits (423),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 92/239 (38%), Positives = 145/239 (61%), Gaps = 11/239 (5%)
 Frame = +3

Query  168  ASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN-----FNDFATTSPYRTKEKCDGIN-IT  329
            A GPE    D    G YTGV++GR+L++  GN     + +FA    ++T  +C     + 
Sbjct  53   AFGPESIVFDHRGGGPYTGVSNGRVLRW-RGNRRHRGWTEFAHNYKHKTVAECAAKKKVV  111

Query  330  NIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVA  509
               + CGRPLGL F HA G +Y+ D + GL++V R  GGLA  +A   +G  F+F++ V 
Sbjct  112  EPESACGRPLGLQFHHASGDMYIADAYLGLMRVGRC-GGLAEVVATEADGLPFNFLNGVD  170

Query  510  VDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMAT  689
            VD+ T +VYF D+  +++   Y  +V +GD +GRL++Y    G VTVL +GL+ P G+A 
Sbjct  171  VDQETGEVYFTDSSTVYQRSEYMLVVLTGDATGRLMRYDPRTGNVTVLRSGLAFPNGVAL  230

Query  690  DIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKR--GTLGGFWVALN  860
              D+T ++++E    R++++++ GP A  T+ V+ +L GYPDNV+   G  GG+WV +N
Sbjct  231  SADRTHLVVAETSSCRLLRHWLRGPAAGETE-VLADLPGYPDNVRHDGGGRGGYWVGMN  288



>ref|XP_003595643.1| Strictosidine synthase-like protein [Medicago truncatula]
 gb|AES65894.1| strictosidine synthase [Medicago truncatula]
Length=336

 Score =   166 bits (421),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 106/299 (35%), Positives = 166/299 (56%), Gaps = 9/299 (3%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYLN--GNFNDFATTSPYRTKEKCDGI-NITNIRA  341
             +GPE  A + + +G YTGV+DGRILKY      F +FA  S  R    C+GI + + ++ 
Sbjct  39    TGPESLAFNSIGEGPYTGVSDGRILKYDEECSCFLEFAHISSDRDNTMCNGISDFSELQE  98

Query  342   ECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAA-GVNGRNFSFIDAVAVDE  518
              CGRP+GL FD+  G LY+ D +YGL+KV   +GG ATQL A  + G  F F+  V VD 
Sbjct  99    TCGRPMGLSFDYNTGELYIADAYYGLVKVPY-DGGAATQLVANNLQGNPFGFLAGVDVDP  157

Query  519   LTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDID  698
              T  VYF +A   ++  +  ++++  D +G L +Y  +  + T+LL+ L+   G+A   D
Sbjct  158   STGIVYFTEASSRYKIRDLQKLLRRKDHTGSLFRYDPSTNETTLLLSNLTEAFGVAVSND  217

Query  699   QTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqq  878
              +F+++SEY   RI +++++G  A T+   +  L G PDN++R +   FWVA+N P    
Sbjct  218   GSFVLVSEYKANRIRRFWLTGANAYTSDIFLR-LPGRPDNIRRNSRNEFWVAVNYPFASS  276

Query  879   qppppipMTDSIAVNFDMDGNIVNTKNVTDTFP-NSFSGYQEYSDIAYVGSLLSDFVAV  1052
              PP P  +   + VN   +G I+ +  + + F   S S  QE     Y  SL  ++  +
Sbjct  277   PPPVPPVLPLGLRVN--AEGLIIESVPLVEAFSTESVSEVQESEGRLYATSLSDNYATI  333



>ref|XP_004971567.1| PREDICTED: strictosidine synthase 1-like [Setaria italica]
Length=341

 Score =   166 bits (420),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 92/234 (39%), Positives = 134/234 (57%), Gaps = 8/234 (3%)
 Frame = +3

Query  174  GPEDTAIDPLDQGIYTGVTDGRILKY--LNGNFNDFATTSPYRTKEKCDG---INITNIR  338
            GPE  A D    G Y  ++DGR+LKY      +  FA  SP  TK KCD    +      
Sbjct  48   GPESVAFDAHGSGPYVSISDGRVLKYDGEGAGWKTFAY-SPSYTKNKCDEFSELPAVATE  106

Query  339  AECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDE  518
            + CGRPLGL F +  G LY+ D + GL++V   NGG AT LA    G    F + V +D+
Sbjct  107  SSCGRPLGLRFHNNSGNLYIADAYMGLMRVG-PNGGEATVLATEAGGAPLRFTNGVDIDQ  165

Query  519  LTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDID  698
            +T DVYF D+   +    +  +  SGD++GR++KY     QVTVL +G++ P G+A   D
Sbjct  166  VTGDVYFTDSSKTYTRAQHQMVTTSGDSTGRIMKYDPQTNQVTVLQSGVTYPNGIAISAD  225

Query  699  QTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            +T ++I+     ++++Y+I GPK NT++    +L GYPDNV+     G+WVAL+
Sbjct  226  RTHLIIALTGPCKLMRYWIRGPKTNTSEP-FADLPGYPDNVRPDGKEGYWVALH  278



>ref|XP_008652645.1| PREDICTED: strictosidine synthase 3-like [Zea mays]
Length=397

 Score =   167 bits (424),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 95/244 (39%), Positives = 140/244 (57%), Gaps = 7/244 (3%)
 Frame = +3

Query  141  FPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCD  314
             P+ L  + A GPE  A D    G +TGV++GRIL++      + +FA    + T   C 
Sbjct  89   LPVRLG-RPAFGPESLAFDHRGDGPFTGVSNGRILRWRGAQRGWTEFAHNHKHETVAMCA  147

Query  315  GIN-ITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFS  491
                +    + CGRPLGL F  A G LY  D + GL++V R  GGLA  +A    G   +
Sbjct  148  AKKRLVVPESACGRPLGLQFHRASGDLYYGDAYLGLMRVGRR-GGLAEAVATEAGGAPLN  206

