BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13441_g1_i1 len=961 path=[1083:0-406 146:407-667 1749:668-960]

Length=961
                                                                      Score     E

ref|XP_011093369.1|  PREDICTED: protein FRA10AC1 isoform X1             343   2e-114   
ref|XP_009590157.1|  PREDICTED: protein FRA10AC1                        343   2e-114   
ref|XP_011093371.1|  PREDICTED: protein FRA10AC1 isoform X3             343   2e-114   
ref|XP_009775584.1|  PREDICTED: protein FRA10AC1                        337   4e-112   
gb|KDP43478.1|  hypothetical protein JCGZ_16765                         326   1e-107   
ref|XP_003633561.1|  PREDICTED: protein FRA10AC1 isoform X1             323   2e-106   
ref|XP_007052523.1|  Uncharacterized protein isoform 1                  322   2e-106   
gb|KHN19455.1|  Protein FRA10AC1 like                                   322   4e-106   
ref|XP_007133818.1|  hypothetical protein PHAVU_011G211400g             317   4e-104   
ref|XP_004237943.1|  PREDICTED: protein FRA10AC1                        318   4e-104   
ref|XP_011047394.1|  PREDICTED: protein FRA10AC1                        317   5e-104   
ref|XP_003541610.1|  PREDICTED: protein FRA10AC1-like isoform X1        316   7e-104   
gb|KHN37623.1|  Protein FRA10AC1 like                                   316   7e-104   
ref|XP_010659346.1|  PREDICTED: protein FRA10AC1 isoform X2             315   1e-103   
ref|XP_010257221.1|  PREDICTED: protein FRA10AC1 homolog                315   1e-103   
ref|XP_006363292.1|  PREDICTED: protein FRA10AC1-like                   316   2e-103   
ref|XP_002299940.1|  hypothetical protein POPTR_0001s27310g             315   2e-103   Populus trichocarpa [western balsam poplar]
gb|KHG24922.1|  Protein FRA10AC1                                        314   6e-103   
ref|XP_004510987.1|  PREDICTED: protein FRA10AC1-like                   312   3e-102   
ref|XP_002870265.1|  predicted protein                                  311   5e-102   
ref|XP_008461295.1|  PREDICTED: protein FRA10AC1                        310   1e-101   
ref|XP_004135932.1|  PREDICTED: protein FRA10AC1-like                   310   1e-101   
gb|AAC31614.1|  Phyb1                                                   310   2e-101   Spuriopimpinella brachycarpa
ref|XP_010440356.1|  PREDICTED: protein FRA10AC1 homolog isoform X1     310   2e-101   
ref|XP_010435008.1|  PREDICTED: protein FRA10AC1 homolog                312   2e-101   
ref|NP_001241993.1|  uncharacterized protein LOC100782621               309   5e-101   
ref|XP_009147899.1|  PREDICTED: protein FRA10AC1                        309   5e-101   
gb|KFK22903.1|  hypothetical protein AALP_AAs72951U000400               309   6e-101   
ref|XP_006591860.1|  PREDICTED: uncharacterized protein LOC100782...    307   4e-100   
ref|XP_010440357.1|  PREDICTED: protein FRA10AC1 homolog isoform X2     305   1e-99    
ref|XP_006439111.1|  hypothetical protein CICLE_v10032186mg             307   2e-99    
ref|XP_010496120.1|  PREDICTED: protein FRA10AC1-like                   304   3e-99    
ref|XP_010067869.1|  PREDICTED: protein FRA10AC1                        305   4e-99    
ref|XP_008231252.1|  PREDICTED: protein FRA10AC1 isoform X2             304   4e-99    
ref|XP_007218450.1|  hypothetical protein PRUPE_ppa011769mg             302   5e-99    
ref|XP_006482872.1|  PREDICTED: protein FRA10AC1-like isoform X1        306   6e-99    
ref|XP_006482873.1|  PREDICTED: protein FRA10AC1-like isoform X2        304   8e-99    
gb|KDO83420.1|  hypothetical protein CISIN_1g020178mg                   305   2e-98    
ref|XP_008231251.1|  PREDICTED: protein FRA10AC1 isoform X1             303   2e-98    
gb|KDO83419.1|  hypothetical protein CISIN_1g020178mg                   305   3e-98    
ref|XP_006838318.1|  hypothetical protein AMTR_s00103p00136340          301   6e-98    
gb|KEH19085.1|  folate-sensitive fragile site protein FRA10AC1          300   1e-97    
emb|CDY50277.1|  BnaAnng10410D                                          299   3e-97    
ref|XP_004306537.1|  PREDICTED: protein FRA10AC1-like                   298   9e-97    
ref|XP_009354749.1|  PREDICTED: protein FRA10AC1 isoform X1             298   1e-96    
ref|XP_010523674.1|  PREDICTED: protein FRA10AC1 homolog isoform X1     296   3e-96    
ref|XP_009354751.1|  PREDICTED: protein FRA10AC1 isoform X3             294   9e-96    
ref|XP_009354750.1|  PREDICTED: protein FRA10AC1 isoform X2             294   1e-95    
ref|XP_006414606.1|  hypothetical protein EUTSA_v10026084mg             295   1e-95    
ref|XP_008375179.1|  PREDICTED: protein FRA10AC1                        295   1e-95    
ref|NP_193239.5|  FRA10AC1 domain-containing protein                    295   3e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002521375.1|  Protein FRA10AC1, putative                         289   2e-94    Ricinus communis
ref|XP_010695220.1|  PREDICTED: protein FRA10AC1                        294   2e-94    
ref|XP_009354753.1|  PREDICTED: protein FRA10AC1 isoform X4             285   3e-92    
ref|XP_010909903.1|  PREDICTED: protein FRA10AC1 isoform X3             286   3e-92    
ref|NP_001154235.1|  FRA10AC1 domain-containing protein                 287   6e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010088231.1|  hypothetical protein L484_012513                   286   8e-92    
ref|XP_009385411.1|  PREDICTED: protein FRA10AC1 isoform X1             284   2e-91    
ref|XP_002449911.1|  hypothetical protein SORBIDRAFT_05g025520          284   2e-91    Sorghum bicolor [broomcorn]
ref|XP_004979825.1|  PREDICTED: protein FRA10AC1-like isoform X1        277   2e-88    
ref|XP_008667693.1|  PREDICTED: uncharacterized protein LOC100277...    277   3e-88    
ref|XP_004979826.1|  PREDICTED: protein FRA10AC1-like isoform X2        276   5e-88    
ref|XP_003577303.1|  PREDICTED: protein FRA10AC1 isoform X1             275   9e-88    
emb|CDP07783.1|  unnamed protein product                                271   3e-87    
ref|XP_009385412.1|  PREDICTED: protein FRA10AC1 isoform X2             269   2e-86    
ref|XP_010523675.1|  PREDICTED: protein FRA10AC1 isoform X2             269   2e-86    
emb|CDY47802.1|  BnaC01g22580D                                          275   3e-86    
ref|XP_006594409.1|  PREDICTED: protein FRA10AC1-like isoform X2        271   3e-86    
ref|XP_006663072.1|  PREDICTED: protein FRA10AC1-like                   271   3e-86    
ref|XP_006594410.1|  PREDICTED: protein FRA10AC1-like isoform X3        270   5e-86    
ref|NP_001144502.1|  uncharacterized protein LOC100277486               267   8e-86    Zea mays [maize]
tpg|DAA42340.1|  TPA: hypothetical protein ZEAMMB73_484226              270   1e-85    
ref|XP_010909901.1|  PREDICTED: protein FRA10AC1 homolog isoform X1     269   4e-85    
gb|EEC68520.1|  hypothetical protein OsI_36803                          268   1e-84    Oryza sativa Indica Group [Indian rice]
gb|EPS60799.1|  hypothetical protein M569_14002                         265   2e-84    
ref|XP_010237497.1|  PREDICTED: protein FRA10AC1 isoform X2             263   2e-84    
ref|XP_011093370.1|  PREDICTED: protein FRA10AC1 isoform X2             266   3e-84    
ref|XP_007052524.1|  Uncharacterized protein isoform 2                  263   8e-84    
gb|ACF87114.1|  unknown                                                 258   6e-82    Zea mays [maize]
gb|KGN45127.1|  hypothetical protein Csa_7G428150                       254   3e-80    
ref|XP_001766488.1|  predicted protein                                  239   3e-73    
ref|XP_008790724.1|  PREDICTED: protein FRA10AC1 homolog isoform X1     226   7e-70    
ref|XP_010909902.1|  PREDICTED: protein FRA10AC1 homolog isoform X2     225   3e-68    
gb|EMT24526.1|  hypothetical protein F775_23674                         218   1e-65    
gb|EMS53478.1|  hypothetical protein TRIUR3_00682                       217   2e-65    
gb|ABA94971.2|  expressed protein                                       211   8e-63    Oryza sativa Japonica Group [Japonica rice]
emb|CBI24891.3|  unnamed protein product                                206   4e-62    
ref|XP_011093372.1|  PREDICTED: protein FRA10AC1 isoform X4             203   3e-60    
ref|XP_001700097.1|  predicted protein                                  199   6e-59    Chlamydomonas reinhardtii
ref|XP_008790732.1|  PREDICTED: protein FRA10AC1 isoform X2             191   9e-57    
ref|XP_003922429.1|  PREDICTED: protein FRA10AC1                        191   2e-54    
ref|XP_005991631.1|  PREDICTED: protein FRA10AC1                        192   2e-54    
emb|CAD24474.1|  FRA10AC1 protein                                       188   1e-53    Homo sapiens [man]
gb|EAW50059.1|  chromosome 10 open reading frame 4, isoform CRA_d       187   2e-53    
emb|CAD24472.1|  FRA10AC1 protein                                       188   2e-53    Homo sapiens [man]
gb|EAW50060.1|  chromosome 10 open reading frame 4, isoform CRA_e       188   2e-53    
emb|CAD24473.1|  FRA10AC1 protein                                       188   2e-53    Homo sapiens [man]
ref|XP_004337706.1|  hypothetical protein ACA1_378110                   186   3e-53    
gb|EAW50055.1|  chromosome 10 open reading frame 4, isoform CRA_a       188   3e-53    
ref|XP_007053063.1|  PREDICTED: protein FRA10AC1                        189   3e-53    
emb|CAD24471.1|  FRA10AC1 protein                                       188   3e-53    Homo sapiens [man]
ref|XP_004580114.1|  PREDICTED: protein FRA10AC1                        188   4e-53    
emb|CAD24470.1|  FRA10AC1 protein                                       188   5e-53    Homo sapiens [man]
gb|EAW50058.1|  chromosome 10 open reading frame 4, isoform CRA_c       187   5e-53    
ref|XP_009696348.1|  PREDICTED: protein FRA10AC1                        188   5e-53    
gb|KFZ45985.1|  Protein FRA10AC1                                        187   6e-53    
gb|KFP57668.1|  Protein FRA10AC1                                        187   6e-53    
gb|AAH18007.1|  C10orf4 protein                                         187   6e-53    Homo sapiens [man]
ref|XP_006926003.1|  PREDICTED: protein FRA10AC1                        187   7e-53    
ref|XP_006630353.1|  PREDICTED: protein FRA10AC1-like                   187   7e-53    
ref|XP_010160374.1|  PREDICTED: protein FRA10AC1                        187   8e-53    
ref|XP_010199882.1|  PREDICTED: protein FRA10AC1                        187   8e-53    
ref|XP_003255284.1|  PREDICTED: protein FRA10AC1 isoform 2              187   1e-52    
gb|KFO14954.1|  Protein FRA10AC1                                        187   1e-52    
ref|XP_005566033.1|  PREDICTED: protein FRA10AC1 isoform X1             187   1e-52    
ref|XP_008113535.1|  PREDICTED: protein FRA10AC1 isoform X2             187   1e-52    
ref|XP_002821041.1|  PREDICTED: protein FRA10AC1                        186   1e-52    
gb|KFP95568.1|  Protein FRA10AC1                                        187   1e-52    
ref|XP_007961785.1|  PREDICTED: protein FRA10AC1 isoform X2             186   1e-52    
ref|XP_002957696.1|  alpha-1,2-mannosidase                              195   1e-52    
ref|XP_002756492.1|  PREDICTED: protein FRA10AC1                        186   1e-52    Callithrix jacchus [common marmoset]
ref|XP_004680672.1|  PREDICTED: protein FRA10AC1 isoform X2             185   1e-52    
ref|XP_507931.2|  PREDICTED: protein FRA10AC1                           186   1e-52    Pan troglodytes
ref|NP_660289.2|  protein FRA10AC1                                      186   1e-52    Homo sapiens [man]
gb|KFV40069.1|  Protein FRA10AC1                                        185   2e-52    
ref|NP_001253649.1|  fragile site, folic acid type, rare, fra(10)...    186   2e-52    
ref|XP_009818244.1|  PREDICTED: protein FRA10AC1                        185   2e-52    
ref|XP_004653276.1|  PREDICTED: protein FRA10AC1                        186   2e-52    
gb|KFW62865.1|  Protein FRA10AC1                                        186   2e-52    
ref|XP_003783761.1|  PREDICTED: protein FRA10AC1                        186   2e-52    
ref|XP_005333779.1|  PREDICTED: protein FRA10AC1                        186   2e-52    
gb|EHH19239.1|  hypothetical protein EGK_19913                          186   2e-52    
gb|KFV82804.1|  Protein FRA10AC1                                        186   2e-52    
gb|KFQ91241.1|  Protein FRA10AC1                                        186   2e-52    
gb|KFP07161.1|  Protein FRA10AC1                                        186   3e-52    
gb|KFZ61629.1|  Protein FRA10AC1                                        186   3e-52    
gb|EOB05670.1|  Protein FRA10AC1-like protein                           181   3e-52    
ref|XP_008790741.1|  PREDICTED: protein FRA10AC1 homolog isoform X3     179   3e-52    
gb|KFP58404.1|  Protein FRA10AC1                                        185   3e-52    
ref|XP_004607413.1|  PREDICTED: protein FRA10AC1                        186   3e-52    
ref|XP_010308972.1|  PREDICTED: protein FRA10AC1                        187   3e-52    
ref|XP_008050367.1|  PREDICTED: protein FRA10AC1 isoform X1             186   3e-52    
ref|XP_008050368.1|  PREDICTED: protein FRA10AC1 isoform X2             185   4e-52    
ref|XP_008587054.1|  PREDICTED: protein FRA10AC1                        185   4e-52    
ref|XP_005013693.1|  PREDICTED: protein FRA10AC1 homolog                187   4e-52    
gb|KGL96254.1|  Protein FRA10AC1                                        185   4e-52    
gb|KFP18682.1|  Protein FRA10AC1                                        185   4e-52    
ref|XP_004370004.1|  PREDICTED: protein FRA10AC1                        185   5e-52    
gb|ELR60081.1|  Protein FRA10AC1                                        184   5e-52    
ref|XP_001502472.1|  PREDICTED: protein FRA10AC1                        185   5e-52    Equus caballus [domestic horse]
ref|XP_008935605.1|  PREDICTED: protein FRA10AC1                        185   5e-52    
gb|KFO91434.1|  Protein FRA10AC1                                        185   5e-52    
ref|XP_004680671.1|  PREDICTED: protein FRA10AC1 isoform X1             185   5e-52    
ref|XP_005958927.1|  PREDICTED: protein FRA10AC1                        185   5e-52    
ref|XP_010356220.1|  PREDICTED: protein FRA10AC1                        185   6e-52    
ref|XP_009867160.1|  PREDICTED: protein FRA10AC1                        185   6e-52    
ref|XP_007516845.1|  PREDICTED: protein FRA10AC1                        185   6e-52    
ref|XP_009927321.1|  PREDICTED: protein FRA10AC1                        185   6e-52    
ref|XP_008268442.1|  PREDICTED: protein FRA10AC1                        185   6e-52    
ref|XP_005292601.1|  PREDICTED: protein FRA10AC1                        185   7e-52    
ref|XP_007639649.1|  PREDICTED: protein FRA10AC1 isoform X2             184   7e-52    
ref|XP_005352262.1|  PREDICTED: protein FRA10AC1 homolog                184   8e-52    
ref|XP_003500758.1|  PREDICTED: protein FRA10AC1 isoform X1             184   8e-52    
ref|XP_008518899.1|  PREDICTED: protein FRA10AC1 isoform X1             185   9e-52    
gb|EMP42131.1|  Protein FRA10AC1                                        182   9e-52    
ref|XP_005804442.1|  PREDICTED: protein FRA10AC1-like                   185   9e-52    
ref|XP_009483548.1|  PREDICTED: protein FRA10AC1                        184   9e-52    
ref|XP_006755147.1|  PREDICTED: protein FRA10AC1 isoform X1             184   1e-51    
ref|XP_005884113.1|  PREDICTED: protein FRA10AC1 isoform X1             184   1e-51    
ref|NP_001074544.1|  protein FRA10AC1 homolog                           184   1e-51    Mus musculus [mouse]
ref|XP_009572334.1|  PREDICTED: protein FRA10AC1                        184   1e-51    
ref|XP_007478851.1|  PREDICTED: protein FRA10AC1 isoform X1             184   1e-51    
ref|XP_010137183.1|  PREDICTED: protein FRA10AC1                        184   1e-51    
ref|XP_007961784.1|  PREDICTED: protein FRA10AC1 isoform X1             187   1e-51    
ref|XP_004567569.1|  PREDICTED: protein FRA10AC1-like                   184   1e-51    
ref|XP_008155116.1|  PREDICTED: protein FRA10AC1                        184   1e-51    
ref|XP_005144100.1|  PREDICTED: protein FRA10AC1                        184   1e-51    
gb|KFM06491.1|  Protein FRA10AC1                                        184   1e-51    
ref|XP_005520675.1|  PREDICTED: protein FRA10AC1                        184   1e-51    
gb|EMC85394.1|  Protein FRA10AC1 like protein                           184   1e-51    
gb|KFO70985.1|  Protein FRA10AC1                                        184   1e-51    
ref|XP_008354924.1|  PREDICTED: LOW QUALITY PROTEIN: protein FRA1...    178   1e-51    
ref|XP_007614615.1|  PREDICTED: protein FRA10AC1 isoform X4             185   1e-51    
ref|XP_005413550.1|  PREDICTED: protein FRA10AC1-like isoform X1        184   2e-51    
ref|XP_009498566.1|  PREDICTED: protein FRA10AC1                        184   2e-51    
ref|XP_004279463.1|  PREDICTED: protein FRA10AC1                        184   2e-51    
gb|KGL75013.1|  Protein FRA10AC1                                        183   2e-51    
ref|XP_004625544.1|  PREDICTED: protein FRA10AC1                        183   2e-51    
ref|XP_009569054.1|  PREDICTED: protein FRA10AC1                        184   2e-51    
gb|KFO54296.1|  Protein FRA10AC1                                        183   2e-51    
ref|XP_005890701.1|  PREDICTED: protein FRA10AC1                        183   2e-51    
ref|XP_005481279.1|  PREDICTED: protein FRA10AC1 isoform X2             184   2e-51    
ref|XP_009676209.1|  PREDICTED: protein FRA10AC1                        184   2e-51    
gb|KFW08204.1|  Protein FRA10AC1                                        183   2e-51    
ref|XP_005481278.1|  PREDICTED: protein FRA10AC1 isoform X1             184   2e-51    
ref|XP_010127628.1|  PREDICTED: protein FRA10AC1                        183   2e-51    
dbj|BAE42904.1|  unnamed protein product                                183   2e-51    Mus musculus [mouse]
ref|NP_001014268.1|  protein FRA10AC1 homolog                           183   2e-51    Rattus norvegicus [brown rat]
ref|XP_009954388.1|  PREDICTED: protein FRA10AC1                        183   2e-51    
ref|XP_005407578.1|  PREDICTED: protein FRA10AC1 isoform X2             183   2e-51    
ref|XP_007949487.1|  PREDICTED: protein FRA10AC1                        182   2e-51    
ref|NP_001069860.1|  protein FRA10AC1                                   183   2e-51    Bos taurus [bovine]
ref|XP_010408850.1|  PREDICTED: protein FRA10AC1 isoform X2             183   3e-51    
ref|XP_006090078.1|  PREDICTED: protein FRA10AC1 isoform X1             184   3e-51    
gb|KFU91440.1|  Protein FRA10AC1                                        183   3e-51    
ref|XP_008758593.1|  PREDICTED: protein FRA10AC1 homolog isoform X1     183   3e-51    
ref|XP_004412623.1|  PREDICTED: protein FRA10AC1                        183   3e-51    
gb|KFP79334.1|  Protein FRA10AC1                                        182   3e-51    
ref|XP_009998417.1|  PREDICTED: protein FRA10AC1                        183   3e-51    
ref|XP_010818224.1|  PREDICTED: protein FRA10AC1 isoform X2             182   3e-51    
ref|XP_005698282.1|  PREDICTED: protein FRA10AC1 isoform X1             183   3e-51    
ref|XP_004020091.1|  PREDICTED: protein FRA10AC1                        183   3e-51    
ref|XP_010209675.1|  PREDICTED: protein FRA10AC1                        183   3e-51    
ref|XP_007439948.1|  PREDICTED: protein FRA10AC1                        182   3e-51    
ref|XP_007187539.1|  PREDICTED: protein FRA10AC1 isoform X1             182   3e-51    
ref|XP_010840487.1|  PREDICTED: protein FRA10AC1                        183   4e-51    
dbj|BAC36871.1|  unnamed protein product                                184   4e-51    
ref|XP_008434924.1|  PREDICTED: protein FRA10AC1                        183   4e-51    
ref|XP_007471638.1|  PREDICTED: protein FRA10AC1 isoform X1             183   4e-51    
ref|XP_007571197.1|  PREDICTED: protein FRA10AC1 isoform X1             183   4e-51    
ref|XP_004080319.1|  PREDICTED: protein FRA10AC1 homolog                182   4e-51    
ref|XP_009887096.1|  PREDICTED: protein FRA10AC1                        185   4e-51    
ref|XP_005432475.1|  PREDICTED: protein FRA10AC1                        184   4e-51    
gb|EDM13215.1|  rCG47325                                                182   4e-51    
gb|EDL41804.1|  mCG15397                                                183   4e-51    
ref|XP_005671347.1|  PREDICTED: protein FRA10AC1 isoform X1             182   4e-51    
ref|XP_006183717.1|  PREDICTED: protein FRA10AC1                        182   5e-51    
ref|XP_005507073.1|  PREDICTED: protein FRA10AC1                        183   5e-51    
gb|KFQ85688.1|  Protein FRA10AC1                                        182   5e-51    
ref|XP_006211087.1|  PREDICTED: protein FRA10AC1                        182   5e-51    
ref|XP_005417433.1|  PREDICTED: protein FRA10AC1                        183   5e-51    
ref|XP_007471639.1|  PREDICTED: protein FRA10AC1 isoform X2             182   5e-51    
gb|KFV65237.1|  Protein FRA10AC1                                        182   5e-51    
gb|EHB07596.1|  Protein FRA10AC1                                        181   6e-51    
ref|XP_009896039.1|  PREDICTED: protein FRA10AC1                        182   6e-51    
ref|XP_004749699.1|  PREDICTED: protein FRA10AC1                        182   6e-51    
ref|NP_001230583.1|  protein FRA10AC1                                   182   6e-51    
ref|XP_005407577.1|  PREDICTED: protein FRA10AC1 isoform X1             183   6e-51    
ref|XP_008642135.1|  PREDICTED: protein FRA10AC1                        183   6e-51    
ref|XP_010408841.1|  PREDICTED: protein FRA10AC1 isoform X1             183   6e-51    
gb|KFR11564.1|  Protein FRA10AC1                                        182   6e-51    
ref|XP_010909904.1|  PREDICTED: protein FRA10AC1 homolog isoform X4     179   7e-51    
ref|XP_008851308.1|  PREDICTED: protein FRA10AC1 isoform X1             182   7e-51    
ref|XP_009071848.1|  PREDICTED: protein FRA10AC1                        182   7e-51    
gb|KFW85955.1|  Protein FRA10AC1                                        182   7e-51    
gb|AEB61310.1|  FRA10AC1-like protein                                   182   8e-51    
ref|XP_534970.4|  PREDICTED: protein FRA10AC1 isoform X6                182   8e-51    Canis lupus familiaris [dogs]
gb|ESA04681.1|  hypothetical protein GLOINDRAFT_38978                   179   8e-51    
ref|XP_005637602.1|  PREDICTED: protein FRA10AC1 isoform X1             182   9e-51    
ref|XP_003755310.1|  PREDICTED: protein FRA10AC1                        184   9e-51    
ref|XP_010153078.1|  PREDICTED: protein FRA10AC1                        182   1e-50    
ref|XP_004427906.1|  PREDICTED: protein FRA10AC1                        181   1e-50    
emb|CBN81432.1|  Protein FRA10AC1                                       183   1e-50    
ref|XP_005239049.1|  PREDICTED: protein FRA10AC1                        184   1e-50    
ref|XP_005848901.1|  hypothetical protein CHLNCDRAFT_22127              181   1e-50    
ref|XP_006880418.1|  PREDICTED: protein FRA10AC1                        181   1e-50    
ref|XP_009967185.1|  PREDICTED: protein FRA10AC1                        181   1e-50    
ref|XP_004891876.1|  PREDICTED: protein FRA10AC1                        181   1e-50    
ref|XP_005747431.1|  PREDICTED: protein FRA10AC1-like                   182   1e-50    
ref|XP_010181105.1|  PREDICTED: protein FRA10AC1                        181   1e-50    
ref|XP_009640213.1|  PREDICTED: protein FRA10AC1                        186   1e-50    
ref|XP_009333090.1|  PREDICTED: protein FRA10AC1                        185   2e-50    
tpe|CAE47417.1|  TPA: Fra10ac1 protein                                  181   2e-50    
ref|XP_006043551.1|  PREDICTED: protein FRA10AC1 isoform X1             181   2e-50    
ref|NP_001006006.1|  protein FRA10AC1                                   181   2e-50    Danio rerio [leopard danio]
ref|XP_003409276.1|  PREDICTED: protein FRA10AC1                        181   2e-50    
emb|CAG12622.1|  unnamed protein product                                180   2e-50    Tetraodon nigroviridis
ref|XP_003961614.1|  PREDICTED: protein FRA10AC1 homolog                181   2e-50    
ref|XP_008694476.1|  PREDICTED: protein FRA10AC1 isoform X1             181   2e-50    
ref|XP_002916143.1|  PREDICTED: protein FRA10AC1-like                   181   2e-50    
ref|XP_009464714.1|  PREDICTED: protein FRA10AC1                        186   2e-50    
ref|XP_007080165.1|  PREDICTED: protein FRA10AC1 isoform X1             181   2e-50    
ref|XP_003994270.1|  PREDICTED: LOW QUALITY PROTEIN: protein FRA1...    181   2e-50    
ref|XP_010789861.1|  PREDICTED: protein FRA10AC1                        182   3e-50    
ref|XP_009988818.1|  PREDICTED: protein FRA10AC1                        181   3e-50    
ref|XP_008928126.1|  PREDICTED: protein FRA10AC1                        182   3e-50    
ref|XP_010630375.1|  PREDICTED: protein FRA10AC1                        180   3e-50    
ref|XP_009934003.1|  PREDICTED: protein FRA10AC1                        183   3e-50    
gb|EXX65790.1|  hypothetical protein RirG_129850                        179   3e-50    
ref|XP_004701120.1|  PREDICTED: protein FRA10AC1                        180   4e-50    
ref|XP_010893930.1|  PREDICTED: protein FRA10AC1 isoform X3             180   4e-50    
ref|XP_010283587.1|  PREDICTED: protein FRA10AC1                        180   4e-50    
gb|ACO14113.1|  FRA10AC1 homolog                                        178   5e-50    
ref|XP_006147707.1|  PREDICTED: protein FRA10AC1                        180   5e-50    
ref|XP_008500294.1|  PREDICTED: protein FRA10AC1                        185   5e-50    
ref|XP_002189620.2|  PREDICTED: protein FRA10AC1                        183   5e-50    
ref|XP_006742118.1|  PREDICTED: protein FRA10AC1 isoform X2             179   5e-50    
ref|XP_004450077.1|  PREDICTED: protein FRA10AC1 isoform 7              179   6e-50    
ref|XP_007894854.1|  PREDICTED: protein FRA10AC1                        180   7e-50    
ref|XP_006742117.1|  PREDICTED: protein FRA10AC1 isoform X1             179   7e-50    
ref|XP_009276295.1|  PREDICTED: protein FRA10AC1                        182   9e-50    
ref|XP_005928209.1|  PREDICTED: protein FRA10AC1-like                   179   1e-49    
ref|XP_010893928.1|  PREDICTED: protein FRA10AC1 isoform X1             179   1e-49    
ref|XP_010893929.1|  PREDICTED: protein FRA10AC1 isoform X2             179   1e-49    
ref|XP_006755150.1|  PREDICTED: protein FRA10AC1 isoform X4             177   1e-49    
ref|XP_005884116.1|  PREDICTED: protein FRA10AC1 isoform X4             177   1e-49    
ref|XP_006259742.1|  PREDICTED: protein FRA10AC1 isoform X1             179   1e-49    
ref|XP_006831215.1|  PREDICTED: protein FRA10AC1                        179   2e-49    
ref|XP_009085929.1|  PREDICTED: protein FRA10AC1                        184   2e-49    
ref|XP_010824207.1|  PREDICTED: protein FRA10AC1-like                   175   2e-49    
ref|XP_004450071.1|  PREDICTED: protein FRA10AC1 isoform 1              178   2e-49    
ref|XP_005048703.1|  PREDICTED: protein FRA10AC1                        183   2e-49    
ref|XP_010969508.1|  PREDICTED: protein FRA10AC1 isoform X1             178   3e-49    
ref|XP_004942213.1|  PREDICTED: protein FRA10AC1 isoform X3             177   3e-49    
ref|XP_005698284.1|  PREDICTED: protein FRA10AC1 isoform X3             176   3e-49    
ref|XP_010746050.1|  PREDICTED: protein FRA10AC1                        178   3e-49    
ref|XP_006090079.1|  PREDICTED: protein FRA10AC1 isoform X2             177   3e-49    
ref|XP_008518901.1|  PREDICTED: protein FRA10AC1 isoform X3             177   3e-49    
ref|XP_006029498.1|  PREDICTED: protein FRA10AC1                        178   3e-49    
gb|EFB20886.1|  hypothetical protein PANDA_004189                       173   5e-49    
ref|XP_006791301.1|  PREDICTED: LOW QUALITY PROTEIN: protein FRA1...    178   5e-49    
gb|EFN70820.1|  Protein FRA10AC1                                        174   7e-49    
ref|XP_421674.1|  PREDICTED: protein FRA10AC1 isoform X2                177   8e-49    
ref|NP_001072824.1|  FRA10AC1 protein                                   177   9e-49    
ref|XP_008758594.1|  PREDICTED: protein FRA10AC1 homolog isoform X2     176   1e-48    
ref|XP_003441908.1|  PREDICTED: protein FRA10AC1-like                   177   1e-48    
ref|XP_008275808.1|  PREDICTED: protein FRA10AC1                        177   1e-48    
emb|CAB46057.1|  putative protein                                       171   2e-48    
ref|XP_009062792.1|  hypothetical protein LOTGIDRAFT_129046             171   3e-48    
ref|XP_008694484.1|  PREDICTED: protein FRA10AC1 isoform X2             173   4e-48    
ref|XP_007232929.1|  PREDICTED: protein FRA10AC1                        175   5e-48    
ref|XP_005834406.1|  hypothetical protein GUITHDRAFT_157639             170   7e-48    
ref|XP_010713019.1|  PREDICTED: protein FRA10AC1                        176   1e-47    
ref|XP_008311971.1|  PREDICTED: protein FRA10AC1 isoform X2             174   2e-47    
gb|EZA59641.1|  FRA10AC1-like protein                                   171   2e-47    
ref|XP_008311969.1|  PREDICTED: protein FRA10AC1 isoform X1             174   2e-47    
gb|EYU29031.1|  hypothetical protein MIMGU_mgv1a016564mg                167   2e-47    
ref|NP_001086932.1|  MGC80372 protein                                   172   5e-47    
ref|XP_003401316.1|  PREDICTED: protein FRA10AC1 homolog                170   5e-47    
ref|XP_002981847.1|  hypothetical protein SELMODRAFT_179170             165   7e-47    
emb|CDH49984.1|  protein fra10ac1 homolog                               169   1e-46    
ref|XP_009014552.1|  hypothetical protein HELRODRAFT_110669             171   1e-46    
gb|KFH68717.1|  hypothetical protein MVEG_05524                         173   2e-46    
ref|XP_011063807.1|  PREDICTED: protein FRA10AC1 homolog                168   2e-46    
ref|XP_002733934.1|  PREDICTED: protein FRA10AC1-like                   171   3e-46    
ref|XP_005647455.1|  hypothetical protein COCSUDRAFT_8481               164   5e-46    
dbj|BAJ94854.1|  predicted protein                                      164   7e-46    
ref|XP_003695996.1|  PREDICTED: protein FRA10AC1 homolog                166   1e-45    
gb|AGM32325.1|  protein FRA10AC1-like protein                           164   2e-45    
ref|XP_006609310.1|  PREDICTED: protein FRA10AC1-like                   166   2e-45    
ref|XP_003699625.1|  PREDICTED: protein FRA10AC1 homolog                166   2e-45    
ref|XP_005111126.1|  PREDICTED: protein FRA10AC1 homolog                167   4e-45    
emb|CDS04697.1|  hypothetical protein LRAMOSA07237                      164   6e-45    
ref|XP_001122241.2|  PREDICTED: protein FRA10AC1-like                   164   6e-45    
gb|KFM83150.1|  Protein FRA10AC1-like protein                           166   7e-45    
ref|XP_004206007.1|  PREDICTED: protein FRA10AC1 homolog                165   8e-45    
ref|XP_003484854.1|  PREDICTED: protein FRA10AC1-like                   164   8e-45    
gb|EAW50061.1|  chromosome 10 open reading frame 4, isoform CRA_f       166   9e-45    
ref|XP_002608982.1|  hypothetical protein BRAFLDRAFT_246817             162   6e-44    
emb|CEG83113.1|  hypothetical protein RMATCC62417_17085                 159   6e-43    
ref|XP_008113534.1|  PREDICTED: protein FRA10AC1 isoform X1             162   8e-43    
ref|XP_782837.1|  PREDICTED: protein FRA10AC1 homolog                   161   1e-42    
emb|CEG70295.1|  hypothetical protein RMATCC62417_06224                 158   1e-42    
emb|CEI92800.1|  hypothetical protein RMCBS344292_07050                 158   2e-42    
emb|CEI92799.1|  hypothetical protein RMCBS344292_07050                 157   2e-42    
ref|XP_007664285.1|  PREDICTED: protein FRA10AC1                        160   2e-42    
ref|XP_008551219.1|  PREDICTED: protein FRA10AC1                        157   3e-42    
emb|CEI90619.1|  hypothetical protein RMCBS344292_04938                 156   4e-42    
ref|XP_004989770.1|  hypothetical protein PTSG_08973                    158   1e-41    
gb|KDR23273.1|  FRA10AC1-like protein                                   155   2e-41    
emb|CAN68911.1|  hypothetical protein VITISV_000212                     150   3e-41    
gb|KHN77118.1|  Protein FRA10AC1 -like protein                          157   4e-41    
ref|XP_001742900.1|  hypothetical protein                               151   4e-41    
gb|EPZ34756.1|  Folate-sensitive fragile site protein Fra10Ac1 do...    152   6e-41    
gb|KFM25641.1|  FRA10AC1-like protein                                   152   2e-40    
ref|XP_002982814.1|  hypothetical protein SELMODRAFT_117310             148   3e-40    
gb|KFB34781.1|  hypothetical protein ZHAS_00000165                      152   4e-40    
ref|XP_001639770.1|  predicted protein                                  152   1e-39    
ref|XP_003387027.1|  PREDICTED: protein FRA10AC1 homolog                152   1e-39    
emb|CDW60926.1|  protein FRA10AC1                                       150   1e-39    
ref|XP_006675116.1|  hypothetical protein BATDEDRAFT_15373              152   1e-39    
gb|ELU18618.1|  hypothetical protein CAPTEDRAFT_105775                  148   2e-39    
ref|XP_007478852.1|  PREDICTED: protein FRA10AC1 isoform X2             151   2e-39    
gb|ERG84346.1|  protein fra10ac1-like protein                           152   2e-39    
ref|XP_003098323.1|  hypothetical protein CRE_07666                     152   2e-39    
gb|ACL88465.1|  CG16890-PB                                              147   2e-39    
gb|ETN66028.1|  FRA10AC1                                                150   3e-39    
ref|XP_002066258.1|  GK18198                                            150   3e-39    
ref|XP_002415348.1|  conserved hypothetical protein                     150   3e-39    
ref|XP_002057458.1|  GJ18091                                            150   3e-39    
ref|XP_002035748.1|  GM15125                                            149   4e-39    
gb|AAX33457.1|  RE15376p                                                147   4e-39    
ref|XP_002079376.1|  GD22045                                            149   4e-39    
ref|NP_609671.1|  CG16890, isoform A                                    149   5e-39    
ref|XP_006976720.1|  PREDICTED: protein FRA10AC1 homolog                149   7e-39    
ref|XP_001661228.1|  hypothetical protein AaeL_AAEL002303               149   1e-38    
ref|XP_008050369.1|  PREDICTED: protein FRA10AC1 isoform X3             149   1e-38    
gb|ELU09729.1|  hypothetical protein CAPTEDRAFT_127161                  148   1e-38    
ref|XP_311443.3|  AGAP010729-PA                                         148   2e-38    
ref|XP_002125901.1|  PREDICTED: protein FRA10AC1 homolog                149   2e-38    
ref|XP_967781.1|  PREDICTED: protein FRA10AC1 homolog                   147   2e-38    
ref|XP_002088634.1|  GE11459                                            147   2e-38    
ref|XP_004049870.1|  PREDICTED: protein FRA10AC1                        150   4e-38    
gb|KHJ49316.1|  hypothetical protein D918_00441                         147   4e-38    
ref|XP_004932743.1|  PREDICTED: protein FRA10AC1 homolog                146   5e-38    
gb|EFX71494.1|  hypothetical protein DAPPUDRAFT_201676                  148   7e-38    
gb|ENN79024.1|  hypothetical protein YQE_04526                          145   7e-38    
gb|AEE63216.1|  unknown                                                 145   1e-37    
gb|ERL91935.1|  hypothetical protein D910_09258                         145   1e-37    
emb|CCD59360.1|  hypothetical protein Smp_039080                        147   1e-37    
gb|EJU04915.1|  hypothetical protein DACRYDRAFT_104808                  145   1e-37    
gb|KFD47641.1|  hypothetical protein M513_11504                         145   1e-37    
gb|EPB83654.1|  hypothetical protein HMPREF1544_09570                   144   2e-37    
ref|NP_001285909.1|  CG16890, isoform D                                 144   2e-37    
ref|NP_001129806.1|  Protein C08H9.16                                   146   3e-37    
ref|XP_001847353.1|  FRA10AC1                                           144   3e-37    
gb|EGT34977.1|  hypothetical protein CAEBREN_07762                      146   3e-37    
gb|EMT03638.1|  hypothetical protein F775_23247                         144   3e-37    
ref|XP_001969585.1|  GG10185                                            144   3e-37    
ref|XP_004361409.1|  hypothetical protein DFA_05691                     144   4e-37    
ref|XP_002004041.1|  GI19750                                            144   4e-37    
gb|AAM48345.1|  GM20271p                                                144   5e-37    
dbj|GAA52502.1|  hypothetical protein CLF_108184                        146   5e-37    
emb|CDJ06245.1|  protein FRA10AC1                                       152   6e-37    
ref|XP_001988337.1|  GH10621                                            143   7e-37    
ref|XP_002429986.1|  conserved hypothetical protein                     142   8e-37    
emb|CDS20611.1|  protein FRA10AC1                                       151   9e-37    
gb|AAK55529.1|AF305826_1  PRO2972                                       140   2e-36    
gb|EKC25617.1|  Protein FRA10AC1                                        143   3e-36    
ref|XP_003283793.1|  hypothetical protein DICPUDRAFT_74743              141   6e-36    
ref|XP_009168128.1|  hypothetical protein T265_13643                    142   6e-36    
ref|NP_001068341.2|  Os11g0639000                                       136   1e-35    
ref|XP_008482517.1|  PREDICTED: protein FRA10AC1 homolog                140   1e-35    
ref|XP_009820925.1|  hypothetical protein H257_00095                    138   4e-35    
ref|XP_002023190.1|  GL21094                                            139   4e-35    
ref|XP_001356249.2|  GA14200                                            138   5e-35    
ref|NP_001191920.1|  protein FRA10AC1                                   137   1e-34    
ref|XP_005190556.1|  PREDICTED: protein FRA10AC1 homolog                136   3e-34    
ref|XP_002116717.1|  hypothetical protein TRIADDRAFT_60773              134   7e-34    
gb|EHJ75741.1|  FRA10AC1                                                134   1e-33    
emb|CBY24536.1|  unnamed protein product                                136   1e-33    
gb|ETO86099.1|  hypothetical protein F444_00319                         134   2e-33    
gb|ETM56775.1|  hypothetical protein L914_00300                         134   2e-33    
gb|ETP55089.1|  hypothetical protein F442_00320                         134   2e-33    
gb|ETL50463.1|  hypothetical protein L916_00300                         134   2e-33    
ref|XP_008615289.1|  hypothetical protein SDRG_11047                    131   3e-33    
ref|XP_008889887.1|  hypothetical protein PPTG_00261                    134   4e-33    
gb|ETM03504.1|  hypothetical protein L917_00283                         134   5e-33    
gb|ETI57351.1|  hypothetical protein F443_00338                         134   5e-33    
ref|XP_009532728.1|  hypothetical protein PHYSODRAFT_516391             133   5e-33    
gb|ETK97113.1|  hypothetical protein L915_00298                         133   6e-33    
gb|EHB07677.1|  FRA10AC1-like protein                                   131   6e-33    
ref|XP_008863070.1|  hypothetical protein H310_01664                    132   8e-33    
ref|XP_003462456.2|  PREDICTED: protein FRA10AC1-like                   130   2e-32    
ref|XP_644870.1|  hypothetical protein DDB_G0272957                     131   2e-32    
emb|CDQ01196.1|  Protein Bm2085                                         132   2e-32    
gb|KDN48719.1|  hypothetical protein RSAG8_02706                        131   3e-32    
ref|XP_005413551.1|  PREDICTED: protein FRA10AC1-like isoform X2        131   5e-32    
gb|KDO33490.1|  hypothetical protein SPRG_02298                         128   6e-32    
ref|XP_004524827.1|  PREDICTED: protein FRA10AC1 homolog                129   9e-32    
ref|XP_005088182.1|  PREDICTED: protein FRA10AC1 homolog                128   9e-32    
ref|XP_001964989.1|  GF21691                                            130   1e-31    
emb|CEF68266.1|  Protein FRA10AC1                                       129   1e-31    
dbj|BAH72830.1|  ACYPI004282                                            128   1e-31    
gb|ACO12206.1|  FRA10AC1                                                129   2e-31    
gb|EJW83917.1|  hypothetical protein WUBG_05171                         130   2e-31    
ref|XP_003145114.1|  acid phosphatase                                   129   4e-31    
ref|XP_004450078.1|  PREDICTED: protein FRA10AC1 isoform 8              126   5e-31    
ref|XP_001438371.1|  hypothetical protein                               125   9e-31    
emb|CCO29642.1|  Protein FRA10AC1                                       126   1e-30    
gb|ELU40626.1|  Fra10Ac1 domain-containing protein                      128   1e-30    
ref|XP_005566037.1|  PREDICTED: protein FRA10AC1 isoform X5             127   2e-30    
ref|XP_002998059.1|  conserved hypothetical protein                     126   2e-30    
gb|KGB35936.1|  Protein FRA10AC1-like protein                           126   3e-30    
ref|XP_008050370.1|  PREDICTED: protein FRA10AC1 isoform X4             126   3e-30    
ref|XP_002629761.1|  Hypothetical protein CBG00997                      130   4e-30    
gb|EMD34006.1|  hypothetical protein CERSUDRAFT_76167                   124   6e-30    
ref|XP_005764604.1|  hypothetical protein EMIHUDRAFT_45319              121   2e-29    
ref|XP_007639650.1|  PREDICTED: protein FRA10AC1 isoform X3             124   3e-29    
gb|ERE77491.1|  putative protein FRA10AC1 like protein                  123   3e-29    
ref|XP_007571198.1|  PREDICTED: protein FRA10AC1 isoform X2             124   4e-29    
ref|XP_008851310.1|  PREDICTED: protein FRA10AC1 isoform X2             122   8e-29    
emb|CDQ61600.1|  unnamed protein product                                120   1e-28    
ref|XP_001018321.2|  hypothetical protein TTHERM_00752220               120   1e-28    
ref|XP_010237498.1|  PREDICTED: protein FRA10AC1 homolog isoform X3     118   2e-28    
ref|XP_007000792.1|  hypothetical protein TREMEDRAFT_26773              119   5e-28    
gb|EUB57605.1|  GTP-binding protein                                     125   6e-28    
ref|XP_005704173.1|  hypothetical protein Gasu_47970                    117   7e-28    
ref|XP_007867522.1|  hypothetical protein GLOTRDRAFT_78146              117   2e-27    
ref|XP_002838406.1|  hypothetical protein                               117   2e-27    
ref|XP_003027078.1|  hypothetical protein SCHCODRAFT_113588             117   5e-27    
tpg|DAA42336.1|  TPA: hypothetical protein ZEAMMB73_484226              114   5e-27    
ref|XP_002313306.2|  hypothetical protein POPTR_0009s06550g             113   6e-27    
ref|XP_001417927.1|  predicted protein                                  115   7e-27    
ref|XP_004828858.1|  hypothetical protein BEWA_020380                   114   8e-27    
gb|KDD75556.1|  folate-sensitive fragile site protein Fra10Ac1          115   2e-26    
ref|XP_007383266.1|  hypothetical protein PUNSTDRAFT_113283             114   3e-26    
emb|CDO71828.1|  hypothetical protein BN946_scf184939.g52               113   9e-26    
emb|CCA21226.1|  conserved hypothetical protein                         113   1e-25    
emb|CCL99310.1|  predicted protein                                      112   2e-25    
gb|AAW25310.1|  SJCHGC07005 protein                                     110   4e-25    
ref|XP_764891.1|  hypothetical protein                                  112   7e-25    
gb|KDQ57092.1|  hypothetical protein JAAARDRAFT_58576                   110   7e-25    
gb|KDQ14908.1|  hypothetical protein BOTBODRAFT_76409                   110   7e-25    
emb|CCI42661.1|  unnamed protein product                                114   1e-24    
ref|XP_001892804.1|  Acid phosphatase F26C11.1                          110   1e-24    
ref|XP_008202848.1|  PREDICTED: protein FRA10AC1 isoform X1             108   1e-24    
ref|XP_007318413.1|  hypothetical protein SERLADRAFT_467596             109   2e-24    
ref|XP_008039531.1|  hypothetical protein TRAVEDRAFT_65189              108   2e-24    
ref|XP_007263160.1|  hypothetical protein FOMMEDRAFT_152223             110   2e-24    



