BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13445_g1_i1 len=1209 path=[2191:0-90 2281:91-436 1816:437-465
2654:466-1208]

Length=1209
                                                                      Score     E

ref|XP_004236090.1|  PREDICTED: strictosidine synthase 3-like           286   7e-90   
ref|XP_004252261.1|  PREDICTED: strictosidine synthase 3-like           285   4e-89   
ref|XP_006345201.1|  PREDICTED: strictosidine synthase 3-like           277   2e-86   
ref|XP_004236089.1|  PREDICTED: strictosidine synthase 1-like           274   6e-85   
ref|XP_010319099.1|  PREDICTED: strictosidine synthase 1-like           267   3e-82   
ref|XP_006345203.1|  PREDICTED: strictosidine synthase 1-like           263   8e-81   
ref|XP_011071027.1|  PREDICTED: protein STRICTOSIDINE SYNTHASE-LI...    256   6e-78   
ref|XP_002274134.3|  PREDICTED: strictosidine synthase 3-like           249   2e-75   Vitis vinifera
ref|XP_010663511.1|  PREDICTED: strictosidine synthase 1-like           249   3e-75   
ref|XP_010099019.1|  Strictosidine synthase 1                           244   9e-74   
ref|XP_011071025.1|  PREDICTED: protein STRICTOSIDINE SYNTHASE-LI...    241   3e-72   
emb|CBI15377.3|  unnamed protein product                                249   7e-72   
emb|CDP10794.1|  unnamed protein product                                238   4e-71   
ref|XP_004298328.1|  PREDICTED: strictosidine synthase-like             238   4e-71   
ref|XP_010099021.1|  Strictosidine synthase 1                           237   1e-70   
ref|XP_010655935.1|  PREDICTED: strictosidine synthase 1-like           233   3e-69   
emb|CBI28987.3|  unnamed protein product                                232   4e-69   
emb|CBI28990.3|  unnamed protein product                                233   4e-69   
ref|XP_003635414.1|  PREDICTED: strictosidine synthase 1-like           232   5e-69   
emb|CBI18784.3|  unnamed protein product                                232   7e-69   
gb|AES93117.1|  strictosidine synthase                                  232   8e-69   
emb|CBI28988.3|  unnamed protein product                                231   1e-68   
ref|XP_002275622.2|  PREDICTED: strictosidine synthase 1-like           232   2e-68   Vitis vinifera
emb|CDP21322.1|  unnamed protein product                                233   2e-68   
ref|XP_010655933.1|  PREDICTED: strictosidine synthase 1-like           232   6e-68   
emb|CAN77945.1|  hypothetical protein VITISV_044021                     230   1e-67   Vitis vinifera
ref|XP_008811198.1|  PREDICTED: strictosidine synthase 1-like           228   2e-67   
ref|XP_010656041.1|  PREDICTED: strictosidine synthase 1-like           228   2e-67   
ref|XP_010658741.1|  PREDICTED: strictosidine synthase 1-like           228   3e-67   
emb|CBI40188.3|  unnamed protein product                                226   4e-67   
ref|XP_006436700.1|  hypothetical protein CICLE_v10033919mg             228   5e-67   
ref|XP_010110081.1|  Strictosidine synthase 1                           228   5e-67   
ref|XP_010656040.1|  PREDICTED: strictosidine synthase 1-like           228   6e-67   
emb|CDP21321.1|  unnamed protein product                                227   6e-67   
ref|XP_006437788.1|  hypothetical protein CICLE_v10032008mg             228   6e-67   
ref|XP_006436702.1|  hypothetical protein CICLE_v10033429mg             227   1e-66   
emb|CBI15378.3|  unnamed protein product                                238   2e-66   
ref|XP_006436705.1|  hypothetical protein CICLE_v10033909mg             226   3e-66   
gb|KDO70174.1|  hypothetical protein CISIN_1g019290mg                   225   7e-66   
ref|XP_010663512.1|  PREDICTED: strictosidine synthase 3-like           224   1e-65   
ref|XP_010257835.1|  PREDICTED: strictosidine synthase 3-like           223   3e-65   
ref|XP_003531955.1|  PREDICTED: strictosidine synthase 3-like           223   4e-65   
ref|XP_002312353.2|  hypothetical protein POPTR_0008s10940g             223   4e-65   Populus trichocarpa [western balsam poplar]
ref|XP_008243874.1|  PREDICTED: strictosidine synthase 3-like           223   4e-65   
ref|XP_004298326.1|  PREDICTED: strictosidine synthase-like             223   5e-65   
ref|XP_010099026.1|  Strictosidine synthase 1                           222   6e-65   
ref|XP_006436612.1|  hypothetical protein CICLE_v10033527mg             222   6e-65   
emb|CDX95058.1|  BnaC05g06130D                                          223   6e-65   
emb|CDP21857.1|  unnamed protein product                                221   2e-64   
emb|CBI35408.3|  unnamed protein product                                229   2e-64   
ref|XP_006436697.1|  hypothetical protein CICLE_v10033295mg             220   4e-64   
gb|ACU23577.1|  unknown                                                 220   6e-64   Glycine max [soybeans]
emb|CBI24410.3|  unnamed protein product                                218   1e-63   
dbj|BAJ53159.1|  JHL10I11.5                                             219   1e-63   
emb|CDX93560.1|  BnaA06g04880D                                          220   1e-63   
ref|XP_006485325.1|  PREDICTED: strictosidine synthase 3-like           222   2e-63   
ref|XP_009627580.1|  PREDICTED: strictosidine synthase 1-like           219   2e-63   
ref|XP_004981761.1|  PREDICTED: adipocyte plasma membrane-associa...    219   3e-63   
ref|XP_008465977.1|  PREDICTED: strictosidine synthase 1-like           219   3e-63   
ref|XP_009148103.1|  PREDICTED: strictosidine synthase 3                219   4e-63   
emb|CAN77943.1|  hypothetical protein VITISV_044019                     216   4e-63   Vitis vinifera
gb|AFK49369.1|  unknown                                                 217   5e-63   
ref|XP_002273764.1|  PREDICTED: strictosidine synthase 1                218   5e-63   Vitis vinifera
ref|XP_002273580.1|  PREDICTED: strictosidine synthase 3                217   7e-63   Vitis vinifera
ref|XP_009797408.1|  PREDICTED: strictosidine synthase 1-like           218   7e-63   
emb|CAN63240.1|  hypothetical protein VITISV_034462                     217   8e-63   Vitis vinifera
ref|XP_002463871.1|  hypothetical protein SORBIDRAFT_01g007960          218   8e-63   Sorghum bicolor [broomcorn]
emb|CBI18783.3|  unnamed protein product                                215   2e-62   
emb|CDO98507.1|  unnamed protein product                                215   2e-62   
ref|XP_008677622.1|  PREDICTED: strictosidine synthase isoform X1       217   2e-62   
emb|CAN78856.1|  hypothetical protein VITISV_013356                     222   3e-62   Vitis vinifera
emb|CAN77942.1|  hypothetical protein VITISV_044018                     215   3e-62   Vitis vinifera
ref|XP_002270060.2|  PREDICTED: strictosidine synthase 1-like           215   3e-62   Vitis vinifera
ref|XP_002513740.1|  strictosidine synthase, putative                   216   3e-62   Ricinus communis
gb|KFK43153.1|  hypothetical protein AALP_AA1G086800                    216   3e-62   
ref|XP_006351273.1|  PREDICTED: strictosidine synthase 1-like           216   4e-62   
ref|XP_009356499.1|  PREDICTED: strictosidine synthase 3-like           215   4e-62   
ref|XP_004150130.1|  PREDICTED: strictosidine synthase 1-like           215   4e-62   
ref|XP_010110077.1|  Strictosidine synthase 1                           214   4e-62   
ref|NP_001150008.1|  strictosidine synthase precursor                   216   5e-62   Zea mays [maize]
ref|XP_004249227.1|  PREDICTED: strictosidine synthase 1                215   9e-62   
ref|XP_006421116.1|  hypothetical protein CICLE_v10005245mg             214   1e-61   
gb|KEH23600.1|  strictosidine synthase family protein                   213   2e-61   
ref|XP_010412433.1|  PREDICTED: strictosidine synthase 1-like           213   2e-61   
ref|XP_009799719.1|  PREDICTED: strictosidine synthase 1-like           213   3e-61   
ref|XP_004308613.1|  PREDICTED: strictosidine synthase-like             212   3e-61   
ref|XP_006494389.1|  PREDICTED: strictosidine synthase 1-like           213   3e-61   
ref|XP_009597336.1|  PREDICTED: strictosidine synthase 1-like           210   3e-61   
ref|XP_002298158.2|  strictosidine synthase family protein              213   6e-61   Populus trichocarpa [western balsam poplar]
ref|XP_004169880.1|  PREDICTED: LOW QUALITY PROTEIN: strictosidin...    212   6e-61   
ref|XP_002323253.2|  strictosidine synthase family protein              212   6e-61   Populus trichocarpa [western balsam poplar]
ref|XP_007045664.1|  Calcium-dependent phosphotriesterase superfa...    213   6e-61   
ref|XP_010655934.1|  PREDICTED: strictosidine synthase 1-like           209   9e-61   
ref|XP_004172338.1|  PREDICTED: adipocyte plasma membrane-associa...    213   1e-60   
ref|XP_009631158.1|  PREDICTED: strictosidine synthase 1-like           211   1e-60   
ref|XP_004137361.1|  PREDICTED: adipocyte plasma membrane-associa...    213   1e-60   
emb|CDP21347.1|  unnamed protein product                                212   1e-60   
gb|EYU18642.1|  hypothetical protein MIMGU_mgv1a008518mg                212   1e-60   
ref|XP_002514533.1|  strictosidine synthase, putative                   211   2e-60   Ricinus communis
gb|AES67180.2|  strictosidine synthase family protein                   212   3e-60   
ref|XP_010269382.1|  PREDICTED: strictosidine synthase 1-like           211   3e-60   
ref|XP_003596929.1|  Adipocyte plasma membrane-associated protein       211   3e-60   
ref|XP_002278088.1|  PREDICTED: strictosidine synthase 3                211   3e-60   Vitis vinifera
emb|CDP09527.1|  unnamed protein product                                211   3e-60   
ref|XP_006826427.1|  hypothetical protein AMTR_s00004p00163660          211   3e-60   
ref|XP_006287902.1|  hypothetical protein CARUB_v10001136mg             211   3e-60   
ref|XP_003609162.1|  Strictosidine synthase                             209   4e-60   
ref|XP_011075619.1|  PREDICTED: protein STRICTOSIDINE SYNTHASE-LI...    209   4e-60   
ref|XP_010430839.1|  PREDICTED: strictosidine synthase 1-like           209   4e-60   
ref|XP_004305393.1|  PREDICTED: strictosidine synthase-like             209   4e-60   
ref|XP_008453519.1|  PREDICTED: strictosidine synthase 3                211   5e-60   
ref|XP_004237337.1|  PREDICTED: strictosidine synthase 3-like           210   5e-60   
ref|XP_011075408.1|  PREDICTED: protein STRICTOSIDINE SYNTHASE-LI...    210   6e-60   
gb|EPS66876.1|  hypothetical protein M569_07898                         210   7e-60   
ref|XP_010454464.1|  PREDICTED: strictosidine synthase 3-like           211   7e-60   
ref|XP_008776219.1|  PREDICTED: adipocyte plasma membrane-associa...    210   8e-60   
ref|XP_007156378.1|  hypothetical protein PHAVU_003G281200g             209   1e-59   
gb|KDP42972.1|  hypothetical protein JCGZ_23914                         210   1e-59   
ref|NP_680189.1|  strictosidine synthase family protein                 210   1e-59   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD95409.1|  putative strictosidine synthase - like                 210   1e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003609164.1|  Strictosidine synthase                             208   1e-59   
gb|AES91361.2|  strictosidine synthase-like protein, putative           208   1e-59   
emb|CDX92388.1|  BnaA10g14270D                                          209   1e-59   
gb|EYU22112.1|  hypothetical protein MIMGU_mgv1a007437mg                209   2e-59   
ref|XP_010425613.1|  PREDICTED: strictosidine synthase 3-like           207   2e-59   
ref|XP_010932965.1|  PREDICTED: strictosidine synthase 3-like           209   3e-59   
ref|XP_010247897.1|  PREDICTED: strictosidine synthase 3-like           209   3e-59   
emb|CDP14992.1|  unnamed protein product                                206   3e-59   
ref|XP_010420991.1|  PREDICTED: adipocyte plasma membrane-associa...    209   3e-59   
ref|XP_010108510.1|  Strictosidine synthase 1                           208   4e-59   
ref|XP_010493259.1|  PREDICTED: strictosidine synthase 3-like           208   4e-59   
ref|XP_002452919.1|  hypothetical protein SORBIDRAFT_04g034960          207   5e-59   Sorghum bicolor [broomcorn]
ref|XP_002874041.1|  strictosidine synthase family protein              208   5e-59   
ref|XP_011000464.1|  PREDICTED: strictosidine synthase 3-like           207   5e-59   
ref|XP_007045667.1|  Calcium-dependent phosphotriesterase superfa...    211   6e-59   
ref|XP_002274235.1|  PREDICTED: strictosidine synthase 3-like           206   7e-59   Vitis vinifera
ref|XP_009394278.1|  PREDICTED: strictosidine synthase 1-like           207   7e-59   
ref|XP_007202861.1|  hypothetical protein PRUPE_ppa015510mg             206   8e-59   
ref|XP_004307669.1|  PREDICTED: strictosidine synthase 1-like iso...    207   9e-59   
gb|ABR18211.1|  unknown                                                 207   1e-58   Picea sitchensis
ref|XP_004487437.1|  PREDICTED: adipocyte plasma membrane-associa...    207   1e-58   
ref|XP_007132511.1|  hypothetical protein PHAVU_011G100400g             207   1e-58   
ref|XP_002454704.1|  hypothetical protein SORBIDRAFT_04g035910          206   1e-58   Sorghum bicolor [broomcorn]
emb|CAN78855.1|  hypothetical protein VITISV_013355                     206   1e-58   Vitis vinifera
ref|XP_006417683.1|  hypothetical protein EUTSA_v10007865mg             207   1e-58   
ref|XP_003547789.1|  PREDICTED: strictosidine synthase-like             206   1e-58   
ref|XP_006390480.1|  hypothetical protein EUTSA_v10018852mg             205   1e-58   
ref|XP_002438841.1|  hypothetical protein SORBIDRAFT_10g027060          206   2e-58   Sorghum bicolor [broomcorn]
gb|KDP29321.1|  hypothetical protein JCGZ_18242                         204   2e-58   
ref|XP_010031589.1|  PREDICTED: adipocyte plasma membrane-associa...    207   2e-58   
ref|XP_010263076.1|  PREDICTED: adipocyte plasma membrane-associa...    206   2e-58   
ref|XP_008244837.1|  PREDICTED: strictosidine synthase 1                206   2e-58   
ref|XP_003559512.1|  PREDICTED: strictosidine synthase-like             206   2e-58   
ref|XP_010031590.1|  PREDICTED: adipocyte plasma membrane-associa...    206   2e-58   
ref|XP_003561520.1|  PREDICTED: strictosidine synthase 1-like           205   3e-58   
ref|XP_006340100.1|  PREDICTED: strictosidine synthase 1-like iso...    206   3e-58   
ref|XP_011037298.1|  PREDICTED: strictosidine synthase 3-like           206   3e-58   
emb|CDP16919.1|  unnamed protein product                                205   3e-58   
ref|XP_006291448.1|  hypothetical protein CARUB_v10017585mg             204   3e-58   
ref|XP_010416232.1|  PREDICTED: strictosidine synthase 3-like           204   4e-58   
ref|XP_004970743.1|  PREDICTED: strictosidine synthase 3-like           204   4e-58   
ref|XP_010672985.1|  PREDICTED: strictosidine synthase 1-like           205   4e-58   
ref|XP_008244844.1|  PREDICTED: strictosidine synthase 1                206   4e-58   
ref|XP_007204530.1|  hypothetical protein PRUPE_ppa017675mg             204   5e-58   
ref|XP_003580953.1|  PREDICTED: strictosidine synthase 1-like           204   6e-58   
ref|XP_010922155.1|  PREDICTED: strictosidine synthase 3-like           205   6e-58   
gb|KFK26348.1|  hypothetical protein AALP_AA8G236100                    205   6e-58   
emb|CDP07817.1|  unnamed protein product                                203   7e-58   
ref|XP_010537421.1|  PREDICTED: strictosidine synthase 1-like           203   7e-58   
gb|EPS65875.1|  hypothetical protein M569_08902                         205   7e-58   
ref|XP_009400113.1|  PREDICTED: strictosidine synthase 1-like           204   7e-58   
gb|KHN41250.1|  Adipocyte plasma membrane-associated protein            204   7e-58   
ref|XP_003575472.1|  PREDICTED: strictosidine synthase 1-like           203   9e-58   
ref|XP_011000438.1|  PREDICTED: strictosidine synthase 1                204   1e-57   
ref|XP_011044611.1|  PREDICTED: strictosidine synthase 3-like           205   1e-57   
dbj|BAJ91613.1|  predicted protein                                      206   1e-57   
gb|KDO48949.1|  hypothetical protein CISIN_1g015463mg                   204   1e-57   
gb|KHG17610.1|  Strictosidine synthase 1 -like protein                  203   1e-57   
dbj|BAJ89445.1|  predicted protein                                      206   1e-57   
ref|XP_002892459.1|  strictosidine synthase family protein              204   1e-57   
gb|AFK33536.1|  unknown                                                 202   1e-57   
ref|XP_011088992.1|  PREDICTED: protein STRICTOSIDINE SYNTHASE-LI...    204   1e-57   
ref|XP_010504621.1|  PREDICTED: strictosidine synthase 1-like           203   1e-57   
ref|XP_008230556.1|  PREDICTED: strictosidine synthase 3                204   1e-57   
ref|XP_010246302.1|  PREDICTED: strictosidine synthase 3-like           203   1e-57   
ref|XP_002532597.1|  strictosidine synthase, putative                   204   2e-57   Ricinus communis
ref|XP_010428359.1|  PREDICTED: strictosidine synthase 3-like iso...    202   2e-57   
ref|XP_009623916.1|  PREDICTED: strictosidine synthase 3-like           204   2e-57   
ref|XP_010544326.1|  PREDICTED: strictosidine synthase 3                204   2e-57   
ref|XP_010056146.1|  PREDICTED: strictosidine synthase 1                203   2e-57   
ref|XP_007205319.1|  hypothetical protein PRUPE_ppa006884mg             204   2e-57   
ref|XP_006305032.1|  hypothetical protein CARUB_v10009397mg             204   2e-57   
ref|XP_010471490.1|  PREDICTED: strictosidine synthase 1-like           202   2e-57   
ref|XP_006424057.1|  hypothetical protein CICLE_v10028617mg             204   2e-57   
ref|XP_004493426.1|  PREDICTED: strictosidine synthase 1-like           203   3e-57   
ref|XP_011027270.1|  PREDICTED: strictosidine synthase 3-like iso...    204   3e-57   
ref|XP_010458085.1|  PREDICTED: strictosidine synthase 3-like           204   3e-57   
ref|XP_009783664.1|  PREDICTED: strictosidine synthase 3-like           203   3e-57   
gb|KHF98782.1|  Adipocyte plasma membrane-associated                    204   3e-57   
ref|XP_006487831.1|  PREDICTED: adipocyte plasma membrane-associa...    203   3e-57   
ref|XP_006361111.1|  PREDICTED: adipocyte plasma membrane-associa...    203   3e-57   
ref|XP_010110078.1|  Strictosidine synthase 1                           202   3e-57   
emb|CDY16615.1|  BnaC09g36580D                                          203   4e-57   
ref|XP_009339573.1|  PREDICTED: strictosidine synthase 3-like           203   4e-57   
ref|XP_008382118.1|  PREDICTED: strictosidine synthase 3                205   4e-57   
ref|XP_009412315.1|  PREDICTED: strictosidine synthase 3-like           203   4e-57   
ref|XP_002452976.1|  hypothetical protein SORBIDRAFT_04g035870          202   5e-57   Sorghum bicolor [broomcorn]
ref|XP_003527512.1|  PREDICTED: adipocyte plasma membrane-associa...    204   5e-57   
ref|XP_006400707.1|  hypothetical protein EUTSA_v10013741mg             203   5e-57   
ref|XP_008392402.1|  PREDICTED: strictosidine synthase 1-like           202   5e-57   
ref|XP_010488915.1|  PREDICTED: strictosidine synthase 3-like           203   5e-57   
ref|XP_010045161.1|  PREDICTED: strictosidine synthase 3-like           203   5e-57   
ref|XP_007028511.1|  Calcium-dependent phosphotriesterase superfa...    202   5e-57   
ref|XP_004978210.1|  PREDICTED: strictosidine synthase 1-like           201   6e-57   
ref|XP_010677108.1|  PREDICTED: strictosidine synthase 1-like           201   7e-57   
emb|CDP12339.1|  unnamed protein product                                201   7e-57   
ref|XP_006348919.1|  PREDICTED: strictosidine synthase 1-like           201   7e-57   
ref|XP_004241357.2|  PREDICTED: strictosidine synthase 3-like           203   7e-57   
gb|KEH23602.1|  strictosidine synthase family protein                   202   7e-57   
gb|EAZ28597.1|  hypothetical protein OsJ_12584                          201   8e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002323255.1|  strictosidine synthase family protein              202   8e-57   Populus trichocarpa [western balsam poplar]
gb|EAZ01726.1|  hypothetical protein OsI_23752                          201   1e-56   Oryza sativa Indica Group [Indian rice]
ref|XP_010525478.1|  PREDICTED: strictosidine synthase 1-like           201   1e-56   
ref|XP_010535734.1|  PREDICTED: adipocyte plasma membrane-associa...    202   1e-56   
emb|CDX73037.1|  BnaC06g34850D                                          200   1e-56   
ref|XP_009378622.1|  PREDICTED: strictosidine synthase 3-like           203   1e-56   
ref|XP_007037729.1|  Calcium-dependent phosphotriesterase superfa...    200   1e-56   
dbj|BAD35676.1|  putative strictosidine synthase precursor              201   1e-56   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ01725.1|  hypothetical protein OsI_23751                          201   1e-56   Oryza sativa Indica Group [Indian rice]
ref|XP_008655533.1|  PREDICTED: strictosidine synthase 3-like           200   1e-56   
ref|XP_009599899.1|  PREDICTED: strictosidine synthase 3-like           201   2e-56   
ref|XP_007015611.1|  Strictosidine synthase-like 3                      201   2e-56   
ref|NP_563818.1|  strictosidine synthase-like 3                         201   2e-56   Arabidopsis thaliana [mouse-ear cress]
emb|CDP09529.1|  unnamed protein product                                201   2e-56   
ref|XP_010056166.1|  PREDICTED: strictosidine synthase 1-like           201   2e-56   
gb|KFK34942.1|  hypothetical protein AALP_AA5G213900                    201   2e-56   
ref|NP_001051286.2|  Os03g0750700                                       201   2e-56   Oryza sativa Japonica Group [Japonica rice]
gb|EYU18639.1|  hypothetical protein MIMGU_mgv1a009932mg                199   2e-56   
ref|XP_010672984.1|  PREDICTED: strictosidine synthase 1-like           201   2e-56   
ref|XP_009797832.1|  PREDICTED: strictosidine synthase 3-like           201   3e-56   
ref|XP_004963976.1|  PREDICTED: strictosidine synthase-like             200   3e-56   
ref|XP_009765833.1|  PREDICTED: strictosidine synthase 3                201   3e-56   
ref|XP_003609161.1|  Strictosidine synthase                             199   3e-56   
ref|XP_010042385.1|  PREDICTED: strictosidine synthase 1-like           200   3e-56   
ref|XP_002456721.1|  hypothetical protein SORBIDRAFT_03g041380          199   3e-56   Sorghum bicolor [broomcorn]
ref|XP_006344500.1|  PREDICTED: adipocyte plasma membrane-associa...    201   3e-56   
ref|XP_004508606.1|  PREDICTED: strictosidine synthase 1-like           199   4e-56   
ref|XP_010023798.1|  PREDICTED: strictosidine synthase 1-like           200   4e-56   
ref|XP_010253308.1|  PREDICTED: adipocyte plasma membrane-associa...    201   4e-56   
ref|XP_010475646.1|  PREDICTED: strictosidine synthase 3-like           201   4e-56   
gb|ABK24858.1|  unknown                                                 201   4e-56   Picea sitchensis
ref|XP_010427562.1|  PREDICTED: strictosidine synthase 1-like           199   5e-56   
gb|EPS68312.1|  hypothetical protein M569_06455                         200   5e-56   
gb|AAR87254.1|  putative strictosidine synthase                         202   7e-56   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009120693.1|  PREDICTED: strictosidine synthase 3                200   7e-56   
ref|XP_002267323.1|  PREDICTED: strictosidine synthase 3                199   8e-56   Vitis vinifera
emb|CBI30108.3|  unnamed protein product                                199   8e-56   
ref|XP_006301516.1|  hypothetical protein CARUB_v10021942mg             199   8e-56   
ref|XP_002452451.1|  hypothetical protein SORBIDRAFT_04g026050          198   9e-56   Sorghum bicolor [broomcorn]
emb|CAN59852.1|  hypothetical protein VITISV_000854                     197   1e-55   Vitis vinifera
gb|AGU43759.1|  strictosidine synthase                                  199   1e-55   
gb|KEH29729.1|  strictosidine synthase family protein                   199   1e-55   
ref|XP_010554777.1|  PREDICTED: strictosidine synthase 3-like           199   1e-55   
ref|XP_004974468.1|  PREDICTED: strictosidine synthase 1-like           198   1e-55   
ref|XP_009391266.1|  PREDICTED: strictosidine synthase 3-like           197   2e-55   
ref|XP_003581637.1|  PREDICTED: strictosidine synthase 1-like           197   2e-55   
ref|XP_009587970.1|  PREDICTED: strictosidine synthase 3-like           199   2e-55   
ref|XP_006494390.1|  PREDICTED: strictosidine synthase 1-like           198   2e-55   
ref|XP_003576994.1|  PREDICTED: LOW QUALITY PROTEIN: strictosidin...    197   2e-55   
tpg|DAA45309.1|  TPA: hypothetical protein ZEAMMB73_979948              197   2e-55   
ref|XP_006340101.1|  PREDICTED: strictosidine synthase 1-like iso...    198   2e-55   
emb|CAB72173.1|  putative protein                                       198   2e-55   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE99809.1|  hypothetical protein                                   198   2e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010532262.1|  PREDICTED: strictosidine synthase 1-like           197   2e-55   
ref|XP_008655524.1|  PREDICTED: strictosidine synthase 3-like           197   2e-55   
ref|NP_191262.2|  calcium-dependent phosphotriesterase superfamil...    198   2e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009106057.1|  PREDICTED: strictosidine synthase 1-like           197   2e-55   
ref|XP_004243243.1|  PREDICTED: strictosidine synthase 1-like           197   3e-55   
ref|XP_002308895.2|  hypothetical protein POPTR_0006s03930g             198   3e-55   Populus trichocarpa [western balsam poplar]
ref|XP_004488398.1|  PREDICTED: strictosidine synthase 3-like           197   3e-55   
ref|XP_004974461.1|  PREDICTED: strictosidine synthase 1-like           197   3e-55   
ref|XP_003554139.1|  PREDICTED: strictosidine synthase 1-like           197   4e-55   
gb|EMT28724.1|  putative Strictosidine synthase                         196   4e-55   
ref|XP_002456259.1|  hypothetical protein SORBIDRAFT_03g033070          197   4e-55   
ref|XP_003572967.1|  PREDICTED: strictosidine synthase 1-like           196   4e-55   
gb|KHG24912.1|  Adipocyte plasma membrane-associated                    197   5e-55   
ref|XP_008777477.1|  PREDICTED: strictosidine synthase 1-like           197   5e-55   
ref|XP_006440860.1|  hypothetical protein CICLE_v10023327mg             196   5e-55   
ref|XP_010091689.1|  Strictosidine synthase                             196   5e-55   
ref|XP_009803216.1|  PREDICTED: strictosidine synthase 1-like           197   5e-55   
ref|XP_004974473.1|  PREDICTED: strictosidine synthase 1-like           196   5e-55   
ref|XP_004974464.1|  PREDICTED: strictosidine synthase 1-like           196   6e-55   
ref|XP_011027271.1|  PREDICTED: strictosidine synthase 3-like iso...    197   7e-55   
ref|XP_008655507.1|  PREDICTED: strictosidine synthase 3-like           196   8e-55   
emb|CDY47728.1|  BnaA02g16670D                                          195   8e-55   
ref|XP_002467870.1|  hypothetical protein SORBIDRAFT_01g035660          196   9e-55   
ref|XP_007037730.1|  Calcium-dependent phosphotriesterase superfa...    195   9e-55   
ref|XP_002532594.1|  strictosidine synthase, putative                   196   9e-55   
ref|XP_003617474.1|  Strictosidine synthase                             195   1e-54   
ref|XP_009128019.1|  PREDICTED: strictosidine synthase 1-like           195   1e-54   
gb|AES81258.2|  strictosidine synthase family protein                   196   1e-54   
ref|XP_002878128.1|  strictosidine synthase family protein              196   1e-54   
tpg|DAA61232.1|  TPA: strictosidine synthase 3                          195   1e-54   
ref|XP_010647214.1|  PREDICTED: strictosidine synthase 1                196   1e-54   
ref|XP_004967164.1|  PREDICTED: strictosidine synthase 1-like           195   1e-54   
gb|EAZ01723.1|  hypothetical protein OsI_23749                          195   1e-54   
ref|XP_004955245.1|  PREDICTED: strictosidine synthase 1-like           195   1e-54   
gb|EAZ01722.1|  hypothetical protein OsI_23748                          195   1e-54   
gb|KDO65594.1|  hypothetical protein CISIN_1g048181mg                   194   2e-54   
ref|XP_011090280.1|  PREDICTED: protein STRICTOSIDINE SYNTHASE-LI...    198   2e-54   
gb|EMT05184.1|  Strictosidine synthase 1                                195   2e-54   
ref|XP_006485738.1|  PREDICTED: strictosidine synthase 1-like           194   2e-54   
ref|XP_004971567.1|  PREDICTED: strictosidine synthase 1-like           195   2e-54   
ref|XP_004967142.1|  PREDICTED: strictosidine synthase 1-like           194   2e-54   
ref|XP_004506244.1|  PREDICTED: adipocyte plasma membrane-associa...    196   2e-54   
gb|KDP37825.1|  hypothetical protein JCGZ_06727                         195   2e-54   
ref|XP_008657056.1|  PREDICTED: strictosidine synthase 3-like           194   2e-54   
ref|XP_002456643.1|  hypothetical protein SORBIDRAFT_03g040000          194   2e-54   
ref|XP_010685469.1|  PREDICTED: strictosidine synthase 3-like           196   2e-54   
ref|XP_004955242.1|  PREDICTED: strictosidine synthase 1-like           194   2e-54   
ref|XP_004136643.1|  PREDICTED: strictosidine synthase 1-like           195   3e-54   
ref|XP_008657057.1|  PREDICTED: LOW QUALITY PROTEIN: strictosidin...    194   3e-54   
ref|XP_004307668.1|  PREDICTED: strictosidine synthase 1-like iso...    196   3e-54   
ref|XP_009614698.1|  PREDICTED: strictosidine synthase 1-like           195   3e-54   
ref|XP_006348986.1|  PREDICTED: strictosidine synthase 1-like           195   3e-54   
dbj|BAD35674.1|  putative strictosidine synthase                        194   4e-54   
ref|XP_006340314.1|  PREDICTED: adipocyte plasma membrane-associa...    195   4e-54   
ref|XP_008657058.1|  PREDICTED: strictosidine synthase 3-like           194   5e-54   
ref|NP_001150769.1|  strictosidine synthase 3 precursor                 194   5e-54   
ref|XP_004986993.1|  PREDICTED: strictosidine synthase 3-like           194   5e-54   
gb|EAZ41691.1|  hypothetical protein OsJ_26224                          194   5e-54   
gb|AFW84563.1|  hypothetical protein ZEAMMB73_589231                    194   6e-54   
dbj|BAD05221.1|  putative male fertility protein                        194   6e-54   
ref|XP_008657012.1|  PREDICTED: strictosidine synthase 3-like           193   6e-54   
ref|XP_006291321.1|  hypothetical protein CARUB_v10017454mg             194   7e-54   
emb|CDX72079.1|  BnaC08g27950D                                          193   7e-54   
ref|XP_003576963.1|  PREDICTED: strictosidine synthase 3-like           193   7e-54   
gb|EAZ37681.1|  hypothetical protein OsJ_22019                          192   8e-54   
ref|XP_004164012.1|  PREDICTED: strictosidine synthase 1-like           194   8e-54   
ref|XP_008443273.1|  PREDICTED: strictosidine synthase 1                194   8e-54   
ref|XP_003524502.1|  PREDICTED: strictosidine synthase 1-like           193   9e-54   
ref|XP_004986991.1|  PREDICTED: strictosidine synthase 3-like           193   9e-54   
gb|KHN15177.1|  Strictosidine synthase 1                                192   1e-53   
ref|XP_004251214.1|  PREDICTED: strictosidine synthase 3                194   1e-53   
ref|NP_001234466.1|  uncharacterized protein LOC543656 precursor        193   1e-53   
gb|ABZ79473.1|  strictosidine synthase                                  193   1e-53   
ref|XP_002972283.1|  hypothetical protein SELMODRAFT_231921             194   1e-53   
emb|CDP06823.1|  unnamed protein product                                192   1e-53   
ref|XP_010230125.1|  PREDICTED: strictosidine synthase 1-like           192   1e-53   
ref|XP_006662726.1|  PREDICTED: strictosidine synthase 3-like           193   1e-53   
ref|XP_008657061.1|  PREDICTED: strictosidine synthase 3-like           192   2e-53   
emb|CDP09528.1|  unnamed protein product                                194   2e-53   
ref|XP_004986966.1|  PREDICTED: strictosidine synthase 3-like           192   2e-53   
ref|XP_004984421.1|  PREDICTED: strictosidine synthase-like             192   2e-53   
ref|XP_004967140.1|  PREDICTED: strictosidine synthase 1-like           192   2e-53   
ref|XP_010108508.1|  Adipocyte plasma membrane-associated protein       196   2e-53   
ref|XP_003576476.1|  PREDICTED: strictosidine synthase 3-like           192   2e-53   
ref|XP_003564761.1|  PREDICTED: strictosidine synthase 3-like           192   2e-53   
ref|XP_006847661.1|  hypothetical protein AMTR_s00149p00021810          192   2e-53   
dbj|BAD35673.1|  putative strictosidine synthase precursor              192   2e-53   
ref|XP_008657062.1|  PREDICTED: strictosidine synthase 3-like           192   2e-53   
ref|NP_001063030.1|  Os09g0373200                                       192   3e-53   
ref|NP_177541.1|  strictosidine synthase-like protein                   191   3e-53   
ref|XP_002888957.1|  strictosidine synthase family protein              191   3e-53   
ref|XP_004955258.1|  PREDICTED: strictosidine synthase 1-like           192   3e-53   
gb|ACF21007.1|  strictosidine synthase                                  191   4e-53   
ref|XP_002460150.1|  hypothetical protein SORBIDRAFT_02g023460          191   5e-53   
ref|NP_001150945.1|  strictosidine synthase 1 precursor                 191   6e-53   
ref|XP_010686168.1|  PREDICTED: strictosidine synthase 3-like           190   7e-53   
ref|XP_010090518.1|  Adipocyte plasma membrane-associated protein       192   8e-53   
ref|XP_008657055.1|  PREDICTED: strictosidine synthase 3-like           191   8e-53   
gb|EEC84476.1|  hypothetical protein OsI_31134                          191   9e-53   
ref|XP_007146688.1|  hypothetical protein PHAVU_006G061000g             190   9e-53   
ref|XP_006651825.1|  PREDICTED: adipocyte plasma membrane-associa...    189   1e-52   
ref|XP_009116408.1|  PREDICTED: strictosidine synthase 1                191   1e-52   
ref|XP_010427563.1|  PREDICTED: strictosidine synthase 1-like           191   1e-52   
ref|XP_003549591.1|  PREDICTED: strictosidine synthase 1-like           189   1e-52   
emb|CDX73039.1|  BnaC06g34870D                                          189   1e-52   
gb|ADK91432.1|  strictosidine synthase                                  190   1e-52   
gb|KHN18404.1|  Strictosidine synthase 1                                189   2e-52   
gb|EMT31336.1|  Strictosidine synthase 1                                190   2e-52   
ref|XP_010507098.1|  PREDICTED: uncharacterized protein LOC104783669    196   2e-52   
ref|XP_004974462.1|  PREDICTED: strictosidine synthase 1-like           189   2e-52   
emb|CDM84363.1|  unnamed protein product                                189   2e-52   
ref|XP_002984195.1|  hypothetical protein SELMODRAFT_156492             191   2e-52   
ref|NP_001059909.2|  Os07g0543600                                       189   2e-52   
ref|XP_002321516.2|  hypothetical protein POPTR_0015s04660g             189   2e-52   
gb|AFW84434.1|  strictosidine synthase 1                                189   2e-52   
ref|XP_004974394.1|  PREDICTED: strictosidine synthase 3-like           189   3e-52   
dbj|BAC83776.1|  putative strictosidine synthase                        189   4e-52   
ref|XP_010504622.1|  PREDICTED: strictosidine synthase 1-like           189   4e-52   
ref|XP_008652645.1|  PREDICTED: strictosidine synthase 3-like           190   5e-52   
ref|XP_007162124.1|  hypothetical protein PHAVU_001G125900g             189   5e-52   
gb|EAZ04232.1|  hypothetical protein OsI_26376                          188   6e-52   
dbj|BAC83125.1|  putative male fertility protein                        188   6e-52   
gb|ACU19372.1|  unknown                                                 187   8e-52   
ref|XP_006436707.1|  hypothetical protein CICLE_v10033463mg             186   8e-52   
ref|XP_003521146.1|  PREDICTED: strictosidine synthase 1-like           189   8e-52   
gb|EAZ40180.1|  hypothetical protein OsJ_24625                          188   9e-52   
emb|CDP12401.1|  unnamed protein product                                187   1e-51   
gb|KDO48948.1|  hypothetical protein CISIN_1g015463mg                   189   1e-51   
ref|XP_010516308.1|  PREDICTED: strictosidine synthase 1-like           188   1e-51   
ref|XP_003595643.1|  Strictosidine synthase-like protein                187   1e-51   
dbj|BAB47180.1|  strictosidine synthase                                 187   2e-51   
ref|XP_009106059.1|  PREDICTED: strictosidine synthase 1-like           186   2e-51   
gb|EMT33531.1|  Strictosidine synthase 1                                186   2e-51   
ref|XP_002966382.1|  hypothetical protein SELMODRAFT_230896             187   3e-51   
ref|XP_006663808.1|  PREDICTED: strictosidine synthase 3-like           187   3e-51   
gb|EMT00978.1|  Strictosidine synthase 1                                186   4e-51   
ref|XP_004986926.1|  PREDICTED: strictosidine synthase-like             186   4e-51   
emb|CDM83814.1|  unnamed protein product                                186   4e-51   
ref|XP_010525477.1|  PREDICTED: strictosidine synthase 1-like           186   6e-51   
ref|XP_002888958.1|  hypothetical protein ARALYDRAFT_476542             185   6e-51   
ref|XP_003528253.1|  PREDICTED: strictosidine synthase 3-like iso...    185   6e-51   
gb|ABA95779.2|  Strictosidine synthase family protein, expressed        187   7e-51   
dbj|BAK04872.1|  predicted protein                                      186   7e-51   
ref|XP_010529101.1|  PREDICTED: strictosidine synthase 3-like           186   9e-51   
ref|NP_177542.1|  strictosidine synthase 2                              185   9e-51   
gb|KDP31453.1|  hypothetical protein JCGZ_11829                         184   1e-50   
ref|XP_001783026.1|  predicted protein                                  186   1e-50   
gb|KFK41840.1|  hypothetical protein AALP_AA2G178200                    184   2e-50   
ref|XP_002438640.1|  hypothetical protein SORBIDRAFT_10g023490          184   2e-50   
gb|AAF22901.1|AC006932_18  T27G7.16                                     186   2e-50   
gb|AAB40593.1|  strictosidine synthase                                  184   3e-50   
ref|XP_002978184.1|  hypothetical protein SELMODRAFT_108020             185   3e-50   
gb|EMT04951.1|  Strictosidine synthase 1                                193   3e-50   
gb|EMT14932.1|  Strictosidine synthase 3                                184   3e-50   
emb|CDM84367.1|  unnamed protein product                                188   3e-50   
ref|XP_006411395.1|  hypothetical protein EUTSA_v10016720mg             185   4e-50   
ref|XP_002443591.1|  hypothetical protein SORBIDRAFT_08g022130          183   4e-50   
gb|EMT18390.1|  Strictosidine synthase 1                                183   5e-50   
ref|XP_004956696.1|  PREDICTED: strictosidine synthase 3-like           184   5e-50   
ref|XP_003595639.1|  Strictosidine synthase-like protein                182   5e-50   
ref|XP_004956695.1|  PREDICTED: strictosidine synthase 3-like           183   5e-50   
gb|KHN36514.1|  Adipocyte plasma membrane-associated protein            182   6e-50   
gb|KHG12177.1|  Adipocyte plasma membrane-associated                    184   7e-50   
ref|XP_010427557.1|  PREDICTED: strictosidine synthase 3-like           183   9e-50   
dbj|BAK06958.1|  predicted protein                                      182   1e-49   
gb|KFK34933.1|  hypothetical protein AALP_AA5G213000                    183   1e-49   
ref|XP_010428361.1|  PREDICTED: strictosidine synthase 1-like           181   1e-49   
gb|AFW84562.1|  hypothetical protein ZEAMMB73_589231                    186   2e-49   
emb|CDM86638.1|  unnamed protein product                                181   2e-49   
gb|KDO41714.1|  hypothetical protein CISIN_1g046018mg                   180   2e-49   
ref|XP_006411394.1|  hypothetical protein EUTSA_v10016811mg             182   3e-49   
ref|XP_009128020.1|  PREDICTED: strictosidine synthase 1 isoform X1     181   3e-49   
emb|CDY06143.1|  BnaA09g36370D                                          182   3e-49   
emb|CDP17488.1|  unnamed protein product                                180   3e-49   
ref|XP_010416234.1|  PREDICTED: strictosidine synthase 1                181   3e-49   
emb|CDY45861.1|  BnaC02g22590D                                          180   4e-49   
ref|XP_006390479.1|  hypothetical protein EUTSA_v10018851mg             180   4e-49   
gb|ABA95780.1|  Strictosidine synthase family protein, expressed        181   4e-49   
ref|XP_006582039.1|  PREDICTED: strictosidine synthase 3-like iso...    181   4e-49   
ref|XP_006376714.1|  hypothetical protein POPTR_0012s04360g             179   5e-49   
gb|KFK36980.1|  hypothetical protein AALP_AA4G196900                    181   5e-49   
ref|XP_006301702.1|  hypothetical protein CARUB_v10022158mg             185   5e-49   
emb|CDY30963.1|  BnaC04g24610D                                          181   7e-49   
gb|KCW64824.1|  hypothetical protein EUGRSUZ_G02396                     181   7e-49   
gb|EAY82206.1|  hypothetical protein OsI_37409                          181   8e-49   
ref|XP_010554776.1|  PREDICTED: LOW QUALITY PROTEIN: strictosidin...    181   8e-49   
gb|KHG24230.1|  Strictosidine synthase 3 -like protein                  179   8e-49   
emb|CDY47729.1|  BnaA02g16660D                                          179   8e-49   
gb|AFW84565.1|  hypothetical protein ZEAMMB73_075997                    179   8e-49   
ref|XP_004977501.1|  PREDICTED: strictosidine synthase 1-like           180   9e-49   
ref|XP_010416233.1|  PREDICTED: strictosidine synthase 3                179   9e-49   
gb|ABA91449.1|  Strictosidine synthase family protein                   180   1e-48   
emb|CDY22515.1|  BnaC03g23250D                                          180   1e-48   
ref|XP_011035620.1|  PREDICTED: strictosidine synthase 3-like           178   1e-48   
ref|XP_010504616.1|  PREDICTED: strictosidine synthase 3-like           180   1e-48   
ref|XP_006660586.1|  PREDICTED: strictosidine synthase 3-like           180   1e-48   
ref|XP_001762553.1|  predicted protein                                  181   1e-48   
ref|XP_006390477.1|  hypothetical protein EUTSA_v10018854mg             179   1e-48   
ref|XP_010428364.1|  PREDICTED: strictosidine synthase 1-like           179   1e-48   
ref|XP_006649792.1|  PREDICTED: adipocyte plasma membrane-associa...    181   2e-48   
ref|XP_007224116.1|  hypothetical protein PRUPE_ppa015698mg             177   2e-48   
ref|XP_004978641.1|  PREDICTED: strictosidine synthase 3-like iso...    179   2e-48   
emb|CDY35420.1|  BnaA03g19400D                                          179   3e-48   
ref|XP_010471492.1|  PREDICTED: strictosidine synthase 1-like           178   3e-48   
ref|XP_010428362.1|  PREDICTED: strictosidine synthase 1-like           178   3e-48   
gb|KFK34932.1|  hypothetical protein AALP_AA5G212900                    179   3e-48   
emb|CDX76033.1|  BnaA04g02970D                                          179   4e-48   
ref|XP_006301859.1|  hypothetical protein CARUB_v10022329mg             177   4e-48   
ref|XP_004984702.1|  PREDICTED: strictosidine synthase-like             179   5e-48   
emb|CDY30962.1|  BnaC04g24620D                                          179   5e-48   
emb|CBX25285.1|  hypothetical_protein                                   181   5e-48   
ref|XP_006644568.1|  PREDICTED: strictosidine synthase 1-like           177   5e-48   
ref|XP_003576475.1|  PREDICTED: strictosidine synthase 3-like           178   5e-48   
emb|CDY45863.1|  BnaC02g22570D                                          177   5e-48   
ref|XP_009128022.1|  PREDICTED: strictosidine synthase 1 isoform X2     177   5e-48   
ref|XP_002443589.1|  hypothetical protein SORBIDRAFT_08g022110          177   5e-48   
ref|XP_009133478.1|  PREDICTED: strictosidine synthase 3                178   6e-48   
gb|EMT11668.1|  Strictosidine synthase 1                                177   6e-48   
ref|NP_001063033.1|  Os09g0374900                                       178   7e-48   
ref|XP_010230123.1|  PREDICTED: strictosidine synthase 1-like           177   7e-48   
gb|EAY79903.1|  hypothetical protein OsI_35066                          178   8e-48   
ref|XP_006291314.1|  hypothetical protein CARUB_v10017448mg             178   8e-48   
gb|EAZ05772.1|  hypothetical protein OsI_28006                          177   9e-48   
ref|XP_004979009.1|  PREDICTED: strictosidine synthase 3-like           178   9e-48   
gb|EMT28721.1|  Strictosidine synthase 3                                176   1e-47   
emb|CDX76030.1|  BnaA04g02940D                                          177   1e-47   
gb|EEC84480.1|  hypothetical protein OsI_31139                          177   1e-47   



>ref|XP_004236090.1| PREDICTED: strictosidine synthase 3-like [Solanum lycopersicum]
Length=332

 Score =   286 bits (733),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 149/298 (50%), Positives = 203/298 (68%), Gaps = 14/298 (5%)
 Frame = +3

Query  165   HAIGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQ  338
               IGPE  AF+ KG GPYTG+ADGRI+KY   +  F DFA TSP RTK  CDG N   LQ
Sbjct  41    QTIGPEASAFDRKGGGPYTGIADGRIVKYQGPRVGFTDFAVTSPNRTKAKCDGKNGPELQ  100

Query  339   LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
              ICGRP GL F+ RTGDLYI D  +GL+ VGP GGL T++  G  G  F+F +A+ +D+S
Sbjct  101   QICGRPFGLGFYYRTGDLYITDAFYGLVVVGPSGGLVTRVP-GFQGRNFAFLDALDIDQS  159

Query  519   --TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
                VYFVDSG IFLTGN T+I +SGDTSGRL KY++ T +VT++L GLSGP G+A+SKD 
Sbjct  160   KGVVYFVDSGAIFLTGNRTRIVESGDTSGRLFKYDIATKQVTLILSGLSGPVGVALSKDN  219

Query  693   TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpq  872
             +++L++E+IA++I ++ +KG KAN++     ++G PDN+KR   G +WVA++  K     
Sbjct  220   SYVLVTEYIAQRIRRFWLKGAKANSSDVFANVDGIPDNIKRTVLGDFWVAISNTKQ----  275

Query  873   qLIPMTESIAVKFDRNGKILDRKNVTSAY--PNSFSAYLEHFGKAYTGSLVPNFLGVY  1040
                P T S+  + ++ GK+++  N T+ Y  PN  +   E+ GK Y GSL  NF+GV+
Sbjct  276   ---PTTFSLGQRINQFGKVVETCNFTAQYNSPNGITEVQEYKGKLYVGSLDQNFIGVF  330



>ref|XP_004252261.1| PREDICTED: strictosidine synthase 3-like [Solanum lycopersicum]
Length=333

 Score =   285 bits (728),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 149/295 (51%), Positives = 201/295 (68%), Gaps = 8/295 (3%)
 Frame = +3

Query  171   IGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQLI  344
             +GPE +AF+  G GPYT VADGR+LKY   +  FIDFATTSPLRTK +C+G N+  L + 
Sbjct  40    VGPEAIAFDLLGNGPYTSVADGRVLKYQGPRIGFIDFATTSPLRTKEVCNGKNDPNLLIT  99

Query  345   CGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDE--S  518
             CGRPLGL F+ R+GDLYIAD+N+GLL VG  GG A QL  G++G  F+FTNAV +D+   
Sbjct  100   CGRPLGLGFYYRSGDLYIADINYGLLVVGRNGGPARQLVTGIDGKPFAFTNAVDIDQLNG  159

Query  519   TVYFVDSGLIF-LTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
              VYF DSG +F  T N T I +S DT+GRL KY++ T +VT++L GL+GP G+A+S D +
Sbjct  160   VVYFTDSGPLFRATRNITLILESKDTTGRLFKYDIRTNKVTLLLSGLAGPVGVAVSLDGS  219

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             ++L++E IA +I ++ ++G +ANT+Q    L G PDN+KR   G YWVAVNI+     Q 
Sbjct  220   YVLVTELIANRIKRFWVRGTRANTSQEFTNLNGYPDNIKRTILGDYWVAVNIVN---NQS  276

Query  876   LIPMTESIAVKFDRNGKILDRKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGVY  1040
             + P   S A K +  G +    N+++ Y NS S   E FG+ Y GSL  +F+GVY
Sbjct  277   MTPPKFSFAQKINVLGNVFVSLNLSTQYRNSISEVQEKFGRLYIGSLEEDFVGVY  331



>ref|XP_006345201.1| PREDICTED: strictosidine synthase 3-like [Solanum tuberosum]
Length=332

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/298 (49%), Positives = 200/298 (67%), Gaps = 14/298 (5%)
 Frame = +3

Query  165   HAIGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQ  338
               IGPE  AF+ KG GPYTG+ADGRI+KY   +  F DFA TSP RTK  CDG N   LQ
Sbjct  41    QTIGPEASAFDRKGGGPYTGIADGRIVKYQGPRVGFTDFAVTSPNRTKAKCDGKNGPELQ  100

Query  339   LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
              ICGRP GL F+ +TGDLYI D  +GL+ VGP GGL T++ +   G  F+F +A+ +D+ 
Sbjct  101   QICGRPFGLGFYYKTGDLYITDAFYGLVVVGPSGGLVTRVPS-FQGRNFAFLDALDIDQR  159

Query  519   T--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
             T  VYFVDSG IFLTGN T+I +SGD SGRL KY++ T +VT++L GLSGP G+A+SKD 
Sbjct  160   TGVVYFVDSGAIFLTGNTTRIVESGDISGRLFKYDIATKQVTLLLSGLSGPIGVALSKDN  219

Query  693   TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpq  872
             +++LI+E IA++I ++ +KG KAN++     ++G PDN+KR   G +WVA++  K     
Sbjct  220   SYVLITESIAQRIRRFWLKGAKANSSDVFANVDGIPDNIKRTVLGDFWVAISNTKQR---  276

Query  873   qLIPMTESIAVKFDRNGKILDRKNVTSAY--PNSFSAYLEHFGKAYTGSLVPNFLGVY  1040
                  T S+  + +R GK+++  N T+ Y  PN  +   E+ GK Y GSL  NF+GV+
Sbjct  277   ----TTFSLGQRINRFGKVVETCNFTAQYKSPNGITEVQEYKGKLYVGSLDQNFIGVF  330



>ref|XP_004236089.1| PREDICTED: strictosidine synthase 1-like [Solanum lycopersicum]
Length=336

 Score =   274 bits (700),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 157/330 (48%), Positives = 215/330 (65%), Gaps = 14/330 (4%)
 Frame = +3

Query  72    MFWI-SILIFI-SSPCVIHSQppgillpiklklHAIGPEDVAFNGKGEGPYTGVADGRIL  245
             MF I  ILIF+ +SP ++H         ++L L A GP+  AF+ KG GPYTGV DGR++
Sbjct  10    MFLILQILIFLNASPYLVHC----AFSRLQLPLQAFGPDSSAFDTKGVGPYTGVGDGRVM  65

Query  246   KYY--NGKFIDFATTSPLRTKVICDGTNNTILQLICGRPLGLEFHPRTGDLYIADVNFGL  419
             KY   N  F +FA TSP RTK IC+GTN+ I Q+ CGRP GL F+ +TGDLYI D  +GL
Sbjct  66    KYQGPNVGFTEFAITSPNRTKQICNGTNDPISQISCGRPYGLGFYNKTGDLYITDAYYGL  125

Query  420   LKVGPKGGLATQLAAGVNGIKFSFTNAVALD--ESTVYFVDSGLIFLTGNFTKIAQSGDT  593
             L V P GGLAT L     G  FSF +++ +D  E  +YF+DSG IF TGN   IA SGDT
Sbjct  126   LVVKPSGGLATPLVTSFEGTPFSFLDSLDIDQEEGVIYFIDSGAIFRTGNRVLIALSGDT  185

Query  594   SGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFLLISEFIAKKITKYIIKGPKANTTQ  773
             +GRL KY++ T +VT++L  LSGPAG+A+SKDK+FLL+SE I K+I ++ +KG KAN++ 
Sbjct  186   TGRLFKYDIATKQVTLLLNKLSGPAGIALSKDKSFLLVSEAIGKRIRRFWLKGAKANSSD  245

Query  774   TLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqLIPMTESIAVKFDRNGKILDRKNVTS  953
                 ++G PDN+KR  SG +WVAV  +       +IP   S   + +++GK+++ ++ T+
Sbjct  246   VFANIDGNPDNIKRTVSGDFWVAV--VTVKTKVLIIPTIISTGQRINQSGKLVETRDFTA  303

Query  954   AYP--NSFSAYLEHFGKAYTGSLVPNFLGV  1037
              Y   N  +   E+  K Y GSL  NF+GV
Sbjct  304   QYMSFNGITEVQEYNDKLYIGSLDQNFIGV  333



>ref|XP_010319099.1| PREDICTED: strictosidine synthase 1-like [Solanum lycopersicum]
Length=336

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 139/294 (47%), Positives = 193/294 (66%), Gaps = 8/294 (3%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYY--NGKFIDFATTSPLRTKVICDGTNNTILQLIC  347
             GP+  AF+ KG+GPYTGV DGR+ KY   N  F +FA TSP RTK IC+GTN+ I Q+ C
Sbjct  42    GPDSAAFDTKGDGPYTGVGDGRVFKYQGPNTGFTEFAITSPNRTKQICNGTNDPISQISC  101

Query  348   GRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--  521
             GRP GL F+ +TGDLYI D  +GLL V P GGLAT L     G  F F +++ +D+    
Sbjct  102   GRPYGLGFYSKTGDLYITDAYYGLLVVKPSGGLATPLVTSFEGRPFGFLDSLDIDQEMGI  161

Query  522   VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFL  701
             +YFVD+G IF T N   IA SGDT+GRL KY++ T +VT++L  LSGPAG+A+SKDK++L
Sbjct  162   IYFVDAGAIFRTSNRFLIALSGDTTGRLFKYDIATKQVTLLLSKLSGPAGVALSKDKSYL  221

Query  702   LISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqLI  881
             L+SE I K+IT++ ++G KAN++     ++G PDN+KR  SG +WVAV  +       +I
Sbjct  222   LVSEAIGKRITRFWLEGTKANSSDVFTNIDGNPDNIKRTVSGDFWVAV--VSVRIKLLII  279

Query  882   PMTESIAVKFDRNGKILDRKNVTSAY--PNSFSAYLEHFGKAYTGSLVPNFLGV  1037
             P   S   + ++ G++++ ++ T+ Y   N  +   E   K Y GSL  NF+GV
Sbjct  280   PTLNSTGQRINQLGEVVETRDFTAQYTSANGITEVQECNDKLYIGSLDQNFIGV  333



>ref|XP_006345203.1| PREDICTED: strictosidine synthase 1-like [Solanum tuberosum]
Length=337

 Score =   263 bits (673),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 136/294 (46%), Positives = 191/294 (65%), Gaps = 8/294 (3%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYY--NGKFIDFATTSPLRTKVICDGTNNTILQLIC  347
             GP+  AF+ KG+GPY  V DGR++KY   N  F +FA TSP RTK  CDGTN+ I Q +C
Sbjct  43    GPDSAAFDPKGDGPYACVGDGRVIKYKDPNVGFTEFAITSPNRTKKRCDGTNDPISQPVC  102

Query  348   GRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--  521
             GRP GL F+ +TGDLYI D  +GL+   P GGL T++A    G  F+F +++ +D+    
Sbjct  103   GRPYGLGFYDKTGDLYITDAYYGLVMAKPSGGLVTRVATSFEGTPFAFLDSLDIDQEMGI  162

Query  522   VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFL  701
             +YFVDSG IF TGN   IA SGDT+GRL KY++ T +VT++L  LSGPAG+A+SKDK++L
Sbjct  163   IYFVDSGAIFRTGNRLLIALSGDTTGRLFKYDIATKQVTLLLNKLSGPAGIALSKDKSYL  222

Query  702   LISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqLI  881
             L+SE IAKK  ++ + G  AN++     ++G PDN+KR  SG +WVAV  +K      ++
Sbjct  223   LVSETIAKKNRRFWLTGANANSSDVFANIDGNPDNIKRTESGDFWVAVVSIK--LKYLIV  280

Query  882   PMTESIAVKFDRNGKILDRKNVTSAYP--NSFSAYLEHFGKAYTGSLVPNFLGV  1037
             P   S   + +  G++++ ++ T+ Y   N  +   EH GK Y GSL   F+GV
Sbjct  281   PAIISTGQRMNEKGEVVETRDFTAQYKGINGITEVQEHKGKLYVGSLDQKFIGV  334



>ref|XP_011071027.1| PREDICTED: protein STRICTOSIDINE SYNTHASE-LIKE 12-like [Sesamum 
indicum]
Length=335

 Score =   256 bits (653),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 139/299 (46%), Positives = 198/299 (66%), Gaps = 12/299 (4%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNT--IL  335
             A+G E  AF+    GPYTG+ DGRI+KY   +  F++FATTS  R+K  CDGT+ T  I+
Sbjct  31    AVGSESYAFDSHNVGPYTGLNDGRIVKYQGPETGFVEFATTSANRSKEFCDGTDGTDPIV  90

Query  336   QLICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDE  515
              LICGR +G+EF+ +TG+LY+ D N+GL+ VG +GGLATQLA G +  +F   +++A+D 
Sbjct  91    TLICGRAIGMEFNHKTGELYLVDANYGLMVVGSRGGLATQLAGGGDAERFDQVDSLAIDP  150

Query  516   ST--VYFVDSGLIFL-TGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISK  686
             +T  VY  D G IF  T N T+I  SGDTSGRLLKY+ +T  +TV+LRGL+   G+A+S+
Sbjct  151   TTGAVYIGDIGTIFQKTKNMTEILLSGDTSGRLLKYDPKTKGLTVLLRGLAMANGVAVSE  210

Query  687   DKTFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppq  866
             D +F+L+SE+I  +IT+Y +KGPKANT++  ++L G PDN++R  SG +WV VNI K   
Sbjct  211   DGSFVLVSEYITCRITRYWLKGPKANTSEIFVELPGNPDNIQRTESGDFWVVVNIQKLYP  270

Query  867   pqqLIPMTESIAVKFDRNGKILDRKNVTSAYPNSF-SAYLEHFGKAYTGSLVPNFLGVY  1040
                     + I+     NG+IL+  N  + Y  ++ +   EH G  Y  S+  NF+GVY
Sbjct  271   KLTCFAFGQRISA----NGRILETLNFFAEYNTTYITEVHEHLGSLYLASVDTNFVGVY  325



>ref|XP_002274134.3| PREDICTED: strictosidine synthase 3-like [Vitis vinifera]
Length=329

 Score =   249 bits (635),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 139/332 (42%), Positives = 204/332 (61%), Gaps = 14/332 (4%)
 Frame = +3

Query  72    MFWISILIFISSPCVIHSQppgillpiklklHAIGPEDVAFNGKGEGPYTGVADGRILKY  251
             M  I +L+F S P  + +        ++L  +  GPE +AF+  G GPYTGV+DGR+LKY
Sbjct  1     MISIFLLLFFSVPHTVLT--LSFFTQLQLPPNVTGPEALAFDRLGGGPYTGVSDGRVLKY  58

Query  252   --YNGKFIDFATTSPLRTKVICDGTNNTILQLICGRPLGLEFHPRTGDLYIADVNFGLLK  425
                +  F DFA T+P R+K +CDGT +      CGRPLG+ F+  TG LYIAD   GLL 
Sbjct  59    GGPSAGFTDFAYTTPTRSKAVCDGTTDPNSGPTCGRPLGVGFNNLTGQLYIADAYSGLLV  118

Query  426   VGPKGGLATQLAAGVNGIKFSFTNAVALDEST--VYFVDSGLIFLTGNFTKIAQSGDTSG  599
             VG  GGLAT +A    G+ F F N + +D+ T  VYF D+  ++   + T+  ++ D SG
Sbjct  119   VGSNGGLATPVATTAEGVPFRFLNGLDVDQLTGNVYFTDASSVYELRDITQGVENNDASG  178

Query  600   RLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFLLISEFIAKKITKYIIKGPKANTTQTL  779
             RLLKY+  T +VTV++RGLSGPAG A+S+D +F+L+SEFIA +  K+ ++GPKANT++  
Sbjct  179   RLLKYDPSTKQVTVLIRGLSGPAGAAVSRDGSFVLVSEFIANRTQKFWLRGPKANTSELF  238

Query  780   LKLEGQPDNVKRATSGGYWVAVNILKppqpqqLIPMTESIAVKFDRNGKILDRKNVTSAY  959
                +G+PDN+K + +  +WVAVNI K       +P T     + D +G +L   N  + Y
Sbjct  239   FTFQGRPDNIKTSITDTFWVAVNIGKS------VPTTVPTGQRMDAHGNVLQTVNFEAEY  292

Query  960   PNSFSAYLEHFGKA--YTGSLVPNFLGVYTLK  1049
              ++  + ++  G+   Y GS   +++GVYTLK
Sbjct  293   GSTMISEVQGRGEIFLYVGSRDASYVGVYTLK  324



>ref|XP_010663511.1| PREDICTED: strictosidine synthase 1-like [Vitis vinifera]
Length=330

 Score =   249 bits (635),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 134/301 (45%), Positives = 183/301 (61%), Gaps = 19/301 (6%)
 Frame = +3

Query  171   IGPEDVAFNGKGEGPYTGVADGRILKYY--NGKFIDFATTSPLRTKVICDGTNNTILQLI  344
             IGPE +AF+  G GPY  VADGR+LK+   +  F+DF   SP R+K +CDG+++   +  
Sbjct  40    IGPEALAFDCSGAGPYASVADGRVLKWQAESAGFVDFTVASPSRSKQLCDGSSDPAKEPT  99

Query  345   CGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST-  521
             CGRPLG+ F+ +TGDLYIAD  +GL  VGP GG ATQLA    G+ F F NAV +D+ T 
Sbjct  100   CGRPLGIGFNNKTGDLYIADAYYGLFVVGPDGGRATQLATEAEGVPFRFLNAVDVDQETG  159

Query  522   -VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF D+   F    F     +GD +GRL+KY+  T +VTV+LRGL    G+AI+KD +F
Sbjct  160   IVYFTDASARFQRREFQNAVLAGDMTGRLMKYDPRTKQVTVLLRGLGLAVGVAINKDGSF  219

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
             +L+SEFIA +I +Y ++GPKANT++  LK  G PDN+KR   G +WVA NI         
Sbjct  220   VLVSEFIATRIQRYWLRGPKANTSELFLKPTGTPDNIKRNARGEFWVAANI------GAE  273

Query  879   IPMTESIAVKFDRNGKIL-----DRKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGVYT  1043
             +     + ++    GKIL     D  ++T     + S   E+ G  Y GSL   F+GV+T
Sbjct  274   MAAAAPLGLRVSEEGKILQVVAFDTGDIT----RTISEVHEYNGALYVGSLALPFVGVFT  329

Query  1044  L  1046
              
Sbjct  330   F  330



>ref|XP_010099019.1| Strictosidine synthase 1 [Morus notabilis]
 gb|EXB76377.1| Strictosidine synthase 1 [Morus notabilis]
Length=325

 Score =   244 bits (624),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 133/329 (40%), Positives = 197/329 (60%), Gaps = 12/329 (4%)
 Frame = +3

Query  72    MFWISILIFISSP--CVIHSQppgillpiklklHAIGPEDVAFNGKGEGPYTGVADGRIL  245
             MF+I +LI +S P  C++ SQ       + L   ++GPE + F+  G GPYTG++DGRI+
Sbjct  1     MFFI-LLILLSVPSNCIVLSQKISTFRKLYLPTTSVGPESITFDSLGRGPYTGISDGRIV  59

Query  246   KY--YNGKFIDFATTSPLRTKVICDGTNNTILQLICGRPLGLEFHPRTGDLYIADVNFGL  419
             +Y  +   F+DFA TS  R+K +CDGTN+  L+ ICGRPLG+EF  R   L+IAD   GL
Sbjct  60    RYDEHTTGFVDFAYTSRNRSKALCDGTNDPALRPICGRPLGIEFFHRKNMLFIADAFLGL  119