Query  492  FIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSG  671
            F++AV VD+ T  VYF D+   ++  +Y  I+ +G+ +GRLL+Y  A G   VL +GLS 
Sbjct  207  FVNAVEVDQETGLVYFTDSSATYQRSDYIMIILTGEATGRLLRYDPATGSAAVLASGLSF  266

Query  672  PAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGG-FW  848
            P G+A   D T ++++E    R++++++ GP A TT+    +L GYPDNV+R   GG +W
Sbjct  267  PNGVALSADGTHVVVAETTRCRLLRHWLRGPAAGTTEP-FADLPGYPDNVRRAGDGGYYW  325

Query  849  VALN  860
            VALN
Sbjct  326  VALN  329



>dbj|BAK06958.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=367

 Score =   167 bits (422),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 95/248 (38%), Positives = 147/248 (59%), Gaps = 12/248 (5%)
 Frame = +3

Query  141  FPIILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN-----FNDFATTSPYRTKE  305
             P+ L  + A GPE    D    G YTGV++G +L++  GN     + +FA    ++T  
Sbjct  47   IPVRLG-RPAFGPESIVFDHRGGGPYTGVSNGHVLRW-RGNRRHHGWTEFAHNYKHKTVA  104

Query  306  KCDGIN-ITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGR  482
            +C     +    + CGRPLGL F HA G +Y+ D + GL++V R  GGLA  +A    G 
Sbjct  105  ECAAKKKLVEPESACGRPLGLQFHHASGDMYIADAYLGLMRVGRC-GGLAEVVATETGGV  163

Query  483  NFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNG  662
             F+F++ V VD+ T DVYF D+  ++    Y  +V +GD +GRL++Y    G VTVL +G
Sbjct  164  PFNFLNGVDVDQETGDVYFTDSSTVYPRSEYMMVVLTGDATGRLMRYDPRTGNVTVLRSG  223

Query  663  LSGPAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVK--RGTL  836
            L+ P G+A   D+T ++++E    R++++++ GP A TT+ V+ +L GYPDNV+   G  
Sbjct  224  LAFPNGVAVSADRTHLVVAETSSCRLLRHWLRGPAAGTTE-VLADLPGYPDNVRPDGGGR  282

Query  837  GGFWVALN  860
            GG+WV +N
Sbjct  283  GGYWVGMN  290



>ref|NP_177542.1| strictosidine synthase 2 [Arabidopsis thaliana]
 sp|P94111.2|SSL12_ARATH RecName: Full=Protein STRICTOSIDINE SYNTHASE-LIKE 12; Short=AtSSL12; 
AltName: Full=Strictosidine synthase 1; Short=SS-1; 
AltName: Full=Strictosidine synthase 13; Short=AtSS13; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG52513.1|AC016662_7 putative strictosidine synthase; 35901-37889 [Arabidopsis thaliana]
 gb|AAK59475.1| putative strictosidine synthase [Arabidopsis thaliana]
 gb|AAL34150.1| putative strictosidine synthase [Arabidopsis thaliana]
 gb|AEE35538.1| strictosidine synthase 2 [Arabidopsis thaliana]
Length=335

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 106/300 (35%), Positives = 154/300 (51%), Gaps = 12/300 (4%)
 Frame = +3

Query  162   QHASGPEDTAIDPLDQGIYTGVTDGRILKYL-NGNFNDFATTSPYRTKEKCDGINITNIR  338
             +  SGPE  A D   +G YTGV+ G+ILKYL    + DFA  +       CDG   T + 
Sbjct  34    ETRSGPEAFAFDSTGKGFYTGVSGGKILKYLPETGYVDFAQITESSNSSWCDGTIGTALA  93

Query  339   AECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDE  518
               CGRP G+ F+   G LYV D   GL  V    GGLAT++   V+G+ F F+D + VD 
Sbjct  94    GRCGRPAGIAFNEKTGDLYVADAPLGL-HVISPAGGLATKITDSVDGKPFKFLDGLDVDP  152

Query  519   LTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDID  698
              T  VYF      F  +     +   D +G+L KY  +   VTVL+ GLSG AG A   D
Sbjct  153   TTGVVYFTSFSSRFSPIQVLIALGLKDATGKLYKYDPSTKVVTVLMEGLSGSAGCAVSSD  212

Query  699   QTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKR-GTLGGFWVALNipkpq  875
              +F+++S++    I +Y+I GPKA +++    ++   PDN+KR G+ G FWVA       
Sbjct  213   GSFVLVSQFTKSNIKRYWIKGPKAGSSEDFTNSVSN-PDNIKRIGSTGNFWVA-------  264

Query  876   qqppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNS-FSGYQEYSDIAYVGSLLSDFVAV  1052
                   I  T+  AV  + +G ++ T  + D F ++  S   E+    Y+G+L   F  +
Sbjct  265   SVVNKIIVPTNPSAVKVNSNGEVLQTIPLKDKFGDTLLSEVNEFEGNLYIGTLTGPFAGI  324



>gb|AAB40593.1| strictosidine synthase [Arabidopsis thaliana]
 gb|AAB40594.1| strictosidine synthase [Arabidopsis thaliana]
Length=335

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 106/300 (35%), Positives = 154/300 (51%), Gaps = 12/300 (4%)
 Frame = +3

Query  162   QHASGPEDTAIDPLDQGIYTGVTDGRILKYL-NGNFNDFATTSPYRTKEKCDGINITNIR  338
             +  SGPE  A D   +G YTGV+ G+ILKYL    + DFA  +       CDG   T + 
Sbjct  34    ETRSGPEAFAFDSTGKGFYTGVSGGKILKYLPETGYVDFAQITESSNSSWCDGTIGTALA  93

Query  339   AECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDE  518
               CGRP G+ F+   G LYV D   GL  V    GGLAT++   V+G+ F F+D + VD 
Sbjct  94    GRCGRPAGIAFNEKTGDLYVADAPLGL-HVISPAGGLATKITDSVDGKPFKFLDGLDVDP  152