>ref|XP_011093369.1| PREDICTED: protein FRA10AC1 isoform X1 [Sesamum indicum]
Length=248

 Score =   343 bits (880),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 181/247 (73%), Positives = 211/247 (85%), Gaps = 5/247 (2%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++Q I+D+EARKQQYQ +I+GLNAYDRHKKFL+DYV YYGKD+S QE LPVKTD
Sbjct  2    MGSFGSLKQAIFDKEARKQQYQDHIRGLNAYDRHKKFLNDYVGYYGKDKSAQETLPVKTD  61

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREGYRFIRT+EDDMNPSWEQRLVKRYYDKLFKEYCIADM+ YK+GKIGLRWRTEKE
Sbjct  62   QDTLREGYRFIRTDEDDMNPSWEQRLVKRYYDKLFKEYCIADMSQYKTGKIGLRWRTEKE  121

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAek-----lly  558
            VISGKGQF+CGNKHCNEKD L+SYEVNF Y EAGE+KQALVKLV CERCA K        
Sbjct  122  VISGKGQFVCGNKHCNEKDDLSSYEVNFSYFEAGEHKQALVKLVACERCAAKLYYKKQKE  181

Query  559  kkrkeeqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRNKTDEDDENFDE  738
            K++ + +  EK +RKR+RS+S D  D ++ R +ER+KG KAS SA D NKTD++++NFDE
Sbjct  182  KEQLKRKENEKHQRKRDRSQSEDDADVDYGRSKERRKGDKASTSATDHNKTDDNNDNFDE  241

Query  739  YLEGMFP  759
            +LEGMFP
Sbjct  242  FLEGMFP  248



>ref|XP_009590157.1| PREDICTED: protein FRA10AC1 [Nicotiana tomentosiformis]
 ref|XP_009590159.1| PREDICTED: protein FRA10AC1 [Nicotiana tomentosiformis]
 ref|XP_009590160.1| PREDICTED: protein FRA10AC1 [Nicotiana tomentosiformis]
Length=250

 Score =   343 bits (880),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 181/252 (72%), Positives = 210/252 (83%), Gaps = 12/252 (5%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            MTSF S++Q I+DR+ARKQQYQ +I GLNAYDRHKKFL+DYV YYG++R TQE LPVKTD
Sbjct  1    MTSFGSLKQAIFDRQARKQQYQDHILGLNAYDRHKKFLNDYVGYYGRERFTQENLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTL+EGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYC+ADMTHYKSGKIGLRWRTEKE
Sbjct  61   QDTLKEGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCLADMTHYKSGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAekll------  555
            VISGKGQF+CGNKHCNE+DGLASYEVNF YVEAGENKQALVKLVTCERCAEKL       
Sbjct  121  VISGKGQFVCGNKHCNERDGLASYEVNFSYVEAGENKQALVKLVTCERCAEKLHYKKRKE  180

Query  556  ----ykkrkeeqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRNKTDEDD  723
                 ++ +E    +  R++      +D +DD+++RR+ + +GSKAS S+E  N  +ED+
Sbjct  181  KEKEKEQSRENLKDKHRRKRERSVSDDDNKDDKYERRKGKSRGSKASTSSE--NPGNEDN  238

Query  724  ENFDEYLEGMFP  759
            EN DEYLEGMFP
Sbjct  239  ENIDEYLEGMFP  250



>ref|XP_011093371.1| PREDICTED: protein FRA10AC1 isoform X3 [Sesamum indicum]
Length=246

 Score =   343 bits (880),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 180/245 (73%), Positives = 212/245 (87%), Gaps = 3/245 (1%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++Q I+D+EARKQQYQ +I+GLNAYDRHKKFL+DYV YYGKD+S QE LPVKTD
Sbjct  2    MGSFGSLKQAIFDKEARKQQYQDHIRGLNAYDRHKKFLNDYVGYYGKDKSAQETLPVKTD  61

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREGYRFIRT+EDDMNPSWEQRLVKRYYDKLFKEYCIADM+ YK+GKIGLRWRTEKE
Sbjct  62   QDTLREGYRFIRTDEDDMNPSWEQRLVKRYYDKLFKEYCIADMSQYKTGKIGLRWRTEKE  121

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAek---llykk  564
            VISGKGQF+CGNKHCNEKD L+SYEVNF Y EAGE+KQALVKLV CERCA K      K+
Sbjct  122  VISGKGQFVCGNKHCNEKDDLSSYEVNFSYFEAGEHKQALVKLVACERCAAKLYYKKQKE  181

Query  565  rkeeqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRNKTDEDDENFDEYL  744
            +++ + KE E+ +R+RS+S D  D ++ R +ER+KG KAS SA D NKTD++++NFDE+L
Sbjct  182  KEQLKRKENEKHQRKRSQSEDDADVDYGRSKERRKGDKASTSATDHNKTDDNNDNFDEFL  241

Query  745  EGMFP  759
            EGMFP
Sbjct  242  EGMFP  246



>ref|XP_009775584.1| PREDICTED: protein FRA10AC1 [Nicotiana sylvestris]
 ref|XP_009775585.1| PREDICTED: protein FRA10AC1 [Nicotiana sylvestris]
Length=252

 Score =   337 bits (865),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 177/254 (70%), Positives = 209/254 (82%), Gaps = 14/254 (6%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            MTSF S++Q I+DR+ARKQQYQ +I GLNAYDRHKKFL+DYV YYG++R TQE LPVKTD
Sbjct  1    MTSFGSLKQAIFDRQARKQQYQDHILGLNAYDRHKKFLNDYVGYYGRERFTQEKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTL+EGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYC+ADMTHYKSGKIGLRWRTEKE
Sbjct  61   QDTLKEGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCLADMTHYKSGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAekll------  555
            VISGKGQF+CGNKHC+E+DG+ASYEVNF YVEAGENKQALVKLVTCERCAEKL       
Sbjct  121  VISGKGQFVCGNKHCDERDGIASYEVNFSYVEAGENKQALVKLVTCERCAEKLHYKKRKE  180