Query  420   LKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--VYFVDSGLIFLTGNFTKIAQSGDT  593
               VGP GGLAT LA    G  F F N +++D+ T  VYF D    FL         + D+
Sbjct  120   FVVGPNGGLATGLATAAEGTPFRFLNGLSVDQHTGDVYFTDFSSKFLQSQILDAIAANDS  179

Query  594   SGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFLLISEFIAKKITKYIIKGPKANTTQ  773
             +GRLLKY+  + +V V+L GLSG  G+AIS D+++LL++E IA +  ++ ++G +A T++
Sbjct  180   TGRLLKYDCRSKKVRVLLSGLSGANGVAISSDRSYLLVAETIAYRTRRFWLRGTRAFTSE  239

Query  774   TLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqLIPMTESIAVKFDRNGKILDRKNVTS  953
              + K  G+PDN+KRA SG +WVAVNI +       +P +    ++ +  G  L    +  
Sbjct  240   VVAKFPGRPDNIKRAPSGDFWVAVNIPRTE-----VPSSVPAEIRINGAGGNLQTLPLDQ  294

Query  954   AYPNSFSAYLEHFGKAYTGSLVPNFLGVY  1040
              Y  + S  L+   + Y GS   +F+GV+
Sbjct  295   YYNTTVSELLQRGSRYYAGSAQADFVGVF  323



>ref|XP_011071025.1| PREDICTED: protein STRICTOSIDINE SYNTHASE-LIKE 12-like [Sesamum 
indicum]
Length=337

 Score =   241 bits (615),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 134/301 (45%), Positives = 194/301 (64%), Gaps = 12/301 (4%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQL  341
             A+G E  AF+    GPYTG++DGRI+KY   +  F++FATTS  R+K +CDGT+   L+L
Sbjct  31    AVGSESYAFDSHNVGPYTGLSDGRIVKYQGPETGFVEFATTSANRSKELCDGTDGNDLKL  90

Query  342   I--CGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDE  515
                CGR LG+EF  +TG+LY+ D  +GL+ VG  GGLATQLA G +G +F   +A+ +D 
Sbjct  91    TETCGRALGMEFDHKTGELYLVDAVYGLMVVGSGGGLATQLAGGKDGERFDEADALDIDP  150

Query  516   ST--VYFVDSG-LIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISK  686
             +T  +Y  D G L+  T N T+I  S + +GRLLKY+ +T ++TV+L+GL+  AG+A+SK
Sbjct  151   NTGEIYIGDLGTLLHKTNNLTEILLSEERTGRLLKYDPKTKKLTVLLKGLALAAGVAVSK  210

Query  687   DKTFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppq  866
             D +F+L+ E+IA +IT+Y +KGPKA T++  ++L G PDN+KR  SG +WVAVNI +   
Sbjct  211   DGSFVLVGEYIACRITRYWLKGPKATTSEIFVELPGNPDNIKRTKSGDFWVAVNIQRLQP  270

Query  867   pqqLIPMTESIAVKFDRNGKILDRKNVTSAY-PNSFSAYLEHFGKAYTGSLVPNFLGVYT  1043
                  P   ++  K   +G+IL+  N  + Y   S +   EH G  Y  S   NF GVY 
Sbjct  271   K----PSCFALGQKIGADGQILETVNFYAEYNATSVAEVQEHHGLMYLSSTNANFAGVYE  326

Query  1044  L  1046
             +
Sbjct  327   V  327



>emb|CBI15377.3| unnamed protein product [Vitis vinifera]
Length=693

 Score =   249 bits (637),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 139/336 (41%), Positives = 206/336 (61%), Gaps = 14/336 (4%)
 Frame = +3

Query  60    KSLTMFWISILIFISSPCVIHSQppgillpiklklHAIGPEDVAFNGKGEGPYTGVADGR  239
              ++ M  I +L+F S P  + +        ++L  +  GPE +AF+  G GPYTGV+DGR
Sbjct  11    STVAMISIFLLLFFSVPHTVLT--LSFFTQLQLPPNVTGPEALAFDRLGGGPYTGVSDGR  68

Query  240   ILKY--YNGKFIDFATTSPLRTKVICDGTNNTILQLICGRPLGLEFHPRTGDLYIADVNF  413
             +LKY   +  F DFA T+P R+K +CDGT +      CGRPLG+ F+  TG LYIAD   
Sbjct  69    VLKYGGPSAGFTDFAYTTPTRSKAVCDGTTDPNSGPTCGRPLGVGFNNLTGQLYIADAYS  128

Query  414   GLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--VYFVDSGLIFLTGNFTKIAQSG  587
             GLL VG  GGLAT +A    G+ F F N + +D+ T  VYF D+  ++   + T+  ++ 
Sbjct  129   GLLVVGSNGGLATPVATTAEGVPFRFLNGLDVDQLTGNVYFTDASSVYELRDITQGVENN  188

Query  588   DTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFLLISEFIAKKITKYIIKGPKANT  767
             D SGRLLKY+  T +VTV++RGLSGPAG A+S+D +F+L+SEFIA +  K+ ++GPKANT
Sbjct  189   DASGRLLKYDPSTKQVTVLIRGLSGPAGAAVSRDGSFVLVSEFIANRTQKFWLRGPKANT  248

Query  768   TQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqLIPMTESIAVKFDRNGKILDRKNV  947
             ++     +G+PDN+K + +  +WVAVNI K       +P T     + D +G +L   N 
Sbjct  249   SELFFTFQGRPDNIKTSITDTFWVAVNIGKS------VPTTVPTGQRMDAHGNVLQTVNF  302

Query  948   TSAYPNSFSAYLEHFGKA--YTGSLVPNFLGVYTLK  1049
              + Y ++  + ++  G+   Y GS   +++GVYTLK
Sbjct  303   EAEYGSTMISEVQGRGEIFLYVGSRDASYVGVYTLK  338


 Score =   214 bits (546),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 127/295 (43%), Positives = 180/295 (61%), Gaps = 8/295 (3%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQL  341
             A GPE +AF+  G GPYTG++DGRILKY NG   F++FA TS   ++  C G  +  L  
Sbjct  393   ATGPESIAFDAAGGGPYTGISDGRILKYVNGSVGFVEFAITSSNSSEEFCVGNGSVALDF  452

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST  521
              CGRP GL FH +TGDLYIAD  +GL+ VGP GG+ATQLA   +G+ F FTNA+ +D  T
Sbjct  453   TCGRPFGLGFHYQTGDLYIADAYYGLMVVGPNGGVATQLANAADGVPFGFTNALDVDTET  512

Query  522   --VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               VY VD    F    F+   Q+ D +GRL+KY+ E+  +TV+L GL G AG+AISKD +
Sbjct  513   GMVYLVDYSSQFSVNEFSVSLQAHDMTGRLMKYDPESKELTVLLGGLGGAAGMAISKDGS  572

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             F+LI+E + K+I K+ ++GPKA T++ L +   +P N+KR   G +WVA   L   +   
Sbjct  573   FILITETVTKRIRKFWLQGPKATTSEILKEFTVRPANIKRNEEGEFWVA--FLVADETGS  630

Query  876   LIPMTESIAVKFDRNGKILDRKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGVY  1040
                  +S  ++   +G IL+  ++ +   +  S    + GK Y GS   +F+ VY
Sbjct  631   CPSQQQSPGLRISGDGMILEAISLDTQ--SGISEVAVYNGKMYIGSPFLHFVDVY  683



>emb|CDP10794.1| unnamed protein product [Coffea canephora]
Length=331

 Score =   238 bits (607),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 133/300 (44%), Positives = 189/300 (63%), Gaps = 14/300 (5%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGT---NNTI  332
             +IG E  AF+  G GPYT ++DGRI+KY   +  F DFATT   R+K +CDG    +N  
Sbjct  32    SIGSEACAFDPHGGGPYTSLSDGRIVKYQGSRIGFTDFATTVANRSKKLCDGIVPGDNVE  91

Query  333   LQLICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD  512
             L   CGRP+GLEF  +TGDLY+ D   G + VGPKGG+AT L + ++G+     +A+ +D
Sbjct  92    LAAKCGRPIGLEFDQKTGDLYVIDAFHGPMVVGPKGGIATPLTS-MDGVPVDVPDAIDVD  150

Query  513   E--STVYFVDSGL-IFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAIS  683
                 TV++ D G  I    N T    SGDT+GRLLKY+ +T + TV+L GLSGP G+A+S
Sbjct  151   PVTGTVFYTDIGPGILKIKNMTAFLLSGDTNGRLLKYDPKTRQRTVLLTGLSGPNGVAVS  210

Query  684   KDKTFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKpp  863
             KD +F+LISE++A +I K+ +KGPKAN+++ L+ L G PDN+KR  SG +WV VNI    
Sbjct  211   KDGSFVLISEYVAGRIRKFWVKGPKANSSEVLVNLPGSPDNIKRTGSGDFWVPVNIENLL  270

Query  864   qpqqLIPMTESIAVKFDRNGKILDRKNVTSAYPNSF-SAYLEHFGKAYTGSLVPNFLGVY  1040
               +   P+ +    KF+  G+IL+  N  + Y N + +   +H G  Y  S+  NF+GV+
Sbjct  271   PRKTTFPLAQ----KFNSYGQILETVNFYAEYNNIYITEVHQHLGSLYVASVYANFVGVF  326



>ref|XP_004298328.1| PREDICTED: strictosidine synthase-like [Fragaria vesca subsp. 
vesca]
Length=346

 Score =   238 bits (608),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 128/298 (43%), Positives = 186/298 (62%), Gaps = 8/298 (3%)
 Frame = +3

Query  165   HAIGPEDVAFNGKGEGPYTGVADGRILKYYN--GKFIDFATTSPLRTKVICDGTNNTILQ  338
             + +GPE VAF+ +G+GPY GV+DGRILK+      + +F+ TSP R + +CDG+ N   +
Sbjct  47    NTVGPESVAFDCRGQGPYVGVSDGRILKWEEPLKGWTEFSYTSPNRQRKLCDGSTNKFNE  106

Query  339   LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
              ICGRPLGL+F+P T +LYIAD  FGLLK GP GG   QLA+   G+ F F NA+ +D  
Sbjct  107   PICGRPLGLKFNPTTCELYIADAYFGLLKTGPNGGRPHQLASSAGGVPFHFLNALDVDNE  166

Query  519   T--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
             +  VYF D+ LIF    +     S D +GRL++Y+  T + TV+L+GL+ P G+A+SKDK
Sbjct  167   SGMVYFTDTSLIFQRSVWILSIISADRTGRLMQYDPRTKKATVLLKGLAFPDGVALSKDK  226

Query  693   TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpq  872
             +FLL+ E    KI +  ++GPKANT +   +L G PDN+KR  +G +WVA+N        
Sbjct  227   SFLLLIETGTLKILRLWLRGPKANTLELFAQLVGFPDNIKRNDNGEFWVAINNGVGGSIS  286

Query  873   qLIPMTESIAVKFDRNG---KILDRKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGV  1037
               + + + +  KFD +G   ++LD K+  +A   S S   EH G  + GS   +++GV
Sbjct  287   ATL-LGDPVGAKFDEDGNVLEVLDGKDSAAALLQSVSEVEEHNGMLWIGSAQNSYVGV  343



>ref|XP_010099021.1| Strictosidine synthase 1 [Morus notabilis]
 gb|EXB76379.1| Strictosidine synthase 1 [Morus notabilis]
Length=328

 Score =   237 bits (604),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 131/319 (41%), Positives = 191/319 (60%), Gaps = 9/319 (3%)
 Frame = +3

Query  99    ISSPCVIHSQppgillpiklklHAIGPEDVAFNGKGEGPYTGVADGRILKY--YNGKFID  272
             + S C++  Q       + L   ++GPE + F+  G GPYTG++DG+I++Y      F+D
Sbjct  12    VPSNCIVLFQQTSTFRRLNLPNTSVGPESITFDSLGRGPYTGISDGKIVRYDRRTAGFVD  71

Query  273   FATTSPLRTKVICDGTNNTILQLICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLAT  452
             FA TS  R+K +CDGTNN  L+ ICGRPLG+EF  R   L+IAD   GL KVG  GGLAT
Sbjct  72    FAFTSRNRSKALCDGTNNPALRPICGRPLGMEFFIRKNMLFIADAFLGLFKVGLNGGLAT  131

Query  453   QLAAGVNGIKFSFTNAVALDEST--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMET  626
             QLA    GI F F N +++D+ T  VYF D    FL     +   + D++GRLLKY+  T
Sbjct  132   QLANAAEGIPFRFLNGLSVDQHTGDVYFTDFSSRFLQTQIQQAVAANDSTGRLLKYDYRT  191

Query  627   GRVTVVLRGLSGPAGLAISKDKTFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDN  806
               VTV+LR LSG  G+AIS D +++L++EF+A +  ++ + G KA T++ +    G PDN
Sbjct  192   KNVTVLLRRLSGANGVAISSDSSYVLVAEFLANRTRRFWLHGTKAFTSEIVATFRGMPDN  251

Query  807   VKRATSGGYWVAVNILKppqpqqLIPMTESIAVKFDRNGKILDRKNVTSAYPNSFSAYLE  986
             ++RA  G + VAVN+ +P    +LIP     A++ +  G+ L    +   Y N+  + + 
Sbjct  252   IRRAPFGNFLVAVNVERPAGGPRLIPT----AIRINGAGQTLQTLPLDRYYNNTTISEVL  307

Query  987   HFGKA-YTGSLVPNFLGVY  1040
               GK  Y GS+  NF+GV+
Sbjct  308   QCGKQYYIGSVEANFVGVF  326



>ref|XP_010655935.1| PREDICTED: strictosidine synthase 1-like [Vitis vinifera]
Length=322

 Score =   233 bits (594),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 124/292 (42%), Positives = 181/292 (62%), Gaps = 14/292 (5%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQLIC  347
             GPE +AF+  G+GPYTG++DGRILK+   K  + +FA TSP R    CDG+ N +++ +C
Sbjct  39    GPESIAFDCNGDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPKFCDGSINPVMEQVC  98

Query  348   GRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--  521
             GRPLGL+F+  T DLYIAD  FGLL VG  GG+A Q+A    G+ F FTNA+ +D++T  
Sbjct  99    GRPLGLKFNEATCDLYIADAYFGLLVVGRNGGVAKQVAINAEGVPFRFTNALDIDQNTGV  158

Query  522   VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFL  701
             VYF D+  IF    +    Q+GD +GRLLKY+  +  VTV+LRGLS   G+A+SKDK F+
Sbjct  159   VYFTDTSTIFQRWAYAIAMQTGDKTGRLLKYDPRSKEVTVLLRGLSFSNGVALSKDKDFV  218

Query  702   LISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqLI  881
             L++E  A K+T+Y ++G K+  + T  +L G PDN++R   G +WVA N           
Sbjct  219   LVTETTAAKVTRYWLQGQKSQLSDTFTQLVGCPDNIQRNIHGEFWVAQNNCGR-------  271

Query  882   PMTESIAVKFDRNGKILDRKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGV  1037
             P  +  +VK ++ GKI++     S      S   E     + GS++ +++G+
Sbjct  272   PELKVRSVKLNKEGKIMEE---LSEDFGPLSEVQEKDNDLWLGSVLLSYIGL  320



>emb|CBI28987.3| unnamed protein product [Vitis vinifera]
Length=315

 Score =   232 bits (592),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 124/292 (42%), Positives = 179/292 (61%), Gaps = 14/292 (5%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQLIC  347
             GPE +AF+  G+GPYTG++DGRILK+   K  + +FA TSP R    CDG+ N  ++ +C
Sbjct  32    GPESIAFDCNGDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPKFCDGSLNPAMEQVC  91

Query  348   GRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--  521
             GRPLGL+F+  T DLYIAD  FGLL VG  GG+A Q+A    G+ F FTNA+ +D++T  
Sbjct  92    GRPLGLKFNEATCDLYIADAYFGLLVVGQNGGVAKQVAISAEGVPFRFTNALDIDQNTGV  151

Query  522   VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFL  701
             VYF D+  IF    +    Q GD +GRLLKY+  T  VTV+LRGLS   G+A+S+DK F+
Sbjct  152   VYFTDTSTIFQRWAYAIAMQIGDKTGRLLKYDPRTKEVTVLLRGLSFSNGVALSEDKDFV  211

Query  702   LISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqLI  881
             L++E  A K+T+Y ++G K+  + T  +L G PDN++R   G +WVA N           
Sbjct  212   LVTETTAAKVTRYWLQGQKSQLSDTFTQLVGCPDNIQRNIHGEFWVAQNNCGR-------  264

Query  882   PMTESIAVKFDRNGKILDRKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGV  1037
             P  +   V+ ++ GKI++  +V        S   E     + GS++ +++GV
Sbjct  265   PEVKVRPVRLNKEGKIVEELSVDVG---PLSEVQEKNNSLWLGSVILSYIGV  313



>emb|CBI28990.3| unnamed protein product [Vitis vinifera]
Length=343

 Score =   233 bits (594),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 124/292 (42%), Positives = 181/292 (62%), Gaps = 14/292 (5%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQLIC  347
             GPE +AF+  G+GPYTG++DGRILK+   K  + +FA TSP R    CDG+ N +++ +C
Sbjct  60    GPESIAFDCNGDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPKFCDGSINPVMEQVC  119

Query  348   GRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--  521
             GRPLGL+F+  T DLYIAD  FGLL VG  GG+A Q+A    G+ F FTNA+ +D++T  
Sbjct  120   GRPLGLKFNEATCDLYIADAYFGLLVVGRNGGVAKQVAINAEGVPFRFTNALDIDQNTGV  179

Query  522   VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFL  701
             VYF D+  IF    +    Q+GD +GRLLKY+  +  VTV+LRGLS   G+A+SKDK F+
Sbjct  180   VYFTDTSTIFQRWAYAIAMQTGDKTGRLLKYDPRSKEVTVLLRGLSFSNGVALSKDKDFV  239

Query  702   LISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqLI  881
             L++E  A K+T+Y ++G K+  + T  +L G PDN++R   G +WVA N           
Sbjct  240   LVTETTAAKVTRYWLQGQKSQLSDTFTQLVGCPDNIQRNIHGEFWVAQNNCGR-------  292

Query  882   PMTESIAVKFDRNGKILDRKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGV  1037
             P  +  +VK ++ GKI++     S      S   E     + GS++ +++G+
Sbjct  293   PELKVRSVKLNKEGKIMEE---LSEDFGPLSEVQEKDNDLWLGSVLLSYIGL  341



>ref|XP_003635414.1| PREDICTED: strictosidine synthase 1-like [Vitis vinifera]
Length=322

 Score =   232 bits (592),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 119/259 (46%), Positives = 167/259 (64%), Gaps = 11/259 (4%)
 Frame = +3

Query  174  GPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQLIC  347
            GPE +AF+   +GPYTG++DGRILK+   K  + +FA TSP R    CDG+ N  ++ +C
Sbjct  39   GPESIAFDCNRDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPEFCDGSANPAMEQVC  98

Query  348  GRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--  521
            GRPLGL+F+  T DLYIAD  FGLL VG  GG+A Q+A  V G+ F FTNA+ +D++T  
Sbjct  99   GRPLGLKFNEATCDLYIADAYFGLLVVGRNGGVAKQVAISVEGVPFRFTNALDIDQNTGV  158

Query  522  VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFL  701
            VYF D+  IF    +    Q+GD +GRLLKY+  T  VTV+LRGLS   G+A+SKDK F+
Sbjct  159  VYFTDTSTIFQRWAYAIAMQTGDKTGRLLKYDPRTKEVTVLLRGLSFSNGVALSKDKDFV  218

Query  702  LISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqLI  881
            L++E  A K+T+Y ++G K+  + T  +L G PDN++R   G +WVA N           
Sbjct  219  LVTETTAAKVTRYWLQGQKSQLSDTFTRLVGCPDNIQRNIHGEFWVAQNNCGR-------  271

Query  882  PMTESIAVKFDRNGKILDR  938
            P  +  +VK +R G+I++ 
Sbjct  272  PELKVRSVKLNREGRIMEE  290



>emb|CBI18784.3| unnamed protein product [Vitis vinifera]
Length=334

 Score =   232 bits (592),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 119/259 (46%), Positives = 167/259 (64%), Gaps = 11/259 (4%)
 Frame = +3

Query  174  GPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQLIC  347
            GPE +AF+   +GPYTG++DGRILK+   K  + +FA TSP R    CDG+ N  ++ +C
Sbjct  51   GPESIAFDCNRDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPEFCDGSANPAMEQVC  110

Query  348  GRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--  521
            GRPLGL+F+  T DLYIAD  FGLL VG  GG+A Q+A  V G+ F FTNA+ +D++T  
Sbjct  111  GRPLGLKFNEATCDLYIADAYFGLLVVGRNGGVAKQVAISVEGVPFRFTNALDIDQNTGV  170

Query  522  VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFL  701
            VYF D+  IF    +    Q+GD +GRLLKY+  T  VTV+LRGLS   G+A+SKDK F+
Sbjct  171  VYFTDTSTIFQRWAYAIAMQTGDKTGRLLKYDPRTKEVTVLLRGLSFSNGVALSKDKDFV  230

Query  702  LISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqLI  881
            L++E  A K+T+Y ++G K+  + T  +L G PDN++R   G +WVA N           
Sbjct  231  LVTETTAAKVTRYWLQGQKSQLSDTFTRLVGCPDNIQRNIHGEFWVAQNNCGR-------  283

Query  882  PMTESIAVKFDRNGKILDR  938
            P  +  +VK +R G+I++ 
Sbjct  284  PELKVRSVKLNREGRIMEE  302



>gb|AES93117.1| strictosidine synthase [Camptotheca acuminata]
Length=330

 Score =   232 bits (591),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 123/283 (43%), Positives = 175/283 (62%), Gaps = 19/283 (7%)
 Frame = +3

Query  216   YTGVADGRILKY--YNGKFIDFATTSPLRTKVICDGTNNTILQLICGRPLGLEFHPRTGD  389
             YTG+ADGRI++Y      F+++  T+P R +  CDGTNNT L  ICGRPLGL F   T  
Sbjct  57    YTGLADGRIVRYQRLRSTFVNYGYTAPNRNQAFCDGTNNTFLAPICGRPLGLAFQFGTRR  116

Query  390   LYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDE--STVYFVDSGLIFLTGN  563
             LY AD  FGL+ + P GG ATQLA GV+G++F +  AV +D+   TVYF D+   F    
Sbjct  117   LYAADAAFGLVVIEPYGGPATQLATGVDGVRFRYPAAVDVDQFSGTVYFTDASTRFNLSQ  176

Query  564   FTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFLLISEFIAKKITKYI  743
              +++ ++ DT+GRLLKY+  T +VTV+LRGL+GP  +AIS D+T++LISEFI  +I KY 
Sbjct  177   LSQLIRTRDTTGRLLKYDPNTRQVTVLLRGLAGPFAVAISSDRTYVLISEFIRNRIQKYW  236

Query  744   IKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqLIPMTESIAVKFDR--  917
             + GP ANT + LL + G P N++R   G +WVA+N+            T ++ ++  R  
Sbjct  237   LTGPNANTAEVLLNVAGSPGNIRRTIRGDFWVAINV-----------QTPTVVLRGQRIN  285

Query  918   -NGKILDRKNVTSAYPNSFSAYLEHFGKA-YTGSLVPNFLGVY  1040
              +G IL  +  +  +  +    +  +G A Y GSL P F+GVY
Sbjct  286   GDGTILQTETFSPDFNTTLITEVNEYGGALYLGSLYPKFVGVY  328



>emb|CBI28988.3| unnamed protein product [Vitis vinifera]
Length=322

 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 123/292 (42%), Positives = 179/292 (61%), Gaps = 14/292 (5%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQLIC  347
             GPE +AF+  G+GPYTG++DG+ILK+   K  + +FA TSP R    CDG+ N  ++ +C
Sbjct  39    GPESIAFDCNGDGPYTGISDGKILKWQGSKHGWKEFAITSPFRIPKFCDGSLNPAMEQVC  98

Query  348   GRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--  521
             GRPLGL+F+  T DLYIAD  FGLL VG  GG+A Q+A    G+ F FTNA+ +D++T  
Sbjct  99    GRPLGLKFNEATCDLYIADAYFGLLVVGQNGGVAKQVAISAEGVPFRFTNALDIDQNTGV  158

Query  522   VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFL  701
             VYF D+  IF    +  + Q GD +GRLLKY+  T  VTV+LRGLS   G+A+S+DK F+
Sbjct  159   VYFTDTSTIFQRWAYAIVMQIGDKTGRLLKYDPRTKEVTVLLRGLSFSNGVALSEDKYFV  218

Query  702   LISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqLI  881
             L++E  A KIT+Y ++G K+  + T  +L G PDN++R   G +WVA N           
Sbjct  219   LVTEMTAAKITRYWLQGQKSQLSDTFTQLVGCPDNIQRNIHGEFWVAQNNCGR-------  271

Query  882   PMTESIAVKFDRNGKILDRKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGV  1037
             P  +   V+ ++ GKI++  +V        S   E     + G ++ +++GV
Sbjct  272   PEVKVRPVRLNKEGKIVEELSVDVG---PLSEVQEKNNSLWLGYVILSYIGV  320



>ref|XP_002275622.2| PREDICTED: strictosidine synthase 1-like [Vitis vinifera]
Length=359

 Score =   232 bits (592),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/292 (42%), Positives = 179/292 (61%), Gaps = 14/292 (5%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQLIC  347
             GPE +AF+  G+GPYTG++DG+ILK+   K  + +FA TSP R    CDG+ N  ++ +C
Sbjct  76    GPESIAFDCNGDGPYTGISDGKILKWQGSKHGWKEFAITSPFRIPKFCDGSLNPAMEQVC  135

Query  348   GRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--  521
             GRPLGL+F+  T DLYIAD  FGLL VG  GG+A Q+A    G+ F FTNA+ +D++T  
Sbjct  136   GRPLGLKFNEATCDLYIADAYFGLLVVGQNGGVAKQVAISAEGVPFRFTNALDIDQNTGV  195

Query  522   VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFL  701
             VYF D+  IF    +  + Q GD +GRLLKY+  T  VTV+LRGLS   G+A+S+DK F+
Sbjct  196   VYFTDTSTIFQRWAYAIVMQIGDKTGRLLKYDPRTKEVTVLLRGLSFSNGVALSEDKYFV  255

Query  702   LISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqLI  881
             L++E  A KIT+Y ++G K+  + T  +L G PDN++R   G +WVA N           
Sbjct  256   LVTEMTAAKITRYWLQGQKSQLSDTFTQLVGCPDNIQRNIHGEFWVAQNNCGR-------  308

Query  882   PMTESIAVKFDRNGKILDRKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGV  1037
             P  +   V+ ++ GKI++  +V        S   E     + G ++ +++GV
Sbjct  309   PEVKVRPVRLNKEGKIVEELSVDVG---PLSEVQEKNNSLWLGYVILSYIGV  357



>emb|CDP21322.1| unnamed protein product [Coffea canephora]
Length=384

 Score =   233 bits (593),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/294 (41%), Positives = 180/294 (61%), Gaps = 9/294 (3%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQLIC  347
             GPE  AF+  G GPYT VADGR+LKY   K  F+DF   S    +  CDGTN T +  IC
Sbjct  92    GPESFAFDWAGGGPYTSVADGRVLKYEGPKVGFVDFQVLSSHMPRKFCDGTNRTDISQIC  151

Query  348   GRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--  521
             GRP GL F+ +TG+LY+AD   GL+ +GPKGG   QLA+   G++F F + + +D+ T  
Sbjct  152   GRPTGLGFYYKTGELYLADGGLGLVVIGPKGGPGKQLASAAGGLRFGFPDGLEVDQRTGI  211

Query  522   VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFL  701
             VYF D+   +      ++  + D +GRLLKY+  T +VTV+LRGL+G AG+AIS+D ++L
Sbjct  212   VYFTDASSRYNISQIAEVVANRDQTGRLLKYDPRTKKVTVLLRGLAGAAGVAISEDGSYL  271

Query  702   LISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqLI  881
             L++EF+  +++KY +KGP A+T+  +  L G PD +KR ++G YW+AV +          
Sbjct  272   LVTEFVKARVSKYWLKGPLAHTSHVIANLSGAPDKIKRNSAGDYWIAVTVQSQKPT----  327

Query  882   PMTESIAVKFDRNGKILDRKNVTSAYPNSFSAYLEHFG-KAYTGSLVPNFLGVY  1040
             P  +    K + NGKIL+    +  + +S    ++ +  K Y GS+   ++GVY
Sbjct  328   PTLQLQGQKINGNGKILETITFSPGFNSSLITEVQEYKRKLYLGSIYIGYVGVY  381



>ref|XP_010655933.1| PREDICTED: strictosidine synthase 1-like [Vitis vinifera]
Length=411

 Score =   232 bits (592),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 124/292 (42%), Positives = 179/292 (61%), Gaps = 14/292 (5%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQLIC  347
             GPE +AF+  G+GPYTG++DGRILK+   K  + +FA TSP R    CDG+ N  ++ +C
Sbjct  128   GPESIAFDCNGDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPKFCDGSLNPAMEQVC  187

Query  348   GRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--  521
             GRPLGL+F+  T DLYIAD  FGLL VG  GG+A Q+A    G+ F FTNA+ +D++T  
Sbjct  188   GRPLGLKFNEATCDLYIADAYFGLLVVGQNGGVAKQVAISAEGVPFRFTNALDIDQNTGV  247

Query  522   VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFL  701
             VYF D+  IF    +    Q GD +GRLLKY+  T  VTV+LRGLS   G+A+S+DK F+
Sbjct  248   VYFTDTSTIFQRWAYAIAMQIGDKTGRLLKYDPRTKEVTVLLRGLSFSNGVALSEDKDFV  307

Query  702   LISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqLI  881
             L++E  A K+T+Y ++G K+  + T  +L G PDN++R   G +WVA N           
Sbjct  308   LVTETTAAKVTRYWLQGQKSQLSDTFTQLVGCPDNIQRNIHGEFWVAQNNCGR-------  360

Query  882   PMTESIAVKFDRNGKILDRKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGV  1037
             P  +   V+ ++ GKI++  +V        S   E     + GS++ +++GV
Sbjct  361   PEVKVRPVRLNKEGKIVEELSVDVG---PLSEVQEKNNSLWLGSVILSYIGV  409



>emb|CAN77945.1| hypothetical protein VITISV_044021 [Vitis vinifera]
Length=361

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 133/295 (45%), Positives = 178/295 (60%), Gaps = 12/295 (4%)
 Frame = +3

Query  171   IGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQLI  344
             +GPE +AF+  G GPY  VADGR+LK+ +    F+DFA  SP R+K +CDG+ +  L+  
Sbjct  72    VGPEAIAFDYTGAGPYASVADGRVLKWLDASAGFVDFAFISPSRSKKLCDGSTDPALEPT  131

Query  345   CGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST-  521
             CGRPLGL F+ RT DLYIAD   GL  VGPK G   QLA    G+ F F NAV +D+ T 
Sbjct  132   CGRPLGLGFNYRTVDLYIADAYHGLNVVGPKDGRIIQLATAAEGVPFLFLNAVDVDQETG  191

Query  522   -VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF D+   F    F    Q+GD +GRL+KY+  T  VTV+LRGL G  G+ ISKD +F
Sbjct  192   IVYFTDASARFQRREFMLAVQTGDMTGRLMKYDPRTQEVTVLLRGLGGAGGVTISKDGSF  251

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
             +L++EF+  +I ++ +KGPKANT++  LK  G PDN+KR   G +WVAVNI        +
Sbjct  252   ILVTEFVTNRIQRFWLKGPKANTSELFLKPPGTPDNIKRNVRGEFWVAVNI---GAGTAV  308

Query  879   IPMTESIAVKFDRNGKILDRKNV-TSAYPNSFSAYLEHFGKAYTGSLVPNFLGVY  1040
             +P      ++    GK+L      T   P + S   E++   Y GSL   F+GVY
Sbjct  309   LPS----GLRLSEEGKVLQVVAFGTGDIPKTISEVQEYYRALYIGSLALPFVGVY  359



>ref|XP_008811198.1| PREDICTED: strictosidine synthase 1-like [Phoenix dactylifera]
Length=324

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 130/306 (42%), Positives = 183/306 (60%), Gaps = 16/306 (5%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQL  341
             A+GPE +AF+  G GPYTGV+DGRI+K+      + DFA  S  R +V C G+N+++L+ 
Sbjct  22    AVGPESLAFDHLGGGPYTGVSDGRIVKWQGQGLGWADFAVHSKYRERV-CHGSNDSMLES  80

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST  521
             ICGRPLGL+F+  TGDLY+AD  FGLL V P GG+ATQLA G +G  F+F N + +D+ T
Sbjct  81    ICGRPLGLQFYKATGDLYVADAYFGLLVVAPNGGVATQLATGADGQPFNFANGLDVDQET  140

Query  522   --VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               VYF DS   F   ++      GD +GRL+ Y+ +   VTV++RGL+ P GLAIS D T
Sbjct  141   GVVYFTDSSTRFRRRDYILAVIMGDATGRLMNYDPKAKNVTVLIRGLAFPNGLAISNDTT  200

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             FLLI+E    ++ KY ++GP+  T +   +L G PDN+KR   G +WVA+N  K     Q
Sbjct  201   FLLIAETGTCRVLKYWLQGPRNGTFEVFAELPGYPDNIKRNPGGEFWVALNQDKVQLNGQ  260

Query  876   LI---------PMTESIAVKFDRNGKILDRKNVTSAYPNSFSAYLEHFGKAYTGSLVPNF  1028
                             +A++  + GK+L+     +A   S S   E  G  + GS+   +
Sbjct  261   TASDFGKTGEPSEHHPVALRLSQEGKVLEVLERRAA--TSVSEVEERNGTMWLGSVDMPY  318

Query  1029  LGVYTL  1046
             +GVYTL
Sbjct  319   VGVYTL  324



>ref|XP_010656041.1| PREDICTED: strictosidine synthase 1-like [Vitis vinifera]
Length=309

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/292 (41%), Positives = 179/292 (61%), Gaps = 14/292 (5%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQLIC  347
             GPE +AF+  G+GPYTG++DGRILK+   K  + +FA TSP R    CDG+ N  ++ +C
Sbjct  26    GPESIAFDCNGDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPKFCDGSLNPAMEQVC  85

Query  348   GRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--  521
             GRPLGL+F+    DLYIA+  FGLL VG  GG+A Q+A    G+ F FTNA+ +D++T  
Sbjct  86    GRPLGLKFNEAKCDLYIANAYFGLLVVGRNGGVAKQVAISAEGVPFRFTNALDIDQNTGV  145

Query  522   VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFL  701
             VYF D+  IF    +    Q+GD +GRLLKY+  +  VTV+LRGLS   G+A+SKDK F+
Sbjct  146   VYFTDTSTIFQRWAYAIAMQTGDKTGRLLKYDPRSKEVTVLLRGLSFSNGVALSKDKDFV  205

Query  702   LISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqLI  881
             L++E    K+T+Y ++G K+  + T  +L G PDN++R   G +WVA N           
Sbjct  206   LVTETTTAKVTRYWLQGQKSQLSDTFTQLVGCPDNIQRNIHGEFWVAQNNCGR-------  258

Query  882   PMTESIAVKFDRNGKILDRKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGV  1037
             P  + I++K ++ GKI++     S      S   E     + GS++ +++G+
Sbjct  259   PELKVISIKLNKEGKIMEE---LSEDFGPLSEVQEKDNDLWLGSVLLSYIGM  307



>ref|XP_010658741.1| PREDICTED: strictosidine synthase 1-like [Vitis vinifera]
 emb|CBI40189.3| unnamed protein product [Vitis vinifera]
Length=322

 Score =   228 bits (580),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 116/259 (45%), Positives = 164/259 (63%), Gaps = 11/259 (4%)
 Frame = +3

Query  174  GPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQLIC  347
            GPE +AF+  G+GPYTG++DGRILK+   K  + +FA TSP R    C+G+ N  ++ +C
Sbjct  39   GPESIAFDCNGDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPKFCNGSINPAMEQVC  98

Query  348  GRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--  521
            GRPLGL+F+  T DLYIAD  FGLL VG  GG+A Q+A    G+ F FTNA+ +D++T  
Sbjct  99   GRPLGLKFNEATCDLYIADAYFGLLVVGHNGGVAKQIAISAEGVPFRFTNALDIDQNTGI  158

Query  522  VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFL  701
            VYF D+  IF    +    Q+GD +GRLLKY+  T  VTV+LRGLS   G+A+SKDK F+
Sbjct  159  VYFTDTSTIFQRWAYAIAMQTGDKTGRLLKYDPRTKEVTVLLRGLSFSNGVALSKDKDFV  218

Query  702  LISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqLI  881
            L++E    K+T+Y ++G K+  + T  +L G PDN++R   G +WVA N           
Sbjct  219  LVTETTTAKVTRYWLRGQKSQLSDTFTQLVGCPDNIQRNIHGEFWVAQNNCGR-------  271

Query  882  PMTESIAVKFDRNGKILDR  938
            P  +   V+ +  GKI++ 
Sbjct  272  PELKVRPVRLNEEGKIMEE  290



>emb|CBI40188.3| unnamed protein product [Vitis vinifera]
Length=291

 Score =   226 bits (576),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 112/231 (48%), Positives = 155/231 (67%), Gaps = 4/231 (2%)
 Frame = +3

Query  174  GPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQLIC  347
            GPE +AF+  G+GPYTG++DGRILK+   K  + +FA TSP R    C+G+ N  ++ +C
Sbjct  56   GPESIAFDCNGDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPKFCNGSINPAMEQVC  115

Query  348  GRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--  521
            GRPLGL+F+  T DLYIAD  FGLL VG  GG+A Q+A    G+ F FTNA+ +D++T  
Sbjct  116  GRPLGLKFNEATCDLYIADAYFGLLVVGHNGGVAKQIAISAEGVPFRFTNALDIDQNTGI  175

Query  522  VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFL  701
            VYF D+  IF    +    Q+GD +GRLLKY+  T  VTV+LRGLS   G+A+SKDK F+
Sbjct  176  VYFTDTSTIFQRWAYAIAMQTGDKTGRLLKYDPRTKEVTVLLRGLSFSNGVALSKDKDFV  235

Query  702  LISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNIL  854
            L++E    K+T+Y ++G K+  + T  +L G PDN++R   G +WVA N L
Sbjct  236  LVTETTTAKVTRYWLQGQKSQLSDTFTQLVGCPDNIQRNIHGEFWVAQNNL  286



>ref|XP_006436700.1| hypothetical protein CICLE_v10033919mg [Citrus clementina]
 gb|ESR49940.1| hypothetical protein CICLE_v10033919mg [Citrus clementina]
Length=344

 Score =   228 bits (581),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 130/298 (44%), Positives = 188/298 (63%), Gaps = 16/298 (5%)
 Frame = +3

Query  171   IGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRT-KVICDGTNNTILQL  341
             +GPE +AF+  GEGPY GV+DGRILK+ + K  + +FA T+P R  + ICDGT++TIL+ 
Sbjct  51    VGPESLAFDCNGEGPYAGVSDGRILKWQDSKLGWTEFAITTPFRRLRRICDGTSSTILEP  110

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST  521
             +CGRPLG++F+P T DLYIAD  FGL+ VG  GG A QLA+    I F FTNA+ +D +T
Sbjct  111   LCGRPLGIKFNPVTCDLYIADAYFGLMVVGRNGGPAKQLASSAERIPFRFTNALDIDPNT  170

Query  522   --VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               VYF DS + F    +  + +SGD SGRLLKY+    +VTV+ RGL+ P G+ +SKDK+
Sbjct  171   GVVYFTDSSMYFQRRQYPMLIESGDRSGRLLKYDPRNKQVTVLRRGLAFPNGVTLSKDKS  230

Query  696   FLLISEFIAKKITKYIIKGPKA-NTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpq  872
             FLL++E  +++I ++ ++G     + Q   ++   PDN++   +G +WVA+N  +     
Sbjct  231   FLLVAESDSRRILRFWVEGESVIYSPQPFAQVAQFPDNIETDRNGDFWVALNTKRGNDK-  289

Query  873   qLIPMTESIAVKFD-RNGKILD--RKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGV  1037
                  T+ +AVK D  NG +LD    N  +A  +S S   EH G  Y GS V  ++ V
Sbjct  290   -----TDLVAVKLDGSNGNVLDVLEGNKQNAL-DSVSEVEEHGGYLYAGSPVQPYVVV  341



>ref|XP_010110081.1| Strictosidine synthase 1 [Morus notabilis]
 gb|EXC25148.1| Strictosidine synthase 1 [Morus notabilis]
Length=353

 Score =   228 bits (581),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 132/335 (39%), Positives = 196/335 (59%), Gaps = 14/335 (4%)
 Frame = +3

Query  60    KSLTMFWISILIFISSPC--VIHSQppgillpiklklHAIGPEDVAFNGKGEGPYTGVAD  233
             +++TM  I +LIF+S P   ++ SQ       + L   ++GPE + F+  G GPYTG++D
Sbjct  23    ETVTMLLI-LLIFLSVPSNYIVLSQQISTFRKLNLPTTSVGPEPIDFDALGRGPYTGISD  81

Query  234   GRILKY--YNGKFIDFATTSPLRTKVICDGTNNTILQLICGRPLGLEFHPRTGDLYIADV  407
             GRI++Y      F+DFA  S  R+K +CDGTN+  L+ +CGRPLG+EF  R   L+IAD 
Sbjct  82    GRIVRYDKRTSSFVDFAFASQNRSKAVCDGTNSPALRPVCGRPLGIEFFHRRNLLFIADA  141

Query  408   NFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--VYFVDSGLIFLTGNFTKIAQ  581
               GL  VGP GGLATQLA    GI   F N +++D+ T  VYF D    FL     +   
Sbjct  142   FAGLCVVGPNGGLATQLATTAEGISLRFLNGLSVDQHTGDVYFTDYSSRFLQTQIQQAIA  201

Query  582   SGDTSGRLLKYEMETGRVTV-VLRGLSGPAGLAISKDKTFLLISEFIAKKITKYIIKGPK  758
             + D++GRLLKY+  T  VTV +LRGLSG  G+AIS D T+LL +E IA +  ++ ++G +
Sbjct  202   ANDSTGRLLKYDYRTKNVTVLLLRGLSGANGVAISSDGTYLLFAESIANRTQRFWLRGAR  261

Query  759   ANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqLIPMTESIAVKFDRNGKILDR  938
             A T++ +   +G P N++R  SG + V V++ +P       P     A++ +  G+IL  
Sbjct  262   AFTSEVVANFQGMPRNIRRTPSGDFLVGVSVQRPGA-----PSIVPTAIRINGAGQILQT  316

Query  939   KNVTSAYPNS-FSAYLEHFGKAYTGSLVPNFLGVY  1040
               +   Y  +  S +L+   + Y GS   NF+GV+
Sbjct  317   LPLDHYYNTTVISEFLQRGSRYYAGSAQANFVGVF  351



>ref|XP_010656040.1| PREDICTED: strictosidine synthase 1-like [Vitis vinifera]
Length=352

 Score =   228 bits (581),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 125/298 (42%), Positives = 180/298 (60%), Gaps = 11/298 (4%)
 Frame = +3

Query  66   LTMFWISILIFISSPCVIHSQppgillpiklklHAIGPEDVAFNGKGEGPYTGVADGRIL  245
            L+ F+I   I IS    ++S        ++L     GPE +AF+  G+GPYTG++DGRIL
Sbjct  3    LSQFFIFSFILISLFGCVNSHQALKYNTLELPSGVSGPESIAFDCNGDGPYTGISDGRIL  62

Query  246  KYYNGK--FIDFATTSPLRTKVICDGTNNTILQLICGRPLGLEFHPRTGDLYIADVNFGL  419
            K+   K  + +FA TSP R    CDG+ N  ++ +CGRPLGL+F+  T DLYIAD  FGL
Sbjct  63   KWQGSKHGWKEFAITSPFRIPKFCDGSLNPAMEQVCGRPLGLKFNEATCDLYIADAYFGL  122

Query  420  LKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--VYFVDSGLIFLTGNFTKIAQSGDT  593
            L VG  GG+A Q+A    G+ F FTNA+ +D++T  VYF D+  IF    +    Q GD 
Sbjct  123  LVVGQNGGVAKQVAISAEGVPFRFTNALDIDQNTGVVYFTDTSTIFQRWAYAIAMQIGDK  182

Query  594  SGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFLLISEFIAKKITKYIIKGPKANTTQ  773
            +GRLLKY+  T  VTV+LRGLS   G+A+S+DK F+L++E  A K+T+Y ++  K+  + 
Sbjct  183  TGRLLKYDPRTKEVTVLLRGLSFSNGVALSEDKDFVLVTETTAAKVTRYWLQCQKSQLSD  242

Query  774  TLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqLIPMTESIAVKFDRNGKILDRKNV  947
            T  +L G PDN++R   G +WVA N           P  +   V+ ++ GKI++  +V
Sbjct  243  TFTQLVGCPDNIQRNIHGEFWVAQNNCGR-------PEVKVRPVRLNKEGKIVEELSV  293



>emb|CDP21321.1| unnamed protein product [Coffea canephora]
Length=335

 Score =   227 bits (579),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 127/328 (39%), Positives = 191/328 (58%), Gaps = 18/328 (5%)
 Frame = +3

Query  75    FWISILIFISSP-CVIHSQppgillpiklklHAIGPEDVAFNGKGEGPYTGVADGRILKY  251
             F++ +L F+ +  C  H Q   +  P        GP+  AF+  G+GPYTGVADGRI KY
Sbjct  17    FYVFVLCFLPAVFCAGHLQKLHLPDP--------GPDSFAFDSAGQGPYTGVADGRIFKY  68

Query  252   YNGK--FIDFATTSPLRTKVICDGTNNTILQLICGRPLGLEFHPRTGDLYIADVNFGLLK  425
                K  F+++  +   R+   CDGTN+T L   CGRP GL F+ +TG+LY+AD   GL+ 
Sbjct  69    KGPKVGFVEYGYSKADRSARFCDGTNSTALAKSCGRPSGLGFYYKTGELYVADDGVGLVV  128

Query  426   VGPKGGLATQLAAGVNGIKFSFTNAVALDEST--VYFVDSGLIFLTGNFTKIAQSGDTSG  599
             +GPKGG    LA+G   + F   + + +D++T  VYF D+   +      +I  SGD++G
Sbjct  129   IGPKGGAGKVLASGAEKVPFGLPDGLDVDQNTGIVYFTDATARYTINEIPQIIASGDSTG  188

Query  600   RLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFLLISEFIAKKITKYIIKGPKANTTQTL  779
             RLLKY   T +VTV+LR L+GPAG+AISKD+++LL++EF+  ++ KY ++GPKANT   L
Sbjct  189   RLLKYNPRTKKVTVLLRRLAGPAGVAISKDRSYLLVTEFLKSRVWKYWLRGPKANTAHVL  248

Query  780   LKLEGQPDNVKRATSGGYWVAVNILKppqpqqLIPMTESIAVKFDRNGKILDRKNVTSAY  959
             L + G P  + R   G +W+A+ + +        P  +   ++ +  GKIL+       +
Sbjct  249   LNVPGSPSKIVRNNVGDFWLAMTVKRQVPT----PRIKLQGLRINGYGKILETITFNPGF  304

Query  960   PNSF-SAYLEHFGKAYTGSLVPNFLGVY  1040
              +S  +   EH G  Y GSL   ++GVY
Sbjct  305   DSSMITEVHEHKGALYLGSLYVGYVGVY  332



>ref|XP_006437788.1| hypothetical protein CICLE_v10032008mg [Citrus clementina]
 ref|XP_006484567.1| PREDICTED: strictosidine synthase 3-like [Citrus sinensis]
 gb|ESR51028.1| hypothetical protein CICLE_v10032008mg [Citrus clementina]
Length=343

 Score =   228 bits (580),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 140/344 (41%), Positives = 197/344 (57%), Gaps = 21/344 (6%)
 Frame = +3

Query  57    MKSLTMFWISILIFISSPCVIHSQppgillpiklklHAIGPEDVAFNGKGEGPYTGVADG  236
             MK L+ F I I   +  PCVI S      L +      +GPE +AF+  GEGPY GV+DG
Sbjct  1     MKLLSSFIIFIFPLVF-PCVILSSKSYQQLQLP---GVVGPESLAFDCNGEGPYVGVSDG  56

Query  237   RILKY--YNGKFIDFATTSPLRTKVICDGTNNTILQLICGRPLGLEFHPRTGDLYIADVN  410
             RILK+   N  + +FATT+P R + ICDG+ NT L+ +CGRPLG++F+P T DLYIAD  
Sbjct  57    RILKWKAANSGWTEFATTAPHRAREICDGSTNTTLEPLCGRPLGIKFNPVTCDLYIADAY  116

Query  411   FGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--VYFVDSGLIFLTGNFTKIAQS  584
             FGL+ VGP GG A QLA+   GI F FTN + +D +T  VYF DS + F    +     +
Sbjct  117   FGLMVVGPNGGQAQQLASSAGGIPFRFTNDLDIDPNTGIVYFTDSSIYFQRRQYFMSIAT  176

Query  585   GDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFLLISEFIAKKITKYIIKGPKAN  764
             GD SGRLLKY+     VTV+  GLS P G+A+S + +FLL++E    KI ++ ++G +  
Sbjct  177   GDRSGRLLKYDPLKKNVTVMYNGLSFPNGVALSNNNSFLLLAESATLKILRFWLQGERTT  236

Query  765   -TTQTLLKLEGQPDNVKRATSGGYWVAVNILK---------ppqpqqLIP--MTESIAVK  908
              T Q   ++   PDN+K  + G +W+A+N  +             +   P  + + + VK
Sbjct  237   YTPQLFAEMPRFPDNIKSDSKGEFWIAMNSARGKIESNKKTAFCEETAKPWFLRDPVGVK  296

Query  909   FDRNGKILDRKNVTSAYP-NSFSAYLEHFGKAYTGSLVPNFLGV  1037
             FD NG ++D  +       NS S   E+ G  YTGS V  ++ V
Sbjct  297   FDVNGNVVDVLDGNEGNTLNSVSEVQEYGGYLYTGSSVQPYVVV  340



>ref|XP_006436702.1| hypothetical protein CICLE_v10033429mg [Citrus clementina]
 gb|ESR49942.1| hypothetical protein CICLE_v10033429mg [Citrus clementina]
Length=338

 Score =   227 bits (578),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/298 (44%), Positives = 187/298 (63%), Gaps = 16/298 (5%)
 Frame = +3

Query  171   IGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRT-KVICDGTNNTILQL  341
             +GPE +AF+  GEGPY GV+DGRILK+ + K  + +FA T+P R  + ICDGT++TIL+ 
Sbjct  45    VGPESLAFDCNGEGPYAGVSDGRILKWQDSKLGWTEFAITTPFRRLRRICDGTSSTILEP  104

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST  521
             +CGRPLG++F+P T DLYIAD  FGL+ VG  GG A QLA+    I F FTNA+ +D +T
Sbjct  105   LCGRPLGIKFNPVTCDLYIADAYFGLMVVGRNGGPAKQLASSAERIPFRFTNALDIDPNT  164

Query  522   --VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               VYF DS + F    +  + +SGD SGRLLKY+    +VTV+ RGL+ P G+ +SKDK+
Sbjct  165   GVVYFTDSSMYFQRRQYPMLIESGDRSGRLLKYDPRNKQVTVLRRGLAFPNGVTLSKDKS  224

Query  696   FLLISEFIAKKITKYIIKGPKA-NTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpq  872
             FLL++E  +++I +  ++G     + Q   ++   PDN++   +G +WVA+N  +     
Sbjct  225   FLLVAESDSRRILRLWVEGESVIYSPQPFAQVAQFPDNIETDRNGDFWVALNTKRGNDK-  283

Query  873   qLIPMTESIAVKFD-RNGKILD--RKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGV  1037
                  T+ +AVK D  NG +LD    N  +A  +S S   EH G  Y GS V  ++ V
Sbjct  284   -----TDLVAVKLDGSNGNVLDVLEGNKQNAL-DSVSEVEEHGGYLYAGSPVQPYVVV  335



>emb|CBI15378.3| unnamed protein product [Vitis vinifera]
Length=1075

 Score =   238 bits (608),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 128/292 (44%), Positives = 176/292 (60%), Gaps = 19/292 (7%)
 Frame = +3

Query  171   IGPEDVAFNGKGEGPYTGVADGRILKYY--NGKFIDFATTSPLRTKVICDGTNNTILQLI  344
             IGPE +AF+  G GPY  VADGR+LK+   +  F+DF   SP R+K +CDG+++   +  
Sbjct  40    IGPEALAFDCSGAGPYASVADGRVLKWQAESAGFVDFTVASPSRSKQLCDGSSDPAKEPT  99

Query  345   CGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST-  521
             CGRPLG+ F+ +TGDLYIAD  +GL  VGP GG ATQLA    G+ F F NAV +D+ T 
Sbjct  100   CGRPLGIGFNNKTGDLYIADAYYGLFVVGPDGGRATQLATEAEGVPFRFLNAVDVDQETG  159

Query  522   -VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF D+   F    F     +GD +GRL+KY+  T +VTV+LRGL    G+AI+KD +F
Sbjct  160   IVYFTDASARFQRREFQNAVLAGDMTGRLMKYDPRTKQVTVLLRGLGLAVGVAINKDGSF  219

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
             +L+SEFIA +I +Y ++GPKANT++  LK  G PDN+KR   G +WVA NI         
Sbjct  220   VLVSEFIATRIQRYWLRGPKANTSELFLKPTGTPDNIKRNARGEFWVAANI------GAE  273

Query  879   IPMTESIAVKFDRNGKIL-----DRKNVTSAYPNSFSAYLEHFGKAYTGSLV  1019
             +     + ++    GKIL     D  ++T     + S   E+ G  Y G  +
Sbjct  274   MAAAAPLGLRVSEEGKILQVVAFDTGDIT----RTISEVHEYNGALYVGEFM  321


 Score =   214 bits (545),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 114/267 (43%), Positives = 170/267 (64%), Gaps = 7/267 (3%)
 Frame = +3

Query  174  GPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQLIC  347
            GPE +AF+ KGEGPYTGV+DGR+LKY      F DFA TSP RT+ +CDG+ +  L+  C
Sbjct  459  GPESLAFDLKGEGPYTGVSDGRVLKYQGPAVGFTDFAVTSPNRTEEMCDGSIDPALEATC  518

Query  348  GRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--  521
            GRPLGL F+  TGDLY+ D   GL+ VG  GG+ATQLAA   GI F F   + +D+    
Sbjct  519  GRPLGLGFNYHTGDLYMVDAYLGLMVVGSSGGIATQLAAAAEGIPFRFLAGLDVDQGNGM  578

Query  522  VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFL  701
            VYF ++   F   +  ++  S D++G L +Y+ ++  V V+L GLS   G+A+S+D  F+
Sbjct  579  VYFTEASTRFQLRDMQELIASNDSTGSLFRYDPQSREVRVLLGGLSVAVGVAVSRDGMFV  638

Query  702  LISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAV-NILKppqpqqL  878
            L++E  A +I ++ + GPKANT++  ++L G+P N+KR   G +WVA+ N L PP P + 
Sbjct  639  LVAELTANRIRRFWLGGPKANTSEVFMELLGKPSNIKRNERGEFWVAINNALGPPAPPES  698

Query  879  IPMTESIAVKFDRNGKILDRKNVTSAY  959
            + M   + ++   +G++L+   +  AY
Sbjct  699  LVM--PLGLRLSNDGRVLEVAPLVGAY  723


 Score =   211 bits (537),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 126/299 (42%), Positives = 171/299 (57%), Gaps = 13/299 (4%)
 Frame = +3

Query  165   HAIGPEDVAFNGKGEGPYTGVADGRILKY--YNGKFIDFATTSPLRTKVICDGTNNTILQ  338
             +  GP  +AF+    GPY GV DGRI++Y   +  F DFA  +P R+K +CDGT +    
Sbjct  781   NVTGPVSLAFDLTVGGPYAGVNDGRIIRYGGTDVGFTDFAFCTPTRSKAVCDGTTDPDSG  840

Query  339   LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
               CGRPLGL F+     +YIAD   GL   G  G LAT+LA    G+ F F N + +D  
Sbjct  841   PTCGRPLGLSFNNLRNQMYIADAYSGLFVAGTNGRLATKLATSAEGVPFCFLNGLDVDPL  900

Query  519   T--VYFVD-SGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKD  689
             +  VYF D S  I L+GN T+   S D +GRLL+Y+ ET  VTV+LRGLSG AG A+S D
Sbjct  901   SGLVYFTDFSTTIQLSGNTTQF--SSDATGRLLRYDPETKNVTVLLRGLSGAAGTAVSND  958

Query  690   KTFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqp  869
               F+L+SEF A +I K+ ++GPKA+T +T +   G+P N+KR  SG +WVAVN+     P
Sbjct  959   GMFVLVSEFNANRILKFWLRGPKASTAETFVSFRGRPVNIKRTASGNFWVAVNVPNNQSP  1018

Query  870   qqLIPMTESIAVKFDRNGKILDRKNVTSAYPNS--FSAYLEHFGKAYTGSLVPNFLGVY  1040
                 P T     +    G IL+  +    Y  S   +   +H G  Y G+   NF+GV+
Sbjct  1019  ----PTTILTGQRISYYGTILETVSFDDQYGGSTLITEVQQHLGALYIGANSANFVGVH  1073


 Score = 90.9 bits (224),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 77/125 (62%), Gaps = 7/125 (6%)
 Frame = +3

Query  558  GNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFLLISEFIAKKITK  737
            G F    Q+GD +GRL+KY+  T  VT +LRGL G  G+ ISKD +F+L++EF+  +I +
Sbjct  318  GEFMLAVQTGDMTGRLMKYDPRTQEVTELLRGLGGAGGVTISKDGSFILVTEFVTNRIQR  377

Query  738  YIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqLIPMTESIAVKFDR  917
            + +KG KANT+Q  LK  G PDN+K    G +WVAVNI        ++P+     ++   
Sbjct  378  FWLKGRKANTSQLFLKPPGTPDNIKSNARGEFWVAVNI---GAGTAVVPL----GLRLSE  430

Query  918  NGKIL  932
             GK+L
Sbjct  431  EGKVL  435



>ref|XP_006436705.1| hypothetical protein CICLE_v10033909mg [Citrus clementina]
 gb|ESR49945.1| hypothetical protein CICLE_v10033909mg [Citrus clementina]
Length=338

 Score =   226 bits (575),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 129/298 (43%), Positives = 187/298 (63%), Gaps = 16/298 (5%)
 Frame = +3

Query  171   IGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRT-KVICDGTNNTILQL  341
             +GPE +AF+  GEGPY GV+DGRILK+ + K  + +FA T+P R  + ICDGT++TIL+ 
Sbjct  45    VGPESLAFDCNGEGPYAGVSDGRILKWQDSKLGWTEFAITTPFRRLRRICDGTSSTILEP  104

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST  521
             +CGRPLG++F+P T DLYIAD  FGL+ VG  GG A QLA+    I F FTNA+ +D +T
Sbjct  105   LCGRPLGIKFNPVTCDLYIADAYFGLMVVGRNGGPAKQLASSAERIPFRFTNALDIDPNT  164

Query  522   --VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               VYF DS + F    +  + +SGD SGRLLKY+    +VTV+ RGL+ P G+ +S DK+
Sbjct  165   GVVYFTDSSMYFQRRQYPMLIESGDRSGRLLKYDPRNKQVTVLRRGLAFPNGVTLSNDKS  224

Query  696   FLLISEFIAKKITKYIIKGPKA-NTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpq  872
             FLL++E  +++I ++ ++G     + Q   ++   PDN++   +G +WVA+N  +     
Sbjct  225   FLLVAESDSRRILRFWVEGESVIYSPQPFAQVAQFPDNIETDRNGDFWVALNTKRGNDK-  283

Query  873   qLIPMTESIAVKFD-RNGKILD--RKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGV  1037
                  T+ +AVK D  NG +LD    N  +A  +S S   EH G  Y GS V  ++ V
Sbjct  284   -----TDLVAVKLDGSNGNVLDVLEGNKQNAL-DSVSEVEEHGGYLYAGSPVQPYVVV  335



>gb|KDO70174.1| hypothetical protein CISIN_1g019290mg [Citrus sinensis]
Length=343

 Score =   225 bits (573),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 139/344 (40%), Positives = 196/344 (57%), Gaps = 21/344 (6%)
 Frame = +3

Query  57    MKSLTMFWISILIFISSPCVIHSQppgillpiklklHAIGPEDVAFNGKGEGPYTGVADG  236
             MK L+ F I I   +  PCVI S      L +      +GPE +AF+  GEGPY GV+DG
Sbjct  1     MKLLSSFIIFIFPLVF-PCVILSSKSYQQLQLP---GVVGPESLAFDCNGEGPYVGVSDG  56

Query  237   RILKY--YNGKFIDFATTSPLRTKVICDGTNNTILQLICGRPLGLEFHPRTGDLYIADVN  410
             RILK+   N  + +FATT+P R + ICDG+ NT L+ +CGRPLG++F+P T DLYIAD  
Sbjct  57    RILKWKAANSGWTEFATTAPHRAREICDGSTNTTLEPLCGRPLGIKFNPVTCDLYIADAY  116

Query  411   FGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--VYFVDSGLIFLTGNFTKIAQS  584
             FGL+ VGP GG A QLA+   GI F FTN + +D +T  VYF DS + F    +     +
Sbjct  117   FGLMVVGPNGGQAQQLASSAGGIPFRFTNDLDIDPNTGIVYFTDSSIYFQRRQYFMSIAT  176

Query  585   GDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFLLISEFIAKKITKYIIKGPKAN  764
             GD SGRLLKY+     VTV+  GLS P G+A+S + +FLL++E    KI ++ ++G +  
Sbjct  177   GDRSGRLLKYDPLKKNVTVMYNGLSFPNGVALSNNNSFLLLAESATLKILRFWLQGERTT  236

Query  765   -TTQTLLKLEGQPDNVKRATSGGYWVAVNILK---------ppqpqqLIP--MTESIAVK  908
              T Q   ++   PDN+K  + G +W+A+N  +             +   P  + + + VK
Sbjct  237   YTPQLFAEMPRFPDNIKSDSKGEFWIAMNSARGKIESNKKTAFCEETAKPWFLRDPVGVK  296

Query  909   FDRNGKILDRKNVTSAYP-NSFSAYLEHFGKAYTGSLVPNFLGV  1037
             FD NG ++D  +       NS S   E+    YTGS V  ++ V
Sbjct  297   FDVNGNVVDVLDGNEGNTLNSVSEVQEYGEYLYTGSSVQPYVVV  340



>ref|XP_010663512.1| PREDICTED: strictosidine synthase 3-like [Vitis vinifera]
Length=335

 Score =   224 bits (570),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 119/300 (40%), Positives = 179/300 (60%), Gaps = 18/300 (6%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQLIC  347
             GPE +AF+ KGEGPYTGV+DGR+LKY      F DFA TSP RT+ +CDG+ +  L+  C
Sbjct  41    GPESLAFDLKGEGPYTGVSDGRVLKYQGPAVGFTDFAVTSPNRTEEMCDGSIDPALEATC  100

Query  348   GRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--  521
             GRPLGL F+  TGDLY+ D   GL+ VG  GG+ATQLAA   GI F F   + +D+    
Sbjct  101   GRPLGLGFNYHTGDLYMVDAYLGLMVVGSSGGIATQLAAAAEGIPFRFLAGLDVDQGNGM  160

Query  522   VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFL  701
             VYF ++   F   +  ++  S D++G L +Y+ ++  V V+L GLS   G+A+S+D  F+
Sbjct  161   VYFTEASTRFQLRDMQELIASNDSTGSLFRYDPQSREVRVLLGGLSVAVGVAVSRDGMFV  220

Query  702   LISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqLI  881
             L++E  A +I ++ + GPKANT++  ++L G+P N+KR   G +WVA+N         L 
Sbjct  221   LVAELTANRIRRFWLGGPKANTSEVFMELLGKPSNIKRNERGEFWVAIN-------NALG  273

Query  882   P------MTESIAVKFDRNGKILDRKNVTSAYP-NSFSAYLEHFGKAYTGSLVPNFLGVY  1040
             P      +   + ++   +G++L+   +  AY  ++ S   E  G+ Y  SLV  +  +Y
Sbjct  274   PPAPPESLVMPLGLRLSNDGRVLEVAPLVGAYQISAISEVQERNGELYVASLVAAYASIY  333



>ref|XP_010257835.1| PREDICTED: strictosidine synthase 3-like [Nelumbo nucifera]
Length=340

 Score =   223 bits (568),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 130/294 (44%), Positives = 178/294 (61%), Gaps = 11/294 (4%)
 Frame = +3

Query  165   HAIGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVIC-DGTNNTIL  335
              A+GPE  AF+  GEGPYTGV+ GRILK+      + +FA+TSP R   IC +G N+   
Sbjct  40    SAVGPESFAFDCNGEGPYTGVSGGRILKWQGAARGWAEFASTSPPRD--ICFNGANDPET  97

Query  336   QLICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDE  515
             +L+CGRPLGL+F+  T +LYIAD +FGL+ VG  GG+A  LA    G+ F FTNA+  D+
Sbjct  98    ELVCGRPLGLQFNKATCELYIADSSFGLMVVGRDGGVAKLLANSAEGVPFRFTNALDFDQ  157

Query  516   ST--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKD  689
                 VYF DS +      F   A SGD +GRL+KY+ +T ++TV+ RGLS P G A+SKD
Sbjct  158   DNGIVYFTDSSIWIPRWEFLIEALSGDETGRLMKYDPKTEKLTVLWRGLSFPNGAALSKD  217

Query  690   KTFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqp  869
              +F+LI+E    +I +Y ++GPKA T +  L+L G PDNVK    G +WVA+N  KP   
Sbjct  218   NSFILIAETSKARILRYWLRGPKAQTLEFFLQLPGFPDNVKSNGRGEFWVALNPGKPSMG  277

Query  870   qqLIPM--TESIAVKFDRNGKILDRKNVTSAYP--NSFSAYLEHFGKAYTGSLV  1019
                 P    E +A++FD  G IL+  N  +        S   E+ G  + GS+V
Sbjct  278   ATFQPRFDGEIVALRFDEEGNILEVLNSRTGTSTLTLVSEVEENNGNLWIGSVV  331