Query  519   LTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDID  698
              T  VYF      F  +     +   D +G+L KY  +   VTVL+ GLSG AG A   D
Sbjct  153   TTGVVYFTSFSSRFSPIQVLIALGLKDATGKLYKYDPSTKVVTVLMEGLSGSAGCAVSSD  212

Query  699   QTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKR-GTLGGFWVALNipkpq  875
              +F+++S++    I +Y+I GPKA +++    ++   PDN+KR G+ G FWVA       
Sbjct  213   GSFVLVSQFTKSNIKRYWIKGPKAGSSEDFTNSVSN-PDNIKRIGSTGNFWVA-------  264

Query  876   qqppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNS-FSGYQEYSDIAYVGSLLSDFVAV  1052
                   I  T+  AV  + +G ++ T  + D F ++  S   E+    Y+G+L   F  +
Sbjct  265   SVVNKIIVPTNPSAVKVNSNGEVLQTIPLKDKFGDTLLSEVNEFEGNLYIGTLTGPFAGI  324



>emb|CDP09528.1| unnamed protein product [Coffea canephora]
Length=394

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 106/278 (38%), Positives = 153/278 (55%), Gaps = 24/278 (9%)
 Frame = +3

Query  81   ISILMFISSPYVI-------HSQPGVDFPIILNLQHASGPEDTAIDP------LDQGIYT  221
            IS L+ +  P  +       H Q     P +  +  A+GPE  A            G Y 
Sbjct  29   ISTLVSVEPPEKLPTKDDNEHRQNQQLHPELFQIFGAAGPESLAFKKDGTGAAAATGPYA  88

Query  222  GVTDGRILKYLNGN---FNDFATTSPYRTKEKCDGINITNIRAE--CGRPLGLDFDHARG  386
            GV+DGRI+++  GN   + +FA T+P RT   CDG +  ++ AE  CGRPLGL F+   G
Sbjct  89   GVSDGRIIQW-RGNESRWVNFAITTPDRTG--CDGSH-DHVEAESRCGRPLGLSFNEKSG  144

Query  387  VLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRS  566
             LY+ D + GLL V  ++GGLAT LA    G  F F + V VD+ +  VYF D+   F+ 
Sbjct  145  DLYIADAYMGLLLVG-SSGGLATCLAKEAQGIPFKFTNGVVVDQTSGIVYFTDSSTKFQR  203

Query  567  LNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIK  746
              Y  ++  GD+SGRL+K+     +VTVLL+GL  P G+A   +  F++++E    RI+K
Sbjct  204  REYISVILRGDSSGRLMKFDPVTYKVTVLLDGLMFPNGVALSKNGDFLLVAETTNCRILK  263

Query  747  YFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            Y++   +A   +   E L G+PDN+KR   G FWVA+N
Sbjct  264  YWLEASRAGKVEPFAE-LPGFPDNIKRNQKGEFWVAIN  300



>emb|CDX79944.1| BnaA05g02120D [Brassica napus]
Length=375

 Score =   167 bits (422),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 102/284 (36%), Positives = 154/284 (54%), Gaps = 19/284 (7%)
 Frame = +3

Query  57   MKSLTMFWISILMFIS-------SPYVIHSQPGVDFP--IILNLQHASGPEDTAIDPLDQ  209
            MK   +  IS  + +S       SP    S   V FP   ++    A GPE  A D    
Sbjct  2    MKLFFVLAISFALLLSLFDSSGESPKHGESMLTVHFPDFHLIPTTGALGPESFAFDFYGD  61

Query  210  GIYTGVTDGRILKYL--NGNFNDFATTSPYRTKEKCDGIN-ITNIRAECGRPLGLDFDHA  380
            G +TG++DGRI+K++     + DFA T+P  T+E C+G +       ECGRPLGL F+ +
Sbjct  62   GPFTGLSDGRIVKWIANESRWMDFAVTTP--TREGCEGPHEHQRTEHECGRPLGLAFEKS  119

Query  381  RGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIF  560
             G LY+ D + GLLKV R  GGLA Q++     +   F +AV +D  T  VYF D+  ++
Sbjct  120  TGDLYIADAYMGLLKVGRE-GGLANQVSTRQLDKPLRFTNAVEIDPRTGVVYFTDSSSVY  178

Query  561  RSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRI  740
            +  NY   + SGD +GRL+KY     QVT L++ LS   G+    +  +++++E    +I
Sbjct  179  QRRNYIGAIMSGDRTGRLMKYDPKTNQVTTLVSNLSFANGVVMSQNGDYLLVAETATSQI  238

Query  741  IKYFISGPKANTT----QTVMENLEGYPDNVKRGTLGGFWVALN  860
            ++Y+++    + +    +   E L G+PDN+KR   GGFWV LN
Sbjct  239  LRYWLNDTSVSKSHEKYEIFAEGLPGFPDNIKRSPRGGFWVGLN  282



>ref|XP_010428364.1| PREDICTED: strictosidine synthase 1-like [Camelina sativa]
Length=337

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 107/300 (36%), Positives = 155/300 (52%), Gaps = 12/300 (4%)
 Frame = +3

Query  162   QHASGPEDTAIDPLDQGIYTGVTDGRILKYL-NGNFNDFATTSPYRTKEKCDGINITNIR  338
             +  SGPE  A D   +G YTGV+ G+ILK+L    + +FA  +       CDG   T + 
Sbjct  33    ESRSGPEAFAFDSTGKGFYTGVSGGKILKWLPETGYVNFAQITESSNSSWCDGNIGTALA  92

Query  339   AECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDE  518
               CGRP G+ F+   G LYV D   GL  V    GGLAT++A  V+G+ F F+D + VD 
Sbjct  93    GRCGRPAGIAFNENTGDLYVADAPLGL-HVISPAGGLATKIADSVDGKPFKFLDGLDVDP  151

Query  519   LTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDID  698
              T  VYF      F  +     +   D +G+L KY  +   VTVL+ GLSG AG A   D
Sbjct  152   TTGVVYFTSFSSRFSPIQVLIALGLKDATGKLYKYDPSTKVVTVLMEGLSGSAGCAVSSD  211