Query  556  ------ykkrkeeqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRNKTDE  717
                   ++ +E    +  R +      +D +DD+++RR+ + +GS+AS S++  N  +E
Sbjct  181  KEKEKEKEQSRENLKDKHRRERERSVSDDDNKDDKYERRKGKSRGSRASTSSD--NPGNE  238

Query  718  DDENFDEYLEGMFP  759
            D+EN DEYLEGMFP
Sbjct  239  DNENIDEYLEGMFP  252



>gb|KDP43478.1| hypothetical protein JCGZ_16765 [Jatropha curcas]
Length=243

 Score =   326 bits (835),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 176/246 (72%), Positives = 196/246 (80%), Gaps = 7/246 (3%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++  IYDRE RKQQYQA+I+GLNAYDRHKKF++DYV++YGK++S    LPVKTD
Sbjct  1    MASFGSLKSAIYDREERKQQYQAHIRGLNAYDRHKKFVNDYVSFYGKEKSANVKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREGYRFIRTEEDDM+ SWEQRLVKRYYDKLFKEYCIADM+ YKSGKIGLRWRTEKE
Sbjct  61   QDTLREGYRFIRTEEDDMDTSWEQRLVKRYYDKLFKEYCIADMSQYKSGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAekllykkrke  573
            VISGKGQFICGNKHC+EKDGLASYEVNF Y EAGENKQALVKLVTCERC EKL YK RKE
Sbjct  121  VISGKGQFICGNKHCDEKDGLASYEVNFSYFEAGENKQALVKLVTCERCVEKLNYKNRKE  180

Query  574  eqlkekerrkrerseSNdqe----ddehdrrrerKKGSKASASAEDRNKTDEDDENFDEY  741
            ++  EK   +  + +          D    R  RKKG +AS S  D      DDENFDE+
Sbjct  181  KEKLEKRDEEEHKRKREKSRIDDDSDNEGSRENRKKGKQASISGHDHKA---DDENFDEF  237

Query  742  LEGMFP  759
            LEGMFP
Sbjct  238  LEGMFP  243



>ref|XP_003633561.1| PREDICTED: protein FRA10AC1 isoform X1 [Vitis vinifera]
Length=245

 Score =   323 bits (827),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 175/247 (71%), Positives = 207/247 (84%), Gaps = 7/247 (3%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++ VI+D+E RKQQYQA+I+GLNAYDRHKKFL+DY  +YG+ RST   LPVKTD
Sbjct  1    MASFGSLKSVIFDKEERKQQYQAHIRGLNAYDRHKKFLNDYAGFYGEQRSTHTKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDT+REGYRFI +EED+M+ SWEQRLVKRY+DKLFKEYCIADM+ YKSGKIGLRWRTEKE
Sbjct  61   QDTIREGYRFILSEEDEMDQSWEQRLVKRYHDKLFKEYCIADMSQYKSGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA-----eklly  558
            VISGKGQFICGNKHC+++DGL SYEVNF Y EAGENKQALVKLVTCERCA     +K   
Sbjct  121  VISGKGQFICGNKHCDKRDGLTSYEVNFSYFEAGENKQALVKLVTCERCAEKLNYKKRKE  180

Query  559  kkrkeeqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRNKTDEDDENFDE  738
            K++  ++ KE+ +RKRER  S+D  ++EH + RER+KG KAS SA D +KT EDDE FDE
Sbjct  181  KEQSAKREKEEHKRKRERVSSDDDTENEHKQSRERRKGKKASTSARD-HKT-EDDETFDE  238

Query  739  YLEGMFP  759
            +LEGMFP
Sbjct  239  FLEGMFP  245



>ref|XP_007052523.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX96680.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=246

 Score =   322 bits (826),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 172/247 (70%), Positives = 209/247 (85%), Gaps = 6/247 (2%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SFRS++  I+DRE +KQQYQA+I+GLNAYDRHKKFL+DYV +YGK++ST   LPVKTD
Sbjct  1    MASFRSLKSAIFDREEKKQQYQAHIRGLNAYDRHKKFLNDYVDFYGKEKSTDVKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
             DTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADM+ Y+SGKIGLRWRTEKE
Sbjct  61   HDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMSQYRSGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAekllykkrke  573
            VISGKGQFICGNKHCNEK+ LASYEVNF Y EAGENKQALVKLVTCERCAEKL YKKRKE
Sbjct  121  VISGKGQFICGNKHCNEKEDLASYEVNFSYFEAGENKQALVKLVTCERCAEKLHYKKRKE  180

Query  574  eqlkekerrkrerseSNdqeddehdrrrerK-----KGSKASASAEDRNKTDEDDENFDE  738
            ++  +++++K  + + +  +D ++      +     KG +AS+SA + +++D+D+E+FD 
Sbjct  181  KEELDRKQKKEYKRKRDLSKDKDNTDEECERSKGKKKGKRASSSAVN-HESDDDNEDFDR  239

Query  739  YLEGMFP  759
            +LEGMFP
Sbjct  240  FLEGMFP  246



>gb|KHN19455.1| Protein FRA10AC1 like [Glycine soja]
Length=246

 Score =   322 bits (825),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 174/247 (70%), Positives = 207/247 (84%), Gaps = 6/247 (2%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++  I+++E RKQQYQ++I+GLNAYDRHKKF+ DYV +YGK+R +   LP+KTD
Sbjct  1    MASFGSLKSTIFEKEERKQQYQSHIRGLNAYDRHKKFMDDYVKFYGKERPSNLKLPIKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREGYRFIR+EEDDMNPSWEQRLVKRYYDKLFKEYC+ADM+ YKSGKIGLRWRTEKE
Sbjct  61   QDTLREGYRFIRSEEDDMNPSWEQRLVKRYYDKLFKEYCLADMSQYKSGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA-----eklly  558
            VISGKGQ ICGNKHCNEKDGLASYEVNFCY EAGENKQALVKLVTCERCA     ++   
Sbjct  121  VISGKGQLICGNKHCNEKDGLASYEVNFCYFEAGENKQALVKLVTCERCAFKLNYKRQKE  180

Query  559  kkrkeeqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRNKTDEDDENFDE  738
            K+  E++ +E++RRKR RS+S+D  DD  + +  R+KG KA  SA D +K D+DD+N DE
Sbjct  181  KELLEKRQEEQDRRKRNRSKSDDDLDDFQESKERRRKGKKALTSASD-HKIDDDDDNLDE  239

Query  739  YLEGMFP  759
            +LEGMFP
Sbjct  240  FLEGMFP  246



>ref|XP_007133818.1| hypothetical protein PHAVU_011G211400g [Phaseolus vulgaris]
 gb|ESW05812.1| hypothetical protein PHAVU_011G211400g [Phaseolus vulgaris]
Length=246

 Score =   317 bits (812),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 171/247 (69%), Positives = 206/247 (83%), Gaps = 6/247 (2%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++  I+D+E RKQQYQ +I+GLNAYDRHKKF++DYV +YGK+R +   LP+KTD
Sbjct  1    MASFGSLKSTIFDKEERKQQYQWHIRGLNAYDRHKKFINDYVNFYGKERPSNLKLPIKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREGYRFIR+EEDDMNPSWEQRLVKRYYDKLFKEYC+ADM+ YKSGKIGLRWRTEKE
Sbjct  61   QDTLREGYRFIRSEEDDMNPSWEQRLVKRYYDKLFKEYCLADMSQYKSGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA-----eklly  558
            V+SGKGQFICGNKHCNEKDGLASYEVNFCY EAGE+KQALVKLVTCERCA     ++   
Sbjct  121  VMSGKGQFICGNKHCNEKDGLASYEVNFCYFEAGEDKQALVKLVTCERCACKLNYKRQKE  180

Query  559  kkrkeeqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRNKTDEDDENFDE  738
            K+  E+  ++++RRKR RS+S+D  DD  + +  R+KG KA  S+ + N  D+DD+N DE
Sbjct  181  KEHSEKIQQDQDRRKRNRSKSDDDVDDYQESKERRRKGKKALTSSSNHN-IDDDDDNLDE  239

Query  739  YLEGMFP  759
            +LEGMFP
Sbjct  240  FLEGMFP  246



>ref|XP_004237943.1| PREDICTED: protein FRA10AC1 [Solanum lycopersicum]
 ref|XP_010320185.1| PREDICTED: protein FRA10AC1 [Solanum lycopersicum]
Length=281

 Score =   318 bits (815),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 145/170 (85%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++Q I+DR+ RKQQYQ +I+GLNAYDRHKKFL+DYV +YG++RSTQE LPVKTD
Sbjct  1    MASFGSLKQAIFDRQTRKQQYQDHIRGLNAYDRHKKFLNDYVRFYGRERSTQEKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTL+EGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE
Sbjct  61   QDTLKEGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            V SGKG F+CGNKHCNE+DGLASYEVNF YVEA ENKQALVKLV CERCA
Sbjct  121  VTSGKGHFVCGNKHCNERDGLASYEVNFSYVEAEENKQALVKLVACERCA  170



>ref|XP_011047394.1| PREDICTED: protein FRA10AC1 [Populus euphratica]
Length=243

 Score =   317 bits (811),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 166/245 (68%), Positives = 203/245 (83%), Gaps = 5/245 (2%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++  ++DRE RKQQYQ++I+GLNAYDRHKKFL+DYV+YYGK +ST E LP+KTD
Sbjct  1    MASFGSLKSAVFDREERKQQYQSHIRGLNAYDRHKKFLNDYVSYYGKGKSTNEKLPIKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            +DTLREGYRFIR+EEDDM+ SWEQRLVKRYYDKLFKEYCIADM+HYK GKIGLRWRTEKE
Sbjct  61   RDTLREGYRFIRSEEDDMDASWEQRLVKRYYDKLFKEYCIADMSHYKVGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAekllykkrke  573
            VISGKGQFICGNKHC+ KDGLASYEVNF Y EAGENKQALVKL+ C+RCAEKL YK+RKE
Sbjct  121  VISGKGQFICGNKHCDVKDGLASYEVNFSYFEAGENKQALVKLILCDRCAEKLHYKRRKE  180

Query  574  eqlkekerrkrerseS---NdqeddehdrrrerKKGSKASASAEDRNKTDEDDENFDEYL  744
            ++  E+  ++    +    +  +D +++   E+++G K + S    NK  +DD+NFDE+L
Sbjct  181  KEQIERREKRDRIRKRELLDVVDDLDNEGSEEKRRGKKPAISGG--NKKTDDDDNFDEFL  238

Query  745  EGMFP  759
            EGMFP
Sbjct  239  EGMFP  243



>ref|XP_003541610.1| PREDICTED: protein FRA10AC1-like isoform X1 [Glycine max]
Length=246

 Score =   316 bits (810),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 173/247 (70%), Positives = 208/247 (84%), Gaps = 6/247 (2%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++  I+++E RKQQYQ++I+GLNAYDRHKKF+ DYV +YGK+R +   LP+KTD
Sbjct  1    MASFGSLKSTIFEKEERKQQYQSHIRGLNAYDRHKKFIDDYVKFYGKERPSNLKLPIKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREGYRFIR+EEDDMNPSWEQRLVKRYYDKLFKEYC+ADM+ YK GKIGLRWRTEKE
Sbjct  61   QDTLREGYRFIRSEEDDMNPSWEQRLVKRYYDKLFKEYCLADMSQYKIGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA-----eklly  558
            VISGKGQFICGNKHCNEKDGLASYEVNF Y EAGENKQALVKLVTCERCA     ++   
Sbjct  121  VISGKGQFICGNKHCNEKDGLASYEVNFYYFEAGENKQALVKLVTCERCAFKLNYKRQKE  180

Query  559  kkrkeeqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRNKTDEDDENFDE  738
            K++ E++ +E++RRKR RS+S+D  DD H+ +  R+KG +A  SA D +K D+DD+N DE
Sbjct  181  KEQLEKRQQEQDRRKRNRSKSDDDLDDFHESKERRRKGKRALTSASD-HKIDDDDDNLDE  239

Query  739  YLEGMFP  759
            +LEGMFP
Sbjct  240  FLEGMFP  246



>gb|KHN37623.1| Protein FRA10AC1 like [Glycine soja]
Length=246

 Score =   316 bits (810),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 172/247 (70%), Positives = 207/247 (84%), Gaps = 6/247 (2%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++  I+++E RKQQYQ++I+GLNAYDRHKKF+ DYV +YGK+R +   LP+KTD
Sbjct  1    MASFGSLKSTIFEKEERKQQYQSHIRGLNAYDRHKKFIDDYVKFYGKERPSNLKLPIKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREGYRFIR+EEDDMNPSWEQRLVKRYYDKLFKEYC+ADM+ YK GKIGLRWRTEKE
Sbjct  61   QDTLREGYRFIRSEEDDMNPSWEQRLVKRYYDKLFKEYCLADMSQYKIGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA-----eklly  558
            VISGKGQFICGNKHCNEKDGLASYEVNF Y EAGENKQALVKLVTCERCA     ++   
Sbjct  121  VISGKGQFICGNKHCNEKDGLASYEVNFYYFEAGENKQALVKLVTCERCAFKLNYKRQKE  180

Query  559  kkrkeeqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRNKTDEDDENFDE  738
            K++ E++ +E++RRKR RS+S+D  DD  + +  R+KG +A  SA D +K D+DD+N DE
Sbjct  181  KEQLEKRQQEQDRRKRNRSKSDDDLDDFQESKERRRKGKRALTSASD-HKIDDDDDNLDE  239

Query  739  YLEGMFP  759
            +LEGMFP
Sbjct  240  FLEGMFP  246



>ref|XP_010659346.1| PREDICTED: protein FRA10AC1 isoform X2 [Vitis vinifera]
Length=217

 Score =   315 bits (806),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 166/242 (69%), Positives = 191/242 (79%), Gaps = 25/242 (10%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++ VI+D+E RKQQYQA+I+GLNAYDRHKKFL+DY  +YG+ RST   LPVKTD
Sbjct  1    MASFGSLKSVIFDKEERKQQYQAHIRGLNAYDRHKKFLNDYAGFYGEQRSTHTKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDT+REGYRFI +EED+M+ SWEQRLVKRY+DKLFKEYCIADM+ YKSGKIGLRWRTEKE
Sbjct  61   QDTIREGYRFILSEEDEMDQSWEQRLVKRYHDKLFKEYCIADMSQYKSGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAekllykkrke  573
            VISGKGQFICGNKHC+++DGL SYEVNF Y EAGENKQALVKLVTCER            
Sbjct  121  VISGKGQFICGNKHCDKRDGLTSYEVNFSYFEAGENKQALVKLVTCER------------  168

Query  574  eqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRNKTDEDDENFDEYLEGM  753
                       ER  S+D  ++EH + RER+KG KAS SA D +KT EDDE FDE+LEGM
Sbjct  169  -----------ERVSSDDDTENEHKQSRERRKGKKASTSARD-HKT-EDDETFDEFLEGM  215

Query  754  FP  759
            FP
Sbjct  216  FP  217



>ref|XP_010257221.1| PREDICTED: protein FRA10AC1 homolog [Nelumbo nucifera]
Length=243

 Score =   315 bits (808),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 171/246 (70%), Positives = 201/246 (82%), Gaps = 7/246 (3%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SFRS +  I+++E RKQQYQ +I+GLNAYDRHKKFL DY+ +YGK R+  E LPVKTD
Sbjct  1    MGSFRSTKSTIFEKEERKQQYQDHIRGLNAYDRHKKFLKDYIDFYGKGRNVHEKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREGYRFIR+EEDDM+ SWEQRLVKRYYDKLFKEYC+ADM+ YK+GKIGLRWRTEKE
Sbjct  61   QDTLREGYRFIRSEEDDMDTSWEQRLVKRYYDKLFKEYCLADMSQYKTGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAe----kllyk  561
            VISGKGQFICGNK CNEKDGLASYEVNF Y EAGENKQALVKLV CERCAE    K   +
Sbjct  121  VISGKGQFICGNKQCNEKDGLASYEVNFSYFEAGENKQALVKLVACERCAEKLVYKKRKE  180

Query  562  krkeeqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRNKTDEDDENFDEY  741
            ++ E + KEK  RKRER++ +   DDE++ +  R+KG KAS S ++R     +DENFDE+
Sbjct  181  EQFERKEKEKLNRKRERTKVDGDSDDEYETKNNRRKGKKASTSTDNRKI---NDENFDEF  237

Query  742  LEGMFP  759
            +EGMFP
Sbjct  238  MEGMFP  243



>ref|XP_006363292.1| PREDICTED: protein FRA10AC1-like [Solanum tuberosum]
Length=281

 Score =   316 bits (810),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++Q I+DR+ RKQQYQ +I+GLNAYDRHKKFL+DYV +YG++RSTQE LP++TD
Sbjct  1    MASFGSLKQAIFDRQTRKQQYQDHIRGLNAYDRHKKFLNDYVGFYGRERSTQEKLPLRTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTL+EGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE
Sbjct  61   QDTLKEGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            V SGKG F+CGNKHCNE+DGLASYEVNF YVEA ENKQALVKLV CERCA
Sbjct  121  VTSGKGHFVCGNKHCNERDGLASYEVNFSYVEAEENKQALVKLVACERCA  170



>ref|XP_002299940.1| hypothetical protein POPTR_0001s27310g [Populus trichocarpa]
 gb|EEE84745.1| hypothetical protein POPTR_0001s27310g [Populus trichocarpa]
Length=243

 Score =   315 bits (806),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 167/245 (68%), Positives = 201/245 (82%), Gaps = 5/245 (2%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++  ++DRE RKQQYQ++I+GLNAYDRHKKFL+DYV+YYGK +ST E LP++TD
Sbjct  1    MASFGSLKSAVFDREERKQQYQSHIRGLNAYDRHKKFLNDYVSYYGKGKSTNEKLPIRTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            +DTLREGYRFIR+EEDDM+ SWEQRLVKRYYDKLFKEYCIADM+HYK GKIGLRWRTEKE
Sbjct  61   RDTLREGYRFIRSEEDDMDASWEQRLVKRYYDKLFKEYCIADMSHYKVGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAekllykkrke  573
            VISGKGQFICGNKHC+ KDGLASYEVNF Y EAGENKQALVKL+ C+RCAEKL YK+RKE
Sbjct  121  VISGKGQFICGNKHCDVKDGLASYEVNFSYFEAGENKQALVKLILCDRCAEKLHYKRRKE  180

Query  574  eqlkekerrkrerseSNdqe---ddehdrrrerKKGSKASASAEDRNKTDEDDENFDEYL  744
            ++  EK  +     +    E   D +++   E+++G K + S    NK  +DD+NFDE+L
Sbjct  181  KEQIEKREKGDRIRKRELLEVVDDLDNEGSEEKRRGKKPTISGG--NKKTDDDDNFDEFL  238

Query  745  EGMFP  759
            EGMFP
Sbjct  239  EGMFP  243



>gb|KHG24922.1| Protein FRA10AC1 [Gossypium arboreum]
Length=253

 Score =   314 bits (805),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 175/254 (69%), Positives = 211/254 (83%), Gaps = 13/254 (5%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SFRS++  I+DRE RKQQYQ++I+GLNAYDRHKKFL+DYV +YGK++ST   LP+KTD
Sbjct  1    MASFRSLKSAIFDREERKQQYQSHIRGLNAYDRHKKFLNDYVGFYGKEKSTDVKLPIKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
             DTLREGYRFIR+EEDDMN SWEQ+LVKRYYDKLFKEYCIADM+ YKSGKIGLRWRTEKE
Sbjct  61   HDTLREGYRFIRSEEDDMNHSWEQKLVKRYYDKLFKEYCIADMSQYKSGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYE--VNFCYVEAGENKQALVKLVTCERCAekll----  555
            VISGKGQFICGNKHCNEKDGLASYE  VNF Y EAGENKQALVK+VTCERCAEKL     
Sbjct  121  VISGKGQFICGNKHCNEKDGLASYEASVNFSYFEAGENKQALVKVVTCERCAEKLHYKKR  180

Query  556  ------ykkrkeeqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRNKTDE  717
                   +K  + + K+  +RKR++S+  D  D+E +R RE++KG +AS+SA + +++D+
Sbjct  181  KEKEKEKEKEFDRKQKKDYKRKRDQSKDKDDTDEERERSREKRKGKRASSSAIN-HESDD  239

Query  718  DDENFDEYLEGMFP  759
             DE+FD+YLEGMFP
Sbjct  240  GDEDFDKYLEGMFP  253



>ref|XP_004510987.1| PREDICTED: protein FRA10AC1-like [Cicer arietinum]
Length=251

 Score =   312 bits (799),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 175/251 (70%), Positives = 205/251 (82%), Gaps = 9/251 (4%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEV-LPVKT  210
            M SF SI+ VI+DRE RKQQYQA+I+GLNAYDRHKKF+ DYV +YGK+     + LP+KT
Sbjct  1    MASFGSIKSVIFDREERKQQYQAHIRGLNAYDRHKKFIHDYVRFYGKEEKPSSLKLPIKT  60

Query  211  DQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEK  390
            DQDTLREGYRFIR+EEDDM+PSWEQRLVKRYY KLFKEYCIADM+ YKSGKIGLRWRTEK
Sbjct  61   DQDTLREGYRFIRSEEDDMDPSWEQRLVKRYYAKLFKEYCIADMSQYKSGKIGLRWRTEK  120

Query  391  EVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA-----ekll  555
            EV+SGKGQFICGNKHCNEKDGLASYEVNFCY EAGENKQALVKLV CERCA     ++  
Sbjct  121  EVMSGKGQFICGNKHCNEKDGLASYEVNFCYFEAGENKQALVKLVACERCAGKLNYKRQK  180

Query  556  ykkrkeeqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRN---KTDEDDE  726
             K++ E++ +E++RRKR RS+SND +D+       R+KG +AS SA D       D+DD+
Sbjct  181  EKEQLEKRQQEQDRRKRSRSKSNDDQDEVEGSEERRRKGKRASISASDHKIDDDNDDDDD  240

Query  727  NFDEYLEGMFP  759
            N DE+LEGMFP
Sbjct  241  NIDEFLEGMFP  251



>ref|XP_002870265.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46524.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=245

 Score =   311 bits (798),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 162/242 (67%), Positives = 199/242 (82%), Gaps = 0/242 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            MTS  +IR  IYDRE RKQQYQA+I+GLNAY+RHKKFL DYV +YGKD+  +  LPVKTD
Sbjct  1    MTSSAAIRSDIYDREERKQQYQAHIRGLNAYERHKKFLKDYVRFYGKDKPAEVKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREGYRFIR+EEDD NPSWEQRLVKRYYDKLFKEYCIADM+ YK+GK+GLRWRTEKE
Sbjct  61   QDTLREGYRFIRSEEDDFNPSWEQRLVKRYYDKLFKEYCIADMSRYKTGKMGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAekllykkrke  573
            V++GKGQF+CG+KHC+EK+GLASYEVNF Y EAGE+KQALVKLV C+RCAEKL YKKRKE
Sbjct  121  VMTGKGQFLCGSKHCDEKEGLASYEVNFSYHEAGEDKQALVKLVACKRCAEKLYYKKRKE  180

Query  574  eqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRNKTDEDDENFDEYLEGM  753
             +  E + +++++ + +    ++     +R+KG    +  E  ++  +DDENFDEY+EGM
Sbjct  181  GERSESKEKRKQKRKRSQSHSEDDTDEEDRRKGKTGKSKLEGGDREGKDDENFDEYMEGM  240

Query  754  FP  759
            FP
Sbjct  241  FP  242



>ref|XP_008461295.1| PREDICTED: protein FRA10AC1 [Cucumis melo]
Length=242

 Score =   310 bits (795),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 168/244 (69%), Positives = 202/244 (83%), Gaps = 4/244 (2%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++  I++RE RKQQYQA+++GLNAYDRHKKF+ DYV +YGK+++ +E LP+KTD
Sbjct  1    MASFGSLKIAIFEREERKQQYQAHVRGLNAYDRHKKFMHDYVHFYGKNKTGEEKLPIKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREGYRFIR+EEDDM+ SWEQ+LVKRYYDKLFKEYCIADMT YKSGKIGLRWR EKE
Sbjct  61   QDTLREGYRFIRSEEDDMDTSWEQKLVKRYYDKLFKEYCIADMTQYKSGKIGLRWRMEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAekll--ykkr  567
            VISGKGQFICGNKHC+EK+GLASYEVNF Y EAGENKQALVKLVTCERC++KL    KK 
Sbjct  121  VISGKGQFICGNKHCDEKNGLASYEVNFSYFEAGENKQALVKLVTCERCSKKLHYKRKKE  180

Query  568  keeqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRNKTDEDDENFDEYLE  747
            KE+  ++++   + +  S+D  D E +  R R+KG+KAS S  D +K D + E FDEYLE
Sbjct  181  KEKVERKEQEMSKRKRPSDDSSDSEDEGSRTRRKGNKASTSFGD-HKAD-NKEEFDEYLE  238

Query  748  GMFP  759
            GMFP
Sbjct  239  GMFP  242



>ref|XP_004135932.1| PREDICTED: protein FRA10AC1-like [Cucumis sativus]
 ref|XP_004158190.1| PREDICTED: protein FRA10AC1-like [Cucumis sativus]
Length=242

 Score =   310 bits (795),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 165/244 (68%), Positives = 199/244 (82%), Gaps = 4/244 (2%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++  I++RE RKQQYQA+++GLNAYDRHKKF+ DYV +YGK+++ +E LP+KTD
Sbjct  1    MASFGSLKNAIFEREERKQQYQAHVRGLNAYDRHKKFMHDYVHFYGKNKTGEEKLPIKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREGYRFIR+EEDDM+ SWEQ+LVKRYYDKLFKEYCIADMT YKSGKIGLRWR EKE
Sbjct  61   QDTLREGYRFIRSEEDDMDTSWEQKLVKRYYDKLFKEYCIADMTQYKSGKIGLRWRAEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAekl--lykkr  567
            V+SGKGQFICGNKHC+EK GLASYEVNF Y EAGENKQALVKLVTC RC++KL    +K 
Sbjct  121  VMSGKGQFICGNKHCDEKSGLASYEVNFSYFEAGENKQALVKLVTCGRCSKKLHYKRQKE  180

Query  568  keeqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRNKTDEDDENFDEYLE  747
            KE+  ++++   + +  S+D  D E +  R R+KG KAS S  D +K D  +E FDEYLE
Sbjct  181  KEKLERKEQEMSKRKRPSDDSSDTEDEGSRTRRKGKKASTSFGD-HKADSKEE-FDEYLE  238