>ref|XP_003531955.1| PREDICTED: strictosidine synthase 3-like [Glycine max]
 gb|KHN37142.1| Strictosidine synthase [Glycine soja]
Length=349

 Score =   223 bits (568),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 131/309 (42%), Positives = 180/309 (58%), Gaps = 20/309 (6%)
 Frame = +3

Query  165   HAI-GPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTIL  335
             H++ G E VAF+  G+GPY GV+DGRILK+   K  +IDFA TSP R K +CDG  N  +
Sbjct  40    HSVFGSESVAFDCHGKGPYVGVSDGRILKWQETKREWIDFAVTSPHRNKKLCDGLQNDKM  99

Query  336   QLICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDE  515
             + +CGRPLGL+F+  T +LYIAD  FGLL VGP GG+A QLA    G+ F FTNA+ +D 
Sbjct  100   ESMCGRPLGLKFNTVTCELYIADAYFGLLVVGPSGGVAKQLATSAEGVPFRFTNALDIDT  159

Query  516   ST--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKD  689
              T  VYF DS ++F    +  I  SGD +GRLLKY   T  V V+++GL+ P G+A+SKD
Sbjct  160   KTGEVYFTDSSILFQRRVYISIILSGDRTGRLLKYVPSTQSVHVLVKGLAFPNGVALSKD  219

Query  690   KTFLLISEFIAKKITKYIIKGPKANTTQTL---LKLEGQPDNVKRATSGGYWVAVNI---  851
              +F+L++E    KI K  ++  K N    +    ++   PDN+KR   G +WVA N    
Sbjct  220   NSFILVAESTTFKILKIQLRDSKTNNNNNIEPFAQVPRSPDNIKRNNKGEFWVAQNSGRG  279

Query  852   ----LKppqpqqLIPMTESIAVKFDRNGK---ILDRKNVTSAYPNSFSAYLEHFGKAYTG  1010
                 L       L    + +A+KFD  G+   +LD +       +S S   EH G  + G
Sbjct  280   LIQKLGNEIETTLPWNADPVAIKFDEKGRAIVVLDGE--YGRQLDSVSEVEEHEGSLWIG  337

Query  1011  SLVPNFLGV  1037
             S V  F+G+
Sbjct  338   SAVQPFIGL  346



>ref|XP_002312353.2| hypothetical protein POPTR_0008s10940g [Populus trichocarpa]
 gb|EEE89720.2| hypothetical protein POPTR_0008s10940g [Populus trichocarpa]
Length=357

 Score =   223 bits (568),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/230 (47%), Positives = 158/230 (69%), Gaps = 4/230 (2%)
 Frame = +3

Query  171  IGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQLI  344
            +GPE +AF+  G+GPY  V+DGRILK+   K  +I+F+ +SP R + +CDG+ NT L+ +
Sbjct  48   VGPESIAFDCNGKGPYVSVSDGRILKWQGAKLGWIEFSVSSPQRDRHMCDGSTNTKLEPV  107

Query  345  CGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST-  521
            CGRPLGL+F+  T DLYIAD  +GLL VGP+GG+ATQLAA   G+ F F NA+ +D  T 
Sbjct  108  CGRPLGLKFNSATCDLYIADAYYGLLVVGPEGGVATQLAASAEGVPFRFMNALDVDSRTG  167

Query  522  -VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
             VYF DS + F    +     S D +GRL+KY+  + +VTV+L+GL+ P G+AISKD +F
Sbjct  168  VVYFTDSSIYFQRREYLLAIISADKTGRLMKYDPNSKKVTVLLKGLAFPNGVAISKDNSF  227

Query  699  LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVN  848
            +L++E    +I K+ + G + +  +T ++L   PDN+KR  +G +WVA+N
Sbjct  228  ILVAESFTMRILKFYLVGSEIHGQETFIQLGRFPDNIKRTANGEFWVALN  277



>ref|XP_008243874.1| PREDICTED: strictosidine synthase 3-like [Prunus mume]
Length=357

 Score =   223 bits (568),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 123/305 (40%), Positives = 181/305 (59%), Gaps = 16/305 (5%)
 Frame = +3

Query  165   HAIGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQ  338
               +GPE +AF+  G+GPY GV+DG ILK+      +I+FA TSP R + +CDG+ N   +
Sbjct  52    RVVGPESIAFDCHGQGPYVGVSDGTILKWQGPSLGWIEFAFTSPDRPRKLCDGSTNATNE  111

Query  339   LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
              ICGRPLGL+F+P+T DLYIAD  FGLLK GP GG    LA+ + G+   FTNA+ +DE 
Sbjct  112   PICGRPLGLKFNPKTCDLYIADAYFGLLKTGPNGGKPEVLASSLGGVPLMFTNALDVDEE  171

Query  519   T--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
             T  VYF D+  +F    + +   +GD +GRLLKY+  T  VTV+L  L+   G+A+SKDK
Sbjct  172   TGIVYFTDTSTVFQRRVWMQSILAGDKTGRLLKYDPCTKEVTVLLHDLAFANGVALSKDK  231

Query  693   TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVN-------I  851
             +F+L++E     I +  ++GPKA   +   +LE  PDN+K    G +WVA+N       +
Sbjct  232   SFILVAESAPFTIHRLWLRGPKAPAFELFAQLERPPDNIKSNNRGEFWVALNSGRGVKEV  291

Query  852   LKppqpqqLIPMTESIAVKFDRNG---KILDRKNVTSAYPNSFSAYLEHFGKAYTGSLVP  1022
             +      + + + + +A KFD  G   ++LD +   +    S S   E  G  + GS+V 
Sbjct  292   VNIATSDKWLNVNDPVAAKFDEQGTVVQVLDGEGGPAL--ESVSEVEEQNGNLWVGSVVK  349

Query  1023  NFLGV  1037
              ++GV
Sbjct  350   PYVGV  354



>ref|XP_004298326.1| PREDICTED: strictosidine synthase-like [Fragaria vesca subsp. 
vesca]
Length=346

 Score =   223 bits (567),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 130/303 (43%), Positives = 185/303 (61%), Gaps = 15/303 (5%)
 Frame = +3

Query  171   IGPEDVAFNGKGEGPYTGVADGRILKYY--NGKFIDFATTSPLRTKVICDGTNNTILQLI  344
             +GPE VAF+  G+GPY GV+DGRILK+   +  + +FA TSP  T+ ICD + +   + I
Sbjct  44    VGPESVAFDCAGKGPYVGVSDGRILKWQGPHRGWKEFAFTSP--TRKICDRSTDNATEPI  101

Query  345   CGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST-  521
             CGRPLGL+FHP+T +LYIAD  FG+LK+G  GG   QLA  +NG+ F FTNA+ +D  T 
Sbjct  102   CGRPLGLKFHPKTCELYIADAYFGILKIGRNGGHPQQLATSLNGVPFRFTNALEIDSHTG  161

Query  522   -VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF D+  IF    +     +GD +GRLL+Y+  T +VTV+L  L+   G+A+SKD +F
Sbjct  162   IVYFTDTSTIFQRRFWPLSIATGDKTGRLLQYDPCTKKVTVLLDKLAFANGVALSKDSSF  221

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVN---ILKppqp  869
             LL++E    KI K  ++GP A   +   +L+   DN+KR  +G +WVA+N    L+  Q 
Sbjct  222   LLVAESATSKIFKLWLRGPNAGDVELFTQLKRPADNIKRTDNGEFWVALNSRRALQGNQT  281

Query  870   qqLIPMT-ESIAVKFDRNG---KILDRKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGV  1037
                  +T + + VKFD  G   K+LD +   +    S S   EH GK + GS+V  ++GV
Sbjct  282   SSAFWLTKDPVGVKFDEQGNIVKVLDGEGGPTL--ESVSEVEEHNGKLWIGSVVKPYVGV  339

Query  1038  YTL  1046
               L
Sbjct  340   LRL  342



>ref|XP_010099026.1| Strictosidine synthase 1 [Morus notabilis]
 gb|EXB76384.1| Strictosidine synthase 1 [Morus notabilis]
Length=324

 Score =   222 bits (565),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 127/296 (43%), Positives = 183/296 (62%), Gaps = 13/296 (4%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNN-TILQLI  344
             ++GPE + F+  G GPYTG++DGR++K+    FI+   TSP RT + CDGTNN   L + 
Sbjct  34    SVGPEAITFDRFGGGPYTGISDGRVVKHNGSTFIEIFITSPNRTSLECDGTNNPATLGVT  93

Query  345   CGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGG-LATQLAAGVNGIKFSFTNAVALDEST  521
             CGRP G+ F+ R   L+IAD   GLL VG  G  LA  +A G  G+ F F NA+ +D+ T
Sbjct  94    CGRPFGVGFYFRENQLFIADAYRGLL-VGVLGKKLAVPIATGAEGVPFKFPNALDVDQLT  152

Query  522   --VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               VYF D+   F      +   + D++GRLLKY+  T +VTV+L+ LSG AG+AI+ ++T
Sbjct  153   GDVYFTDASARFSLSQIQEAVATNDSTGRLLKYDRRTQQVTVLLKNLSGAAGVAINANRT  212

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             F+L+SEFIA +ITK+ ++GP A  +Q +   +G PDN+KR  SG +WVAVN+  P     
Sbjct  213   FVLVSEFIANRITKFWLRGPNAFKSQVVATFQGMPDNIKRTPSGDFWVAVNV--PGPGGV  270

Query  876   LIPMTESIAVKFDRNGKILDRKNVTSAYPNSFSAYLEH--FGKAYTGSLVPNFLGV  1037
             ++P     A++ + NG IL   ++   Y N+  +  +   FG  Y GS V NF+GV
Sbjct  271   MLPT----AIRINGNGNILKTLHLEKYYKNTPISEFQQRGFGTYYIGSRVGNFVGV  322



>ref|XP_006436612.1| hypothetical protein CICLE_v10033527mg [Citrus clementina]
 gb|ESR49852.1| hypothetical protein CICLE_v10033527mg [Citrus clementina]
Length=338

 Score =   222 bits (566),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 127/298 (43%), Positives = 185/298 (62%), Gaps = 16/298 (5%)
 Frame = +3

Query  171   IGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRT-KVICDGTNNTILQL  341
             +GPE +AF+  GEGPY  V+DGRILK+ + K  + +FA T+P R  + ICDGT++TIL+ 
Sbjct  45    VGPESLAFDCNGEGPYASVSDGRILKWQDSKLGWTEFAITTPFRRLRRICDGTSSTILEP  104

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST  521
             +CGRPLG++F+P T DLYIAD  FGL+ VG  GG A QLA+    I F FTNA+ +D +T
Sbjct  105   LCGRPLGIKFNPVTCDLYIADAYFGLMVVGRNGGPAKQLASSAERIPFRFTNALDIDPNT  164

Query  522   --VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               VYF DS + F    +  + +SGD SGRLLKY+    +VTV+ RGL+ P G+ +S DK+
Sbjct  165   GVVYFTDSSMYFQRRQYPMLIESGDRSGRLLKYDPRNKQVTVLRRGLAFPNGVTLSNDKS  224

Query  696   FLLISEFIAKKITKYIIKGPK-ANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpq  872
             FLL++E  +++I ++ ++G     + Q   ++   PDN++   +G +WVA+N  +     
Sbjct  225   FLLVAESDSRRILRFWVEGESVVYSPQPFAQVAQFPDNIETDRNGDFWVALNTKRGNDK-  283

Query  873   qLIPMTESIAVKFD-RNGKILD--RKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGV  1037
                  T+ +AVK D  NG +LD    N  +A  +S S   EH    Y GS V  ++ V
Sbjct  284   -----TDLVAVKLDGSNGNVLDVLEGNKQNAL-DSVSEVEEHGAYLYAGSPVQPYVVV  335



>emb|CDX95058.1| BnaC05g06130D [Brassica napus]
Length=374

 Score =   223 bits (568),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 124/303 (41%), Positives = 179/303 (59%), Gaps = 13/303 (4%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE +AF+  G GPYTGVADGRIL +   ++ DFA TS  R++ +CD  ++ +  L    
Sbjct  72    GPESIAFDPLGRGPYTGVADGRILFWDGTRWTDFAYTSNNRSE-LCDTKSSLLAYLKNEH  130

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-ES  518
             ICGRPLGL FH RTGDLY+AD  FG++KVGP+GGLAT L    +G+   FTN + +D E 
Sbjct  131   ICGRPLGLRFHKRTGDLYVADAYFGIMKVGPEGGLATSLTTEGDGVPLRFTNDLDVDDEG  190

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF DS  +F   NF  +  SG+ +GR+LKY  ET   T +LR L  P GL++ KD +F
Sbjct  191   NVYFTDSSSVFQRRNFMHLIVSGEDTGRVLKYNPETKETTTLLRNLQFPNGLSLGKDGSF  250

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
              +  E    ++ KY +KG KA T++ +  L G PDN++    G +WVAV+  +      +
Sbjct  251   FIFCEGSIGRLRKYWLKGEKAGTSEVVALLHGFPDNIRTNKDGDFWVAVHCHRNIFTHVM  310

Query  879   IP------MTESIAVKFDRNGKILD-RKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGV  1037
                        ++AVK+ ++GK+L   ++       + S   E  GK + GS++ +F+ V
Sbjct  311   AHHPNVGGWPHAVAVKYSKDGKVLKVLEDKQGKVVKAVSEIEEKDGKLWMGSVLMSFIAV  370

Query  1038  YTL  1046
             Y L
Sbjct  371   YDL  373



>emb|CDP21857.1| unnamed protein product, partial [Coffea canephora]
Length=337

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 120/296 (41%), Positives = 180/296 (61%), Gaps = 11/296 (4%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNG--KFIDFATTSPLR--TKVICDGTNNTILQL  341
             GPE  AF+  G GPYTGVADGRILKY      F+++  T   R  +K +CD  + T L  
Sbjct  43    GPESYAFDLAGHGPYTGVADGRILKYEGPILGFVEYGYTKENRQESKQLCDNIDTTDLAK  102

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST  521
             ICGRPLG+ F+ +TG+L+ AD   GL+ VGP+GG   QLA+G  G+ F   + + +D+ T
Sbjct  103   ICGRPLGIGFYYKTGELHTADAGLGLVVVGPEGGPGKQLASGAEGVPFGLPDGLEVDKKT  162

Query  522   --VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               ++F ++   +     ++I  + D SGRLLKY+ +T +VTV+LR L+GPAG+AIS+D +
Sbjct  163   GVIFFTEASSRYNISQISQIISTRDASGRLLKYDPQTKKVTVLLRSLAGPAGVAISRDGS  222

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             +LL++EF+ +++ KY +KGP ANTT+ L+ L G PD +KR + G YW+ +N+        
Sbjct  223   YLLVTEFLNQRVLKYWLKGPLANTTRVLVNLSGSPDKIKRNSRGDYWIGLNVQSQGPN--  280

Query  876   LIPMTESIAVKFDRNGKILDRKNVTSAYPNS-FSAYLEHFGKAYTGSLVPNFLGVY  1040
               P T     + +  G IL+    +  +  S  +   E+ G  Y GSL   ++GVY
Sbjct  281   --PTTIIQGQRINGKGHILETITFSPDFNASVITEVQEYKGALYLGSLFVGYVGVY  334



>emb|CBI35408.3| unnamed protein product [Vitis vinifera]
Length=653

 Score =   229 bits (583),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 125/298 (42%), Positives = 180/298 (60%), Gaps = 11/298 (4%)
 Frame = +3

Query  66   LTMFWISILIFISSPCVIHSQppgillpiklklHAIGPEDVAFNGKGEGPYTGVADGRIL  245
            L+ F+I   I IS    ++S        ++L     GPE +AF+  G+GPYTG++DGRIL
Sbjct  3    LSQFFIFSFILISLFGCVNSHQALKYNTLELPSGVSGPESIAFDCNGDGPYTGISDGRIL  62

Query  246  KYYNGK--FIDFATTSPLRTKVICDGTNNTILQLICGRPLGLEFHPRTGDLYIADVNFGL  419
            K+   K  + +FA TSP R    CDG+ N  ++ +CGRPLGL+F+  T DLYIAD  FGL
Sbjct  63   KWQGSKHGWKEFAITSPFRIPKFCDGSLNPAMEQVCGRPLGLKFNEATCDLYIADAYFGL  122

Query  420  LKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--VYFVDSGLIFLTGNFTKIAQSGDT  593
            L VG  GG+A Q+A    G+ F FTNA+ +D++T  VYF D+  IF    +    Q GD 
Sbjct  123  LVVGQNGGVAKQVAISAEGVPFRFTNALDIDQNTGVVYFTDTSTIFQRWAYAIAMQIGDK  182

Query  594  SGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFLLISEFIAKKITKYIIKGPKANTTQ  773
            +GRLLKY+  T  VTV+LRGLS   G+A+S+DK F+L++E  A K+T+Y ++  K+  + 
Sbjct  183  TGRLLKYDPRTKEVTVLLRGLSFSNGVALSEDKDFVLVTETTAAKVTRYWLQCQKSQLSD  242

Query  774  TLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqLIPMTESIAVKFDRNGKILDRKNV  947
            T  +L G PDN++R   G +WVA N           P  +   V+ ++ GKI++  +V
Sbjct  243  TFTQLVGCPDNIQRNIHGEFWVAQNNCGR-------PEVKVRPVRLNKEGKIVEELSV  293


 Score =   228 bits (582),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 121/292 (41%), Positives = 179/292 (61%), Gaps = 14/292 (5%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQLIC  347
             GPE +AF+  G+GPYTG++DGRILK+   K  + +FA TSP R    CDG+ N  ++ +C
Sbjct  370   GPESIAFDCNGDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPKFCDGSLNPAMEQVC  429

Query  348   GRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--  521
             GRPLGL+F+    DLYIA+  FGLL VG  GG+A Q+A    G+ F FTNA+ +D++T  
Sbjct  430   GRPLGLKFNEAKCDLYIANAYFGLLVVGRNGGVAKQVAISAEGVPFRFTNALDIDQNTGV  489

Query  522   VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFL  701
             VYF D+  IF    +    Q+GD +GRLLKY+  +  VTV+LRGLS   G+A+SKDK F+
Sbjct  490   VYFTDTSTIFQRWAYAIAMQTGDKTGRLLKYDPRSKEVTVLLRGLSFSNGVALSKDKDFV  549

Query  702   LISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqLI  881
             L++E    K+T+Y ++G K+  + T  +L G PDN++R   G +WVA N           
Sbjct  550   LVTETTTAKVTRYWLQGQKSQLSDTFTQLVGCPDNIQRNIHGEFWVAQNNCGR-------  602

Query  882   PMTESIAVKFDRNGKILDRKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGV  1037
             P  + I++K ++ GKI++     S      S   E     + GS++ +++G+
Sbjct  603   PELKVISIKLNKEGKIMEE---LSEDFGPLSEVQEKDNDLWLGSVLLSYIGM  651



>ref|XP_006436697.1| hypothetical protein CICLE_v10033295mg [Citrus clementina]
 gb|ESR49937.1| hypothetical protein CICLE_v10033295mg [Citrus clementina]
Length=338

 Score =   220 bits (560),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 127/298 (43%), Positives = 185/298 (62%), Gaps = 16/298 (5%)
 Frame = +3

Query  171   IGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRT-KVICDGTNNTILQL  341
             +GPE +AF+  G+GPY GV+DGRILK+ + K  + +FA T+P R  + ICDGT++TIL+ 
Sbjct  45    VGPESLAFDCNGKGPYAGVSDGRILKWQDSKLGWTEFAITTPFRRLRRICDGTSSTILEP  104

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST  521
             +CGRPLG++F+P T DLYIAD  FGL+ VG  GG A QLA+    I F FTNA+ +D +T
Sbjct  105   LCGRPLGIKFNPVTCDLYIADAYFGLMVVGRNGGPAKQLASSAERIPFRFTNALDIDPNT  164

Query  522   --VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               VYF DS + F    +  + +SGD SGRLLKY+    +VTV+ RGL+ P G+ +S DK+
Sbjct  165   GVVYFTDSSMYFQRRQYPMLIESGDRSGRLLKYDPRNKQVTVLRRGLAFPNGVTLSNDKS  224

Query  696   FLLISEFIAKKITKYIIKGPKA-NTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpq  872
             FLL++E  ++ I ++ ++G     + Q   ++   PDN++   +G +WVA+N  +     
Sbjct  225   FLLVAESDSRTILRFWVEGESVIYSPQPFAQVAQFPDNIETDRNGDFWVALNTKRGNDK-  283

Query  873   qLIPMTESIAVKFD-RNGKILD--RKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGV  1037
                  T+ +AVK D  NG +LD    N  +   +S S   EH G  Y GS V  ++ V
Sbjct  284   -----TDLVAVKLDGSNGNVLDVLEGNKQNDL-DSVSEVEEHGGYLYAGSPVQPYVVV  335



>gb|ACU23577.1| unknown [Glycine max]
Length=349

 Score =   220 bits (560),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 130/308 (42%), Positives = 178/308 (58%), Gaps = 20/308 (6%)
 Frame = +3

Query  165   HAI-GPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTIL  335
             H++ G E VAF+  G+GPY GV+DGRILK+   K  +IDFA TSP R K +CDG  N  +
Sbjct  40    HSVFGSESVAFDCHGKGPYVGVSDGRILKWQETKREWIDFAVTSPHRNKKLCDGLQNDKM  99

Query  336   QLICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDE  515
             + +CGRPLGL+F+  T +LYIAD  FGLL VGP GG+A QLA    G+ F FTNA+ +D 
Sbjct  100   ESMCGRPLGLKFNTVTCELYIADAYFGLLVVGPSGGVAKQLATSAEGVPFRFTNALDIDT  159

Query  516   ST--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKD  689
              T  VYF DS ++F    +  I  SGD +GRLLKY   T  V V+++GL+ P G+A+SKD
Sbjct  160   KTGEVYFTDSSILFQRRVYISIILSGDRTGRLLKYVPSTQSVHVLVKGLAFPNGVALSKD  219

Query  690   KTFLLISEFIAKKITKYIIKGPKANTT---QTLLKLEGQPDNVKRATSGGYWVAVNI---  851
              +F+L++E    KI K  ++  K N     +   ++   PDN+KR   G +WVA N    
Sbjct  220   NSFILVAESTTFKILKIQLRDSKTNNNNNIEPFAQVPRSPDNIKRNNKGEFWVAQNSGRG  279

Query  852   ----LKppqpqqLIPMTESIAVKFDRNGK---ILDRKNVTSAYPNSFSAYLEHFGKAYTG  1010
                 L       L    + +A+KFD  G+   +LD +       +S S   EH G  + G
Sbjct  280   LMQKLGNEIETTLPWNADPVAIKFDEKGRAIVVLDGE--YGRQLDSVSEVEEHEGSLWIG  337

Query  1011  SLVPNFLG  1034
               V  F+G
Sbjct  338   FAVQPFIG  345



>emb|CBI24410.3| unnamed protein product [Vitis vinifera]
Length=328

 Score =   218 bits (556),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 127/301 (42%), Positives = 182/301 (60%), Gaps = 11/301 (4%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK-FIDFATTSPLRTKVICDGTNNTILQL---  341
             GPE VAF+  G GPYTGVADGRIL ++NG+ + DFA TSP R++ +CD   + +  L   
Sbjct  30    GPESVAFDPLGRGPYTGVADGRIL-FWNGEAWSDFAYTSPNRSE-LCDPKPSPLSYLKNE  87

Query  342   -ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
              ICGRPLGL F+ RTGDLYIAD   GL+KVGP+GGLAT L    +G+   FTN + +D++
Sbjct  88    HICGRPLGLRFNKRTGDLYIADSYLGLMKVGPEGGLATSLVTEADGVPLRFTNDLDIDDA  147

Query  519   -TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               +YF DS   +   NF ++  S + SGRLLKY+  T   TV+LRGL  P G+++SKD +
Sbjct  148   GNIYFTDSSSKYQRRNFMQLVFSSEDSGRLLKYDPLTKETTVLLRGLQFPNGVSLSKDGS  207

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             FL++ E    ++ KY +KG KA T++    L G PDNV+    G +WVA++  +      
Sbjct  208   FLVLCEGSPGRLVKYWLKGDKAGTSEVFAILPGYPDNVRTNEKGEFWVAIHCRRTMYQYL  267

Query  876   LI--PMTESIAVKFDRNGKILD-RKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGVYTL  1046
             L       ++ VK+   GK++   ++       + S   E  GK + GS++  F+ VY L
Sbjct  268   LHIGGRLHAVVVKYSPEGKLVKILEDSEGKVVRAVSEVEEREGKLWMGSVLMPFVAVYQL  327

Query  1047  K  1049
             +
Sbjct  328   E  328



>dbj|BAJ53159.1| JHL10I11.5 [Jatropha curcas]
 gb|KDP20050.1| hypothetical protein JCGZ_05819 [Jatropha curcas]
Length=336

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 127/303 (42%), Positives = 182/303 (60%), Gaps = 18/303 (6%)
 Frame = +3

Query  165   HAIGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDG-TNNTIL  335
               +GPE  AF+ +G+GPYTGV DGR LKY      F+D+A  SP R+K  CDG TN +  
Sbjct  42    QVMGPEAFAFDLQGQGPYTGVLDGRTLKYQGPSLGFLDYAFDSPNRSKAACDGNTNPSAF  101

Query  336   QLICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDE  515
               ICGRPLG+ F   TG+LYIAD N GLL     G LA  +A+   G  F F + + +  
Sbjct  102   GGICGRPLGIGFQ-YTGELYIADANLGLLVASTNGRLARAVASSAEGQPFKFLDGLDIYP  160

Query  516   --STVYFVDSGLIFLTGNFTKIAQS---GDTSGRLLKYEMETGRVTVVLRGLSGPAGLAI  680
                TV+  D+   F   NF+++AQ+    D++GR +KYE      TV+LR LS PAG+A+
Sbjct  161   LTKTVFLTDASSRF---NFSELAQAVAANDSTGRFIKYEPNINTTTVLLRNLSAPAGVAV  217

Query  681   SKDKTFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKp  860
             S D +F+L++E++A ++ KY +KGPKANT++ L+  +G+PDN+KR   G +WVAVN+ + 
Sbjct  218   SLDGSFVLVTEYLANRVLKYWLKGPKANTSEALVTFQGRPDNIKRNPLGDFWVAVNV-QE  276

Query  861   pqpqqLIPMTESIAVKFDRNGKILDRKNVTSAY-PNSFSAYLEHFGKAYTGSLVPNFLGV  1037
                  ++P     AVK + +GKIL    ++  Y   + S   E+ G  Y GSL   F+G 
Sbjct  277   TPTAPIVP----TAVKINYSGKILASFPLSDQYNTTTISEVNEYDGNLYIGSLETKFVGK  332

Query  1038  YTL  1046
             Y +
Sbjct  333   YRI  335



>emb|CDX93560.1| BnaA06g04880D [Brassica napus]
Length=393

 Score =   220 bits (561),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 126/322 (39%), Positives = 182/322 (57%), Gaps = 32/322 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE +AF+  G GPYTGVADGRIL +   ++ DFA TS  R++ +CD  ++ +  L    
Sbjct  72    GPESIAFDPLGRGPYTGVADGRILFWDGTRWTDFAYTSNNRSE-LCDTKSSLLAYLKNEH  130

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES-  518
             ICGRPLGL FH RTGDLYIAD  FG++KVGP+GGLAT L    +G+   FTN + +DE  
Sbjct  131   ICGRPLGLRFHKRTGDLYIADAYFGIMKVGPEGGLATSLTTEADGVPLRFTNDLDVDEEG  190

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF DS  +F   NF  +  SG+ +GR+LKY  ET   T +LR L  P GL++ +D +F
Sbjct  191   NVYFTDSSSVFQRRNFMHLIVSGEDTGRVLKYNPETKETTTLLRNLQFPNGLSLGRDGSF  250

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
              +  E    ++ KY +KG KA T++ +  L G PDN++    G +WVAV+  +      +
Sbjct  251   FIFCEGSIGRLRKYWLKGEKAGTSEVVALLHGFPDNIRTNKDGDFWVAVHCHRNIFTHVM  310

Query  879   ------------IPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                         +P+T              ++AVK+  +GK+L   ++       + S  
Sbjct  311   AHHPNVRKFFLKLPITVKFQYLLQVGGWPHAVAVKYSEDGKVLKVLEDKQGKVVKAVSEI  370

Query  981   LEHFGKAYTGSLVPNFLGVYTL  1046
              E  GK + GS++ +F+ VY L
Sbjct  371   EEKDGKLWMGSVLMSFIAVYDL  392



>ref|XP_006485325.1| PREDICTED: strictosidine synthase 3-like [Citrus sinensis]
Length=473

 Score =   222 bits (566),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 128/297 (43%), Positives = 185/297 (62%), Gaps = 17/297 (6%)
 Frame = +3

Query  171   IGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQLI  344
             +GPE +AF+  GEGPY GV+DGRILK+ + K  + +FA T+P R   ICDGT++TIL+ +
Sbjct  183   VGPESLAFDCNGEGPYAGVSDGRILKWQDSKLGWTEFAITTPFRR--ICDGTSSTILEPL  240

Query  345   CGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST-  521
             CGRPLG++F+P T DLYIAD  FGL+ VG  GG A QLA+    I F FTNA+ +D +T 
Sbjct  241   CGRPLGIKFNPVTCDLYIADAYFGLMVVGRNGGPAKQLASSAERIPFRFTNALDIDPNTG  300

Query  522   -VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF DS + F    +  + +SGD SGRLLKY+    +VTV+ RGL+ P G+ +S DK+F
Sbjct  301   VVYFTDSSMYFQRRQYPMLIESGDRSGRLLKYDPRNKQVTVLRRGLAFPNGVTLSNDKSF  360

Query  699   LLISEFIAKKITKYIIKGPKA-NTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             LL++E  +++I ++ ++G     + Q   ++   PDN++   +G +WVA+N  +      
Sbjct  361   LLVAESDSRRILRFWVEGESVIYSPQPFAQVAQFPDNIETDRNGDFWVALNTKRGNDK--  418

Query  876   LIPMTESIAVKFD-RNGKILD--RKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGV  1037
                 T+ +AVK D  NG +LD    N  +   +S S   EH G  Y GS V  ++ V
Sbjct  419   ----TDLVAVKLDGSNGNVLDVLEGNKQNDL-DSVSEVEEHGGYLYAGSPVQPYVVV  470



>ref|XP_009627580.1| PREDICTED: strictosidine synthase 1-like [Nicotiana tomentosiformis]
Length=372

 Score =   219 bits (558),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 129/323 (40%), Positives = 179/323 (55%), Gaps = 32/323 (10%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQL  341
             A+GPE +AF+  GEGPYTGVADGRILK+      ++DFA TS  R + +     +  ++ 
Sbjct  51    AVGPESLAFDPNGEGPYTGVADGRILKWQGDSEGWVDFAVTSSQRKECVRHFAPH--MEH  108

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST  521
             +CGRPLGL F  RTGDLYIAD   GL  VGP GGLAT L   V G    FTN + LDE  
Sbjct  109   VCGRPLGLRFDTRTGDLYIADAYLGLQVVGPSGGLATPLVTEVEGQPLHFTNDMDLDEQE  168

Query  522   --VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               +YF D+   F    F     SGD +GRL+KY+  T  VTV+LRGL+   G+A+SKDK+
Sbjct  169   DIIYFTDTSTQFQRRQFIASVVSGDKTGRLMKYDKSTKAVTVLLRGLAFANGVALSKDKS  228

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             F+L++E    +I +Y +KGP A    T   L G PDN++R + G +WVA++  +    Q 
Sbjct  229   FVLVAETSTGRIVRYWLKGPDAGKHDTFADLPGYPDNIRRNSRGEFWVALHSKRSLLAQL  288

Query  876   L------------IPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSA  977
             +            +P T              + A+K    G++L+  ++V S      S 
Sbjct  289   VTSNSWLGRTLLKLPFTFQQLHYLLVGGQPHATAIKLSEEGQVLEVLEDVESKTLKFLSE  348

Query  978   YLEHFGKAYTGSLVPNFLGVYTL  1046
               E  G+ + GS++  F+GVY L
Sbjct  349   VEEKNGRLWIGSVLVPFVGVYEL  371



>ref|XP_004981761.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Setaria italica]
Length=398

 Score =   219 bits (559),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 126/323 (39%), Positives = 180/323 (56%), Gaps = 32/323 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE VAF+ +G GPYTGVADGR++ +   ++  FAT SP  T+ +C G   + L+     
Sbjct  72    GPESVAFDPRGRGPYTGVADGRVVFWDGERWAHFATASPRWTQELCGGPRASPLEYLPNE  131

Query  342   -ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-E  515
              ICGRPLGL F  RTGDLYIAD  FGLLKVGP+GGLAT LA    G++ +FTN + LD E
Sbjct  132   HICGRPLGLRFDKRTGDLYIADAYFGLLKVGPEGGLATPLATEAEGVRLNFTNDLDLDDE  191

Query  516   STVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               VYF DS + +   NF ++  SGD SGRLLKY  +T   TV+ R L  P G+++SKD +
Sbjct  192   GNVYFTDSSIHYQRRNFMQLVFSGDPSGRLLKYNPQTKETTVLHRNLQFPNGVSMSKDGS  251

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             F +  E    ++++Y +KG KA T      L G PDNV+    G +WVA++  +    + 
Sbjct  252   FFVFCEGSRGRLSRYWLKGEKAGTVDLFAILPGFPDNVRTNEKGEFWVAIHCRRSLYARL  311

Query  876   L--------------IPMT-----------ESIAVKFDRNGKILD-RKNVTSAYPNSFSA  977
             +              IP              ++ +K+  +G++LD  ++       + S 
Sbjct  312   MSRHVKLRKFLLSLPIPAKYHYLSQIGGRLHAVIIKYSPDGEVLDILEDTKGEVVRAVSE  371

Query  978   YLEHFGKAYTGSLVPNFLGVYTL  1046
               E  GK + GS++  F+ V+ L
Sbjct  372   VEEKDGKLWIGSVLMPFIAVFDL  394



>ref|XP_008465977.1| PREDICTED: strictosidine synthase 1-like [Cucumis melo]
Length=371

 Score =   219 bits (557),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 128/312 (41%), Positives = 177/312 (57%), Gaps = 26/312 (8%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQLIC  347
             GPE +AF+ +GEGPY  V+DGRILK+      +  FA TSP R    CDG   +  +  C
Sbjct  58    GPESIAFDCRGEGPYASVSDGRILKWKGPDLGWTQFALTSPNREGKECDGQPQS--EAAC  115

Query  348   GRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--  521
             GRPLG++FHP T DLYIAD  FGLL VGPKGGLA QLA    G+   FTNA+ +D     
Sbjct  116   GRPLGIKFHPTTCDLYIADAYFGLLAVGPKGGLARQLATSAQGVPLRFTNALDIDPQNGV  175

Query  522   VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFL  701
             VYF DS ++F    +     +GD +GRLLKY+  T  VTV+  GL+ P G+A++ D +FL
Sbjct  176   VYFTDSSILFQRRVWLLSIMNGDKTGRLLKYDPRTQNVTVLRNGLAFPNGVALNADSSFL  235

Query  702   LISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNI----------  851
             L++E    +I K+ +KGPKANT +   +LE  PDN+KR  +G +W+A+N           
Sbjct  236   LMAETGTLQILKFWLKGPKANTMEIFAQLERFPDNIKRTDNGDFWIAMNTARGKLDTQTW  295

Query  852   -------LKppqpqqLIPMTES--IAVKFDRNGKILDRKNVTSAYP-NSFSAYLEHFGKA  1001
                     K  Q +  IP  ++  +AVK D  G++    +        S S   E  G+ 
Sbjct  296   KEMYMRGAKLQQGEVKIPWIQADPVAVKLDERGEVKGMVDGGEGQALESVSEVEESRGRL  355

Query  1002  YTGSLVPNFLGV  1037
             + GS V  ++G+
Sbjct  356   WIGSAVKPYVGL  367



>ref|XP_009148103.1| PREDICTED: strictosidine synthase 3 [Brassica rapa]
Length=393

 Score =   219 bits (558),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 125/322 (39%), Positives = 182/322 (57%), Gaps = 32/322 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE +AF+  G GPYTGVADGRIL +   ++ DFA TS  R++ +CD  ++ +  L    
Sbjct  72    GPESIAFDPLGRGPYTGVADGRILFWDGTRWTDFAYTSNNRSE-LCDTKSSLLAYLKNEH  130

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES-  518
             ICGRPLGL FH RTGDLYIAD  FG++KVGP+GGLAT L    +G+   FTN + +DE  
Sbjct  131   ICGRPLGLRFHKRTGDLYIADAYFGIMKVGPEGGLATSLTTEADGVPLRFTNDLDVDEEG  190

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF DS  +F   NF  +  SG+ +GR+LKY  ET   T +LR L  P GL++ +D +F
Sbjct  191   NVYFTDSSSVFQRRNFMHLIVSGEDTGRVLKYNPETKETTTLLRNLQFPNGLSLGRDGSF  250

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
              +  E    ++ KY +KG K+ T++ +  L G PDN++    G +WVAV+  +      +
Sbjct  251   FIFCEGSIGRLRKYWLKGEKSGTSEVVALLHGFPDNIRTNKDGDFWVAVHCHRNIFTHVM  310

Query  879   ------------IPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                         +P+T              ++AVK+  +GK+L   ++       + S  
Sbjct  311   AHHPNVRKFFLKLPITVKFQYLLQVGGWPHAVAVKYSEDGKVLKVLEDKQGKVVKAVSEI  370

Query  981   LEHFGKAYTGSLVPNFLGVYTL  1046
              E  GK + GS++ +F+ VY L
Sbjct  371   EEKDGKLWMGSVLMSFIAVYDL  392



>emb|CAN77943.1| hypothetical protein VITISV_044019 [Vitis vinifera]
Length=300

 Score =   216 bits (550),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 114/266 (43%), Positives = 166/266 (62%), Gaps = 10/266 (4%)
 Frame = +3

Query  264   FIDFATTSPLRTKVICDGTNNTILQLICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGG  443
             F DFA T+P R+K +CDGT +      CGRPLG+ F+  TG LYIAD   GLL VG  GG
Sbjct  36    FTDFAYTTPTRSKAVCDGTTDPNSGPTCGRPLGVGFNNLTGQLYIADAYSGLLVVGSNGG  95

Query  444   LATQLAAGVNGIKFSFTNAVALDEST--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYE  617
             LAT +A    G+ F F N + +D+ T  VYF D+  ++   + T+  ++ D SGRLLKY+
Sbjct  96    LATPVATTAEGVPFRFLNGLDVDQLTGNVYFTDASSVYELRDITQGVENNDASGRLLKYD  155

Query  618   METGRVTVVLRGLSGPAGLAISKDKTFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQ  797
               T +VTV++RGLSGPAG A+S+D +F+L+SEFIA +  K+ ++GPKANT++     +G+
Sbjct  156   PSTKQVTVLIRGLSGPAGAAVSRDGSFVLVSEFIANRTQKFWLRGPKANTSELFFTFQGR  215

Query  798   PDNVKRATSGGYWVAVNILKppqpqqLIPMTESIAVKFDRNGKILDRKNVTSAYPNSFSA  977
             PDN+K + +  +WVAVNI K       +P T     + D +G +L   N  + Y ++  +
Sbjct  216   PDNIKTSITDTFWVAVNIGKS------VPTTVPTGQRMDAHGNVLQTVNFEAEYGSTMIS  269

Query  978   YLEHFGKA--YTGSLVPNFLGVYTLK  1049
              ++  G    Y GS   +++GVYTLK
Sbjct  270   EVQXRGXIFLYVGSRDASYVGVYTLK  295



>gb|AFK49369.1| unknown [Lotus japonicus]
Length=334

 Score =   217 bits (553),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 118/298 (40%), Positives = 179/298 (60%), Gaps = 13/298 (4%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYY--NGKFIDFATTSPLRTKVICDGTNN-TILQLI  344
             GPE +AF+  G GPY   +DGRI KY   N  F ++A TSP R K+ CDG  + + LQ  
Sbjct  39    GPEALAFDRNGSGPYVSSSDGRIFKYVGPNEGFQEYAYTSPNRNKITCDGLADFSTLQAT  98

Query  345   CGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST-  521
             CGRPLGL F+ +TG+LY+AD  FGLLK+G  GG   QL     G    F + + +D  T 
Sbjct  99    CGRPLGLGFNHQTGELYVADAYFGLLKIGANGGPPIQLVGPAQGNSSMFADGLDIDPDTG  158

Query  522   -VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF ++   F   + + I  SGD++GRLLKY+  T + TV+L  L+ P G+A+S+D +F
Sbjct  159   IVYFTEASANFQIKDISTILTSGDSTGRLLKYDPSTNQTTVLLSDLAVPNGVAVSRDGSF  218

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNI---LKppqp  869
             +L+SEF+  +I ++ +KGP+AN + T ++L G+PDN+KR + G +WVAVN    L     
Sbjct  219   VLVSEFMENRIQRFWLKGPRANLSDTFIRLAGKPDNIKRNSRGQFWVAVNSYLGLPRRPI  278

Query  870   qqLIPMTESIAVKFDRNGKILDRKNVTSAYPNSFSAYLEHF-GKAYTGSLVPNFLGVY  1040
             ++++P      V+   NG +L   ++   Y    ++ ++ F G  Y GSL  ++  ++
Sbjct  279   RRVLPS----GVRISENGLVLQVVSLAQEYGTEPASEVQEFNGTLYAGSLFVSYASIF  332



>ref|XP_002273764.1| PREDICTED: strictosidine synthase 1 [Vitis vinifera]
Length=370

 Score =   218 bits (555),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 135/365 (37%), Positives = 198/365 (54%), Gaps = 37/365 (10%)
 Frame = +3

Query  57    MKSLTMFWISILIFISS------PCVIHSQppgillpiklklHAIGPEDVAFNGKGEGPY  218
             + ++T+  ISI++ ++S      P +  +        +     A GPE +AF+ KGEGPY
Sbjct  7     LTAITLAAISIILAVNSNHLFKPPSIPGTHDLLHGSEVIQVTGAFGPESIAFDPKGEGPY  66

Query  219   TGVADGRILKYY-NGK-FIDFATTSPLRTKVICDGTNNTILQLICGRPLGLEFHPRTGDL  392
             TGVADGR+LK+  +G+ + DFA T+  R +  C       ++ ICGRPLGL F  +TGDL
Sbjct  67    TGVADGRVLKWEGDGRGWTDFAVTTSERKE--CVRPFAPEMEHICGRPLGLRFDKKTGDL  124

Query  393   YIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDE--STVYFVDSGLIFLTGNF  566
             YIAD  FGL  V P GGLAT L   V G +  FTN + +DE    +YF D+   F    F
Sbjct  125   YIADAYFGLQVVEPNGGLATPLVTEVEGRRLLFTNDMDIDEVEDVIYFTDTSTDFHRRQF  184

Query  567   TKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFLLISEFIAKKITKYII  746
                  SGD +GRL+KY+  +  VTV+LRGL+   G+A+SKD++F+L++E    KI +Y +
Sbjct  185   MAALLSGDNTGRLMKYDKSSKEVTVLLRGLAFANGVAMSKDRSFVLVAETTTGKIIRYWL  244

Query  747   KGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL------------IPMT  890
             KGP A  +    ++ G PDNV+R + G +WVA++  K P    +            +P+T
Sbjct  245   KGPNAGKSDVFAEVPGYPDNVRRNSKGEFWVALHAKKGPHANWITSNSWVGKTLLKLPLT  304

Query  891   ------------ESIAVKFDRNGKILDRKNVTSAYPNSF-SAYLEHFGKAYTGSLVPNFL  1031
                          + A+K    G++L+           F S   EH GK + GS++  F+
Sbjct  305   FKQLHKLIVVEAHATAIKLSEEGQVLEVLEDCEGKSMRFISEVEEHNGKLWLGSVMMPFI  364

Query  1032  GVYTL  1046
             GVY L
Sbjct  365   GVYDL  369



>ref|XP_002273580.1| PREDICTED: strictosidine synthase 3 [Vitis vinifera]
 emb|CBI35398.3| unnamed protein product [Vitis vinifera]
Length=340

 Score =   217 bits (552),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 126/293 (43%), Positives = 183/293 (62%), Gaps = 11/293 (4%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQLIC  347
             GPE + F+  GEGPYTGV+DGRILK++  +  + DFA TSPLRT  +CDG ++T  + +C
Sbjct  47    GPETLVFDCNGEGPYTGVSDGRILKWHGSEVGWKDFAVTSPLRTSRLCDGLSDTSAEHVC  106

Query  348   GRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES--T  521
             GRPLGL+F+  T DLYIAD  FGLL VG KGGLA QLA    GI F F NAV +D+   T
Sbjct  107   GRPLGLKFNQATCDLYIADAYFGLLVVGRKGGLARQLATSAEGIPFLFANAVDIDQKTGT  166

Query  522   VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFL  701
             VYF D+   F    F    +SGD +GRL++Y+ +T +V V+L+ L    G+A+S++ +FL
Sbjct  167   VYFTDTSTRFRRWEFGIAMESGDNTGRLMRYDPKTKKVKVLLKHLFFANGVALSRNGSFL  226

Query  702   LISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqLI  881
             L++E  A ++ ++ ++GP++ T     KL+G PDN++R   G +WVA N   P       
Sbjct  227   LVTETNANRVLRFWLEGPRSQTRDVFAKLDGCPDNIERNPKGEFWVAQN---PKFDSIGT  283

Query  882   PMTESI-AVKFDRNGKILDRKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGV  1037
             P+  +I A+K D  GK+L    V +    S S  +E     + GS++ + +G+
Sbjct  284   PLQTNISALKLDEEGKVL---RVLNEEFGSLSDVIEKDDCMWLGSVLQSHVGM  333



>ref|XP_009797408.1| PREDICTED: strictosidine synthase 1-like [Nicotiana sylvestris]
Length=372

 Score =   218 bits (554),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 135/358 (38%), Positives = 190/358 (53%), Gaps = 38/358 (11%)
 Frame = +3

Query  81    ISILIFISS------PCVIHSQppgillpiklklHAIGPEDVAFNGKGEGPYTGVADGRI  242
             I++++ +SS      P +  S+       +     A+GPE +AF+  GEGPYTGVADGRI
Sbjct  16    ITVILTLSSKNVYRPPSIAGSKDLLSKAEVIQLKGAVGPESLAFDPNGEGPYTGVADGRI  75

Query  243   LKYYNGK--FIDFATTSPLRTKVICDGTNNTILQLICGRPLGLEFHPRTGDLYIADVNFG  416
             LK+      ++DFA TS  R +  C       ++ +CGRPLGL F  RTGDLYIAD   G
Sbjct  76    LKWQGDSQGWVDFAVTSSQRKE--CVRPFAPHMEHVCGRPLGLRFDTRTGDLYIADAYLG  133

Query  417   LLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--VYFVDSGLIFLTGNFTKIAQSGD  590
             L  VGP GGLAT L   V G    FTN + LDE    +YF D+   F    F      GD
Sbjct  134   LQVVGPSGGLATPLVTEVEGQPLRFTNDMDLDEQEDIIYFTDTSTQFQRRQFIASVVIGD  193

Query  591   TSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFLLISEFIAKKITKYIIKGPKANTT  770
              +GRL+KY+  T  VTV+LRGL+   G+A+SKDK+F+L++E    +I KY +KGP A   
Sbjct  194   KTGRLMKYDKSTKAVTVLLRGLAFANGVALSKDKSFVLVAETSTGRIVKYWLKGPDAGKH  253

Query  771   QTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL------------IPMT--------  890
              T   L G PDN++R + G +WVA++  +    + +            +P T        
Sbjct  254   ATFADLPGYPDNIRRNSRGEFWVALHSKRSLLARLVTSNSWLGRTLLKLPFTFQQLHYLL  313

Query  891   -----ESIAVKFDRNGKILD-RKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGVYTL  1046
                   + A+K    G++L+  ++V S      S   E  GK + GS++  F+GVY L
Sbjct  314   VGGQPHATAIKLSEEGQVLEVLEDVESKTLKFLSEVEEKNGKLWIGSVLVPFIGVYEL  371



>emb|CAN63240.1| hypothetical protein VITISV_034462 [Vitis vinifera]
Length=340

 Score =   217 bits (552),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 126/293 (43%), Positives = 183/293 (62%), Gaps = 11/293 (4%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQLIC  347
             GPE + F+  GEGPYTGV+DGRILK++  +  + DFA TSPLRT  +CDG ++T  + +C
Sbjct  47    GPETLVFDCBGEGPYTGVSDGRILKWHGSEVGWKDFAVTSPLRTSRLCDGLSDTSAEHVC  106

Query  348   GRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES--T  521
             GRPLGL+F+  T DLYIAD  FGLL VG KGGLA QLA    GI F F NAV +D+   T
Sbjct  107   GRPLGLKFNQATCDLYIADAYFGLLVVGRKGGLARQLATSAEGIPFLFANAVDIDQKTGT  166

Query  522   VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFL  701
             VYF D+   F    F    +SGD +GRL++Y+ +T +V V+L+ L    G+A+S++ +FL
Sbjct  167   VYFTDTSTRFRRWEFGIAMESGDNTGRLMRYDPKTKKVKVLLKHLFFANGVALSRNGSFL  226

Query  702   LISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqLI  881
             L++E  A ++ ++ ++GP++ T     KL+G PDN++R   G +WVA N   P       
Sbjct  227   LVTETNANRVLRFWLEGPRSQTRDVFAKLDGCPDNIERNPKGEFWVAQN---PKFDSIGT  283

Query  882   PMTESI-AVKFDRNGKILDRKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGV  1037
             P+  +I A+K D  GK+L    V +    S S  +E     + GS++ + +G+
Sbjct  284   PLQTNISALKLDEEGKVL---RVLNEEFGSLSDVIEKDDCMWLGSVLQSHVGM  333



>ref|XP_002463871.1| hypothetical protein SORBIDRAFT_01g007960 [Sorghum bicolor]
 gb|EER90869.1| hypothetical protein SORBIDRAFT_01g007960 [Sorghum bicolor]
Length=398

 Score =   218 bits (556),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 125/323 (39%), Positives = 180/323 (56%), Gaps = 32/323 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE VAF+ +G GPYTGVADGR++ +   +++ FAT SP  T+ +C G   + L+     
Sbjct  72    GPESVAFDPQGRGPYTGVADGRVVFWDGERWVPFATASPRWTQELCGGPKASPLEYLPNE  131

Query  342   -ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-E  515
              ICGRPLGL F  +TGDLYIAD  FGLLKVGP+GGLAT LA    G++ +FTN + LD E
Sbjct  132   HICGRPLGLRFDKKTGDLYIADAYFGLLKVGPEGGLATPLATEAEGVRLNFTNDLDLDDE  191

Query  516   STVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               VYF DS + +   NF ++  SGD SGRLLKY  +T   TV+ R L  P G+++SKD +
Sbjct  192   GNVYFTDSSIHYQRRNFMQLVFSGDPSGRLLKYNPQTKETTVLHRNLQFPNGVSMSKDGS  251

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             F +  E    ++++Y +KG KA T      L G PDNV+    G +WVA++  +    + 
Sbjct  252   FFVFCEGSRGRLSRYWLKGEKAGTVDLFAILPGFPDNVRTNEKGEFWVAIHCRRSLYARL  311

Query  876   L--------------IPMT-----------ESIAVKFDRNGKILD-RKNVTSAYPNSFSA  977
             +              IP              ++ +K+   G++LD  ++       + S 
Sbjct  312   MSRYVKMRKFFLSLPIPAKYHYLMQIGGKLHAVIIKYSPEGQVLDILEDTKGEVVRAVSE  371

Query  978   YLEHFGKAYTGSLVPNFLGVYTL  1046
               E  GK + GS++  F+ V+ L
Sbjct  372   VEEKDGKLWIGSVLMPFIAVFDL  394



>emb|CBI18783.3| unnamed protein product [Vitis vinifera]
Length=312

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 120/292 (41%), Positives = 173/292 (59%), Gaps = 24/292 (8%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQLIC  347
             GPE +AF+  G+GPYTG++DGRILK+   K  + +FA TSP R    CDG+ N  ++ +C
Sbjct  39    GPESIAFDCNGDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPNFCDGSLNLAIEQVC  98

Query  348   GRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--  521
             GRPLGL+F+  T DLYIAD  FGLL VG  GG+A Q+A    G+ F FTNA+ +D++T  
Sbjct  99    GRPLGLKFNEATCDLYIADAYFGLLVVGQNGGVAKQVAISAEGVPFRFTNALDIDQNTGV  158

Query  522   VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFL  701
             VYF D+  IF    +    Q GD +GRLLKY+  T  VTV+LRGLS   G+A+S+DK F+
Sbjct  159   VYFTDTSTIFQRWAYAIAMQIGDKTGRLLKYDPRTKEVTVLLRGLSFSNGVALSEDKDFV  218

Query  702   LISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqLI  881
             L++E  A K+T+Y           T  +L G PDN++R  +G +WVA N           
Sbjct  219   LVTETTAAKVTRY----------WTFTQLVGCPDNIQRNINGEFWVAQNNCGR-------  261

Query  882   PMTESIAVKFDRNGKILDRKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGV  1037
             P  +   V+ ++ GKI++  +V        S   +     + G ++ +++GV
Sbjct  262   PEVKVRPVRLNKEGKIVEELSVDVG---PLSEVQQKNNSLWLGYVILSYIGV  310



>emb|CDO98507.1| unnamed protein product [Coffea canephora]
Length=331

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 138/331 (42%), Positives = 182/331 (55%), Gaps = 13/331 (4%)
 Frame = +3

Query  72    MFWISILIFIS-SPCVIHSQppgillpiklklHAIGPEDVAFNGKGEGPYTGVADGRILK  248
             M  +SI + +S  P +I   P    + + L   A GPE VA + + EGPY  ++DGR+LK
Sbjct  1     MAALSIFVIVSFLPSIIALDPYSKFIQLNLPSGATGPESVALDSRNEGPYCAISDGRVLK  60

Query  249   YY--NGKFIDFATTSPLRTKVICDGTNNTILQLICGRPLGLEFHPRTGDLYIADVNFGLL  422
             Y   N  F+DFA TSP RTK +CDGT +  L   CGRPLG  F      LYI D   GL 
Sbjct  61    YIDSNTGFVDFAYTSPKRTKQLCDGTTDANLGPTCGRPLGFSFDNLINVLYIVDAFLGLF  120

Query  423   KVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--VYFVDSGLIFLTGNFTKIAQSGDTS  596
             KVGP GGLAT LA    G+K +F   + ++  T  VY  D+ L +   N T+     D+S
Sbjct  121   KVGPDGGLATLLANSAGGVKLNFLTGIDVNPITRDVYITDASLTYDLRNITQPNLVTDSS  180

Query  597   GRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFLLISEFIAKKITKYIIKGPKANTTQT  776
             GRL+KY      VTV+  GLS P G A+S D +F+L SE+ AK++ KY + GPKANT++ 
Sbjct  181   GRLIKYNPRKNEVTVLQEGLSVPIGPAVSFDGSFVLFSEYSAKRVVKYWLLGPKANTSEV  240

Query  777   LLKLEGQPDNVKRATS-GGYWVAVNILKppqpqqLIPMTESIAVKFDRNGKILDRKNVTS  953
             L  L G P  VKRA++ G +WVAV+I            T     K D  G +L  K++  
Sbjct  241   LRDLPGNPSKVKRASNVGEFWVAVDINVQQPR-----FTTPYGYKIDSFGNLLFVKDLED  295

Query  954   AYPN-SFSAYLEHFGKA-YTGSLVPNFLGVY  1040
              Y N   S   E+FG     GS   NF+G+Y
Sbjct  296   HYYNVPVSVVQEYFGTTLLVGSRGENFVGIY  326



>ref|XP_008677622.1| PREDICTED: strictosidine synthase isoform X1 [Zea mays]
 gb|ACG42017.1| strictosidine synthase precursor [Zea mays]
 gb|ACR34130.1| unknown [Zea mays]
 tpg|DAA51393.1| TPA: strictosidine synthase [Zea mays]
Length=398

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 124/323 (38%), Positives = 180/323 (56%), Gaps = 32/323 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE VAF+ +G GPYTGVADGR++ +   +++ FAT SP  T+ +C G   + ++     
Sbjct  72    GPESVAFDPQGRGPYTGVADGRVVFWDGERWVPFATASPRWTQELCGGPKASPVEYLPNE  131

Query  342   -ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-E  515
              ICGRPLGL F  +TGDLYIAD  FGLLKVGP+GGLAT LA    G++ +FTN + LD E
Sbjct  132   HICGRPLGLRFDKKTGDLYIADAYFGLLKVGPEGGLATPLATEAEGVRLNFTNDLDLDDE  191

Query  516   STVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               VYF DS + +   NF ++  SGD SGRLLKY  +T   TV+ R L  P G+++SKD +
Sbjct  192   GNVYFTDSSIHYQRRNFMQLVFSGDPSGRLLKYNPQTKETTVLHRNLQFPNGVSMSKDGS  251

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             F +  E    ++++Y +KG KA T      L G PDNV+    G +WVA++  +    + 
Sbjct  252   FFVFCEGSRGRLSRYWLKGEKAGTVDLFAILPGFPDNVRTNEKGEFWVAIHCRRSLYARL  311

Query  876   L--------------IPMT-----------ESIAVKFDRNGKILD-RKNVTSAYPNSFSA  977
             +              IP              ++ +K+   G++LD  ++       + S 
Sbjct  312   MSRHVKLRKFLLSLPIPAKYHYLMQIGGRLHAVIIKYSPEGQVLDILEDTKGEVVRAVSE  371

Query  978   YLEHFGKAYTGSLVPNFLGVYTL  1046
               E  GK + GS++  F+ V+ L
Sbjct  372   VEEKDGKLWIGSVLMPFIAVFDL  394



>emb|CAN78856.1| hypothetical protein VITISV_013356 [Vitis vinifera]
Length=600

 Score =   222 bits (565),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 122/295 (41%), Positives = 182/295 (62%), Gaps = 8/295 (3%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQLIC  347
             GPE +AF+ KGEGPYTGV+DGR+LKY      F DFA TSP RT+ +CDG+ +  L   C
Sbjct  306   GPESLAFDLKGEGPYTGVSDGRVLKYQGPXVGFTDFAVTSPNRTEEMCDGSIDPALAATC  365

Query  348   GRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--  521
             GRPLGL F+  TGDLY+ D   GL+ VG  GG+ATQLAA   GI F F   + +D+    
Sbjct  366   GRPLGLGFNYHTGDLYMVDAYLGLMVVGSSGGIATQLAAAAEGIPFRFLAGLDVDQGNGM  425

Query  522   VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFL  701
             VYF ++   F   +  ++  S D++G L +Y+ ++  V V+L GLS   G+A+S+D  F+
Sbjct  426   VYFTEASTRFQLRDMQELIASNDSTGSLFRYDPQSREVRVLLGGLSVAVGVAVSRDGMFV  485

Query  702   LISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAV-NILKppqpqqL  878
             L++E  A +I ++ + GPKANT++  ++L G+P N+KR   G +WVA+ N L PP P + 
Sbjct  486   LVAELTANRIRRFWLGGPKANTSEVFMELLGKPSNIKRNERGEFWVAINNALGPPAPPES  545

Query  879   IPMTESIAVKFDRNGKILDRKNVTSAYP-NSFSAYLEHFGKAYTGSLVPNFLGVY  1040
             + M   + ++   +G++L+   +  AY  ++ S   E  G+ Y  SLV  +  +Y
Sbjct  546   LVM--PLGLRLSNDGRVLEVAPLVGAYQISAISEVQERNGELYVASLVAAYASIY  598


 Score =   149 bits (376),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 98/252 (39%), Positives = 136/252 (54%), Gaps = 28/252 (11%)
 Frame = +3

Query  291   LRTKVICDGTNNTILQLICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGV  470
             LR+K +CDG+ +  L+  CGRPLGL F+ RT                   G   QLA   
Sbjct  63    LRSKKLCDGSTDPGLEPTCGRPLGLGFNYRTD------------------GRIIQLATAA  104

Query  471   NGIKFSFTNAVALDEST--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVV  644
              G+ F F NAV +D+ T  VYF D+   F    F    Q+GD +GRL+KY+  T  VT +
Sbjct  105   EGVPFLFLNAVDVDQETGIVYFTDASARFQRREFMLAVQTGDMTGRLMKYDPRTQEVTEL  164

Query  645   LRGLSGPAGLAISKDKTFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATS  824
             LRGL G  G+ ISKD +F+L++EF+  +I ++ +KG KANT+Q  LK  G PDN+K    
Sbjct  165   LRGLGGAGGVTISKDGSFILVTEFVTNRIQRFWLKGRKANTSQLFLKPPGTPDNIKSNAR  224

Query  825   GGYWVAVNILKppqpqqLIPMTESIAVKFDRNGKILDRKNV-TSAYPNSFSAYLEHFGKA  1001
             G +WVAVNI        ++P+     ++    GK+L      T   P + S   E+ G  
Sbjct  225   GEFWVAVNI---GAGTAVVPL----GLRLSEEGKVLQMVAFGTGDIPKTISEVQEYNGAL  277

Query  1002  YTGSLVPNFLGV  1037
             Y GSL  +F+GV
Sbjct  278   YIGSLPLHFVGV  289



>emb|CAN77942.1| hypothetical protein VITISV_044018 [Vitis vinifera]
Length=341

 Score =   215 bits (548),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 127/295 (43%), Positives = 180/295 (61%), Gaps = 8/295 (3%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQL  341
             A GPE +AF+  G GPYTG++DGRILKY NG   F++FA TS   ++  C G  +  L  
Sbjct  41    ATGPESIAFDAAGGGPYTGISDGRILKYVNGSVGFVEFAITSSNSSEEFCVGNGSVALDF  100

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST  521
              CGRP GL FH +TGDLYIAD  +GL+ VGP GG+ATQLA   +G+ F FTNA+ +D  T
Sbjct  101   TCGRPFGLGFHYQTGDLYIADAYYGLMVVGPNGGVATQLANAADGVPFGFTNALDVDTET  160

Query  522   --VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               VY VD    F    F+   Q+ D +GRL+KY+ E+  +TV+L GL G AG+AISKD +
Sbjct  161   GMVYLVDYSSQFSVNEFSVSLQAHDMTGRLMKYDPESKELTVLLGGLGGAAGMAISKDGS  220

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             F+LI+E + K+I K+ ++GPKA T++ L +   +P N+KR   G +WVA   L   +   
Sbjct  221   FILITETVTKRIRKFWLQGPKATTSEILKEFTVRPANIKRNEEGEFWVA--FLVADETGS  278

Query  876   LIPMTESIAVKFDRNGKILDRKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGVY  1040
                  +S  ++   +G IL+  ++ +   +  S    + GK Y GS   +F+ VY
Sbjct  279   CPSQQQSPGLRISGDGMILEAISLDTQ--SGISEVAVYNGKMYIGSPFLHFVDVY  331



>ref|XP_002270060.2| PREDICTED: strictosidine synthase 1-like [Vitis vinifera]
Length=341

 Score =   215 bits (548),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 127/295 (43%), Positives = 180/295 (61%), Gaps = 8/295 (3%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQL  341
             A GPE +AF+  G GPYTG++DGRILKY NG   F++FA TS   ++  C G  +  L  
Sbjct  41    ATGPESIAFDAAGGGPYTGISDGRILKYVNGSVGFVEFAITSSNSSEEFCVGNGSVALDF  100

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST  521
              CGRP GL FH +TGDLYIAD  +GL+ VGP GG+ATQLA   +G+ F FTNA+ +D  T
Sbjct  101   TCGRPFGLGFHYQTGDLYIADAYYGLMVVGPNGGVATQLANAADGVPFGFTNALDVDTET  160

Query  522   --VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               VY VD    F    F+   Q+ D +GRL+KY+ E+  +TV+L GL G AG+AISKD +
Sbjct  161   GMVYLVDYSSQFSVNEFSVSLQAHDMTGRLMKYDPESKELTVLLGGLGGAAGMAISKDGS  220

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             F+LI+E + K+I K+ ++GPKA T++ L +   +P N+KR   G +WVA   L   +   
Sbjct  221   FILITETVTKRIRKFWLQGPKATTSEILKEFTVRPANIKRNEEGEFWVA--FLVADETGS  278

Query  876   LIPMTESIAVKFDRNGKILDRKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGVY  1040
                  +S  ++   +G IL+  ++ +   +  S    + GK Y GS   +F+ VY
Sbjct  279   CPSQQQSPGLRISGDGMILEAISLDTQ--SGISEVAVYNGKMYIGSPFLHFVDVY  331



>ref|XP_002513740.1| strictosidine synthase, putative [Ricinus communis]
 gb|EEF48687.1| strictosidine synthase, putative [Ricinus communis]
Length=391

 Score =   216 bits (551),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 130/322 (40%), Positives = 183/322 (57%), Gaps = 32/322 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE +AF+  G GPYTG+ADGRI+ +   K+IDFA TSP R++ IC+   + +  L    
Sbjct  70    GPESMAFDPLGRGPYTGIADGRIVFWDGLKWIDFAYTSPNRSE-ICERKPSPLSYLKNEH  128

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-ES  518
             ICGRPLGL F+ +TGDLYIAD  FGL+KVGP+GGLAT LA    GIK  FTN + +D E 
Sbjct  129   ICGRPLGLRFNKKTGDLYIADAYFGLMKVGPEGGLATSLATEAEGIKLGFTNDLDIDDEG  188

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              +YF DS   +   NF ++  S + SGR+LKY   T   TV++R +  P G+++SKD TF
Sbjct  189   NIYFTDSSTQYQRRNFMQLVFSSEHSGRVLKYNPTTKGTTVLVRNVQFPNGVSLSKDGTF  248

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
              +  E    +++KY +KG KA TT+ L  L G PDNV+    G +WVAV+  +       
Sbjct  249   FVFCEGSMGRLSKYWLKGEKAGTTEVLAILPGFPDNVRTNEEGNFWVAVHCRRTYYSYIC  308

Query  879   ------------IPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                         +P++              ++AVK+   GK+L   ++       + S  
Sbjct  309   ALYPKLRTFLLKLPISAKIHYLFHIGGRLHAVAVKYSPEGKLLQILEDSQGKVVKAISEV  368