Query  699   QTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKR-GTLGGFWVALNipkpq  875
              +F+++S++    I +Y+I GPKA T++    ++   PDN+KR G+ G FWVA       
Sbjct  212   GSFVLVSQFTKSNIKRYWIKGPKAGTSEDFTNSVSN-PDNIKRVGSTGNFWVA-------  263

Query  876   qqppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNS-FSGYQEYSDIAYVGSLLSDFVAV  1052
                   I  T+  AV  + DG ++ T  + D F ++  S   E+    Y+G+L   F  +
Sbjct  264   SVVNKFIVPTNPSAVKVNSDGEVLQTIPLKDKFGDTLLSEVNEFEGNLYIGTLTGPFAGI  323



>emb|CDP06820.1| unnamed protein product [Coffea canephora]
Length=259

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/216 (43%), Positives = 128/216 (59%), Gaps = 4/216 (2%)
 Frame = +3

Query  189  AIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRAECGRPLG  362
            A+D  +QG Y G++DGRILKY   N  F  FA TSP +T E  DG+   N+   CGRP  
Sbjct  11   ALDQFNQGPYVGISDGRILKYKGPNVGFVLFAYTSPNKTNELYDGVIDPNLGPTCGRPFR  70

Query  363  LDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFI  542
              F++  GVLY+ D F GL KV    GGLAT +A       F F++ + VD+LT DVY  
Sbjct  71   FSFNNFNGVLYIVDAFLGLFKVGPE-GGLATLIAKSAGAVPFKFLNGIDVDQLTGDVYLT  129

Query  543  DAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISE  722
            DA   F   N  Q     D++GRL+KY+    ++ VLL+GLS PAG+    D+TF++ SE
Sbjct  130  DASQTFDLRNVIQGNYVLDSTGRLIKYNPITKELKVLLDGLSIPAGLVVSTDRTFVLFSE  189

Query  723  YIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRG  830
            +  + + KY ++G K NTT+ ++ NL G P  +KR 
Sbjct  190  FNTKTVKKYCLTGLKENTTEALL-NLLGNPVKIKRA  224



>ref|XP_008655524.1| PREDICTED: strictosidine synthase 3-like [Zea mays]
Length=339

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 105/297 (35%), Positives = 157/297 (53%), Gaps = 8/297 (3%)
 Frame = +3

Query  174   GPEDTAIDPLDQGIYTGVTDGRILKYLNG--NFNDFATTSPYRTKEKCDGINITNIRAE-  344
             G E  A D   QG Y GV+DGR+LK+      +  FA ++ YR    C    + + + E 
Sbjct  46    GAESLAFDRRGQGPYAGVSDGRVLKWGGSALGWTTFAHSANYRKIPLCTASVVPSEQTES  105

Query  345   -CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDEL  521
              CGRPLGL F    G LY+ D + GL+KV  N G  A  LA       F F++ + VD+ 
Sbjct  106   MCGRPLGLQFFAMTGDLYIADAYMGLMKVGPNGGEEAQVLATQAGDAPFHFVNGLDVDQA  165

Query  522   TADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQ  701
             T DVYF D+  I+     T+I+ + D +GRLLKY A   +VTVL   L  P G+A   D+
Sbjct  166   TGDVYFTDSSAIYPRRFNTEIMMNADATGRLLKYDARTKRVTVLKADLPYPNGVAVSNDR  225

Query  702   TFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqq  881
             T ++++  +  +  +Y++ GPKA   + ++ +L GYPDNV+R   GG+WVALN  K +  
Sbjct  226   THVVVAHTVPCQAFRYWLKGPKAGQYE-LLADLPGYPDNVRRDARGGYWVALNQEKARLD  284

Query  882   ppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSFSGYQEYSDIAYVGSLLSDFVAV  1052
                P      + V   +DG +V  + +T     + S   E     ++GS+  D+V +
Sbjct  285   ATAPPA-KHLVGVRLAVDGAVV--EELTAAKGVTLSDVAEKDGQLWLGSIELDYVGL  338



>emb|CAN77942.1| hypothetical protein VITISV_044018 [Vitis vinifera]
Length=341

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 116/301 (39%), Positives = 165/301 (55%), Gaps = 15/301 (5%)
 Frame = +3

Query  168   ASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRA  341
             A+GPE  A D    G YTG++DGRILKY+NG+  F +FA TS   ++E C G     +  
Sbjct  41    ATGPESIAFDAAGGGPYTGISDGRILKYVNGSVGFVEFAITSSNSSEEFCVGNGSVALDF  100

Query  342   ECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDEL  521
              CGRP GL F +  G LY+ D +YGL+ V   NGG+ATQLA   +G  F F +A+ VD  
Sbjct  101   TCGRPFGLGFHYQTGDLYIADAYYGLMVV-GPNGGVATQLANAADGVPFGFTNALDVDTE  159

Query  522   TADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQ  701
             T  VY +D    F    ++  +Q+ D +GRL+KY     ++TVLL GL G AGMA   D 
Sbjct  160   TGMVYLVDYSSQFSVNEFSVSLQAHDMTGRLMKYDPESKELTVLLGGLGGAAGMAISKDG  219

Query  702   TFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqq  881
             +FI+I+E + +RI K+++ GPKA T++ +++     P N+KR   G FWVA        +
Sbjct  220   SFILITETVTKRIRKFWLQGPKATTSE-ILKEFTVRPANIKRNEEGEFWVAF---LVADE  275

Query  882   ppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSFSGYQE---YSDIAYVGSLLSDFVAV  1052
                      S  +    DG I+   ++     ++ SG  E   Y+   Y+GS    FV V
Sbjct  276   TGSCPSQQQSPGLRISGDGMILEAISL-----DTQSGISEVAVYNGKMYIGSPFLHFVDV  330