Query  748  GMFP  759
            GMFP
Sbjct  239  GMFP  242



>gb|AAC31614.1| Phyb1 [Spuriopimpinella brachycarpa]
Length=244

 Score =   310 bits (794),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 168/243 (69%), Positives = 200/243 (82%), Gaps = 5/243 (2%)
 Frame = +1

Query  37   TSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTDQ  216
            +S  S++ VI+DR+ARKQQYQ++I GLNAYDRHKKF+SDYV +YGKD S +E LPVKTD+
Sbjct  3    SSLGSLKSVIFDRQARKQQYQSHILGLNAYDRHKKFISDYVDFYGKDVSAEEKLPVKTDK  62

Query  217  DTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEV  396
            DTLREGYRFIR+EEDD++PSWEQRLVKRYY+KLFKEYCIADM+ Y++GKIGLRWRTEKEV
Sbjct  63   DTLREGYRFIRSEEDDLDPSWEQRLVKRYYNKLFKEYCIADMSQYRTGKIGLRWRTEKEV  122

Query  397  ISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAek---llykkr  567
            ISGKGQF+CGNKHC+EKDGLASYEVNF Y EAGE+KQALVKLVTCERCA+K      K++
Sbjct  123  ISGKGQFVCGNKHCDEKDGLASYEVNFSYFEAGESKQALVKLVTCERCAKKLNYKKQKEK  182

Query  568  keeqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRNKTDEDDENFDEYLE  747
             +   KE  RRKRERSES+D    E+   ++ +K  K S S  D+   D   ENFDE+LE
Sbjct  183  LKRNEKEVLRRKRERSESDDDIPTEYKGNKDSRKVMKTSTSLGDQKAGDT--ENFDEFLE  240

Query  748  GMF  756
            GMF
Sbjct  241  GMF  243



>ref|XP_010440356.1| PREDICTED: protein FRA10AC1 homolog isoform X1 [Camelina sativa]
Length=250

 Score =   310 bits (794),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 163/242 (67%), Positives = 196/242 (81%), Gaps = 0/242 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M S  +IR  IYDRE RKQQYQA+I+GLNAY+RHKKFL DYV +YG D+     LPVKTD
Sbjct  1    MASSGTIRSDIYDREERKQQYQAHIRGLNAYERHKKFLKDYVRFYGTDKPAVVKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREGYRFIR+EEDD+NPSWEQRLVK+YYDKLFKEYCIADM+ YK+GK+GLRWRTEKE
Sbjct  61   QDTLREGYRFIRSEEDDLNPSWEQRLVKKYYDKLFKEYCIADMSRYKTGKMGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAekllykkrke  573
            V++GKGQF+CG+KHC+EK+GLASYEVNF Y EAGE+KQALVKLV CERCA+KL YKKRKE
Sbjct  121  VMTGKGQFMCGSKHCDEKEGLASYEVNFSYHEAGEDKQALVKLVACERCADKLYYKKRKE  180

Query  574  eqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRNKTDEDDENFDEYLEGM  753
             +  E + +K+ + + N    ++     ER+KG      AE  ++  +DDENFDEY+EGM
Sbjct  181  GERSESKEKKKLKRKRNQSCSEDDTDEEERRKGKTGKRKAEGGDREGKDDENFDEYMEGM  240

Query  754  FP  759
            FP
Sbjct  241  FP  242



>ref|XP_010435008.1| PREDICTED: protein FRA10AC1 homolog [Camelina sativa]
Length=315

 Score =   312 bits (800),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 163/242 (67%), Positives = 198/242 (82%), Gaps = 0/242 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M S  +IR  IYDRE RKQQYQA+I+GLNAY+RHKKFL DYV +YG D+  +  LPVKTD
Sbjct  1    MASKATIRSDIYDREERKQQYQAHIRGLNAYERHKKFLKDYVRFYGTDKPAEVKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREGYRFIR+EEDD+NPSWEQRLVK+YYDKLFKEYCIADM+ YK+GK+GLRWRTEKE
Sbjct  61   QDTLREGYRFIRSEEDDLNPSWEQRLVKKYYDKLFKEYCIADMSRYKTGKMGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAekllykkrke  573
            V++GKGQF+CG+KHC+EK+GLASYEVNF Y EAGE+KQALVKLV CERCA+KL YKKRKE
Sbjct  121  VMTGKGQFMCGSKHCDEKEGLASYEVNFSYHEAGEDKQALVKLVACERCADKLYYKKRKE  180

Query  574  eqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRNKTDEDDENFDEYLEGM  753
             +  E + +K+++ + N    ++     ER+KG      AE  ++  +DDENFDEY+EGM
Sbjct  181  GEKSESKEKKKQKRKRNQSCSEDDTDEEERRKGKTGKRKAEGGDREGKDDENFDEYMEGM  240

Query  754  FP  759
            FP
Sbjct  241  FP  242



>ref|NP_001241993.1| uncharacterized protein LOC100782621 [Glycine max]
 gb|ACU23989.1| unknown [Glycine max]
Length=246

 Score =   309 bits (791),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++  I+++E RKQQYQ++I+GLNAYDRHKKF+ DYV +YGK+R +   LP+KTD
Sbjct  1    MASFGSLKSTIFEKEERKQQYQSHIRGLNAYDRHKKFMDDYVKFYGKERPSNLKLPIKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREGYRFIR+EEDDMNPSWEQRLVKRYYDKLFKEYC+ADM+ YKSGKIGLRWRTEKE
Sbjct  61   QDTLREGYRFIRSEEDDMNPSWEQRLVKRYYDKLFKEYCLADMSQYKSGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            V+SGKGQ ICGNKHCNEKDGLASYEVNFCY EAGENKQALVKLVTCERCA
Sbjct  121  VVSGKGQLICGNKHCNEKDGLASYEVNFCYFEAGENKQALVKLVTCERCA  170



>ref|XP_009147899.1| PREDICTED: protein FRA10AC1 [Brassica rapa]
Length=247

 Score =   309 bits (791),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 162/242 (67%), Positives = 198/242 (82%), Gaps = 0/242 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M S  +IR  IYDRE RKQQYQA+I+GLNAY+RHKKFL DYV +YGKD+ T+  LPVKTD
Sbjct  1    MASSATIRSEIYDREERKQQYQAHIRGLNAYERHKKFLKDYVRFYGKDKPTEVKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
             DTLREGYRFIR+EEDD+NPSWEQRLVKRYYDKLFKEYCIADM+ YK+G++GLRWRTEKE
Sbjct  61   HDTLREGYRFIRSEEDDLNPSWEQRLVKRYYDKLFKEYCIADMSRYKTGQMGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAekllykkrke  573
            V+SGKGQF+CG+K C+E +GLASYEVNF Y EAGE+KQALVKLVTCERCAEKL YK+RK+
Sbjct  121  VMSGKGQFMCGSKQCHEIEGLASYEVNFSYHEAGEHKQALVKLVTCERCAEKLYYKRRKD  180

Query  574  eqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRNKTDEDDENFDEYLEGM  753
             +  E + +K+++ + N    ++     ER+KG K  +  E   +  +DDENFDE++EGM
Sbjct  181  AERSESKEKKKQKRKRNRSSSEDDTEEEERQKGKKNKSKLEGGEREGKDDENFDEFMEGM  240

Query  754  FP  759
            FP
Sbjct  241  FP  242



>gb|KFK22903.1| hypothetical protein AALP_AAs72951U000400 [Arabis alpina]
Length=248

 Score =   309 bits (791),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 167/243 (69%), Positives = 199/243 (82%), Gaps = 1/243 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M+S  +IR  IYDRE RKQQYQA+I+GLNAYDRHKKFL+DYV +YGKD+  +  LPVKTD
Sbjct  1    MSSSATIRSEIYDREERKQQYQAHIRGLNAYDRHKKFLNDYVRFYGKDKPVEVKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREGYRFIR+EEDD+NPSWEQRLVKRYYDKLFKEYCIADM+ YK+GK+GLRWRTEKE
Sbjct  61   QDTLREGYRFIRSEEDDLNPSWEQRLVKRYYDKLFKEYCIADMSRYKTGKMGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAekllykkrke  573
            V+SGKGQF+CG+KHC+EKDGLASYEVNF Y EAGE+KQALVKLV CERCAEKL YKKRKE
Sbjct  121  VMSGKGQFMCGSKHCDEKDGLASYEVNFAYYEAGEHKQALVKLVACERCAEKLYYKKRKE  180

Query  574  eqlkekerrkrerseSNdqeddehdrrrerKKGSKASASA-EDRNKTDEDDENFDEYLEG  750
            E+    + +K+ + + N    +E     E ++  K   S  E  ++  +DDENFDE++EG
Sbjct  181  EERSNSKEKKKHKRKWNQSSSEEGASDEEERRKGKKGKSKLEGCDREAKDDENFDEFMEG  240

Query  751  MFP  759
            MFP
Sbjct  241  MFP  243



>ref|XP_006591860.1| PREDICTED: uncharacterized protein LOC100782621 isoform X1 [Glycine 
max]
Length=257

 Score =   307 bits (786),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++  I+++E RKQQYQ++I+GLNAYDRHKKF+ DYV +YGK+R +   LP+KTD
Sbjct  1    MASFGSLKSTIFEKEERKQQYQSHIRGLNAYDRHKKFMDDYVKFYGKERPSNLKLPIKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREGYRFIR+EEDDMNPSWEQRLVKRYYDKLFKEYC+ADM+ YKSGKIGLRWRTEKE
Sbjct  61   QDTLREGYRFIRSEEDDMNPSWEQRLVKRYYDKLFKEYCLADMSQYKSGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            VISGKGQ ICGNKHCNEKDGLASYEVNFCY EAGENKQALVKLVTCERCA
Sbjct  121  VISGKGQLICGNKHCNEKDGLASYEVNFCYFEAGENKQALVKLVTCERCA  170



>ref|XP_010440357.1| PREDICTED: protein FRA10AC1 homolog isoform X2 [Camelina sativa]
Length=247

 Score =   305 bits (782),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 161/242 (67%), Positives = 195/242 (81%), Gaps = 0/242 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M S  +IR  IYDRE RKQQYQA+I+GLNAY+RHKKFL DYV +YG D+     LPVKTD
Sbjct  1    MASSGTIRSDIYDREERKQQYQAHIRGLNAYERHKKFLKDYVRFYGTDKPAVVKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREGYRFIR+EEDD+NPSWEQRLVK+YYDKLFKEYCIADM+ YK+GK+GLRWRTEKE
Sbjct  61   QDTLREGYRFIRSEEDDLNPSWEQRLVKKYYDKLFKEYCIADMSRYKTGKMGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAekllykkrke  573
            V++GKGQF+CG+KHC+EK+GLASYEVNF Y EAGE+KQALVKLV CERCA+KL YKKRKE
Sbjct  121  VMTGKGQFMCGSKHCDEKEGLASYEVNFSYHEAGEDKQALVKLVACERCADKLYYKKRKE  180

Query  574  eqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRNKTDEDDENFDEYLEGM  753
             +  E + +K+ + + N    ++     ER+KG      +   ++  +DDENFDEY+EGM
Sbjct  181  GERSESKEKKKLKRKRNQSCSEDDTDEEERRKGKTGKRKSGGGDREGKDDENFDEYMEGM  240

Query  754  FP  759
            FP
Sbjct  241  FP  242



>ref|XP_006439111.1| hypothetical protein CICLE_v10032186mg [Citrus clementina]
 gb|ESR52351.1| hypothetical protein CICLE_v10032186mg [Citrus clementina]
Length=310

 Score =   307 bits (787),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++  I+DRE RKQQYQA I+GLNAYDRH KFL DYVA+YGK++     LPVKTD
Sbjct  1    MASFGSLKSKIFDREERKQQYQAQIRGLNAYDRHNKFLKDYVAFYGKEKPMSLKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREG+RFIR+EEDD + SWEQRLVKRYYDKLFKEYCIADM+HYKSGKIGLRWRTEKE
Sbjct  61   QDTLREGFRFIRSEEDDKDSSWEQRLVKRYYDKLFKEYCIADMSHYKSGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            VI+GKGQF+CGNKHC+EKDGLASYEVNF YVEAGENKQALVKLVTCERCA
Sbjct  121  VIAGKGQFVCGNKHCDEKDGLASYEVNFTYVEAGENKQALVKLVTCERCA  170



>ref|XP_010496120.1| PREDICTED: protein FRA10AC1-like [Camelina sativa]
Length=247

 Score =   304 bits (779),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 161/242 (67%), Positives = 197/242 (81%), Gaps = 0/242 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M S  +IR  IYDRE RKQQYQA+I+GLNAY+RHKKFL DYV +YG D+  +  LPVKTD
Sbjct  1    MASKATIRSDIYDREERKQQYQAHIRGLNAYERHKKFLKDYVRFYGTDKPAEVKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREGYRFIR+EEDD+NPSWEQRLVK+YYDKLFKEYCIADM+ YK+GK+GLRWRTEKE
Sbjct  61   QDTLREGYRFIRSEEDDLNPSWEQRLVKKYYDKLFKEYCIADMSRYKTGKMGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAekllykkrke  573
            V++GKGQF+CG+KHC+EK+GLASYEVNF Y EAGE+KQALVKLV CERCA+KL YKKRKE
Sbjct  121  VMTGKGQFMCGSKHCDEKEGLASYEVNFSYHEAGEDKQALVKLVACERCADKLYYKKRKE  180

Query  574  eqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRNKTDEDDENFDEYLEGM  753
             +  E + +K+++ + N    ++     ER+KG      +   ++  +DDENFDEY+EGM
Sbjct  181  GERSESKEKKKQKRKRNQSCSEDDTDEEERRKGKTGKRKSGGGDREGKDDENFDEYMEGM  240

Query  754  FP  759
            FP
Sbjct  241  FP  242



>ref|XP_010067869.1| PREDICTED: protein FRA10AC1 [Eucalyptus grandis]
 gb|KCW66105.1| hypothetical protein EUGRSUZ_G03378 [Eucalyptus grandis]
Length=256

 Score =   305 bits (780),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M+S  S++  I+DRE RKQQYQA+I+GLNAYDRHKKF+ DYV +YGK+RS Q  LPVKTD
Sbjct  1    MSSLGSLKSQIFDREERKQQYQAHIRGLNAYDRHKKFVRDYVNFYGKERSVQANLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREGYRFIRTEEDDM+ SWEQRLVKRYYDKLFKEYCIADMT YKSGKIGLRWRTEKE
Sbjct  61   QDTLREGYRFIRTEEDDMDSSWEQRLVKRYYDKLFKEYCIADMTKYKSGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            VISGKGQFICGNKHC+  DGLASYEVNF Y EAGENKQALVKLVTCERCA
Sbjct  121  VISGKGQFICGNKHCDGTDGLASYEVNFSYFEAGENKQALVKLVTCERCA  170



>ref|XP_008231252.1| PREDICTED: protein FRA10AC1 isoform X2 [Prunus mume]
Length=247

 Score =   304 bits (779),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++  I+DREARKQQYQA+I GLNAYDRHKKF+ DYV++YG++ S+   LPVKTD
Sbjct  1    MASFGSLKSAIFDREARKQQYQAHILGLNAYDRHKKFVKDYVSFYGREESSHVKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREGYRFIR+EEDDM+ SWEQRLVKRYYDKLFKEYCIADM+HYKSGKIGLRWRTEKE
Sbjct  61   QDTLREGYRFIRSEEDDMDRSWEQRLVKRYYDKLFKEYCIADMSHYKSGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            V+SGKGQF+CGNKHC+ KDGLASYEVNF Y EAGENKQALVKLVTCERC+
Sbjct  121  VVSGKGQFVCGNKHCDVKDGLASYEVNFSYFEAGENKQALVKLVTCERCS  170



>ref|XP_007218450.1| hypothetical protein PRUPE_ppa011769mg [Prunus persica]
 gb|EMJ19649.1| hypothetical protein PRUPE_ppa011769mg [Prunus persica]
Length=197

 Score =   302 bits (773),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++  I+DREARKQQYQA+I GLNAYDRHKKF+ DYV++YG++ S+   LPVKTD
Sbjct  1    MASFGSLKSAIFDREARKQQYQAHILGLNAYDRHKKFVKDYVSFYGREESSHVKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREGYRFIR+EEDDM+ SWEQRLVKRYYDKLFKEYCIADM+HYKSGKIGLRWRTEKE
Sbjct  61   QDTLREGYRFIRSEEDDMDRSWEQRLVKRYYDKLFKEYCIADMSHYKSGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            V+SGKGQF+CGNKHC+ KDGLASYEVNF Y EAGENKQALVKLVTCERC+
Sbjct  121  VVSGKGQFVCGNKHCDVKDGLASYEVNFSYFEAGENKQALVKLVTCERCS  170



>ref|XP_006482872.1| PREDICTED: protein FRA10AC1-like isoform X1 [Citrus sinensis]
Length=310

 Score =   306 bits (783),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++  I+DRE RKQQYQA I+GLNAYDRH KFL DYVA+YGK++     LPVKTD
Sbjct  1    MASFGSLKSKIFDREERKQQYQAQIRGLNAYDRHNKFLKDYVAFYGKEKPMSLKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREG+RFIR+EEDD + SWEQRLVKRYYDKLFKEYCIADM HYKSGKIGLRWRTEKE
Sbjct  61   QDTLREGFRFIRSEEDDKDSSWEQRLVKRYYDKLFKEYCIADMLHYKSGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            VI+GKGQF+CGNKHC+EKDGLASYEVNF YVEAGENKQALVKLVTCERCA
Sbjct  121  VIAGKGQFVCGNKHCDEKDGLASYEVNFTYVEAGENKQALVKLVTCERCA  170



>ref|XP_006482873.1| PREDICTED: protein FRA10AC1-like isoform X2 [Citrus sinensis]
Length=275

 Score =   304 bits (779),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++  I+DRE RKQQYQA I+GLNAYDRH KFL DYVA+YGK++     LPVKTD
Sbjct  1    MASFGSLKSKIFDREERKQQYQAQIRGLNAYDRHNKFLKDYVAFYGKEKPMSLKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREG+RFIR+EEDD + SWEQRLVKRYYDKLFKEYCIADM HYKSGKIGLRWRTEKE
Sbjct  61   QDTLREGFRFIRSEEDDKDSSWEQRLVKRYYDKLFKEYCIADMLHYKSGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            VI+GKGQF+CGNKHC+EKDGLASYEVNF YVEAGENKQALVKLVTCERCA
Sbjct  121  VIAGKGQFVCGNKHCDEKDGLASYEVNFTYVEAGENKQALVKLVTCERCA  170



>gb|KDO83420.1| hypothetical protein CISIN_1g020178mg [Citrus sinensis]
Length=313

 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++  I+DRE RKQQYQA I+GLNAYDRH KFL DYVA+YGK++     LPVKTD
Sbjct  1    MASFGSLKSKIFDREERKQQYQAQIRGLNAYDRHNKFLKDYVAFYGKEKPMSLKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREG+RFIR+EEDD + SWEQRLVKRYYDKLFKEYCIADM HYKSGKIGLRWRTEKE
Sbjct  61   QDTLREGFRFIRSEEDDKDSSWEQRLVKRYYDKLFKEYCIADMLHYKSGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            VI+GKGQF+CGNKHC+EKDGLASYEVNF YVEAGENKQALVKLVTCERCA
Sbjct  121  VIAGKGQFVCGNKHCDEKDGLASYEVNFTYVEAGENKQALVKLVTCERCA  170



>ref|XP_008231251.1| PREDICTED: protein FRA10AC1 isoform X1 [Prunus mume]
Length=255

 Score =   303 bits (775),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++  I+DREARKQQYQA+I GLNAYDRHKKF+ DYV++YG++ S+   LPVKTD
Sbjct  1    MASFGSLKSAIFDREARKQQYQAHILGLNAYDRHKKFVKDYVSFYGREESSHVKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREGYRFIR+EEDDM+ SWEQRLVKRYYDKLFKEYCIADM+HYKSGKIGLRWRTEKE
Sbjct  61   QDTLREGYRFIRSEEDDMDRSWEQRLVKRYYDKLFKEYCIADMSHYKSGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            V+SGKGQF+CGNKHC+ KDGLASYEVNF Y EAGENKQALVKLVTCERC+
Sbjct  121  VVSGKGQFVCGNKHCDVKDGLASYEVNFSYFEAGENKQALVKLVTCERCS  170



>gb|KDO83419.1| hypothetical protein CISIN_1g020178mg [Citrus sinensis]
Length=330

 Score =   305 bits (781),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++  I+DRE RKQQYQA I+GLNAYDRH KFL DYVA+YGK++     LPVKTD
Sbjct  1    MASFGSLKSKIFDREERKQQYQAQIRGLNAYDRHNKFLKDYVAFYGKEKPMSLKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREG+RFIR+EEDD + SWEQRLVKRYYDKLFKEYCIADM HYKSGKIGLRWRTEKE
Sbjct  61   QDTLREGFRFIRSEEDDKDSSWEQRLVKRYYDKLFKEYCIADMLHYKSGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            VI+GKGQF+CGNKHC+EKDGLASYEVNF YVEAGENKQALVKLVTCERCA
Sbjct  121  VIAGKGQFVCGNKHCDEKDGLASYEVNFTYVEAGENKQALVKLVTCERCA  170



>ref|XP_006838318.1| hypothetical protein AMTR_s00103p00136340 [Amborella trichopoda]
 gb|ERN00887.1| hypothetical protein AMTR_s00103p00136340 [Amborella trichopoda]
Length=249

 Score =   301 bits (771),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 159/242 (66%), Positives = 192/242 (79%), Gaps = 5/242 (2%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++  I+++E RKQQYQ +I+GLNAYDRHKKF+ DY  YYGK R  Q VLP+KTD
Sbjct  1    MASFGSVKAAIFEKEERKQQYQNHIRGLNAYDRHKKFVEDYALYYGKGRREQHVLPLKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREGYRFIR+EEDD NPSWEQRL KRYYDKLFKEYCIADM+ YK GKIGLRWRTEKE
Sbjct  61   QDTLREGYRFIRSEEDDTNPSWEQRLAKRYYDKLFKEYCIADMSQYKKGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAekllykk---  564
            VISGKGQFICGN+ C+EK+GL+SYEVNF YVEAGENKQALVKLV CERCAEKL+YKK   
Sbjct  121  VISGKGQFICGNRKCDEKEGLSSYEVNFSYVEAGENKQALVKLVACERCAEKLMYKKWKE  180

Query  565  rkeeqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRNKTDEDDENFDEYL  744
            ++++  K ++  ++ R E  + + +      + KKG KA+ S +   K D D++NFDE+ 
Sbjct  181  KEKQSEKREKENRKRRREEENSDSERDQSSGKTKKGQKATTSRD--RKIDSDEDNFDEFF  238

Query  745  EG  750
            EG
Sbjct  239  EG  240



>gb|KEH19085.1| folate-sensitive fragile site protein FRA10AC1 [Medicago truncatula]
Length=248

 Score =   300 bits (768),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 162/249 (65%), Positives = 195/249 (78%), Gaps = 8/249 (3%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEV-LPVKT  210
            MTS  S++  I+DRE RKQQYQA+I GLNAYDRHKKF++DYV +YGK+     + LP+KT
Sbjct  1    MTSLGSLKSTIFDREERKQQYQAHILGLNAYDRHKKFINDYVTFYGKEEKPSTLKLPIKT  60

Query  211  DQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEK  390
            D+DTLREGYRFIR+EEDDM+PSWEQRLVKRYY KLFKEYC+ADM+ YKSGKIGLRWRTEK
Sbjct  61   DKDTLREGYRFIRSEEDDMDPSWEQRLVKRYYAKLFKEYCLADMSQYKSGKIGLRWRTEK  120

Query  391  EVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA------ekl  552
            EV+SGKGQF+CGNKHCNEKDGLASYEVNFCY EAGENKQALVKLV CERCA       + 
Sbjct  121  EVMSGKGQFLCGNKHCNEKDGLASYEVNFCYFEAGENKQALVKLVACERCAGKLNYKRQK  180

Query  553  lykkrkeeqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRNKTDEDDENF  732
              ++ ++ Q K   R++      +D  D+  +    R+KG +A  S+ D +K DEDD+N 
Sbjct  181  EKEQLEKRQQKHDRRKRSRSKSDDDDLDESQESEERRRKGKRALVSSSD-HKIDEDDDNI  239

Query  733  DEYLEGMFP  759
            DE+LEGMFP
Sbjct  240  DEFLEGMFP  248



>emb|CDY50277.1| BnaAnng10410D [Brassica napus]
Length=247

 Score =   299 bits (766),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 157/242 (65%), Positives = 196/242 (81%), Gaps = 0/242 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M S  +IR  IYDRE RKQQYQA+I+GLNAY+RHKKFL DYV +YGKD+ T+  LPVKTD
Sbjct  1    MASSATIRSEIYDREERKQQYQAHIRGLNAYERHKKFLKDYVRFYGKDKPTEVKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
             DTLREGYRFIR+EEDD+NPSWEQRLVKRYYDKLFKEYCIADM+ YK+G++GLRWRTEKE
Sbjct  61   HDTLREGYRFIRSEEDDLNPSWEQRLVKRYYDKLFKEYCIADMSRYKTGQMGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAekllykkrke  573
            V+SGKGQF+CG+K C+E +GL + +VNF Y EAGE+KQALVKLVTCERCAEKL YK+RK+
Sbjct  121  VMSGKGQFMCGSKQCHEIEGLLNLQVNFSYHEAGEHKQALVKLVTCERCAEKLYYKRRKD  180

Query  574  eqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRNKTDEDDENFDEYLEGM  753
             +  E + +K+++ + N    ++     ER+KG K  +  E   +  +D+ENFDE++EGM
Sbjct  181  TERSESKEKKKQKRKRNRSSSEDDTEEEERRKGKKNKSKLEGCEREGKDEENFDEFMEGM  240

Query  754  FP  759
            FP
Sbjct  241  FP  242



>ref|XP_004306537.1| PREDICTED: protein FRA10AC1-like [Fragaria vesca subsp. vesca]
Length=245