Query  981   LEHFGKAYTGSLVPNFLGVYTL  1046
              E  GK + GS++  F+GVY L
Sbjct  369   EERDGKLWMGSVLMPFVGVYNL  390



>gb|KFK43153.1| hypothetical protein AALP_AA1G086800 [Arabis alpina]
Length=392

 Score =   216 bits (551),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 122/323 (38%), Positives = 187/323 (58%), Gaps = 34/323 (11%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTIL-----Q  338
             GPE VAF+ +G GPYTGVADGR++ +   ++ DFA TS  R++ +CD T  ++L     +
Sbjct  71    GPESVAFDPQGRGPYTGVADGRVIFWDGTRWNDFAYTSNNRSE-LCD-TKPSLLDYLKNE  128

Query  339   LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
              ICGRPLGL FH +TG+LYIAD  FG++KVGP+GGLAT +    +G+   FTN + +DE 
Sbjct  129   HICGRPLGLRFHKKTGELYIADAYFGIMKVGPEGGLATSVTNEADGVPLRFTNDLDVDEE  188

Query  519   -TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               VYF DS  +F   NF ++  SG+ +GR+LKY  ET   T ++R L  P GL++ KD++
Sbjct  189   GNVYFTDSSTVFQRRNFMQLIVSGEDTGRVLKYNPETKETTTLVRNLQFPNGLSLGKDES  248

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             F +  E    ++ KY +KG KA T++ +  L G PDN++    G +WVA++  +     +
Sbjct  249   FFIFCEGTIGRLRKYWLKGEKAGTSEVVALLHGFPDNIRTNKDGDFWVAIHCHRNIFTHE  308

Query  876   L------------IPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSA  977
             +            +P+T              ++AVK+  +GK+L   ++       + S 
Sbjct  309   MAHHTSIRKFFLKLPITVKFQYLLQVGGWPHAVAVKYSEDGKVLKVLEDKQGKVVKAVSE  368

Query  978   YLEHFGKAYTGSLVPNFLGVYTL  1046
               E  GK + GS++ +F+ VY L
Sbjct  369   IEEKDGKLWMGSVLMSFIAVYDL  391



>ref|XP_006351273.1| PREDICTED: strictosidine synthase 1-like [Solanum tuberosum]
Length=372

 Score =   216 bits (549),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 126/324 (39%), Positives = 181/324 (56%), Gaps = 34/324 (10%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKYYNGK---FIDFATTSPLRTKVICDGTNNTILQ  338
             A+GPE VAF+  GEGPYTGVADGRILK+ NG    ++DFA TS  R +  C       ++
Sbjct  51    AVGPESVAFDPNGEGPYTGVADGRILKW-NGDSDGWVDFAVTSSQRKQ--CVHPFAPQME  107

Query  339   LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
              +CGRPLGL F  RTGDLY+AD   GL  VGP GGLAT L   V G    FTN + +DE 
Sbjct  108   HVCGRPLGLRFDTRTGDLYVADAYLGLHVVGPSGGLATSLVTEVEGQHLRFTNDLDIDEQ  167

Query  519   --TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
                +YF D+   F    F     SGD +GRL+KY++ T  VTV+LRGL+   G+A+SKDK
Sbjct  168   EDVIYFTDTSTQFQRRQFIASVVSGDKTGRLMKYDISTKAVTVLLRGLAFANGVALSKDK  227

Query  693   TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpq  872
             +F+L++E    ++ ++ +KGP A    T   L G PDN++R + G +WV ++  +    +
Sbjct  228   SFVLVAETTTCRVVRHWLKGPHAGKHDTFADLPGYPDNIRRNSRGEFWVGLHSKRSLLAK  287

Query  873   qL------------IPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFS  974
              +            +P T              + A+K   +G++L+  +++ S      S
Sbjct  288   LVTSNSWLGKTILKLPFTFQQLHFLLVGGQPHATAIKLSEDGQVLEVLEDLESKTLKFIS  347

Query  975   AYLEHFGKAYTGSLVPNFLGVYTL  1046
                E  GK + GS++  F+GV+ L
Sbjct  348   EVEEKNGKLWIGSVLVPFIGVHEL  371



>ref|XP_009356499.1| PREDICTED: strictosidine synthase 3-like [Pyrus x bretschneideri]
Length=357

 Score =   215 bits (548),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 118/313 (38%), Positives = 178/313 (57%), Gaps = 24/313 (8%)
 Frame = +3

Query  165   HAIGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQ  338
               +GPE +AF+ +G+GPY GV+DG ILK+   +  + +FA TSP R +  CDG+ N   +
Sbjct  44    RVVGPESIAFDCRGKGPYVGVSDGTILKWQGPRLGWTEFAFTSPNRARKQCDGSTNVTNE  103

Query  339   LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
              ICGRPLG+ FHP+T DLY AD  FGL+K GP GG A  LA  + G+ F F N++ +DE 
Sbjct  104   PICGRPLGMMFHPKTCDLYFADAYFGLMKTGPNGGKAEVLANSIGGVPFLFVNSLDIDEE  163

Query  519   T--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
             T  VYF D+  +F    + +   +GD +GRLL+Y+  T +V V+L GL    G+A+S DK
Sbjct  164   TGIVYFTDTSTVFQRRVWVQSVLAGDKTGRLLQYDPRTKKVKVLLHGLGFANGVALSGDK  223

Query  693   TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVN--------  848
             +F+L+ E    +I +  ++GPKA+  +   +L+  PDN+KR   G +WV +N        
Sbjct  224   SFVLVVESAEFRIHRLWLRGPKAHVLELFTQLQRPPDNIKRTKKGEFWVGLNSGRGVKGV  283

Query  849   -------ILKppqpqqLIPMTESIAVKFDRNG---KILDRKNVTSAYPNSFSAYLEHFGK  998
                    +       +L+ + + + VK D  G   ++LD +   S    + S   EH G 
Sbjct  284   QNKVQNMMNNNESSGELLNVNDPVGVKLDEQGGVLQVLDGEGGKSL--QAVSEVEEHNGI  341

Query  999   AYTGSLVPNFLGV  1037
              + GS V  ++GV
Sbjct  342   LWIGSAVAPYVGV  354



>ref|XP_004150130.1| PREDICTED: strictosidine synthase 1-like [Cucumis sativus]
 gb|KGN50870.1| hypothetical protein Csa_5G305760 [Cucumis sativus]
Length=350

 Score =   215 bits (547),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 125/311 (40%), Positives = 176/311 (57%), Gaps = 25/311 (8%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQLIC  347
             GPE +AF+ +GEGPY  V+DGRILK+      +  FA TSP R    CDG   +  +  C
Sbjct  38    GPESIAFDCRGEGPYASVSDGRILKWKGPHLGWTQFALTSPNREGKECDGQPQS--EAAC  95

Query  348   GRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--  521
             GRPLG++FHP T DLYIAD  FGLL VGPKGGLA QLA    G+   FTNA+ +D     
Sbjct  96    GRPLGIKFHPTTCDLYIADAYFGLLAVGPKGGLARQLATSAQGVPLRFTNALDIDPQNGI  155

Query  522   VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFL  701
             VYF DS ++F    +     +GD +GRLLKY+  T  VTV+  GL+ P G+A++ D +FL
Sbjct  156   VYFTDSSILFQRRVWLLSIMNGDKTGRLLKYDPRTQNVTVLRNGLAFPNGVALNADSSFL  215

Query  702   LISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL-  878
             L++E    ++ K+ +KGPKANT +   +LE  PDN+KR  +G +W+A+N  +     Q  
Sbjct  216   LMAETGTLQVLKFWLKGPKANTMEIFAQLERFPDNIKRTDNGDFWIAMNSARGTLDTQTW  275

Query  879   ---------------IPMTES--IAVKFDRNGKILDRKNVTSAYP-NSFSAYLEHFGKAY  1004
                            IP  ++  +AVK +  G++    +        S S   E  G+ +
Sbjct  276   KELYRGATMKQGEVKIPWIQADPVAVKLNERGEVKGMVDGGEGQALESVSEVEESRGRLW  335

Query  1005  TGSLVPNFLGV  1037
              GS V  ++G+
Sbjct  336   IGSAVKPYVGL  346



>ref|XP_010110077.1| Strictosidine synthase 1 [Morus notabilis]
 gb|EXC25144.1| Strictosidine synthase 1 [Morus notabilis]
Length=331

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 131/328 (40%), Positives = 185/328 (56%), Gaps = 11/328 (3%)
 Frame = +3

Query  81    ISILIFI-SSPCVIHSQppgillpiklklHAIGPEDVAFNGKGEGPYTGVADGRILKY--  251
             +SI+IF+ S P ++  QP        L   A+GP  +AF+  G GP+TG++DGR+L+Y  
Sbjct  2     LSIVIFLFSVPSLVFCQPFSNFQKYDLPSAAVGPFSIAFDSSGRGPFTGISDGRVLRYDP  61

Query  252   YNGKFIDFATTSPLRTKVICDGTNNT---ILQLICGRPLGLEFHPRTGDLYIADVNFGLL  422
                 F DFA TSP R+K +CDGT+N        ICGRPLG+ FH RT  LY+ D   GLL
Sbjct  62    VQNSFFDFAFTSPNRSKAVCDGTDNNDNPTRGAICGRPLGVSFHFRTNQLYVTDAYKGLL  121

Query  423   KVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--VYFVDSGLIFLTGNFTKIAQSGDTS  596
              V P G LA  +A G  G+ F F   + +D+ T  VYF +    F            D++
Sbjct  122   VVPPNGRLAENVATGAEGVPFKFPFLLDVDQVTGDVYFTEFSSQFQLSQVQHAIDVRDST  181

Query  597   GRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFLLISEFIAKKITKYIIKGPKANTTQT  776
             GRLLKY   TG  TV+LRGLSG AG+A+S D+T+LLI+E  A ++ K  + GP A TT  
Sbjct  182   GRLLKYNPNTGETTVLLRGLSGAAGIALSYDRTYLLIAEMTANRVKKLWLSGPNAFTTVD  241

Query  777   LLKLEGQPDNVKRATSGGYWVAVNI-LKppqpqqLIPMTESIAVKFDRNGKILDRKNVTS  953
             L+ + G+P N+K+ +   +WVAVN  +  P    +I +  +I +     G IL   +++S
Sbjct  242   LITVRGRPSNIKKNSLADFWVAVNTWIPGPTVGSMIRVPSAIRIS-GTGGAILQTVDLSS  300

Query  954   AYPNSFSAYLEHFG-KAYTGSLVPNFLG  1034
              Y N+  +  + FG   Y G+L    LG
Sbjct  301   YYTNTSISEFQPFGLGGYIGALRAASLG  328



>ref|NP_001150008.1| strictosidine synthase precursor [Zea mays]
 gb|ACG37487.1| strictosidine synthase precursor [Zea mays]
Length=398

 Score =   216 bits (551),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 125/323 (39%), Positives = 179/323 (55%), Gaps = 32/323 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE VAF+ +G GPYTGVADGR++ +   +++ FAT SP  T+ +C G   + ++     
Sbjct  72    GPESVAFDPQGRGPYTGVADGRVVFWDGERWVPFATASPRWTQELCGGPKASPVEYLPNE  131

Query  342   -ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-E  515
              ICGRPLGL F  +TGDLYIAD  FGLLKVGP+GGLAT LA    G++ +FTN + LD E
Sbjct  132   HICGRPLGLRFDKKTGDLYIADAYFGLLKVGPEGGLATPLATEAEGVRLNFTNDLDLDDE  191

Query  516   STVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               VYF DS + +   NF ++  SGD SGRLLKY  +T   TV+ R L  P G+++SKD +
Sbjct  192   GNVYFTDSSIHYQRRNFMQLVFSGDPSGRLLKYNPQTKETTVLHRNLQFPNGVSMSKDGS  251

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNI--------  851
             F +  E    ++++Y +KG KA T      L G PDNV+    G +WVA++         
Sbjct  252   FFVFCEGSRGRLSRYWLKGEKAGTVDLFAILPGFPDNVRTNEKGEFWVAIHCRRGLYARL  311

Query  852   ------LKppqpqqLIPMT-----------ESIAVKFDRNGKILD-RKNVTSAYPNSFSA  977
                   L+       IP              ++ +K+   G++LD  ++       + S 
Sbjct  312   MSRHVKLRKFLLSLPIPAKYHYLMQIGGRLHALIIKYSPEGQVLDILEDTKGEVVRAVSE  371

Query  978   YLEHFGKAYTGSLVPNFLGVYTL  1046
               E  GK + GS++  F+ V+ L
Sbjct  372   VEEKDGKLWIGSVLMPFIAVFDL  394



>ref|XP_004249227.1| PREDICTED: strictosidine synthase 1 [Solanum lycopersicum]
Length=372

 Score =   215 bits (547),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 127/324 (39%), Positives = 180/324 (56%), Gaps = 34/324 (10%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKYYNGK---FIDFATTSPLRTKVICDGTNNTILQ  338
             A+GPE +AF+  GEGPYTGVADGRILK+ NG    ++DFA TS  R +  C       ++
Sbjct  51    AVGPESIAFDPNGEGPYTGVADGRILKW-NGDSDGWVDFAVTSSQRKE--CVHPFAPQME  107

Query  339   LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
              +CGRPLGL F  RTGDLYIAD   GL  VGP GGLAT L   V G    FTN + +DE 
Sbjct  108   HVCGRPLGLRFDTRTGDLYIADAYLGLHVVGPSGGLATPLVTEVEGQPLRFTNDLDIDEQ  167

Query  519   --TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
                +YF D+   F    F     SGD +GRL+KY+  T  VTV+LRGL+   G+A+SKDK
Sbjct  168   EDVIYFTDTSTQFQRRQFVASVVSGDKTGRLMKYDKSTKSVTVLLRGLAFANGVALSKDK  227

Query  693   TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpq  872
             +F+L++E    ++ ++ +KGP A    T   L G PDN++R + G +WV ++  +    +
Sbjct  228   SFVLVAETSTCRVVRHWLKGPHAGKHDTFADLPGYPDNIRRNSRGEFWVGLHSKRSLLAK  287

Query  873   qL------------IPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFS  974
              +            +P T              + A+K   +G++LD  +++ S      S
Sbjct  288   LVTSYSWFGKTTLKLPFTFQQLHFLLVGGQPHATAIKLSEDGQVLDVLEDLESKTLKFIS  347

Query  975   AYLEHFGKAYTGSLVPNFLGVYTL  1046
                E  GK + GS++  F+GV+ L
Sbjct  348   EVEEKNGKLWIGSVLVPFVGVHEL  371



>ref|XP_006421116.1| hypothetical protein CICLE_v10005245mg [Citrus clementina]
 gb|ESR34356.1| hypothetical protein CICLE_v10005245mg [Citrus clementina]
Length=360

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 124/276 (45%), Positives = 172/276 (62%), Gaps = 23/276 (8%)
 Frame = +3

Query  54   NMKSLTMFWISILIFI----SSPCVIHSQppgillpiklklHAIGPEDVAFNGKGEGPYT  221
            N  SL+    SI+IF+    S+  V+  Q  G          AIGPE  AF+  GEGPYT
Sbjct  2    NSTSLSFIAKSIVIFLFINSSTQGVVQYQIEG----------AIGPESFAFDALGEGPYT  51

Query  222  GVADGRILKYYNG--KFIDFATTSPLRTKVICDGT---NNTILQLICGRPLGLEFHPRTG  386
            GV+DGRI+K++    +++ FA TSP R    C+G    ++   + ICGRPLGL F+   G
Sbjct  52   GVSDGRIIKWHQDQRRWLHFALTSPNRDG--CEGAYEYDHAAKEHICGRPLGLCFNKTNG  109

Query  387  DLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--VYFVDSGLIFLTG  560
            DLYIAD  FGLLKVGP+GGLAT +A    GI F F N++ +D+ST  VYF DS   F   
Sbjct  110  DLYIADAYFGLLKVGPEGGLATAVATQSEGIPFRFCNSLDIDQSTGIVYFTDSSSQFQRR  169

Query  561  NFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFLLISEFIAKKITKY  740
            N   +  SGD +GRL+KY+  T +VTV+L  LS P G+A+S+D  ++L++E  + +I +Y
Sbjct  170  NHISVILSGDKTGRLMKYDPATKQVTVLLGNLSFPNGVALSEDGNYILLAETTSCRILRY  229

Query  741  IIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVN  848
             +K  KA T + + +L G PDNVKR+  GG+WV ++
Sbjct  230  WLKTSKAGTIEIVAQLPGFPDNVKRSPRGGFWVGIH  265



>gb|KEH23600.1| strictosidine synthase family protein [Medicago truncatula]
Length=325

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 132/332 (40%), Positives = 181/332 (55%), Gaps = 24/332 (7%)
 Frame = +3

Query  66    LTMFWISILIFISSPCVIHSQppgillpiklklHAIGPEDVAFNGKGEGPYTGVADGRIL  245
             LT+F   I    S   V  S        +     AIGPE + F+  G GPYTGVADGRIL
Sbjct  13    LTLF--CIFTLFSPVLVAGSMHNLHSARLLHVTRAIGPESLVFDSHGGGPYTGVADGRIL  70

Query  246   KYYNGK--FIDFATTSPLRTKVICDGTNNTILQLICGRPLGLEFHPRTGDLYIADVNFGL  419
             K+   K  + +FA TS  R++  C       L+ ICGRPLGL F  + GDLYIAD   GL
Sbjct  71    KWKGKKRGWTEFAVTSSNRSQ--CVRPFAPKLEHICGRPLGLRFDKKNGDLYIADAYLGL  128

Query  420   LKVGPKGGLATQLAAGVNGIKFSFTNAVALDES--TVYFVDSGLIFLTGNFTKIAQSGDT  593
               VG  GGLATQ+A    G  F FTN + +DE+   +YF DS  ++    +T +  SGD 
Sbjct  129   KVVGAAGGLATQVATEAEGHPFHFTNDLDIDENEGVIYFTDSSTVYERTQYTLLLVSGDK  188

Query  594   SGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFLLISEFIAKKITKYIIKGPKANTTQ  773
             +GRL+KY+  T  V V+LRGL+ P G+A+SKD +FLL++E    +I +  + GPKA    
Sbjct  189   TGRLMKYDKSTKEVKVLLRGLAFPNGVALSKDGSFLLVAETSNCRILRLWLHGPKAGKVS  248

Query  774   TLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqLIPMTESIAVKFDRNGKILDR-KNVT  950
             T + L G PDN++R + G +WVA+                S AVK    G+IL+  ++  
Sbjct  249   TFVDLPGFPDNIRRNSYGQFWVALY---------------SSAVKLSDEGEILETLEDFE  293

Query  951   SAYPNSFSAYLEHFGKAYTGSLVPNFLGVYTL  1046
                  + S   E  GK +  S+V  ++GVY+L
Sbjct  294   RKTMKNISEVEEKDGKLWIASIVTPYIGVYSL  325



>ref|XP_010412433.1| PREDICTED: strictosidine synthase 1-like [Camelina sativa]
Length=340

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 128/302 (42%), Positives = 170/302 (56%), Gaps = 22/302 (7%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKYYNGK---FIDFATTSPLRTKVICDGTNNTILQ  338
             A GPE +AF+  GEGPY GVADGR+LK+  GK   + DFA TS  R    C      +L+
Sbjct  52    ASGPESIAFDPAGEGPYVGVADGRVLKW-RGKSLGWTDFAYTSANRQ--FCVRPFAPLLE  108

Query  339   LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
              +CGRPLGL FH +TGDLYIAD  FGLL VGP GGLA  L     G  F FTN + +D+ 
Sbjct  109   PVCGRPLGLRFHKKTGDLYIADAYFGLLIVGPAGGLAKPLVTEAEGQPFRFTNDLDIDDQ  168

Query  519   T--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
                +YF D+   F    +     +GD +GR +KY+  + + TV+L GLS   G+A+SKD+
Sbjct  169   NDVIYFTDASSKFQRWEYIGSFLTGDKTGRFMKYDRSSKKATVLLHGLSFANGVALSKDQ  228

Query  693   TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpq  872
             +F+L++E    KI +  + GPKA T    + L G PDN++R + G +WVA+N L      
Sbjct  229   SFVLVAETTNCKILRLWLSGPKAGTQDVFVVLPGYPDNIRRNSKGEFWVALNSL------  282

Query  873   qLIPMTESI----AVKFDRNGKILDRKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGVY  1040
                   E I    AVK   +GKIL+     +      S   E  GK + GS V  F+GVY
Sbjct  283   ----FNEEIRYTKAVKLSESGKILEVLGDKAKRLRFISDVEEKDGKLWIGSSVAPFVGVY  338

Query  1041  TL  1046
              L
Sbjct  339   DL  340



>ref|XP_009799719.1| PREDICTED: strictosidine synthase 1-like [Nicotiana sylvestris]
Length=337

 Score =   213 bits (541),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 130/325 (40%), Positives = 177/325 (54%), Gaps = 24/325 (7%)
 Frame = +3

Query  96    FISSPCVIHSQppgillpiklklHAIGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FI  269
              +  P +  +Q       I     A+GPE +AF+  GEGPYTGVADGRILK+      + 
Sbjct  28    MLKQPPIPSTQNLLRKAEIIQLKGAVGPESIAFDPNGEGPYTGVADGRILKWQEQAQTWA  87

Query  270   DFATTSPLRTKVICDGTNNTILQLICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLA  449
             +FA TS  R    C   +   ++ ICGRPLGL F  +TGDLYIAD  FGL  VGPKGGLA
Sbjct  88    NFAVTSSERNN--CTRPSAPEMEHICGRPLGLRFDKKTGDLYIADAYFGLQVVGPKGGLA  145

Query  450   TQLAAGVNGIKFSFTNAVALDE--STVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEME  623
             T L     G    FTN + +D+  + +YF DS   +    +     SGDT+GRL+KY+  
Sbjct  146   TPLVHEFEGKPLIFTNDMDIDDQNNVIYFTDSSTKYQRRQYFAAFVSGDTTGRLMKYDKS  205

Query  624   TGRVTVVLRGLSGPAGLAISKDKTFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPD  803
             T +VTV+LRGL+   G+A++KD++FLL+SE    +I +Y IKGP          + G PD
Sbjct  206   TKKVTVLLRGLAFANGVALNKDQSFLLVSETANCRIIRYWIKGPYKGRHDIFADVPGFPD  265

Query  804   NVKRATSGGYWVAVNILKppqpqqLIPMTESIAVKFDRNGKIL----DRKNVTSAYPNSF  971
             N++  + G +WVA+N             T + A+K    G++L    D +  T  Y    
Sbjct  266   NIRINSRGEFWVALNA-----------KTSATAIKLSAEGQMLEVLEDEEGKTLRY---I  311

Query  972   SAYLEHFGKAYTGSLVPNFLGVYTL  1046
             S   E  GK + GS+   FLGVY L
Sbjct  312   SQVEEKHGKLWFGSVTMPFLGVYGL  336



>ref|XP_004308613.1| PREDICTED: strictosidine synthase-like [Fragaria vesca subsp. 
vesca]
Length=321

 Score =   212 bits (540),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 122/295 (41%), Positives = 164/295 (56%), Gaps = 20/295 (7%)
 Frame = +3

Query  165   HAIGPEDVAFNGKGEGPYTGVADGRILKYYNGKF--IDFATTSPLRTKVICDGTNNTILQ  338
             H   PE +AF+  G  PY GVADGRI K+    F   +F  T+P R + +CD + +   +
Sbjct  38    HVPQPESIAFDCNG-APYVGVADGRIFKWLGRPFGWTEFTVTAPNRPREVCDLSTSKGSE  96

Query  339   LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
              ICGRPLGL+F   T +LYIAD  FGLLK GP GG+A  LA    G  F F N V +D+ 
Sbjct  97    PICGRPLGLKFDLNTCELYIADAYFGLLKTGPNGGVAQTLATSAEGFPFRFLNGVDVDQE  156

Query  519   T--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
             T  VYF D+  I+   N+     +GD +GRL+ Y+  T  VTV+L GL+   G+A+SKD 
Sbjct  157   TGMVYFTDTSAIYQRRNWELSVSTGDKTGRLMLYDPSTKNVTVLLHGLAFANGVALSKDG  216

Query  693   TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpq  872
              F+L+++  AK I +Y ++GP+ANT  T   L+G PDN+ R  +G +WVA N        
Sbjct  217   DFVLVTQTTAKNILRYWLRGPRANTVDTFFNLQGAPDNINRNLNGEFWVAEN--------  268

Query  873   qLIPMTESIAVKFDRNGKILDRKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGV  1037
                      AVK D  G  LD   V     N  S   +  G  + GS+V NF+GV
Sbjct  269   ---SAGRGKAVKLDAQGNFLD---VVDGL-NPVSHVEQRHGNLWIGSVVNNFVGV  316



>ref|XP_006494389.1| PREDICTED: strictosidine synthase 1-like [Citrus sinensis]
 gb|KDO41713.1| hypothetical protein CISIN_1g018242mg [Citrus sinensis]
Length=359

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 111/234 (47%), Positives = 157/234 (67%), Gaps = 9/234 (4%)
 Frame = +3

Query  168  AIGPEDVAFNGKGEGPYTGVADGRILKYYNG--KFIDFATTSPLRTKVICDGT---NNTI  332
            AIGPE +AF+  GEGPYTGV+DGRI+K++    +++ FA TSP R    C+G    ++  
Sbjct  33   AIGPESLAFDALGEGPYTGVSDGRIIKWHQDQRRWLHFARTSPNRDG--CEGAYEYDHAA  90

Query  333  LQLICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD  512
             + ICGRPLGL F+   GDLYIAD  FGLLKVGP+GGLAT +A    GI F F N++ +D
Sbjct  91   KEHICGRPLGLCFNKTNGDLYIADAYFGLLKVGPEGGLATAVATQSEGIPFRFCNSLDID  150

Query  513  EST--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISK  686
            +ST  +YF DS   F   N   +  SGD +GRL+KY+  T +VTV+L  LS P G+A+S+
Sbjct  151  QSTGIIYFTDSSSQFQRRNHISVILSGDKTGRLMKYDPATKQVTVLLGNLSFPNGVALSE  210

Query  687  DKTFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVN  848
            D  ++L++E  + +I +Y +K  KA T + + +L G PDN+KR+  GG+WV ++
Sbjct  211  DGNYILLAETTSCRILRYWLKTSKAGTIEIVAQLPGFPDNIKRSPRGGFWVGIH  264



>ref|XP_009597336.1| PREDICTED: strictosidine synthase 1-like [Nicotiana tomentosiformis]
Length=270

 Score =   210 bits (535),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 136/328 (41%), Positives = 180/328 (55%), Gaps = 65/328 (20%)
 Frame = +3

Query  72    MFWISILIFISSPCVIHSQppgillpiklklHAIGPEDVAFNGKGEGPYTGVADGRILKY  251
             MF + +LIF SS       PP     ++L    +GP+  AF+ KG GPYT VADGR+LKY
Sbjct  1     MFSMLLLIFSSSLAYSSQLPPLQFKKLQLPQQTVGPDSTAFDLKGNGPYTSVADGRVLKY  60

Query  252   Y--NGKFIDFATTSPLRTKVICDGTNNTILQLICGRPLGLEFHPRTGDLYIADVNFGLLK  425
                N  FIDFATTSPLRTK  CDGTN+  L +  GRPLG+ F+ +TGDLYI D+N+GLL 
Sbjct  61    QGPNIGFIDFATTSPLRTKEECDGTNDPNLLITRGRPLGVGFYYKTGDLYITDINYGLLS  120

Query  426   VGPKGGLATQLAAGVNGIKFSFTNAVALDE--STVYFVDSGLIFLTGNFTKIAQSGDTSG  599
             VG  GGLATQL +G++G+ F+F +A+ +D+    +YF+DSGLIF T              
Sbjct  121   VGSNGGLATQLVSGIDGVPFAFADALDVDQIGGVIYFIDSGLIFRT--------------  166

Query  600   RLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFLLISEFIAKKITKYIIKGPKANTTQTL  779
             R+ ++             L GP                              KAN+T+  
Sbjct  167   RIRRFW------------LKGP------------------------------KANSTEIF  184

Query  780   LKLEGQPDNVKRATSGGYWVAVNILKppqpqqLIPMTESIAVKFDRNGKILDRKNVTSAY  959
               L G PDN+KR   G Y VAVNI+K  Q     P   ++A + D  G ++   N+T+ Y
Sbjct  185   ANLTGHPDNIKRTILGDYCVAVNIVKQQQT----PTIFALAQRVDVLGNVVLSLNLTAQY  240

Query  960   PNSFSAYLEHFGKAYTGS-LVPNFLGVY  1040
             PNSFS   E+FG+ Y GS  + NF+GVY
Sbjct  241   PNSFSEVQEYFGRLYIGSFFLENFVGVY  268



>ref|XP_002298158.2| strictosidine synthase family protein [Populus trichocarpa]
 gb|EEE82963.2| strictosidine synthase family protein [Populus trichocarpa]
Length=391

 Score =   213 bits (543),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 130/322 (40%), Positives = 178/322 (55%), Gaps = 32/322 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE +AF+  G GPYTGVADGRIL Y   K+ DFA TS  R++ IC+   + +  L    
Sbjct  70    GPESMAFDPLGRGPYTGVADGRILFYDGQKWTDFAYTSSNRSE-ICNPQPSPLSYLKNEH  128

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-ES  518
             ICGRPLGL F  +TGDLYIAD  FGL+KVGP+GGLAT L+    GI   FTN + +D E 
Sbjct  129   ICGRPLGLRFDKKTGDLYIADAYFGLMKVGPEGGLATSLSNEAEGIPLRFTNDLDIDDEG  188

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              +YF DS   +   NF ++  SG+ SGR+LKY   T   TV++R L  P G+++SKD +F
Sbjct  189   NIYFTDSSTTYQRRNFMQLVFSGENSGRVLKYNPTTKETTVLVRNLQFPNGVSLSKDGSF  248

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNI---------  851
              +  E    ++ KY +KG KA T++ L  L G PDNV+    G +WVA++          
Sbjct  249   FVFCEGSIGRLRKYWLKGEKAGTSEVLAILPGFPDNVRTNEEGNFWVAIHCRRSFYTHIN  308

Query  852   -----LKppqpqqLIPMT-----------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                  L+    +  IPM              + VK+   GK+L   ++       + S  
Sbjct  309   AQYPNLRTFLLKLPIPMKIQYLLQIGGWPHGLVVKYSPEGKLLQILEDSQGKVVKAISEV  368

Query  981   LEHFGKAYTGSLVPNFLGVYTL  1046
              E  GK + GS++  F+GVY L
Sbjct  369   EEKDGKLWMGSVLMRFVGVYNL  390



>ref|XP_004169880.1| PREDICTED: LOW QUALITY PROTEIN: strictosidine synthase 1-like 
[Cucumis sativus]
Length=350

 Score =   212 bits (540),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 124/311 (40%), Positives = 175/311 (56%), Gaps = 25/311 (8%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQLIC  347
             GPE +AF+ +GEGPY  V+DGRILK+      +  FA TSP R    CDG   +  +  C
Sbjct  38    GPESIAFDCRGEGPYASVSDGRILKWKGPHLGWTQFALTSPNREGKECDGQPQS--EAAC  95

Query  348   GRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--  521
             GRPLG++FHP T DLYIAD   GLL VGPKGGLA QLA    G+   FTNA+ +D     
Sbjct  96    GRPLGIKFHPTTCDLYIADAYXGLLAVGPKGGLARQLATSAQGVPLRFTNALDIDPQNGI  155

Query  522   VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFL  701
             VYF DS ++F    +     +GD +GRLLKY+  T  VTV+  GL+ P G+A++ D +FL
Sbjct  156   VYFTDSSILFQRRVWLLSIMNGDKTGRLLKYDPRTQNVTVLRNGLAFPNGVALNADSSFL  215

Query  702   LISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL-  878
             L++E    ++ K+ +KGPKANT +   +LE  PDN+KR  +G +W+A+N  +     Q  
Sbjct  216   LMAETGTLQVLKFWLKGPKANTMEIFAQLERFPDNIKRTDNGDFWIAMNSARGTLDTQTW  275

Query  879   ---------------IPMTES--IAVKFDRNGKILDRKNVTSAYP-NSFSAYLEHFGKAY  1004
                            IP  ++  +AVK +  G++    +        S S   E  G+ +
Sbjct  276   KELYRGATMKQGEVKIPWIQADPVAVKLNERGEVKGMVDGGEGQALESVSEVEESRGRLW  335

Query  1005  TGSLVPNFLGV  1037
              GS V  ++G+
Sbjct  336   IGSAVKPYVGL  346



>ref|XP_002323253.2| strictosidine synthase family protein [Populus trichocarpa]
 gb|EEF05014.2| strictosidine synthase family protein [Populus trichocarpa]
Length=349

 Score =   212 bits (539),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 124/324 (38%), Positives = 186/324 (57%), Gaps = 33/324 (10%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNT-ILQ  338
             AIGPE  AF+  GEGPYT ++DGRI+K+   K  +IDFA TSP R    C G ++   ++
Sbjct  28    AIGPESFAFDSLGEGPYTSLSDGRIIKWQGDKKRWIDFAVTSPNRDG--CGGPHDHHQME  85

Query  339   LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
              +CGRPLG  F    GDLYIAD   GL +VGP+GGLAT++A    GI F FTN++ +D+S
Sbjct  86    HVCGRPLGSCFDETHGDLYIADAYMGLFRVGPEGGLATKIATHAQGIPFRFTNSLDIDQS  145

Query  519   T--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
             +  +YF DS   +   ++  +  SGD SGRL+KY+  + +VTV+L+ L+ P G+A+S D 
Sbjct  146   SGAIYFTDSSTQYQRRDYLSVVLSGDKSGRLMKYDTASKQVTVLLKNLTFPNGVALSTDG  205

Query  693   TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpq  872
             +F+L++E  + +I +Y IK  KA   +   +L+G PDN+KR+  GGYWV +N  +    +
Sbjct  206   SFVLLAETTSCRILRYWIKTSKAGALEVFAQLQGFPDNIKRSPRGGYWVGINSKREKLSE  265

Query  873   qL------------IPMTES-------------IAVKFDRNGKILDR-KNVTSAYPNSFS  974
              L            +P+  +             +AV+   NG I++  ++       S S
Sbjct  266   LLFSYPWIGKVLLKLPLDITKFQTALAKYRGGGLAVRLSENGDIVEVFEDRDGNRLKSIS  325

Query  975   AYLEHFGKAYTGSLVPNFLGVYTL  1046
               +E  GK + GS+   F G + L
Sbjct  326   EVMEKDGKLWIGSIDLPFAGRFKL  349



>ref|XP_007045664.1| Calcium-dependent phosphotriesterase superfamily protein, putative 
[Theobroma cacao]
 gb|EOY01496.1| Calcium-dependent phosphotriesterase superfamily protein, putative 
[Theobroma cacao]
Length=376

 Score =   213 bits (541),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 122/300 (41%), Positives = 178/300 (59%), Gaps = 10/300 (3%)
 Frame = +3

Query  165   HAIGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQ  338
                GPE +AF+ K +GPY GV+DGRILK++     + +FA  SP+R + +CDG+ N  L+
Sbjct  75    QVTGPESIAFDCKNQGPYVGVSDGRILKWHGPHLGWKEFAIPSPVRDRKLCDGSTNPNLE  134

Query  339   LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
              ICGRPLGL+F+  T DLYIAD  FGLL VGP GG+A QLA    G+ F FTN + +D  
Sbjct  135   PICGRPLGLKFNYATCDLYIADAYFGLLVVGPNGGVAQQLATSAEGVPFRFTNGLDIDSK  194

Query  519   T--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
             T  VYF DS + F       +  + D SGRLLKY+  T  VTV+ RGL  P G+A++ D 
Sbjct  195   TGMVYFTDSSIFFQRRYHLLLRITSDRSGRLLKYDPRTKDVTVMSRGLMFPNGVALNADN  254

Query  693   TFLLISEFIAKKITKYIIKGPKANT--TQTLLKLEGQPDNVKRATSGGYWVAVNILKp--  860
             ++LL++E    +I K+ ++G +AN+   +  ++L   PDN++R  +G +WV +N  +   
Sbjct  255   SYLLVAESTTMRILKFRLEG-EANSYIPELFVQLSRTPDNIQRNKNGEFWVGLNSGRSGR  313

Query  861   pqpqqLIPMTESIAVKFDRNGKILDRKNVTSAYP-NSFSAYLEHFGKAYTGSLVPNFLGV  1037
              Q      + + + VK ++ GKIL + +       NS S   E  G  Y GS+   +LG+
Sbjct  314   IQDDAYAKLPDPVGVKLNQEGKILKQLDGNGGITFNSISEVQELNGTLYIGSVTKPYLGI  373



>ref|XP_010655934.1| PREDICTED: strictosidine synthase 1-like [Vitis vinifera]
 emb|CBI28989.3| unnamed protein product [Vitis vinifera]
Length=273

 Score =   209 bits (532),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 103/224 (46%), Positives = 149/224 (67%), Gaps = 4/224 (2%)
 Frame = +3

Query  174  GPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQLIC  347
            GPE +AF+  G+GPYTG++DG+ILK+   K  + +FA TSPLR    CDG+ N  ++ +C
Sbjct  39   GPESIAFDCNGDGPYTGISDGKILKWQGSKHGWKEFAITSPLRIPKFCDGSANPAMEQVC  98

Query  348  GRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--  521
            GRPLGL+F+  T DLYIAD  FGLL V   GG+A Q+A    G+ F FTNA+ +D++T  
Sbjct  99   GRPLGLKFNEATCDLYIADAYFGLLVVRRNGGVAKQVAISAEGVPFRFTNALDIDQNTGV  158

Query  522  VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFL  701
            VYF D+  IF    +    Q+GD + RLLKY+  +  VT++LRGLS   G+A+S+D  F+
Sbjct  159  VYFTDTSTIFQRWAYAIAMQTGDKTRRLLKYDPRSKEVTMLLRGLSFSNGVALSQDNDFV  218

Query  702  LISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGY  833
            L++E  A K+T+Y ++G K+  + T  +L G PDN++R   G +
Sbjct  219  LVTETTAAKVTRYWLQGQKSQLSDTFTRLVGCPDNIQRNIHGEF  262



>ref|XP_004172338.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Cucumis sativus]
Length=402

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 131/323 (41%), Positives = 181/323 (56%), Gaps = 34/323 (11%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK-FIDFATTSPLRTKVICDGTNNTI----LQ  338
             GPE VAF+  G GPYTGVADGR+L ++NG+ + DFA TSP R++ ICD   +       +
Sbjct  81    GPESVAFDSLGRGPYTGVADGRVL-FWNGESWTDFAYTSPNRSE-ICDPKPSIFGYAKNE  138

Query  339   LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-E  515
              ICGRPLGL F  +TGDLYIAD  FGL+KVGP+GGLAT L+    G+ F F N + LD E
Sbjct  139   HICGRPLGLRFDKKTGDLYIADAYFGLMKVGPEGGLATSLSTEAEGVPFKFINDLDLDDE  198

Query  516   STVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               VYF DS   +   NF ++  S + +GRLLKY   TG  TV++R L  P G+++SKD +
Sbjct  199   GNVYFTDSSTKYERRNFIQVVFSAENTGRLLKYNAATGETTVLVRDLHFPNGVSLSKDGS  258

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVN---------  848
             F L  E    ++ KY +KG KA T +    L G PDNV+    G +WVAV+         
Sbjct  259   FFLFCEGGKGRLRKYWLKGEKAGTNELFAILPGFPDNVRTNDKGDFWVAVHSRHSTLAHL  318

Query  849   ---ILKppqpqqLIPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSA  977
                  K  +    +P++              ++AVK+   GK+L   ++       + S 
Sbjct  319   EAKYPKLRKILLKLPISAKIQFLLHVGGRPHAVAVKYSPEGKLLQILEDTQGKVVKAVSE  378

Query  978   YLEHFGKAYTGSLVPNFLGVYTL  1046
               E  GK + GS++ +F+ VY L
Sbjct  379   VEEKDGKLWIGSVLMSFIAVYEL  401



>ref|XP_009631158.1| PREDICTED: strictosidine synthase 1-like [Nicotiana tomentosiformis]
Length=337

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 125/301 (42%), Positives = 170/301 (56%), Gaps = 24/301 (8%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQL  341
             A+GPE +AF+  GEGPYTGVADGRILK+      + DFA TS  R    C   +   ++ 
Sbjct  52    AVGPESIAFDPNGEGPYTGVADGRILKWQEQAQTWADFAVTSSERNN--CTQPSAPEMEH  109

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDE--  515
             ICGRPLG+ F  +TGDLYIAD   GL  VGPKGGL T L     G    FTN + +D   
Sbjct  110   ICGRPLGIRFDKKTGDLYIADAYLGLQVVGPKGGLTTPLVQKFEGKPLIFTNDMDIDNQN  169

Query  516   STVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
             + +YF DS   +    +     SGDT+GRL+KY+  T +VTVVLRGL+   G+A++KD++
Sbjct  170   NVIYFTDSSTKYQRRQYFAAFVSGDTTGRLMKYDKSTKKVTVVLRGLAFANGVALNKDRS  229

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             F+L++E    +I +Y IKGP A        + G PDN++  + G +WVA++         
Sbjct  230   FVLVAETANCRIIRYWIKGPYAGRHDIFADVPGFPDNIRINSRGEFWVALHA--------  281

Query  876   LIPMTESIAVKFDRNGKIL----DRKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGVYT  1043
                 T + A+K   NG++L    D    T  Y    S   E  GK + GS++  FLGVY 
Sbjct  282   ---KTSATAIKLSANGRMLEVLEDEDGKTLRY---ISEVEEKHGKLWFGSVMMPFLGVYG  335

Query  1044  L  1046
             L
Sbjct  336   L  336



>ref|XP_004137361.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Cucumis sativus]
 gb|KGN63897.1| hypothetical protein Csa_1G025790 [Cucumis sativus]
Length=402

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 131/323 (41%), Positives = 181/323 (56%), Gaps = 34/323 (11%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK-FIDFATTSPLRTKVICDGTNNTI----LQ  338
             GPE VAF+  G GPYTGVADGR+L ++NG+ + DFA TSP R++ ICD   +       +
Sbjct  81    GPESVAFDSLGRGPYTGVADGRVL-FWNGESWTDFAYTSPNRSE-ICDPKPSIFGYAKNE  138

Query  339   LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-E  515
              ICGRPLGL F  +TGDLYIAD  FGL+KVGP+GGLAT L+    G+ F F N + LD E
Sbjct  139   HICGRPLGLRFDKKTGDLYIADAYFGLMKVGPEGGLATSLSTEAEGVPFKFINDLDLDDE  198

Query  516   STVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               VYF DS   +   NF ++  S + +GRLLKY   TG  TV++R L  P G+++SKD +
Sbjct  199   GNVYFTDSSTKYERRNFIQVVFSAENTGRLLKYNAATGETTVLVRDLHFPNGVSLSKDGS  258

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVN---------  848
             F L  E    ++ KY +KG KA T +    L G PDNV+    G +WVAV+         
Sbjct  259   FFLFCEGGKGRLRKYWLKGEKAGTNELFAILPGFPDNVRTNDKGDFWVAVHSRHSTLAHL  318

Query  849   ---ILKppqpqqLIPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSA  977
                  K  +    +P++              ++AVK+   GK+L   ++       + S 
Sbjct  319   EAEYPKLRKILLKLPISAKIQFLLHVGGRPHAVAVKYSPEGKLLQILEDTQGKVVKAVSE  378

Query  978   YLEHFGKAYTGSLVPNFLGVYTL  1046
               E  GK + GS++ +F+ VY L
Sbjct  379   VEEKDGKLWIGSVLMSFIAVYEL  401



>emb|CDP21347.1| unnamed protein product [Coffea canephora]
Length=391

 Score =   212 bits (540),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 135/328 (41%), Positives = 183/328 (56%), Gaps = 42/328 (13%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE +AF+ +G GPYTG+ADGRI+ +   K+IDFA TS  R+  +CD   +    L    
Sbjct  70    GPESIAFDPQGRGPYTGIADGRIVFWDGEKWIDFAYTSANRSG-LCDPKPSPFSYLKNEH  128

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-ES  518
             ICGRPLGL F  +TGDLYIAD  FGL+KVGP+GGLAT L     G+   FTN + +D E 
Sbjct  129   ICGRPLGLRFDKKTGDLYIADAYFGLMKVGPEGGLATSLTTEAEGVPLGFTNDLDIDDEG  188

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              +YF DS   +   NF  +  SGD SGRLLKY  ET   TV++RGL  P G+++SKD++F
Sbjct  189   NIYFTDSSTKYQRRNFLLLVFSGDDSGRLLKYNPETKETTVLVRGLQFPNGVSMSKDRSF  248

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAV----------N  848
              +  E    ++ KY +KG KA T++ +  L G PDN++    G +WVAV          N
Sbjct  249   FVFCEGSIGRLRKYWLKGDKAGTSEVMAVLPGFPDNIRTNEKGEFWVAVHCRRTVYAYIN  308

Query  849   ILKppqpqqLIPM---------------TESIAVKFDRNGKIL----DR--KNVTSAYPN  965
              L P   + L+ +                 ++ VK+   GKIL    DR  K V +A   
Sbjct  309   ALYPNVRKFLLKLPIPAKIHYLLQIGGRPHAVIVKYSPEGKILQILEDRQGKVVKAA---  365

Query  966   SFSAYLEHFGKAYTGSLVPNFLGVYTLK  1049
               S   E  GK + GS++  F+ VY L+
Sbjct  366   --SEVEEKDGKLWIGSVLMPFVAVYQLE  391



>gb|EYU18642.1| hypothetical protein MIMGU_mgv1a008518mg [Erythranthe guttata]
Length=371

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/322 (36%), Positives = 184/322 (57%), Gaps = 30/322 (9%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQLIC  347
             A+GPE + F+  G GPYTGVADGRILK+    +++F+ TS  R +  C    N  ++ +C
Sbjct  52    AVGPESLVFDPSGGGPYTGVADGRILKWNGKNWLEFSVTSSQREE--CSEAFNPTMEHVC  109

Query  348   GRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDE--ST  521
             GRPLGL FH ++GDLYIAD   GL  VGP+GG+A+ L   V+G KF FTN + +DE  + 
Sbjct  110   GRPLGLRFHRKSGDLYIADAYLGLQVVGPRGGMASPLVTHVHGNKFLFTNDIDIDEEDNA  169

Query  522   VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFL  701
             +YF DS  +F    F     + D +G+L+KY++ + +VT++L+GL+   G+A+SKD++F+
Sbjct  170   IYFTDSSTVFHRREFMPSILTMDKTGKLMKYDISSKQVTILLQGLAFANGVALSKDRSFV  229

Query  702   LISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVN-----------  848
             L++E   ++I +Y ++GP      T ++L G PDNV+R   G +WVA++           
Sbjct  230   LVAETTNRRILRYWLQGPNIGKHDTFVELPGLPDNVRRNQEGEFWVALHSKTGLLTKWAI  289

Query  849   --------ILKppqpqqLIPM------TESIAVKFDRNGKILD-RKNVTSAYPNSFSAYL  983
                     +LK     + +          + A+K    GKIL   +++        S   
Sbjct  290   SYSWFGSTMLKLSLNFKQLHYFLVGGKPHATAIKLSSEGKILQVLEDLEGTTLRFISEVE  349

Query  984   EHFGKAYTGSLVPNFLGVYTLK  1049
             E  GK +  S++  ++G+YTL+
Sbjct  350   ERNGKLWISSVLMPYIGIYTLQ  371



>ref|XP_002514533.1| strictosidine synthase, putative [Ricinus communis]
 gb|EEF47639.1| strictosidine synthase, putative [Ricinus communis]
Length=352

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/298 (39%), Positives = 179/298 (60%), Gaps = 12/298 (4%)
 Frame = +3

Query  171   IGPEDVAFNGKGEGPYTGVADGRILKYY-NGK-FIDFATTSPLRTKVICDGTNNTILQLI  344
             +GPE +AF+  G GPY GV+DGRIL++   GK +++FA TS  R   +CDG+ NT L+ I
Sbjct  61    LGPESLAFDCNGNGPYAGVSDGRILRWQGQGKGWVEFAITSANRK--LCDGSENTDLEPI  118

Query  345   CGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST-  521
             CGRPLGL+FHP T DLY+AD  FGLLKVGP GG+AT+LA    G+   FTN + +D ++ 
Sbjct  119   CGRPLGLKFHPATCDLYVADAYFGLLKVGPNGGVATRLATSAEGVPLKFTNDLDIDPNSG  178

Query  522   -VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF DS + +    F +     D +GRLLKY++ T +V+V+ RGL+ P G+ +SKD ++
Sbjct  179   VVYFTDSSVHYERRLFMEAISKADRTGRLLKYDLTTKKVSVLYRGLAFPNGVVLSKDNSY  238

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
             LL+ E +  ++ K+ +             L+  PDN++R  +G +WVA+N  +       
Sbjct  239   LLLVESMNFQVLKFPLSSYGVGVPHVFASLDRFPDNIRRNDNGDFWVALNTARGKLQGA-  297

Query  879   IPMTESIAVKFDRNGKILDRKNVTSAYP-NSFSAYLEHFGKAYTGSLVPNFLGVYTLK  1049
               + + + ++F+  G+++   N       +S S   EH G+ + GS    ++G  TLK
Sbjct  298   --VEDPVGIRFNEYGRVVQVVNGNGGDTLDSVSEIEEHDGRLWFGSPTQPYVG--TLK  351



>gb|AES67180.2| strictosidine synthase family protein [Medicago truncatula]
Length=396

 Score =   212 bits (539),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 131/324 (40%), Positives = 180/324 (56%), Gaps = 34/324 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNG-KFIDFATTSPLRTKVICDGTNNTILQL---  341
             GPE +AF+  G GPYTGVADGRIL ++NG  +IDFA TSP R+++     + T L     
Sbjct  73    GPESIAFDSHGRGPYTGVADGRIL-FWNGLSWIDFAYTSPNRSELCNLKASATPLSYVET  131

Query  342   --ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-  512
               ICGRPLGL F  +TGDLYIAD  FGL+KVGP+GG AT LA    G+ F FTN V +D 
Sbjct  132   EDICGRPLGLRFDKKTGDLYIADAYFGLMKVGPQGGFATSLATEAEGVPFRFTNDVDIDT  191

Query  513   ESTVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
             E  VYF DS   +   NF ++  SGD SGR+LKY   T   TV++R +  P G+++SKD 
Sbjct  192   EGNVYFTDSSTKYQRRNFIQLILSGDNSGRVLKYNSATKETTVLVRNIQFPNGISLSKDG  251

Query  693   TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNIL------  854
             +F + SE +  ++ KY +KG KA T + L  L G  DNV+   +G +WVA++        
Sbjct  252   SFFVFSEGVIGRLCKYWLKGDKAGTLEILAILPGFADNVRVNENGDFWVAIHCRRYMYSY  311

Query  855   ------KppqpqqLIPMTESI-------------AVKFDRNGKILD-RKNVTSAYPNSFS  974
                   K  +    +P+   I              VK+  +GK+L   ++       + S
Sbjct  312   INALYPKIRKAILKLPIPTRIQYLLHIGGKMHAAVVKYSPDGKLLQILEDNEGKVVKAVS  371

Query  975   AYLEHFGKAYTGSLVPNFLGVYTL  1046
                E  GK + GS++  F+ VY L
Sbjct  372   EVEEKDGKLWIGSVLMPFIAVYHL  395



>ref|XP_010269382.1| PREDICTED: strictosidine synthase 1-like [Nelumbo nucifera]
Length=371

 Score =   211 bits (536),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 119/323 (37%), Positives = 179/323 (55%), Gaps = 32/323 (10%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKYY-NGK-FIDFATTSPLRTKVICDGTNNTILQL  341
             A+GPE +AF+  GEGPYTGVADGRILK+   G+ + +FA TSP R    C       ++ 
Sbjct  50    AVGPESLAFDPNGEGPYTGVADGRILKWQGEGQGWTEFAVTSPQRKD--CVQPQAPHMEH  107

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDE--  515
             +CGRPLG+ FHP TGDLYIAD   G  +VGP GGLAT+L     G   +FTN + +DE  
Sbjct  108   VCGRPLGIRFHPTTGDLYIADSYLGFHRVGPAGGLATRLITEAEGEPLTFTNDLDIDEHE  167

Query  516   STVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               +YF D+   F    F  +  SGD +GRL+KY+     V V+LRGL+   G+A+SKD++
Sbjct  168   DVIYFTDTSTKFQRRQFISVILSGDKTGRLMKYDRSRNEVKVLLRGLAFANGVALSKDRS  227

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             F+L++E    ++ ++ ++GPKA T     +L G PDN++R + G +WVA++  K      
Sbjct  228   FVLVAETTNCRVLRFWLQGPKAGTHDVFAELPGFPDNIRRNSKGEFWVALHSKKGLLSGW  287

Query  876   LI------------PMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSA  977
              +            P++              + A+K D  G++++  ++         S 
Sbjct  288   AVSNCWVGKALLKLPLSFRKLHLVLIGWKVHATAIKLDEEGRVVEVLEDSQGRTLRLISE  347

Query  978   YLEHFGKAYTGSLVPNFLGVYTL  1046
               E  G  + GS++  F+G+Y L
Sbjct  348   VEEKDGNLWIGSVLMPFMGLYNL  370



>ref|XP_003596929.1| Adipocyte plasma membrane-associated protein [Medicago truncatula]
Length=393

 Score =   211 bits (538),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 131/324 (40%), Positives = 181/324 (56%), Gaps = 34/324 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNG-KFIDFATTSPLRTKVICDGTNNTIL-----  335
             GPE +AF+  G GPYTGVADGRIL ++NG  +IDFA TSP R+++     + T L     
Sbjct  70    GPESIAFDSHGRGPYTGVADGRIL-FWNGLSWIDFAYTSPNRSELCNLKASATPLSYVET  128

Query  336   QLICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-  512
             + ICGRPLGL F  +TGDLYIAD  FGL+KVGP+GG AT LA    G+ F FTN V +D 
Sbjct  129   EDICGRPLGLRFDKKTGDLYIADAYFGLMKVGPQGGFATSLATEAEGVPFRFTNDVDIDT  188

Query  513   ESTVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
             E  VYF DS   +   NF ++  SGD SGR+LKY   T   TV++R +  P G+++SKD 
Sbjct  189   EGNVYFTDSSTKYQRRNFIQLILSGDNSGRVLKYNSATKETTVLVRNIQFPNGISLSKDG  248

Query  693   TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNIL------  854
             +F + SE +  ++ KY +KG KA T + L  L G  DNV+   +G +WVA++        
Sbjct  249   SFFVFSEGVIGRLCKYWLKGDKAGTLEILAILPGFADNVRVNENGDFWVAIHCRRYMYSY  308

Query  855   ------KppqpqqLIPMTESI-------------AVKFDRNGKILD-RKNVTSAYPNSFS  974
                   K  +    +P+   I              VK+  +GK+L   ++       + S
Sbjct  309   INALYPKIRKAILKLPIPTRIQYLLHIGGKMHAAVVKYSPDGKLLQILEDNEGKVVKAVS  368

Query  975   AYLEHFGKAYTGSLVPNFLGVYTL  1046
                E  GK + GS++  F+ VY L
Sbjct  369   EVEEKDGKLWIGSVLMPFIAVYHL  392



>ref|XP_002278088.1| PREDICTED: strictosidine synthase 3 [Vitis vinifera]
Length=391

 Score =   211 bits (538),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 129/324 (40%), Positives = 185/324 (57%), Gaps = 34/324 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK-FIDFATTSPLRTKVICDGTNNTILQL---  341
             GPE VAF+  G GPYTGVADGRIL ++NG+ + DFA TSP R++ +CD   + +  L   
Sbjct  70    GPESVAFDPLGRGPYTGVADGRIL-FWNGEAWSDFAYTSPNRSE-LCDPKPSPLSYLKNE  127

Query  342   -ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
              ICGRPLGL F+ RTGDLYIAD   GL+KVGP+GGLAT L    +G+   FTN + +D++
Sbjct  128   HICGRPLGLRFNKRTGDLYIADSYLGLMKVGPEGGLATSLVTEADGVPLRFTNDLDIDDA  187

Query  519   -TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               +YF DS   +   NF ++  S + SGRLLKY+  T   TV+LRGL  P G+++SKD +
Sbjct  188   GNIYFTDSSSKYQRRNFMQLVFSSEDSGRLLKYDPLTKETTVLLRGLQFPNGVSLSKDGS  247

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNI--------  851
             FL++ E    ++ KY +KG KA T++    L G PDNV+    G +WVA++         
Sbjct  248   FLVLCEGSPGRLVKYWLKGDKAGTSEVFAILPGYPDNVRTNEKGEFWVAIHCRRTMYSYL  307

Query  852   ------LKppqpqqLIPMT-----------ESIAVKFDRNGKILD-RKNVTSAYPNSFSA  977
                   L+    +  IP              ++ VK+   GK++   ++       + S 
Sbjct  308   CGLYPKLRMFLLKLPIPTRYQYLLHIGGRLHAVVVKYSPEGKLVKILEDSEGKVVRAVSE  367

Query  978   YLEHFGKAYTGSLVPNFLGVYTLK  1049
               E  GK + GS++  F+ VY L+
Sbjct  368   VEEREGKLWMGSVLMPFVAVYQLE  391



>emb|CDP09527.1| unnamed protein product [Coffea canephora]
Length=374

 Score =   211 bits (536),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 121/323 (37%), Positives = 179/323 (55%), Gaps = 32/323 (10%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQL  341
             A+GPE +AF+  GEGPYTGVADGRILK+   +  ++DFA TS  R    C       ++ 
Sbjct  53    AVGPESLAFDPNGEGPYTGVADGRILKWQGHQLGWVDFAVTSSQRKD--CFHPFAPHMEH  110

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDE--  515
             ICGRPLGL F  + GDLYIAD   GL  VGP GGLAT L   V G    FTN + +DE  
Sbjct  111   ICGRPLGLRFDRKNGDLYIADAYLGLQVVGPTGGLATPLVTEVEGAVLRFTNDMDIDEHE  170

Query  516   STVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
              T+YF DS  +FL   F     S D +GRL+KY+  +  V+++LRGL+   G+++SKD++
Sbjct  171   DTIYFTDSSTVFLRRQFISSVLSADRTGRLMKYDKSSKEVSILLRGLAFANGVSLSKDQS  230

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             F+L++E    +I ++ ++GP A    T  +L G PDN++R + G +WVA++       + 
Sbjct  231   FVLVAESTTCRIVRFWLRGPNAGKHDTFTELPGFPDNIRRNSKGEFWVALHAKTGLLIKW  290

Query  876   LI------------PMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSA  977
             +I            P++              + A+K    G++LD  +++        S 
Sbjct  291   VIANSWSGKTLLKLPLSFKQLHHFLVGGQAHATAIKLSEEGEVLDVLEDLDGKTLRFISE  350

Query  978   YLEHFGKAYTGSLVPNFLGVYTL  1046
               E  GK + GS++  F+G+Y L
Sbjct  351   VEERNGKLWIGSVLMPFIGIYNL  373



>ref|XP_006826427.1| hypothetical protein AMTR_s00004p00163660 [Amborella trichopoda]
 gb|ERM93664.1| hypothetical protein AMTR_s00004p00163660 [Amborella trichopoda]
Length=388

 Score =   211 bits (537),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 124/320 (39%), Positives = 181/320 (57%), Gaps = 32/320 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE +AF+ +G GPYTGVADGRIL +    + +FA TSP R++ ICD   + +  L    
Sbjct  70    GPESLAFDPQGRGPYTGVADGRILFWNGYSWTEFAVTSPNRSE-ICDPKPSPLAYLKNEH  128

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES-  518
             ICGRPLGL F+ +TG+LYI D  FGLLKVGP+GGLAT L + VNG+   FTN + +DE  
Sbjct  129   ICGRPLGLRFNKKTGELYICDAYFGLLKVGPEGGLATPLVSEVNGVPLKFTNDLDIDEDG  188

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF DS   +   NF ++  S + SGR+ KY+  T  VTV+L G+    GL++SKD +F
Sbjct  189   NVYFTDSSTTYQRRNFMQLIFSSEGSGRVFKYDAITKEVTVLLSGIQFANGLSLSKDGSF  248

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNI---------  851
              ++ E +  ++ +Y +KG K  T+  L  L G PDNV+    G +WVA++          
Sbjct  249   FVVCECVPGRLRRYWLKGKKVGTSDMLAVLPGFPDNVRTNEKGDFWVAMHCRRTFYAYFT  308

Query  852   -----LKppqpqqLIP-----------MTESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                  ++       IP              +I +K+  NG++L+  ++ +     + S  
Sbjct  309   GLYPKIRKFILNLPIPTKYQYLLQVGGWPHAIIIKYSPNGEVLEVLEDRSGKVVKAVSEV  368

Query  981   LEHFGKAYTGSLVPNFLGVY  1040
              EH GK + GS++  F+ VY
Sbjct  369   EEHDGKLWMGSVLMPFIAVY  388



>ref|XP_006287902.1| hypothetical protein CARUB_v10001136mg [Capsella rubella]
 gb|EOA20800.1| hypothetical protein CARUB_v10001136mg [Capsella rubella]
Length=395

 Score =   211 bits (538),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 125/322 (39%), Positives = 178/322 (55%), Gaps = 32/322 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE VAF+ +G GPYTGVADGR+L +   K+IDFA TS  R++ ICD   + +  L    
Sbjct  75    GPESVAFDPQGRGPYTGVADGRVLFWNGEKWIDFAYTSSNRSE-ICDPKPSALSYLRNEH  133

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES-  518
             ICGRPLGL F  RTGDLYIAD   GLLKVGP+GGLA  L     G+   FTN + +D+  
Sbjct  134   ICGRPLGLRFDKRTGDLYIADAYMGLLKVGPEGGLAMPLVTEAEGVPLGFTNDLDIDDDG  193

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
             TVYF DS + +   NF ++  SGD +GR+LKY+  + +  V++  +  P G++ISKD +F
Sbjct  194   TVYFTDSSINYQRRNFLQLVFSGDNTGRVLKYDPISKKAVVLVSNVQFPNGVSISKDGSF  253

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
              +  E     + +Y +KG KA TT     L G PDNV+   +G +WVA++  +      +
Sbjct  254   FVFCEGDIGSLRRYWLKGEKAGTTDVFAMLPGHPDNVRTNQNGEFWVALHCRRNYYSYLM  313

Query  879   ------------IPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                         +P+T               + VK+   GK++   ++    +  S S  
Sbjct  314   ARYPKLRMFILRLPITARTHYSFQIGLRPHGVVVKYSPEGKLIQVLEDSEGKFVRSVSEV  373

Query  981   LEHFGKAYTGSLVPNFLGVYTL  1046
              E  GK + GS++ NF+ VY L
Sbjct  374   EEKDGKLWMGSVLMNFVAVYDL  395



>ref|XP_003609162.1| Strictosidine synthase [Medicago truncatula]
 gb|AES91359.1| SMP-30/gluconolaconase/LRE-like region protein [Medicago truncatula]
Length=335

 Score =   209 bits (533),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 116/298 (39%), Positives = 179/298 (60%), Gaps = 9/298 (3%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYY--NGKFIDFATTSPLRTKVICDGTNN-TILQLI  344
             GPE +AF+  G GPY   +DGRI KY   N  F ++A T+P R + ICDG  + +++Q I
Sbjct  38    GPESLAFDRNGGGPYVTSSDGRIFKYVGSNEGFKEYAYTAPNRNRTICDGLADFSVVQAI  97

Query  345   CGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST-  521
             CGRPLGL F+ +T DLY+AD  FGL+KVGP GG ATQL          F + + +D  T 
Sbjct  98    CGRPLGLGFNHQTNDLYVADAYFGLVKVGPNGGNATQLVGPTQANSTMFADGLDVDPDTG  157

Query  522   -VYFVDSGLIFLTGNFTKI--AQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
              VYF  +   +   +F  +  + SGD SG LL+Y+  T + TV+LR L+ P+G+A+SK+ 
Sbjct  158   IVYFTIASTNYKLKDFQTVLASGSGDNSGSLLRYDPSTNQTTVLLRNLTIPSGVAVSKEG  217

Query  693   TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpq  872
             +F+L+SE++A +I +  +KGP+AN+++  + L G+PDN+KR + G +W++V+        
Sbjct  218   SFVLVSEYLANRIQRVWLKGPRANSSELFMLLAGRPDNIKRNSGGQFWISVSSFLGTPRS  277

Query  873   qLIPMTESIAVKFDRNGKILDRKNVTSAY-PNSFSAYLEHFGKAYTGSLVPNFLGVYT  1043
                    S  V+ + NG +L   ++   Y P + S   E+ G  Y GSL+ ++   +T
Sbjct  278   PGCSTLPS-GVRVNENGLVLQIVSLVEEYGPEAASEVQEYNGTLYGGSLLASYATSFT  334



>ref|XP_011075619.1| PREDICTED: protein STRICTOSIDINE SYNTHASE-LIKE 11 [Sesamum indicum]
Length=331

 Score =   209 bits (533),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 107/232 (46%), Positives = 154/232 (66%), Gaps = 7/232 (3%)
 Frame = +3

Query  168  AIGPEDVAFNGKGEGPYTGVADGRILKYY--NGKFIDFATTSPLRTKVICDGTNN-TILQ  338
            AIGPE  +F+G G+GPYTGV+DGRI+++     +++DFA TSP+R    C+G ++ +  +
Sbjct  48   AIGPESFSFDGNGDGPYTGVSDGRIIRWRANESQWVDFAVTSPMRDG--CEGPHDHSQKE  105

Query  339  LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
             ICGRPLGL F+ +TGDLYI D   GLL VGP GGLA+ LA  ++G+ F FTN++ +D +
Sbjct  106  HICGRPLGLRFNEKTGDLYITDAYMGLLVVGPNGGLASPLAQQLDGLAFGFTNSLDIDHN  165

Query  519  T--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
            T  VYF DS   F   N+  +  SGD +GRL+K++  T + T++L  L  P G+A+SK+ 
Sbjct  166  TGVVYFTDSSTRFPRRNYVSVIISGDDTGRLMKFDPRTKKTTLLLNNLKFPNGVALSKNG  225

Query  693  TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVN  848
             FLL  E    ++ K+ +K PKA   + L +L G PDNVKR + G +WV +N
Sbjct  226  DFLLFVETTTCRLFKFWLKPPKAGNVEVLAQLPGFPDNVKRNSIGEFWVGIN  277



>ref|XP_010430839.1| PREDICTED: strictosidine synthase 1-like [Camelina sativa]
Length=315