Query  1053  Y  1055
             Y
Sbjct  331   Y  331



>gb|KFK41838.1| hypothetical protein AALP_AA2G178000 [Arabis alpina]
Length=326

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 113/297 (38%), Positives = 152/297 (51%), Gaps = 12/297 (4%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYL-NGNFNDFATTSPYRTKEKCDGINITNIRAEC  347
             SGPE  A D    G YTGV+ G+ILKY     F DFA  +   +   C+G+  T +  +C
Sbjct  36    SGPEAFAFDSTGNGFYTGVSGGKILKYTPEKGFVDFAQITKTSSTSWCNGVFGTALAGKC  95

Query  348   GRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTA  527
             GRP G+ F    G LYV D   G        GGLAT+LA  V+G+ F F+D + VD  T 
Sbjct  96    GRPAGIAFSSKTGELYVADAPLGXX-XXXXXGGLATKLADSVDGKPFKFLDGLDVDPTTG  154

Query  528   DVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTF  707
              VYF      F        V   D +G+L KY      VT L++GLSG AG A   D +F
Sbjct  155   VVYFTSFSSKFGPREVLVAVGLKDATGKLFKYDPTTKTVTELMDGLSGAAGCAVSSDGSF  214

Query  708   IMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKR-GTLGGFWVALNipkpqqqp  884
             I++SE+I   I +Y+I GPKA T +    +L   PDN+KR G+ G FWVA  + K     
Sbjct  215   ILVSEFIKSNIKRYWIKGPKAGTIED-FTSLVSNPDNIKRVGSTGDFWVASVVNKVVVP-  272

Query  885   pppipMTDSIAVNFDMDGNIVNTKNVTDTFPNS-FSGYQEYSDIAYVGSLLSDFVAV  1052
                   TD  AV  + +G +V T  + + F N+  S   E++   Y+G+L   F  V
Sbjct  273   ------TDPRAVKVNSEGKVVRTIFLKNEFGNTLLSEVNEFNGNLYIGTLTGPFAGV  323



>gb|KFK36980.1| hypothetical protein AALP_AA4G196900 [Arabis alpina]
Length=378

 Score =   167 bits (422),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 108/288 (38%), Positives = 157/288 (55%), Gaps = 24/288 (8%)
 Frame = +3

Query  57   MKSLTMFWISILMFISSPYVIHSQPG-------VDFP--IILNLQHASGPEDTAIDPLDQ  209
            MK L +  IS  +FIS    ++ +P        V FP   ++    ASGPE    D    
Sbjct  2    MKLLFVVAISFALFISLNDFLNERPKHGDSMLTVHFPDFRLIPTTGASGPESFVFDFSGD  61

Query  210  GIYTGVTDGRILKYL--NGNFNDFATTSPYRTKEKCDGINITNIRAE--CGRPLGLDFDH  377
            G YTG++DGRI+K+L     + DFA T+P  T+E C+G +  + R E  CGRPLGL F+ 
Sbjct  62   GPYTGLSDGRIVKWLANESRWIDFAVTTP--TREGCEGPH-EHQRTEHVCGRPLGLAFEK  118

Query  378  ARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDI  557
            + G LY+ D + GLLKV    GGLA Q+       +  F + V +D  T  VYF D+  +
Sbjct  119  STGDLYIADAYMGLLKVG-PEGGLANQILPRELEESLRFTNGVDIDPRTGVVYFTDSSTV  177

Query  558  FRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRR  737
            ++  NY  ++ SGD +GRL+KY     QVT LL  L+ P G+    +  +++++E    R
Sbjct  178  YQRRNYIGVMMSGDKTGRLMKYDPNTKQVTTLLTNLAFPNGVLLSQNGDYLLVAETATSR  237

Query  738  IIKYFI------SGPKANTTQTVM-ENLEGYPDNVKRGTLGGFWVALN  860
            I++Y++      S PK +    V  + L G+PDN+KR   GG WV LN
Sbjct  238  ILRYWLNDTWTSSTPKPSQNYEVFADQLPGFPDNIKRSPRGGIWVGLN  285



>tpg|DAA45309.1| TPA: hypothetical protein ZEAMMB73_979948 [Zea mays]
Length=357

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 105/297 (35%), Positives = 157/297 (53%), Gaps = 8/297 (3%)
 Frame = +3

Query  174   GPEDTAIDPLDQGIYTGVTDGRILKYLNG--NFNDFATTSPYRTKEKCDGINITNIRAE-  344
             G E  A D   QG Y GV+DGR+LK+      +  FA ++ YR    C    + + + E 
Sbjct  64    GAESLAFDRRGQGPYAGVSDGRVLKWGGSALGWTTFAHSANYRKIPLCTASVVPSEQTES  123

Query  345   -CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDEL  521
              CGRPLGL F    G LY+ D + GL+KV  N G  A  LA       F F++ + VD+ 
Sbjct  124   MCGRPLGLQFFAMTGDLYIADAYMGLMKVGPNGGEEAQVLATQAGDAPFHFVNGLDVDQA  183

Query  522   TADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQ  701
             T DVYF D+  I+     T+I+ + D +GRLLKY A   +VTVL   L  P G+A   D+
Sbjct  184   TGDVYFTDSSAIYPRRFNTEIMMNADATGRLLKYDARTKRVTVLKADLPYPNGVAVSNDR  243

Query  702   TFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqq  881
             T ++++  +  +  +Y++ GPKA   + ++ +L GYPDNV+R   GG+WVALN  K +  
Sbjct  244   THVVVAHTVPCQAFRYWLKGPKAGQYE-LLADLPGYPDNVRRDARGGYWVALNQEKARLD  302

Query  882   ppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSFSGYQEYSDIAYVGSLLSDFVAV  1052
                P      + V   +DG +V  + +T     + S   E     ++GS+  D+V +
Sbjct  303   ATAPPA-KHLVGVRLAVDGAVV--EELTAAKGVTLSDVAEKDGQLWLGSIELDYVGL  356



>ref|XP_002878128.1| strictosidine synthase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54387.1| strictosidine synthase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=374

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 92/239 (38%), Positives = 138/239 (58%), Gaps = 6/239 (3%)
 Frame = +3