 Score =   298 bits (763),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 167/245 (68%), Positives = 199/245 (81%), Gaps = 3/245 (1%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++  I+DRE RK+QYQ +I+GLNAY+RH KF+ DYV+YYG ++S+   LPVKTD
Sbjct  1    MASFASLKSTIFDREERKRQYQDHIRGLNAYERHNKFVKDYVSYYGGEKSSHVKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREGYRFIR+EEDDM+ SWEQRLVKRYYDKLFKEYCIADM+HYKSGKIGLRWRTEKE
Sbjct  61   QDTLREGYRFIRSEEDDMDTSWEQRLVKRYYDKLFKEYCIADMSHYKSGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAekllykkrke  573
            V+SGKGQFICG+KHC++KD LASYEVNF Y EAGENKQAL+KLVTCERC++KL YK+RKE
Sbjct  121  VVSGKGQFICGSKHCDKKDALASYEVNFSYYEAGENKQALIKLVTCERCSKKLHYKRRKE  180

Query  574  eqlkekerrkrerseSNdqeddehdrrrerK---KGSKASASAEDRNKTDEDDENFDEYL  744
            ++  +KE+ +  R + +   D +       K   KG KAS S  D    DEDD+NFDEYL
Sbjct  181  KEHMDKEKNEVNRRKRDRSGDGDDTDDEGSKERRKGKKASLSTSDNRVNDEDDDNFDEYL  240

Query  745  EGMFP  759
            EGMFP
Sbjct  241  EGMFP  245



>ref|XP_009354749.1| PREDICTED: protein FRA10AC1 isoform X1 [Pyrus x bretschneideri]
Length=247

 Score =   298 bits (762),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++  I+DRE RKQQYQA+I GLNAYDRHKKF+ DYV +YG+  S+   LPVKTD
Sbjct  1    MASFGSLKSAIFDREERKQQYQAHILGLNAYDRHKKFVKDYVNFYGRQESSHVKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREGYRFIR+EEDDM+ SWEQRLVKRYYDKLFKEYCIADM+HYKSGKIGLRWRTEKE
Sbjct  61   QDTLREGYRFIRSEEDDMDRSWEQRLVKRYYDKLFKEYCIADMSHYKSGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            V+SGKGQFICGNKHC+ KDGLASYEVNF Y EAGENKQALVKLVTC+RC+
Sbjct  121  VVSGKGQFICGNKHCDVKDGLASYEVNFSYFEAGENKQALVKLVTCQRCS  170



>ref|XP_010523674.1| PREDICTED: protein FRA10AC1 homolog isoform X1 [Tarenaya hassleriana]
Length=245

 Score =   296 bits (759),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 166/245 (68%), Positives = 200/245 (82%), Gaps = 6/245 (2%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M S  S+R  IY+RE RKQQYQA I+GLNAYDRH KFL+DYV +YGK++ T+  LPVKTD
Sbjct  1    MASSASLRSDIYNREERKQQYQAYIRGLNAYDRHNKFLNDYVRFYGKEKPTEVKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
             DTLREGYRFIR+EEDD+N SWEQRLVKRYYDKLFKEYCIAD++ YK+G+IGLRWRTE+E
Sbjct  61   YDTLREGYRFIRSEEDDLNASWEQRLVKRYYDKLFKEYCIADLSRYKTGQIGLRWRTERE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAekllykkrke  573
            VISGKGQF+CGNKHC+EK+ LASYEVNF Y EAGE+KQALVKL  CERCA KL YK+RKE
Sbjct  121  VISGKGQFVCGNKHCDEKE-LASYEVNFSYHEAGEHKQALVKLAACERCAGKLHYKRRKE  179

Query  574  eqlkekerrkrer---seSNdqeddehdrrrerKKGSKASASAEDRNKTDEDDENFDEYL  744
             +  E++ +KR+R   S  ++++ +     RE++KG KAS S  D  +  EDDENFDE+L
Sbjct  180  HERSERKAKKRKREQWSSEDNKDAEHEACIREKRKGRKASKS--DGKRGIEDDENFDEFL  237

Query  745  EGMFP  759
            EGMFP
Sbjct  238  EGMFP  242



>ref|XP_009354751.1| PREDICTED: protein FRA10AC1 isoform X3 [Pyrus x bretschneideri]
Length=199

 Score =   294 bits (752),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++  I+DRE RKQQYQA+I GLNAYDRHKKF+ DYV +YG+  S+   LPVKTD
Sbjct  1    MASFGSLKSAIFDREERKQQYQAHILGLNAYDRHKKFVKDYVNFYGRQESSHVKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREGYRFIR+EEDDM+ SWEQRLVKRYYDKLFKEYCIADM+HYKSGKIGLRWRTEKE
Sbjct  61   QDTLREGYRFIRSEEDDMDRSWEQRLVKRYYDKLFKEYCIADMSHYKSGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCER  537
            V+SGKGQFICGNKHC+ KDGLASYEVNF Y EAGENKQALVKLVTC+R
Sbjct  121  VVSGKGQFICGNKHCDVKDGLASYEVNFSYFEAGENKQALVKLVTCQR  168



>ref|XP_009354750.1| PREDICTED: protein FRA10AC1 isoform X2 [Pyrus x bretschneideri]
Length=219

 Score =   294 bits (753),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++  I+DRE RKQQYQA+I GLNAYDRHKKF+ DYV +YG+  S+   LPVKTD
Sbjct  1    MASFGSLKSAIFDREERKQQYQAHILGLNAYDRHKKFVKDYVNFYGRQESSHVKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREGYRFIR+EEDDM+ SWEQRLVKRYYDKLFKEYCIADM+HYKSGKIGLRWRTEKE
Sbjct  61   QDTLREGYRFIRSEEDDMDRSWEQRLVKRYYDKLFKEYCIADMSHYKSGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCER  537
            V+SGKGQFICGNKHC+ KDGLASYEVNF Y EAGENKQALVKLVTC+R
Sbjct  121  VVSGKGQFICGNKHCDVKDGLASYEVNFSYFEAGENKQALVKLVTCQR  168



>ref|XP_006414606.1| hypothetical protein EUTSA_v10026084mg [Eutrema salsugineum]
 gb|ESQ56059.1| hypothetical protein EUTSA_v10026084mg [Eutrema salsugineum]
Length=246

 Score =   295 bits (756),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 165/245 (67%), Positives = 201/245 (82%), Gaps = 5/245 (2%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M S  +IR  IYDRE RKQQYQA+I+GLNAY+RHKKFL DYV +YGK +S +  LPVKTD
Sbjct  1    MASSATIRSEIYDREERKQQYQAHIRGLNAYERHKKFLKDYVRFYGKGKSVEVKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
             DTLREGYRFIR+EEDD+NPSWEQRLVKRYYDKLFKE+CIADM+ YK+GK+GLRWRTEKE
Sbjct  61   HDTLREGYRFIRSEEDDLNPSWEQRLVKRYYDKLFKEFCIADMSRYKTGKMGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAek---llykk  564
            V+SGKGQF+CG+K C+EKDGLASYEVNF Y EAGE+KQALVKLV CERC+EK      K+
Sbjct  121  VMSGKGQFMCGSKQCDEKDGLASYEVNFSYHEAGEDKQALVKLVACERCSEKLYYKRRKE  180

Query  565  rkeeqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRNKTDEDDENFDEYL  744
             ++   KEK++ KR+R+ S+ ++D + + RR+ KKG   S  ++DR    +DDENFDEY+
Sbjct  181  GEKSDSKEKKKHKRKRNRSSSEDDTDEEERRKGKKGKSKSVGSDDRE--GKDDENFDEYM  238

Query  745  EGMFP  759
            EGMFP
Sbjct  239  EGMFP  243



>ref|XP_008375179.1| PREDICTED: protein FRA10AC1 [Malus domestica]
 ref|XP_008346931.1| PREDICTED: protein FRA10AC1-like [Malus domestica]
Length=247

 Score =   295 bits (755),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++  I+DRE RKQQYQA+I GLNAYDRHKKF+ DYV +YG+  S+    PVKTD
Sbjct  1    MASFGSLKSAIFDREERKQQYQAHILGLNAYDRHKKFVKDYVNFYGRQESSHVKPPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREGYRFIR+EEDDM+ SWEQRLVKRYYDKLFKEYCIADM+HYKSGKIGLRWRTEKE
Sbjct  61   QDTLREGYRFIRSEEDDMDRSWEQRLVKRYYDKLFKEYCIADMSHYKSGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            V+SGKGQFICGNKHC+ KDGLASYEVNF Y EAGENKQALVKLVTC+RC+
Sbjct  121  VVSGKGQFICGNKHCDVKDGLASYEVNFSYFEAGENKQALVKLVTCQRCS  170



>ref|NP_193239.5| FRA10AC1 domain-containing protein [Arabidopsis thaliana]
 gb|AEE83542.1| FRA10AC1 domain-containing protein [Arabidopsis thaliana]
Length=278

 Score =   295 bits (756),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            MTS  +IR  IYDRE RKQQYQA+I+GLNAY+RHKKFL DYV +YGKD+  +  LPVKTD
Sbjct  1    MTSSAAIRSDIYDREERKQQYQAHIRGLNAYERHKKFLKDYVRFYGKDKPAEVKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREGYRFIR+EEDD++PSWEQRLVKRYYDKLFKEYCIADM+ YK+GK+GLRWRTEKE
Sbjct  61   QDTLREGYRFIRSEEDDLDPSWEQRLVKRYYDKLFKEYCIADMSRYKTGKMGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            V++GKGQF+CG+KHC+EK+GLASYEVNF Y EAGE+KQALVKLV CERCA
Sbjct  121  VMTGKGQFMCGSKHCDEKEGLASYEVNFSYHEAGEDKQALVKLVACERCA  170



>ref|XP_002521375.1| Protein FRA10AC1, putative [Ricinus communis]
 gb|EEF41043.1| Protein FRA10AC1, putative [Ricinus communis]
Length=168

 Score =   289 bits (740),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++  IYD+E RKQQYQ+ I+GLNAYDRHKKFL+DYV++YGK+ ST   LP+KTD
Sbjct  1    MASFGSLKSTIYDKEERKQQYQSYIRGLNAYDRHKKFLNDYVSFYGKENSTNLKLPIKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            +DTLREGYRFIRT EDDM+ SWEQRLVKRYYDKLFK+YCIADM+HYKSGKIGLRWRTEKE
Sbjct  61   KDTLREGYRFIRTAEDDMDTSWEQRLVKRYYDKLFKKYCIADMSHYKSGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCER  537
            VISGKGQFICGNKHC++KD L+SYEVNF Y EAGENKQALVKLV C+R
Sbjct  121  VISGKGQFICGNKHCDDKDDLSSYEVNFSYFEAGENKQALVKLVACKR  168



>ref|XP_010695220.1| PREDICTED: protein FRA10AC1 [Beta vulgaris subsp. vulgaris]
Length=304

 Score =   294 bits (752),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++  I+DRE RK  YQ +I+GLNAYDRHKKFL+DYV YYG +    + LPVKTD
Sbjct  1    MASFSSLKSAIFDREERKLHYQDHIRGLNAYDRHKKFLNDYVRYYGNEGPADQKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QD LREGYRFIR+EEDDM+PSWEQRLVKRYYDKLFKEYCIADM+ YKSGKIGLRWRTEKE
Sbjct  61   QDALREGYRFIRSEEDDMDPSWEQRLVKRYYDKLFKEYCIADMSKYKSGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            VISGKGQFICGNKHC+E++GLAS+EVNF Y EAGE+KQALVKLV CERCA
Sbjct  121  VISGKGQFICGNKHCDERNGLASFEVNFSYFEAGESKQALVKLVVCERCA  170



>ref|XP_009354753.1| PREDICTED: protein FRA10AC1 isoform X4 [Pyrus x bretschneideri]
Length=198

 Score =   285 bits (728),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++  I+DRE RKQQYQA+I GLNAYDRHKKF+ DYV +YG+  S+   LPVKTD
Sbjct  1    MASFGSLKSAIFDREERKQQYQAHILGLNAYDRHKKFVKDYVNFYGRQESSHVKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREGYRFIR+EEDDM+ SWEQRLVKRYYDKLFKEYCIADM+HYKSGKIGLRWRTEKE
Sbjct  61   QDTLREGYRFIRSEEDDMDRSWEQRLVKRYYDKLFKEYCIADMSHYKSGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKL  522
            V+SGKGQFICGNKHC+ KDGLASYEVNF Y EAGENKQALVKL
Sbjct  121  VVSGKGQFICGNKHCDVKDGLASYEVNFSYFEAGENKQALVKL  163



>ref|XP_010909903.1| PREDICTED: protein FRA10AC1 isoform X3 [Elaeis guineensis]
Length=245

 Score =   286 bits (732),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 146/248 (59%), Positives = 183/248 (74%), Gaps = 9/248 (4%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M S  S++  I+DRE RK QYQ++I+GLNAYDRHKKF++DYV +YG  +     +P+KTD
Sbjct  1    MASLGSLKSSIFDREERKMQYQSHIRGLNAYDRHKKFMNDYVQFYGNTKDVHNDMPIKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDT+REGYRFI +EEDDM+ +WE+RLVKRYYDKLFKEYCIADM+ YK G+IGLRWRTEKE
Sbjct  61   QDTIREGYRFIISEEDDMDSTWEKRLVKRYYDKLFKEYCIADMSQYKMGQIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAek------ll  555
            VISGKGQFICGN+ CNE   L SYEVNF Y EAGE+KQALVKLV C+RCAEK        
Sbjct  121  VISGKGQFICGNRACNENKSLGSYEVNFSYTEAGESKQALVKLVACKRCAEKLTYKRNKE  180

Query  556  ykkrkeeqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRNKTDEDDENFD  735
             +  +  +  + +R++    + +  +D+        KKG K S+SA D  +TDED  NF+
Sbjct  181  KEHSQVREKDKYKRKRERSRDGDSTDDEYDKSTNRSKKGQKTSSSAND-GRTDED--NFE  237

Query  736  EYLEGMFP  759
            E+LEGMFP
Sbjct  238  EFLEGMFP  245



>ref|NP_001154235.1| FRA10AC1 domain-containing protein [Arabidopsis thaliana]
 gb|AEE83543.1| FRA10AC1 domain-containing protein [Arabidopsis thaliana]
Length=282

 Score =   287 bits (734),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 134/174 (77%), Positives = 155/174 (89%), Gaps = 4/174 (2%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARK----QQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLP  201
            MTS  +IR  IYDRE RK    +QYQA+I+GLNAY+RHKKFL DYV +YGKD+  +  LP
Sbjct  1    MTSSAAIRSDIYDREERKHRVCRQYQAHIRGLNAYERHKKFLKDYVRFYGKDKPAEVKLP  60

Query  202  VKTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
            VKTDQDTLREGYRFIR+EEDD++PSWEQRLVKRYYDKLFKEYCIADM+ YK+GK+GLRWR
Sbjct  61   VKTDQDTLREGYRFIRSEEDDLDPSWEQRLVKRYYDKLFKEYCIADMSRYKTGKMGLRWR  120

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            TEKEV++GKGQF+CG+KHC+EK+GLASYEVNF Y EAGE+KQALVKLV CERCA
Sbjct  121  TEKEVMTGKGQFMCGSKHCDEKEGLASYEVNFSYHEAGEDKQALVKLVACERCA  174



>ref|XP_010088231.1| hypothetical protein L484_012513 [Morus notabilis]
 gb|EXB32783.1| hypothetical protein L484_012513 [Morus notabilis]
Length=257

 Score =   286 bits (731),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 155/182 (85%), Gaps = 12/182 (7%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++  I+DRE +KQQYQA+I+GLNAYDRHKKF+ DYV +YGK++S+    PVKTD
Sbjct  1    MASFASLKSAIFDREEKKQQYQAHIRGLNAYDRHKKFIKDYVGFYGKEKSSSIRWPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKE----------YCIADMTHYKSGK  363
            QDTLREGYRFIR+EEDDM+ SWEQRLVKRYYDKLFK+          YCIADM++YKSGK
Sbjct  61   QDTLREGYRFIRSEEDDMDTSWEQRLVKRYYDKLFKDSIVALKTNLRYCIADMSYYKSGK  120

Query  364  IGLRWRTEKEVISGKGQFICGNKHCNEKDGLASYE--VNFCYVEAGENKQALVKLVTCER  537
            IGLRWRTEKEV+SGKGQFICGNKHC+EK+GLASYE  VNF Y EAGENKQALVKLV CER
Sbjct  121  IGLRWRTEKEVVSGKGQFICGNKHCDEKEGLASYEARVNFSYFEAGENKQALVKLVACER  180

Query  538  CA  543
            CA
Sbjct  181  CA  182



>ref|XP_009385411.1| PREDICTED: protein FRA10AC1 isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=244

 Score =   284 bits (727),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 153/249 (61%), Positives = 187/249 (75%), Gaps = 12/249 (5%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M S RS++  IYDRE +K QYQ+ I+GLNAYDRH KF+ DYV +YGK   T + LP+KTD
Sbjct  1    MASLRSLKSSIYDREEKKMQYQSQIRGLNAYDRHNKFMKDYVQFYGKTSHTHDKLPIKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDT+REGYRFI +E+DDM  +WE+RLVKRYY+KLFKEYCIADM+ YK GKIGLRWRTEKE
Sbjct  61   QDTIREGYRFIISEDDDMESTWEKRLVKRYYNKLFKEYCIADMSLYKQGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAek-----lly  558
            V+SGKGQFICG+K CNEKDGL SYEVNF YVE GENKQALVKLV C+ CAEK        
Sbjct  121  VVSGKGQFICGDKKCNEKDGLGSYEVNFSYVEVGENKQALVKLVACKGCAEKLAYRRQKE  180

Query  559  kkrkeeqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRNKTDEDD--ENF  732
            ++R ++  ++  +RKRE+ + ND +D+        KKG + SAS      T E D  E+F
Sbjct  181  RERLKDNDRDTSKRKREKDKDNDIDDEYDKNSNTIKKGRRTSASV-----TKETDAVEDF  235

Query  733  DEYLEGMFP  759
            +E+LEGMFP
Sbjct  236  EEFLEGMFP  244



>ref|XP_002449911.1| hypothetical protein SORBIDRAFT_05g025520 [Sorghum bicolor]
 gb|EES08899.1| hypothetical protein SORBIDRAFT_05g025520 [Sorghum bicolor]
Length=250

 Score =   284 bits (727),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 148/258 (57%), Positives = 186/258 (72%), Gaps = 24/258 (9%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M S   ++  I+DRE RK QYQ++I+GLNAYDRHKKF+ DYV +YG +++    LP+KTD
Sbjct  1    MASLGRLKSAIFDREERKMQYQSHIRGLNAYDRHKKFMKDYVQFYGHEKNVDSSLPIKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            +DTLREGYRFI +EEDDM+ +WE+RLVKRYYDKLFKEYCIADMT YK GKIGLRWRTEKE
Sbjct  61   KDTLREGYRFILSEEDDMDSTWEKRLVKRYYDKLFKEYCIADMTQYKKGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAekllykkrke  573
            VISGKGQFICGN+HC+EK GL SYEVNF YVEAGE KQALVKLV C+RCA        ++
Sbjct  121  VISGKGQFICGNRHCDEKHGLGSYEVNFSYVEAGEQKQALVKLVACKRCA--------EK  172

Query  574  eqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAED------RNKTDE------  717
               K ++ +++E   S ++E +  D  + ++K  +   ++ED      R K D       
Sbjct  173  LAYKRQKEKEKENELSGEKEIELKDSDKRKRKHEENDDTSEDEDEKYRRKKKDRSGASSR  232

Query  718  ----DDENFDEYLEGMFP  759
                +DE F+EYLEGMFP
Sbjct  233  SSGNNDEGFEEYLEGMFP  250



>ref|XP_004979825.1| PREDICTED: protein FRA10AC1-like isoform X1 [Setaria italica]
Length=266

 Score =   277 bits (709),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 158/266 (59%), Positives = 194/266 (73%), Gaps = 24/266 (9%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M S   ++  I+ RE RK QYQ++I+GLNAYDRHKKF+ DYV +YG +++    LP+KTD
Sbjct  1    MASLGRLKSAIFGREERKMQYQSHIRGLNAYDRHKKFMKDYVQFYGHEKNVDNSLPIKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            +DTLREGYRFI +EEDDM+ +WE+RLVKRYYDKLFKEYCIADMT YK GKIGLRWRTEKE
Sbjct  61   KDTLREGYRFILSEEDDMDSTWEKRLVKRYYDKLFKEYCIADMTQYKKGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAekll------  555
            VISGKGQFICGN+HC+EK GL SYEVNF YVEAGE KQALVKLV C+RCAEKL       
Sbjct  121  VISGKGQFICGNRHCDEKHGLGSYEVNFSYVEAGEQKQALVKLVACKRCAEKLAYKRLKE  180

Query  556  --------ykkrkeeqlkekerrkrerseSNdqeddehdrrrerKKGSK-----ASASAE  696
                        KE +LK++++RKRE  ES+D  +DE  + R +KKG+      +  +A 
Sbjct  181  KEKEKEEEPCGEKEIELKDRDKRKREHEESDDTSEDEAKKDRRKKKGTADCKTYSCTNAA  240

Query  697  DRN-----KTDEDDENFDEYLEGMFP  759
            DR       +  +DE F+E+LEGMFP
Sbjct  241  DRKGASSRSSGNNDEGFEEFLEGMFP  266



>ref|XP_008667693.1| PREDICTED: uncharacterized protein LOC100277486 isoform X1 [Zea 
mays]
 gb|ACN25740.1| unknown [Zea mays]
 tpg|DAA42338.1| TPA: hypothetical protein ZEAMMB73_484226 [Zea mays]
Length=262

 Score =   277 bits (708),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 148/262 (56%), Positives = 185/262 (71%), Gaps = 20/262 (8%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M S   ++  I+DRE RK QYQ++I+GLNAYDRHKKF+ DYV +YG +++    LP+KTD
Sbjct  1    MASLGRLKSAIFDREERKMQYQSHIRGLNAYDRHKKFMKDYVQFYGHEKNVDSSLPIKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            +DTLREGYRFI +EED+M+ +WE+RLVKRYYDKLFKEYCIADMT YK GKIGLRWRTEKE
Sbjct  61   KDTLREGYRFILSEEDEMDSTWEKRLVKRYYDKLFKEYCIADMTQYKKGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAekllykkrke  573
            VISGKGQFICGN+HC+EK GL SYEVNF YVEA E KQALVKLV C+RCAEKL YK++KE
Sbjct  121  VISGKGQFICGNRHCDEKHGLGSYEVNFSYVEAEEQKQALVKLVACKRCAEKLAYKRQKE  180

Query  574  eqlkekerrkrerseSNdqeddehdrrr----------erKKGSKASASAEDRNKTD---  714
            ++ + +   ++E    +  +                   +KKG K + ++  +   D   
Sbjct  181  KENENELPGEKEIDLKDSDKRKRKHEESDHSSEDEKYRRKKKGFKDAKNSGSQRPADRCG  240

Query  715  -------EDDENFDEYLEGMFP  759
                     DE F+EYLEGMFP
Sbjct  241  ASSKSSGNSDEAFEEYLEGMFP  262



>ref|XP_004979826.1| PREDICTED: protein FRA10AC1-like isoform X2 [Setaria italica]
Length=252

 Score =   276 bits (705),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 145/170 (85%), Gaps = 0/170 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M S   ++  I+ RE RK QYQ++I+GLNAYDRHKKF+ DYV +YG +++    LP+KTD
Sbjct  1    MASLGRLKSAIFGREERKMQYQSHIRGLNAYDRHKKFMKDYVQFYGHEKNVDNSLPIKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            +DTLREGYRFI +EEDDM+ +WE+RLVKRYYDKLFKEYCIADMT YK GKIGLRWRTEKE
Sbjct  61   KDTLREGYRFILSEEDDMDSTWEKRLVKRYYDKLFKEYCIADMTQYKKGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            VISGKGQFICGN+HC+EK GL SYEVNF YVEAGE KQALVKLV C+RCA
Sbjct  121  VISGKGQFICGNRHCDEKHGLGSYEVNFSYVEAGEQKQALVKLVACKRCA  170



>ref|XP_003577303.1| PREDICTED: protein FRA10AC1 isoform X1 [Brachypodium distachyon]
Length=252

 Score =   275 bits (704),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 147/249 (59%), Positives = 184/249 (74%), Gaps = 9/249 (4%)
 Frame = +1

Query  37   TSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTDQ  216
             S   +R  IYD+E RK QYQ++I+GLNAYDRHKKF++DYV +YG D++    LP+KTD+
Sbjct  3    ASLGRLRSAIYDKEERKTQYQSHIRGLNAYDRHKKFMNDYVRFYGHDKNLDHSLPIKTDK  62

Query  217  DTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEV  396
            DTLREGYRFI +EEDD++ +WE+RLVKRY DKLFKEYCIADMT YK GKIGLRWRTEKEV
Sbjct  63   DTLREGYRFILSEEDDVDSTWEKRLVKRYCDKLFKEYCIADMTAYKKGKIGLRWRTEKEV  122

Query  397  ISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAe----kllykk  564
            ISGKGQF+CGNK CNE +GL SYEVNF YVEAGE KQALVKLV C+RCAE    K   ++
Sbjct  123  ISGKGQFVCGNKKCNENNGLGSYEVNFSYVEAGEQKQALVKLVACKRCAEKLAYKREKER  182

Query  565  rkeeqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRNK-----TDEDDEN  729
             KE++L  ++    + ++   Q D+E +   + +   K S   +DR +      D+ DE 
Sbjct  183  VKEKELSGEKEMDLKENKRKRQHDEESEDTTDDESAEKYSRRKKDRKRASSRNVDDKDEG  242

Query  730  FDEYLEGMF  756
            FDE+LEGMF
Sbjct  243  FDEFLEGMF  251



>emb|CDP07783.1| unnamed protein product [Coffea canephora]
Length=174

 Score =   271 bits (693),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 138/148 (93%), Gaps = 0/148 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++Q I+D+EARKQQYQA+I+GLNAYDRHKKF++DYV +YGK+RS +  LPVKTD
Sbjct  1    MASFASLKQTIFDKEARKQQYQAHIRGLNAYDRHKKFINDYVGFYGKERSVKAKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADM+HYKSGK+G+RWRTEKE
Sbjct  61   QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMSHYKSGKVGMRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNF  477
            VISGKGQF CGNKHCN K+GLASYE +F
Sbjct  121  VISGKGQFFCGNKHCNNKEGLASYEASF  148



>ref|XP_009385412.1| PREDICTED: protein FRA10AC1 isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=176