 Score =   209 bits (531),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 125/300 (42%), Positives = 170/300 (57%), Gaps = 22/300 (7%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFI---DFATTSPLRTKVICDGTNNTILQLI  344
             GPE +AF+  GEGPY GVADGR+LK+  GK +   DFA T  +  + IC       L+ +
Sbjct  29    GPESIAFDPAGEGPYVGVADGRVLKW-RGKLLGWTDFAYT--MANRQICVLPFAPELEHV  85

Query  345   CGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST-  521
             CGRPLGL FH +TGDLYIAD  FGLL VGP GGLA  L     G  F FTN + +DE   
Sbjct  86    CGRPLGLRFHKKTGDLYIADAYFGLLIVGPAGGLAKPLVTEAEGQPFRFTNDLDIDEEND  145

Query  522   -VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF D+   F    + +   + D +GR +KY+  + + TV+L G+S   G+A+SKD++F
Sbjct  146   VVYFTDASSKFQRWEYFRSFLNVDKTGRFIKYDRSSKKATVLLHGISFANGVALSKDRSF  205

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
             +L++E    KI +  + GPKA T    + L G PDN++R + G +WVA+N L        
Sbjct  206   VLVAETTNCKILRLWLSGPKAGTQDVFVVLPGYPDNIRRNSKGEFWVALNSL--------  257

Query  879   IPMTESI----AVKFDRNGKILDRKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGVYTL  1046
               + E I    AVK   +GK+L+     +      S   E  GK + GS V  F+GVY L
Sbjct  258   --INEEIRYTKAVKLSESGKVLEALGDKANRLQFISDVEEKDGKIWIGSSVAPFVGVYDL  315



>ref|XP_004305393.1| PREDICTED: strictosidine synthase-like [Fragaria vesca subsp. 
vesca]
Length=324

 Score =   209 bits (532),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 119/295 (40%), Positives = 164/295 (56%), Gaps = 20/295 (7%)
 Frame = +3

Query  165   HAIGPEDVAFNGKGEGPYTGVADGRILKYYNGKF--IDFATTSPLRTKVICDGTNNTILQ  338
             H   PE +AF+  G  PY GVADGRI K+    F  I+FA TS  R + +CD + +   +
Sbjct  41    HVPQPESIAFDCNG-APYVGVADGRIFKWLGSPFGWIEFAVTSANRPREVCDLSTSKDNE  99

Query  339   LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
              ICGRPLGL+F   T +LYIAD  FGLLK GP GG+A  LA    G  F F N V +D  
Sbjct  100   PICGRPLGLKFDLTTCELYIADAYFGLLKTGPYGGVAQVLATSAEGFPFRFLNGVDIDHQ  159

Query  519   T--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
             +  VYF D+  I+   N+     +GD +GRL++Y+  T +VTV+L GL+   G+A+SKD 
Sbjct  160   SGMVYFTDTSAIYQRRNWELSVSTGDKTGRLMRYDPSTKKVTVLLHGLAFANGVALSKDS  219

Query  693   TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpq  872
              F+L+++  AK + +Y ++GP+ANT  T   L G PDN+    +G +WVA N        
Sbjct  220   DFVLVTQTTAKNVLRYWLQGPRANTVDTFFNLRGAPDNINININGEFWVAEN--------  271

Query  873   qLIPMTESIAVKFDRNGKILDRKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGV  1037
                      AVK D  G  LD  +      N  S   + +G  + GS+V  F+GV
Sbjct  272   ---SAGRGKAVKLDAQGNFLDVVDGL----NPVSHVEQRYGNLWIGSVVNKFVGV  319



>ref|XP_008453519.1| PREDICTED: strictosidine synthase 3 [Cucumis melo]
Length=402

 Score =   211 bits (537),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 136/365 (37%), Positives = 193/365 (53%), Gaps = 36/365 (10%)
 Frame = +3

Query  54    NMKSLTMFWISILIFISSPCVIHSQppgillpiklklHAIGPEDVAFNGKGEGPYTGVAD  233
             N      +++ +  +   P    S+       I  K    GPE VAF+  G GPYTGVAD
Sbjct  41    NFPDFETYYVELPSWSQIPTERDSENLLQKSTIMFKDQVQGPESVAFDSLGRGPYTGVAD  100

Query  234   GRILKYYNGK-FIDFATTSPLRTKVICDGTNNTIL-----QLICGRPLGLEFHPRTGDLY  395
             GR+L ++NG+ + DFA TSP R++ ICD    +IL     + ICGRPLGL F  +TG+LY
Sbjct  101   GRVL-FWNGESWTDFAYTSPNRSE-ICD-PKPSILGYAKNEHICGRPLGLRFDKKTGNLY  157

Query  396   IADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-ESTVYFVDSGLIFLTGNFTK  572
             IAD  FGL+KVGP+GGLAT L+    G+ F F N + LD E  VYF DS   +   NF +
Sbjct  158   IADAYFGLMKVGPEGGLATSLSTEAEGVPFKFINDLDLDDEGNVYFTDSSTKYHRRNFIQ  217

Query  573   IAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFLLISEFIAKKITKYIIKG  752
             +  S + +GRLLKY   TG  TV++R L  P G+++SKD +F L  E    ++ KY +KG
Sbjct  218   VVFSAENTGRLLKYNAATGETTVLVRDLYFPNGVSLSKDGSFFLFCEGGKGRLRKYWLKG  277

Query  753   PKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpq------------qLIPMT--  890
              KA TT+    L G PDNV+    G +WVAV+                      +P++  
Sbjct  278   EKAGTTELFAILPGFPDNVRTNDKGDFWVAVHSRHSTLAHLEAKYPKLRKLLLKLPISAK  337

Query  891   -----------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLG  1034
                         ++ VK+   GK+L   ++       + S   E  GK + GS++ +F+ 
Sbjct  338   IQFLLHVGGRPHAVVVKYSPEGKLLQILEDTEGKVVKAVSEVEEKDGKLWIGSVLMSFIA  397

Query  1035  VYTLK  1049
             VY L+
Sbjct  398   VYELR  402



>ref|XP_004237337.1| PREDICTED: strictosidine synthase 3-like [Solanum lycopersicum]
Length=377

 Score =   210 bits (535),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 127/324 (39%), Positives = 174/324 (54%), Gaps = 34/324 (10%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKY--YNGKFIDFATTSPLRTKVICDGTNNTILQL  341
             A G E V F+  GEGPYTGVADGRI+K+  +N  ++DFA TS  R    C   +   ++ 
Sbjct  56    AFGAESVVFDPNGEGPYTGVADGRIIKWLQHNQTWVDFAVTSSQREN--CTRASAPEMEH  113

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES-  518
             +CGRPLGL F  +TGDLYIAD   GL  VGP GGLAT L          FTN + +D+  
Sbjct  114   VCGRPLGLRFDHQTGDLYIADAYLGLQVVGPNGGLATPLVQHFEDQPLLFTNDLDIDDHD  173

Query  519   -TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               +YF DS  I+    F     SGD +GRL+KY+  T +VT++L+GLS   G+A+SKD+T
Sbjct  174   HVIYFTDSSTIYQRRQFVNATASGDKTGRLMKYDKSTKQVTILLQGLSFANGVALSKDRT  233

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             F+L+SE  A +IT+Y +KGP   T  T  +L G PDNV+  + G +WVA++  K     +
Sbjct  234   FVLVSETSACRITRYWLKGPNVGTHDTFAQLPGFPDNVRMNSRGEFWVALHA-KASPLAR  292

Query  876   LIPMT-------------------------ESIAVKFDRNGKILDRKNVTSAYPNSF--S  974
             LI                             + A+K   +G IL+           F   
Sbjct  293   LITSNSWLGKALLRKFNFQQMHNLLVGGKPHATAIKLSEDGGILEVLEDVEGKKLRFISE  352

Query  975   AYLEHFGKAYTGSLVPNFLGVYTL  1046
              + E  GK + GS++ + LGVY L
Sbjct  353   VHEEENGKLWIGSVLMSSLGVYQL  376



>ref|XP_011075408.1| PREDICTED: protein STRICTOSIDINE SYNTHASE-LIKE 11 [Sesamum indicum]
Length=368

 Score =   210 bits (534),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 118/321 (37%), Positives = 176/321 (55%), Gaps = 30/321 (9%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQLIC  347
             A+GPE + F+  G GPYTGVADGR+LK+    +++FA TS  R K  C    N  ++ IC
Sbjct  50    AVGPESLVFDPSGGGPYTGVADGRVLKWNGVDWVEFAVTSSQREK--CSHPFNPAMEHIC  107

Query  348   GRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES--T  521
             GRPLGL FHP+T DLYIAD   GL  VGP GG+ +QL   V G    FTN + +DE    
Sbjct  108   GRPLGLRFHPKTEDLYIADAYLGLQVVGPGGGMGSQLVTEVEGQPLRFTNDMDIDEEEDV  167

Query  522   VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFL  701
             +YF DS  +F    F     + D +G+L+KY++    VTV+LRGL+   G+++SKD++F+
Sbjct  168   IYFTDSSTVFHRREFMSSVLTMDMTGKLMKYDIPKKEVTVLLRGLAFANGVSLSKDRSFV  227

Query  702   LISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVN-----ILKppq  866
             L++E    +I ++ ++GP A       +L G PDN++R + G +WVA++     + K   
Sbjct  228   LVAETTRCRIVRFWLQGPNAGKHDIFAELPGFPDNIRRNSEGEFWVALHSKTGVLTKWAT  287

Query  867   pqqL-------IPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAYL  983
                        +P+T              + AVK    GKIL   ++V        S   
Sbjct  288   SYSWFGRSLLKLPLTFKQLHYLLVGGKPHATAVKLSNEGKILQVLEDVEGKTLKFISEVE  347

Query  984   EHFGKAYTGSLVPNFLGVYTL  1046
             E  GK +  S++  ++G+YT+
Sbjct  348   ERHGKLWIASVLMPYIGIYTV  368



>gb|EPS66876.1| hypothetical protein M569_07898, partial [Genlisea aurea]
Length=383

 Score =   210 bits (535),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 123/319 (39%), Positives = 175/319 (55%), Gaps = 29/319 (9%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDG----TNNTILQL  341
             GPE +AF+  G GPYTGVADGRIL +   K+  FA TSP R++ +CD     T+ +  + 
Sbjct  65    GPESLAFDPIGRGPYTGVADGRILFWDGQKWTHFAHTSPNRSQGLCDPKPSITDYSDNEH  124

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES-  518
             ICGRPLGL F  R GDLYIAD   GL+KVGP+GGLAT LA    GI   FTN + +DE  
Sbjct  125   ICGRPLGLRFDKRNGDLYIADAYLGLMKVGPRGGLATSLATEAEGIPLGFTNDLDIDEHG  184

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF DS   +   N+ ++  + D +GRL+KY+  T +  V++R L  P G+++SKD +F
Sbjct  185   NVYFSDSSTNYRRRNYMQLIYTADNTGRLIKYDPTTKQTRVLVRNLQFPNGVSLSKDGSF  244

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
                 EF   +++KY +KG KA TT+ +  L G PDNV+    G +WVAV   +      L
Sbjct  245   FAYCEFSRARLSKYWLKGEKAGTTEIMAALPGYPDNVRTNEEGEFWVAVPTRRMWYADFL  304

Query  879   ----------------------IPMTESIAVKFDRNGKILD-RKNVTSAYPNSFSAYLEH  989
                                    P+  ++ +K+   GKIL   ++       + S   E 
Sbjct  305   GRHPSLRKLRLKLPLPIMRRKSSPLN-AMVIKYSPEGKILKILEDEPGKVVRAVSEVDEK  363

Query  990   FGKAYTGSLVPNFLGVYTL  1046
              G+ + G+++ N + VY L
Sbjct  364   DGRLWMGTVILNSIAVYQL  382



>ref|XP_010454464.1| PREDICTED: strictosidine synthase 3-like [Camelina sativa]
Length=395

 Score =   211 bits (536),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 126/322 (39%), Positives = 176/322 (55%), Gaps = 32/322 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE VAF+  G GPYTGVADGR+L +   ++IDFA TS  R+ VICD   + +  L    
Sbjct  75    GPESVAFDPLGRGPYTGVADGRVLFWNGERWIDFAYTSSNRS-VICDPKPSALSYLRNEH  133

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES-  518
             ICGRPLGL F  R GDLYIAD   GLLKVGP+GGLA  L     G+   FTN + +D+  
Sbjct  134   ICGRPLGLRFDKRNGDLYIADAYMGLLKVGPEGGLAMPLVTEAGGVPLGFTNDLDIDDDG  193

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
             TVYF DS + +   NF ++  SGD SGR+LKY+    +  V++  +  P G++ISKD +F
Sbjct  194   TVYFTDSSINYQRRNFLQLVFSGDNSGRVLKYDPVAKKAVVLVSNVQFPNGVSISKDGSF  253

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
              L  E    ++ +Y +KG KA TT     L G PDNV+   +G +WVA++  +      +
Sbjct  254   FLFCEGDVGRLRRYWLKGKKAGTTDVFALLPGHPDNVRTNQNGEFWVALHCRRNYYSYLM  313

Query  879   ------------IPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                         +P+T               + VK+   GK++   ++    +  S S  
Sbjct  314   ARYPKLRMFILRLPITARTHYSFQIGLRPHGLVVKYSPEGKLMQVLEDSEGKFVRSVSEV  373

Query  981   LEHFGKAYTGSLVPNFLGVYTL  1046
              E  GK + GS++ NF+ VY L
Sbjct  374   EEKDGKLWLGSVLMNFVAVYDL  395



>ref|XP_008776219.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Phoenix dactylifera]
Length=389

 Score =   210 bits (535),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 127/323 (39%), Positives = 178/323 (55%), Gaps = 38/323 (12%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE VAF+  G GPYTGVADGR+L +    + DFA TSP+R++ +CD   + +  L    
Sbjct  71    GPESVAFDPLGRGPYTGVADGRVLFWNGHSWSDFAYTSPIRSE-LCDPKPSPLSYLKNEH  129

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES-  518
             ICGRPLGL F  +TGDLYIAD  FGLLKVGP+GGLAT L     G++ +FTN + +DE  
Sbjct  130   ICGRPLGLRFDKKTGDLYIADAYFGLLKVGPEGGLATPLTTEAEGVQLNFTNDLDIDEEG  189

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              +YF DS   +   NF ++  SG+ SGRLLKY   T   TV+LR L  P G+++SKD +F
Sbjct  190   NIYFTDSSTNYQRRNFMQLVFSGEPSGRLLKYNPVTNETTVLLRNLQFPNGVSLSKDGSF  249

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
              +  E    ++++Y +KG KA T+     L G PDNV+    G +WVA++  +      +
Sbjct  250   FVFCEGSRGRLSRYWLKGEKAGTSDIFAILPGFPDNVRTNEKGEFWVAIHCRRTVYAHLM  309

Query  879   --------------IPMT-----------ESIAVKFDRNGKIL----DRKNVTSAYPNSF  971
                           IP              ++ +K+  +GK+L    DRK        + 
Sbjct  310   GRYTRLRKFLLKLPIPAKYQYLMQIGGRLHALIIKYSPDGKLLEILEDRKGKVV---RAV  366

Query  972   SAYLEHFGKAYTGSLVPNFLGVY  1040
             S   E  GK + GS++  F+ VY
Sbjct  367   SEVEEKDGKLWIGSVLMPFIAVY  389



>ref|XP_007156378.1| hypothetical protein PHAVU_003G281200g [Phaseolus vulgaris]
 gb|ESW28372.1| hypothetical protein PHAVU_003G281200g [Phaseolus vulgaris]
Length=344

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 130/304 (43%), Positives = 184/304 (61%), Gaps = 20/304 (7%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYY--NGKFIDFATTSPLRTKVICDGTNNTILQLIC  347
             G E  AF+  G+GPY GV+DGRILK++  N  +IDFA TSP R K +CDG  +  ++ +C
Sbjct  42    GSESAAFDCHGKGPYVGVSDGRILKWHPTNKHWIDFAVTSPHRDKKVCDGLTDESMESMC  101

Query  348   GRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--  521
             GRPLGL+F+  T DLYIAD  FGLL VGP GG+A QLA    G+ F FTNA+ +   T  
Sbjct  102   GRPLGLKFNNVTCDLYIADAYFGLLVVGPGGGVAKQLATSAEGVPFRFTNALDIHPQTGE  161

Query  522   VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFL  701
             VYF DS ++F    +  I  SGD +GRLLKY   + RV V+++GL+ P G+A+SKD +FL
Sbjct  162   VYFTDSSILFQRRVYLSIILSGDRTGRLLKYVPSSQRVYVMVKGLAFPNGVALSKDNSFL  221

Query  702   LISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVN--------ILK  857
             L++E    K+ K  ++G   NT QT  ++   PDN+K  + G +WVA+N          K
Sbjct  222   LLAESTTFKVLKVSLRG--RNTIQTFAEVPRSPDNIKSNSKGEFWVALNSGRGRINGFEK  279

Query  858   ppqpqqLIPM-TESIAVKFDRNGKILDRKNVTSAYP---NSFSAYLEHFGKAYTGSLVPN  1025
               + +  +P  T+ +A+KFD  GK+++   +   Y    NS S   EH G  + GS V  
Sbjct  280   EREVETTVPWTTDPVAIKFDSEGKVVEV--LDGGYGTQLNSVSEVEEHDGSLWIGSAVQP  337

Query  1026  FLGV  1037
             ++ +
Sbjct  338   YIAL  341



>gb|KDP42972.1| hypothetical protein JCGZ_23914 [Jatropha curcas]
Length=391

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 128/322 (40%), Positives = 175/322 (54%), Gaps = 32/322 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE +AF+  G GPYTG+ADGRI+ +   K+ DFA TS  R++ ICD   + +  L    
Sbjct  70    GPESIAFDPLGRGPYTGIADGRIVFWNGQKWTDFAYTSSNRSE-ICDPKPSPLSYLKNEH  128

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-ES  518
             ICGRPLGL F  +TGDLYIAD   GL+KVGP+GG AT L     G+   FTN + +D E 
Sbjct  129   ICGRPLGLRFDKKTGDLYIADAYLGLMKVGPEGGSATSLTTEAEGVPLRFTNDLDIDDEG  188

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              +YF DS   +   NF ++  S D SGR+LKY   T   TV++R L  P GL++SKD TF
Sbjct  189   NIYFTDSSTQYQRRNFMQLVFSADDSGRVLKYNPTTKETTVLVRNLQFPNGLSLSKDGTF  248

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNIL--------  854
              +  E    ++ KY +KG KA T++ L  L G PDNV+    G +WVAV+          
Sbjct  249   FVFCEGSIGRLRKYWLKGEKAGTSEVLAILPGFPDNVRTNEEGNFWVAVHCRRSLYTYIC  308

Query  855   ----KppqpqqLIPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                 K       +P++              ++AVK+   GKIL   ++       + S  
Sbjct  309   ALYPKLRMFMLKLPISAKIQYLLHIGGRLHAVAVKYSPEGKILQILEDSQGKVVKAISEV  368

Query  981   LEHFGKAYTGSLVPNFLGVYTL  1046
              E  GK + GS++  F+GVY L
Sbjct  369   EEKDGKLWMGSVLMPFIGVYNL  390



>ref|NP_680189.1| strictosidine synthase family protein [Arabidopsis thaliana]
 emb|CAC34495.1| putative strictosidine synthase-like [Arabidopsis thaliana]
 gb|AAT44971.1| At5g22020 [Arabidopsis thaliana]
 gb|ABF59040.1| At5g22020 [Arabidopsis thaliana]
 gb|AED92969.1| strictosidine synthase family protein [Arabidopsis thaliana]
Length=395

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 126/322 (39%), Positives = 175/322 (54%), Gaps = 32/322 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE VAF+  G GPYTGVADGR+L +   K+IDFA TS  R++ ICD   + +  L    
Sbjct  75    GPESVAFDSLGRGPYTGVADGRVLFWDGEKWIDFAYTSSNRSE-ICDPKPSALSYLRNEH  133

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVAL-DES  518
             ICGRPLGL F  RTGDLYIAD   GLLKVGP+GGLAT L     G+   FTN + + D+ 
Sbjct  134   ICGRPLGLRFDKRTGDLYIADAYMGLLKVGPEGGLATPLVTEAEGVPLGFTNDLDIADDG  193

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
             TVYF DS + +   NF ++  SGD +GR+LKY+    +  V++  L  P G++IS+D +F
Sbjct  194   TVYFTDSSISYQRRNFLQLVFSGDNTGRVLKYDPVAKKAVVLVSNLQFPNGVSISRDGSF  253

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
              +  E     + +Y +KG KA TT     L G PDNV+    G +WVA++  +      +
Sbjct  254   FVFCEGDIGSLRRYWLKGEKAGTTDVFAYLPGHPDNVRTNQKGEFWVALHCRRNYYSYLM  313

Query  879   ------------IPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                         +P+T               + VK+   GK++   ++       S S  
Sbjct  314   ARYPKLRMFILRLPITARTHYSFQIGLRPHGLVVKYSPEGKLMHVLEDSEGKVVRSVSEV  373

Query  981   LEHFGKAYTGSLVPNFLGVYTL  1046
              E  GK + GS++ NF+ VY L
Sbjct  374   EEKDGKLWMGSVLMNFVAVYDL  395



>dbj|BAD95409.1| putative strictosidine synthase - like [Arabidopsis thaliana]
Length=394

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 126/322 (39%), Positives = 175/322 (54%), Gaps = 32/322 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE VAF+  G GPYTGVADGR+L +   K+IDFA TS  R++ ICD   + +  L    
Sbjct  74    GPESVAFDSLGRGPYTGVADGRVLFWDGEKWIDFAYTSSNRSE-ICDPKPSALSYLRNEH  132

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVAL-DES  518
             ICGRPLGL F  RTGDLYIAD   GLLKVGP+GGLAT L     G+   FTN + + D+ 
Sbjct  133   ICGRPLGLRFDKRTGDLYIADAYMGLLKVGPEGGLATPLVTEAEGVPLGFTNDLDIADDG  192

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
             TVYF DS + +   NF ++  SGD +GR+LKY+    +  V++  L  P G++IS+D +F
Sbjct  193   TVYFTDSSISYQRRNFLQLVFSGDNTGRVLKYDPVAKKAVVLVSNLQFPNGVSISRDGSF  252

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
              +  E     + +Y +KG KA TT     L G PDNV+    G +WVA++  +      +
Sbjct  253   FVFCEGDIGSLRRYWLKGEKAGTTDVFAYLPGHPDNVRTNQKGEFWVALHCRRNYYSYLM  312

Query  879   ------------IPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                         +P+T               + VK+   GK++   ++       S S  
Sbjct  313   ARYPKLRMFILRLPITARTHYSFQIGLRPHGLVVKYSPEGKLMHVLEDSEGKVVRSVSEV  372

Query  981   LEHFGKAYTGSLVPNFLGVYTL  1046
              E  GK + GS++ NF+ VY L
Sbjct  373   EEKDGKLWMGSVLMNFVAVYDL  394



>ref|XP_003609164.1| Strictosidine synthase [Medicago truncatula]
Length=333

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/298 (38%), Positives = 180/298 (60%), Gaps = 11/298 (4%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK---FIDFATTSPLRTKVICDGTNN-TILQL  341
             GPE +AF+  GEGPY G +DGRI KY NG    F ++A TSP R K +CDG ++ + +Q 
Sbjct  36    GPESLAFDKNGEGPYVGSSDGRIFKY-NGPDVGFKEYAYTSPNRNKTVCDGLSDFSAVQA  94

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST  521
              CGRPLGL F+ +TGDLY+AD   GL+KV P GG  TQL          F + + +D  T
Sbjct  95    TCGRPLGLGFNHQTGDLYVADAYLGLVKVSPDGGNVTQLVGPAQANSTMFADGLDVDPDT  154

Query  522   --VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               VYF  +   F   ++  +  SGD+SG LL+Y+  T + TV+L  LS P+G+A+SKD +
Sbjct  155   GIVYFTVASTNFQLKDYQTLVTSGDSSGSLLRYDPSTNQTTVLLSNLSMPSGVAVSKDGS  214

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             F+L+ E+++ +I +  +KGP+AN+++  + L G+P+N+KR ++G +W++V+ +       
Sbjct  215   FVLVGEYLSNRIQRVWLKGPRANSSELFMLLTGRPNNIKRNSAGQFWISVHSV-LGLGLP  273

Query  876   LIPMTESI--AVKFDRNGKILDRKNVTSAYP-NSFSAYLEHFGKAYTGSLVPNFLGVY  1040
             + P   ++   V+   N  IL   ++ + Y     S   E+ GK Y GSL+ ++  ++
Sbjct  274   ISPRRTALPRGVRVSENRIILQIASLVAEYGIEPASEVQEYNGKLYAGSLLASYASIF  331



>gb|AES91361.2| strictosidine synthase-like protein, putative [Medicago truncatula]
Length=336

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/298 (38%), Positives = 180/298 (60%), Gaps = 11/298 (4%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK---FIDFATTSPLRTKVICDGTNN-TILQL  341
             GPE +AF+  GEGPY G +DGRI KY NG    F ++A TSP R K +CDG ++ + +Q 
Sbjct  39    GPESLAFDKNGEGPYVGSSDGRIFKY-NGPDVGFKEYAYTSPNRNKTVCDGLSDFSAVQA  97

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST  521
              CGRPLGL F+ +TGDLY+AD   GL+KV P GG  TQL          F + + +D  T
Sbjct  98    TCGRPLGLGFNHQTGDLYVADAYLGLVKVSPDGGNVTQLVGPAQANSTMFADGLDVDPDT  157

Query  522   --VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               VYF  +   F   ++  +  SGD+SG LL+Y+  T + TV+L  LS P+G+A+SKD +
Sbjct  158   GIVYFTVASTNFQLKDYQTLVTSGDSSGSLLRYDPSTNQTTVLLSNLSMPSGVAVSKDGS  217

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             F+L+ E+++ +I +  +KGP+AN+++  + L G+P+N+KR ++G +W++V+ +       
Sbjct  218   FVLVGEYLSNRIQRVWLKGPRANSSELFMLLTGRPNNIKRNSAGQFWISVHSV-LGLGLP  276

Query  876   LIPMTESI--AVKFDRNGKILDRKNVTSAYP-NSFSAYLEHFGKAYTGSLVPNFLGVY  1040
             + P   ++   V+   N  IL   ++ + Y     S   E+ GK Y GSL+ ++  ++
Sbjct  277   ISPRRTALPRGVRVSENRIILQIASLVAEYGIEPASEVQEYNGKLYAGSLLASYASIF  334



>emb|CDX92388.1| BnaA10g14270D [Brassica napus]
Length=366

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 125/304 (41%), Positives = 173/304 (57%), Gaps = 25/304 (8%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK-FIDFATTSPLRTKVICDGTNNTILQL---  341
             GPE VAF+  G GPYTGVADGR+L ++NG+ + +FA TS  RT+ ICD   + +  L   
Sbjct  75    GPESVAFDPLGRGPYTGVADGRVL-FWNGENWTNFAYTSSKRTE-ICDPKPSALSYLRNE  132

Query  342   -ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
              ICGRPLGL F  RTGDLYIAD   GLLKVGP+GGLAT L     G+   FTN + +D+ 
Sbjct  133   HICGRPLGLRFDKRTGDLYIADAYMGLLKVGPEGGLATPLVTEAEGVPLGFTNDLDIDDD  192

Query  519   -TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
              TVYF DS + +   NF ++  SGD +GR+LKY+    +  V++  +  P G++ISKD +
Sbjct  193   GTVYFTDSSISYQRRNFLQLVFSGDNTGRVLKYDPIAKKAAVLVSDVQFPNGVSISKDGS  252

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             F +  E     + +Y +KG KA T+     L G PDNV+    G +WVA++  +      
Sbjct  253   FFVFCEGDIGSLRRYWLKGEKAGTSDVFAMLPGHPDNVRTNKDGEFWVALHCRRNYYSYI  312

Query  876   L-------IPMTESIAVKFDRNGKILDRKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLG  1034
             +       IP  + + V  D  GK++           S S   E  GK + GS++ NF+ 
Sbjct  313   MARNPKLRIPEGKLVKVLEDSEGKVV----------RSVSEVEEKDGKLWLGSVLMNFVA  362

Query  1035  VYTL  1046
             VY L
Sbjct  363   VYDL  366



>gb|EYU22112.1| hypothetical protein MIMGU_mgv1a007437mg [Erythranthe guttata]
Length=407

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 122/323 (38%), Positives = 180/323 (56%), Gaps = 32/323 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE +AF+  G GPYTGVADGRIL +   K+ DFA TS  R+  +CD   + +  L    
Sbjct  70    GPESMAFDPNGRGPYTGVADGRILFWDGQKWTDFAYTSANRSG-LCDPKPSPMSYLKNEH  128

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-ES  518
             ICGRPLGL F    GDLYIAD   GL+KVGP+GGLAT L+   +G+   FTN + +D + 
Sbjct  129   ICGRPLGLRFDKTNGDLYIADAYLGLMKVGPEGGLATSLSTEADGVPLGFTNDLDIDVDG  188

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF DS + +   NF ++  SGD SGRLLKY+      TV++R L  P G+++SKD +F
Sbjct  189   NVYFTDSSIKYQRRNFLQLVFSGDDSGRLLKYDPSKKETTVLIRNLQFPNGVSLSKDGSF  248

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
              +  E    +++KY +KG KA +T+ +  L G PDNV+    G +WVA++  +      L
Sbjct  249   FVFCEGSLGRLSKYWLKGEKAGSTEVMAVLSGHPDNVRTNKDGDFWVAIHCRRYMYSHFL  308

Query  879   ------------IPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                         +P++              ++ VK++  G++L   ++ +     + S  
Sbjct  309   GLYPKIRQVWLKLPISARLHYMMQIGGRLHAVVVKYNAEGELLKILEDSSGKVVKAVSEV  368

Query  981   LEHFGKAYTGSLVPNFLGVYTLK  1049
              E  G+ + GS++  FL VY L+
Sbjct  369   EEKDGRLWIGSVLMPFLAVYQLQ  391



>ref|XP_010425613.1| PREDICTED: strictosidine synthase 3-like [Camelina sativa]
Length=340

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 126/300 (42%), Positives = 169/300 (56%), Gaps = 22/300 (7%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFI---DFATTSPLRTKVICDGTNNTILQLI  344
             GPE +AF+  GEGPY GVADGR+LK+  GK +   DFA T+  R   IC       L+ +
Sbjct  54    GPESIAFDPAGEGPYVGVADGRVLKW-RGKLLGWTDFAYTTANRQ--ICVLPFAPELEHV  110

Query  345   CGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST-  521
             CGRPLGL FH +TGDLYIAD  FGLL VGP GGLA  L     G  F FTN + +DE   
Sbjct  111   CGRPLGLRFHKKTGDLYIADAYFGLLIVGPAGGLAKPLVTEAEGQPFRFTNDLDIDEQND  170

Query  522   -VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF D+   F    + +   + D +GR +KY+  + + TV+L G+S   G+A+SKD +F
Sbjct  171   VVYFTDASSKFQRWEYFRSFLNVDKTGRFIKYDRSSKKATVLLHGISFANGVALSKDWSF  230

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
             +L++E    KI +  + GPKA T    + L G PDN++R + G +WVA+N L        
Sbjct  231   VLVAETTNCKILRLWLSGPKAGTQDVFVVLPGYPDNIRRNSKGEFWVALNSL--------  282

Query  879   IPMTESI----AVKFDRNGKILDRKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGVYTL  1046
               + E I    AVK   +GK+L+     +      S   E  GK + GS V  F+GVY L
Sbjct  283   --INEEIRYTKAVKLSESGKVLEVLGDKANRLQFISDVEEKDGKLWIGSSVAPFVGVYDL  340



>ref|XP_010932965.1| PREDICTED: strictosidine synthase 3-like [Elaeis guineensis]
Length=391

 Score =   209 bits (532),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 125/323 (39%), Positives = 177/323 (55%), Gaps = 38/323 (12%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE VAF+  G GPYTGVADGR+L +    + DFA TSP+R++ +CD   + +  L    
Sbjct  73    GPESVAFDPLGRGPYTGVADGRVLFWNGHSWSDFAYTSPIRSE-LCDPKPSALSYLRNEH  131

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES-  518
             ICGRPLGL F  +TGDLYIAD  FGLLKVGP+GGLAT L+    G+  +FTN + +DE  
Sbjct  132   ICGRPLGLRFDKKTGDLYIADAYFGLLKVGPEGGLATPLSTEAEGVPLNFTNDLDIDEEG  191

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              +YF DS   +   NF ++  SG+ SGRLLKY   T    V+LR L  P G+++SKD +F
Sbjct  192   NIYFTDSSTNYQRRNFMQLVFSGEPSGRLLKYNPVTKETIVLLRNLQFPNGVSLSKDGSF  251

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
              +  E    ++T+Y +KG KA T++    L G PDNV+    G +WVA++  +      +
Sbjct  252   FVFCEGSRGRLTRYWLKGEKAGTSEIFAILPGFPDNVRTNEKGEFWVAIHCRRTVYAHLM  311

Query  879   IPMT-------------------------ESIAVKFDRNGKIL----DRKNVTSAYPNSF  971
                T                          ++ +K+  +G++L    DRK        + 
Sbjct  312   SQYTRLRKFLLKLPIPAKYQYLMQIGGRLHALIIKYSPDGELLEILEDRKGKVV---RAV  368

Query  972   SAYLEHFGKAYTGSLVPNFLGVY  1040
             S   E  GK + GS++  F+ VY
Sbjct  369   SEVEEKDGKLWIGSVLMPFIAVY  391



>ref|XP_010247897.1| PREDICTED: strictosidine synthase 3-like [Nelumbo nucifera]
Length=391

 Score =   209 bits (531),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 124/322 (39%), Positives = 174/322 (54%), Gaps = 32/322 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTIL----QL  341
             GPE VAF+  G GPYTGVADGRIL +    +  FA TSP R++ +C    + +     + 
Sbjct  70    GPESVAFDPLGRGPYTGVADGRILFWNGNSWTSFAYTSPNRSE-LCSPKPSPLSYVKNEH  128

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-ES  518
             ICGRPLGL F  +TGDLYIAD  FGL+KVG +GGLAT L     G+   FTN + +D E 
Sbjct  129   ICGRPLGLRFDKKTGDLYIADAYFGLMKVGAEGGLATPLVTQAEGVPLRFTNDLDIDDEG  188

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF DS + +   NF  +  SG+  GRLLKY   TG  TV+LR L  P G+++SKD +F
Sbjct  189   NVYFTDSSIKYQRRNFMHLVFSGEDDGRLLKYNQVTGETTVLLRNLQFPNGVSMSKDGSF  248

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
              + SE     +T+Y +KG KA +++    L G PDNV+   +G +WVA++  +       
Sbjct  249   FVFSECSVGTLTRYWLKGEKARSSEIFATLHGAPDNVRTNENGEFWVAIHCRRSMYAYIT  308

Query  879   ------------IPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                         +P++              ++ VK+   GKIL   ++       + S  
Sbjct  309   GLYPWLRKFMLKLPISVKSHYLLQIGGKQHAVVVKYSAEGKILQILEDSEGKVVKAVSEV  368

Query  981   LEHFGKAYTGSLVPNFLGVYTL  1046
              E  GK + GS++  F+ VY L
Sbjct  369   EEKDGKLWIGSVLMPFMAVYQL  390



>emb|CDP14992.1| unnamed protein product [Coffea canephora]
Length=310

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 111/254 (44%), Positives = 162/254 (64%), Gaps = 9/254 (4%)
 Frame = +3

Query  291   LRTKVICDGTNNTILQLICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGV  470
              RTK +CDG N++     CGRPLGL F+ +TG+LY+ D  FG L V P GGLATQLA G+
Sbjct  60    FRTKQLCDGANSSAAS-TCGRPLGLGFNFKTGELYVLDFKFGFLVVSPGGGLATQLATGL  118

Query  471   NGIKFSFTNAVALDEST--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVV  644
             NG  F F NA+ +D++   VYF D+G IFL+ N + I QS DTSG+L KY+  T  ++++
Sbjct  119   NGTTFVFPNALDIDQANQIVYFTDAGAIFLSRNLSTIIQSNDTSGKLYKYDARTKTLSLM  178

Query  645   LRGLSGPAGLAISKDKTFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATS  824
             L GLSGP G+A+SK   ++LI E+IA ++ +Y  +GPKA +++ L+ L G PDN+KR  S
Sbjct  179   LNGLSGPLGVAVSKCGAYVLIDEYIASRVRRYWARGPKAGSSEILVNLPGSPDNIKRTIS  238

Query  825   GGYWVAVNILKppqpqqLIPMTESIAVKFDRNGKILDRK-NVTSAYPNSFSAYLEHF-GK  998
               ++ AV IL           T S+  + + +  I++   N+T+ Y N+  + ++ F GK
Sbjct  239   DDFFAAVTILNRHT----FQTTSSLGQRINGDLGIVEATVNLTAQYTNNLISEVQEFLGK  294

Query  999   AYTGSLVPNFLGVY  1040
              Y GS   +F+GVY
Sbjct  295   LYIGSSTASFVGVY  308



>ref|XP_010420991.1| PREDICTED: adipocyte plasma membrane-associated protein [Camelina 
sativa]
Length=395

 Score =   209 bits (531),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 125/322 (39%), Positives = 175/322 (54%), Gaps = 32/322 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE VAF+  G GPYTGVADGR+L +   ++IDFA TS  R+ VICD   + +  L    
Sbjct  75    GPESVAFDPLGRGPYTGVADGRVLFWNGDEWIDFAYTSSNRS-VICDPKPSALSYLRNEH  133

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES-  518
             ICGRPLGL F  R GDLYIAD   GLLKVGP+GGLA  L     G+   FTN + +D+  
Sbjct  134   ICGRPLGLRFDKRNGDLYIADAYMGLLKVGPEGGLAMPLVTEAEGVPLGFTNDLDIDDDG  193

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
             +VYF DS + +   NF ++  SGD SGR+LKY+    +  V++  +  P G++ISKD +F
Sbjct  194   SVYFTDSSINYQRRNFLQLVFSGDNSGRVLKYDPIAKKAVVLVPNVQFPNGVSISKDGSF  253

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
              L  E    ++ +Y +KG KA TT     L G PDNV+    G +WVA++  +      +
Sbjct  254   FLFCEGDVGRLRRYWLKGEKAGTTDVFAVLPGHPDNVRTNQKGEFWVALHCKRNYYSYLM  313

Query  879   ------------IPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                         +P+T               + VK+   GK++   ++    +  S S  
Sbjct  314   ARYPKLRMFILRLPITARTHYSFQIGLRPHGLVVKYSPEGKLMQVLEDSEGKFVRSVSEV  373

Query  981   LEHFGKAYTGSLVPNFLGVYTL  1046
              E  GK + GS++ NF+ VY L
Sbjct  374   EEKDGKLWLGSVLMNFVAVYDL  395



>ref|XP_010108510.1| Strictosidine synthase 1 [Morus notabilis]
 gb|EXC19610.1| Strictosidine synthase 1 [Morus notabilis]
Length=386

 Score =   208 bits (530),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 105/232 (45%), Positives = 156/232 (67%), Gaps = 7/232 (3%)
 Frame = +3

Query  168  AIGPEDVAFNGKGEGPYTGVADGRILKYYNG--KFIDFATTSPLRTKVICDGTNNTIL-Q  338
            A+GPE  AF+  G+GPYTGV+DGRI+K+     ++IDFA TSP R+   C+G+++  L +
Sbjct  61   ALGPESYAFDSLGDGPYTGVSDGRIIKWQEDQRRWIDFAVTSPNRSS--CEGSHDHHLTE  118

Query  339  LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
             ICGRPLGL FH  +GDLYIAD   GLL VG +GGLAT++     G+ F+F N + +++ 
Sbjct  119  HICGRPLGLSFHKTSGDLYIADAYMGLLVVGAEGGLATRVVTQAQGVPFAFPNGLDINDE  178

Query  519  T--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
               VYF DS   +   N+  +  SGDT+GRL+ Y+ ++ +V V+L  LS P G+A+S++ 
Sbjct  179  NGLVYFTDSSSRYQRRNYLSVILSGDTTGRLMSYDPQSKQVDVLLENLSFPNGVALSQNG  238

Query  693  TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVN  848
             FLLI+E  + +I +Y ++ PKA T +   +L G PDN+K +  GG+WVA++
Sbjct  239  DFLLIAETTSCRIMRYWLRTPKAGTFEVFSQLPGFPDNIKGSPRGGFWVAIH  290



>ref|XP_010493259.1| PREDICTED: strictosidine synthase 3-like [Camelina sativa]
Length=395

 Score =   208 bits (530),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 125/322 (39%), Positives = 175/322 (54%), Gaps = 32/322 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE VAF+  G GPYTGVADGR+L +   ++IDFA TS  R+ VICD   + +  L    
Sbjct  75    GPESVAFDPLGRGPYTGVADGRVLFWNGDEWIDFAYTSSNRS-VICDPKPSALSYLRNEH  133

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES-  518
             ICGRPLGL F  R GDLYIAD   GLLKVGP+GGLA  L     G+   FTN + +D+  
Sbjct  134   ICGRPLGLRFDKRNGDLYIADAYMGLLKVGPEGGLAMPLVTEAEGVPLGFTNDLDIDDDG  193

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
             TVYF DS + +   NF ++  SGD SGR+LKY+    +  V++  +  P G++ISKD +F
Sbjct  194   TVYFTDSSINYQRRNFLQLVFSGDNSGRVLKYDPIAKKAVVLVSNVQFPNGVSISKDGSF  253

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
              L  E    ++ +Y +KG KA TT     L G PDNV+   +G +WVA++  +      +
Sbjct  254   FLFCEGDVGRLGRYWLKGEKAGTTDVFAVLPGHPDNVRTNQNGEFWVALHCKRNYYSYLM  313

Query  879   ------------IPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                         +P+T               +  K+   GK++   ++    +  S S  
Sbjct  314   ARYPKLRMFILRLPITARTHYSFQIGLRPHGLVAKYSPEGKLMQVLEDSEGKFVRSVSEV  373

Query  981   LEHFGKAYTGSLVPNFLGVYTL  1046
              E  GK + GS++ NF+ VY L
Sbjct  374   EEKDGKLWLGSVLMNFVAVYEL  395



>ref|XP_002452919.1| hypothetical protein SORBIDRAFT_04g034960 [Sorghum bicolor]
 gb|EES05895.1| hypothetical protein SORBIDRAFT_04g034960 [Sorghum bicolor]
Length=346

 Score =   207 bits (526),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 122/296 (41%), Positives = 176/296 (59%), Gaps = 13/296 (4%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATT--SPLRTKVICDGTNNTILQLI-  344
             GPE VAF+G G GPY+GV+DGR+LK+ NG    ++T   SP      C  +     +L  
Sbjct  52    GPESVAFDGAGAGPYSGVSDGRVLKW-NGFARGWSTYAYSPGYDAEACTASRTRPAELTE  110

Query  345   --CGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
               CGRPLGL FH R+G+LYIAD   GL++VGP GG AT LAA V+G+   FTN V +D+ 
Sbjct  111   SRCGRPLGLRFHHRSGNLYIADAYKGLMRVGPGGGEATVLAAEVDGVPLRFTNGVDVDQV  170

Query  519   T--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
             T  V+F DS + +      ++  +GD+SGRL+KY+ +TG+VTV+  G++ P GLAIS D+
Sbjct  171   TGDVFFTDSSMNYPRSQHERVTATGDSSGRLMKYDPKTGQVTVLQAGVTYPNGLAISADR  230

Query  693   TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpq  872
             T L+++     K+ +Y IKGPKA T++ L  L G PDNV+    GG+WVA++  +     
Sbjct  231   THLVVALTGPCKLLRYWIKGPKAGTSEHLADLPGYPDNVRADGRGGFWVALH--REKMEL  288

Query  873   qLIPMTESIAVKFDRNGKILD-RKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGV  1037
                P +  +AV+   +G+++   K   S  P          GK Y GS+   ++ V
Sbjct  289   PFGPDSHLLAVRIGADGQVVQVMKGPKSVRPTEVVE--RDGGKLYMGSVELPYVAV  342



>ref|XP_002874041.1| strictosidine synthase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50300.1| strictosidine synthase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=395

 Score =   208 bits (530),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 126/322 (39%), Positives = 175/322 (54%), Gaps = 32/322 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE VAF+  G GPYTGVADGR+L +   K+IDFA TS  R++ ICD   + +  L    
Sbjct  75    GPESVAFDSLGRGPYTGVADGRVLFWNGQKWIDFAYTSSNRSE-ICDPKPSALSYLRNEH  133

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES-  518
             ICGRPLGL F  RTGDLYIAD   GLLKVGP+GGLA  L     G+   FTN + +D+  
Sbjct  134   ICGRPLGLRFDKRTGDLYIADAYMGLLKVGPEGGLAMPLVTEAEGVPLGFTNDLDIDDDG  193

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
             TVYF DS + +   NF ++  SGD +GR+LKY+    +  V++  L  P G++ISKD +F
Sbjct  194   TVYFTDSSINYQRRNFLQLVFSGDNTGRVLKYDPIAKKAVVLVSNLQFPNGVSISKDGSF  253

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
              +  E     + +Y +KG KA TT     L G PDNV+   +G +WVA++  +      +
Sbjct  254   FVFCEGDIGSLRRYWLKGEKAGTTDVFAFLPGHPDNVRTNENGEFWVALHCRRNYYSYLM  313

Query  879   ------------IPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                         +P+T               + VK+   GK++   ++       S S  
Sbjct  314   ARYPKLRMFILRLPITARTHYSFQIGLRPHGLVVKYSPEGKLMQVLEDSEGKVVRSVSEV  373

Query  981   LEHFGKAYTGSLVPNFLGVYTL  1046
              E  GK + GS++ NF+ VY L
Sbjct  374   EEKDGKLWLGSVLMNFVAVYDL  395



>ref|XP_011000464.1| PREDICTED: strictosidine synthase 3-like, partial [Populus euphratica]
Length=352

 Score =   207 bits (526),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 104/232 (45%), Positives = 154/232 (66%), Gaps = 7/232 (3%)
 Frame = +3

Query  168  AIGPEDVAFNGKGEGPYTGVADGRILKY--YNGKFIDFATTSPLRTKVICDG-TNNTILQ  338
            A GPE  AF+  G+GPY G++DGRI+K+  +  ++I+FA TS  R    C G  ++  ++
Sbjct  51   ATGPESFAFDPLGQGPYAGISDGRIIKWEEHERRWINFAITSQKRDG--CGGPHDHHRME  108

Query  339  LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
             +CGRPLG  F    GDLYIAD   GLL+VGP+GGLAT++A    GI F FTN++ +D+S
Sbjct  109  HVCGRPLGSCFDETRGDLYIADAYMGLLRVGPQGGLATKIATHAQGIPFRFTNSLDIDQS  168

Query  519  --TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
               +YF DS   +   ++  +  SGD SGRL+KY+  + +VTV+L+ L+ P G+A+SKD 
Sbjct  169  GGAIYFTDSSTQYQRRDYLSVVLSGDKSGRLMKYDAASKQVTVLLKNLTFPNGVALSKDG  228

Query  693  TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVN  848
            +F+L++E  + +I +Y IK  KA   +   +L+G PDN+KR+  GGYWV +N
Sbjct  229  SFVLLAETTSCRILRYWIKTSKAGALEVFAQLQGFPDNIKRSPRGGYWVGIN  280



>ref|XP_007045667.1| Calcium-dependent phosphotriesterase superfamily protein, putative 
[Theobroma cacao]
 gb|EOY01499.1| Calcium-dependent phosphotriesterase superfamily protein, putative 
[Theobroma cacao]
Length=495

 Score =   211 bits (536),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 125/308 (41%), Positives = 178/308 (58%), Gaps = 17/308 (6%)
 Frame = +3

Query  165   HAIGPEDVAFNGKGEGPYTGVADGRILKYY--NGKFIDFATTSPLRTKVICDGTNNTILQ  338
                GPE +AF+ K +GPY GV+DGRILK+   N  + +FA  S  R + +CDG+ N  L+
Sbjct  185   QVTGPESIAFDCKNQGPYVGVSDGRILKWQGPNLGWKEFAIPSSDRDRKLCDGSTNPDLE  244

Query  339   LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
               CGRPLGL+F+  T DL+IAD  FGLL VG  GG+A QLA    G+ F FTNA+ +D +
Sbjct  245   PTCGRPLGLKFNSATCDLFIADAYFGLLLVGRSGGVAQQLATSAEGVPFKFTNALDIDTN  304

Query  519   T--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
             T  VYF DS +IF   ++     + D SGRLLKY   T  VTV+ +GL+ P G+A+SKD 
Sbjct  305   TGVVYFTDSSIIFQRRHYFLSTITFDRSGRLLKYNFRTKEVTVLYKGLAFPNGVALSKDN  364

Query  693   TFLLISEFIAKKITKYIIKG-PKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILK----  857
             +FLL++E    +I K+ +     + T +   +L   PDN+KR   G +WVA+N  +    
Sbjct  365   SFLLVAETTKMRILKFNLDSTTDSYTPEQFAQLPKMPDNIKRNDKGEFWVALNSGRGRIQ  424

Query  858   -----ppqpqqLIPM--TESIAVKFDRNGKILDRKNVTSAYP-NSFSAYLEHFGKAYTGS  1013
                      +  IP    + + VK+D+ GKI+ + +       +S S   E  GK Y GS
Sbjct  425   NEGETKLSSETTIPWFTLDPVGVKYDQEGKIMKQLDGNGGIRFDSVSEVEELNGKLYIGS  484

Query  1014  LVPNFLGV  1037
             +V  ++GV
Sbjct  485   VVKPYVGV  492



>ref|XP_002274235.1| PREDICTED: strictosidine synthase 3-like [Vitis vinifera]
Length=342

 Score =   206 bits (525),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 122/305 (40%), Positives = 166/305 (54%), Gaps = 17/305 (6%)
 Frame = +3

Query  165   HAIGPEDVAFNGKGEGPYTGVADGRILKY--YNGKFIDFATTSPLRTKVICDGTNNTILQ  338
             +  GP  +AF+    GPY GV DGRI++Y   +  F DFA  +P R+K +CDGT +    
Sbjct  40    NVTGPVSLAFDLTVGGPYAGVNDGRIIRYGGTDVGFTDFAFCTPTRSKAVCDGTTDPDSG  99

Query  339   LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD--  512
               CGRPLGL F+     +YIAD   GL   G  G LAT+LA    G+ F F N + +D  
Sbjct  100   PTCGRPLGLSFNNLRNQMYIADAYSGLFVAGTNGRLATKLATSAEGVPFCFLNGLDVDPL  159

Query  513   ESTVYFVDSGLIFLTGNFTKIAQSG-------DTSGRLLKYEMETGRVTVVLRGLSGPAG  671
                VYF D        N ++   SG       D +GRLL+Y+ ET  VTV+LRGLSG AG
Sbjct  160   SGLVYFTDFSTTIQLRNISRALASGNTTQFSSDATGRLLRYDPETKNVTVLLRGLSGAAG  219

Query  672   LAISKDKTFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNI  851
              A+S D  F+L+SEF A +I K+ ++GPKA+T +T +   G+P N+KR  SG +WVAVN+
Sbjct  220   TAVSNDGMFVLVSEFNANRILKFWLRGPKASTAETFVSFRGRPVNIKRTASGNFWVAVNV  279

Query  852   LKppqpqqLIPMTESIAVKFDRNGKILDRKNVTSAYPNS--FSAYLEHFGKAYTGSLVPN  1025
                  P    P T     +    G IL+  +    Y  S   +   +H G  Y G+   N
Sbjct  280   PNNQSP----PTTILTGQRISYYGTILETVSFDDQYGGSTLITEVQQHLGALYIGANSAN  335

Query  1026  FLGVY  1040
             F+GV+
Sbjct  336   FVGVH  340



>ref|XP_009394278.1| PREDICTED: strictosidine synthase 1-like [Musa acuminata subsp. 
malaccensis]
Length=389

 Score =   207 bits (528),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 128/322 (40%), Positives = 182/322 (57%), Gaps = 36/322 (11%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK-FIDFATTSPLRTKVICDGTNNTIL-----  335
             GPE +AF+ +G GPYTGVADGR+L ++NG+ ++DFA TSP R++ IC+  N ++      
Sbjct  71    GPESIAFDPRGRGPYTGVADGRVL-FWNGESWVDFAYTSPNRSE-ICN-LNPSLFSYLKN  127

Query  336   QLICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDE  515
             + ICGRPLGL F  RTGDLYIAD  FGLLKVGP+GGLA  L     G+ F+FTN + +DE
Sbjct  128   EHICGRPLGLRFDKRTGDLYIADAYFGLLKVGPQGGLAAPLTTEAEGVPFNFTNDLDIDE  187

Query  516   S-TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
                VYF DS   +   NF ++  SG+ SGRLLKY   T    V+ RGL  P G+ +SKD 
Sbjct  188   EGNVYFTDSSTNYQRRNFMQLIFSGEPSGRLLKYNPVTKETIVLHRGLQFPNGVTLSKDG  247

Query  693   TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNI-------  851
             +FLL  E    ++ ++ +KG KA T      L G PDNV+    G +WVA++        
Sbjct  248   SFLLFCEGSRLRLNRHWLKGEKAGTLDVFAYLPGFPDNVRTNEKGEFWVAIHCRHSTYAH  307

Query  852   -------LKppqpqqLIPMT-----------ESIAVKFDRNGKILDR-KNVTSAYPNSFS  974
                    L+    +  IP+             ++ +K+  NG +L+  ++       + S
Sbjct  308   LMADHSKLRKFFLKLPIPVKYHYFMLVGGRLHALIIKYGPNGDLLETLEDKEGKVVKAVS  367

Query  975   AYLEHFGKAYTGSLVPNFLGVY  1040
                E  GK + GS++ +F+ VY
Sbjct  368   EVEEKDGKLWIGSVLMSFIAVY  389



>ref|XP_007202861.1| hypothetical protein PRUPE_ppa015510mg, partial [Prunus persica]
 gb|EMJ04060.1| hypothetical protein PRUPE_ppa015510mg, partial [Prunus persica]
Length=334

 Score =   206 bits (524),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 107/232 (46%), Positives = 154/232 (66%), Gaps = 7/232 (3%)
 Frame = +3

Query  168  AIGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTN-NTILQ  338
            A+GPE   F+  G GPYTG++DGRI+K+   K  +I+FA TSP R    C+G++ +   +
Sbjct  13   AVGPESFVFDPLGGGPYTGISDGRIVKWDQDKHHWINFAVTSPNRDG--CEGSHEHDKTE  70

Query  339  LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
             ICGRPLGL F+  +GDLY+AD   GLL VGP+GGLAT++    +GI F FTNA+ +D+ 
Sbjct  71   HICGRPLGLCFNETSGDLYVADAYMGLLIVGPQGGLATEVVTRAHGIPFGFTNALDIDQE  130

Query  519  --TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
               VYF DS   +   N+  +  SGD +GRL+KY+ E+ +V V+L  LS P G+A+SK+ 
Sbjct  131  PGAVYFTDSSSQYQRRNYISVILSGDKTGRLMKYDPESKQVQVLLGNLSFPNGVALSKNG  190

Query  693  TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVN  848
             F+L++E    +I +Y +K PKA T Q   +L G PDN+KR+  GG+WV ++
Sbjct  191  DFILLAETTHCRIMRYWLKTPKAGTFQVFAQLPGFPDNIKRSPRGGFWVGIH  242



>ref|XP_004307669.1| PREDICTED: strictosidine synthase 1-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=364

 Score =   207 bits (526),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 121/323 (37%), Positives = 175/323 (54%), Gaps = 32/323 (10%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKY--YNGKFIDFATTSPLRTKVICDGTNNTILQL  341
             A+GPE +AF+  G+GPYTGVADGRILK+   + ++ DFA T+  R +  C       L+ 
Sbjct  44    AVGPESLAFDPNGDGPYTGVADGRILKWDPNHHRWTDFAVTTSQRKE--CVRPFAPELEH  101

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDE--  515
             +CGRPLGL F+ +TGDLYIAD   GL  VGP GGLA+Q+   V G +  FTN + +DE  
Sbjct  102   VCGRPLGLRFNKKTGDLYIADAYLGLQVVGPAGGLASQVVKEVEGQQLHFTNDIDIDEKK  161

Query  516   STVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               +YF DS  +F    F     +GD +GRLLKY + +  V V+L+GL+   G+A+SKD +
Sbjct  162   DVIYFTDSSTVFHRRQFMSSILNGDKTGRLLKYNISSQEVVVLLQGLAFANGVALSKDHS  221

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             F+L++E    +I ++ + GP A  T    KL G PDN++R + G +WVA++  K    + 
Sbjct  222   FVLVAETTNCRILRHWLYGPNAGDTDIFTKLPGFPDNIRRNSKGEFWVALHAKKGLFAKW  281

Query  876   LIPMTE-------------------------SIAVKFDRNGKILDRKNVTSAYPNSF-SA  977
             L+  T                          + A+K    G +L            F S 
Sbjct  282   LVSNTWAGKSLLKLPLGFKRLHSLLVGGKAYATAIKLSEKGDVLQVLEDCEGKSMRFISE  341

Query  978   YLEHFGKAYTGSLVPNFLGVYTL  1046
               E  GK + GS++  F+G+Y L
Sbjct  342   VEEKDGKLWMGSVLMPFIGIYNL  364



>gb|ABR18211.1| unknown [Picea sitchensis]
Length=393

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/230 (46%), Positives = 151/230 (66%), Gaps = 5/230 (2%)
 Frame = +3

Query  174  GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICD-GTN---NTILQL  341
            GPE +AF+ +G GPYTGVADGRI+ +  G++ +F+ TSP R++ +C  GTN   N   + 
Sbjct  74   GPESIAFDPQGRGPYTGVADGRIMFWNGGQWSEFSFTSPNRSEELCKPGTNPMANIKYEH  133

Query  342  ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES-  518
            ICGRPLGL F+  TGDLYIAD  FGLL VGP+GG AT+L + V GI   FTN + +DE  
Sbjct  134  ICGRPLGLRFNKGTGDLYIADAYFGLLVVGPQGGQATRLVSEVEGIPLKFTNDLDIDEQG  193

Query  519  TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
             VYF DS +++   NF ++A S + SGR+LKY  +T   ++++  +  P GL++SKD +F
Sbjct  194  IVYFTDSSVVYQRRNFIQLAFSAEPSGRVLKYNPQTKEASLLVGNIQLPNGLSLSKDGSF  253

Query  699  LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVN  848
             + S+    ++ ++ +KGPK  TT     L G PDNV+    G +WVA++
Sbjct  254  FVFSDTCVGRLKRHWLKGPKTGTTDVFAILPGHPDNVRTNEKGEFWVALH  303



>ref|XP_004487437.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Cicer arietinum]
Length=393

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 130/324 (40%), Positives = 184/324 (57%), Gaps = 34/324 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNG-KFIDFATTSPLRTKVICDGTNNTIL-----  335
             GPE +AF+  G GPYTGVADG+IL ++NG  +IDFA TSP R+++     + + L     
Sbjct  70    GPESIAFDPLGHGPYTGVADGKIL-FWNGLSWIDFAYTSPNRSELCNSKESASPLSYAET  128

Query  336   QLICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-  512
             + ICGRPLGL F  +TGDLYIAD  FGL+KVGP+GGLAT LA    G+   FTN V +D 
Sbjct  129   EHICGRPLGLRFDKKTGDLYIADAYFGLMKVGPQGGLATSLATEAEGVPLRFTNDVDIDA  188

Query  513   ESTVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
             E  VYF DS   F   NF  +  SG+ SGR+L+Y   T    V++R +  P G+++SKD 
Sbjct  189   EGNVYFTDSSNKFQRRNFVHLVFSGEDSGRVLRYSSATKETVVLVRNIQFPNGISLSKDG  248

Query  693   TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVN--------  848
             +F + SE I  ++ KY +KG KA T++ L  L G PDNV+   +G +WV ++        
Sbjct  249   SFFVFSEGITGRLRKYWLKGDKAGTSEILAILPGFPDNVRVNENGDFWVGIHCRRYMYGY  308

Query  849   -----------ILKppqpqqLIPMTE------SIAVKFDRNGKILD-RKNVTSAYPNSFS  974
                        ILK P P ++  + +      ++ VK+   GK+L   ++       + S
Sbjct  309   LNALYPKIRKFILKLPIPTRIHYLLQIGGRFHAVIVKYSPEGKLLQILEDSEGKVVKAVS  368

Query  975   AYLEHFGKAYTGSLVPNFLGVYTL  1046
                E  GK + GS++  F+ VY L
Sbjct  369   EVEEKDGKLWIGSVLMPFIAVYHL  392



>ref|XP_007132511.1| hypothetical protein PHAVU_011G100400g [Phaseolus vulgaris]
 gb|ESW04505.1| hypothetical protein PHAVU_011G100400g [Phaseolus vulgaris]
Length=394

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 123/325 (38%), Positives = 181/325 (56%), Gaps = 33/325 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKV---ICDGTNNTIL--Q  338
             GPE +AF+  G GPYTG+ADGRI+ + +  ++DFA TSP R+++   I   T  + +  +
Sbjct  70    GPESIAFDPLGRGPYTGLADGRIVFWNSHSWVDFAYTSPNRSEICNPIASATPFSYVKTE  129

Query  339   LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-E  515
              ICGRPLGL F  +TGDL+IAD  FGLLKVGP+GGLAT L     GI   FTN V +D E
Sbjct  130   HICGRPLGLRFDKKTGDLFIADAYFGLLKVGPEGGLATSLVTEAEGIPLKFTNDVDVDGE  189

Query  516   STVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               VYF +S   +   NF ++  SGD SG++L+Y + T   TV+LR +  P G+ +SKD +
Sbjct  190   GNVYFTESSSHYPRRNFFQLVLSGDDSGKVLRYNLATKETTVLLRNIQFPNGITLSKDGS  249

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNI--------  851
             F +  E +  ++ KY +KG KA T++ L  L G PDNV+    G +WVA++         
Sbjct  250   FFVFCEGVVGRLRKYWLKGEKAGTSEILAVLPGYPDNVRVNEDGDFWVALHCRRYKYGYY  309

Query  852   -------LKppqpqqLIPMT-----------ESIAVKFDRNGKILD-RKNVTSAYPNSFS  974
                    ++    +  IP+             ++ +K+   G+IL   ++       + S
Sbjct  310   SANAPSGIRKIILKLPIPIKFHYLLHIGGRLHALVIKYSPEGRILQILEDSEGKVVKAVS  369

Query  975   AYLEHFGKAYTGSLVPNFLGVYTLK  1049
                E  GK + GS++  F+ VY LK
Sbjct  370   EVEEKDGKLWMGSVLMPFVAVYNLK  394



>ref|XP_002454704.1| hypothetical protein SORBIDRAFT_04g035910 [Sorghum bicolor]
 gb|EES07680.1| hypothetical protein SORBIDRAFT_04g035910 [Sorghum bicolor]
Length=346

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 121/296 (41%), Positives = 175/296 (59%), Gaps = 13/296 (4%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATT--SPLRTKVICDGTNNTILQLI-  344
             GPE VAF+G G GPY+GV+DGR+LK+ NG    ++T   SP      C  +     +L  
Sbjct  52    GPESVAFDGAGAGPYSGVSDGRVLKW-NGFARGWSTYAYSPGYDAEACTASRARPAELTE  110

Query  345   --CGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
               CGRPLGL FH R+G+LYIAD   GL++VGP GG AT LAA V+G+   FTN V +D+ 
Sbjct  111   SKCGRPLGLRFHRRSGNLYIADAYKGLMRVGPGGGEATVLAAEVDGVPLRFTNGVDVDQV  170

Query  519   T--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
             T  V+F DS + +      ++  +GD+SGRL+KY+  TG+VTV+  G++ P GLAIS D+
Sbjct  171   TGDVFFTDSSMNYPRSQHERVTATGDSSGRLMKYDPRTGQVTVLQAGITYPNGLAISADR  230

Query  693   TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpq  872
             T L+++     K+ +Y IKGPKA T++ L  L G PDNV+    GG+WVA++  +     
Sbjct  231   THLVVALTGPCKLMRYWIKGPKAGTSEHLADLPGYPDNVRADGRGGFWVALH--REKMEL  288

Query  873   qLIPMTESIAVKFDRNGKILD-RKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGV  1037
                P +  +AV+   +G+++   +   S  P          GK Y GS+   ++ V
Sbjct  289   PFGPDSHLLAVRVGADGQVVQVMRGPKSVRPTEVVE--REGGKLYMGSVELPYVAV  342



>emb|CAN78855.1| hypothetical protein VITISV_013355 [Vitis vinifera]
Length=342

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 121/305 (40%), Positives = 166/305 (54%), Gaps = 17/305 (6%)
 Frame = +3

Query  165   HAIGPEDVAFNGKGEGPYTGVADGRILKY--YNGKFIDFATTSPLRTKVICDGTNNTILQ  338
             +  GP  +AF+    GPY GV DGRI++Y   +  F DFA  +P R+K +CDGT +    
Sbjct  40    NVTGPVSLAFDLTVGGPYAGVNDGRIIRYGGTDVGFTDFAFCTPTRSKAVCDGTTDPDSG  99

Query  339   LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD--  512
               CGRPLGL F+     +YIAD   GL   G  G LAT+LA    G+ F F N + +D  
Sbjct  100   PTCGRPLGLSFNNLRNQMYIADAYSGLFVAGTNGRLATKLATSAEGVPFCFLNGLDVDPL  159

Query  513   ESTVYFVDSGLIFLTGNFTKIAQSG-------DTSGRLLKYEMETGRVTVVLRGLSGPAG  671
                VYF D        N ++   SG       D +GRLL+Y+ ET  VTV+LRGLSG AG
Sbjct  160   SGLVYFTDFSTTIQLRNISRALASGNTTQFSSDATGRLLRYDPETKNVTVLLRGLSGAAG  219

Query  672   LAISKDKTFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNI  851
              A+S D  F+L+SEF A +I K+ ++GPKA+T +T +   G+P N+KR  SG +WVAVN+
Sbjct  220   TAVSNDGMFVLVSEFNANRILKFWLRGPKASTAETFVSFRGRPVNIKRTASGNFWVAVNV  279

Query  852   LKppqpqqLIPMTESIAVKFDRNGKILDRKNVTSAYPNS--FSAYLEHFGKAYTGSLVPN  1025
                  P    P T     +    G IL+  +    Y  S   +   +H G  Y G+   N
Sbjct  280   PNNQSP----PTTILTGQRISYYGTILETVSFDDQYGGSTLITEVQQHLGALYIGANSAN  335