Query  150  ILNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGIN  323
            ++ L  ASGPE  A DP  +G Y GV+DGR+LK+ + +  ++DFA TS  R  ++C    
Sbjct  48   VVTLTGASGPESIAFDPAGEGPYVGVSDGRVLKWRSESLGWSDFAYTSSNR--QECVRPF  105

Query  324  ITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDA  503
               +   CGRPLGL FD   G LY+ D ++GLL V    GGLA  L     G+ F F + 
Sbjct  106  APELEHVCGRPLGLRFDKKTGDLYIADAYFGLLVVG-PAGGLAKPLVTEAEGQPFRFTND  164

Query  504  VAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGM  683
            + +DE    +YF D    F+   +   V + D +GR +KY  +  + TVLL GL+   G+
Sbjct  165  LDIDEQEDVIYFTDTSARFQRRQFLAAVLNVDKTGRFIKYDRSSKKATVLLQGLAFANGV  224

Query  684  ATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALN  860
            A   D++F+++ E    +I++ ++SGP A T + V   L G+PDN++R + G FWVAL+
Sbjct  225  ALSKDRSFVLVVETTTCKILRLWLSGPNAGTHE-VFAELPGFPDNIRRNSNGEFWVALH  282



>gb|KHG24230.1| Strictosidine synthase 3 -like protein [Gossypium arboreum]
Length=325

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 106/302 (35%), Positives = 161/302 (53%), Gaps = 14/302 (5%)
 Frame = +3

Query  165   HASGPEDTAIDPLDQGIYTGVTDGRILKYLNG---NFNDFATTSPYRTKEKCDGINITNI  335
             + +GPE  A +      Y GVTDGRIL+Y NG    F +F +T   RTK  CDGI   ++
Sbjct  33    NVTGPESIAFELATGRFYVGVTDGRILQY-NGPTVGFVEFGSTGRNRTKTMCDGITDPDL  91

Query  336   RAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVD  515
                CGRP GL F +A   LYV D + GL+ V  +   LAT L+ GV G  + F + + V 
Sbjct  92    GPMCGRPYGLGFHYATNQLYVCDAYLGLM-VLGSGRRLATPLSTGVEGVPYRFCNGLDVH  150

Query  516   ELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDI  695
             +L+ +V+F D+   +   N ++ ++S D++GRLL Y+    +VTVLL  L GPAG+A   
Sbjct  151   QLSGNVFFTDSTTNYDLRNASKGLESNDSTGRLLMYNPTNNRVTVLLKNLPGPAGVAVSQ  210

Query  696   DQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpq  875
             D  + ++S Y     I++++ GP+A+T + +  N +  P+N++R  +G FW A  + K  
Sbjct  211   DGLYALVSNYNANNTIRFWLRGPRADTYEII--NFQARPNNIQRTLVGDFWEAAAMVKQS  268

Query  876   qqppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSF-SGYQEYSDIAYVGSLLSDFVAV  1052
              Q          I       G ++ T N    + N   S  QE+ D  YV S   DF+ +
Sbjct  269   TQTLV------PIGQRISGLGLVLQTVNFERWYGNKLISEVQEFRDALYVASPDVDFIGI  322

Query  1053  YT  1058
             Y+
Sbjct  323   YS  324



>ref|XP_007037730.1| Calcium-dependent phosphotriesterase superfamily protein, putative 
[Theobroma cacao]
 gb|EOY22231.1| Calcium-dependent phosphotriesterase superfamily protein, putative 
[Theobroma cacao]
Length=336

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 114/338 (34%), Positives = 176/338 (52%), Gaps = 18/338 (5%)
 Frame = +3

Query  54    NMKSLTMFWISILMFISSPYVIHSQPGVDFPIILNLQHASGPEDTAIDPLDQGIYTGVTD  233
             +++  T+F I I +F S P ++ SQ    F  I     A GPE  A +     IY GV D
Sbjct  11    SLREATLFSIFIFIFCS-PSMVLSQ---FFSSIQLPPTAKGPESFAFELGTGRIYVGVDD  66

Query  234   GRILKYLNG---NFNDFATTSPYRTKEKCDGINITNIRAECGRPLGLDFDHARGVLYVTD  404
             GRIL+Y NG    F DF  TS  R+K  CDG    ++   CGRP+GL F +A   LYV D
Sbjct  67    GRILQY-NGPATGFVDFGYTSGTRSKAVCDGATNPDLGPICGRPMGLGFHYASSQLYVCD  125

Query  405   MFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDELTADVYFIDAGDIFRSLNYTQI  584
              + GL+ ++ + GGLA  +++  +G  + F + + V +L+ +V+F D   ++   N ++ 
Sbjct  126   AYVGLVALD-SRGGLANLVSSSADGEPYRFCNGLDVHQLSGNVFFTDTSTVYDLRNASKG  184

Query  585   VQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQTFIMISEYIGRRIIKYFISGP  764
             + S D++GRLL+Y     +VTVLL  L+GPAG A   D T+++IS +     ++Y++ GP
Sbjct  185   LTSNDSTGRLLRYDPNTKRVTVLLKNLTGPAGAAVSQDGTYVLISNFNSNTTMRYWLQGP  244

Query  765   KANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqqppppipMTDSIAVNFDMDGNI  944
             +ANT   +  + +  P+N++    G FW A  + K   Q          I       G +
Sbjct  245   RANTYDII--STQARPNNIQGTLAGDFWQAAAMVKQPTQSLV------PIGQRISGLGIV  296

Query  945   VNTKNVTDTFPNSF-SGYQEYSDIAYVGSLLSDFVAVY  1055
               T N    + N+  S  QE+    YV S   +F+ VY
Sbjct  297   TRTVNFEQWYGNNLISEVQEFGGALYVASRYVNFIGVY  334



>ref|XP_007028511.1| Calcium-dependent phosphotriesterase superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY09013.1| Calcium-dependent phosphotriesterase superfamily protein isoform 
1 [Theobroma cacao]
Length=369

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 99/267 (37%), Positives = 143/267 (54%), Gaps = 15/267 (6%)
 Frame = +3