 Score =   269 bits (688),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 142/167 (85%), Gaps = 0/167 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M S RS++  IYDRE +K QYQ+ I+GLNAYDRH KF+ DYV +YGK   T + LP+KTD
Sbjct  1    MASLRSLKSSIYDREEKKMQYQSQIRGLNAYDRHNKFMKDYVQFYGKTSHTHDKLPIKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDT+REGYRFI +E+DDM  +WE+RLVKRYY+KLFKEYCIADM+ YK GKIGLRWRTEKE
Sbjct  61   QDTIREGYRFIISEDDDMESTWEKRLVKRYYNKLFKEYCIADMSLYKQGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCE  534
            V+SGKGQFICG+K CNEKDGL SYEVNF YVE GENKQALVKLV C+
Sbjct  121  VVSGKGQFICGDKKCNEKDGLGSYEVNFSYVEVGENKQALVKLVACK  167



>ref|XP_010523675.1| PREDICTED: protein FRA10AC1 isoform X2 [Tarenaya hassleriana]
Length=178

 Score =   269 bits (688),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 147/167 (88%), Gaps = 1/167 (1%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M S  S+R  IY+RE RKQQYQA I+GLNAYDRH KFL+DYV +YGK++ T+  LPVKTD
Sbjct  1    MASSASLRSDIYNREERKQQYQAYIRGLNAYDRHNKFLNDYVRFYGKEKPTEVKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
             DTLREGYRFIR+EEDD+N SWEQRLVKRYYDKLFKEYCIAD++ YK+G+IGLRWRTE+E
Sbjct  61   YDTLREGYRFIRSEEDDLNASWEQRLVKRYYDKLFKEYCIADLSRYKTGQIGLRWRTERE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCE  534
            VISGKGQF+CGNKHC+EK+ LASYEVNF Y EAGE+KQALVKL  CE
Sbjct  121  VISGKGQFVCGNKHCDEKE-LASYEVNFSYHEAGEHKQALVKLAACE  166



>emb|CDY47802.1| BnaC01g22580D [Brassica napus]
Length=346

 Score =   275 bits (703),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 149/168 (89%), Gaps = 0/168 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M S  +IR  IYDRE RKQQYQA+I+GLNAY+RHKKFL DYV +YGKD+ T+  LPVKTD
Sbjct  1    MASSATIRSEIYDREERKQQYQAHIRGLNAYERHKKFLKDYVRFYGKDKPTEVKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
             DTLREGYRFIR+EEDD+NPSWEQRLVKRYYDKLFKEYCIADM+ YK+G++GLRWRTEKE
Sbjct  61   HDTLREGYRFIRSEEDDLNPSWEQRLVKRYYDKLFKEYCIADMSRYKTGQMGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCER  537
            V+SGKGQF+CG+K C+E +GL + +VNF Y EAGE+KQALVKLVTCER
Sbjct  121  VMSGKGQFMCGSKQCHEIEGLLNLQVNFSYHEAGEHKQALVKLVTCER  168


 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 140/174 (80%), Gaps = 0/174 (0%)
 Frame = +1

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RFIR+EEDD+NPSWEQRLVKRYYDKLFKEYCIADM+ YK+G++GLRWRTEKEV+SGKGQF
Sbjct  168  RFIRSEEDDLNPSWEQRLVKRYYDKLFKEYCIADMSRYKTGQMGLRWRTEKEVMSGKGQF  227

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAekllykkrkeeqlkeker  597
            +CG+K C+E +GL + +VNF Y EAGE+KQALVKLVTCERCAEKL YK+RK+ +  E + 
Sbjct  228  MCGSKQCHEIEGLLNLQVNFSYHEAGEHKQALVKLVTCERCAEKLYYKRRKDAERSESKE  287

Query  598  rkrerseSNdqeddehdrrrerKKGSKASASAEDRNKTDEDDENFDEYLEGMFP  759
            +KR++ + N    ++     ER+KG K  +  E   +  +DDENFDE++EGMFP
Sbjct  288  KKRQKRKRNRSSSEDDIEEEERRKGKKNKSKLEGCEREGKDDENFDEFMEGMFP  341



>ref|XP_006594409.1| PREDICTED: protein FRA10AC1-like isoform X2 [Glycine max]
Length=229

 Score =   271 bits (692),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 156/247 (63%), Positives = 191/247 (77%), Gaps = 23/247 (9%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++  I+++E RKQQYQ++I+GLNAYDRHKKF+ DYV +YGK+R +   LP+KTD
Sbjct  1    MASFGSLKSTIFEKEERKQQYQSHIRGLNAYDRHKKFIDDYVKFYGKERPSNLKLPIKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREGYRFIR+EEDDMNPSWEQRLVKRYYDKLFKEYC+ADM+ YK             
Sbjct  61   QDTLREGYRFIRSEEDDMNPSWEQRLVKRYYDKLFKEYCLADMSQYKI------------  108

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA-----eklly  558
                 GQFICGNKHCNEKDGLASYEVNF Y EAGENKQALVKLVTCERCA     ++   
Sbjct  109  -----GQFICGNKHCNEKDGLASYEVNFYYFEAGENKQALVKLVTCERCAFKLNYKRQKE  163

Query  559  kkrkeeqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRNKTDEDDENFDE  738
            K++ E++ +E++RRKR RS+S+D  DD H+ +  R+KG +A  SA D +K D+DD+N DE
Sbjct  164  KEQLEKRQQEQDRRKRNRSKSDDDLDDFHESKERRRKGKRALTSASD-HKIDDDDDNLDE  222

Query  739  YLEGMFP  759
            +LEGMFP
Sbjct  223  FLEGMFP  229



>ref|XP_006663072.1| PREDICTED: protein FRA10AC1-like [Oryza brachyantha]
Length=253

 Score =   271 bits (694),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 143/251 (57%), Positives = 184/251 (73%), Gaps = 10/251 (4%)
 Frame = +1

Query  37   TSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTDQ  216
            +S   ++  I+D+E RK QYQ++I+GLNAYDRHKKF+ DYV +YG  +     +P+KTD+
Sbjct  3    SSLGRLKSSIFDKEERKMQYQSHIRGLNAYDRHKKFMKDYVQFYGHGKDADNSVPIKTDK  62

Query  217  DTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEV  396
            DTLREGYRFI +EEDDM+ +WE+RLVKRYYDKLFKEYCIADM+ YK GKIGLRWRTEKEV
Sbjct  63   DTLREGYRFIFSEEDDMDSTWEKRLVKRYYDKLFKEYCIADMSQYKKGKIGLRWRTEKEV  122

Query  397  ISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAek-----llyk  561
            ISGKGQFICGN+ C+EK+GL SYEVNF Y+EAGE KQALVKLV C+RCAEK        K
Sbjct  123  ISGKGQFICGNRICDEKNGLGSYEVNFSYIEAGEQKQALVKLVACKRCAEKLAYKRQKEK  182

Query  562  krkeeqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRN-----KTDEDDE  726
            +++    KE E ++R++ + + +  +E +   E +   K +   +DR      K    DE
Sbjct  183  EKELSGEKEMELKQRDKRKRDHEGSEETEDASEDESTEKYTRRTKDRKRSSTRKMSNTDE  242

Query  727  NFDEYLEGMFP  759
             F+E+LEGMFP
Sbjct  243  GFEEFLEGMFP  253



>ref|XP_006594410.1| PREDICTED: protein FRA10AC1-like isoform X3 [Glycine max]
Length=229

 Score =   270 bits (690),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 156/247 (63%), Positives = 191/247 (77%), Gaps = 23/247 (9%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++  I+++E RKQQYQ++I+GLNAYDRHKKF+ DYV +YGK+R +   LP+KTD
Sbjct  1    MASFGSLKSTIFEKEERKQQYQSHIRGLNAYDRHKKFIDDYVKFYGKERPSNLKLPIKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREGYRFIR+EEDDMNPSWEQRLVKRYYDKLFKEYC+ADM+ YK GK          
Sbjct  61   QDTLREGYRFIRSEEDDMNPSWEQRLVKRYYDKLFKEYCLADMSQYKIGK----------  110

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA-----eklly  558
                   FICGNKHCNEKDGLASYEVNF Y EAGENKQALVKLVTCERCA     ++   
Sbjct  111  -------FICGNKHCNEKDGLASYEVNFYYFEAGENKQALVKLVTCERCAFKLNYKRQKE  163

Query  559  kkrkeeqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRNKTDEDDENFDE  738
            K++ E++ +E++RRKR RS+S+D  DD H+ +  R+KG +A  SA D +K D+DD+N DE
Sbjct  164  KEQLEKRQQEQDRRKRNRSKSDDDLDDFHESKERRRKGKRALTSASD-HKIDDDDDNLDE  222

Query  739  YLEGMFP  759
            +LEGMFP
Sbjct  223  FLEGMFP  229



>ref|NP_001144502.1| uncharacterized protein LOC100277486 [Zea mays]
 gb|ACG40970.1| hypothetical protein [Zea mays]
 tpg|DAA42337.1| TPA: hypothetical protein ZEAMMB73_484226 [Zea mays]
Length=172

 Score =   267 bits (683),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 144/170 (85%), Gaps = 0/170 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M S   ++  I+DRE RK QYQ++I+GLNAYDRHKKF+ DYV +YG +++    LP+KTD
Sbjct  1    MASLGRLKSAIFDREERKMQYQSHIRGLNAYDRHKKFMKDYVQFYGHEKNVDSSLPIKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            +DTLREGYRFI +EED+M+ +WE+RLVKRYYDKLFKEYCIADMT YK GKIGLRWRTEKE
Sbjct  61   KDTLREGYRFILSEEDEMDSTWEKRLVKRYYDKLFKEYCIADMTQYKKGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            VISGKGQFICGN+HC+EK GL SYEVNF YVEA E KQALVKLV C+R A
Sbjct  121  VISGKGQFICGNRHCDEKHGLGSYEVNFSYVEAEEQKQALVKLVACKRKA  170



>tpg|DAA42340.1| TPA: hypothetical protein ZEAMMB73_484226 [Zea mays]
Length=261

 Score =   270 bits (690),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 150/269 (56%), Positives = 187/269 (70%), Gaps = 35/269 (13%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVA-------------YYGK  174
            M S   ++  I+DRE RK QYQ++I+GLNAYDRHKKF+ DYV              +YG 
Sbjct  1    MASLGRLKSAIFDREERKMQYQSHIRGLNAYDRHKKFMKDYVCVGTYKIPVMLEIQFYGH  60

Query  175  DRSTQEVLPVKTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYK  354
            +++    LP+KTD+DTLREGYRFI +EED+M+ +WE+RLVKRYYDKLFKEYCIADMT YK
Sbjct  61   EKNVDSSLPIKTDKDTLREGYRFILSEEDEMDSTWEKRLVKRYYDKLFKEYCIADMTQYK  120

Query  355  SGKIGLRWRTEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCE  534
             GKIGLRWRTEKEVISGKGQFICGN+HC+EK GL SYEVNF YVEA E KQALVKLV C+
Sbjct  121  KGKIGLRWRTEKEVISGKGQFICGNRHCDEKHGLGSYEVNFSYVEAEEQKQALVKLVACK  180

Query  535  RCAekllykkrkeeqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAED----R  702
            RCAEKL YK++KE++ + +   ++E    +          + ++K  ++  S+ED    R
Sbjct  181  RCAEKLAYKRQKEKENENELPGEKEIDLKD--------SDKRKRKHEESDHSSEDEKYRR  232

Query  703  NKTD----------EDDENFDEYLEGMFP  759
             K D            DE F+EYLEGMFP
Sbjct  233  KKKDRCGASSKSSGNSDEAFEEYLEGMFP  261



>ref|XP_010909901.1| PREDICTED: protein FRA10AC1 homolog isoform X1 [Elaeis guineensis]
Length=264

 Score =   269 bits (687),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 143/170 (84%), Gaps = 0/170 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M S  S++  I+DRE RK QYQ++I+GLNAYDRHKKF++DYV +YG  +     +P+KTD
Sbjct  1    MASLGSLKSSIFDREERKMQYQSHIRGLNAYDRHKKFMNDYVQFYGNTKDVHNDMPIKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDT+REGYRFI +EEDDM+ +WE+RLVKRYYDKLFKEYCIADM+ YK G+IGLRWRTEKE
Sbjct  61   QDTIREGYRFIISEEDDMDSTWEKRLVKRYYDKLFKEYCIADMSQYKMGQIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            VISGKGQFICGN+ CNE   L SYEVNF Y EAGE+KQALVKLV C+RCA
Sbjct  121  VISGKGQFICGNRACNENKSLGSYEVNFSYTEAGESKQALVKLVACKRCA  170



>gb|EEC68520.1| hypothetical protein OsI_36803 [Oryza sativa Indica Group]
 gb|EEE52430.1| hypothetical protein OsJ_34558 [Oryza sativa Japonica Group]
Length=256

 Score =   268 bits (684),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 144/254 (57%), Positives = 188/254 (74%), Gaps = 13/254 (5%)
 Frame = +1

Query  37   TSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTDQ  216
            +S   ++  I+D+E RK QYQ++I+GLNAYDRHKKF+ DYV +YG D++     P+KTD+
Sbjct  3    SSLGRLKSSIFDKEERKMQYQSHIRGLNAYDRHKKFMKDYVQFYGHDKNVDNRAPIKTDK  62

Query  217  DTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEV  396
            DTLREGYRFI +EEDD++ +WE+RLVKRYYDKLFKEYCIADM+ YK GKIGLRWRTEKEV
Sbjct  63   DTLREGYRFILSEEDDVDSTWEKRLVKRYYDKLFKEYCIADMSQYKRGKIGLRWRTEKEV  122

Query  397  ISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAekll-------  555
            ISGKGQF+CGN+ C+EK+GL SYEVNF Y+EAGE KQALVKLV C+RCAEKL        
Sbjct  123  ISGKGQFLCGNRICDEKNGLGSYEVNFSYIEAGEQKQALVKLVACQRCAEKLAYKRQKEK  182

Query  556  --ykkrkeeqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRN----KTDE  717
               K+++  + KE E ++R++ +   +  +E +   E +   K S   +DR     K+  
Sbjct  183  EREKEKEISREKEMELKERDKRKREREGSEETEDTSEDESTEKYSRRKKDRKRSSRKSSN  242

Query  718  DDENFDEYLEGMFP  759
            +DE F+E+LEGMFP
Sbjct  243  NDEGFEEFLEGMFP  256



>gb|EPS60799.1| hypothetical protein M569_14002 [Genlisea aurea]
Length=197

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 150/197 (76%), Gaps = 29/197 (15%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SFRS+RQ I+D+EARK+ YQ  I+GLNAYDRH K+L+DY  YYG   + +++LPVK+D
Sbjct  1    MASFRSLRQEIFDKEARKRHYQEEIRGLNAYDRHSKYLNDYARYYGNRENDRQILPVKSD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDTLREGYRFIRTEEDD+NPSWE++LVKRYYDKLFKEYC+ADM+ YK+GKIGLRWRTEKE
Sbjct  61   QDTLREGYRFIRTEEDDLNPSWEKKLVKRYYDKLFKEYCLADMSQYKAGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYE-----------------------------VNFCYV  486
            VISGKGQF+CGNK C+ KD L+SYE                             VNF Y 
Sbjct  121  VISGKGQFVCGNKRCDCKDSLSSYEASLITYLALWLYGISIFFMPVYLSVTEEQVNFSYH  180

Query  487  EAGENKQALVKLVTCER  537
            EAGENKQALVKLVTCER
Sbjct  181  EAGENKQALVKLVTCER  197



>ref|XP_010237497.1| PREDICTED: protein FRA10AC1 isoform X2 [Brachypodium distachyon]
Length=173

 Score =   263 bits (673),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +1

Query  37   TSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTDQ  216
             S   +R  IYD+E RK QYQ++I+GLNAYDRHKKF++DYV +YG D++    LP+KTD+
Sbjct  3    ASLGRLRSAIYDKEERKTQYQSHIRGLNAYDRHKKFMNDYVRFYGHDKNLDHSLPIKTDK  62

Query  217  DTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEV  396
            DTLREGYRFI +EEDD++ +WE+RLVKRY DKLFKEYCIADMT YK GKIGLRWRTEKEV
Sbjct  63   DTLREGYRFILSEEDDVDSTWEKRLVKRYCDKLFKEYCIADMTAYKKGKIGLRWRTEKEV  122

Query  397  ISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            ISGKGQF+CGNK CNE +GL SYEVNF YVEAGE KQALVKLV C+R A
Sbjct  123  ISGKGQFVCGNKKCNENNGLGSYEVNFSYVEAGEQKQALVKLVACKRKA  171



>ref|XP_011093370.1| PREDICTED: protein FRA10AC1 isoform X2 [Sesamum indicum]
Length=248

 Score =   266 bits (680),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 156/252 (62%), Positives = 191/252 (76%), Gaps = 15/252 (6%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++Q I+D+EARKQQYQ +I+GLNAYDRHKKFL+DYV YYGKD+S QE LPVKTD
Sbjct  2    MGSFGSLKQAIFDKEARKQQYQDHIRGLNAYDRHKKFLNDYVGYYGKDKSAQETLPVKTD  61

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLR-----W  378
            QDTLREGYRFIRT+EDDMNPSWEQRLVKRYYDKLFKEYCIADM+ YK+GK+  R     W
Sbjct  62   QDTLREGYRFIRTDEDDMNPSWEQRLVKRYYDKLFKEYCIADMSQYKTGKMEDRKRSDIW  121

Query  379  RTEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAek---  549
             +   VIS   + +     C     +A+ +VNF Y EAGE+KQALVKLV CERCA K   
Sbjct  122  ESLFAVISTATRKMI----CQAMRQVAA-KVNFSYFEAGEHKQALVKLVACERCAAKLYY  176

Query  550  --llykkrkeeqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRNKTDEDD  723
                 K++ + +  EK +RKR+RS+S D  D ++ R +ER+KG KAS SA D NKTD+++
Sbjct  177  KKQKEKEQLKRKENEKHQRKRDRSQSEDDADVDYGRSKERRKGDKASTSATDHNKTDDNN  236

Query  724  ENFDEYLEGMFP  759
            +NFDE+LEGMFP
Sbjct  237  DNFDEFLEGMFP  248



>ref|XP_007052524.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX96681.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=200

 Score =   263 bits (673),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SFRS++  I+DRE +KQQYQA+I+GLNAYDRHKKFL+DYV +YGK++ST   LPVKTD
Sbjct  1    MASFRSLKSAIFDREEKKQQYQAHIRGLNAYDRHKKFLNDYVDFYGKEKSTDVKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
             DTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADM+ Y+SGKIGLRWRTEKE
Sbjct  61   HDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMSQYRSGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYE  468
            VISGKGQFICGNKHCNEK+ LASYE
Sbjct  121  VISGKGQFICGNKHCNEKEDLASYE  145



>gb|ACF87114.1| unknown [Zea mays]
 tpg|DAA42339.1| TPA: hypothetical protein ZEAMMB73_484226 [Zea mays]
Length=185

 Score =   258 bits (658),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 144/183 (79%), Gaps = 13/183 (7%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVA-------------YYGK  174
            M S   ++  I+DRE RK QYQ++I+GLNAYDRHKKF+ DYV              +YG 
Sbjct  1    MASLGRLKSAIFDREERKMQYQSHIRGLNAYDRHKKFMKDYVCVGTYKIPVMLEIQFYGH  60

Query  175  DRSTQEVLPVKTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYK  354
            +++    LP+KTD+DTLREGYRFI +EED+M+ +WE+RLVKRYYDKLFKEYCIADMT YK
Sbjct  61   EKNVDSSLPIKTDKDTLREGYRFILSEEDEMDSTWEKRLVKRYYDKLFKEYCIADMTQYK  120

Query  355  SGKIGLRWRTEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCE  534
             GKIGLRWRTEKEVISGKGQFICGN+HC+EK GL SYEVNF YVEA E KQALVKLV C+
Sbjct  121  KGKIGLRWRTEKEVISGKGQFICGNRHCDEKHGLGSYEVNFSYVEAEEQKQALVKLVACK  180

Query  535  RCA  543
            R A
Sbjct  181  RKA  183



>gb|KGN45127.1| hypothetical protein Csa_7G428150 [Cucumis sativus]
Length=205

 Score =   254 bits (649),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 140/207 (68%), Positives = 167/207 (81%), Gaps = 4/207 (2%)
 Frame = +1

Query  145  LSDYVAYYGKDRSTQEVLPVKTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKE  324
            + DYV +YGK+++ +E LP+KTDQDTLREGYRFIR+EEDDM+ SWEQ+LVKRYYDKLFKE
Sbjct  1    MHDYVHFYGKNKTGEEKLPIKTDQDTLREGYRFIRSEEDDMDTSWEQKLVKRYYDKLFKE  60

Query  325  YCIADMTHYKSGKIGLRWRTEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENK  504
            YCIADMT YKSGKIGLRWR EKEV+SGKGQFICGNKHC+EK GLASYEVNF Y EAGENK
Sbjct  61   YCIADMTQYKSGKIGLRWRAEKEVMSGKGQFICGNKHCDEKSGLASYEVNFSYFEAGENK  120

Query  505  QALVKLVTCERCAekl--lykkrkeeqlkekerrkrerseSNdqeddehdrrrerKKGSK  678
            QALVKLVTC RC++KL    +K KE+  ++++   + +  S+D  D E +  R R+KG K
Sbjct  121  QALVKLVTCGRCSKKLHYKRQKEKEKLERKEQEMSKRKRPSDDSSDTEDEGSRTRRKGKK  180

Query  679  ASASAEDRNKTDEDDENFDEYLEGMFP  759
            AS S  D +K D  +E FDEYLEGMFP
Sbjct  181  ASTSFGD-HKADSKEE-FDEYLEGMFP  205



>ref|XP_001766488.1| predicted protein [Physcomitrella patens]
 gb|EDQ68816.1| predicted protein [Physcomitrella patens]
Length=289

 Score =   239 bits (610),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 134/175 (77%), Gaps = 5/175 (3%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRST-----QEVL  198
            M SF  ++  I++RE R+QQ+   + GLNAY+RHK+F+ DY A+YG           +VL
Sbjct  1    MASFSRVKNDIFEREQRRQQHHDRVLGLNAYERHKQFMRDYQAHYGFSAGVSAGQQHQVL  60

Query  199  PVKTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRW  378
            P KTD+DTLRE YRFIR+EEDD+  SWEQRL KRY+DKLFKEYCIADM+ YK  +IGLRW
Sbjct  61   PAKTDRDTLRETYRFIRSEEDDLERSWEQRLAKRYHDKLFKEYCIADMSRYKENRIGLRW  120

Query  379  RTEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            RTEKEVISGKGQF CGNK C  ++GL SYEVNF Y EAGENKQALVKL  C +C+
Sbjct  121  RTEKEVISGKGQFECGNKKCTAREGLRSYEVNFAYSEAGENKQALVKLRVCPKCS  175



>ref|XP_008790724.1| PREDICTED: protein FRA10AC1 homolog isoform X1 [Phoenix dactylifera]
Length=146

 Score =   226 bits (575),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M S  S++  ++ RE RK QYQ++I+GLNAYDRHKKF++DYV +YG  ++    +P+KTD
Sbjct  1    MASLGSLKSAVFHREERKMQYQSHIRGLNAYDRHKKFMNDYVQFYGNTKNVHNDMPIKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDT+REGYRFI +E+DDM+ +WE+RLVKRYYDKLFKEYCIADM+ YK GKIGLRWRTEKE
Sbjct  61   QDTIREGYRFIISEDDDMDSTWEKRLVKRYYDKLFKEYCIADMSQYKMGKIGLRWRTEKE  120

Query  394  VISGKGQFICGNKHCNEKDGLASYEV  471
            VISGKGQFICGN+ CNEK+ L SYE 
Sbjct  121  VISGKGQFICGNRACNEKESLGSYEA  146



>ref|XP_010909902.1| PREDICTED: protein FRA10AC1 homolog isoform X2 [Elaeis guineensis]
Length=247

 Score =   225 bits (573),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 126/170 (74%), Gaps = 17/170 (10%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M S  S++  I+DRE RK QYQ++I+GLNAYDRHKKF++DYV +YG  +     +P+KTD
Sbjct  1    MASLGSLKSSIFDREERKMQYQSHIRGLNAYDRHKKFMNDYVQFYGNTKDVHNDMPIKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDT+REGYRFI +EEDDM+ +WE+RLVKRYYDKLFKEYCIADM+ YK             
Sbjct  61   QDTIREGYRFIISEEDDMDSTWEKRLVKRYYDKLFKEYCIADMSQYKM------------  108

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
                 GQFICGN+ CNE   L SYEVNF Y EAGE+KQALVKLV C+RCA
Sbjct  109  -----GQFICGNRACNENKSLGSYEVNFSYTEAGESKQALVKLVACKRCA  153



>gb|EMT24526.1| hypothetical protein F775_23674 [Aegilops tauschii]
Length=228

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 123/170 (72%), Gaps = 24/170 (14%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M S   ++  I+DRE RK QYQ++I+GLNAY RHKKF+ DYV +YG +++    LP+KTD
Sbjct  1    MASLGRLKSAIFDREERKMQYQSHIRGLNAYHRHKKFMKDYVQFYGHEKNVDNSLPIKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            +DTLREGYRFI +EEDDM+ +WE+RL                        IGLRWRTEKE
Sbjct  61   KDTLREGYRFILSEEDDMDSTWEKRL------------------------IGLRWRTEKE  96

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            VISGKGQFICGN+HC+EK GL SYEVNF YVEAGE KQALVKLV C+RCA
Sbjct  97   VISGKGQFICGNRHCDEKHGLGSYEVNFSYVEAGEQKQALVKLVACKRCA  146



>gb|EMS53478.1| hypothetical protein TRIUR3_00682 [Triticum urartu]
Length=228

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 123/170 (72%), Gaps = 24/170 (14%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M S   ++  I+DRE R+ QYQ++I+GLNAYDRHKKF+ DYV +YG  ++  + LP+KTD
Sbjct  1    MASLGRLKSAIFDREERRMQYQSHIRGLNAYDRHKKFMKDYVQFYGHGKNVDDSLPIKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            +DTLREGYRFI TEEDDM+ +WE+RL                        IGLRWRTEKE
Sbjct  61   KDTLREGYRFILTEEDDMDSTWEKRL------------------------IGLRWRTEKE  96

Query  394  VISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            VISGKGQFICGN+HC+EK GL SYEVNF YVEAGE KQALVKLV C+ CA
Sbjct  97   VISGKGQFICGNRHCDEKHGLGSYEVNFSYVEAGEQKQALVKLVACKGCA  146



>gb|ABA94971.2| expressed protein [Oryza sativa Japonica Group]
Length=232

 Score =   211 bits (536),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 123/254 (48%), Positives = 166/254 (65%), Gaps = 37/254 (15%)
 Frame = +1