Query  1026  FLGVY  1040
             F+G++
Sbjct  336   FVGIH  340



>ref|XP_006417683.1| hypothetical protein EUTSA_v10007865mg [Eutrema salsugineum]
 gb|ESQ36036.1| hypothetical protein EUTSA_v10007865mg [Eutrema salsugineum]
Length=390

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 123/323 (38%), Positives = 179/323 (55%), Gaps = 34/323 (11%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTIL-----Q  338
             GPE +AF+  G GPYTGVADGRIL +   ++ DFA TS  R++ +CD T  ++L     +
Sbjct  69    GPESIAFDPLGRGPYTGVADGRILFWNGTRWTDFAYTSNNRSE-LCD-TKPSLLDYLKDE  126

Query  339   LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
              ICGRPLGL F  RTGDLYIAD  FG++KVGP+GGLAT L    +G+   FTN + +D+ 
Sbjct  127   HICGRPLGLRFDKRTGDLYIADAYFGIMKVGPEGGLATSLTTEADGVPLRFTNDLDVDDQ  186

Query  519   -TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               VYF DS  +F    F  +  SG+ SGR+LKY   T   + +LR L  P GL++ KD +
Sbjct  187   GNVYFTDSSSVFQRRKFMLLIVSGEDSGRVLKYNPVTKETSTLLRNLQFPNGLSLGKDGS  246

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             F +  E    ++ KY +KG KA T++ +  L G PDN++    G +WVA++  +      
Sbjct  247   FFIFCEGSIGRLRKYWLKGEKAGTSEVVALLHGFPDNIRTNKDGDFWVAIHCHRNIFTHV  306

Query  876   L------------IPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSA  977
             +            +P+T              ++AVK+   GK+L   ++       + S 
Sbjct  307   MAHHPIVRRFFLKLPITVKFQYLLQVGGWPHAVAVKYSEEGKVLKVLEDKQGKVVKAVSE  366

Query  978   YLEHFGKAYTGSLVPNFLGVYTL  1046
               E  GK + GS++ +F+ VY L
Sbjct  367   VEEKDGKLWMGSVLMSFIAVYDL  389



>ref|XP_003547789.1| PREDICTED: strictosidine synthase-like [Glycine max]
 gb|KHN15543.1| Strictosidine synthase [Glycine soja]
Length=347

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 127/306 (42%), Positives = 182/306 (59%), Gaps = 15/306 (5%)
 Frame = +3

Query  165   HAI-GPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTIL  335
             H++ G E VAF+  G+GPY GV+DGRILK++  K  +IDFA TSP R K +CDG  N  +
Sbjct  39    HSVFGSESVAFDCHGKGPYVGVSDGRILKWHETKREWIDFAVTSPHRNKKLCDGLTNDKM  98

Query  336   QLICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDE  515
             + +CGRPLGL+F+  T +LYIAD  FGLL VGP GG+A QLA    G+ F FTNA+ +D 
Sbjct  99    ESMCGRPLGLKFNTLTCELYIADAYFGLLVVGPGGGVAKQLATSAEGVPFRFTNALDIDT  158

Query  516   ST--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKD  689
              T  VYF DS ++F    +  I  SGD +GRLLKY   T  V V+++GL+ P G+A+SKD
Sbjct  159   KTGEVYFTDSSIMFQRRVYISIILSGDRTGRLLKYVPSTQSVHVLVKGLAFPNGVALSKD  218

Query  690   KTFLLISEFIAKKITKYIIKGPKANTT--QTLLKLEGQPDNVKRATSGGYWVAVNI----  851
              +F++++E    KI K  ++  K N    +   ++   PDN+KR   G +WVA+N     
Sbjct  219   NSFIIVAESTTFKILKIQVRDSKTNNNNIEPFAQVPRSPDNIKRNAKGEFWVALNSGRGL  278

Query  852   ---LKppqpqqLIPMTESIAVKFDRNGKILDRKNVTSAYP-NSFSAYLEHFGKAYTGSLV  1019
                L+      L    + +A+KFD  G+ ++  +       +S S   EH G  + GS V
Sbjct  279   IQKLENEIETTLPWNADPVAIKFDEKGRAIEVLDGEYGRQLDSVSEVEEHEGSLWIGSAV  338

Query  1020  PNFLGV  1037
               ++G+
Sbjct  339   QPYIGL  344



>ref|XP_006390480.1| hypothetical protein EUTSA_v10018852mg [Eutrema salsugineum]
 gb|ESQ27766.1| hypothetical protein EUTSA_v10018852mg [Eutrema salsugineum]
Length=328

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 120/292 (41%), Positives = 163/292 (56%), Gaps = 10/292 (3%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQLIC  347
             GPE  AF+  G GPYTGV+ G+ILKY   K  F +FA  SP   K +CD    + L  IC
Sbjct  40    GPEAFAFDSHGGGPYTGVSGGKILKYQGPKLGFAEFAYISPTANKSLCDKAIGSFLGNIC  99

Query  348   GRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--  521
             GRP+GL F+ +TGDLYIAD   GL  V  +GG A +LA    G  F F + + +D  T  
Sbjct  100   GRPVGLAFNEKTGDLYIADAFLGLYMVSHRGGQAKRLADSAGGFPFRFLDGLDVDPVTGL  159

Query  522   VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFL  701
             VYF      F            D +GRL +Y+ +   VTV+L GLSG AG A+S D  F+
Sbjct  160   VYFTSFSTRFGPSQLVLAVAVKDATGRLFRYDPKMKTVTVLLSGLSGSAGCAVSSDGEFV  219

Query  702   LISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqLI  881
             L+ EF+  +I KY IKGPKANT + L+     PDN++R   G +WVA N +K      ++
Sbjct  220   LVGEFLRNRILKYWIKGPKANTWEILVPSIPGPDNIRRTDGGDFWVASNSVK-----LIV  274

Query  882   PMTESIAVKFDRNGKILDRKNVTSAYPNSFSAYLEHFGK-AYTGSLVPNFLG  1034
               TE  AVK   +G+IL R ++   Y ++  + +  +    Y G+L  NF+G
Sbjct  275   VPTEPTAVKISSDGEILRRISLGEYYGDTLVSEVNEYKNIVYMGTLTTNFVG  326



>ref|XP_002438841.1| hypothetical protein SORBIDRAFT_10g027060 [Sorghum bicolor]
 gb|EER90208.1| hypothetical protein SORBIDRAFT_10g027060 [Sorghum bicolor]
Length=346

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 121/296 (41%), Positives = 176/296 (59%), Gaps = 13/296 (4%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATT--SPLRTKVICDGTNNTILQLI-  344
             GPE VAF+G G GPY+GV+DGR+LK+ NG    ++T   SP      C  +     +L  
Sbjct  52    GPESVAFDGAGAGPYSGVSDGRVLKW-NGFARGWSTYAYSPGYDAEACTASRARPAELTE  110

Query  345   --CGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
               CGRPLGL FH R+G+LYIAD   GL++VGP GG AT LAA V+G+   FTN V +D+ 
Sbjct  111   SKCGRPLGLRFHRRSGNLYIADAYKGLMRVGPGGGEATVLAAEVDGVPLRFTNGVDVDQV  170

Query  519   T--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
             T  V+F DS + +      ++  +GD+SGRL+KY+ +TG+VTV+  G++ P GLAIS D+
Sbjct  171   TGDVFFTDSSMNYPRSQHERVTATGDSSGRLMKYDPKTGQVTVLQAGITYPNGLAISADR  230

Query  693   TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpq  872
             T L+++     K+ +Y IKGPKA T++ L  L G PDNV+    GG+WVA++  +     
Sbjct  231   THLVVALTGPCKLMRYWIKGPKAGTSEHLADLPGYPDNVRFDGRGGFWVALH--REKMEL  288

Query  873   qLIPMTESIAVKFDRNGKILD-RKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGV  1037
                P +  +AV+   +G+++   +   S  P          GK Y GS+   ++ V
Sbjct  289   PFGPDSHLLAVRVGADGQVVQVMRGPKSVRPTEVVE--REGGKLYMGSVELPYVAV  342



>gb|KDP29321.1| hypothetical protein JCGZ_18242 [Jatropha curcas]
Length=319

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 119/303 (39%), Positives = 176/303 (58%), Gaps = 15/303 (5%)
 Frame = +3

Query  171   IGPEDVAFNGKGEGPYTGVADGRILKYY--NGKFIDFATTSPLRTKVICDGTNNTILQLI  344
             IGPE +AF+  G GPY GV+DGRILK++  N  ++DFA +SP R K  CDG+ +   +  
Sbjct  13    IGPESLAFDCNGNGPYVGVSDGRILKWHQSNQSWLDFAVSSPNRDKKECDGSTDPNKEPE  72

Query  345   CGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST-  521
             CGR LGL+F+P T DLYIAD  +GLL VGP GG+ TQLAA   G+ F F N + +D  T 
Sbjct  73    CGRALGLKFNPATCDLYIADAYYGLLVVGPMGGVPTQLAASAEGVPFRFANGLDIDPKTG  132

Query  522   -VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF DS + F    + +   S D SGRLLKY+  + +VTV+ +GL+ P G+A+S D +F
Sbjct  133   AVYFTDSSIFFQRREYLRAILSSDRSGRLLKYDPNSKKVTVLFKGLAFPNGVALSNDNSF  192

Query  699   LLISEFIAKKITKY-IIKGPKANTTQ--TLLKLEGQPDNVKRATSGGYWVAVNILKppqp  869
             +L++E    +I K+ ++     N  Q     +L   PDN+KR  +G +WVA+N  +    
Sbjct  193   VLVAEEGMLRILKFKLLNNDNHNEMQEEVFAELGRLPDNIKRNDNGEFWVALNSGRGKIQ  252

Query  870   qqLIPM-------TESIAVKFDRNGKILDRKNVTSAYP-NSFSAYLEHFGKAYTGSLVPN  1025
             +    M        +++ +KF  +GK++   +       +S S   E+ G  + GS V  
Sbjct  253   KYKEEMINEGWVFNDTVGIKFSEDGKVVKMLDGNGGEILDSVSEVAEYDGGLWFGSSVQP  312

Query  1026  FLG  1034
             ++G
Sbjct  313   YVG  315



>ref|XP_010031589.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Eucalyptus grandis]
 gb|KCW50951.1| hypothetical protein EUGRSUZ_J00588 [Eucalyptus grandis]
Length=393

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 124/322 (39%), Positives = 177/322 (55%), Gaps = 32/322 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE +AF+  G GPYTGVADGR+L +    + DFA TSP R++ +C+   +++  L    
Sbjct  72    GPESIAFDPLGRGPYTGVADGRVLFWDGQAWSDFAYTSPNRSE-LCNPKPSSLSYLKNEH  130

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-ES  518
             ICGRPLGL F  +TGDLYIAD  FGL+KVGP+GGLAT L     GI   FTN + +D E 
Sbjct  131   ICGRPLGLRFDKKTGDLYIADAYFGLMKVGPEGGLATSLTTEAEGIPLRFTNDLDIDDEG  190

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF DS  ++   NF  +  S ++SGRLLKY   T   TV+ R L  P G+++SKD++F
Sbjct  191   NVYFTDSSSVYQRRNFLHLVFSAESSGRLLKYNPVTKETTVLERNLQFPNGVSLSKDRSF  250

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNI---------  851
              +  E    ++ KY +KG KA T++    L G PDNV+    G +WVAV+          
Sbjct  251   FVFCEGAIGRLRKYWLKGEKAGTSEVFAVLPGFPDNVRTNKDGEFWVAVHSRRTPYTYLC  310

Query  852   -----LKppqpqqLIPMT-----------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                  ++    +  IP               + VK+ + GK++   ++       + S  
Sbjct  311   AHYPKIRKFTLKLPIPAKIQFLLHIGGRLHGVVVKYSQEGKVVRILEDSQGKVVRAVSEA  370

Query  981   LEHFGKAYTGSLVPNFLGVYTL  1046
              E  GK + GS++ +F+ VY L
Sbjct  371   EEKDGKLWMGSVLMSFIAVYNL  392



>ref|XP_010263076.1| PREDICTED: adipocyte plasma membrane-associated protein [Nelumbo 
nucifera]
Length=391

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 126/324 (39%), Positives = 178/324 (55%), Gaps = 34/324 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK-FIDFATTSPLRTKVICDGTNNTILQL---  341
             GPE VAF+  G GPYTGVADGRIL ++NG+ + DFA TSP R++ +C    + +  L   
Sbjct  70    GPESVAFDSLGRGPYTGVADGRIL-FWNGESWTDFAYTSPNRSE-LCSPKPSPMSYLKNE  127

Query  342   -ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-E  515
              ICGRPLGL F  +TG+LYIAD  FGL+KVGP+GGLA  L   V G+   FTN + +D E
Sbjct  128   HICGRPLGLRFDKKTGELYIADAYFGLMKVGPEGGLAKSLVTEVEGVPLRFTNDLDIDDE  187

Query  516   STVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               VYF DS + +   NF ++  SG+  GRLLKY   T   +V++R L  P G+++SKDK+
Sbjct  188   GNVYFTDSSIKYQRRNFIQLVFSGEDDGRLLKYNPLTKETSVLMRNLQFPNGVSMSKDKS  247

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqp--  869
             F + S+    ++ +Y +KG KA T+     L G PDNV+    G +WVA++  +      
Sbjct  248   FFVFSDGSCGRLRRYWLKGEKAGTSDIFAILPGFPDNVRTNERGEFWVAIHCRRSMYAYI  307

Query  870   qqLIP-----------------------MTESIAVKFDRNGKILD-RKNVTSAYPNSFSA  977
               L P                          ++ VK+   GKIL   ++       + S 
Sbjct  308   SSLYPKLRKFLLKLPVLAKFQYLLQIGGRQHAVVVKYSPEGKILQILEDSQGKVVRAVSE  367

Query  978   YLEHFGKAYTGSLVPNFLGVYTLK  1049
               E  GK + GS++  F+ VY L+
Sbjct  368   VEEKDGKLWIGSVLMPFMAVYQLE  391



>ref|XP_008244837.1| PREDICTED: strictosidine synthase 1 [Prunus mume]
Length=375

 Score =   206 bits (524),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 125/323 (39%), Positives = 174/323 (54%), Gaps = 32/323 (10%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKY--YNGKFIDFATTSPLRTKVICDGTNNTILQL  341
             A+GPE +AF+  G GPYTGVADGRILK+   + ++ DFA TS  R +  C       L+ 
Sbjct  55    ALGPESLAFDPNGGGPYTGVADGRILKWDQNDRRWTDFAVTSSQRKE--CIRPFAPELEH  112

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDE--  515
             +CGRPLGL+F  +TGDLYIAD   GL  VGP GGLA+Q+   V G    FTN + +DE  
Sbjct  113   VCGRPLGLKFDTKTGDLYIADAYLGLQVVGPAGGLASQVVREVEGQPLRFTNDMDIDEHK  172

Query  516   STVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               +YF DS  IF    F     +GD +GRLLKY      VTV+LRGL+   G+A+SKD +
Sbjct  173   DVIYFTDSSTIFHRRQFMSSVLNGDRTGRLLKYNKSNKEVTVLLRGLAFANGVALSKDHS  232

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             F+L++E    +I +  + GP A  T T  +L G PDN++R + G +WVA++  +    + 
Sbjct  233   FVLVAETTTCRILRLWLHGPNAGNTDTFAELPGFPDNIRRNSKGEFWVALHAKRGFFAKW  292

Query  876   LI------------PM-------------TESIAVKFDRNGKILDRKNVTSAYPNSF-SA  977
              +            P+               + A+K    G+IL+           F S 
Sbjct  293   FVSNKLVGKSLLKLPLDFKQLHSLLVGGKAHATAIKLSERGEILEVLEDCEGKNMRFISE  352

Query  978   YLEHFGKAYTGSLVPNFLGVYTL  1046
               E  GK + GS++  FLG+Y L
Sbjct  353   VEEKDGKLWIGSVLMPFLGIYEL  375



>ref|XP_003559512.1| PREDICTED: strictosidine synthase-like [Brachypodium distachyon]
Length=397

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 123/321 (38%), Positives = 175/321 (55%), Gaps = 33/321 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE VAF+ +G GPYTGVADGR+L +   +++ FA  SP  T  +C G   + L      
Sbjct  72    GPESVAFDPQGRGPYTGVADGRVLFWDGARWVYFAHASPNWTAELC-GPKASPLDFLRDE  130

Query  342   -ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-E  515
              ICGR LG+ F  RTG+LYIAD  FGL KVGP+GGLAT LA    G++F+FTN + LD E
Sbjct  131   HICGRALGIRFDKRTGNLYIADAYFGLFKVGPEGGLATPLATEAEGVRFNFTNDLDLDAE  190

Query  516   STVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               VYF DS + +   NF ++  SGD SGRLLKY  +T   TV+ R L  P G+++SKD +
Sbjct  191   GNVYFTDSSIYYQRRNFMQLVFSGDPSGRLLKYNPQTKETTVLHRNLQFPNGVSLSKDGS  250

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNI--------  851
             F +  E    ++++Y +KG KA T      L G PDNV+    G +WVA++         
Sbjct  251   FFVFCEGSRGRLSRYWLKGEKAGTVDLFAILPGFPDNVRTNEKGEFWVAIHCRRSAYARL  310

Query  852   ------LKppqpqqLIPMT-----------ESIAVKFDRNGKILD-RKNVTSAYPNSFSA  977
                   L+       IP              ++ +K+  +G++LD  ++       + S 
Sbjct  311   TSRRVQLRKFLLSLPIPAKYHYLMQIGGNLHALIIKYSPDGEVLDILEDTKGQVVRAVSE  370

Query  978   YLEHFGKAYTGSLVPNFLGVY  1040
               E  GK + GS++  F+ V+
Sbjct  371   VEEKDGKLWIGSVLMPFIAVF  391



>ref|XP_010031590.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Eucalyptus grandis]
 gb|KCW50952.1| hypothetical protein EUGRSUZ_J00590 [Eucalyptus grandis]
Length=393

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 123/322 (38%), Positives = 174/322 (54%), Gaps = 32/322 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE +AF+  G GPYTGVADGR+L +    + DFA TSP R++ +CD  ++    L    
Sbjct  72    GPESIAFDPLGRGPYTGVADGRVLFWDGQAWSDFAYTSPNRSE-LCDPKSSPRSYLKNEH  130

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES-  518
             ICGRPLGL F  +TGDLYIAD  FGL+KVGP+GGLAT L     GI   FTN + +DE  
Sbjct  131   ICGRPLGLRFDKKTGDLYIADAYFGLMKVGPEGGLATSLTTEAEGIPLRFTNDLDIDEEG  190

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF DS  ++   NF  +  S ++SGRLLKY   T   TV+ R L  P G+++SKD++F
Sbjct  191   NVYFTDSSSVYQRRNFLHLVFSAESSGRLLKYNPVTKETTVLERNLQFPNGVSLSKDRSF  250

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
              +  E    ++ KY +KG KA  ++    L G PDNV+    G +WVAV+  +       
Sbjct  251   FVFCEGAIGRLRKYWLKGEKAGNSEVFAVLPGFPDNVRTNKDGEFWVAVHCRRTLYTYLC  310

Query  879   ------------IPMTESI-------------AVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                         +P++  I              +K+ + GK++   ++       + S  
Sbjct  311   AHYPKIRKYILKLPISAEIQYVLHIGGGLHGVVIKYSQEGKVMRILEDSQGKVVKAVSEA  370

Query  981   LEHFGKAYTGSLVPNFLGVYTL  1046
              E  GK + GS++  F+ VY L
Sbjct  371   EEKDGKLWMGSVLMPFIAVYNL  392



>ref|XP_003561520.1| PREDICTED: strictosidine synthase 1-like [Brachypodium distachyon]
Length=345

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 120/298 (40%), Positives = 177/298 (59%), Gaps = 13/298 (4%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTS--PLRTKVICDGT---NNTILQ  338
             GPE VAF+G+G GPY+GV+DGRILK+ NG  I ++T +  P  +   C  +   + T+ +
Sbjct  51    GPESVAFDGEGHGPYSGVSDGRILKW-NGDKIGWSTYAYGPDYSSEACTASKLRSETVTE  109

Query  339   LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
               CGRPLGL+FH ++G+LYIAD   GL+ VGP GG AT L   V+G    FTN V +D+ 
Sbjct  110   SHCGRPLGLQFHHKSGNLYIADAYKGLMWVGPSGGEATVLVNQVDGAPLRFTNGVDVDQI  169

Query  519   T--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
             T  VYF DS + +       + ++GD++GRL++Y+  T  VT +  G++ P G++IS D+
Sbjct  170   TGQVYFTDSSMNYQRSQHEMVTRTGDSTGRLMRYDPRTNDVTTLQSGITYPNGVSISHDR  229

Query  693   TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpq  872
             T L+ +     K+ +Y IKGP+A  T+    L G PDNV+R   GGYWVA++  K   P 
Sbjct  230   THLVFASTGPCKLLRYWIKGPEAGKTEPFADLPGYPDNVRRDRRGGYWVALHREKNELPF  289

Query  873   qLIPMTESIAVKFDRNGKILDR-KNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGVYT  1043
             +    +  +AV+   NGK+L+  +   S  P   +      GK Y GS+   ++GV T
Sbjct  290   EF--GSHLLAVRVGPNGKVLEEMRGPKSVRPTEINE--RGNGKYYMGSVELPYVGVVT  343



>ref|XP_006340100.1| PREDICTED: strictosidine synthase 1-like isoform X1 [Solanum 
tuberosum]
Length=381

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 124/324 (38%), Positives = 172/324 (53%), Gaps = 34/324 (10%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKY--YNGKFIDFATTSPLRTKVICDGTNNTILQL  341
             A G E V F+  GEGPYTGVADGRI+K+  +N  ++DFA TS  R    C  T+   ++ 
Sbjct  60    AFGAESVVFDPNGEGPYTGVADGRIIKWLQHNQTWVDFAVTSSQREN--CSRTSAPEMEH  117

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES-  518
             +CGRPLGL F   TGDLYIAD   GL  VGP GGLAT L          FTN + +++  
Sbjct  118   VCGRPLGLRFDQETGDLYIADAYLGLQVVGPTGGLATPLVQHFEDHPLLFTNDLDINDHD  177

Query  519   -TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               +YF DS  I+    F     SGD +GRL+KY+  T +VT++L+GLS   G+A+SKD+T
Sbjct  178   HVIYFTDSSTIYQRRQFVNATASGDKTGRLMKYDKSTKQVTILLQGLSFANGVALSKDRT  237

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             F+L++E  A +IT+Y +KGP   T     +L G PDN++  + G +WVA++  K     +
Sbjct  238   FVLVAETSACRITRYWLKGPNVGTHDIFAQLPGFPDNIRMNSKGEFWVALHA-KASPLAR  296

Query  876   LIP-------------------------MTESIAVKFDRNGKILDRKNVTSAYPNSF--S  974
             LI                             + A+K    G IL+           F   
Sbjct  297   LITSNSWLGKALLRKFNFQQMHNLLVGGQPHATAIKLSEEGGILEVLEDVEGKKLRFISE  356

Query  975   AYLEHFGKAYTGSLVPNFLGVYTL  1046
              + E  GK + GS++ + LGVY L
Sbjct  357   VHEEEDGKLWIGSVLMSSLGVYQL  380



>ref|XP_011037298.1| PREDICTED: strictosidine synthase 3-like [Populus euphratica]
Length=391

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 128/322 (40%), Positives = 176/322 (55%), Gaps = 32/322 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE +AF+  G GPYTGVADGRIL Y   K+ DFA TS  R++ IC+   + +  L    
Sbjct  70    GPESMAFDPLGRGPYTGVADGRILFYDGQKWTDFAYTSSNRSE-ICNPQPSPLSYLKNEH  128

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-ES  518
             ICGRPLGL F  +TGDLYIAD  FGL+KVGP+GGLAT L+    GI   FTN + +D E 
Sbjct  129   ICGRPLGLRFDKKTGDLYIADAYFGLMKVGPEGGLATSLSNEAEGIPLRFTNDLDIDDEG  188

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              +YF DS   +   NF ++  SG+ SGR+LKY   T   TV++R L  P G+++SKD +F
Sbjct  189   NIYFTDSSTTYQRRNFMQLVFSGENSGRVLKYNPTTKETTVLVRNLQFPNGVSLSKDGSF  248

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNI---------  851
              +  E    ++ K+ +KG KA T++ L  L G PDNV+    G +WVAV+          
Sbjct  249   FVFCEGSIGRLRKHWLKGEKAGTSEVLAILPGFPDNVRTNEEGNFWVAVHCRRSFYTHIN  308

Query  852   -----LKppqpqqLIP-----------MTESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                  L+    +  IP               + VK+   GK+L   ++       + S  
Sbjct  309   AQYPKLRTFLLKLPIPAKIHYLLQVGGWPHGLVVKYSPEGKLLQILEDSQGKVVKAISEV  368

Query  981   LEHFGKAYTGSLVPNFLGVYTL  1046
              E  GK + GS++  F+ VY L
Sbjct  369   EEKDGKLWMGSVLMPFVVVYNL  390



>emb|CDP16919.1| unnamed protein product [Coffea canephora]
Length=368

 Score =   205 bits (522),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 109/295 (37%), Positives = 170/295 (58%), Gaps = 14/295 (5%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTK---VICDGTNNTILQLI  344
             GPE  AF+  G GPY  +ADGR+ +Y  G  + F      +++     CDGTN T +  I
Sbjct  81    GPESYAFDSAGRGPYASLADGRVFRYL-GPAVGFRCIHFFKSRKPRRFCDGTNRTDISQI  139

Query  345   CGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST-  521
             CGRP GL F+ +TG+L++ D + GL+ +   GG   QLA+   G++F F + + +D++T 
Sbjct  140   CGRPTGLGFYYKTGELFLGDADLGLVVIPSGGGPGIQLASSAEGVRFGFPDGLEVDQATG  199

Query  522   -VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF D+   +       I  + D +GRLLKY+  T  VTV+LRGLSG AG+AIS+D ++
Sbjct  200   IVYFTDASSRYNLSQINNIVSNRDATGRLLKYDPRTKNVTVLLRGLSGAAGVAISEDGSY  259

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
             LL+++F+  +++KY +KGP ANT + L+ + G PD +KR T G YW+AV +         
Sbjct  260   LLVTQFVIGQVSKYWLKGPLANTAEVLVNMTGMPDKIKRNTKGEYWIAVTVTSKNS----  315

Query  879   IPMTESIAVKFDRNGKILDRKNVTSAYPNSFSAYLEHF-GKAYTGSLVPNFLGVY  1040
                T+    + D +G  L+    +  + +S    ++ + G  Y  SL   ++GVY
Sbjct  316   ---TQLQGQRIDGDGNSLETLTFSPDFDSSLITEVQEYKGALYLASLYVGYVGVY  367



>ref|XP_006291448.1| hypothetical protein CARUB_v10017585mg [Capsella rubella]
 gb|EOA24346.1| hypothetical protein CARUB_v10017585mg [Capsella rubella]
Length=339

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 123/319 (39%), Positives = 172/319 (54%), Gaps = 11/319 (3%)
 Frame = +3

Query  102   SSPCVIHSQppgillpiklklHAIGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDF  275
             S P +  S+       +     A GPE +AF+  G GPY GV+DGR+LK+   K  + DF
Sbjct  28    SPPKIPRSRNVFPSAKVVNLTRASGPESIAFDPSGGGPYVGVSDGRVLKWRGKKLGWTDF  87

Query  276   ATTSPLRTKVICDGTNNTILQLICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQ  455
             A T+  R   +C  +    L+ +CGRPLGL FH +TGDLYIAD  FGLL VGP GG+A  
Sbjct  88    AYTAANRK--MCVRSFAPELEHVCGRPLGLRFHKKTGDLYIADAYFGLLVVGPAGGVAKP  145

Query  456   LAAGVNGIKFSFTNAVALDEST--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETG  629
             L     G    FTN + +DE    +YF DS   F   ++     + D +GR +KY+  + 
Sbjct  146   LVTEAEGKPIRFTNDLDIDEQNDVIYFTDSSSRFQRWDYFGSFMTVDKTGRFIKYDRSSK  205

Query  630   RVTVVLRGLSGPAGLAISKDKTFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNV  809
             + TV+L GLS P G+ +SKD++F+L+ E    KI +  + GPKA T      L G PDN+
Sbjct  206   KATVLLHGLSFPNGVTLSKDRSFVLVDETTNFKILRLWLSGPKAGTQDVFAVLPGYPDNI  265

Query  810   KRATSGGYWVAVNILKppqpqqLIPMTESIAVKFDRNGKILDRKNVTSAYPNSFSAYLEH  989
             +R ++G +WVA+N           P T+  AVK   +G++L+            S   E 
Sbjct  266   RRNSNGEFWVAINY---SIFNGERPHTK--AVKLSESGEVLEVLEDKGKRLRYISEVEEK  320

Query  990   FGKAYTGSLVPNFLGVYTL  1046
              GK + GS V  F+GVY L
Sbjct  321   DGKLWIGSSVMPFVGVYDL  339



>ref|XP_010416232.1| PREDICTED: strictosidine synthase 3-like [Camelina sativa]
Length=338

 Score =   204 bits (520),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 122/292 (42%), Positives = 164/292 (56%), Gaps = 10/292 (3%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQLIC  347
             GPE  AF+ +G GPYTGV+ G+ILKY      FI+FA   P+  K +C+    T L  IC
Sbjct  50    GPEAFAFDSQGGGPYTGVSGGKILKYQGPTLGFIEFAYILPIANKSLCEKAIGTFLGNIC  109

Query  348   GRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--  521
             GRP+GL F+ +TGDLYIAD   GL  V  +GGLA +LA    GI F F + + +D  T  
Sbjct  110   GRPVGLAFNEKTGDLYIADAYLGLYVVSHRGGLAKRLADSAAGIPFRFLDGLDVDPVTGM  169

Query  522   VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFL  701
             VYF      F            DTSGRL +Y+ +T  VTV+L GLSG AG A+S D  F+
Sbjct  170   VYFTSFSTRFGPSELVLAVAVKDTSGRLFRYDPKTKTVTVLLSGLSGSAGCAVSSDGGFV  229

Query  702   LISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqLI  881
             L+ EF+  +I +Y IKGPKANT +  +     PDN++R   G +WVA N +K      ++
Sbjct  230   LVGEFLRNRILRYWIKGPKANTFEIFVPSIPGPDNIRRTEGGDFWVASNSVK-----LIV  284

Query  882   PMTESIAVKFDRNGKILDRKNVTSAYPNSF-SAYLEHFGKAYTGSLVPNFLG  1034
               TE  AVK   +G+IL    +   Y ++  S   E+    Y G+L   F+G
Sbjct  285   VPTEPSAVKISSDGEILRHMPLGEYYRDTLVSEVNEYKNVVYLGTLTTTFVG  336



>ref|XP_004970743.1| PREDICTED: strictosidine synthase 3-like [Setaria italica]
Length=342

 Score =   204 bits (520),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 113/296 (38%), Positives = 174/296 (59%), Gaps = 10/296 (3%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKY--YNGKFIDFATTSPLRTKVICDG--TNNTILQL  341
             G E +AF+GKGEGPY GV+DGR+LK+      +  FA ++  R   +C      +   + 
Sbjct  47    GAESLAFDGKGEGPYAGVSDGRVLKWGGSAAGWTTFAHSANYRKIPLCTAGVVPSEETES  106

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST  521
             +CGRPLGL+FH +TGDLYIAD   GL++VGP GG A  LA G +G  F+F N + +D++T
Sbjct  107   MCGRPLGLQFHAKTGDLYIADAYLGLMRVGPGGGEAEVLATGADGAPFNFVNGLDVDQAT  166

Query  522   --VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               VYF DS   +     T+I  + D +GRLLKY+  +GRVTV+  GL  P G+A+S D  
Sbjct  167   GDVYFTDSSATYPRRFNTEIMMNADATGRLLKYDARSGRVTVLKAGLPYPNGVAVSPDGA  226

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
              ++++  +  +  +Y ++G KA   + L +L G PDNV+R   GGYWV++N  K      
Sbjct  227   HVVVAHTVPCQAFRYTLRGSKAGQYELLAELPGYPDNVRRDGKGGYWVSLNQEKQRLDAA  286

Query  876   --LIPMTESIAVKFDRNGKILDRKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGV  1037
                 P+   + V+ D +G  ++ + +T+A   + S   E  G+ + GS+   ++G+
Sbjct  287   PGAAPVKHLVGVRLDADG--VEVEELTAAKGVTLSDVAERKGQLWLGSVELEYVGL  340



>ref|XP_010672985.1| PREDICTED: strictosidine synthase 1-like [Beta vulgaris subsp. 
vulgaris]
Length=377

 Score =   205 bits (522),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 121/323 (37%), Positives = 179/323 (55%), Gaps = 31/323 (10%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKYY--NGKFIDFATTSPLRTKVICDGTNNTILQL  341
             A GPE +AF+  G GPYTGVADGRILK+   +  ++DFA TS    K  C       L+ 
Sbjct  55    AFGPESLAFDPSGGGPYTGVADGRILKWDPDSNSWLDFAFTSSSSRKE-CTRAFAPELEH  113

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST  521
             +CGRPLGL F  ++GDLYIAD  FGL +VGP+GGLA+ +A    G+   FTN + +DE  
Sbjct  114   VCGRPLGLRFEQKSGDLYIADAYFGLQRVGPEGGLASNVATQAEGVPLYFTNDMDIDEEN  173

Query  522   --VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               +YF D+   F   +F     SGD +GR +KY   T  VTV+LRGL+   G+A+SKD++
Sbjct  174   DIIYFTDTSTKFRRRHFMPSILSGDQTGRFIKYNKLTKEVTVLLRGLAFANGVALSKDRS  233

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             F+L++E    +I +Y ++GP A   +T + L G PDN++R + G +WVA++  K      
Sbjct  234   FVLVAETSTCRILRYWLQGPNAGQVETFVVLPGFPDNIRRNSKGEFWVALHAKKTRLADW  293

Query  876   L------------IPMT-------------ESIAVKFDRNGKILDRKNVTSAYPNSFSAY  980
             L            +P++              +IAVK +  GK ++           +++ 
Sbjct  294   LLKNSWVGNVLLKLPLSSAQRLHALFMGGHHAIAVKLNEEGKTVEVLEDAQGKQVRYASE  353

Query  981   LEHF-GKAYTGSLVPNFLGVYTL  1046
             +E   GK + GS++   + VY L
Sbjct  354   VEERNGKLWIGSVMMPSVWVYNL  376



>ref|XP_008244844.1| PREDICTED: strictosidine synthase 1 [Prunus mume]
Length=389

 Score =   206 bits (523),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 109/240 (45%), Positives = 154/240 (64%), Gaps = 13/240 (5%)
 Frame = +3

Query  168  AIGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVI--------CDG  317
            A+GPE  AF+  G GPYTGV+DGRI+K+   K  +I+FA TSP    +         C+G
Sbjct  58   AVGPESFAFDPLGGGPYTGVSDGRIVKWDQDKHHWINFAVTSPNSASLCNPIPSRGGCEG  117

Query  318  TN-NTILQLICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFT  494
            ++ +   + ICGRPLGL F+  +GDLYIAD   GLL VGP+GGLAT++    +GI F FT
Sbjct  118  SHEHDKTEHICGRPLGLCFNQTSGDLYIADAYMGLLIVGPQGGLATEVVTRAHGIPFGFT  177

Query  495  NAVALDES--TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPA  668
            NA+ +D+    VYF DS   +   N+  +  SGD +GRL+KY+ E+ +V V+L  LS P 
Sbjct  178  NALDIDQELGAVYFTDSSSQYQRRNYISVILSGDKTGRLMKYDPESKQVQVLLENLSFPN  237

Query  669  GLAISKDKTFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVN  848
            G+A+SK+  F+L+ E    +I +Y +K PKA T Q   +L G PDN+KR+  GG+WV ++
Sbjct  238  GVALSKNGDFILLVETTHCRIMRYWLKTPKAGTFQVFAQLPGFPDNIKRSPRGGFWVGIH  297



>ref|XP_007204530.1| hypothetical protein PRUPE_ppa017675mg, partial [Prunus persica]
 gb|EMJ05729.1| hypothetical protein PRUPE_ppa017675mg, partial [Prunus persica]
Length=340

 Score =   204 bits (519),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 124/323 (38%), Positives = 173/323 (54%), Gaps = 32/323 (10%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKY--YNGKFIDFATTSPLRTKVICDGTNNTILQL  341
             A+GPE +AF+  G GPYTGVADGRILK+   + ++ DFA TS  R +  C       L+ 
Sbjct  20    ALGPESLAFDPNGGGPYTGVADGRILKWDQNDRRWTDFAVTSSQRKE--CIRPFAPELEH  77

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDE--  515
             +CGRPLGL+F   TGDLYIAD   GL  VGP GGLA+Q+   V G    FTN + +DE  
Sbjct  78    VCGRPLGLKFDTETGDLYIADAYLGLQVVGPAGGLASQVVREVEGQPLRFTNDMDIDEHK  137

Query  516   STVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               +YF DS  +F    F     +GD +GRLLKY      VTV+LRGL+   G+A+SKD +
Sbjct  138   DVIYFTDSSTVFHRRQFMSSILNGDRTGRLLKYNKSNKEVTVLLRGLAFANGVALSKDHS  197

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             F+L++E    +I +  + GP A  T T  +L G PDN++R + G +WVA++  +    + 
Sbjct  198   FVLVAETTTCRILRLWLHGPNAGNTDTFAELPGFPDNIRRNSKGEFWVALHAKRGFFAKW  257

Query  876   LI------------PM-------------TESIAVKFDRNGKILDRKNVTSAYPNSF-SA  977
              +            P+               + A+K    G+IL+           F S 
Sbjct  258   FVSNRLVGKSLLKLPLDFKQLHSLLVGGKAHATAIKLSETGEILEVLEDCEGKNMRFISE  317

Query  978   YLEHFGKAYTGSLVPNFLGVYTL  1046
               E  GK + GS++  FLG+Y L
Sbjct  318   VEEKDGKLWIGSVLMPFLGIYEL  340



>ref|XP_003580953.1| PREDICTED: strictosidine synthase 1-like [Brachypodium distachyon]
Length=345

 Score =   204 bits (519),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 118/298 (40%), Positives = 176/298 (59%), Gaps = 13/298 (4%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTS--PLRTKVICDGTN---NTILQ  338
             GPE VAF+ +G+GPY+GV+DGRILK+ NG  I + T +  P  +   C  +     T+ +
Sbjct  51    GPESVAFDSEGQGPYSGVSDGRILKW-NGDKIGWTTYAYGPDYSSEACTASKLRPETVTE  109

Query  339   LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
               CGRPLGL+FH ++G+LYIAD   GL++VGP GG AT L    +G    FTN V +D+ 
Sbjct  110   SHCGRPLGLQFHHKSGNLYIADAYKGLMRVGPTGGEATVLVNQADGAPLRFTNGVDVDQI  169

Query  519   T--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
             T  VYF DS + +       + ++GD++GRL++Y+  T  VT +  G++ P G++IS D+
Sbjct  170   TGQVYFTDSSMNYQRSQHEMVTRTGDSTGRLMRYDPRTNDVTTLQSGITYPNGVSISHDR  229

Query  693   TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpq  872
             T L+++     K+ +Y IKGP A  T+    L G PDNV++   GGYWVA++  K   P 
Sbjct  230   THLVVASTGPCKLLRYWIKGPDAGKTEPFADLPGYPDNVRQDRRGGYWVALHREKNELPF  289

Query  873   qLIPMTESIAVKFDRNGKILDR-KNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGVYT  1043
             +    +  +AV+  RNGK+L+  +   S  P   +      GK Y GS+   ++GV T
Sbjct  290   EF--GSHLLAVRVGRNGKVLEEMRGPKSVRPTEINE--RGNGKYYMGSVELPYVGVVT  343



>ref|XP_010922155.1| PREDICTED: strictosidine synthase 3-like [Elaeis guineensis]
Length=370

 Score =   205 bits (521),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 111/323 (34%), Positives = 181/323 (56%), Gaps = 30/323 (9%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQL  341
             A GPE +AF+ KGEGPYTG++DGRILK+   +  ++++A          C G+ +  L+ 
Sbjct  44    ATGPESIAFDAKGEGPYTGISDGRILKWQGKEHGWLEYAAVHAPHLLSKCRGSQDPNLEH  103

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST  521
             +CGRPLGL F  +TG+L++AD   GLL VGP    AT +A    G++F  TN + +D  +
Sbjct  104   VCGRPLGLRFSDKTGELFVADAYLGLLVVGPDDKFATPIAKQAQGVEFHVTNGLDIDPDS  163

Query  522   --VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               VYF DS + F    +     +GD +GRL+KY+ ++  V V+L  LS P G+A+S+D +
Sbjct  164   GAVYFTDSSMRFQRRQYISAVIAGDKTGRLMKYDPQSKEVQVLLDSLSFPNGVALSQDGS  223

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
              LLI E I  +I +Y ++ PKANT + + +L G PDN+KR+  GG+WVA++  +    ++
Sbjct  224   HLLIVETITCRILRYWLRTPKANTVEVIAQLPGFPDNIKRSPRGGFWVALHSKRTKFVER  283

Query  876   LIP--------MTESI-----------------AVKFDRNGKILD-RKNVTSAYPNSFSA  977
             ++         +  SI                 A++   +G++L+  +        + S 
Sbjct  284   VLSDPWLCDVLLNSSIDLQRVSSFVNRRSGKASALRLSEDGQVLEVLEGFGGGTMRAISE  343

Query  978   YLEHFGKAYTGSLVPNFLGVYTL  1046
               E +G+ + GS+   F+G+Y +
Sbjct  344   VEERYGRLWIGSIAMPFVGIYNV  366



>gb|KFK26348.1| hypothetical protein AALP_AA8G236100 [Arabis alpina]
Length=395

 Score =   205 bits (522),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 125/322 (39%), Positives = 173/322 (54%), Gaps = 32/322 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE VAF+  G GPYTGVADGR+L +   K+IDFA TS  R++ ICD   + +  L    
Sbjct  75    GPESVAFDPLGRGPYTGVADGRVLFWNGEKWIDFAYTSSNRSE-ICDPKPSALSYLKNEH  133

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES-  518
             ICGRPLGL F  RTGDLYIAD   GLLKVGP+GGLA  L     G+   FTN + +D+  
Sbjct  134   ICGRPLGLRFDKRTGDLYIADAYMGLLKVGPEGGLAMSLVTEAEGVPLGFTNDLDIDDDG  193

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
             TVYF DS   +   NF ++  SGD SGR+LKY+    +  V++  +  P G++ISKD +F
Sbjct  194   TVYFTDSSTNYQRRNFLQLVFSGDNSGRVLKYDPIAKKAVVLVSNVQFPNGVSISKDGSF  253

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
              L  +     + +Y +KG KA T+     L G PDNV+    G +WVA++  +      +
Sbjct  254   FLFCDGDVGSLRRYWLKGEKAGTSDVFAMLPGHPDNVRTNEKGEFWVALHCKRNYYAYIM  313

Query  879   ------------IPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                         +P+T               + VK+   GK++   ++       S S  
Sbjct  314   AKYPKLRMFILKLPITAKTHYLFQIGMRPHGLVVKYSPEGKLVKVLEDSEGKVVRSVSEV  373

Query  981   LEHFGKAYTGSLVPNFLGVYTL  1046
              E  GK + GS++ NF+ VY L
Sbjct  374   EEKDGKLWMGSVLMNFVAVYDL  395



>emb|CDP07817.1| unnamed protein product [Coffea canephora]
Length=331

 Score =   203 bits (517),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 113/260 (43%), Positives = 158/260 (61%), Gaps = 13/260 (5%)
 Frame = +3

Query  168  AIGPEDVAFNGKGEGPYTGVADGRILKYYNG--KFIDFATTSPLRTKVICDGTNNTIL-Q  338
            A GPE +AF+  G GPYTGV+DGRI+K+     +++DFATT+P R    C G  + +L +
Sbjct  41   ATGPESLAFDRNGGGPYTGVSDGRIIKWQANVNRWVDFATTTPYRFG--CQGPFDHVLTE  98

Query  339  LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
              CGRPLGL F+ RTGDLYIAD   GLL VGP+GGLA  LA    G+ F FTN V +D++
Sbjct  99   ARCGRPLGLSFNHRTGDLYIADAYMGLLVVGPEGGLARPLAKEAGGVPFRFTNDVVVDQN  158

Query  519  T--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
            +  VYF D+        +  +  SGD SGRLLKY++ T +VTV++  L  P G+A+SK+ 
Sbjct  159  SGIVYFTDTSTRLPRSAYAYVILSGDNSGRLLKYDLRTNQVTVLMDHLMFPNGVALSKNG  218

Query  693  TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpq  872
             FLL++E    ++ +Y ++  +  T     +L G+PDN+KR   G +WVA N        
Sbjct  219  DFLLVTETTNSRVLRYWLEPSRVGTVDVFAELPGRPDNIKRNQQGEFWVAANSRDGIYN-  277

Query  873  qLIPMTESIAVKFDRNGKIL  932
               P+   + VK  +NG IL
Sbjct  278  ---PL--GMIVKLSQNGDIL  292



>ref|XP_010537421.1| PREDICTED: strictosidine synthase 1-like [Tarenaya hassleriana]
Length=333

 Score =   203 bits (517),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 120/295 (41%), Positives = 167/295 (57%), Gaps = 12/295 (4%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK---FIDFATTSPLRTKVICDGTNNTILQLI  344
             GPE  AF+ +GEGPYTGV+ G+ILKY NG    F+ F+ TSPL    +CD    T L  +
Sbjct  44    GPEAFAFDPRGEGPYTGVSGGKILKY-NGPLLGFVHFSFTSPLANTSVCDKAVGTFLGKV  102

Query  345   CGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST-  521
             CGRP+G+ F+PRTG LYIAD   GL    P+GG A +LA    G  F F + + +D  T 
Sbjct  103   CGRPVGIAFNPRTGYLYIADAYLGLYVASPRGGRAKRLADSAEGSPFRFLDGLDVDPVTG  162

Query  522   -VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF      F            D +G+L +Y+ +T  V V++ GLSG AG A+S D +F
Sbjct  163   NVYFTSFSSRFGPSELLLAVAVKDATGKLFRYDPKTKNVAVLMTGLSGSAGCAVSSDGSF  222

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
             +L+ E +  +I +Y IKG KA T +  +     PDN++R   G +WVA  ++K      +
Sbjct  223   VLVGEVLRNRILRYWIKGSKAATWEVFVPWIPGPDNIRRTDGGDFWVASVVMK----LAV  278

Query  879   IPMTESIAVKFDRNGKILDRKNVTSAYPNSF-SAYLEHFGKAYTGSLVPNFLGVY  1040
             +P TE  AVK + +G I+ R  +   Y N+  S   EH G  Y G+L  +F+GVY
Sbjct  279   VP-TEPSAVKLNTSGGIVRRIPLGEYYGNTLVSEANEHNGVIYFGTLTSDFIGVY  332



>gb|EPS65875.1| hypothetical protein M569_08902 [Genlisea aurea]
Length=391

 Score =   205 bits (522),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 124/323 (38%), Positives = 179/323 (55%), Gaps = 33/323 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNG-KFIDFATTSPLRTKVICDGTNNTILQL---  341
             GPE +AF+  G GPYTGVADGRIL ++NG  + DFA TSP R+  +CD   + +  L   
Sbjct  70    GPESLAFDPSGRGPYTGVADGRIL-FWNGVDWTDFAYTSPNRSDGLCDPKPSILDYLKNE  128

Query  342   -ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-E  515
              ICGRPLGL F  + GDLYIAD  FGL+KVG +GGLAT LA    GI   FTN + +D E
Sbjct  129   HICGRPLGLRFDRKNGDLYIADAYFGLMKVGREGGLATSLATEAEGIPLGFTNDLDVDDE  188

Query  516   STVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               VYF DS   +   NF ++  + + SGRLLKY+ +T   +V++R L  P G+++SKD +
Sbjct  189   GNVYFTDSSTRYRRRNFLQLVFTAENSGRLLKYDPKTRETSVLVRNLQFPNGVSLSKDGS  248

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             F++  E    +++KY +KG K  T++ +  L G PDNV+    G +WVAV+  +      
Sbjct  249   FIVYCESSKGRLSKYWLKGKKGGTSEVMAVLPGFPDNVRTNEEGEFWVAVHCRRTRYAHF  308

Query  876   L--------------IPMT-----------ESIAVKFDRNGKILD-RKNVTSAYPNSFSA  977
             +              IP+             ++ VK+   GK++   ++       + S 
Sbjct  309   MGEHTKVRRFFLKLPIPLRIHYLLQIGGRPHAVVVKYSPEGKLVKILEDQHGKVVRAVSE  368

Query  978   YLEHFGKAYTGSLVPNFLGVYTL  1046
               E  GK + GS++  F+ VY L
Sbjct  369   VEEKGGKLWMGSVLMQFVSVYDL  391



>ref|XP_009400113.1| PREDICTED: strictosidine synthase 1-like [Musa acuminata subsp. 
malaccensis]
Length=359

 Score =   204 bits (519),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 108/233 (46%), Positives = 154/233 (66%), Gaps = 8/233 (3%)
 Frame = +3

Query  174  GPEDVAFNGKGEGPYTGVADGRILKYYNGK---FIDFATTSPLRTKVICDGTNNTILQLI  344
            GPE +AF+ +GEGPYTGV+ GRILK+  GK   +  FA  +  R K  CD T++  L+ +
Sbjct  51   GPESLAFDRRGEGPYTGVSGGRILKW-QGKGRGWTGFAVNAGNR-KECCD-TSDVSLESM  107

Query  345  CGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST-  521
            CGRPLGL+FH  TG LY+AD  FGLL VGPKGG A +LAA  +G +F+FTN V +D+ T 
Sbjct  108  CGRPLGLQFHKATGVLYVADAYFGLLAVGPKGGAARRLAASADGGRFNFTNGVDVDQGTG  167

Query  522  -VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
             VYF DS   +   ++     +GD++GRL+KY+  T +VTV+ RGL  P G+A+S D +F
Sbjct  168  EVYFTDSSTRYQRPDYILSVITGDSTGRLMKYDPRTRKVTVLRRGLPFPNGVALSGDGSF  227

Query  699  LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILK  857
            LL +E  + ++ K+ ++GP+    +   +L G PDN++R   G YW+A+N  K
Sbjct  228  LLFAETGSCRVLKHWLRGPRTGAMEVFAELPGYPDNIRRTARGEYWIALNREK  280



>gb|KHN41250.1| Adipocyte plasma membrane-associated protein [Glycine soja]
Length=353

 Score =   204 bits (519),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 122/324 (38%), Positives = 179/324 (55%), Gaps = 32/324 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKV---ICDGTNNTIL--Q  338
             GPE +AF+  G GPYTG+ADG I+ +    ++ FA TSP R+++   I   T  + +  +
Sbjct  30    GPESIAFDPLGRGPYTGLADGTIVFWNGHSWLHFAYTSPNRSEICNPIASATPFSYVKNE  89

Query  339   LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-E  515
              ICGRPLGL F  +TGDLYIAD  FGLLKVGP+GGLAT L     GI   FTN V +D E
Sbjct  90    HICGRPLGLRFDKKTGDLYIADAYFGLLKVGPEGGLATSLVTEAEGIPLRFTNDVDVDTE  149

Query  516   STVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               VYF +S  ++   NF ++  SGD SGR+LKY + T   TV++R +  P G+++SKD +
Sbjct  150   GNVYFTESSALYPRRNFLQLVFSGDDSGRVLKYNLATKETTVLVRNIQFPNGISLSKDGS  209

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNI--------  851
             F +  E +  ++ KY +KG KA T++ L  L G PDNV+    G +WVA++         
Sbjct  210   FFVFCEGVVGRLRKYWLKGEKAGTSEILAILPGYPDNVRVNEDGDFWVALHSRRYMYAYY  269

Query  852   ------LKppqpqqLIPM-----------TESIAVKFDRNGKILD-RKNVTSAYPNSFSA  977
                   ++    +  IP+             +  +++   GK+L   ++       + S 
Sbjct  270   NGIYPKMRKIILKLPIPIKIHYLLQIGGRQHAAVIRYSPEGKLLQILEDSEGKVVKAVSE  329

Query  978   YLEHFGKAYTGSLVPNFLGVYTLK  1049
               E  GK + GS++  F+ VY LK
Sbjct  330   VEEKDGKLWMGSVLMPFVAVYNLK  353



>ref|XP_003575472.1| PREDICTED: strictosidine synthase 1-like [Brachypodium distachyon]
Length=345

 Score =   203 bits (517),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 121/298 (41%), Positives = 172/298 (58%), Gaps = 11/298 (4%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTN---NTILQLI  344
             GPE VAF+ KG GPY+GV+DGRILK+  G +  +A  +P  +   C  T     T+ +  
Sbjct  53    GPESVAFDAKGRGPYSGVSDGRILKWTKGGWTTYAY-APGYSSEACMATARRPETVTESS  111

Query  345   CGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST-  521
             CGRPLGL FH R+G+LYIAD   GL++VGP GG AT L   V  +   FTN V +D+ T 
Sbjct  112   CGRPLGLRFHLRSGNLYIADAYKGLMRVGPGGGEATVLVNEVEDVPLRFTNGVDIDQVTG  171

Query  522   -VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VY  DS + +       + ++GD++GRL++Y  +TG+V V+  G++ P GLAIS D+T 
Sbjct  172   EVYLTDSSMNYQRSQHEMVTRTGDSTGRLMRYNPQTGKVVVLQAGITYPNGLAISADRTH  231

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
             L+IS     K+ +Y IKGPKA T + L+ L G PDNV+    GGYWVA++  K   P  +
Sbjct  232   LVISSTGPCKLLRYWIKGPKAGTIEVLVDLPGYPDNVRPDGRGGYWVALHREKNELPFGV  291

Query  879   IPMTESIAVKFDRNGKILDR-KNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGVYTLK  1049
                +  +AV+   +G IL+  K   S  P          G+ + GS+   ++ V   K
Sbjct  292   D--SHLLAVRIGADGMILEEMKGPKSVRPTEIME--RKAGRLFMGSVELPYVSVVKRK  345



>ref|XP_011000438.1| PREDICTED: strictosidine synthase 1 [Populus euphratica]
Length=375

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 123/326 (38%), Positives = 176/326 (54%), Gaps = 35/326 (11%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKYY-----NGKFIDFATTSPLRTKVICDGTNNTI  332
             A+GPE + F+  GEGPYTGVADGR+LK+      +G + DFATTS  R K  C       
Sbjct  52    AVGPESLVFDPNGEGPYTGVADGRVLKWIAGDDGSGSWTDFATTSSNRNK--CVRPFAPE  109

Query  333   LQLICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD  512
             ++ +CGRPLGL F  +TG+LYIAD   GL  VGP GGLAT +   + G    FTN + +D
Sbjct  110   MEHVCGRPLGLRFDKKTGNLYIADAYLGLQVVGPTGGLATPVVTELEGQPMRFTNDLDID  169

Query  513   ES--TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISK  686
             E    +YF D+ ++F    F     + D +GRLLKY+  +  VTV+ RGL+   G+A+SK
Sbjct  170   EQEDVIYFTDTSMVFQRRQFMLSLLTKDKTGRLLKYDRSSKEVTVLARGLAFANGVALSK  229

Query  687   DKTFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppq  866
             D TFLL++E  + +I ++ + GP A  +    +L G PDN++R + G +WVA++  K   
Sbjct  230   DSTFLLVAETTSCRILRFWLHGPNAGKSDVFSELPGFPDNIRRNSKGEFWVALHSKKGLF  289

Query  867   pqqLI------------PMT-------------ESIAVKFDRNGKILDRKNVTSAYPNSF  971
              + ++            P++              + A+K    GKILD           F
Sbjct  290   AKVVLSNSWIGRTLLKFPLSFKQLHSLLVGGKAHATAIKLSEEGKILDVLEDCDGKTLRF  349

Query  972   -SAYLEHFGKAYTGSLVPNFLGVYTL  1046
              S   E  GK + GS++  FLG Y L
Sbjct  350   ISEVEEKDGKLWIGSVLMPFLGTYNL  375



>ref|XP_011044611.1| PREDICTED: strictosidine synthase 3-like [Populus euphratica]
Length=391

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 127/322 (39%), Positives = 176/322 (55%), Gaps = 32/322 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE +AF+  G GPYTGVADGRIL Y   K+ DFA TS  R++ +C+   + +  L    
Sbjct  70    GPESMAFDPLGRGPYTGVADGRILFYDGQKWTDFAYTSSNRSE-MCNPQPSPLSYLKNEH  128

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-ES  518
             ICGRPLGL F  +TGDLYIAD  FGL+KVGP+GGLAT L+    GI   FTN + +D E 
Sbjct  129   ICGRPLGLRFDKKTGDLYIADAYFGLMKVGPEGGLATSLSNEAEGIPLRFTNDLDIDDEG  188

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              +YF DS   +   NF ++  SG+ SGR+LKY   T   TV++R L  P G+++SKD +F
Sbjct  189   NIYFTDSSTTYQRRNFMQLVFSGENSGRVLKYNPTTKETTVLVRNLQFPNGVSLSKDGSF  248

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNI---------  851
              +  E    ++ K+ +KG KA T++ L  L G PDNV+    G +WVAV+          
Sbjct  249   FVFCEGSIGRLRKHWLKGEKAGTSEVLAILPGFPDNVRTNEEGNFWVAVHCRRSFYTHIN  308

Query  852   -----LKppqpqqLIP-----------MTESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                  L+    +  IP               + VK+   GK+L   ++       + S  
Sbjct  309   AQYPKLRTFLLKLPIPAKIHYLLQVGGWPHGLVVKYSPEGKLLQILEDSQGKVVKAISEV  368

Query  981   LEHFGKAYTGSLVPNFLGVYTL  1046
              E  GK + GS++  F+ VY L
Sbjct  369   EEKDGKLWMGSVLMPFVVVYNL  390



>dbj|BAJ91613.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=431

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 120/321 (37%), Positives = 174/321 (54%), Gaps = 32/321 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE VAF+ +G GPYTGVADGR+L +   ++  FA  SP  T   C G   +  +     
Sbjct  104   GPESVAFDPRGRGPYTGVADGRVLVWDGARWAYFAHASPAWTADRCGGPKASPTEYLRDE  163

Query  342   -ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-E  515
              +CGR LG+ F  RTGDLYIAD  FGL KVGP+GGLAT LA    G++F+FTN + LD +
Sbjct  164   HVCGRALGIRFDKRTGDLYIADAYFGLSKVGPEGGLATPLATEAEGVRFNFTNDLDLDAD  223

Query  516   STVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               VYF DS +++   +F ++  SGD SGRLLKY  +T   TV+ R L  P G+++SKD +
Sbjct  224   GNVYFTDSSVLYQRRHFMQLVFSGDASGRLLKYNPQTKETTVLHRNLQFPNGVSLSKDGS  283

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             F +  E    ++++Y +KG KA T      L G PDNV+    G +WVA++  +    + 
Sbjct  284   FFVFCEGSRGRLSRYWLKGEKAGTVDLFAILPGFPDNVRTNDKGEFWVAIHCRRSAYARL  343

Query  876   L--------------IPMT-----------ESIAVKFDRNGKILD-RKNVTSAYPNSFSA  977
             L              IP              ++ +K+   G++LD  ++       + S 
Sbjct  344   LSHRVQLRKFLLSLPIPAKYHYLMQIGGNLHALIIKYSPEGEVLDILEDTKGQVVRAVSE  403

Query  978   YLEHFGKAYTGSLVPNFLGVY  1040
               E  GK + GS++  F+ V+
Sbjct  404   VEEKDGKLWIGSVLMPFIAVF  424



>gb|KDO48949.1| hypothetical protein CISIN_1g015463mg [Citrus sinensis]
Length=391

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 125/322 (39%), Positives = 177/322 (55%), Gaps = 32/322 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICD----GTNNTILQL  341
             GPE +AF+  G GPYTGVADGRIL +   K+ DFA TS  R++ +C+     T+    + 
Sbjct  70    GPESMAFDPLGRGPYTGVADGRILFWDGLKWTDFAFTSNNRSE-LCNPKPIATSYLKNEH  128

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-ES  518
             ICGRPLGL F  +TGDLYIAD  FGL+KVGP+GGLAT LA    G+   FTN + +D E 
Sbjct  129   ICGRPLGLRFDKKTGDLYIADAYFGLMKVGPEGGLATSLATEAEGVPLRFTNDLDIDDEG  188

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF DS   +   NF ++  S + +GR+LKY+  T + TV+LR L  P GL++SKDK+F
Sbjct  189   NVYFTDSSTNYQRRNFMQLVFSAEDTGRVLKYDPTTKQTTVLLRNLQFPNGLSLSKDKSF  248

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
              +  E    ++ KY + G KA   +    L G PDNV+    G +WVA++  +      +
Sbjct  249   FVFCEGSVGRLHKYWLIGEKAGNLEAFAILPGYPDNVRTNEKGEFWVAIHCRRSLYSHLM  308

Query  879   ------------IPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                         +P++              ++AVK+   GKIL   ++       + S  
Sbjct  309   ALYPKIRHFLLKLPISAKTHYLIHVGGRLHAMAVKYSPEGKILQVLEDSKGKVVKAISEV  368

Query  981   LEHFGKAYTGSLVPNFLGVYTL  1046
              E  GK + GS++  F+ VY L
Sbjct  369   EEKDGKLWMGSVLMPFVAVYDL  390



>gb|KHG17610.1| Strictosidine synthase 1 -like protein [Gossypium arboreum]
Length=332

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 125/327 (38%), Positives = 186/327 (57%), Gaps = 17/327 (5%)
 Frame = +3

Query  81    ISILIFISS-PCVIHSQppgillpiklklHAIGPEDVAFNGKGEGPYTGVADGRILKYYN  257
             + I IF+S  P ++ SQ    L          GPE +AF       Y GVADGRIL+Y N
Sbjct  14    VPIFIFVSCFPPLMLSQSFRSLQLPP---KVTGPESIAFEFGTSRFYVGVADGRILQY-N  69

Query  258   GK---FIDFATTSPLRTKVICDGTNNTILQLICGRPLGLEFHPRTGDLYIADVNFGLLKV  428
             G    F DF  T P R+K +CDGT++  L  ICGRPLGL FH     LYI D  FGL+ +
Sbjct  70    GPRVGFRDFGFTGPNRSKRMCDGTSDPNLGPICGRPLGLAFHYSLNKLYICDAYFGLMVL  129

Query  429   GPKGGLATQLAAGVNGIKFSFTNAVALDEST--VYFVDSGLIFLTGNFTKIAQSGDTSGR  602
             G  G  ATQ++A  +G  +   +A+ + + +  V F DS   +   N +K   + D++GR
Sbjct  130   GSSGKQATQVSAAADGEPYRLCDALDVHQPSGNVIFADSSANYDLRNISKAVNANDSTGR  189

Query  603   LLKYEMETGRVTVVLRGLSGPAGLAISKDKTFLLISEFIAKKITKYIIKGPKANTTQTLL  782
             LL Y  +T RVTV+++ LSGPAG+A+S+D  ++L+S FI     +Y ++GP ANT   ++
Sbjct  190   LLMYNPDTDRVTVLIKNLSGPAGVAVSQDGAYVLVSNFINNSTIRYWLRGPGANTYD-VI  248

Query  783   KLEGQPDNVKRATSGGYWVAVNILKppqpqqLIPMTESIAVKFDRNGKILDRKNVTSAYP  962
              L+ +PDN+KR   G +W A  ++K    + L+P+ + I    +  G++L   N  + Y 
Sbjct  249   NLQERPDNIKRTAFGDFWRAAALVK-QPTRSLVPIGQRI----NEFGRVLRTVNFEAWYG  303

Query  963   NSFSAYLEHF-GKAYTGSLVPNFLGVY  1040
             N   + ++ F G+ Y GSL   F+GV+
Sbjct  304   NQLISEVQEFGGELYLGSLSAPFVGVF  330



>dbj|BAJ89445.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=431

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 120/321 (37%), Positives = 174/321 (54%), Gaps = 32/321 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE VAF+ +G GPYTGVADGR+L +   ++  FA  SP  T   C G   +  +     
Sbjct  104   GPESVAFDPRGRGPYTGVADGRVLVWDGARWAYFAHASPAWTADRCGGPKASPTEYLRDE  163

Query  342   -ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-E  515
              +CGR LG+ F  RTGDLYIAD  FGL KVGP+GGLAT LA    G++F+FTN + LD +
Sbjct  164   HVCGRALGIRFDKRTGDLYIADAYFGLSKVGPEGGLATPLATEAEGVRFNFTNDLDLDAD  223

Query  516   STVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               VYF DS +++   +F ++  SGD SGRLLKY  +T   TV+ R L  P G+++SKD +
Sbjct  224   GNVYFTDSSVLYQRRHFMQLVFSGDASGRLLKYNPQTKETTVLHRNLQFPNGVSLSKDGS  283

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             F +  E    ++++Y +KG KA T      L G PDNV+    G +WVA++  +    + 
Sbjct  284   FFVFCEGSRGRLSRYWLKGEKAGTVDLFAILPGFPDNVRTNDKGEFWVAIHCRRSAYARL  343

Query  876   L--------------IPMT-----------ESIAVKFDRNGKILD-RKNVTSAYPNSFSA  977
             L              IP              ++ +K+   G++LD  ++       + S 
Sbjct  344   LSHRVQLRKFLLSLPIPAKYHYLMQIGGNLHALIIKYSPEGEVLDILEDTKGQVVRAVSE  403

Query  978   YLEHFGKAYTGSLVPNFLGVY  1040
               E  GK + GS++  F+ V+
Sbjct  404   VEEKDGKLWIGSVLMPFIAVF  424



>ref|XP_002892459.1| strictosidine synthase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68718.1| strictosidine synthase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=390

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 120/322 (37%), Positives = 178/322 (55%), Gaps = 32/322 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE +AF+ +G GPYTGVADGRIL +   ++IDFA TS  R++ +CD   + +  L    
Sbjct  69    GPESIAFDPQGRGPYTGVADGRILFWNGTRWIDFAYTSNNRSE-LCDPKPSLLDYLKDED  127

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES-  518
             ICGRPLGL F  +TGDLYIAD   G++KVGP+GGLAT +    +G+   FTN + +D+  
Sbjct  128   ICGRPLGLRFDKKTGDLYIADAYLGIMKVGPEGGLATSVTNEADGVPLRFTNDLDIDDQG  187