Query  153  LNLQHASGPEDTAIDPLDQGIYTGVTDGRILKYLNG--NFNDFATTSPYRTKEKCDGINI  326
            + L  A GPE  A D    G Y+GV DGRILK+      + DFA TS +R  E C     
Sbjct  44   IRLDSAFGPESLAFDANGDGPYSGVADGRILKWQGDAVGWTDFAFTSSHR--EDCVRPFA  101

Query  327  TNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAV  506
              +   CGRPLGL FD   G LY+ D ++GL +V    GGLATQL     G+   F + +
Sbjct  102  PEMEHICGRPLGLRFDKKTGDLYIADAYFGL-QVVGPAGGLATQLITEAEGQPLYFTNDM  160

Query  507  AVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMA  686
             +DEL   +YF D    FR   +   + + D +GRLLKY+ +  +VTVLL GL+   G+A
Sbjct  161  DIDELDDVIYFTDTSTSFRRRQFLPSIFTTDKTGRLLKYNKSSKEVTVLLRGLAFANGVA  220

Query  687  TDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNip  866
               D +F++++E    RI++ ++ GP A   + V   L G+PDN++R   G FWVAL+  
Sbjct  221  LSKDSSFVLVAETTTCRILRLWLRGPNAGNVE-VFSELPGFPDNIRRNKKGEFWVALH--  277

Query  867  kpqqqppppipMTDSIAVNFDMDGNIV  947
                       +   +A+++ + GN V
Sbjct  278  -------AKKGLVAKLALSYSLFGNTV  297



>tpg|DAA61232.1| TPA: strictosidine synthase 3 [Zea mays]
Length=343

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 101/274 (37%), Positives = 148/274 (54%), Gaps = 12/274 (4%)
 Frame = +3

Query  147  IILNL-QHASGPEDTAIDPLDQGIYTGVTDGRILKY---LNGNFNDFATTSPYRTKEKC-  311
            +++ L +  SGPE  A D    G Y+GV+DGR+L++   L G + +FA  S +R+   C 
Sbjct  40   VVMTLPEPVSGPESLAFDGRGGGPYSGVSDGRVLRWQGPLRG-WTEFAYNSKHRSVALCA  98

Query  312  DGINITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFS  491
                +    + CGRPLGL F    G LYV D + GLL+V    GGLA  +A    G  F+
Sbjct  99   PDKKLVVPESLCGRPLGLQFHRQSGDLYVADAYLGLLRVA-ARGGLAQVVATEAAGGPFN  157

Query  492  FIDAVAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSG  671
            F++ + VD+ T DVYF D+   +R  +Y  +V  GD +GRLL+Y    G+V VL  GLS 
Sbjct  158  FLNGLDVDQRTGDVYFTDSSATYRRSDYLLVVAMGDETGRLLRYERRTGRVGVLQAGLSY  217

Query  672  PAGMATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWV  851
            P G+A   D T ++++      + +Y+I G +A T+ T  E L GYPDN++    GG+WV
Sbjct  218  PNGVAVSADGTHVVVAHTALCELRRYWIRGARAGTSDTFAE-LPGYPDNLRADGRGGYWV  276

Query  852  ALNipkpqqqppppipMTDSIAVNFDMDGNIVNT  953
            AL+                ++AV    DGN+   
Sbjct  277  ALS----SGVAADEAAAAPTVAVRVSRDGNVTEA  306



>gb|EMT28724.1| putative Strictosidine synthase [Aegilops tauschii]
Length=340

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 105/303 (35%), Positives = 162/303 (53%), Gaps = 11/303 (4%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYLNGN---FNDFATTSPYRTKEKCDGINITNIRA  341
             +G E  A D L QG YTGV+D R+LK+ +G+   + DF   + YR    C      +   
Sbjct  43    TGAERLAFDALGQGPYTGVSDRRVLKW-DGSAVGWTDFDHHANYRKLPMCTVAMAPSEET  101

Query  342   E--CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVD  515
             E  CGRPLGL F    G LY+ D + GL++V   +GG A  LA   +G  F+F++ + +D
Sbjct  102   EGLCGRPLGLAFHLESGDLYMADAYNGLMRVG-PDGGEAEVLATAADGVQFNFVNGLDID  160

Query  516   ELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDI  695
             ++T DVYF D+   +     T+I+ + D +GRLLKY A   QVTVL  GL  P G+A   
Sbjct  161   QVTGDVYFTDSSVTYPRRFNTEIMMNADATGRLLKYDARTKQVTVLKYGLPYPNGVAVSH  220

Query  696   DQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpq  875
             D+  I+++  +  +  +Y++ GPKA   + ++ +L GYPDNV+R   GG+WVALN  + +
Sbjct  221   DRMHIVVAHTLPCQAYRYYLQGPKAGHYE-LLADLPGYPDNVRRDENGGYWVALNQERGR  279

Query  876   qqppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSFSGYQEYSDIAYVGSLLSDFVAVY  1055
                           V   +DGN V  + +      + S   E     ++GS+  D++ + 
Sbjct  280   PGATTRPVRH---LVGVRLDGNGVEVEELNAAKGVTLSEVAERKGKLWLGSIELDYIGLL  336

Query  1056  TAI  1064
              A+
Sbjct  337   VAL  339



>ref|XP_002270060.2| PREDICTED: strictosidine synthase 1-like [Vitis vinifera]
Length=341

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 116/301 (39%), Positives = 165/301 (55%), Gaps = 15/301 (5%)
 Frame = +3

Query  168   ASGPEDTAIDPLDQGIYTGVTDGRILKYLNGN--FNDFATTSPYRTKEKCDGINITNIRA  341
             A+GPE  A D    G YTG++DGRILKY+NG+  F +FA TS   ++E C G     +  
Sbjct  41    ATGPESIAFDAAGGGPYTGISDGRILKYVNGSVGFVEFAITSSNSSEEFCVGNGSVALDF  100