Query  37   TSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTDQ  216
            +S   ++  I+D+E RK QYQ++I+GLNAYDRHKKF+ DYV +YG D++     P+KTD+
Sbjct  3    SSLGRLKSSIFDKEERKMQYQSHIRGLNAYDRHKKFMKDYVQFYGHDKNVDNRAPIKTDK  62

Query  217  DTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEV  396
            DTLREGYRFI +EEDD++ +WE+RL                        IGLRWRTEKEV
Sbjct  63   DTLREGYRFILSEEDDVDSTWEKRL------------------------IGLRWRTEKEV  98

Query  397  ISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAekll-------  555
            ISGKGQF+CGN+ C+EK+GL SYEVNF Y+EAGE KQALVKLV C+RCAEKL        
Sbjct  99   ISGKGQFLCGNRICDEKNGLGSYEVNFSYIEAGEQKQALVKLVACQRCAEKLAYKRQKEK  158

Query  556  --ykkrkeeqlkekerrkrerseSNdqeddehdrrrerKKGSKASASAEDRN----KTDE  717
               K+++  + KE E ++R++ +   +  +E +   E +   K S   +DR     K+  
Sbjct  159  EREKEKEISREKEMELKERDKRKREREGSEETEDTSEDESTEKYSRRKKDRKRSSRKSSN  218

Query  718  DDENFDEYLEGMFP  759
            +DE F+E+LEGMFP
Sbjct  219  NDEGFEEFLEGMFP  232



>emb|CBI24891.3| unnamed protein product [Vitis vinifera]
Length=168

 Score =   206 bits (525),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 141/170 (83%), Gaps = 7/170 (4%)
 Frame = +1

Query  265  MNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQFICGNKHCNE  444
            M+ SWEQRLVKRY+DKLFKEYCIADM+ YKSGKIGLRWRTEKEVISGKGQFICGNKHC++
Sbjct  1    MDQSWEQRLVKRYHDKLFKEYCIADMSQYKSGKIGLRWRTEKEVISGKGQFICGNKHCDK  60

Query  445  KDGLASYEVNFCYVEAGENKQALVKLVTCERCA-----ekllykkrkeeqlkekerrkre  609
            +DGL SYEVNF Y EAGENKQALVKLVTCERCA     +K   K++  ++ KE+ +RKRE
Sbjct  61   RDGLTSYEVNFSYFEAGENKQALVKLVTCERCAEKLNYKKRKEKEQSAKREKEEHKRKRE  120

Query  610  rseSNdqeddehdrrrerKKGSKASASAEDRNKTDEDDENFDEYLEGMFP  759
            R  S+D  ++EH + RER+KG KAS SA D +KT EDDE FDE+LEGMFP
Sbjct  121  RVSSDDDTENEHKQSRERRKGKKASTSARD-HKT-EDDETFDEFLEGMFP  168



>ref|XP_011093372.1| PREDICTED: protein FRA10AC1 isoform X4 [Sesamum indicum]
Length=220

 Score =   203 bits (517),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 114/144 (79%), Gaps = 6/144 (4%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++Q I+D+EARKQQYQ +I+GLNAYDRHKKFL+DYV YYGKD+S QE LPVKTD
Sbjct  2    MGSFGSLKQAIFDKEARKQQYQDHIRGLNAYDRHKKFLNDYVGYYGKDKSAQETLPVKTD  61

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLR-----W  378
            QDTLREGYRFIRT+EDDMNPSWEQRLVKRYYDKLFKEYCIADM+ YK+GK+  R     W
Sbjct  62   QDTLREGYRFIRTDEDDMNPSWEQRLVKRYYDKLFKEYCIADMSQYKTGKMEDRKRSDIW  121

Query  379  RTEKEVIS-GKGQFICGNKHCNEK  447
             +   VIS    + IC    C  K
Sbjct  122  ESLFAVISTATRKMICQAMRCAAK  145


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  664  KKGSKASASAEDRNKTDEDDENFDEYLEGMFP  759
            +KG KAS SA D NKTD++++NFDE+LEGMFP
Sbjct  189  RKGDKASTSATDHNKTDDNNDNFDEFLEGMFP  220



>ref|XP_001700097.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDO98391.1| predicted protein [Chlamydomonas reinhardtii]
Length=182

 Score =   199 bits (505),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 117/177 (66%), Gaps = 7/177 (4%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQ-------E  192
            M +F   R+  + R    Q Y   + GLNA DRH+K ++DY+ YY +    Q       E
Sbjct  1    MANFGETRRSAFGRAHAAQHYATTLLGLNAADRHRKLVNDYLTYYARGVPGQPGGPPAGE  60

Query  193  VLPVKTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGL  372
               V+TD D LRE +RFIRTEEDD +  WE RL KRYYD+LFKEY I D++ YK  ++G+
Sbjct  61   AKAVRTDADALREHHRFIRTEEDDGDHGWEARLAKRYYDRLFKEYAIVDLSFYKESRLGM  120

Query  373  RWRTEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            RWRT+KEV+SGKGQF+CG K C   DGL SYEVNF Y EAGE KQALVKL  C  CA
Sbjct  121  RWRTQKEVVSGKGQFVCGAKGCEASDGLCSYEVNFAYQEAGERKQALVKLRVCPACA  177



>ref|XP_008790732.1| PREDICTED: protein FRA10AC1 isoform X2 [Phoenix dactylifera]
Length=129

 Score =   191 bits (486),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M S  S++  ++ RE RK QYQ++I+GLNAYDRHKKF++DYV +YG  ++    +P+KTD
Sbjct  1    MASLGSLKSAVFHREERKMQYQSHIRGLNAYDRHKKFMNDYVQFYGNTKNVHNDMPIKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDT+REGYRFI +E+DDM+ +WE+RLVKRYYDKLFKEYCIADM+ YK GKIGLRWRTEKE
Sbjct  61   QDTIREGYRFIISEDDDMDSTWEKRLVKRYYDKLFKEYCIADMSQYKMGKIGLRWRTEKE  120

Query  394  VISGK  408
            VISGK
Sbjct  121  VISGK  125



>ref|XP_003922429.1| PREDICTED: protein FRA10AC1 [Saimiri boliviensis boliviensis]
 ref|XP_010331570.1| PREDICTED: protein FRA10AC1 [Saimiri boliviensis boliviensis]
 ref|XP_010331571.1| PREDICTED: protein FRA10AC1 [Saimiri boliviensis boliviensis]
Length=315

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 125/174 (72%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  R   + L   
Sbjct  44   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKREDFKRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDLDVIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLFKEYCIADLSKYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF+CGNKHC++K+GL S+EVNF Y E GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFVCGNKHCDKKEGLKSWEVNFGYTEHGEKRNALVKLRLCQECS  215



>ref|XP_005991631.1| PREDICTED: protein FRA10AC1 [Latimeria chalumnae]
Length=341

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 118/158 (75%), Gaps = 4/158 (3%)
 Frame = +1

Query  76   EARKQQYQANIQGLNAYDRHKKFLSDYVAYYG--KDRSTQEVLPVKTDQDTLREGYRFIR  249
            EAR ++Y  ++  ++AY RHKKF++DY+ YYG  K+   +     KTD D +RE +RF+ 
Sbjct  84   EARNRRY--HLIAMDAYARHKKFVNDYLLYYGGKKEDFKRSTTNDKTDLDVIRENHRFLW  141

Query  250  TEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQFICGN  429
            TEED+   +WE+RL ++YYDKLFKEYCIAD+T YK  K+G RWR EKEVISGKGQF CGN
Sbjct  142  TEEDEDEMTWEKRLARKYYDKLFKEYCIADLTRYKENKVGFRWRVEKEVISGKGQFFCGN  201

Query  430  KHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            KHC+EK+GL S+EVNF Y+E GE + ALVKL  C  C+
Sbjct  202  KHCDEKEGLKSWEVNFGYIEHGEKRNALVKLRLCPECS  239



>emb|CAD24474.1| FRA10AC1 protein [Homo sapiens]
Length=276

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 126/174 (72%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH+KF++DY+ YYG  +   + L   
Sbjct  44   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHRKFINDYILYYGGKKEDFKRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDLDVIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLFKEYCIADLSKYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK+C++K+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFFCGNKYCDKKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  215



>gb|EAW50059.1| chromosome 10 open reading frame 4, isoform CRA_d [Homo sapiens]
Length=276

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 126/174 (72%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH+KF++DY+ YYG  +   + L   
Sbjct  44   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHRKFVNDYILYYGGKKEDFKRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDLDVIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLFKEYCIADLSKYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK+C++K+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFFCGNKYCDKKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  215



>emb|CAD24472.1| FRA10AC1 protein [Homo sapiens]
Length=292

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 126/174 (72%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH+KF++DY+ YYG  +   + L   
Sbjct  44   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHRKFINDYILYYGGKKEDFKRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDLDVIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLFKEYCIADLSKYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK+C++K+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFFCGNKYCDKKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  215



>gb|EAW50060.1| chromosome 10 open reading frame 4, isoform CRA_e [Homo sapiens]
Length=292

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 126/174 (72%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH+KF++DY+ YYG  +   + L   
Sbjct  44   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHRKFVNDYILYYGGKKEDFKRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDLDVIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLFKEYCIADLSKYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK+C++K+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFFCGNKYCDKKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  215



>emb|CAD24473.1| FRA10AC1 protein [Homo sapiens]
Length=315

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 126/174 (72%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH+KF++DY+ YYG  +   + L   
Sbjct  44   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHRKFINDYILYYGGKKEDFKRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDLDVIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLFKEYCIADLSKYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK+C++K+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFFCGNKYCDKKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  215



>ref|XP_004337706.1| hypothetical protein ACA1_378110 [Acanthamoeba castellanii str. 
Neff]
 gb|ELR15693.1| hypothetical protein ACA1_378110 [Acanthamoeba castellanii str. 
Neff]
Length=254

 Score =   186 bits (473),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 110/148 (74%), Gaps = 5/148 (3%)
 Frame = +1

Query  115  LNAYDRHKKFLSDYVAYYGKDR-STQEVLPVKTDQDTLREGYRFIRTEEDDM----NPSW  279
            +NAY+RH++++ DYV YYG+ +       P K+D D L++ YRFIRTEEDD       +W
Sbjct  1    MNAYERHQRYIRDYVLYYGRGKLPAVPQKPTKSDDDILKQQYRFIRTEEDDRADDSREAW  60

Query  280  EQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQFICGNKHCNEKDGLA  459
            E+RL +RYY++L++EYCIAD+T Y+ G++G+RWR EKEVI GKGQFICGNKHC  K+ L 
Sbjct  61   EKRLARRYYERLYREYCIADLTRYREGQVGMRWRVEKEVIIGKGQFICGNKHCEAKEDLK  120

Query  460  SYEVNFCYVEAGENKQALVKLVTCERCA  543
            SYEVNF Y EAGE K ALVKL  C  CA
Sbjct  121  SYEVNFQYAEAGETKNALVKLRLCPPCA  148



>gb|EAW50055.1| chromosome 10 open reading frame 4, isoform CRA_a [Homo sapiens]
Length=315

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 126/174 (72%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH+KF++DY+ YYG  +   + L   
Sbjct  44   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHRKFVNDYILYYGGKKEDFKRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDLDVIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLFKEYCIADLSKYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK+C++K+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFFCGNKYCDKKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  215



>ref|XP_007053063.1| PREDICTED: protein FRA10AC1 [Chelonia mydas]
Length=329

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 123/169 (73%), Gaps = 5/169 (3%)
 Frame = +1

Query  46   RSIRQVIYDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYG--KDRSTQEVLPVKTDQ  216
            R I    +DRE AR +++  ++  ++AY RHKKF++DY+ YYG  K+   +     KTD 
Sbjct  60   RQIAAEEWDREEARNRRF--HLIAMDAYARHKKFVNDYILYYGGKKEDFQRSGASDKTDL  117

Query  217  DTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEV  396
            D +RE YRF+  EED ++ +WE+RL K+YYDKLFKEYCIAD+T YK  K G RWR EKEV
Sbjct  118  DVVRENYRFLWKEEDAVDMNWEKRLAKKYYDKLFKEYCIADLTRYKENKFGFRWRHEKEV  177

Query  397  ISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            +SGKGQF CGNKHC+EK+GL S+EVNF Y+E GE + ALVKL  C +C+
Sbjct  178  VSGKGQFSCGNKHCDEKEGLKSWEVNFGYIEYGEKRNALVKLRLCPQCS  226



>emb|CAD24471.1| FRA10AC1 protein [Homo sapiens]
Length=313

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 126/174 (72%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH+KF++DY+ YYG  +   + L   
Sbjct  44   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHRKFINDYILYYGGKKEDFKRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDLDVIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLFKEYCIADLSKYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK+C++K+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFFCGNKYCDKKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  215



>ref|XP_004580114.1| PREDICTED: protein FRA10AC1 [Ochotona princeps]
Length=315

 Score =   188 bits (477),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 120/168 (71%), Gaps = 3/168 (2%)
 Frame = +1

Query  46   RSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV--KTDQD  219
            + +   + DRE  K + + ++  ++AY RH KF++DY+ YYG  +     L    KTD D
Sbjct  49   KQVAAELLDREEAKNR-RFHLIAMDAYQRHTKFVNDYILYYGGKKEDFRRLGENDKTDLD  107

Query  220  TLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVI  399
             +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVI
Sbjct  108  VIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRVEKEVI  167

Query  400  SGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            SGKGQF CGNK+C+EK+GL S+EVNF YVE GE K ALVKL  C+ C+
Sbjct  168  SGKGQFFCGNKYCDEKEGLKSWEVNFGYVEHGEKKNALVKLRLCQECS  215



>emb|CAD24470.1| FRA10AC1 protein [Homo sapiens]
Length=315

 Score =   188 bits (477),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 126/174 (72%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH+KF++DY+ YYG  +   + L   
Sbjct  44   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHRKFINDYILYYGGKKEDFKRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDLDVIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLFKEYCIADLSKYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK+C++K+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFFCGNKYCDKKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  215



>gb|EAW50058.1| chromosome 10 open reading frame 4, isoform CRA_c [Homo sapiens]
Length=313

 Score =   187 bits (476),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 126/174 (72%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH+KF++DY+ YYG  +   + L   
Sbjct  44   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHRKFVNDYILYYGGKKEDFKRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDLDVIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLFKEYCIADLSKYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK+C++K+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFFCGNKYCDKKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  215



>ref|XP_009696348.1| PREDICTED: protein FRA10AC1, partial [Cariama cristata]
Length=318

 Score =   188 bits (477),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 121/162 (75%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY+RHKKF+SDY+ YYG   +   +     KTD D +RE +
Sbjct  55   WDREEARKRRF--HLIAMDAYERHKKFVSDYILYYGGKIEDFRRSGANDKTDLDVIRENH  112

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  E+D+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  113  RFLWNEDDETDMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQF  172

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC+EK+GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  173  SCGNKHCDEKEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  214



>gb|KFZ45985.1| Protein FRA10AC1, partial [Caprimulgus carolinensis]
Length=318

 Score =   187 bits (476),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 120/162 (74%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY+RHKKF+ DY+ YYG   +   +     KTD D +RE +
Sbjct  55   WDREEARKRRF--HLIAMDAYERHKKFVHDYILYYGGKLEDFRRSGANDKTDLDVIRENH  112

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  EED+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR+EKEVISGKGQF
Sbjct  113  RFLWNEEDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRSEKEVISGKGQF  172

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC EK+GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  173  SCGNKHCEEKEGLKSWEVNFGYVEHGERRNALVKLRVCPECS  214



>gb|KFP57668.1| Protein FRA10AC1, partial [Cariama cristata]
Length=323

 Score =   187 bits (476),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 121/162 (75%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY+RHKKF+SDY+ YYG   +   +     KTD D +RE +
Sbjct  60   WDREEARKRRF--HLIAMDAYERHKKFVSDYILYYGGKIEDFRRSGANDKTDLDVIRENH  117

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  E+D+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  118  RFLWNEDDETDMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQF  177

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC+EK+GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  178  SCGNKHCDEKEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  219



>gb|AAH18007.1| C10orf4 protein [Homo sapiens]
 gb|EAW50056.1| chromosome 10 open reading frame 4, isoform CRA_b [Homo sapiens]
 gb|EAW50057.1| chromosome 10 open reading frame 4, isoform CRA_b [Homo sapiens]
 gb|ADQ32087.1| chromosome 10 open reading frame 4 [synthetic construct]
 gb|AIC57603.1| FRA10AC1, partial [synthetic construct]
Length=315

 Score =   187 bits (476),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 126/174 (72%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH+KF++DY+ YYG  +   + L   
Sbjct  44   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHRKFVNDYILYYGGKKEDFKRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDLDVIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLFKEYCIADLSKYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK+C++K+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFFCGNKYCDKKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  215



>ref|XP_006926003.1| PREDICTED: protein FRA10AC1 [Pteropus alecto]
Length=315

 Score =   187 bits (475),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 124/174 (71%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  +     L   
Sbjct  44   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKEDFRRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDMDVIRENHRFLWNEEDEMDTNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK+C++K+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFFCGNKYCDKKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  215



>ref|XP_006630353.1| PREDICTED: protein FRA10AC1-like [Lepisosteus oculatus]
Length=328

 Score =   187 bits (476),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 121/171 (71%), Gaps = 5/171 (3%)
 Frame = +1

Query  40   SFRSIRQVIYDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYG--KDRSTQEVLPVKT  210
            + R++    +DRE AR +++  ++  +NAYDRHKKF+SDY+ YYG  K+   +     KT
Sbjct  56   AHRNVAAQEWDREEARNRRH--HLISMNAYDRHKKFVSDYILYYGGKKEDFKRSTANDKT  113

Query  211  DQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEK  390
            D D LRE +RF+  EED+ + +WE+ L K+YYDKLFKEYCIAD++ YK  K G RWR E 
Sbjct  114  DVDVLRENHRFLWREEDEEDMTWEKELAKKYYDKLFKEYCIADLSRYKENKFGFRWRVET  173

Query  391  EVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            EVISGKGQF CGNK C +K+GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  174  EVISGKGQFFCGNKRCEKKEGLKSWEVNFAYVEHGEKRNALVKLRLCPECS  224



>ref|XP_010160374.1| PREDICTED: protein FRA10AC1, partial [Caprimulgus carolinensis]
Length=329

 Score =   187 bits (476),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 120/162 (74%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY+RHKKF+ DY+ YYG   +   +     KTD D +RE +
Sbjct  66   WDREEARKRRF--HLIAMDAYERHKKFVHDYILYYGGKLEDFRRSGANDKTDLDVIRENH  123

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  EED+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR+EKEVISGKGQF
Sbjct  124  RFLWNEEDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRSEKEVISGKGQF  183

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC EK+GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  184  SCGNKHCEEKEGLKSWEVNFGYVEHGERRNALVKLRVCPECS  225



>ref|XP_010199882.1| PREDICTED: protein FRA10AC1, partial [Colius striatus]
 gb|KFP25675.1| Protein FRA10AC1, partial [Colius striatus]
Length=318

 Score =   187 bits (475),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 121/165 (73%), Gaps = 11/165 (7%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKD-----RSTQEVLPVKTDQDTLR  228
            +DRE ARK+++  ++  ++AY RHKKF+SDY+ YYG       RS +     KTD D +R
Sbjct  55   WDREEARKRRF--HLIAMDAYQRHKKFVSDYILYYGGKIEDFRRSGEND---KTDLDVIR  109

Query  229  EGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGK  408
            E +RF+  EED+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGK
Sbjct  110  ENHRFLWNEEDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGK  169

Query  409  GQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            GQF CGNKHC+EK+GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  170  GQFSCGNKHCDEKEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  214



>ref|XP_003255284.1| PREDICTED: protein FRA10AC1 isoform 2 [Nomascus leucogenys]
Length=315

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 125/174 (72%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  +   + L   
Sbjct  44   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKEDFKRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDLDVIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLFKEYCIADLSKYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK+C++K+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFFCGNKYCDKKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  215



>gb|KFO14954.1| Protein FRA10AC1, partial [Balearica regulorum gibbericeps]
Length=318

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 121/162 (75%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY+RHKKF+SDY+ YYG   +   +     KTD D +RE +
Sbjct  55   WDREEARKRRF--HLIAMDAYERHKKFVSDYILYYGGKIEDFRRSGANDKTDLDVIRENH  112

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  E+D+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  113  RFLWNEDDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQF  172

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC+EK+GL S+EVNF Y+E GE + ALVKL  C  C+
Sbjct  173  SCGNKHCDEKEGLKSWEVNFGYIEHGEKRNALVKLRLCPECS  214



>ref|XP_005566033.1| PREDICTED: protein FRA10AC1 isoform X1 [Macaca fascicularis]
 ref|XP_009213254.1| PREDICTED: protein FRA10AC1 isoform X1 [Papio anubis]
Length=327

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 125/174 (72%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  +   + L   
Sbjct  56   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKEDFKRLGEN  113

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  114  DKTDLDVIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLFKEYCIADLSKYKENKFGFRWR  173

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK+C++K+GL S+EVNF YVE GE + ALVKL  C+ C+
Sbjct  174  VEKEVISGKGQFFCGNKYCDKKEGLKSWEVNFGYVEHGEKRNALVKLRLCQECS  227



>ref|XP_008113535.1| PREDICTED: protein FRA10AC1 isoform X2 [Anolis carolinensis]
Length=324

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 119/169 (70%), Gaps = 8/169 (5%)
 Frame = +1

Query  55   RQVIYDR----EARKQQYQANIQGLNAYDRHKKFLSDYVAYYG--KDRSTQEVLPVKTDQ  216
            RQV  D     EAR Q++  +   ++AY RHKK ++DY+ YYG  K+   +     KTD 
Sbjct  53   RQVATDEWDREEARNQRF--HFIAMDAYARHKKLVNDYILYYGGKKEDFKRSGKDDKTDL  110

Query  217  DTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEV  396
            D +RE +RF+  EED+ + SWE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEV
Sbjct  111  DIIRENHRFLWKEEDEADMSWEKRLSKKYYDKLFKEYCIADLSKYKENKFGFRWRHEKEV  170

Query  397  ISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            +SGKGQF CGNKHC+EK+GL S+EVNF YVE GE K ALVKL  C  C+
Sbjct  171  VSGKGQFSCGNKHCDEKEGLKSWEVNFGYVEHGEKKNALVKLRLCPECS  219



>ref|XP_002821041.1| PREDICTED: protein FRA10AC1 [Pongo abelii]
 ref|XP_009243908.1| PREDICTED: protein FRA10AC1 [Pongo abelii]
 ref|XP_009243909.1| PREDICTED: protein FRA10AC1 [Pongo abelii]
Length=314

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 125/174 (72%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  +   + L   
Sbjct  43   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKEDFKRLGEN  100

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  101  DKTDLDVIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLFKEYCIADLSKYKENKFGFRWR  160

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK+C++K+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  161  VEKEVISGKGQFFCGNKYCDKKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  214



>gb|KFP95568.1| Protein FRA10AC1, partial [Haliaeetus albicilla]
Length=317

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 121/162 (75%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY+RHKKF++DY+ YYG   +   +     KTD D +RE +
Sbjct  55   WDREEARKRRF--HLIAMDAYERHKKFVNDYILYYGGKIEDFQRSGANDKTDLDVIRENH  112

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  E+D+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  113  RFLWNEDDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQF  172

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC+EK+GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  173  SCGNKHCDEKEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  214



>ref|XP_007961785.1| PREDICTED: protein FRA10AC1 isoform X2 [Chlorocebus sabaeus]
 ref|XP_007961786.1| PREDICTED: protein FRA10AC1 isoform X2 [Chlorocebus sabaeus]
 ref|XP_007961787.1| PREDICTED: protein FRA10AC1 isoform X2 [Chlorocebus sabaeus]
 ref|XP_007961788.1| PREDICTED: protein FRA10AC1 isoform X2 [Chlorocebus sabaeus]
Length=315

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 125/174 (72%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  +   + L   
Sbjct  44   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKEDFKRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDLDVIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLFKEYCIADLSKYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK+C++K+GL S+EVNF YVE GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFFCGNKYCDKKEGLKSWEVNFGYVEHGEKRNALVKLRLCQECS  215



>ref|XP_002957696.1| alpha-1,2-mannosidase [Volvox carteri f. nagariensis]
 gb|EFJ41245.1| alpha-1,2-mannosidase [Volvox carteri f. nagariensis]
Length=852

 Score =   195 bits (495),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 128/189 (68%), Gaps = 17/189 (9%)
 Frame = +1

Query  25   WGKMTSFRSIRQVIYDREAR------------KQQYQANIQGLNAYDRHKKFLSDYVAYY  168
            WG  T   ++R+V+ +   R             Q YQ+N+ G+ A +RHKKF++DY+ YY
Sbjct  518  WGTETDL-TLREVLANAHGRLEASGVNALGKSAQYYQSNLMGMTAAERHKKFVNDYLTYY  576

Query  169  --GKDRST--QEVLPVKTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIA  336
              G+D  +   +   ++TD D LRE +RFIR++ D+ + SWE RL KRYYD+LFKEY I 
Sbjct  577  ACGRDEPSTKNDAARIRTDADALREHHRFIRSDADNESSSWEARLAKRYYDRLFKEYAIV  636

Query  337  DMTHYKSGKIGLRWRTEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALV  516
            D+T+YK  K+G+RWRT+KEV+SGKGQF+CG K C+  +GL SYEVNF Y EAGE KQALV
Sbjct  637  DLTYYKQSKLGMRWRTQKEVVSGKGQFVCGAKGCDAGEGLCSYEVNFAYQEAGERKQALV  696

Query  517  KLVTCERCA  543
            KL  C  CA
Sbjct  697  KLRLCPACA  705



>ref|XP_002756492.1| PREDICTED: protein FRA10AC1 [Callithrix jacchus]
Length=315

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 124/174 (71%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  +     L   
Sbjct  44   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKEDFRRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDLDVIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLFKEYCIADLSKYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF+CGNK+C++K+GL S+EVNF Y E GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFVCGNKYCDKKEGLKSWEVNFGYTEHGEKRNALVKLRLCQECS  215



>ref|XP_004680672.1| PREDICTED: protein FRA10AC1 isoform X2 [Condylura cristata]
Length=276

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 120/171 (70%), Gaps = 3/171 (2%)
 Frame = +1

Query  37   TSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV--KT  210
             + + +   + DRE  K + + ++  ++AY RH KF++DY+ YYG  +     L    KT
Sbjct  46   VAHKQVAAELLDREEAKNR-RFHLIAMDAYQRHTKFVNDYILYYGGKKEDFRRLGENDKT  104