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF DS   F    F  +  SG+ SGR+LKY  +T   T ++R L  P GL++ KD +F
Sbjct  188   NVYFTDSSSFFQRRKFMLLIVSGEDSGRVLKYNPKTKETTTLVRNLQFPNGLSLGKDGSF  247

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
              +  E    ++ KY +KG KA T++ +  L G PDN++    G +WVAV+  +      +
Sbjct  248   FIFCEGSIGRLRKYWLKGEKAGTSEVVALLHGFPDNIRTNKDGDFWVAVHCHRNIFTHVM  307

Query  879   ------------IPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                         +P++              ++AVK+   GK+L   ++       + S  
Sbjct  308   AHHPRVRKFFLKLPISVKFQYLLQVGGWPHAVAVKYSEEGKVLKVLEDSKGKVVKAVSEV  367

Query  981   LEHFGKAYTGSLVPNFLGVYTL  1046
              E  GK + GS++ +F+ VY L
Sbjct  368   EEKDGKLWMGSVLMSFIAVYDL  389



>gb|AFK33536.1| unknown [Medicago truncatula]
Length=310

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 122/294 (41%), Positives = 163/294 (55%), Gaps = 23/294 (8%)
 Frame = +3

Query  66   LTMFWISILIFISSPCVIHSQppgillpiklklHAIGPEDVAFNGKGEGPYTGVADGRIL  245
            LT+F   I    S   V  S        +     AIGPE + F+  G GPYTGVADGRIL
Sbjct  13   LTLF--CIFTLFSPVLVAGSMHNLHSARLLHVTRAIGPESLVFDSHGGGPYTGVADGRIL  70

Query  246  KYYNGK--FIDFATTSPLRTKVICDGTNNTILQLICGRPLGLEFHPRTGDLYIADVNFGL  419
            K+   K  + +FA TS  R++  C       L+ ICGRPLGL F  + GDLYIAD   GL
Sbjct  71   KWKGKKRGWTEFAVTSSNRSQ--CVRPFAPKLEHICGRPLGLRFDKKNGDLYIADAYLGL  128

Query  420  LKVGPKGGLATQLAAGVNGIKFSFTNAVALDES--TVYFVDSGLIFLTGNFTKIAQSGDT  593
              VG  GGLATQ+A    G  F FTN + +DE+   +YF DS  ++    +T +  SGD 
Sbjct  129  KVVGAAGGLATQVATEAEGHPFHFTNDLDIDENEGVIYFTDSSTVYERTQYTLLLVSGDK  188

Query  594  SGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFLLISEFIAKKITKYIIKGPKANTTQ  773
            +GRL+KY+  T  V V+LRGL+ P G+A+SKD +FLL++E    +I +  + GPKA    
Sbjct  189  TGRLMKYDKSTKEVKVLLRGLAFPNGVALSKDGSFLLVAETSNCRILRLWLHGPKAGKVS  248

Query  774  TLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqLIPMTESIAVKFDRNGKILD  935
            T + L G PDN++R + G +WVA+                S AVK    G+IL+
Sbjct  249  TFVDLPGFPDNIRRNSYGQFWVALY---------------SSAVKLSDEGEILE  287



>ref|XP_011088992.1| PREDICTED: protein STRICTOSIDINE SYNTHASE-LIKE 11 [Sesamum indicum]
Length=391

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 127/325 (39%), Positives = 174/325 (54%), Gaps = 38/325 (12%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE +AF+  G GPYTGVADGRI+ +   K+ DFA TS  R+  +CD   + +  L    
Sbjct  70    GPESMAFDPAGRGPYTGVADGRIIFWNGEKWTDFAYTSANRSG-LCDPQPSPMSYLKNEH  128

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-ES  518
             ICGRPLGL F  RTG+LYIAD  FGL+KVGP+GGLAT L     G+   FTN + +D E 
Sbjct  129   ICGRPLGLRFDKRTGELYIADAYFGLMKVGPEGGLATSLTTEAEGVPLGFTNDLDIDNEG  188

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF DS   +   NF ++  SG+ SGR+LKY   T   TV+ R L  P GL++SKD +F
Sbjct  189   NVYFTDSSTKYKRRNFLQLIFSGEDSGRVLKYNPNTKETTVLFRNLQFPNGLSLSKDGSF  248

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
              +  E    ++ KY +KG KA T++ +  L G PDNV+    G +WVA++  +      L
Sbjct  249   FVFCEGSIGRLRKYWLKGEKAGTSEIMAVLPGFPDNVRTNEKGEFWVAIHCRRTVYAYIL  308

Query  879   --------------IPM-----------TESIAVKFDRNGKIL----DRKNVTSAYPNSF  971
                           IP              ++ +K+   GK+L    DR+        + 
Sbjct  309   ALYPKVRKLWLKLPIPAKIHYLMQIGGRVHAVVLKYSPEGKLLQILEDRQGKVV---KAV  365

Query  972   SAYLEHFGKAYTGSLVPNFLGVYTL  1046
             S   E  GK + GS++  F+ VY L
Sbjct  366   SEVEEKDGKLWMGSVLMPFVAVYQL  390



>ref|XP_010504621.1| PREDICTED: strictosidine synthase 1-like [Camelina sativa]
Length=339

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 124/298 (42%), Positives = 167/298 (56%), Gaps = 14/298 (5%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKYYNGK---FIDFATTSPLRTKVICDGTNNTILQ  338
             A GPE +AFN  GEGPY GVADGR+LK+  GK   + DFA TS  R   +C       L+
Sbjct  51    ASGPESIAFNPAGEGPYVGVADGRVLKW-RGKSLGWTDFAYTSANRQ--MCVHPFAPELE  107

Query  339   LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDE-  515
              +CGRPLGL FH +TGDLYIAD  FGLL VGP GGLA  L     G  F FTN + +DE 
Sbjct  108   HVCGRPLGLRFHKKTGDLYIADAYFGLLIVGPAGGLAKPLVTEAEGQPFRFTNDLDIDEH  167

Query  516   -STVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
                +YF D+   F    +     + D +GR +KY++ + + TV+LR +S   G+A+SKD+
Sbjct  168   DDVIYFTDASSKFQRWEYFSSFLNVDKTGRFIKYDISSKKATVLLRDISFANGVALSKDR  227

Query  693   TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpq  872
             +F+L+ E    K+ +  + GPKA        L G PDN++R  +G +WVA+N L   +  
Sbjct  228   SFVLVDETTNCKVLRLWLSGPKAGIQDVFAVLPGYPDNIRRNLNGEFWVALNSLLYERR-  286

Query  873   qLIPMTESIAVKFDRNGKILDRKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGVYTL  1046
                P T+  AVK   +G++L             S   E  GK + GS V  F+GVY L
Sbjct  287   ---PYTK--AVKLSASGEVLMVLEDKGKRLRYISDVEEKDGKLWIGSSVMPFVGVYDL  339



>ref|XP_008230556.1| PREDICTED: strictosidine synthase 3 [Prunus mume]
Length=391

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 127/323 (39%), Positives = 173/323 (54%), Gaps = 34/323 (11%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK-FIDFATTSPLRTKVICDGTNNTILQL---  341
             GPE VAF+  G GPY GVADGR+L ++NG+ + DFA TSP R+  IC    + +  L   
Sbjct  70    GPESVAFDPLGRGPYAGVADGRVL-FWNGQSWTDFAYTSPHRSD-ICSPKPSPLSYLKNE  127

Query  342   -ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
              ICGRPLGL F  +TGDLYIAD  FGLLKVGP+GGLAT L     G+   FTN + +DE 
Sbjct  128   HICGRPLGLRFDKKTGDLYIADAYFGLLKVGPEGGLATALTTEAEGVPLRFTNDLDIDEE  187

Query  519   -TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               VYF DS   +   NF ++  S + +GR+LKY   T   TV+ + L  P GL++SKD +
Sbjct  188   GNVYFTDSSTTYQRRNFMQLVFSAEDTGRVLKYNPTTKETTVLEKNLQFPNGLSLSKDGS  247

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpq-  872
             F +  E    ++ KY +KG KA T++    L G PDNV+   +G +WVAV+  +      
Sbjct  248   FFVFCEGAIGRLRKYWLKGEKAGTSEVFAVLPGFPDNVRTNENGDFWVAVHCRRNMYTHL  307

Query  873   -qLIPM-----------------------TESIAVKFDRNGKILD-RKNVTSAYPNSFSA  977
               L P                          ++ VK+   GKIL   ++       + S 
Sbjct  308   CALFPQIRKFLLKLPISAKIQFLIHIGGRPHAVVVKYSPEGKILQILEDSQGKVVKAVSE  367

Query  978   YLEHFGKAYTGSLVPNFLGVYTL  1046
               E  GK + GS++  F+ VY L
Sbjct  368   VEEKDGKLWMGSVLMPFIAVYNL  390



>ref|XP_010246302.1| PREDICTED: strictosidine synthase 3-like [Nelumbo nucifera]
Length=360

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/260 (40%), Positives = 161/260 (62%), Gaps = 6/260 (2%)
 Frame = +3

Query  174  GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQLICGR  353
            GPE +AF+ +GEGPY G++DGRI+K+    + ++  TS  R   ICDG+N+  L+ ICGR
Sbjct  19   GPESLAFDCRGEGPYVGISDGRIIKWNGFVWTNYVITSRFRRNYICDGSNDPRLENICGR  78

Query  354  PLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--VY  527
            PLGL+F+ +T DLY+AD  +GL+ VGP+  +  QLA    GI F FTN + +D+    VY
Sbjct  79   PLGLQFNMKTCDLYVADAYYGLIVVGPEQKIPMQLATSAEGIPFYFTNGLDIDQRMGIVY  138

Query  528  FVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFLLI  707
            F DS   +   ++     SGD +GRL++Y+     VTV+L GL+   G+AIS D +F+L+
Sbjct  139  FTDSSTKYQRRDYAGSILSGDKTGRLMRYDPRNREVTVLLTGLAFANGVAISDDGSFVLV  198

Query  708  SEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNIL----Kppqpqq  875
            +E    +I ++ ++G +A T+   ++L GQPDN+K    G +WVAVN      +      
Sbjct  199  TETGTGRILRFWLQGGRAMTSDLFIQLPGQPDNIKTNARGEFWVAVNPFEGGPRFMPNTS  258

Query  876  LIPMTESIAVKFDRNGKILD  935
             + +T S A++ ++ G +L+
Sbjct  259  SMSITNSQAMRINKYGIVLE  278



>ref|XP_002532597.1| strictosidine synthase, putative [Ricinus communis]
 gb|EEF29794.1| strictosidine synthase, putative [Ricinus communis]
Length=375

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 125/323 (39%), Positives = 180/323 (56%), Gaps = 35/323 (11%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKY--YNGKFIDFATTSPLRTKVICDGTNNTILQL  341
             A GPE  AF+G G GPYTG++DGRI+++  +  ++IDFA TS  R    C+G +    Q+
Sbjct  53    ATGPESFAFDGLGRGPYTGISDGRIIRWEEHEQRWIDFAVTSLYRDG--CEGPHVDQYQM  110

Query  342   --ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAA-GVNGIKFSFTNAVALD  512
               ICGRPLGL F+   GDLY+AD   GLLKVG  GGLAT +A  G + I F+FTN++ +D
Sbjct  111   EHICGRPLGLCFNESNGDLYVADAYMGLLKVGRDGGLATTIATHGDDDIPFNFTNSLDVD  170

Query  513   EST--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISK  686
              S+  +YF DS   +    +     SGD SGRLL+Y+ E  +V ++L  LS P G+A+SK
Sbjct  171   PSSSALYFTDSSSRYQRREYIYAILSGDKSGRLLRYDPEDKKVRILLGNLSFPNGVALSK  230

Query  687   DKTFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppq  866
             D  F+LI+E    ++ KY IK  KA   +   ++ G PDN+KR+  GGYWVA+N  +   
Sbjct  231   DGNFILIAETTTCRVLKYWIKTSKAGILEVFAQVPGFPDNIKRSPRGGYWVAINSRRDKF  290

Query  867   pqqLIPMT-------------------------ESIAVKFDRNGKILDRKNVTSAYPNSF  971
              + ++                              +AV+ D NG IL+     + +  + 
Sbjct  291   LEWVLSHPWIGNSLIKLPFDLMKIYSILGKYRGTGMAVRLDENGDILEVFEDRNRF-KTL  349

Query  972   SAYLEHFGKAYTGSLVPNFLGVY  1040
             S  +E  GK + GS+   F+G Y
Sbjct  350   SEVMEKDGKLWIGSINLPFVGRY  372



>ref|XP_010428359.1| PREDICTED: strictosidine synthase 3-like isoform X1 [Camelina 
sativa]
 ref|XP_010428360.1| PREDICTED: strictosidine synthase 3-like isoform X2 [Camelina 
sativa]
Length=338

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 121/292 (41%), Positives = 164/292 (56%), Gaps = 10/292 (3%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQLIC  347
             GPE  AF+ +G GPYTGV+ G+ILKY      F +FA   P+  K +C+    T L  IC
Sbjct  50    GPEAFAFDPQGGGPYTGVSGGKILKYQGPTLGFTEFAYILPIANKSLCEKAIGTFLGNIC  109

Query  348   GRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--  521
             GRP+GL F+ +TGDLYIAD   GL  V  +GGLA +LA    G+ F F + + +D  T  
Sbjct  110   GRPVGLAFNEKTGDLYIADAYLGLYVVSYRGGLAKRLADSAAGVPFRFLDGLDVDPVTGM  169

Query  522   VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFL  701
             VYF      F            DTSGRL +Y+ +T  VTV+L GLSG AG A+S D  F+
Sbjct  170   VYFTSFSTRFGPSQLVLAVAVKDTSGRLFRYDPKTKTVTVLLSGLSGSAGCAVSSDGGFV  229

Query  702   LISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqLI  881
             L+ EF+  +I +Y IKGPKANT +  +     PDN++R  SG +WVA N +K      ++
Sbjct  230   LVGEFLRNRILRYWIKGPKANTFEIFVPSIPGPDNIRRTESGDFWVASNSVK-----LIV  284

Query  882   PMTESIAVKFDRNGKILDRKNVTSAYPNSF-SAYLEHFGKAYTGSLVPNFLG  1034
               TE  AVK   +G+IL    +   Y ++  S   E+    Y G+L   F+G
Sbjct  285   VPTEPSAVKISSDGEILQHMPLGEYYGDTLVSEVNEYKNVVYLGTLTTTFVG  336



>ref|XP_009623916.1| PREDICTED: strictosidine synthase 3-like [Nicotiana tomentosiformis]
Length=391

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 125/326 (38%), Positives = 178/326 (55%), Gaps = 38/326 (12%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE +AF+ +G GPYTG+ADGR++ +   K+ DFA TS  R+  +CD   + +  L    
Sbjct  70    GPESIAFDPQGRGPYTGIADGRVVFWDGEKWNDFAYTSANRSG-LCDPKPSPMSYLKNEH  128

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-ES  518
             ICGRPLGL F  RTGDLYIAD  FGL+KVGP+GGLA  L     G++  FTN + +D E 
Sbjct  129   ICGRPLGLRFDKRTGDLYIADAYFGLMKVGPEGGLAESLTTEAEGVRLGFTNDLDVDDEG  188

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF DS   +   NF ++  S + SGR+LKY   T   TV++  L  P GL++SKD +F
Sbjct  189   NVYFTDSSTTYQRRNFMQLVFSAEDSGRVLKYNPRTKETTVLIHNLQFPNGLSLSKDGSF  248

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVN----------  848
              +  E    ++ KY +KG KA TT+ +  L G PDNV+      +WVA++          
Sbjct  249   FIFCEGSKGRLRKYWLKGEKAATTEVIAILPGYPDNVRANERNEFWVAIHCRRTIYSYLN  308

Query  849   ---------ILKppqpqqLIPMT------ESIAVKFDRNGKIL----DRKNVTSAYPNSF  971
                      +LK P   +L  +        ++ VK+   GK+L    DR+        + 
Sbjct  309   AIYPPLRQFLLKLPVSAKLQYLMHIGGRLHAVVVKYSPEGKLLQILEDRQGKVV---KAV  365

Query  972   SAYLEHFGKAYTGSLVPNFLGVYTLK  1049
             S   E  GK + GS++ +F+ VY L+
Sbjct  366   SEVEEREGKLWMGSVLMSFISVYQLE  391



>ref|XP_010544326.1| PREDICTED: strictosidine synthase 3 [Tarenaya hassleriana]
Length=394

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 119/322 (37%), Positives = 177/322 (55%), Gaps = 32/322 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE +AF+  G GPYTGVADGR+  +   ++ DFA TS  R++ +CD   +    L    
Sbjct  72    GPESIAFDPLGRGPYTGVADGRVRFWDGSRWTDFAYTSSNRSE-LCDPKPSPFAYLKNEH  130

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-ES  518
             ICGRPLGL F  +TGDLYIAD  FGL+KVGP+GG+AT L    +G+   FTN + +D E 
Sbjct  131   ICGRPLGLRFDKKTGDLYIADAYFGLMKVGPEGGVATSLTTEADGVPLRFTNDLDIDDEG  190

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF DS   +   NF ++  +G+ SGR+LKY  +T   T ++R L  P G+ +SKD +F
Sbjct  191   NVYFSDSSSFYQRRNFMQLILAGENSGRILKYNPKTKETTTLVRNLQFPNGVTLSKDGSF  250

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
              +  E    ++ KY +KG KA T++ +  L G PDN++    G +WVA++  +      +
Sbjct  251   FIFCEGSIGRLRKYWLKGEKAGTSEVVAILHGFPDNIRTNKDGDFWVAIHCHRNILTHVM  310

Query  879   ------------IPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                         +P+T              ++ VK+D +GK+L   ++       + S  
Sbjct  311   GLYPRLRKFFLKLPITLKFQYLLQVGGRPHAMVVKYDGDGKVLKVLEDKQGKVVKAVSEV  370

Query  981   LEHFGKAYTGSLVPNFLGVYTL  1046
              E  GK + GS++  F+ VY L
Sbjct  371   EEKDGKLWMGSVLMPFISVYDL  392



>ref|XP_010056146.1| PREDICTED: strictosidine synthase 1 [Eucalyptus grandis]
 ref|XP_010056153.1| PREDICTED: strictosidine synthase 1 [Eucalyptus grandis]
Length=374

 Score =   203 bits (517),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/233 (45%), Positives = 149/233 (64%), Gaps = 9/233 (4%)
 Frame = +3

Query  168  AIGPEDVAFNGKGEGPYTGVADGRILKYY--NGKFIDFATTSPLRTKVICDGT-NNTILQ  338
            A+GPE  AF+ +G+GPYTGV+DGRI+K+     +++DFA TSP R   IC+   NN  ++
Sbjct  48   AVGPESFAFDPRGDGPYTGVSDGRIVKWAASERRWVDFAFTSPSRD--ICEKPHNNQEME  105

Query  339  LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD--  512
             +CGRPLGL F+PRT  LYIAD   GLL VGP GG AT +AA  +G+ F FTN++ +D  
Sbjct  106  NVCGRPLGLGFNPRTSRLYIADAYMGLLAVGPGGGRATVVAAQADGVPFRFTNSLDIDPL  165

Query  513  ESTVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
               VYF DS   +   N+  +  SGD +GRL+KY+ E+ RVT +L  LS P G+ + +  
Sbjct  166  SGAVYFTDSSSQYQRRNYIPLILSGDRTGRLMKYDPESDRVTTILSNLSFPNGVVLGESG  225

Query  693  TFLLISEFIAKKITKYIIKGPK--ANTTQTLLKLEGQPDNVKRATSGGYWVAV  845
             FLL++E    +I KY ++ P   A   +   +L G PDN++R+  GGYWV +
Sbjct  226  DFLLVAETSTCRILKYWLRPPPEAAGEVEVFAQLPGFPDNIRRSPRGGYWVGI  278



>ref|XP_007205319.1| hypothetical protein PRUPE_ppa006884mg [Prunus persica]
 gb|EMJ06518.1| hypothetical protein PRUPE_ppa006884mg [Prunus persica]
Length=391

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 127/323 (39%), Positives = 173/323 (54%), Gaps = 34/323 (11%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK-FIDFATTSPLRTKVICDGTNNTILQL---  341
             GPE VAF+  G GPY GVADGR+L ++NG+ + DFA TSP R+  IC    + +  L   
Sbjct  70    GPESVAFDPLGRGPYAGVADGRVL-FWNGQSWTDFAYTSPHRSD-ICSPKPSPLSYLKNE  127

Query  342   -ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
              ICGRPLGL F  +TGDLYIAD  FGLLKVGP+GGLAT L     G+   FTN + +DE 
Sbjct  128   HICGRPLGLRFDKKTGDLYIADAYFGLLKVGPEGGLATPLTTEAEGVPLRFTNDLDIDEE  187

Query  519   -TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               VYF DS   +   NF ++  S + +GR+LKY   T   TV+ + L  P GL++SKD +
Sbjct  188   GNVYFTDSSTTYQRRNFMQLVFSAEDTGRVLKYNPTTKETTVLEKNLQFPNGLSLSKDGS  247

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpq-  872
             F +  E    ++ KY +KG KA T++    L G PDNV+   +G +WVAV+  +      
Sbjct  248   FFVFCEGSIGRLRKYWLKGEKAGTSEVFAVLPGFPDNVRTNENGDFWVAVHCRRNMYTHL  307

Query  873   -qLIPM-----------------------TESIAVKFDRNGKILD-RKNVTSAYPNSFSA  977
               L P                          ++ VK+   GKIL   ++       + S 
Sbjct  308   CALFPQIRKFLLKLPISAKIQFLIHIGGRPHAVVVKYSPEGKILQILEDSQGKVVKAVSE  367

Query  978   YLEHFGKAYTGSLVPNFLGVYTL  1046
               E  GK + GS++  F+ VY L
Sbjct  368   VEEKDGKLWMGSVLMPFIAVYNL  390



>ref|XP_006305032.1| hypothetical protein CARUB_v10009397mg [Capsella rubella]
 gb|EOA37930.1| hypothetical protein CARUB_v10009397mg [Capsella rubella]
Length=390

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 120/322 (37%), Positives = 176/322 (55%), Gaps = 32/322 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE +AF+ +G GPYTGVADGRIL +   ++ DFA TS  R++ +CD   + +  L    
Sbjct  69    GPESIAFDPQGRGPYTGVADGRILFWNGTRWTDFAYTSNNRSE-LCDPKPSLLDYLKDEH  127

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES-  518
             ICGRPLGL F   TGDLYIAD   G++KVGP+GGLAT L    +G+   FTN + +D+  
Sbjct  128   ICGRPLGLRFDKNTGDLYIADAYLGIMKVGPQGGLATSLTTEADGLPLRFTNDLDIDDQG  187

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF DS   F    F  +  SG+ SGR+LKY  +T   T ++R L  P GL++ KD +F
Sbjct  188   NVYFTDSSSFFQRRKFLLLIVSGEDSGRVLKYNAKTKETTTLVRNLQFPNGLSLGKDGSF  247

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
              +  E    ++ KY +KG KA T++ +  L G PDN++    G +WVAV+  +      +
Sbjct  248   FIFCEGSIGRLQKYWLKGEKAGTSEVVALLHGFPDNIRTNKDGDFWVAVHCHRNIFTHVM  307

Query  879   ------------IPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                         +P++              ++AVK+   GK+L   ++       + S  
Sbjct  308   AHHPRVRKFFLKLPISVKFQYLLQVGGWPHAVAVKYSEEGKVLKVLEDSQGKVVKAVSEV  367

Query  981   LEHFGKAYTGSLVPNFLGVYTL  1046
              E  GK + GS++ +F+ VY L
Sbjct  368   EEKDGKLWMGSVLMSFIAVYDL  389



>ref|XP_010471490.1| PREDICTED: strictosidine synthase 1-like [Camelina sativa]
Length=328

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 121/292 (41%), Positives = 163/292 (56%), Gaps = 10/292 (3%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQLIC  347
             GPE  AF+ +G GPYTGV+ G+ILKY      F +FA   P+  K +C+    T L  IC
Sbjct  40    GPEAFAFDPQGGGPYTGVSGGKILKYQGPALGFTEFAYILPVANKSLCEKAVGTFLGNIC  99

Query  348   GRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--  521
             GRP+GL F+ +TGDLYIAD   GL  V  +GGLA +LA    GI F F + + +D  T  
Sbjct  100   GRPVGLAFNEKTGDLYIADAYLGLYVVSYRGGLAKRLADSAAGIPFRFLDGLDVDPVTGM  159

Query  522   VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFL  701
             VYF      F            DTSGRL +Y+ +T  VTV+L GLSG AG A+S D  F+
Sbjct  160   VYFTSFSTRFGPSQLVLAVAVKDTSGRLFRYDPKTKTVTVLLSGLSGSAGCAVSSDGGFV  219

Query  702   LISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqLI  881
             L+ EF+  +I +Y IKGPKANT +  +     PDN++R   G +WVA N +K      ++
Sbjct  220   LVGEFLRNRILRYWIKGPKANTFEIFVPSIPGPDNIRRTEGGDFWVASNSVK-----LIV  274

Query  882   PMTESIAVKFDRNGKILDRKNVTSAYPNSF-SAYLEHFGKAYTGSLVPNFLG  1034
               TE  AVK   +G+IL    +   Y ++  S   E+    Y G+L   F+G
Sbjct  275   VPTEPSAVKISSDGEILQHMPLGEYYGDTLVSEVHEYKNVVYLGTLTTTFVG  326



>ref|XP_006424057.1| hypothetical protein CICLE_v10028617mg [Citrus clementina]
 gb|ESR37297.1| hypothetical protein CICLE_v10028617mg [Citrus clementina]
Length=391

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 125/322 (39%), Positives = 176/322 (55%), Gaps = 32/322 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE +AF+  G GPYTGVADGRIL +   K+ DFA TS  R++ +C+     +  L    
Sbjct  70    GPESMAFDPLGRGPYTGVADGRILFWDGLKWTDFAFTSNNRSE-LCNPKPIAMSYLKNEH  128

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-ES  518
             ICGRPLGL F  +TGDLYIAD  FGL+KVGP+GGLAT LA    G+   FTN + +D E 
Sbjct  129   ICGRPLGLRFDKKTGDLYIADAYFGLMKVGPEGGLATSLATEAEGVPLRFTNDLDIDDEG  188

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF DS   +   NF ++  S + +GR+LKY+  T + TV+LR L  P GL++SKDK+F
Sbjct  189   NVYFTDSSTNYQRRNFMQLVFSAEDTGRVLKYDPTTKQTTVLLRNLQFPNGLSLSKDKSF  248

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
              +  E    ++ KY + G KA   +    L G PDNV+    G +WVA++  +      +
Sbjct  249   FVFCEGSVGRLHKYWLIGEKAGNLEAFAILPGYPDNVRTNEKGEFWVAIHCRRSLYSHLM  308

Query  879   ------------IPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                         +P++              ++AVK+   GKIL   ++       + S  
Sbjct  309   ALYPKIRHFVLKLPISAKTHYLIHIGGRLHAMAVKYSPEGKILQVLEDSKGKVVKAISEV  368

Query  981   LEHFGKAYTGSLVPNFLGVYTL  1046
              E  GK + GS++  F+ VY L
Sbjct  369   EEKDGKLWMGSVLMPFVAVYDL  390



>ref|XP_004493426.1| PREDICTED: strictosidine synthase 1-like [Cicer arietinum]
Length=369

 Score =   203 bits (516),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 123/321 (38%), Positives = 174/321 (54%), Gaps = 30/321 (9%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQL  341
             A+GPE +AF+G G+GPYTGVADGRILK+   +  +  FA T+  R+   C       L+ 
Sbjct  51    AVGPESLAFDGNGQGPYTGVADGRILKWEGEERGWTQFALTTSNRSD--CVRPIALELEH  108

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNA--VALDE  515
             +CGRPLGL+F  + GDLYIAD  FGL  VGP+GGLATQ+     G  F FTN   ++ DE
Sbjct  109   VCGRPLGLKFDKKNGDLYIADAYFGLNVVGPEGGLATQVVTEAEGQPFRFTNDMDISEDE  168

Query  516   STVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               +YF DS  +F    F     SGD +GRL+KY+  T  V V+LRGL+   G+A+SKD +
Sbjct  169   DVIYFTDSSTVFQRRQFMLALLSGDKTGRLMKYDKSTKEVKVLLRGLAFANGVALSKDGS  228

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVN---------  848
             F+L++E    +I +  ++GP +    T   L G PDN++R + G +WVA++         
Sbjct  229   FILVAETSTFRILRLWLRGPNSGQVDTFAVLPGFPDNIRRNSEGQFWVALHAKETPFAKL  288

Query  849   ----------ILK----ppqpqqLIPMTESIAVKFDRNGKILDRKNVTSAYPNSF-SAYL  983
                       +LK          L     + A+K    G+IL+           F S   
Sbjct  289   IASNPWAGKALLKLGNFKQLHASLAKKPHAAAIKLSNEGEILEVLEDCEGNTLKFISEVE  348

Query  984   EHFGKAYTGSLVPNFLGVYTL  1046
             E  GK +  S++  F+GVY+L
Sbjct  349   EKDGKLWIASVLMPFIGVYSL  369



>ref|XP_011027270.1| PREDICTED: strictosidine synthase 3-like isoform X1 [Populus 
euphratica]
Length=389

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 124/324 (38%), Positives = 177/324 (55%), Gaps = 33/324 (10%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDG-TNNTILQ  338
             A GPE  AF+  G+GPYT ++DGRI+K+   +  + DFA  SP R    C G  ++   +
Sbjct  68    AFGPESFAFDSLGQGPYTSLSDGRIIKWQGNRKGWTDFAVASPNRDG--CGGPQDHQQTE  125

Query  339   LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
              ICGRPLGL F    GDLYIAD   GLL+VG +GGLAT++     GI  SFTN + +D+S
Sbjct  126   HICGRPLGLCFDETHGDLYIADAYMGLLRVGAQGGLATKIVTHAQGIPLSFTNGLDIDQS  185

Query  519   T--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
                +YF DS   +   ++  +  SGD SGRL+KY+    +V+V+L  L+ P G+A+SKD 
Sbjct  186   NGAIYFTDSSSQYQRRHYLSVVLSGDKSGRLMKYDPVNKQVSVLLSNLTFPNGVALSKDG  245

Query  693   TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpq  872
             TF+L++E    +I +Y IK  KA T +   +L+G PDN+KR+  GGYWV +N  +    +
Sbjct  246   TFILLAETTRCRILRYWIKTSKAGTVEVFAQLQGFPDNIKRSPRGGYWVGLNSRREKLSE  305

Query  873   qL----------------IPMTES---------IAVKFDRNGKILDR-KNVTSAYPNSFS  974
              L                I M ES         +AV+   NG IL+  ++       S S
Sbjct  306   LLFSYPWIGNVLLKLPLDISMLESTLSKYRGSGLAVRLSENGDILEVFEDEDGNRLQSVS  365

Query  975   AYLEHFGKAYTGSLVPNFLGVYTL  1046
               +E     + GS+   F G Y +
Sbjct  366   EVMEKDEILWIGSIALPFAGRYRI  389



>ref|XP_010458085.1| PREDICTED: strictosidine synthase 3-like [Camelina sativa]
Length=393

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 119/322 (37%), Positives = 174/322 (54%), Gaps = 31/322 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE +AF+  G GPYTGVADGRIL +   ++ DFA TS  R+K +CD   + +  L    
Sbjct  71    GPESIAFDPLGRGPYTGVADGRILFWNGSRWTDFAFTSINRSKELCDPKPSLLDYLKDEH  130

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES-  518
             ICGRPLGL F  +TGDLYIAD   G++KVGP+GG AT L    +G+   FTN + +DE  
Sbjct  131   ICGRPLGLRFDKKTGDLYIADAYLGIMKVGPEGGFATSLTTEADGVPLRFTNDLDIDEEG  190

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF DS  +F    F  +  SG+ +GR+LKY  +T   T ++R L  P GL++ KD +F
Sbjct  191   NVYFTDSSSVFQRRKFMLLIVSGEDTGRVLKYNPKTKETTTLVRNLQFPNGLSLGKDGSF  250

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
              +  E    ++ KY +KG KA T++ +  L G PDN++    G +WVAV+  +      +
Sbjct  251   FICCEGSIGRLRKYWLKGEKAGTSEVVALLHGFPDNIRTNKDGDFWVAVHGHRNIFTHVM  310

Query  879   ------------IPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                         +P++               + VK+   GK+L   ++       + S  
Sbjct  311   AHYPRVRKFFLKLPISVKFQYLLQVGGWPHGVVVKYSEEGKVLKVLEDSQGKVVKAVSEV  370

Query  981   LEHFGKAYTGSLVPNFLGVYTL  1046
              E  GK + GS++ +F+ VY L
Sbjct  371   EEKDGKLWMGSVLMSFIAVYDL  392



>ref|XP_009783664.1| PREDICTED: strictosidine synthase 3-like [Nicotiana sylvestris]
Length=385

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 102/232 (44%), Positives = 152/232 (66%), Gaps = 7/232 (3%)
 Frame = +3

Query  168  AIGPEDVAFNGKGEGPYTGVADGRILKYY--NGKFIDFATTSPLRTKVICDG-TNNTILQ  338
            A+GPE  AF+  G+GPY GV+DGRI+K+     +++DFA TSP R    C+G  ++T  +
Sbjct  60   AVGPESFAFDRHGDGPYAGVSDGRIIKWLRNESRWLDFAVTSPERNG--CEGFHDHTDTE  117

Query  339  LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
              CGRPLG++F   +GDLY+AD   GLL VGP GGLAT++A    G+ F FTN++ +D++
Sbjct  118  HRCGRPLGMDFDENSGDLYVADAYLGLLVVGPNGGLATKVAKMAEGVPFGFTNSLCIDQT  177

Query  519  --TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
               +YF DS   F   ++  +  SGD +GRL+KY+M++  V+V+L+ L  P G+A+SK  
Sbjct  178  HGVLYFTDSSTTFSRRSYISVIVSGDNTGRLMKYDMQSKLVSVLLKNLKFPNGVAMSKHG  237

Query  693  TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVN  848
             FLL +E    KI K+ +K  +A + + + +L G PDN+KR  +G +WV VN
Sbjct  238  DFLLFAETTTCKIFKFWLKTSQAGSVEVVSELPGFPDNIKRNKNGEFWVGVN  289



>gb|KHF98782.1| Adipocyte plasma membrane-associated [Gossypium arboreum]
Length=402

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 121/327 (37%), Positives = 182/327 (56%), Gaps = 37/327 (11%)
 Frame = +3

Query  171   IGPEDVAFNGKGEGPYTGVADGRILKYY--NGKFIDFATTSPLRTKVICDGTNN-TILQL  341
             +GPE VAF+  G+GPY G++DGRI+K+     ++I F  TSP R    C+G ++    + 
Sbjct  78    VGPESVAFHPLGDGPYVGISDGRIIKWQPNEHRWISFGITSPNREG--CEGKHDHETREH  135

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLA--AGVNGIKFSFTNAVALDE  515
             ICGRPLG+ FH  TGDLYIAD   GLLK+GP GGLAT +   A    I F+FTN++ +++
Sbjct  136   ICGRPLGICFHETTGDLYIADAYMGLLKLGPAGGLATPIPTHAQPQPIPFTFTNSLDINQ  195

Query  516   S--TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKD  689
             S  ++YF  +  ++   N   +  SGD +G LLKYE E+ ++TV+L  LS P G+A+SKD
Sbjct  196   SDGSIYFTHTSSLYHRRNHIAVVLSGDKTGMLLKYEQESKQITVLLTNLSFPNGVALSKD  255

Query  690   KTFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqp  869
              +FL+ +E    +I +Y +  PKA   +TL +L G PDN+KR+  GG+WVA++  +    
Sbjct  256   GSFLVFAETTKCRILRYWLSTPKAGNLETLAQLPGFPDNIKRSPRGGFWVAIHSRRCKVL  315

Query  870   qqLIPMTE---------------------------SIAVKFDRNGKILDRKNVTSAYP-N  965
               ++  ++                            +A++    G IL+   + S    +
Sbjct  316   SWILSYSKLGNALIWVLPVDVITKAYSVMSKYLGSGLAMRISEEGVILETLELESGNKMS  375

Query  966   SFSAYLEHFGKAYTGSLVPNFLGVYTL  1046
             S S   E     + GS+   FLGVY L
Sbjct  376   SISEVQEKDDHLWMGSINMPFLGVYRL  402



>ref|XP_006487831.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Citrus sinensis]
Length=391

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 124/322 (39%), Positives = 177/322 (55%), Gaps = 32/322 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICD----GTNNTILQL  341
             GPE +AF+  G GPYTGVADGRIL +   K+ DFA TS  R++ +C+     T+    + 
Sbjct  70    GPESMAFDPLGRGPYTGVADGRILFWDGLKWTDFAFTSNNRSE-LCNPKPIATSYLKNEH  128

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-ES  518
             ICGRPLGL F  +TGDLYIAD  FGL+KVGP+GG+AT LA    G+   FTN + +D E 
Sbjct  129   ICGRPLGLRFDKKTGDLYIADAYFGLMKVGPEGGVATSLATEAEGVPLRFTNDLDIDDEG  188

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF DS   +   NF ++  S + +GR+LKY+  T + TV+LR L  P GL++SKDK+F
Sbjct  189   NVYFTDSSTNYQRRNFMQLVFSAEDTGRVLKYDPTTKQTTVLLRNLQFPNGLSLSKDKSF  248

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
              +  E    ++ KY + G KA   +    L G PDNV+    G +WVA++  +      +
Sbjct  249   FVFCEGSVGRLHKYWLIGEKAGNLEAFAILPGYPDNVRTNEKGEFWVAIHCRRSLYSHLM  308

Query  879   ------------IPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                         +P++              ++AVK+   GKIL   ++       + S  
Sbjct  309   ALYPKIRHFLLKLPISAKTHYLIHVGGRLHAMAVKYSPEGKILQVLEDSKGKVVKAISEV  368

Query  981   LEHFGKAYTGSLVPNFLGVYTL  1046
              E  GK + GS++  F+ VY L
Sbjct  369   EEKDGKLWMGSVLMPFVAVYDL  390



>ref|XP_006361111.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Solanum tuberosum]
Length=391

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 124/323 (38%), Positives = 173/323 (54%), Gaps = 32/323 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE +AF+ KG GPYTG+ADGRI+ +   K+ DFA TS  R+  +CD   + +  L    
Sbjct  70    GPESIAFDPKGRGPYTGIADGRIVWWDGEKWTDFAYTSANRSG-LCDPKPSPLSYLENEH  128

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-ES  518
             ICGRPLGL F  RTGDLYIAD  FGL+KVGP+GGLA  L     G+   FTN + +D E 
Sbjct  129   ICGRPLGLRFDKRTGDLYIADAYFGLMKVGPEGGLAETLTTEAEGVPLRFTNDLDIDDEG  188

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF DS   +   N+  +  S + SGR+LKY   T + T ++R L  P GL++SKD +F
Sbjct  189   NVYFTDSSTKYQRRNYMLLVYSAEDSGRVLKYNPNTKQTTALVRNLQFPNGLSLSKDGSF  248

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNI---------  851
              +  E    ++ KY +KG KA T + +  L G PDNV     G +WVA++          
Sbjct  249   FVFCEGAKGRLQKYWLKGEKAGTLEVMAVLPGYPDNVSTNERGEFWVAIHCRRTIYSYIN  308

Query  852   -----LKppqpqqLIPM-----------TESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                  L+    +  IP+             +I VK+   GK+L   ++       + S  
Sbjct  309   SIYPQLRLFLLKLPIPVKLRALLHLGGKQPAIVVKYSPEGKLLQILEDEEGKVVRAVSEV  368

Query  981   LEHFGKAYTGSLVPNFLGVYTLK  1049
              E  GK + GS++  F+ VY L+
Sbjct  369   EEKDGKLWMGSVLMPFIAVYQLE  391



>ref|XP_010110078.1| Strictosidine synthase 1 [Morus notabilis]
 gb|EXC25145.1| Strictosidine synthase 1 [Morus notabilis]
Length=332

 Score =   202 bits (513),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 122/330 (37%), Positives = 182/330 (55%), Gaps = 11/330 (3%)
 Frame = +3

Query  72    MFWISILIFISSPCVIHSQppgillpiklklHAIGPEDVAFNGKGEGPYTGVADGRILKY  251
             M +I I +F S P ++ SQP        L   A+GP  +AF+  G GP+TG++DGRIL+Y
Sbjct  1     MLFIIIFLF-SIPSLVFSQPFSNFQRYDLPSTAVGPFSLAFDASGRGPFTGISDGRILRY  59

Query  252   --YNGKFIDFATTSPLRTKVICDGTNNTI---LQLICGRPLGLEFHPRTGDLYIADVNFG  416
                   F DFA TSP  +K +CDGT+N        ICGRPLG+ F+ RT  LY+ D   G
Sbjct  60    DPVQNSFFDFAFTSPTGSKAVCDGTDNNDNPDRGAICGRPLGISFYFRTNQLYVTDAYKG  119

Query  417   LLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--VYFVDSGLIFLTGNFTKIAQSGD  590
             L+ V P G LA  +A    G+ F F   + +D+ T  VYF D    F      +   + D
Sbjct  120   LVVVPPNGRLAENVATSAEGVPFKFPFHLDVDQVTGDVYFTDFSSQFQLSQLLQAIDARD  179

Query  591   TSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFLLISEFIAKKITKYIIKGPKANTT  770
              +GRLLKY   T   TV+LRGL+G AG+A+S D+T+LL++E  A ++ K  + GP A TT
Sbjct  180   ATGRLLKYNPNTRETTVLLRGLTGAAGVALSYDRTYLLVAEMNANRVKKLWLSGPNAFTT  239

Query  771   QTLLKLEGQPDNVKRATSGGYWVAVNI-LKppqpqqLIPMTESIAVKFDRNGKILDRKNV  947
               L+  +G+P+N+++ +   +WV VN  +        I +  ++ +     G IL   ++
Sbjct  240   VDLITFQGRPNNIEKNSLTDFWVVVNTRIPGTTAGSFIRIPSAVRIS-GIGGGILQTVDL  298

Query  948   TSAYPNSFSAYLEHFG-KAYTGSLVPNFLG  1034
             +  +PN   +  + +G   Y GSL  ++LG
Sbjct  299   SRYFPNMTISEFQPYGLGGYIGSLRTDYLG  328



>emb|CDY16615.1| BnaC09g36580D [Brassica napus]
Length=395

 Score =   203 bits (517),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 126/323 (39%), Positives = 177/323 (55%), Gaps = 34/323 (11%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK-FIDFATTSPLRTKVICDGTNNTIL----Q  338
             GPE VAF+  G GPYTGVADGR+L ++NG+ + DFA TS  RT+ ICD   + +     +
Sbjct  75    GPESVAFDPLGRGPYTGVADGRVL-FWNGENWTDFAYTSSNRTE-ICDPKPSALSYQRNE  132

Query  339   LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
              ICGRPLGL F  RTGDLYIAD   GLLKVGP+GGLAT L     G+   FTN + +D+ 
Sbjct  133   HICGRPLGLRFDKRTGDLYIADAYMGLLKVGPEGGLATPLVTEAEGVPLGFTNDLDIDDD  192

Query  519   -TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
              TVYF DS + +   NF ++  SGD +GR+LKY+    +  V++  +  P G++ISKD +
Sbjct  193   GTVYFTDSSINYQRRNFLQLVFSGDNTGRVLKYDPIAKKAVVLVSDVQFPNGVSISKDGS  252

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             F +  E     + +Y +KG KA T+     L G PDNV+    G +WVA++  +      
Sbjct  253   FFVFCEGDIGSLRRYWLKGEKAGTSDVFAMLPGHPDNVRTNKDGEFWVALHCRRNYYSYI  312

Query  876   L------------IPMTESI-------------AVKFDRNGKILD-RKNVTSAYPNSFSA  977
             +            +P+T  I              VK+   GK++   ++       S S 
Sbjct  313   MARNPKLRMFILRLPITARIHYMFQIGMKPHGLVVKYSPEGKLVKVLEDSEGKVVRSVSE  372

Query  978   YLEHFGKAYTGSLVPNFLGVYTL  1046
               E  GK + GS++ NF+ VY L
Sbjct  373   VEEKDGKLWLGSVLMNFVAVYDL  395



>ref|XP_009339573.1| PREDICTED: strictosidine synthase 3-like [Pyrus x bretschneideri]
Length=375

 Score =   203 bits (516),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 120/323 (37%), Positives = 177/323 (55%), Gaps = 32/323 (10%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKY--YNGKFIDFATTSPLRTKVICDGTNNTILQL  341
             A+GPE +AF+  G+GPYTGVADGR+LK+   N ++ DFA T+  R +  C       ++ 
Sbjct  55    ALGPESLAFDPTGDGPYTGVADGRVLKWDRNNRRWTDFAVTTSQRKE--CVRPFAPEMEH  112

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDE--  515
             +CGRPLGL+F  + GDLYIAD   GL  VGP GGLA+Q+   V G    FTN + +DE  
Sbjct  113   VCGRPLGLKFDKKNGDLYIADAYLGLQVVGPAGGLASQVVREVEGQPLLFTNDLDIDEHK  172

Query  516   STVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               +YF DS  IF    F     +GD +GRLLKY   +  VTV+LRGL+   G+A+SKD++
Sbjct  173   DVIYFTDSSTIFQRRQFMSSVFNGDRTGRLLKYNKSSKEVTVLLRGLAFANGVALSKDRS  232

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             F+L++E    +I +  + GP A  T    +L G PDN++R ++G +WVA++       + 
Sbjct  233   FVLVAESTTCRILRVWLDGPNAGNTDVFAELPGFPDNIRRNSNGEFWVALHAKSGFVSKF  292

Query  876   L------------IPM-------------TESIAVKFDRNGKILDRKNVTSAYPNSFSAY  980
             +            +P+               + AVK   NG++L            F + 
Sbjct  293   ITSNTWVGKSMLKLPLDFKRLHSLLVGGKAHATAVKLSENGEVLQVLEDCEGKTMKFISE  352

Query  981   LEHF-GKAYTGSLVPNFLGVYTL  1046
             LE   G+ + GS++  F+G+Y L
Sbjct  353   LEEKDGELWMGSVLMPFIGIYKL  375



>ref|XP_008382118.1| PREDICTED: strictosidine synthase 3 [Malus domestica]
Length=450

 Score =   205 bits (521),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 126/323 (39%), Positives = 176/323 (54%), Gaps = 34/323 (11%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK-FIDFATTSPLRTKVICDGTNNTILQL---  341
             GPE V F+  G GPYTGVADGR+L ++NG+ + DFA TSP R+  IC    + +  L   
Sbjct  129   GPESVTFDPLGRGPYTGVADGRVL-FWNGQAWTDFAYTSPHRSD-ICSPKPSPLSYLKNE  186

Query  342   -ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
              ICGRPLGL F  +TGDLYIAD   GLLKVGP+GGLAT L     G+   FTN + +DE 
Sbjct  187   HICGRPLGLRFDKKTGDLYIADAYLGLLKVGPEGGLATSLTTEAEGVPLRFTNDLDIDEE  246

Query  519   -TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               +YF DS  ++   NF ++  SG+ +GR+LKY   T   TV+ R +  P GL++SKD +
Sbjct  247   GNIYFTDSSTMYQRRNFMQLVFSGEDTGRVLKYNPTTKETTVLQRNIRFPNGLSLSKDGS  306

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNI--------  851
             F L  E    ++ KY +KG KA T++    L G PDNV+   +G +WVA++         
Sbjct  307   FFLFCEGAVGRLRKYWLKGEKAGTSEVFAVLPGFPDNVRTNENGEFWVALHCRRNLYTHI  366

Query  852   ------LKppqpqqLIP-----------MTESIAVKFDRNGKILD-RKNVTSAYPNSFSA  977
                   L+    +  +P              ++ VK+   GKIL   ++       + S 
Sbjct  367   CAAFPQLRKFLLKLPVPSRIQFLLHIGGRLHAVVVKYSPEGKILQILEDSEGKVVKAVSE  426

Query  978   YLEHFGKAYTGSLVPNFLGVYTL  1046
               E  GK + GS++  F+ VY L
Sbjct  427   VEEKDGKLWMGSVLMPFIAVYDL  449



>ref|XP_009412315.1| PREDICTED: strictosidine synthase 3-like [Musa acuminata subsp. 
malaccensis]
Length=389

 Score =   203 bits (516),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 122/320 (38%), Positives = 177/320 (55%), Gaps = 32/320 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE VAF+ +G GPYTGVADGR++ +    + DFA TSP R++ IC+   + +  L    
Sbjct  71    GPESVAFDPQGRGPYTGVADGRVVFWDGESWSDFAYTSPNRSE-ICNPKPSPLSYLKNEH  129

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES-  518
             ICGRPLGL F  +TG+LYIAD  FGLLKVGP+GGLAT +     GI   FTN + +DE  
Sbjct  130   ICGRPLGLRFDKKTGELYIADAYFGLLKVGPEGGLATPVTTEAEGIPLKFTNDLDIDEDG  189

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
             ++YF DS   +   NF ++  +G+ SGRLLKY       TV+LRGL  P G+ +SKD +F
Sbjct  190   SIYFTDSSTNYQRRNFMQLVFTGEPSGRLLKYNPVMKETTVLLRGLQFPNGVTLSKDGSF  249

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNI---------  851
              L  E    ++++Y +KG KA T+     L G PDNV+    G +WVA++          
Sbjct  250   FLFCEGSRGRLSRYWLKGEKAGTSDVFAVLPGFPDNVRTNEKGEFWVAIHCRLSMYTHLT  309

Query  852   -----LKppqpqqLIPM-----------TESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                  L+    +  IP              ++ +K+  +G++L+  ++       + S  
Sbjct  310   SRYFRLRKFLLKLPIPAKYHFLLQIGGRPHAVIIKYSPDGELLEILEDSQGKVVRAVSEV  369

Query  981   LEHFGKAYTGSLVPNFLGVY  1040
              E  GK + GS++  F+ VY
Sbjct  370   EEKDGKLWIGSVLMPFIAVY  389



>ref|XP_002452976.1| hypothetical protein SORBIDRAFT_04g035870 [Sorghum bicolor]
 gb|EES05952.1| hypothetical protein SORBIDRAFT_04g035870 [Sorghum bicolor]
Length=346

 Score =   202 bits (513),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 120/296 (41%), Positives = 174/296 (59%), Gaps = 13/296 (4%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATT--SPLRTKVICDGTNNTILQLI-  344
             GPE VAF+G G GPY+GV+DGR+LK+ NG    ++T   SP      C  +     +L  
Sbjct  52    GPESVAFDGAGAGPYSGVSDGRVLKW-NGFARGWSTYAYSPGYDAEACTASRARPAELTE  110

Query  345   --CGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
               CGRPLGL FH R+G+LYIAD   GL++V P GG AT LAA V+G+   FTN V +D+ 
Sbjct  111   SKCGRPLGLRFHRRSGNLYIADAYKGLMRVRPGGGEATVLAAEVDGVPLRFTNGVDVDQV  170

Query  519   T--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
             T  V+F DS + +      ++  +GD+SGRL+KY+  TG+VTV+  G++ P GLAIS D+
Sbjct  171   TGDVFFTDSSMNYPRSQHERVTATGDSSGRLMKYDPRTGQVTVLQAGITYPNGLAISADR  230

Query  693   TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpq  872
             T L+++     K+ +Y I+GPKA T++ L  L G PDNV+    GG+WVA++  +     
Sbjct  231   THLVVALTGPCKLMRYWIEGPKAGTSEHLADLPGYPDNVRADGRGGFWVALH--REKMEL  288

Query  873   qLIPMTESIAVKFDRNGKILD-RKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGV  1037
                P +  +AV+   +G+++   K   S  P          GK Y GS+   ++ V
Sbjct  289   PFGPDSHLLAVRVGADGQMVQVMKGPKSVRPTEVVE--RDGGKLYMGSVELPYVAV  342



>ref|XP_003527512.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Glycine max]
Length=441

 Score =   204 bits (519),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 122/324 (38%), Positives = 179/324 (55%), Gaps = 32/324 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKV---ICDGTNNTIL--Q  338
             GPE +AF+  G GPYTG+ADG I+ +    ++ FA TSP R+++   I   T  + +  +
Sbjct  118   GPESIAFDPLGRGPYTGLADGTIVFWNGHSWLHFAYTSPNRSEICNPIASATPFSYVKNE  177

Query  339   LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-E  515
              ICGRPLGL F  +TGDLYIAD  FGLLKVGP+GGLAT L     GI   FTN V +D E
Sbjct  178   HICGRPLGLRFDKKTGDLYIADAYFGLLKVGPEGGLATSLVTEAEGIPLRFTNDVDVDTE  237

Query  516   STVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               VYF +S  ++   NF ++  SGD SGR+LKY + T   TV++R +  P G+++SKD +
Sbjct  238   GNVYFTESSALYPRRNFLQLVFSGDDSGRVLKYNLATKETTVLVRNIQFPNGISLSKDGS  297

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNI--------  851
             F +  E +  ++ KY +KG KA T++ L  L G PDNV+    G +WVA++         
Sbjct  298   FFVFCEGVVGRLRKYWLKGEKAGTSEILAILPGYPDNVRVNEDGDFWVALHSRRYMYAYY  357

Query  852   ------LKppqpqqLIPM-----------TESIAVKFDRNGKILD-RKNVTSAYPNSFSA  977
                   ++    +  IP+             +  +++   GK+L   ++       + S 
Sbjct  358   NGIYPKMRKIILKLPIPIKIHYLLQIGGRQHAAVIRYSPEGKLLQILEDSEGKVVKAVSE  417

Query  978   YLEHFGKAYTGSLVPNFLGVYTLK  1049
               E  GK + GS++  F+ VY LK
Sbjct  418   VEEKDGKLWMGSVLMPFVAVYNLK  441



>ref|XP_006400707.1| hypothetical protein EUTSA_v10013741mg [Eutrema salsugineum]
 gb|ESQ42160.1| hypothetical protein EUTSA_v10013741mg [Eutrema salsugineum]
Length=395

 Score =   203 bits (516),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 124/322 (39%), Positives = 173/322 (54%), Gaps = 32/322 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE VAF+  G GPYTGVADGR+L +   K+ DFA TS  R++ ICD   + +  L    
Sbjct  75    GPESVAFDPLGRGPYTGVADGRVLFWNGDKWTDFAYTSSNRSE-ICDPKPSALSYLRNEH  133

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES-  518
             ICGRPLGL F  RTGDLYIAD   GLLKVGP+GGLA  L     G+   FTN + +D+  
Sbjct  134   ICGRPLGLRFGKRTGDLYIADAYMGLLKVGPEGGLAMPLVTEAEGVPLGFTNDLDIDDDG  193

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
             TVYF DS + +   NF ++  SGD +GR+LKY+    +  V++  +  P G++ISKD +F
Sbjct  194   TVYFTDSSINYQRRNFLQLVFSGDNTGRVLKYDPIAKKAVVLVSNVQFPNGVSISKDGSF  253

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
              +  E     + +Y +KG KA T+     L G PDNV+    G +WVA++  +      +
Sbjct  254   FVFCEGDIGSLRRYWLKGEKAGTSDVFAMLPGHPDNVRTNKDGEFWVALHCKRNYYSYIM  313

Query  879   ------------IPMTESI-------------AVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                         +P+T  I              VK+   GK++   ++       S S  
Sbjct  314   ARYPKLRMFILKLPITARIHYLFQIGMRPHGVVVKYSPEGKLVKILEDSEGKVVRSVSEV  373

Query  981   LEHFGKAYTGSLVPNFLGVYTL  1046
              E  GK + GS++ NF+ VY L
Sbjct  374   EEKDGKLWMGSVLMNFVAVYDL  395



>ref|XP_008392402.1| PREDICTED: strictosidine synthase 1-like [Malus domestica]
 ref|XP_008360679.1| PREDICTED: strictosidine synthase 1-like [Malus domestica]
Length=375

 Score =   202 bits (515),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 119/323 (37%), Positives = 178/323 (55%), Gaps = 32/323 (10%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKY--YNGKFIDFATTSPLRTKVICDGTNNTILQL  341
             A+GPE +AF+  G+GPYTGVADGR+LK+   + ++ DFA T+  R +  C       ++ 
Sbjct  55    ALGPESLAFDPTGDGPYTGVADGRVLKWDRNDRRWTDFAVTTSQRKE--CVRPFAPEMEH  112

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDE--  515
             +CGRPLGL+F  + GDLYIAD   GL  VGP GGLA+Q+   V G    FTN + +DE  
Sbjct  113   VCGRPLGLKFDKKNGDLYIADAYLGLQVVGPAGGLASQVVREVEGQPLRFTNDMDIDEHK  172

Query  516   STVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               +YF DS  IF    F     +GD +GRLLKY+  +  VTV+LRGL+   G+A+SKD++
Sbjct  173   DVIYFTDSSTIFQRRQFMSSVLNGDRTGRLLKYDKSSKEVTVLLRGLAFANGVALSKDRS  232

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             F+L++E    +I +  + GP A  T    +L G PDN++R ++G +WVA++       + 
Sbjct  233   FVLVAETTTCRILRIWLDGPNAGNTDVFAELPGFPDNIRRNSNGEFWVALHAKSGFVSKF  292

Query  876   L------------IPM-------------TESIAVKFDRNGKILDRKNVTSAYPNSFSAY  980
             +            +P+               + AVK   NG++L            F + 
Sbjct  293   ITSNTWVGKLMLKLPLGFKRLHSLLVGGKAHATAVKLSENGEVLQVLEDCEGKTIKFISE  352

Query  981   LEHF-GKAYTGSLVPNFLGVYTL  1046
             LE   G+ + GS++  F+G+Y L
Sbjct  353   LEEKDGELWIGSVLMPFIGIYKL  375



>ref|XP_010488915.1| PREDICTED: strictosidine synthase 3-like [Camelina sativa]
Length=393

 Score =   203 bits (516),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 120/322 (37%), Positives = 174/322 (54%), Gaps = 31/322 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE +AF+  G GPYTGVADGRIL +    + DFA TS  R+K +CD   + +  L    
Sbjct  71    GPESIAFDPLGRGPYTGVADGRILFWNGSLWTDFAYTSINRSKELCDPKPSLLDYLKDEH  130

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-ES  518
             ICGRPLGL F  +TGDLYIAD   G++KVGP+GGLAT L    +G+   FTN + +D E 
Sbjct  131   ICGRPLGLRFDKKTGDLYIADAYLGIMKVGPEGGLATSLTTEADGVPLRFTNDLDIDDEG  190

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF DS  +F    F  +  SG+ +GR+LKY  +T   T ++R L  P GL++ KD +F
Sbjct  191   NVYFTDSSSVFQRRKFMLLIVSGEDTGRVLKYNPKTKETTTLVRNLQFPNGLSLGKDGSF  250

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
              +  E    ++ KY +KG KA T++ +  L G PDN++    G +WVAV+  +      +
Sbjct  251   FIFCEGSIGRLRKYWLKGEKAGTSEVVALLHGFPDNIRTNKDGDFWVAVHGHRNIFTHVM  310

Query  879   ------------IPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                         +P++               + VK+   GK+L   ++       + S  
Sbjct  311   AHHPRVRKFFLKLPISVKFQYLLQVGGWPHGVVVKYSEEGKVLKVLEDSQGKVVKAVSEV  370

Query  981   LEHFGKAYTGSLVPNFLGVYTL  1046
              E  GK + GS++ +F+ VY L
Sbjct  371   EEKDGKLWMGSVLMSFIAVYDL  392



>ref|XP_010045161.1| PREDICTED: strictosidine synthase 3-like [Eucalyptus grandis]
 gb|KCW87315.1| hypothetical protein EUGRSUZ_B03802 [Eucalyptus grandis]
Length=391

 Score =   203 bits (516),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 124/322 (39%), Positives = 176/322 (55%), Gaps = 32/322 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE +AF+  G GPY GVADGR+L +    + DFA TS  R+  +CD   + +  L    
Sbjct  70    GPESIAFDPAGRGPYAGVADGRVLFWDGESWKDFAYTSGNRSG-LCDPKPSPLSYLKNEH  128

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES-  518
             ICGRPLGL F  RTGDLYIAD  FGL+KVGP+GGLAT LA    G+   FTN + +DE  
Sbjct  129   ICGRPLGLRFDKRTGDLYIADAYFGLMKVGPEGGLATSLATEAEGVPLRFTNDLDIDEEG  188

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF DS   +   NF ++  S + SGRLLKY   T   T+++R L  P G+++SKD +F
Sbjct  189   NVYFTDSSTKYQRRNFPQLVFSAEDSGRLLKYNPTTKETTILIRNLQFPNGVSLSKDGSF  248

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNIL--------  854
             L+ SE    ++ K+ +K  KA T++    L G PDNV+  T G +WVA++          
Sbjct  249   LVFSEGAIGRLRKFWLKVEKAGTSEVFAVLPGFPDNVRTNTDGDFWVAIHCRRSMYSYYS  308

Query  855   ----KppqpqqLIPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                 K  +    +P++              ++ VK+   GK++   ++       S S  
Sbjct  309   GLYPKLRKLWLKLPISVKTQFQLQIGGQPHAVVVKYSPEGKLVQILEDSEGKTVRSVSEV  368

Query  981   LEHFGKAYTGSLVPNFLGVYTL  1046
              E  GK + GS++  F+ VY+L
Sbjct  369   EEKDGKLWMGSVLMPFVAVYSL  390



>ref|XP_007028511.1| Calcium-dependent phosphotriesterase superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY09013.1| Calcium-dependent phosphotriesterase superfamily protein isoform 
1 [Theobroma cacao]
Length=369

 Score =   202 bits (514),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 126/323 (39%), Positives = 173/323 (54%), Gaps = 32/323 (10%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQL  341
             A GPE +AF+  G+GPY+GVADGRILK+      + DFA TS  R    C       ++ 
Sbjct  49    AFGPESLAFDANGDGPYSGVADGRILKWQGDAVGWTDFAFTSSHRED--CVRPFAPEMEH  106

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDE--  515
             ICGRPLGL F  +TGDLYIAD  FGL  VGP GGLATQL     G    FTN + +DE  
Sbjct  107   ICGRPLGLRFDKKTGDLYIADAYFGLQVVGPAGGLATQLITEAEGQPLYFTNDMDIDELD  166

Query  516   STVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               +YF D+   F    F     + D +GRLLKY   +  VTV+LRGL+   G+A+SKD +
Sbjct  167   DVIYFTDTSTSFRRRQFLPSIFTTDKTGRLLKYNKSSKEVTVLLRGLAFANGVALSKDSS  226

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVN-----ILKp  860
             F+L++E    +I +  ++GP A   +   +L G PDN++R   G +WVA++     + K 
Sbjct  227   FVLVAETTTCRILRLWLRGPNAGNVEVFSELPGFPDNIRRNKKGEFWVALHAKKGLVAKL  286

Query  861   pqpqqL-------IPMT-------------ESIAVKFDRNGKILDRKNVTSAYPNSF-SA  977
                  L       +P++              +IAVK   NG+IL+    T      F S 
Sbjct  287   ALSYSLFGNTVLKLPLSFKQLHSLFIGGKPHAIAVKLSENGEILEVLEDTEGKTMRFISE  346

Query  978   YLEHFGKAYTGSLVPNFLGVYTL  1046
               E  GK + GS++  F+G+Y L
Sbjct  347   VEEKDGKLWIGSVMMPFVGIYHL  369



>ref|XP_004978210.1| PREDICTED: strictosidine synthase 1-like [Setaria italica]
Length=346

 Score =   201 bits (512),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 111/260 (43%), Positives = 159/260 (61%), Gaps = 10/260 (4%)
 Frame = +3

Query  174  GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATT--SPLRTKVICDGTN---NTILQ  338
            GPE VAF+G G GPY+GV+DGR+LK+ NG    ++T   SP      C  +      + +
Sbjct  53   GPESVAFDGAGAGPYSGVSDGRVLKW-NGHARGWSTYAYSPGYNAKACTASRVRPAEVTE  111

Query  339  LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
             +CGRPLGL FH  +GDLYIAD   GL++VGP GG AT +A  V+G    FTN V +D+ 
Sbjct  112  SMCGRPLGLRFHYGSGDLYIADAYKGLMRVGPGGGEATVVATMVDGKPLRFTNGVDVDQV  171

Query  519  T--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
            T  VYF DS + +      ++  +GD++GRL+KY+ +T  VTV+  G++ P GLAIS D+
Sbjct  172  TGEVYFTDSSMKYSRSQHERVTATGDSTGRLMKYDPKTDHVTVLQSGITYPNGLAISADR  231

Query  693  TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpq  872
            T L+++     K+ +Y I GPK  T++TL  L G PDNV+    GG+WVA++  +     
Sbjct  232  THLVVALTGPCKLMRYWITGPKVGTSETLADLPGYPDNVRPDGRGGFWVALH--REKMEL  289

Query  873  qLIPMTESIAVKFDRNGKIL  932
               P    +AV+ D +GK+L
Sbjct  290  PFGPDRHLLAVRIDADGKVL  309



>ref|XP_010677108.1| PREDICTED: strictosidine synthase 1-like [Beta vulgaris subsp. 
vulgaris]
Length=334

 Score =   201 bits (511),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 106/233 (45%), Positives = 150/233 (64%), Gaps = 8/233 (3%)
 Frame = +3

Query  165  HAIGPEDVAFNGKGEGPYTGVADGRILKYYNGKFID---FATTSPLRTKVICDGTNNTIL  335
            +A+ PE +AF+ +G GPY GV+DGRILK+  G  +    FA  SP R+   CDG N++  
Sbjct  56   NAVAPESIAFDCQGGGPYVGVSDGRILKW-QGPLLGWTVFAVISPYRSNS-CDGLNDSPA  113

Query  336  QLICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDE  515
            +  CGRPLGL+F+  T +LYIAD +FGL+KVG  GG+AT +A    GI F F NA+ +D 
Sbjct  114  EQYCGRPLGLKFNIVTCELYIADSSFGLVKVGSNGGIATSVATSAEGILFRFLNALDIDS  173

Query  516  ST--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKD  689
             +  VYF DS        +T I  S D SGRL++Y  +TGR  V+L+GLS   G+A+SK 
Sbjct  174  ESGDVYFTDSSSHHHRWEYTAI-DSTDRSGRLMRYNPKTGRTIVLLKGLSFANGVALSKK  232