Query  342   ECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDEL  521
              CGRP GL F +  G LY+ D +YGL+ V   NGG+ATQLA   +G  F F +A+ VD  
Sbjct  101   TCGRPFGLGFHYQTGDLYIADAYYGLMVV-GPNGGVATQLANAADGVPFGFTNALDVDTE  159

Query  522   TADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDIDQ  701
             T  VY +D    F    ++  +Q+ D +GRL+KY     ++TVLL GL G AGMA   D 
Sbjct  160   TGMVYLVDYSSQFSVNEFSVSLQAHDMTGRLMKYDPESKELTVLLGGLGGAAGMAISKDG  219

Query  702   TFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqqq  881
             +FI+I+E + +RI K+++ GPKA T++ +++     P N+KR   G FWVA        +
Sbjct  220   SFILITETVTKRIRKFWLQGPKATTSE-ILKEFTVRPANIKRNEEGEFWVAF---LVADE  275

Query  882   ppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSFSGYQE---YSDIAYVGSLLSDFVAV  1052
                      S  +    DG I+   ++     ++ SG  E   Y+   Y+GS    FV V
Sbjct  276   TGSCPSQQQSPGLRISGDGMILEAISL-----DTQSGISEVAVYNGKMYIGSPFLHFVDV  330

Query  1053  Y  1055
             Y
Sbjct  331   Y  331



>ref|XP_003547789.1| PREDICTED: strictosidine synthase-like [Glycine max]
 gb|KHN15543.1| Strictosidine synthase [Glycine soja]
Length=347

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 113/319 (35%), Positives = 166/319 (52%), Gaps = 22/319 (7%)
 Frame = +3

Query  153   LNLQHAS-GPEDTAIDPLDQGIYTGVTDGRILKY--LNGNFNDFATTSPYRTKEKCDGIN  323
             L+L H+  G E  A D   +G Y GV+DGRILK+      + DFA TSP+R K+ CDG+ 
Sbjct  35    LDLPHSVFGSESVAFDCHGKGPYVGVSDGRILKWHETKREWIDFAVTSPHRNKKLCDGLT  94

Query  324   ITNIRAECGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDA  503
                + + CGRPLGL F+     LY+ D ++GLL V    G +A QLA    G  F F +A
Sbjct  95    NDKMESMCGRPLGLKFNTLTCELYIADAYFGLLVVGPGGG-VAKQLATSAEGVPFRFTNA  153

Query  504   VAVDELTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGM  683
             + +D  T +VYF D+  +F+   Y  I+ SGD +GRLLKY  +   V VL+ GL+ P G+
Sbjct  154   LDIDTKTGEVYFTDSSIMFQRRVYISIILSGDRTGRLLKYVPSTQSVHVLVKGLAFPNGV  213

Query  684   ATDIDQTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGY------PDNVKRGTLGGF  845
             A   D +FI+++E    +I+K  +   K N       N+E +      PDN+KR   G F
Sbjct  214   ALSKDNSFIIVAESTTFKILKIQVRDSKTNNN-----NIEPFAQVPRSPDNIKRNAKGEF  268

Query  846   WVALNipkpqqqppppipMT------DSIAVNFDMDGNIVNTKN-VTDTFPNSFSGYQEY  1004
             WVALN  +   Q       T      D +A+ FD  G  +   +       +S S  +E+
Sbjct  269   WVALNSGRGLIQKLENEIETTLPWNADPVAIKFDEKGRAIEVLDGEYGRQLDSVSEVEEH  328

Query  1005  SDIAYVGSLLSDFVAVYTA  1061
                 ++GS +  ++ +  A
Sbjct  329   EGSLWIGSAVQPYIGLIKA  347



>ref|XP_003576994.1| PREDICTED: LOW QUALITY PROTEIN: strictosidine synthase 3-like 
[Brachypodium distachyon]
Length=344

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 103/298 (35%), Positives = 159/298 (53%), Gaps = 8/298 (3%)
 Frame = +3

Query  171   SGPEDTAIDPLDQGIYTGVTDGRILKYLNG--NFNDFATTSPYRTKEKCDGINITNIRAE  344
             +G E  A D   +G Y GV+DGR+L++      +  FA    YR    C      +   E
Sbjct  50    TGAESLAFDAQGKGPYAGVSDGRVLRWDGSATGWTTFAHHEDYRRIPLCTVPMAPSHETE  109

Query  345   --CGRPLGLDFDHARGVLYVTDMFYGLLKVERNNGGLATQLAAGVNGRNFSFIDAVAVDE  518
               CGRPLGL F    G LY+ D + GLL+V  ++GG A  L  GV+G  F F++ + VD+
Sbjct  110   SICGRPLGLAFHQKSGDLYIADAYKGLLRVG-SDGGEAEVLVTGVDGVPFRFVNGIDVDQ  168

Query  519   LTADVYFIDAGDIFRSLNYTQIVQSGDTSGRLLKYSAAKGQVTVLLNGLSGPAGMATDID  698
              T DVYF D+   +     T+I+ + D +GR LKY A   QV VL +GL  P G+A   D
Sbjct  169   ATGDVYFTDSSLTYPRRFNTEIMMNADATGRXLKYEARTKQVMVLKDGLPYPNGVAVSHD  228

Query  699   QTFIMISEYIGRRIIKYFISGPKANTTQTVMENLEGYPDNVKRGTLGGFWVALNipkpqq  878
             +T+++++  +  +  +Y++ G KA   + +M +L GYPDNV+R   GG+WVALN  K + 
Sbjct  229   RTYVVVAHTVSCQAHRYYLQGAKAGQYE-LMADLPGYPDNVRRDGKGGYWVALNQEKARP  287

Query  879   qppppipMTDSIAVNFDMDGNIVNTKNVTDTFPNSFSGYQEYSDIAYVGSLLSDFVAV  1052
                   P+   + V  D +G  V  + +T     + S   E +   ++GS+  D++ +
Sbjct  288   DMASMGPVKHLVGVRLDENG--VQVEVLTAAKGVTLSEVSERNGRLWLGSVELDYIGL  343



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2941102238830