Query  690  KTFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVN  848
            + F+L++E    ++ +Y + GP A T++  +KL GQPDN+ R  +G +WVA N
Sbjct  233  RDFVLVAETTLHRVQRYWLTGPGAGTSEEFIKLTGQPDNINRNGNGDFWVAQN  285



>emb|CDP12339.1| unnamed protein product [Coffea canephora]
Length=347

 Score =   201 bits (512),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 117/272 (43%), Positives = 160/272 (59%), Gaps = 16/272 (6%)
 Frame = +3

Query  84   SILIFISSPCVIHS-QppgillpiklklH-------AIGPEDVAFNGKGEGPYTGVADGR  239
            +ILIF+ S   +HS   P   +  +   H       A GPE +AF+  G GPYTGV+DGR
Sbjct  17   AILIFVGSLGTVHSGHEPRHPISQRKWSHEQFPIYGASGPESLAFDRHGGGPYTGVSDGR  76

Query  240  ILKY--YNGKFIDFATTSPLRTKVICDGT-NNTILQLICGRPLGLEFHPRTGDLYIADVN  410
            I+K+     ++I+FATT+P R    CDG+ ++   +  CGRPLGL F  +TGDLYIAD  
Sbjct  77   IIKWDRNQSRWINFATTTPFRDG--CDGSADHANTEARCGRPLGLSFDHKTGDLYIADAY  134

Query  411  FGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--VYFVDSGLIFLTGNFTKIAQS  584
             GLL VG KGGLAT +A  V+G  F F N + +D+ +  +YF D+   F    F  +  S
Sbjct  135  MGLLAVGSKGGLATPVAQEVDGFPFKFLNDLVIDQDSGAIYFTDTSTRFERREFANVMFS  194

Query  585  GDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFLLISEFIAKKITKYIIK-GPKA  761
            GD SGRLLKY+     VTV+L  L  P G+A+SKD  FLL++E    +I +Y ++   K 
Sbjct  195  GDNSGRLLKYDPRNNEVTVLLHNLMFPNGVALSKDGDFLLVAETTNSRILRYWLEPSSKL  254

Query  762  NTTQTLLKLEGQPDNVKRATSGGYWVAVNILK  857
               +    L G+PDN+KR  +G +WVA N  K
Sbjct  255  GKVEVFANLPGRPDNIKRNQNGEFWVAANSEK  286



>ref|XP_006348919.1| PREDICTED: strictosidine synthase 1-like [Solanum tuberosum]
Length=350

 Score =   201 bits (512),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 126/313 (40%), Positives = 168/313 (54%), Gaps = 22/313 (7%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKYYNGK-----FIDFATTSPLRTKVICDGTNNTI  332
             AIGPE VAF+ KGEGPY GVADGRILK   G      + DFA TS  R    C       
Sbjct  40    AIGPESVAFDPKGEGPYIGVADGRILKLQLGSQNRLIWADFAVTSSHRRN--CTLPFAPE  97

Query  333   LQLICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD  512
             ++ ICGRPLGL F  +TGDLYIAD   GL  VG KGGLAT L     G    FTN V +D
Sbjct  98    MEHICGRPLGLRFDTKTGDLYIADAYLGLQVVGSKGGLATPLVQKFEGKPLVFTNDVDID  157

Query  513   ESTVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
                +YF D+   +    F     +GDT+GRL+KY   T +VTV+L  L+   G+A+SK++
Sbjct  158   GDVIYFTDTSTKYQRWQFLTSFSNGDTTGRLMKYVKSTKKVTVLLGDLAFANGVALSKNR  217

Query  693   TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpq  872
             +F+L+SE    +I +Y +KGP A T    ++L G PDN++    G +WVA+  ++     
Sbjct  218   SFVLVSETTNFRILRYWLKGPLAGTHDVFVELPGFPDNIRINPKGEFWVALQAIRSVSSI  277

Query  873   q--------LIPMT------ESIAVKFDRNGKILDR-KNVTSAYPNSFSAYLEHFGKAYT  1007
                        P           A+K   +G++L+  ++V      S S   E  GK + 
Sbjct  278   SDSKFGMLHFTPQQMDEGELHPTAIKLSEDGRVLEALEDVEGKTLRSISDIEEKDGKLWI  337

Query  1008  GSLVPNFLGVYTL  1046
             GS+V  FL VY L
Sbjct  338   GSVVMPFLRVYGL  350



>ref|XP_004241357.2| PREDICTED: strictosidine synthase 3-like, partial [Solanum lycopersicum]
Length=420

 Score =   203 bits (517),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 124/323 (38%), Positives = 175/323 (54%), Gaps = 32/323 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE +AF+ KG GPYTG+ADGRI+ +   K+ DFA TS  R+  +CD   + +  L    
Sbjct  99    GPESIAFDPKGRGPYTGIADGRIVLWDGEKWTDFAYTSANRSG-LCDPKPSPLSYLENEH  157

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-ES  518
             ICGRPLGL F  +TGDLYIAD  FGL+KVGP+GGLA  L     G+   FTN + +D E 
Sbjct  158   ICGRPLGLRFDKKTGDLYIADAYFGLMKVGPEGGLAETLTTEAEGVPLVFTNDLDVDDEG  217

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF DS   +   N+  +  S + SGR+LKY   T + TV++R L  P GL++SKD +F
Sbjct  218   NVYFTDSSTKYQRRNYMLLVYSAEDSGRVLKYNSNTKQTTVLVRNLQFPNGLSLSKDGSF  277

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNI---------  851
              +  E    ++ KY +KG KA T + +  L G PDNV     G +WVA++          
Sbjct  278   FVFCEVAKGRLQKYWLKGEKAGTFEVMAVLPGYPDNVSTNERGEFWVAIHCRRTIYSYIN  337

Query  852   -----LKppqpqqLIPMT-----------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                  L+    +  IP+             +I VK++  GK+L   ++       + S  
Sbjct  338   SIYPQLRLFLLKLPIPVKLRALLHLGGKLPAIVVKYNPEGKLLRILEDEEGKVVRAVSDV  397

Query  981   LEHFGKAYTGSLVPNFLGVYTLK  1049
              E  GK + GS++  F+ VY L+
Sbjct  398   EEKDGKLWMGSVLMPFIAVYQLQ  420



>gb|KEH23602.1| strictosidine synthase family protein [Medicago truncatula]
Length=369

 Score =   202 bits (513),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 122/321 (38%), Positives = 170/321 (53%), Gaps = 30/321 (9%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQL  341
             A+GPE + F+  G+GPYTGVADGRILK+   +  +  FA TS  R+   C       L+ 
Sbjct  51    AVGPESLVFDSNGDGPYTGVADGRILKWEGEERGWTQFAVTSSNRSN--CVHPFAPELEH  108

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNA--VALDE  515
             +CGRPLGL+F  ++GDLYIAD   GL  VGP GGLATQ+A    G  F FTN   ++ DE
Sbjct  109   VCGRPLGLKFDKKSGDLYIADAYLGLKVVGPAGGLATQVATEAEGQPFHFTNDMDISEDE  168

Query  516   STVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               +YF DS  ++    F  +  SGD +GRL+KY+  T  V V+L GL+ P G+A+SKD +
Sbjct  169   DVIYFTDSSTVYRRRQFMLVLLSGDKTGRLMKYDKSTKEVKVLLSGLAFPNGVALSKDGS  228

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKp-----  860
             FLL++E    KI +  ++GP A    T   L G PDNV+R + G +WVA++  +      
Sbjct  229   FLLVAETSTCKILRLWLRGPNAGQVDTFAVLPGFPDNVRRNSEGQFWVALHAKETPFAKW  288

Query  861   ------------------pqpqqLIPMTESIAVKFDRNGKILDRKNVTSAYPNSF-SAYL  983
                                    L     + A+K    G+IL+           F S   
Sbjct  289   MSSNLWAGKALSKLGNFKWLHASLAMKPHAAAIKLSDEGEILEVLEDCEGKTLKFISEIE  348

Query  984   EHFGKAYTGSLVPNFLGVYTL  1046
             E  GK +  S++  ++GVY L
Sbjct  349   EKDGKLWMASVLMPYIGVYNL  369



>gb|EAZ28597.1| hypothetical protein OsJ_12584 [Oryza sativa Japonica Group]
Length=349

 Score =   201 bits (511),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 122/320 (38%), Positives = 177/320 (55%), Gaps = 31/320 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE VAF+  G GPYTGVADGR++++   +++ FA +SP  T  +C    + +  L    
Sbjct  24    GPESVAFDPLGRGPYTGVADGRVVRWDGARWVYFAHSSPNWTAELCGHKASPLDYLKDEH  83

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES-  518
             ICGR LGL F  RTGDLYIAD  FGLLKVGP GGLAT LA    G++F+FTN + LD+  
Sbjct  84    ICGRALGLRFDRRTGDLYIADAYFGLLKVGPDGGLATPLATEAEGVRFNFTNDLDLDDDG  143

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF DS + +   +F ++  SGD SGRLLKY+  T + TV+ R +  P G+++SKD  F
Sbjct  144   NVYFTDSSIHYQRRHFMQLVFSGDPSGRLLKYDPNTKKATVLHRNIQFPNGVSMSKDGLF  203

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNI---------  851
              +  E    ++++Y +KG KA T      L G PDNV+    G +WVA++          
Sbjct  204   FVFCEGSRGRLSRYWLKGEKAGTVDLFAILPGFPDNVRTNDKGEFWVAIHCRRSIYARMV  263

Query  852   -----LKppqpqqLIPMT-----------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                  L+       IP              ++ +K++  G++LD  ++ T     + S  
Sbjct  264   SRNVRLRKFLLSLPIPAKYHYLMQIGGKLHALIIKYNPEGEVLDILEDTTGQVVRAVSEV  323

Query  981   LEHFGKAYTGSLVPNFLGVY  1040
              E  GK + GS++  F+ V+
Sbjct  324   EEKDGKLWIGSVLMPFIAVF  343



>ref|XP_002323255.1| strictosidine synthase family protein [Populus trichocarpa]
 gb|EEF05016.1| strictosidine synthase family protein [Populus trichocarpa]
Length=375

 Score =   202 bits (513),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 121/326 (37%), Positives = 175/326 (54%), Gaps = 35/326 (11%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKYY-----NGKFIDFATTSPLRTKVICDGTNNTI  332
             A+GPE + F+  GEGPYTGVADGR+LK+      +G + DFATTS  R +  C       
Sbjct  52    AVGPESLVFDPNGEGPYTGVADGRVLKWIAGDDGSGSWTDFATTSSNRNE--CVRPFAPE  109

Query  333   LQLICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD  512
             ++ +CGRPLGL F  +TG+LYIAD   GL  VGP GGLAT +   + G    FTN + +D
Sbjct  110   MEHVCGRPLGLRFDKKTGNLYIADAYLGLQVVGPTGGLATPVVTELEGQPMRFTNDLDID  169

Query  513   ES--TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISK  686
             E    +YF D+ ++F    F     + D +GRLLKY+  +  VTV+ RGL+   G+A+SK
Sbjct  170   EQEDVIYFTDTSMVFQRRQFILSLLTKDKTGRLLKYDKSSKEVTVLARGLAFANGVALSK  229

Query  687   DKTFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppq  866
             D TFLL++E    +I ++ + GP A  +    +L G PDN++R + G +WVA++  K   
Sbjct  230   DSTFLLVAETTTCRILRFWLHGPNAGKSDVFTELPGFPDNIRRNSKGEFWVALHSKKGLF  289

Query  867   pqqLI------------PMT-------------ESIAVKFDRNGKILDRKNVTSAYPNSF  971
              + ++            P++              + A+K    GK+LD           F
Sbjct  290   AKVVLSNSWIGKTLLKFPLSFKQLHSLLVGGKAHATAIKLSEEGKVLDVLEDCDGKTLRF  349

Query  972   -SAYLEHFGKAYTGSLVPNFLGVYTL  1046
              S   E  GK + GS++  FLG Y L
Sbjct  350   ISEVEEKDGKLWIGSVLMPFLGTYNL  375



>gb|EAZ01726.1| hypothetical protein OsI_23752 [Oryza sativa Indica Group]
Length=350

 Score =   201 bits (511),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 112/296 (38%), Positives = 176/296 (59%), Gaps = 12/296 (4%)
 Frame = +3

Query  171   IGPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATT--SPLRTKVICDGTNNTILQL-  341
             +GPE VAF+GKG GPY+GV+DGRI+++ NG+   ++T   SP  TK  C  +    +Q  
Sbjct  56    VGPESVAFDGKGRGPYSGVSDGRIMRW-NGEAAGWSTYTYSPSYTKNKCAASTLPTVQTE  114

Query  342   -ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
               CGRPLGL FH +TG+LYIAD   GL++VGPKGG AT LA   +G+   FTN V +D+ 
Sbjct  115   SKCGRPLGLRFHYKTGNLYIADAYMGLMRVGPKGGEATVLAMKADGVPLRFTNGVDIDQV  174

Query  519   T--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
             T  VYF DS + +      ++  + D++GRL+KY+  T +VTV+   ++ P G+A+S D+
Sbjct  175   TGDVYFTDSSMNYQRSQHEQVTATKDSTGRLMKYDPRTNQVTVLQSNITYPNGVAMSADR  234

Query  693   TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpq  872
             T L+++     K+ ++ I+GPK   ++  + L G PDNV+    GGYW+A++  +     
Sbjct  235   THLIVALTGPCKLMRHWIRGPKTGKSEPFVDLPGYPDNVRPDGKGGYWIALH--REKYEL  292

Query  873   qLIPMTESIAVKFDRNGKILDR-KNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGV  1037
                P +  +A++    GK++ + +   S  P       +  GK Y G++   ++GV
Sbjct  293   PFGPDSHLVAMRVSAGGKLVQQMRGPKSLRPTEVMERKD--GKIYMGNVELPYVGV  346



>ref|XP_010525478.1| PREDICTED: strictosidine synthase 1-like [Tarenaya hassleriana]
Length=373

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 122/322 (38%), Positives = 175/322 (54%), Gaps = 32/322 (10%)
 Frame = +3

Query  171   IGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQLI  344
             +GPE +AFN  GEGPYTGVADGRIL++      + DFA TS  R +  C       ++ +
Sbjct  54    VGPESLAFNPAGEGPYTGVADGRILRWRGDSLGWTDFAYTSHNRQE--CSRPFAPEMEHV  111

Query  345   CGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST-  521
             CGRPLGL F  +TGDLYIAD  FGLL VGP GGLA  L   ++G    FTN + + +   
Sbjct  112   CGRPLGLRFDNKTGDLYIADAYFGLLVVGPTGGLARPLVTEIDGQPLRFTNDLDIHDQAG  171

Query  522   -VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              +YF D+   F    F     + D +GRL+K+E  TG+VTV+L+GL+   G+A+SKD+++
Sbjct  172   AIYFTDTSTRFQRRQFLLSVLNLDKTGRLIKFEKSTGKVTVLLQGLAFANGVALSKDQSY  231

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
             LL++E    +I +  + GPKA +     +L G PDNV+R   G +WVA++  K    +  
Sbjct  232   LLVAETTTCRILRLWLDGPKAGSHDVFAELPGFPDNVRRNPEGEFWVALHAKKGRVARLA  291

Query  879   IPMT-------------------------ESIAVKFDRNGKILDRKNVTSAYPNSF-SAY  980
             +  +                          + A+K    G++L+    T A   SF S  
Sbjct  292   LSHSWFRNLLLKLPVSPQRLHSIFIGGEPHATAMKLSETGEVLEVLEDTEAKRLSFISEV  351

Query  981   LEHFGKAYTGSLVPNFLGVYTL  1046
              E  GK + GS++  FLG+Y L
Sbjct  352   EEKDGKLWMGSVLMPFLGIYDL  373



>ref|XP_010535734.1| PREDICTED: adipocyte plasma membrane-associated protein [Tarenaya 
hassleriana]
Length=395

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 120/322 (37%), Positives = 177/322 (55%), Gaps = 32/322 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTIL----QL  341
             GPE + F+  G GPYTGVADGR+L +   K++ FA TS  R++ ICD   +T+     + 
Sbjct  74    GPESIVFDRLGRGPYTGVADGRVLLWNGEKWVGFAYTSSNRSE-ICDPKPSTLSYVKNEH  132

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES-  518
             ICGRPLGL F  RTGDLYIAD   GLL+VGP+GGLA  L     G+   FTN + +D+  
Sbjct  133   ICGRPLGLRFDKRTGDLYIADAYLGLLRVGPEGGLAMPLVTEAEGVPLRFTNDLDIDDDG  192

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF DS   +   NF ++  SGD SGR+LKY+ +T +V V++R +  P G ++SKD +F
Sbjct  193   NVYFTDSSTKYQRRNFMQLVFSGDDSGRVLKYDPKTNKVDVLVRNVQFPNGASLSKDGSF  252

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
             L+  E    ++ +Y +KG KA  ++    L G PDNV+    G +WVA++  +    + +
Sbjct  253   LIFCEGAIGRLRRYWLKGEKAGASEVFAILPGFPDNVRTNKDGEFWVALHCRRNYFAEVM  312

Query  879   ------------IPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                         +P++              +  VK+   GK+L   ++       S S  
Sbjct  313   AKYPKFRKFLLKLPISARTQFGFHIGLRPHAAVVKYSPEGKLLQILEDSEGRVVRSVSEV  372

Query  981   LEHFGKAYTGSLVPNFLGVYTL  1046
              E  GK + GS++ NF+ +Y L
Sbjct  373   EEKDGKLWIGSVLMNFIALYHL  394



>emb|CDX73037.1| BnaC06g34850D [Brassica napus]
Length=328

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 118/292 (40%), Positives = 162/292 (55%), Gaps = 10/292 (3%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQLIC  347
             GPE  AF+  G GPYTGV+ G+ILKY   +  F +FA  +PL  K +CD    T L  IC
Sbjct  40    GPEAFAFDSHGGGPYTGVSGGKILKYQGSELGFTEFAYITPLANKSLCDKAVGTFLGNIC  99

Query  348   GRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST--  521
             GRP+GL F+  TGDLYIAD   GL  V  +GG A +LA    G  F F + + +D  T  
Sbjct  100   GRPVGLAFNEITGDLYIADAFLGLYVVSGRGGQAKRLADSAGGSPFKFLDGLDVDPVTGS  159

Query  522   VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTFL  701
             VYF      F            D +GR  +Y+ +T  VTV+L GLSG AG A+S D  F+
Sbjct  160   VYFTSFSTRFGPSQLVLAVAVNDATGRFFRYDPKTKSVTVLLSGLSGSAGCAVSSDGEFV  219

Query  702   LISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqLI  881
             L+ EF+  +I +Y IKGPKANT +  +     PDN++R   G +W+A N LK      ++
Sbjct  220   LVGEFLRNRILRYWIKGPKANTWEIFVPSIPGPDNIRRTDGGDFWIASNSLK-----LIV  274

Query  882   PMTESIAVKFDRNGKILDRKNVTSAYPNSF-SAYLEHFGKAYTGSLVPNFLG  1034
               T+  AVK +  G+I+ R ++   Y ++  S   E+    Y G+L  NF+G
Sbjct  275   LPTKPSAVKINAGGEIIRRMSLGEYYGDTLVSEVNEYKSVVYVGTLTTNFVG  326



>ref|XP_009378622.1| PREDICTED: strictosidine synthase 3-like [Pyrus x bretschneideri]
Length=440

 Score =   203 bits (517),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 125/323 (39%), Positives = 175/323 (54%), Gaps = 34/323 (11%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK-FIDFATTSPLRTKVICDGTNNTILQL---  341
             GPE V F+  G GPYTGVADGR+L ++NG+ + DFA TSP R+  IC    + +  L   
Sbjct  119   GPESVTFDPLGRGPYTGVADGRVL-FWNGQAWTDFAYTSPHRSD-ICSPKPSPLSYLKNE  176

Query  342   -ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
              ICGRPLGL F  +TGDLYIAD   GLLKVGP+GGLAT L     G+   FTN + +DE 
Sbjct  177   HICGRPLGLRFDKKTGDLYIADAYLGLLKVGPEGGLATSLTTEAEGVPLRFTNDLDIDEE  236

Query  519   -TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               +YF DS  ++   NF ++  SG+ +GR+LKY   T   TV+ R +  P GL++SKD +
Sbjct  237   GNIYFTDSSTMYQRRNFMQLVFSGEDTGRVLKYNPTTNETTVLQRNIRFPNGLSLSKDGS  296

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNI--------  851
             F L  E    ++ KY +K  KA T++    L G PDNV+   +G +WVA++         
Sbjct  297   FFLFCEGAVGRLRKYWLKSEKAGTSEVFAVLPGFPDNVRTNENGEFWVALHCRRNLYTHI  356

Query  852   ------LKppqpqqLIP-----------MTESIAVKFDRNGKILD-RKNVTSAYPNSFSA  977
                   L+    +  +P              ++ VK+   GKIL   ++       + S 
Sbjct  357   CAAFPQLRKFLLKLPVPSRIQFLLHIGGRLHAVVVKYSPEGKILQILEDSEGKVVKAVSE  416

Query  978   YLEHFGKAYTGSLVPNFLGVYTL  1046
               E  GK + GS++  F+ VY L
Sbjct  417   VEEKDGKLWMGSVLMPFIAVYDL  439



>ref|XP_007037729.1| Calcium-dependent phosphotriesterase superfamily protein, putative 
[Theobroma cacao]
 gb|EOY22230.1| Calcium-dependent phosphotriesterase superfamily protein, putative 
[Theobroma cacao]
Length=334

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 118/298 (40%), Positives = 172/298 (58%), Gaps = 13/298 (4%)
 Frame = +3

Query  165   HAIGPEDVAFNGKGEGPY-TGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTIL  335
             +A GPE +AF   G G + TG+ADGRILKY      F+DF   +P R+K +CDGT+    
Sbjct  42    NATGPEALAFV-SGTGQFCTGIADGRILKYQGPTTGFVDFGFAAPNRSKSVCDGTDTANP  100

Query  336   QLICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDE  515
             + +CGRPLGL  H  T  LY+ D  FG   +GPKGG  T L+ G +G  F F NAV + +
Sbjct  101   KPVCGRPLGLALHHATNRLYVCDAFFGFGVLGPKGGQVTILSTGADGEPFRFCNAVDVHQ  160

Query  516   ST--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKD  689
              T  VYF DS  ++          + D++GRL+KY+ +T +VTV+ R LSG  G+A+ ++
Sbjct  161   RTGDVYFTDSSAVYDIRQIETAISTNDSTGRLMKYDFKTEQVTVLFRNLSGAVGVAVDEE  220

Query  690   KTFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqp  869
               F+L+SEFI  +  K  ++G KAN  + ++ L+  PDN+KR  S  +W+A  ++K    
Sbjct  221   AKFVLVSEFIINRTIKIWLQGTKANKFE-IINLQPMPDNIKRTASENFWLAAAMIK-QGT  278

Query  870   qqLIPMTESIAVKFDRNGKILDRKNVTSAYPN-SFSAYLEHFGKAYTGSLVPNFLGVY  1040
             Q L+P+ + I    + +G +L   N    Y N S S   E  G  +  S + NF+GVY
Sbjct  279   QSLVPIGQRI----NASGTVLQTVNFERWYGNKSISEVQEFNGLLHVASRLVNFIGVY  332



>dbj|BAD35676.1| putative strictosidine synthase precursor [Oryza sativa Japonica 
Group]
 gb|EAZ37683.1| hypothetical protein OsJ_22021 [Oryza sativa Japonica Group]
 dbj|BAN15820.1| hypothetical protein [Oryza sativa Japonica Group]
Length=350

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 112/296 (38%), Positives = 176/296 (59%), Gaps = 12/296 (4%)
 Frame = +3

Query  171   IGPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATT--SPLRTKVICDGTNNTILQL-  341
             +GPE VAF+GKG GPY+GV+DGRI+++ NG+   ++T   SP  TK  C  +    +Q  
Sbjct  56    VGPESVAFDGKGRGPYSGVSDGRIMRW-NGEAAGWSTYTYSPSYTKNKCAASTLPTVQTE  114

Query  342   -ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
               CGRPLGL FH +TG+LYIAD   GL++VGPKGG AT LA   +G+   FTN V +D+ 
Sbjct  115   SKCGRPLGLRFHYKTGNLYIADAYMGLMRVGPKGGEATVLAMKADGVPLRFTNGVDIDQV  174

Query  519   T--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
             T  VYF DS + +      ++  + D++GRL+KY+  T +VTV+   ++ P G+A+S D+
Sbjct  175   TGDVYFTDSSMNYQRSQHEQVTATKDSTGRLMKYDPRTNQVTVLQSNITYPNGVAMSADR  234

Query  693   TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpq  872
             T L+++     K+ ++ I+GPK   ++  + L G PDNV+    GGYW+A++  +     
Sbjct  235   THLIVALTGPCKLMRHWIRGPKTGKSEPFVDLPGYPDNVRPDGKGGYWIALH--REKYEL  292

Query  873   qLIPMTESIAVKFDRNGKILDR-KNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGV  1037
                P +  +A++    GK++ + +   S  P       +  GK Y G++   ++GV
Sbjct  293   PFGPDSHLVAMRVSAGGKLVQQMRGPKSLRPTEVMERKD--GKIYMGNVELPYVGV  346



>gb|EAZ01725.1| hypothetical protein OsI_23751 [Oryza sativa Indica Group]
Length=350

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 113/296 (38%), Positives = 175/296 (59%), Gaps = 12/296 (4%)
 Frame = +3

Query  171   IGPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATT--SPLRTKVICDGTNNTILQL-  341
             +GPE VAF+GKG GPY+GV+DGRI+++ NG+   ++T   SP  TK  C  +    +Q  
Sbjct  56    VGPESVAFDGKGRGPYSGVSDGRIMRW-NGEAAGWSTYTYSPSYTKNKCAASTLPTVQTE  114

Query  342   -ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
               CGRPLGL FH +TG+LYIAD   GL++VGPKGG AT LA   +G+   FTN V +D+ 
Sbjct  115   SKCGRPLGLRFHYKTGNLYIADAYMGLMRVGPKGGEATVLATKADGVPLRFTNGVDIDQV  174

Query  519   T--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
             T  VYF DS + +      ++  + D++GRL+KY+  T +VTV+   ++ P G+AIS D+
Sbjct  175   TGDVYFTDSSMNYQRSQHEQVTATKDSTGRLMKYDPRTNQVTVLQSNITYPNGVAISADR  234

Query  693   TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpq  872
             T L+++     K+ ++ I+GPK   ++    L G PDNV+    GGYW+A++  +     
Sbjct  235   THLIVALTGPCKLMRHWIRGPKTGKSEPFADLPGYPDNVRPDGKGGYWIALH--REKYEL  292

Query  873   qLIPMTESIAVKFDRNGKILDR-KNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGV  1037
                P +  +A++    GK++ + +   S  P       +  GK Y G++   ++GV
Sbjct  293   PFGPDSHLVAMRVSAGGKLVQQMRGPKSLRPTEVMDRKD--GKIYMGNVELPYVGV  346



>ref|XP_008655533.1| PREDICTED: strictosidine synthase 3-like [Zea mays]
 tpg|DAA45310.1| TPA: hypothetical protein ZEAMMB73_945680 [Zea mays]
Length=338

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 112/295 (38%), Positives = 169/295 (57%), Gaps = 8/295 (3%)
 Frame = +3

Query  171   IGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGT--NNTILQ  338
             IG E +AF+ +G+GPY GV+DGR+LK+      +  FA ++  R   +C  +   +   +
Sbjct  45    IGAESLAFDRRGQGPYAGVSDGRVLKWGGSALGWTTFAHSANYRKIPLCTASVVPSEQTE  104

Query  339   LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
              +CGRPLGL+F   TGDLYIAD   GL+KVGP GG A  LA       F F N + +D++
Sbjct  105   SMCGRPLGLQFFAMTGDLYIADAYMGLMKVGPNGGEAQVLATQAGDAPFHFVNGLDVDQA  164

Query  519   T--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
             T  VYF DS  I+     T+I  + D +GRLLKY+  T RVTV+   L  P G+A+S D+
Sbjct  165   TGDVYFTDSSAIYPRRFNTEIMMNADATGRLLKYDARTKRVTVLKADLPYPNGVAVSNDR  224

Query  693   TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpq  872
             T ++++  +  +  +Y +KGPKA   + L  L G PDNV+R   GGYWVA+N  K     
Sbjct  225   THVVVAHTVPCQAFRYWLKGPKAGQYELLADLPGYPDNVRRDARGGYWVALNQEKARLDA  284

Query  873   qLIPMTESIAVKFDRNGKILDRKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGV  1037
                P    + V+   +G +++   +T+A   + S   E  G+ + GS+  +++G+
Sbjct  285   TAPPAKHLVGVRLAVDGAVVE--ELTAAKGVTLSDVAEKDGQLWLGSIELDYVGL  337



>ref|XP_009599899.1| PREDICTED: strictosidine synthase 3-like [Nicotiana tomentosiformis]
Length=386

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/246 (43%), Positives = 154/246 (63%), Gaps = 7/246 (3%)
 Frame = +3

Query  168  AIGPEDVAFNGKGEGPYTGVADGRILKYY--NGKFIDFATTSPLRTKVICDG-TNNTILQ  338
            A+GPE  AF+  G+GPY GV+DGRI+K+     +++DFA TSP R    C+G  ++T  +
Sbjct  61   AVGPESFAFDRHGDGPYAGVSDGRIIKWLRNESRWLDFAVTSPERDG--CEGFHDHTETE  118

Query  339  LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
              CGRPLGL F   +GDLYIAD   GL  VGP GGLAT++A    G+ F FTN++ +D++
Sbjct  119  HRCGRPLGLGFDENSGDLYIADAYLGLFVVGPNGGLATKVAKMAEGVPFGFTNSLCIDQT  178

Query  519  --TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
               +YF DS   F   ++  +  SGD +GRL+KY+M++  V+V+L+ L  P G+A+SK  
Sbjct  179  HGVLYFTDSSTTFSRRSYVSVIVSGDNTGRLMKYDMQSKLVSVLLKNLKFPNGVAMSKHG  238

Query  693  TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpq  872
             FLL +E    KI K+ +K  +A + + + +L G PDN+KR  +G +WV VN  +     
Sbjct  239  DFLLFAETTTCKIFKFWLKTSQAGSIEVVSELPGFPDNIKRNKNGEFWVGVNSRRSKFLD  298

Query  873  qLIPMT  890
             L+  T
Sbjct  299  WLLSKT  304



>ref|XP_007015611.1| Strictosidine synthase-like 3 [Theobroma cacao]
 gb|EOY33230.1| Strictosidine synthase-like 3 [Theobroma cacao]
Length=391

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 122/322 (38%), Positives = 174/322 (54%), Gaps = 32/322 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE +AF+  G GPYTGVADGRIL +   K+ +FA TS  R++ +C+   + +  L    
Sbjct  70    GPESIAFDPLGRGPYTGVADGRILFWDGEKWKEFAYTSSNRSE-LCNPKPSPLSYLPNEH  128

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-ES  518
             ICGRPLGL F   TGDLYIAD   GL KVGP+GGLAT L     G+   FTN + +D E 
Sbjct  129   ICGRPLGLRFDKNTGDLYIADAYLGLFKVGPEGGLATSLVTEAEGVPLRFTNDLDIDDEG  188

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              +YF DS  I+   NF ++  S ++SGRLLKY   T   TV++R +  P G+++S D +F
Sbjct  189   NIYFTDSSSIYQRRNFMQLVFSSESSGRLLKYNPHTKEATVLVRNIQFPNGVSLSNDGSF  248

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
             L+  E    ++ KY +KG KA T++    L G PDNV+    G +WVA++  +      L
Sbjct  249   LVFCEGCLGRLHKYWLKGEKAGTSEVFAILPGFPDNVRTNKDGEFWVAIHCRRSIYAHVL  308

Query  879   ------------IPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                         +P++              +I VK+   GK+L   ++       + S  
Sbjct  309   GLYPKLRKFLLKLPISSKIQYLLHVGGKLHAIVVKYSPEGKLLQVLEDSEGKVVRAVSEV  368

Query  981   LEHFGKAYTGSLVPNFLGVYTL  1046
              E  GK + GS++  F+ VY L
Sbjct  369   EERDGKLWMGSVLMPFVAVYDL  390



>ref|NP_563818.1| strictosidine synthase-like 3 [Arabidopsis thaliana]
 sp|Q8VWF6.1|SSL3_ARATH RecName: Full=Protein STRICTOSIDINE SYNTHASE-LIKE 3; Short=AtSSL3; 
AltName: Full=Strictosidine synthase 9; Short=AtSS9; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL31926.1|AF419594_1 At1g08470/T27G7_9 [Arabidopsis thaliana]
 gb|AAL36403.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51389.1| unknown protein [Arabidopsis thaliana]
 gb|AEE28296.1| strictosidine synthase-like 3 [Arabidopsis thaliana]
Length=390

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 119/322 (37%), Positives = 176/322 (55%), Gaps = 32/322 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE +AF+ +G GPYTGVADGRIL +   ++ DFA TS  R++ +CD   + +  L    
Sbjct  69    GPESIAFDPQGRGPYTGVADGRILFWNGTRWTDFAYTSNNRSE-LCDPKPSLLDYLKDED  127

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-ES  518
             ICGRPLGL F  + GDLYIAD   G++KVGP+GGLAT +    +G+   FTN + +D E 
Sbjct  128   ICGRPLGLRFDKKNGDLYIADAYLGIMKVGPEGGLATSVTNEADGVPLRFTNDLDIDDEG  187

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF DS   F    F  +  SG+ SGR+LKY  +T   T ++R L  P GL++ KD +F
Sbjct  188   NVYFTDSSSFFQRRKFMLLIVSGEDSGRVLKYNPKTKETTTLVRNLQFPNGLSLGKDGSF  247

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
              +  E    ++ KY +KG KA T++ +  L G PDN++    G +WVAV+  +      +
Sbjct  248   FIFCEGSIGRLRKYWLKGEKAGTSEVVALLHGFPDNIRTNKDGDFWVAVHCHRNIFTHLM  307

Query  879   ------------IPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                         +P++              ++AVK+   GK+L   ++       + S  
Sbjct  308   AHYPRVRKFFLKLPISVKFQYLLQVGGWPHAVAVKYSEEGKVLKVLEDSKGKVVKAVSEV  367

Query  981   LEHFGKAYTGSLVPNFLGVYTL  1046
              E  GK + GS++ +F+ VY L
Sbjct  368   EEKDGKLWMGSVLMSFIAVYDL  389



>emb|CDP09529.1| unnamed protein product [Coffea canephora]
Length=360

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 107/232 (46%), Positives = 146/232 (63%), Gaps = 7/232 (3%)
 Frame = +3

Query  168  AIGPEDVAFNGKGEGPYTGVADGRILKYY--NGKFIDFATTSPLRTKVICDGT-NNTILQ  338
            A+GPE +AF+  GEGPYTGV+DGRI+K+     ++I+FA T+P R    C+G  ++   +
Sbjct  49   AVGPESLAFDKHGEGPYTGVSDGRIIKWQRNENRWINFAVTTPHRHG--CEGAQDHDDTE  106

Query  339  LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
              CGR LGL F+ +TGDLYIAD   GLL VGPKGGLAT LA    G+ F FTN V +D+ 
Sbjct  107  FRCGRTLGLSFNHKTGDLYIADAYMGLLVVGPKGGLATPLAKEAQGVPFKFTNGVVVDQR  166

Query  519  T--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
            +  VYF DS   F   ++  I  SGD SGRL+K++    +VTV+L  L  P G+A+SK+ 
Sbjct  167  SGVVYFTDSSTKFQRKDYMSIIFSGDNSGRLMKFDPTAKKVTVLLHNLMFPNGVALSKNG  226

Query  693  TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVN  848
             FLLI+E    ++ K+ +   KA   +    L G PDN+ R   G +WVA+N
Sbjct  227  DFLLITETTNCRVLKFWLDPSKAGGVEVFANLPGIPDNINRNQKGEFWVAIN  278



>ref|XP_010056166.1| PREDICTED: strictosidine synthase 1-like [Eucalyptus grandis]
 gb|KCW90056.1| hypothetical protein EUGRSUZ_A02258 [Eucalyptus grandis]
Length=372

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 127/326 (39%), Positives = 178/326 (55%), Gaps = 38/326 (12%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQL  341
             A GPE +AF+  G GPYTGVADGRILK+   +  ++DFA TS  R +  C       L+ 
Sbjct  51    AFGPESLAFDPSGGGPYTGVADGRILKWEGDERGWVDFAFTSSQRKE--CIRPFAPELEH  108

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES-  518
             ICGRPLGL F  +TGDLYIAD  FGL+ VGP GGLAT +A    G  F FTN + +DES 
Sbjct  109   ICGRPLGLRFDKKTGDLYIADAYFGLMVVGPDGGLATLVANEAEGEPFWFTNDLDIDESE  168

Query  519   -TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               +YF DS   F    F     SGD +GRL+KY+  +  + V+LRG++   G+A+SKD  
Sbjct  169   DVIYFTDSSTNFHRRQFMNSCLSGDKTGRLMKYDKSSKELKVLLRGIAFANGVALSKDGM  228

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             FLL++E    +I ++ +KGP A       +L G PDN++R + G +WV ++  + P  + 
Sbjct  229   FLLMAETATCRILRFWLKGPNAGKFDIFAELPGYPDNIRRNSRGEFWVGLHAKRGPVARF  288

Query  876   L------------IPMT-------------ESIAVKFDRNGKIL----DRKNVTSAYPNS  968
             L            +P++             ++ AVK    G+IL    DR+  T  +   
Sbjct  289   LLSNSLIGNFALRLPISFQQLHSLFVGGKADATAVKLGTEGEILEVLEDREGKTLQF---  345

Query  969   FSAYLEHFGKAYTGSLVPNFLGVYTL  1046
              S   E   K +  S++  FLG+Y L
Sbjct  346   ISEVEERDNKLWIASVMRPFLGIYDL  371



>gb|KFK34942.1| hypothetical protein AALP_AA5G213900 [Arabis alpina]
Length=373

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 124/323 (38%), Positives = 176/323 (54%), Gaps = 32/323 (10%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQL  341
             A GPE VAF+  GEGPY GV+DGR+LK+      +IDFA TS  R K  C       L+ 
Sbjct  53    ASGPESVAFDPSGEGPYVGVSDGRVLKWRGESLGWIDFAHTSTNREK--CVRPFAPELEH  110

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES-  518
             +CGRPLGL F  +TGDLYIAD  FGLL VGP GGLA  L    +G+ F FTN + +DE  
Sbjct  111   VCGRPLGLRFDKKTGDLYIADAYFGLLVVGPAGGLAKPLVTEADGVPFRFTNDLDIDEEE  170

Query  519   -TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               +YF D+   F    F     + D +GRL+KY+  + +VTV+L+G++   G+A+SKD++
Sbjct  171   DVIYFTDTSTRFQRRQFLAAVLNFDKTGRLMKYDRSSKKVTVLLQGIAFANGVALSKDRS  230

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             F+L++E    KI +  + GP A T     +L G PDNV++ ++G +WVA++  K    + 
Sbjct  231   FVLVAETTTCKILRLWLSGPNAGTQDVFAELPGFPDNVRKNSNGEFWVALHSKKGLFAKL  290

Query  876   LI----------------PMTESI---------AVKFDRNGKILDRKNVTSAYPNSF-SA  977
              +                P   S+         A+K   +G++L+           F S 
Sbjct  291   SLTQPWFRDLVLRLPISGPRLHSVFIGGRPHATAMKLSESGEVLEVLEDKEGKRLRFISE  350

Query  978   YLEHFGKAYTGSLVPNFLGVYTL  1046
               E  GK + GS++  FLGVY L
Sbjct  351   VEEKDGKLWIGSVLMPFLGVYDL  373



>ref|NP_001051286.2| Os03g0750700 [Oryza sativa Japonica Group]
 dbj|BAF13200.2| Os03g0750700 [Oryza sativa Japonica Group]
Length=399

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 122/320 (38%), Positives = 177/320 (55%), Gaps = 31/320 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE VAF+  G GPYTGVADGR++++   +++ FA +SP  T  +C    + +  L    
Sbjct  74    GPESVAFDPLGRGPYTGVADGRVVRWDGARWVYFAHSSPNWTAELCGHKASPLDYLKDEH  133

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES-  518
             ICGR LGL F  RTGDLYIAD  FGLLKVGP GGLAT LA    G++F+FTN + LD+  
Sbjct  134   ICGRALGLRFDRRTGDLYIADAYFGLLKVGPDGGLATPLATEAEGVRFNFTNDLDLDDDG  193

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF DS + +   +F ++  SGD SGRLLKY+  T + TV+ R +  P G+++SKD  F
Sbjct  194   NVYFTDSSIHYQRRHFMQLVFSGDPSGRLLKYDPNTKKATVLHRNIQFPNGVSMSKDGLF  253

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNI---------  851
              +  E    ++++Y +KG KA T      L G PDNV+    G +WVA++          
Sbjct  254   FVFCEGSRGRLSRYWLKGEKAGTVDLFAILPGFPDNVRTNDKGEFWVAIHCRRSIYARMV  313

Query  852   -----LKppqpqqLIPMT-----------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                  L+       IP              ++ +K++  G++LD  ++ T     + S  
Sbjct  314   SRNVRLRKFLLSLPIPAKYHYLMQIGGKLHALIIKYNPEGEVLDILEDTTGQVVRAVSEV  373

Query  981   LEHFGKAYTGSLVPNFLGVY  1040
              E  GK + GS++  F+ V+
Sbjct  374   EEKDGKLWIGSVLMPFIAVF  393



>gb|EYU18639.1| hypothetical protein MIMGU_mgv1a009932mg [Erythranthe guttata]
Length=327

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/232 (44%), Positives = 151/232 (65%), Gaps = 7/232 (3%)
 Frame = +3

Query  168  AIGPEDVAFNGKGEGPYTGVADGRILKYYNG--KFIDFATTSPLRTKVICDGTNN-TILQ  338
            A+GPE  AF+G G GPYTGV+DGRI+++ +   +++DFA TSP R    C+G+++ + ++
Sbjct  5    AVGPESFAFDGSGGGPYTGVSDGRIIRWRDNESRWVDFAVTSPDRNG--CEGSHDHSKME  62

Query  339  LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
             ICGRPLGL F+ ++GDLYIAD   GLL VGP GG A+ +A  VN +   FTN++ +D+ 
Sbjct  63   HICGRPLGLRFNQKSGDLYIADAYMGLLVVGPNGGRASPVAQQVNRVALRFTNSLDIDQD  122

Query  519  T--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
            +  VYF DS   F   N   I  SGD +GRL+K+E  T + T++L  L  P G+A+S++ 
Sbjct  123  SGVVYFTDSSTRFQRRNHLPIIISGDNTGRLMKFEPTTNKTTLLLDNLKFPNGVALSQNG  182

Query  693  TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVN  848
             FLL  E     + K+ +K PK+   ++L +  G PDN+KR  +G +WV +N
Sbjct  183  EFLLFVETTTCTLFKFWLKTPKSGNLESLAQFPGFPDNIKRNRNGEFWVGIN  234



>ref|XP_010672984.1| PREDICTED: strictosidine synthase 1-like [Beta vulgaris subsp. 
vulgaris]
Length=375

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 120/322 (37%), Positives = 178/322 (55%), Gaps = 33/322 (10%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKY--YNGKFIDFATTSPLRTKVICD-GTNNTILQ  338
             A GPE +AF+  G+GPY G++DGRI+K+  +  +++DFA TSPLR   +C+  +N+  ++
Sbjct  51    AFGPESLAFDAAGDGPYAGISDGRIIKWLPHQRRWVDFAFTSPLRE--VCEKQSNHEQME  108

Query  339   LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
               CGRPLGL F+ +TG+LYIAD   GLL VGP GGLA  +A  V GI   FTN + +D+ 
Sbjct  109   HKCGRPLGLSFNDKTGELYIADAYLGLLVVGPNGGLARSVATEVEGIPLGFTNGLDIDQQ  168

Query  519   T--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
             +  VYF  S   +   ++  +  S D +GRLLKY+ ET +VT +L  L+ P G+++SK++
Sbjct  169   SGDVYFTSSSTRYPRRSYMSLILSNDKTGRLLKYDPETKQVTKLLDNLTFPNGVSLSKNR  228

Query  693   TFLLISEFIAKKITKYIIKG-PKANTTQTLLKLEGQPDNVKRATSGGYWVAV-----NIL  854
              FLL+ E  + +I +Y +K  PK+ T + L +L G PDN+K  + G YWV +      +L
Sbjct  229   KFLLLIETTSCQILRYWLKNTPKSGTVEVLAELPGYPDNIKMNSKGQYWVGIYSKRGKVL  288

Query  855   KppqpqqLI-------PMTE-------------SIAVKFDRNGKILDRKNVTSAYPNSFS  974
             K       +       P                 +AVK D N  +L      S      S
Sbjct  289   KWLLSYHWVGNTIVKLPFNAVELVKLFVRLRAIGLAVKLDENCNVLQMLEDKSGMLKFVS  348

Query  975   AYLEHFGKAYTGSLVPNFLGVY  1040
               +E  G  + GS+V  F  +Y
Sbjct  349   EVVEKDGNLWFGSVVLPFASLY  370



>ref|XP_009797832.1| PREDICTED: strictosidine synthase 3-like [Nicotiana sylvestris]
Length=391

 Score =   201 bits (511),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 122/323 (38%), Positives = 176/323 (54%), Gaps = 32/323 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE +AF+ KG GPYTG+ADGRI+ +   K+ DFA TS  R+   CD   + +  L    
Sbjct  70    GPESIAFDPKGRGPYTGIADGRIVLWDGQKWTDFAYTSANRSGN-CDPKPSPLSYLANEH  128

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-ES  518
             ICGRPLGL F   TGDLYIAD  FG++KVG +GGLA  L     G+   FTN + +D E 
Sbjct  129   ICGRPLGLRFDKTTGDLYIADAYFGVMKVGLEGGLAETLTNEAEGVPLGFTNDLDIDDEG  188

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              +YF DS   +   NF  +  S + SGR+LKY+  T + TV+LR L  P GL++SKD++F
Sbjct  189   NIYFTDSSTKYQRRNFMLLVYSAEDSGRVLKYDPSTKQTTVLLRNLQFPNGLSLSKDRSF  248

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNI---------  851
              +  E    ++ KY +KG KA T++ +  L G PDN++    G +WVA++          
Sbjct  249   FVFCEGAKGRLQKYWLKGDKAGTSEVMAILPGYPDNIRANERGEFWVAIHCRRTIYSYIN  308

Query  852   -----LKppqpqqLIPMT-----------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                  L+    +  IP+             +I VK+  +GK+L   ++       + S  
Sbjct  309   SIYPKLRLFLLKLPIPVKLRSLLHLGGRLHAIVVKYSPDGKLLQILEDGEGKVVRAISEV  368

Query  981   LEHFGKAYTGSLVPNFLGVYTLK  1049
              E  GK + GS++  F+ VY L+
Sbjct  369   EERDGKLWMGSVLMPFIAVYQLE  391



>ref|XP_004963976.1| PREDICTED: strictosidine synthase-like [Setaria italica]
Length=352

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 115/298 (39%), Positives = 170/298 (57%), Gaps = 12/298 (4%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKY--YNGKFIDFATTSPLRTKVIC--DGTNNTILQL  341
             G E +AF+ +G+GPYTGV+DGRIL++   +  +  FA  +  + K IC         ++ 
Sbjct  61    GAESLAFDRRGQGPYTGVSDGRILRWDGSSNSWTTFAYNANYKNKPICTAPARRQEDVES  120

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST  521
             ICGRPLGL+F+ +TGDLYIAD   GL+KVG  GG A  LAA  +G+ F+FTN + +D+ T
Sbjct  121   ICGRPLGLQFYAKTGDLYIADAYLGLMKVGSNGGEAEVLAAEADGVPFTFTNGIDVDQVT  180

Query  522   --VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               +YF DS   +     T+I    D +GRLL+Y    GRVTV+  GL  P G+A+S D+T
Sbjct  181   GDIYFTDSSTTYTRARNTQIMIHRDVTGRLLRYNARAGRVTVLKAGLPYPNGVALSTDRT  240

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
              ++++     +  +Y I+GPKA   + L  L G  DN++R T GGYW A+N  K      
Sbjct  241   HVVVAHTGPCQAFRYWIRGPKAGRYELLADLPGYADNIRRDTRGGYWFALNREKINATAP  300

Query  876   LIPMTESIAVKFDRNGKILDRKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGVYTLK  1049
                    + V+ D  G  L+   +T+A   + S   E  GK + GS+  +++G+   K
Sbjct  301   ----EHLVGVRVDSKGAELE--VMTAAKGVTLSDIAEKDGKLWLGSVELDYVGLVNYK  352



>ref|XP_009765833.1| PREDICTED: strictosidine synthase 3 [Nicotiana sylvestris]
Length=391

 Score =   201 bits (511),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 122/326 (37%), Positives = 175/326 (54%), Gaps = 38/326 (12%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE +AF+ +G GPYTG+ADGR++ +   K+ DFA TS  R+  +CD   + +  L    
Sbjct  70    GPESIAFDPQGRGPYTGIADGRVVFWDGEKWNDFAYTSANRSG-LCDPKPSPMSYLKNEH  128

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-ES  518
             ICGRPLGL F  RTGDLYIAD  FGL+KVGP+GGLA  L     G+   FTN + +D E 
Sbjct  129   ICGRPLGLRFDKRTGDLYIADAYFGLVKVGPEGGLAESLTTEAEGVPLGFTNDLDVDNEG  188

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF DS   +   NF ++  S + SGR+LKY   T   TV++  L  P GL++SKD +F
Sbjct  189   NVYFTDSSTKYQRRNFMQLVFSAEDSGRVLKYNPRTKETTVLIHNLQFPNGLSLSKDGSF  248

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNI---------  851
              +  E    ++ KY +KG KA T++ +  L G PDNV+      +WVA++          
Sbjct  249   FIFCEGSKGRLRKYWLKGEKAGTSEVIAILPGYPDNVRANERNEFWVAIHCRRTIYSYIN  308

Query  852   -----LKppqpqqLIPMT-----------ESIAVKFDRNGKIL----DRKNVTSAYPNSF  971
                  L+    +  +P              ++ VK+   GK+L    DR+        + 
Sbjct  309   AIYPPLRQFLLKLPVPAKLQYLMHIGGRLHAVVVKYSPEGKLLQILEDRQGKVV---KAV  365

Query  972   SAYLEHFGKAYTGSLVPNFLGVYTLK  1049
             S   E  GK + GS++ +F+ VY L+
Sbjct  366   SEVEEREGKLWMGSVLMSFISVYQLE  391



>ref|XP_003609161.1| Strictosidine synthase [Medicago truncatula]
 gb|AES91358.1| SMP-30/gluconolaconase/LRE-like region protein [Medicago truncatula]
Length=326

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 119/300 (40%), Positives = 172/300 (57%), Gaps = 20/300 (7%)
 Frame = +3

Query  171   IGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNN-TILQL  341
             IGPE +AF+  G GPY   +DGRI KY      F ++A TSP R + ICDG ++ + +Q 
Sbjct  37    IGPEALAFDRNGGGPYVTSSDGRIFKYVGPSEGFKEYAYTSPNRNRTICDGFSDFSNIQA  96

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST  521
             ICGRPLGL F+ +TGDLY AD  +GL+KVGP GG ATQL          F N + +D +T
Sbjct  97    ICGRPLGLGFNHQTGDLYAADGYYGLVKVGPNGGKATQLVGPAQSNSTVFANGLDVDSNT  156

Query  522   --VYFVDSGLIFLTGNFTKIAQSG---DTSGRLLKYEMETGRVTVVLRGLSGPAGLAISK  686
               VYF  +   F   +F     +G   D SG LL Y+    + TV LR L+  +G+A+S 
Sbjct  157   GIVYFTIASTKFQPKDFPTALLTGGIGDNSGSLLSYDPSNNQTTVFLRNLTFASGVAVSG  216

Query  687   DKTFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppq  866
             D +F+L+SE+ A +I +  +KGPKAN++   + L G+PDN+KR + G +W+AVN      
Sbjct  217   DGSFVLVSEYFANRIRRVWLKGPKANSSDLFMLLAGRPDNIKRNSRGQFWIAVNT-----  271

Query  867   pqqLIPMTESIAVKFDRNGKILDRKNVTSAYP-NSFSAYLEHFGKAYTGSLVPNFLGVYT  1043
                   +T S  V+   NG +L   ++   Y   + S   E+ G  Y GSL+ ++  ++T
Sbjct  272   ------VTLSSGVRVTENGIVLQIVSLVEEYGLEAASEVQEYNGTLYGGSLLASYAIIFT  325



>ref|XP_010042385.1| PREDICTED: strictosidine synthase 1-like [Eucalyptus grandis]
Length=372

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 124/323 (38%), Positives = 173/323 (54%), Gaps = 32/323 (10%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQL  341
             A GPE +AF+  G GPYTGVADGRILK+   +  ++DFA TS  R    C       L+ 
Sbjct  51    AFGPESLAFDPSGGGPYTGVADGRILKWEGDERGWVDFAFTSSRRKD--CIRPFAPELEH  108

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES-  518
             +CGRPLGL F  +TGDLYIAD  FGL+ VGP GGLAT +A+   G  F  TN + +DES 
Sbjct  109   VCGRPLGLRFDKKTGDLYIADAYFGLMVVGPDGGLATLVASEAEGKPFRLTNDLDIDESE  168

Query  519   -TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               +YF DS   F    F     SGD +GRL+KY+  +  + V+LRGL+ P G+A+SKD  
Sbjct  169   DVIYFTDSSTTFQRRQFLSACLSGDKTGRLMKYDKSSKELKVLLRGLTFPNGVALSKDGL  228

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             FLL+ E    +I +  +KGP A       +L G PDN++R + G +WVA++  K P  + 
Sbjct  229   FLLVVETATYRILRLWLKGPNAGKLDIFAELPGFPDNIRRNSRGEFWVALHSKKGPASRF  288

Query  876   L------------IPMT-------------ESIAVKFDRNGKILDRKNVTSAYPNSF-SA  977
                          +P++             ++IA+K    G+IL+           F S 
Sbjct  289   FLSSSLIGNFALRLPISFQQLHSLVVGGKADAIAIKLGEEGEILEVVEDAEGKTVQFLSE  348

Query  978   YLEHFGKAYTGSLVPNFLGVYTL  1046
               E   K +  S++  F+ +Y L
Sbjct  349   VEERDDKLWIASVMRPFIAIYDL  371



>ref|XP_002456721.1| hypothetical protein SORBIDRAFT_03g041380 [Sorghum bicolor]
 gb|EES01841.1| hypothetical protein SORBIDRAFT_03g041380 [Sorghum bicolor]
Length=347

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 113/297 (38%), Positives = 175/297 (59%), Gaps = 11/297 (4%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDG--TNNTILQL  341
             G E +AF+GKGEGPY GV+DGR+LK+      +  +A ++  R   +C      +T  + 
Sbjct  51    GAESLAFDGKGEGPYAGVSDGRVLKWGGSSVGWTTYAHSANYRKIPLCTAGVLPSTETES  110

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVN-GIKFSFTNAVALDES  518
             +CGRPLGL+FH +TGDLYIAD   GL++VGP GG A  LA G + G+ F+F N + +D++
Sbjct  111   LCGRPLGLQFHAKTGDLYIADAYLGLMRVGPGGGEAEVLATGSDDGVPFNFVNGLDVDQA  170

Query  519   T--VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
             T  VYF DS   +     T+I  + D +GRLL+Y+  TG VTV+  GL  P G+A+S+D 
Sbjct  171   TGDVYFTDSSATYPRRFNTEIMMNADATGRLLRYDARTGGVTVLRSGLPYPNGVAVSRDG  230

Query  693   TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKpp--q  866
               ++++  +  +  +Y ++G +A   + L  L G PDNV+R   GGYWVA+N  K     
Sbjct  231   AQVVVAHTVPCQAFRYFLRGARAGQYELLADLPGYPDNVRRDGKGGYWVALNQEKQRLDA  290

Query  867   pqqLIPMTESIAVKFDRNGKILDRKNVTSAYPNSFSAYLEHFGKAYTGSLVPNFLGV  1037
               +  P+   + V+ D  G  ++ + +T+A   + S   E  GK + GS+   ++G+
Sbjct  291   TSETAPVKHLVGVRLDAQG--VEVEELTAAKGVTLSDVAERRGKLWLGSVELEYVGL  345



>ref|XP_006344500.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Solanum tuberosum]
Length=388

 Score =   201 bits (510),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 105/232 (45%), Positives = 148/232 (64%), Gaps = 7/232 (3%)
 Frame = +3

Query  168  AIGPEDVAFNGKGEGPYTGVADGRILKYYNG--KFIDFATTSPLRTKVICDG-TNNTILQ  338
            A+GPE  AF+  G+GPYTGV+DGRI+K+     ++ DFA TSP R    C+G  +++  +
Sbjct  52   AVGPESFAFDPHGDGPYTGVSDGRIIKWLQNETRWFDFALTSPNRDG--CEGFHDHSTSE  109

Query  339  LICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES  518
              CGRPLGLEF   +GDL+IAD   GLL VGP GGLATQ+A    G+ F FTN++ +D++
Sbjct  110  HKCGRPLGLEFDENSGDLFIADAYLGLLVVGPNGGLATQVAKFAQGVPFGFTNSLCIDQN  169

Query  519  --TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDK  692
               +YF DS   +   +   +  SGD +GRL+KY+M+  +V+++L+ L  P G+AISK  
Sbjct  170  HGVLYFTDSSTTYSRRSHISVIVSGDDTGRLMKYDMKNKQVSILLKNLKFPNGIAISKHG  229

Query  693  TFLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVN  848
             FLL  E    KI K  +K  KA + + + +L G PDN+KR   G +WV VN
Sbjct  230  DFLLFVETTTCKIFKLWLKTSKAGSVEVVSELPGFPDNIKRNKKGEFWVGVN  281



>ref|XP_004508606.1| PREDICTED: strictosidine synthase 1-like [Cicer arietinum]
Length=334

 Score =   199 bits (506),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 122/303 (40%), Positives = 178/303 (59%), Gaps = 21/303 (7%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYY--NGKFIDFATTSPLRTKVICDGTNN-TILQLI  344
             GPE +AF+  GEGPY   +DGRILKY   N  F ++A TSP R K ICDG  + + +Q  
Sbjct  39    GPESLAFDRNGEGPYVSSSDGRILKYLGPNYGFKEYAVTSPNRNKTICDGLADFSAIQAT  98

Query  345   CGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDEST-  521
             CGRPLGL F+ +T DLY+AD  FGL+KVGP G   TQL          F + + +D+ T 
Sbjct  99    CGRPLGLGFNHQTNDLYVADAYFGLIKVGPNGENVTQLVGPAKPNSTRFGDGLDVDQDTG  158

Query  522   -VYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF ++   F   +F  +  SGD+SG LL Y+  T + TV+L  L+ P+G+A+S D +F
Sbjct  159   IVYFTEASTNFQLKDFQTLLNSGDSSGSLLSYDPSTNQTTVLLSNLALPSGVAVSLDGSF  218

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
             +L+SE++A +I +  IKGP+ANT++  ++L G+PDN+KR + G +W++VN          
Sbjct  219   VLVSEYLANRIQRVWIKGPRANTSELFMQLPGRPDNIKRNSRGQFWISVN--------SF  270

Query  879   IP-------MTESIAVKFDRNGKILDRKNVTSAYPNSFSAYLEHF-GKAYTGSLVPNFLG  1034
             IP        T    V+   NG +L   ++   Y     + ++ F G  Y GSL+ +F  
Sbjct  271   IPPPRFPRRSTLPAGVRVGANGLVLQIVSLVPEYGTEPVSEVQEFNGTLYGGSLLASFAS  330

Query  1035  VYT  1043
             V+T
Sbjct  331   VFT  333



>ref|XP_010023798.1| PREDICTED: strictosidine synthase 1-like [Eucalyptus grandis]
 gb|KCW90055.1| hypothetical protein EUGRSUZ_A02257 [Eucalyptus grandis]
Length=372

 Score =   200 bits (508),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 124/323 (38%), Positives = 173/323 (54%), Gaps = 32/323 (10%)
 Frame = +3

Query  168   AIGPEDVAFNGKGEGPYTGVADGRILKYYNGK--FIDFATTSPLRTKVICDGTNNTILQL  341
             A GPE +AF+  G GPYTGVADGRILK+   +  ++DFA TS  R    C       L+ 
Sbjct  51    AFGPESLAFDPSGGGPYTGVADGRILKWEGDERGWVDFAFTSSRRKD--CIRPFAPELEH  108

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES-  518
             +CGRPLGL F  +TGDLYIAD  FGL+ VGP GGLAT +A+   G  F  TN + +DES 
Sbjct  109   VCGRPLGLRFDKKTGDLYIADAYFGLMVVGPDGGLATLVASEAEGKPFRLTNDLDIDESE  168

Query  519   -TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKT  695
               +YF DS   F    F     SGD +GRL+KY+  +  + V+LRGL+ P G+A+SKD  
Sbjct  169   DVIYFTDSSTTFQRRQFLSACLSGDKTGRLMKYDKSSKELKVLLRGLTFPNGVALSKDGL  228

Query  696   FLLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqq  875
             FLL+ E    +I +  +KGP A       +L G PDN++R + G +WVA++  K P  + 
Sbjct  229   FLLVVETATYRILRLWLKGPNAGKLDIFAELPGFPDNIRRNSRGEFWVALHSKKGPASRF  288

Query  876   L------------IPMT-------------ESIAVKFDRNGKILDRKNVTSAYPNSF-SA  977
                          +P++             ++IA+K    G+IL+           F S 
Sbjct  289   FLSSSLIGNFALRLPISFQQLHSLVVGGKADAIAIKLGEEGEILEVVEDAEGKTVQFLSE  348

Query  978   YLEHFGKAYTGSLVPNFLGVYTL  1046
               E   K +  S++  F+ +Y L
Sbjct  349   VEERDDKLWIASVMRPFIAIYDL  371



>ref|XP_010253308.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Nelumbo nucifera]
 ref|XP_010253309.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Nelumbo nucifera]
Length=391

 Score =   201 bits (510),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 127/323 (39%), Positives = 173/323 (54%), Gaps = 32/323 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
              PE V F+  G GPYTG ADGRI+ +    + DFA TSP R+  +C+   +    L    
Sbjct  70    APESVVFDSLGRGPYTGTADGRIVLWNGESWTDFAFTSPNRSD-LCNPKPSIFNYLNDEH  128

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALD-ES  518
             ICGRPLGL F  RTGDLYIAD  FGL+KVGP+GG AT LA  V GI F FTN + +D E 
Sbjct  129   ICGRPLGLRFDKRTGDLYIADAYFGLMKVGPEGGQATLLATEVEGIPFGFTNDLDIDDEG  188

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF DS   +   NF  +  SG+  GRLLKY   T   TV++R L  P G+++SKDK+F
Sbjct  189   NVYFTDSSTKYQRRNFLLLVFSGEPDGRLLKYNPVTKETTVLVRNLQFPNGVSLSKDKSF  248

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVN----------  848
             L+       K+ +Y +KG KA TT     L G PDNV+   +G +WVA++          
Sbjct  249   LVFCHGHPGKLMRYWLKGDKAGTTDAFAILPGFPDNVRSNDNGEFWVAIHSRRTMYGYVN  308

Query  849   --ILKppqpqqLIPMT-------------ESIAVKFDRNGKI-LDRKNVTSAYPNSFSAY  980
                 K  +    +P++              ++ +K+   GK+ L  ++       + S  
Sbjct  309   GLYPKLRKFFLNLPISAKLQYLLTVGGRPHAMVIKYSFEGKVLLVLEDSQGKLVKAVSGV  368

Query  981   LEHFGKAYTGSLVPNFLGVYTLK  1049
              E  GK + GS++  F+ VY LK
Sbjct  369   EEKDGKLWIGSILMPFIAVYHLK  391



>ref|XP_010475646.1| PREDICTED: strictosidine synthase 3-like [Camelina sativa]
Length=393

 Score =   201 bits (510),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 119/322 (37%), Positives = 174/322 (54%), Gaps = 31/322 (10%)
 Frame = +3

Query  174   GPEDVAFNGKGEGPYTGVADGRILKYYNGKFIDFATTSPLRTKVICDGTNNTILQL----  341
             GPE +AF+  G GPYTGVADGRIL +    + DFA TS  R+K +CD   + +  L    
Sbjct  71    GPESIAFDPLGRGPYTGVADGRILFWNGSLWSDFAYTSINRSKELCDLKPSLLDYLKDEH  130

Query  342   ICGRPLGLEFHPRTGDLYIADVNFGLLKVGPKGGLATQLAAGVNGIKFSFTNAVALDES-  518
             ICGRPLGL F  +TGDLYIAD   G++KVGP+GGLAT L    +G+   FTN + +DE  
Sbjct  131   ICGRPLGLRFDKKTGDLYIADAYLGIMKVGPEGGLATSLTTEADGVPLRFTNDLDVDEEG  190

Query  519   TVYFVDSGLIFLTGNFTKIAQSGDTSGRLLKYEMETGRVTVVLRGLSGPAGLAISKDKTF  698
              VYF DS  +F    F  +  SG+ +GR+LKY  +T   T ++R L  P G+++ KD +F
Sbjct  191   NVYFTDSSSVFQRRKFMLLIVSGEDTGRVLKYNPKTKETTTLVRNLQFPNGVSLGKDGSF  250

Query  699   LLISEFIAKKITKYIIKGPKANTTQTLLKLEGQPDNVKRATSGGYWVAVNILKppqpqqL  878
              +  E    ++ KY +KG KA T++ +  L G PDN++    G +WVAV+  +      +
Sbjct  251   FIFCEGSIGRLRKYWLKGEKAGTSEVVALLHGFPDNIRTNKDGDFWVAVHGHRNIFTHVM  310

Query  879   ------------IPMT-------------ESIAVKFDRNGKILD-RKNVTSAYPNSFSAY  980
                         +P++               + VK+   GK+L   ++       + S  
Sbjct  311   AHYPRVRKFFLKLPISVKFQYLLQVGGWPHGVVVKYSEEGKVLKVLEDSQGKVVKAVSEV  370

Query  981   LEHFGKAYTGSLVPNFLGVYTL  1046
              E  GK + GS++ +F+ VY L
Sbjct  371   EEKDGKLWMGSVLMSFIAVYDL  392



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3025133731368