Query  211  DQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEK  390
            D D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EK
Sbjct  105  DMDVIRENHRFLWNEEDEMDMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRIEK  164

Query  391  EVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            EVISGKGQF CGNK C++KDGL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  165  EVISGKGQFFCGNKCCDKKDGLKSWEVNFGYIEHGEKRNALVKLRLCQDCS  215



>ref|XP_507931.2| PREDICTED: protein FRA10AC1 [Pan troglodytes]
 ref|XP_003825421.1| PREDICTED: protein FRA10AC1 [Pan paniscus]
 ref|XP_009457231.1| PREDICTED: protein FRA10AC1 [Pan troglodytes]
Length=315

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 125/174 (72%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  +   + L   
Sbjct  44   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKEDFKRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDLDVIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLFKEYCIADLSKYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK+C++K+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFFCGNKYCDKKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  215



>ref|NP_660289.2| protein FRA10AC1 [Homo sapiens]
 ref|XP_005269572.1| PREDICTED: protein FRA10AC1 isoform X1 [Homo sapiens]
 ref|XP_005269573.1| PREDICTED: protein FRA10AC1 isoform X2 [Homo sapiens]
 sp|Q70Z53.3|F10C1_HUMAN RecName: Full=Protein FRA10AC1 [Homo sapiens]
 dbj|BAC03556.1| unnamed protein product [Homo sapiens]
Length=315

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 125/174 (72%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  +   + L   
Sbjct  44   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKEDFKRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDLDVIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLFKEYCIADLSKYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK+C++K+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFFCGNKYCDKKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  215



>gb|KFV40069.1| Protein FRA10AC1, partial [Gavia stellata]
Length=262

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 120/162 (74%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY+RHKKF+ DY+ YYG   +   +     KTD D +RE +
Sbjct  55   WDREEARKRRF--HLIAMDAYERHKKFVHDYILYYGGKIEDFRRSGANDKTDLDVIRENH  112

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  E+D+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  113  RFLWNEDDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQF  172

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC+EK+GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  173  SCGNKHCDEKEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  214



>ref|NP_001253649.1| fragile site, folic acid type, rare, fra(10)(q23.3) or fra(10)(q24.2) 
candidate 1 [Macaca mulatta]
 ref|XP_003904064.1| PREDICTED: protein FRA10AC1 isoform X2 [Papio anubis]
 ref|XP_005566034.1| PREDICTED: protein FRA10AC1 isoform X2 [Macaca fascicularis]
 ref|XP_005566035.1| PREDICTED: protein FRA10AC1 isoform X3 [Macaca fascicularis]
 ref|XP_005566036.1| PREDICTED: protein FRA10AC1 isoform X4 [Macaca fascicularis]
 ref|XP_009213255.1| PREDICTED: protein FRA10AC1 isoform X2 [Papio anubis]
 ref|XP_009213256.1| PREDICTED: protein FRA10AC1 isoform X2 [Papio anubis]
 gb|EHH64892.1| hypothetical protein EGM_18222 [Macaca fascicularis]
Length=315

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 125/174 (72%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  +   + L   
Sbjct  44   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKEDFKRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDLDVIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLFKEYCIADLSKYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK+C++K+GL S+EVNF YVE GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFFCGNKYCDKKEGLKSWEVNFGYVEHGEKRNALVKLRLCQECS  215



>ref|XP_009818244.1| PREDICTED: protein FRA10AC1, partial [Gavia stellata]
Length=268

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 120/162 (74%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY+RHKKF+ DY+ YYG   +   +     KTD D +RE +
Sbjct  55   WDREEARKRRF--HLIAMDAYERHKKFVHDYILYYGGKIEDFRRSGANDKTDLDVIRENH  112

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  E+D+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  113  RFLWNEDDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQF  172

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC+EK+GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  173  SCGNKHCDEKEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  214



>ref|XP_004653276.1| PREDICTED: protein FRA10AC1 [Jaculus jaculus]
Length=315

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 124/174 (71%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  R   + L   
Sbjct  44   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKREDFKRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  +ED+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDLDVIRENHRFLWNDEDETDMTWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK+C+EK+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  IEKEVISGKGQFFCGNKYCDEKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  215



>gb|KFW62865.1| Protein FRA10AC1, partial [Pygoscelis adeliae]
Length=318

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 121/162 (75%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY+RHKKF++DY+ YYG   +   +     KTD D +RE +
Sbjct  58   WDREEARKRRF--HLIAMDAYERHKKFVNDYILYYGGKIEDFRRSGANDKTDLDVIRENH  115

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  E+D+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  116  RFLWNEDDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQF  175

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC+EK+GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  176  SCGNKHCDEKEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  217



>ref|XP_003783761.1| PREDICTED: protein FRA10AC1 [Otolemur garnettii]
Length=315

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 123/174 (71%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  +     L   
Sbjct  44   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFINDYILYYGGKKEDFRRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDLDVIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK C+EK+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  IEKEVISGKGQFFCGNKCCDEKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  215



>ref|XP_005333779.1| PREDICTED: protein FRA10AC1 [Ictidomys tridecemlineatus]
Length=315

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 121/174 (70%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  R     L   
Sbjct  44   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKREDFRRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M  +WE+RL K+YYDKLFKEYCI D++ YK  K G RWR
Sbjct  102  DKTDLDVIRENHRFLWNEEDEMEMTWEKRLAKKYYDKLFKEYCIGDLSRYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK C+EK+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFFCGNKRCDEKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  215



>gb|EHH19239.1| hypothetical protein EGK_19913 [Macaca mulatta]
Length=315

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 125/174 (72%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  +   + L   
Sbjct  44   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKEDFKRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDLDVIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLFKEYCIADLSKYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK+C++K+GL S+EVNF YVE GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFFCGNKYCDKKEGLKSWEVNFGYVEHGEKRNALVKLRLCQECS  215



>gb|KFV82804.1| Protein FRA10AC1, partial [Struthio camelus australis]
Length=317

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 124/172 (72%), Gaps = 5/172 (3%)
 Frame = +1

Query  37   TSFRSIRQVIYDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRST--QEVLPVK  207
             + R +    +DRE ARK+++  ++  ++AY+RHKKF++DY+ YYG  R    +     K
Sbjct  44   VAHRQVAAEEWDREEARKRRF--HLIAMDAYERHKKFVNDYILYYGGKREDFRRSRANDK  101

Query  208  TDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTE  387
            TD D +RE +RF+  E+D+++ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR E
Sbjct  102  TDLDVIRENHRFLWKEDDEVDMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHE  161

Query  388  KEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            KEV+SGKGQF CGNKHC+EK+GL S+EVNF YVE  E + ALVKL  C  C+
Sbjct  162  KEVVSGKGQFSCGNKHCDEKEGLKSWEVNFGYVEHDEKRNALVKLRLCPECS  213



>gb|KFQ91241.1| Protein FRA10AC1, partial [Nipponia nippon]
Length=318

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 122/169 (72%), Gaps = 5/169 (3%)
 Frame = +1

Query  46   RSIRQVIYDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQ  216
            R      +DRE ARK+++  ++  ++AY+RHKKF++DY+ YYG   +   +     KTD 
Sbjct  48   RQFAAEAWDREEARKRRF--HLIAMDAYERHKKFVNDYILYYGGKIEDFRRSGANDKTDL  105

Query  217  DTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEV  396
            D +RE +RF+  E+D+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEV
Sbjct  106  DVIRENHRFLWNEDDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEV  165

Query  397  ISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            ISGKGQF CGNKHC+EK+GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  166  ISGKGQFSCGNKHCDEKEGLRSWEVNFGYVEHGEKRNALVKLRLCPECS  214



>gb|KFP07161.1| Protein FRA10AC1, partial [Calypte anna]
Length=318

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 121/162 (75%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY+RHKKF+SDY+ YYG   +   +     KTD D +RE +
Sbjct  55   WDREEARKRRF--HLISMDAYERHKKFVSDYILYYGGKIEDFQRSGANDKTDLDVIRENH  112

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  EED+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  113  RFLWNEEDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQF  172

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC+E++GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  173  SCGNKHCDEEEGLKSWEVNFGYVEHGEKRNALVKLRLCPGCS  214



>gb|KFZ61629.1| Protein FRA10AC1, partial [Podiceps cristatus]
Length=318

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 121/162 (75%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY+RHKKF++DY+ YYG   +   +     KTD D +RE +
Sbjct  55   WDREEARKRRF--HLIAMDAYERHKKFVNDYILYYGGKIEDFRRSGANDKTDLDVIRENH  112

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  E+D+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  113  RFLWNEDDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQF  172

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC+EK+GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  173  SCGNKHCDEKEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  214



>gb|EOB05670.1| Protein FRA10AC1-like protein, partial [Anas platyrhynchos]
Length=182

 Score =   181 bits (460),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 118/155 (76%), Gaps = 5/155 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRST--QEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY+RHKKF+SDY+ YYG  R    +     KTD D +RE +
Sbjct  30   WDREEARKRRF--HLISMDAYERHKKFVSDYILYYGGKREDFRRSGENDKTDLDIIRENH  87

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  E+D+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  88   RFLWNEDDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQF  147

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKL  522
             CGNKHC+E++GL S+EVNF YVE GE + ALVKL
Sbjct  148  SCGNKHCDEEEGLKSWEVNFGYVEHGEKRNALVKL  182



>ref|XP_008790741.1| PREDICTED: protein FRA10AC1 homolog isoform X3 [Phoenix dactylifera]
Length=129

 Score =   179 bits (455),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 106/146 (73%), Gaps = 17/146 (12%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M S  S++  ++ RE RK QYQ++I+GLNAYDRHKKF++DYV +YG  ++    +P+KTD
Sbjct  1    MASLGSLKSAVFHREERKMQYQSHIRGLNAYDRHKKFMNDYVQFYGNTKNVHNDMPIKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
            QDT+REGYRFI +E+DDM+ +WE+RLVKRYYDKLFKEYCIADM+ YK GK          
Sbjct  61   QDTIREGYRFIISEDDDMDSTWEKRLVKRYYDKLFKEYCIADMSQYKMGK----------  110

Query  394  VISGKGQFICGNKHCNEKDGLASYEV  471
                   FICGN+ CNEK+ L SYE 
Sbjct  111  -------FICGNRACNEKESLGSYEA  129



>gb|KFP58404.1| Protein FRA10AC1, partial [Cathartes aura]
Length=305

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 121/162 (75%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY+RHKKF++DY+ YYG   +   +     KTD D +RE +
Sbjct  55   WDREEARKRRF--HLIAMDAYERHKKFVNDYILYYGGKIEDFRRSGANDKTDLDVIRENH  112

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  E+D+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  113  RFLWNEDDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQF  172

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC+EK+GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  173  SCGNKHCDEKEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  214



>ref|XP_004607413.1| PREDICTED: protein FRA10AC1 [Sorex araneus]
Length=315

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 124/174 (71%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYG--KDRSTQEVLP  201
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  KD   +    
Sbjct  44   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKDDFRRLGEN  101

Query  202  VKTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDMDVIRENHRFLWNEEDEMDMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK C++K+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  IEKEVISGKGQFFCGNKSCDKKEGLKSWEVNFGYIEQGEKRNALVKLRLCQECS  215



>ref|XP_010308972.1| PREDICTED: protein FRA10AC1 [Balearica regulorum gibbericeps]
Length=359

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 121/162 (75%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY+RHKKF+SDY+ YYG   +   +     KTD D +RE +
Sbjct  96   WDREEARKRRF--HLIAMDAYERHKKFVSDYILYYGGKIEDFRRSGANDKTDLDVIRENH  153

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  E+D+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  154  RFLWNEDDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQF  213

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC+EK+GL S+EVNF Y+E GE + ALVKL  C  C+
Sbjct  214  SCGNKHCDEKEGLKSWEVNFGYIEHGEKRNALVKLRLCPECS  255



>ref|XP_008050367.1| PREDICTED: protein FRA10AC1 isoform X1 [Tarsius syrichta]
Length=315

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 123/174 (71%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  +     L   
Sbjct  44   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKEDFRRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDLDVIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK+C+ K+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFFCGNKYCDNKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  215



>ref|XP_008050368.1| PREDICTED: protein FRA10AC1 isoform X2 [Tarsius syrichta]
Length=302

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 123/174 (71%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  +     L   
Sbjct  44   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKEDFRRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDLDVIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK+C+ K+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFFCGNKYCDNKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  215



>ref|XP_008587054.1| PREDICTED: protein FRA10AC1 [Galeopterus variegatus]
Length=318

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 123/174 (71%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  +     L   
Sbjct  48   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKEDFRRLGEN  105

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  106  DKTDFDVIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWR  165

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK C+EK+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  166  VEKEVISGKGQFFCGNKCCDEKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  219



>ref|XP_005013693.1| PREDICTED: protein FRA10AC1 homolog [Anas platyrhynchos]
Length=385

 Score =   187 bits (475),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 121/162 (75%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRST--QEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY+RHKKF+SDY+ YYG  R    +     KTD D +RE +
Sbjct  125  WDREEARKRRF--HLISMDAYERHKKFVSDYILYYGGKREDFRRSGENDKTDLDIIRENH  182

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  E+D+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  183  RFLWNEDDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQF  242

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC+E++GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  243  SCGNKHCDEEEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  284



>gb|KGL96254.1| Protein FRA10AC1, partial [Charadrius vociferus]
Length=318

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 120/162 (74%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY+RHKKF+ DY+ YYG   +   +     KTD D +RE +
Sbjct  55   WDREEARKRRF--HLIAMDAYERHKKFVKDYILYYGGKIEDFRRSGANDKTDLDVIRENH  112

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  E+D+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  113  RFLWNEDDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQF  172

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC+EK+GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  173  SCGNKHCDEKEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  214



>gb|KFP18682.1| Protein FRA10AC1, partial [Egretta garzetta]
Length=318

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 121/162 (75%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY+RHKK ++DY+ YYG   +   +     KTD D +RE +
Sbjct  55   WDREEARKRRF--HLIAMDAYERHKKLVNDYILYYGGKIEDFRRSGANDKTDLDVIRENH  112

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  E+D+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  113  RFLWNEDDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQF  172

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC+EK+GL S+EVNF YVE GE + ALVKL TC  C+
Sbjct  173  SCGNKHCDEKEGLKSWEVNFGYVEHGEKRNALVKLRTCPECS  214



>ref|XP_004370004.1| PREDICTED: protein FRA10AC1 [Trichechus manatus latirostris]
Length=315

 Score =   185 bits (470),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 123/174 (71%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RHKKF++DY+ YYG  +     L   
Sbjct  44   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHKKFVNDYILYYGGKKEDFRRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDLDVIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLFKEYCIADLSKYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK C+ K+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFFCGNKCCDVKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  215



>gb|ELR60081.1| Protein FRA10AC1, partial [Bos mutus]
Length=275

 Score =   184 bits (466),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 116/162 (72%), Gaps = 3/162 (2%)
 Frame = +1

Query  64   IYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV--KTDQDTLREGY  237
            + DRE  K + + ++  ++AY RH KF++DY+ YYG  +     L    KTD D +RE +
Sbjct  55   LLDREEAKNR-RFHLIAMDAYQRHTKFVNDYILYYGGKKEDFRRLGENDKTDMDVIRENH  113

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  114  RFLWNEEDEMDMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRVEKEVISGKGQF  173

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNK C++K+GL S+EVNF Y E GE + ALVKL  C+ C+
Sbjct  174  CCGNKSCDKKEGLKSWEVNFGYTEHGEKRNALVKLRLCQECS  215



>ref|XP_001502472.1| PREDICTED: protein FRA10AC1 [Equus caballus]
 ref|XP_008518900.1| PREDICTED: protein FRA10AC1 isoform X2 [Equus przewalskii]
Length=315

 Score =   185 bits (469),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 123/174 (71%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRST--QEVLP  201
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  R    +    
Sbjct  44   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKREDFRRSGEN  101

Query  202  VKTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDMDVIRENHRFLWNEEDEMDMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK C++K+GL S+EVNF YVE GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFFCGNKCCDKKEGLKSWEVNFGYVEHGEKRNALVKLRLCQECS  215



>ref|XP_008935605.1| PREDICTED: protein FRA10AC1, partial [Merops nubicus]
 gb|KFQ26924.1| Protein FRA10AC1, partial [Merops nubicus]
Length=318

 Score =   185 bits (470),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 121/162 (75%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY+RHKKF+ DY+ YYG   +   +  +  KTD D +RE +
Sbjct  55   WDREEARKRRF--HLIAMDAYERHKKFVHDYILYYGGKIEDFRRSGVNDKTDLDVIRENH  112

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            +F+  EED+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  113  KFLWHEEDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQF  172

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC+EK+GL S+EVNF Y+E GE + ALVKL  C  C+
Sbjct  173  SCGNKHCDEKEGLKSWEVNFGYIEHGEKRNALVKLRLCPECS  214



>gb|KFO91434.1| Protein FRA10AC1, partial [Buceros rhinoceros silvestris]
Length=308

 Score =   185 bits (469),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 120/162 (74%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY+RHKK ++DY+ YYG   +   +     KTD D +RE +
Sbjct  58   WDREEARKRRF--HLIAMDAYERHKKLVNDYILYYGGKIEDFQRSGANDKTDLDVIRENH  115

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  EED+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  116  RFLWNEEDETDMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQF  175

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC+EK+GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  176  SCGNKHCDEKEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  217



>ref|XP_004680671.1| PREDICTED: protein FRA10AC1 isoform X1 [Condylura cristata]
Length=315

 Score =   185 bits (469),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 120/171 (70%), Gaps = 3/171 (2%)
 Frame = +1

Query  37   TSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV--KT  210
             + + +   + DRE  K + + ++  ++AY RH KF++DY+ YYG  +     L    KT
Sbjct  46   VAHKQVAAELLDREEAKNR-RFHLIAMDAYQRHTKFVNDYILYYGGKKEDFRRLGENDKT  104

Query  211  DQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEK  390
            D D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EK
Sbjct  105  DMDVIRENHRFLWNEEDEMDMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRIEK  164

Query  391  EVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            EVISGKGQF CGNK C++KDGL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  165  EVISGKGQFFCGNKCCDKKDGLKSWEVNFGYIEHGEKRNALVKLRLCQDCS  215



>ref|XP_005958927.1| PREDICTED: protein FRA10AC1 [Pantholops hodgsonii]
Length=315

 Score =   185 bits (469),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 116/162 (72%), Gaps = 3/162 (2%)
 Frame = +1

Query  64   IYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV--KTDQDTLREGY  237
            + DRE  K + + ++  ++AY RH KF++DY+ YYG  +     L    KTD D +RE +
Sbjct  55   LLDREEAKNR-RFHLIAMDAYQRHTKFVNDYILYYGGKKEDFRRLGENDKTDMDVIRENH  113

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  114  RFLWNEEDEMDMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRVEKEVISGKGQF  173

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNK CNEK+GL S+EVNF Y E GE + ALVKL  C+ C+
Sbjct  174  CCGNKCCNEKEGLKSWEVNFGYTEHGEKRNALVKLRLCQECS  215



>ref|XP_010356220.1| PREDICTED: protein FRA10AC1 [Rhinopithecus roxellana]
 ref|XP_010356221.1| PREDICTED: protein FRA10AC1 [Rhinopithecus roxellana]
Length=315

 Score =   185 bits (469),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 125/174 (72%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  +   + L   
Sbjct  44   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKEDFKRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  E+D+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDLDVIRENHRFLWNEDDEMDMTWEKRLAKKYYDKLFKEYCIADLSKYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK+C++K+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFFCGNKYCDKKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  215



>ref|XP_009867160.1| PREDICTED: protein FRA10AC1, partial [Apaloderma vittatum]
 gb|KFP88188.1| Protein FRA10AC1, partial [Apaloderma vittatum]
Length=317

 Score =   185 bits (469),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 119/162 (73%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY+RHKKF+ DY+ YYG   +   +     KTD D +RE +
Sbjct  55   WDREEARKRRF--HLIAMDAYERHKKFVKDYILYYGGKIEDFRRSGANDKTDLDVIRENH  112

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  E+D+   +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  113  RFLWNEDDEAEMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQF  172

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC+EK+GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  173  SCGNKHCDEKEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  214



>ref|XP_007516845.1| PREDICTED: protein FRA10AC1 [Erinaceus europaeus]
Length=315

 Score =   185 bits (469),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 123/174 (71%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  +     +   
Sbjct  44   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKEDFRRVGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDMDVIRENHRFLWNEEDEMDMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK C+EK+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  IEKEVISGKGQFFCGNKCCDEKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  215



>ref|XP_009927321.1| PREDICTED: protein FRA10AC1 [Haliaeetus albicilla]
 ref|XP_010563330.1| PREDICTED: protein FRA10AC1 [Haliaeetus leucocephalus]
Length=336

 Score =   185 bits (470),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 121/162 (75%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY+RHKKF++DY+ YYG   +   +     KTD D +RE +
Sbjct  74   WDREEARKRRF--HLIAMDAYERHKKFVNDYILYYGGKIEDFQRSGANDKTDLDVIRENH  131

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  E+D+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  132  RFLWNEDDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQF  191

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC+EK+GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  192  SCGNKHCDEKEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  233



>ref|XP_008268442.1| PREDICTED: protein FRA10AC1 [Oryctolagus cuniculus]
Length=316

 Score =   185 bits (469),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 124/174 (71%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  +     L   
Sbjct  46   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKEDFRRLGEN  103

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE ++F+  EED+++ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  104  DKTDLDVIRENHKFLWNEEDEVDMTWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWR  163

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK+C+EK+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  164  VEKEVISGKGQFFCGNKYCDEKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  217



>ref|XP_005292601.1| PREDICTED: protein FRA10AC1 [Chrysemys picta bellii]
Length=330

 Score =   185 bits (470),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 126/181 (70%), Gaps = 11/181 (6%)
 Frame = +1

Query  34   MTSFRSIRQV-IYDREARKQQY--------QANIQGLNAYDRHKKFLSDYVAYYG--KDR  180
            +  F+ ++QV + DR+   +Q+        + ++  ++AY RHKKF++DY+ YYG  K+ 
Sbjct  46   IKPFQKVKQVKVADRQIAAEQWDREEARNRRFHLIAMDAYARHKKFVNDYILYYGGKKED  105

Query  181  STQEVLPVKTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSG  360
              +     KTD D +RE YRF+  EED ++ +WE+RL K+YYDKLFKEYCIAD++ YK  
Sbjct  106  FQRSGASDKTDLDVVRENYRFLWKEEDAVDMNWEKRLAKKYYDKLFKEYCIADLSRYKEN  165

Query  361  KIGLRWRTEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERC  540
            K G RWR EKEV+SGKGQF CGNKHC+EK+ L S+EVNF Y+E GE + ALVKL  C +C
Sbjct  166  KFGFRWRHEKEVVSGKGQFSCGNKHCDEKEALKSWEVNFGYMEYGEKRNALVKLRLCPQC  225

Query  541  A  543
            +
Sbjct  226  S  226



>ref|XP_007639649.1| PREDICTED: protein FRA10AC1 isoform X2 [Cricetulus griseus]
 gb|EGV98680.1| Protein FRA10AC1-like [Cricetulus griseus]
 gb|ERE77490.1| putative protein FRA10AC1 like protein [Cricetulus griseus]
Length=314

 Score =   184 bits (468),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 121/174 (70%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +    ++   EAR +++  ++  ++AY RH KF++DY+ YYG  R     L   
Sbjct  45   GKVVHKQVAADLLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKREDFRRLGEN  102

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  103  DKTDLDVIRENHRFLWNEEDEADMTWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWR  162

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK C+EK+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  163  IEKEVISGKGQFFCGNKRCDEKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  216



>ref|XP_005352262.1| PREDICTED: protein FRA10AC1 homolog [Microtus ochrogaster]
Length=312

 Score =   184 bits (468),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 126/179 (70%), Gaps = 7/179 (4%)
 Frame = +1

Query  16   RSNWGKMTSFRSIRQVIYDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQE  192
            + N GK+   + +   + DRE AR +++  ++  ++AY RH KF++DY+ YYG  R   +
Sbjct  39   KENHGKVH--KQVAADLLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKREDFK  94

Query  193  VLPV--KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKI  366
             L    KTD D +RE +RF+  EED+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K 
Sbjct  95   RLGENDKTDLDVIRENHRFLWNEEDETDMTWEKRLAKKYYDKLFKEYCIADLSRYKENKF  154

Query  367  GLRWRTEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            G RWR EKEVISGKGQF CGNK C+EK+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  155  GFRWRIEKEVISGKGQFFCGNKRCDEKEGLRSWEVNFGYIEHGEKRNALVKLRLCQECS  213



>ref|XP_003500758.1| PREDICTED: protein FRA10AC1 isoform X1 [Cricetulus griseus]
Length=315

 Score =   184 bits (468),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 121/174 (70%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +    ++   EAR +++  ++  ++AY RH KF++DY+ YYG  R     L   
Sbjct  45   GKVVHKQVAADLLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKREDFRRLGEN  102

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  103  DKTDLDVIRENHRFLWNEEDEADMTWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWR  162

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK C+EK+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  163  IEKEVISGKGQFFCGNKRCDEKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  216



>ref|XP_008518899.1| PREDICTED: protein FRA10AC1 isoform X1 [Equus przewalskii]
Length=331

 Score =   185 bits (469),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 123/174 (71%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRST--QEVLP  201
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  R    +    
Sbjct  60   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKREDFRRSGEN  117

Query  202  VKTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  118  DKTDMDVIRENHRFLWNEEDEMDMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWR  177

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK C++K+GL S+EVNF YVE GE + ALVKL  C+ C+
Sbjct  178  VEKEVISGKGQFFCGNKCCDKKEGLKSWEVNFGYVEHGEKRNALVKLRLCQECS  231



>gb|EMP42131.1| Protein FRA10AC1 [Chelonia mydas]
Length=236

 Score =   182 bits (462),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 119/162 (73%), Gaps = 5/162 (3%)
 Frame = +1

Query  46   RSIRQVIYDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYG--KDRSTQEVLPVKTDQ  216
            R I    +DRE AR +++  ++  ++AY RHKKF++DY+ YYG  K+   +     KTD 
Sbjct  60   RQIAAEEWDREEARNRRF--HLIAMDAYARHKKFVNDYILYYGGKKEDFQRSGASDKTDL  117

Query  217  DTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEV  396
            D +RE YRF+  EED ++ +WE+RL K+YYDKLFKEYCIAD+T YK  K G RWR EKEV
Sbjct  118  DVVRENYRFLWKEEDAVDMNWEKRLAKKYYDKLFKEYCIADLTRYKENKFGFRWRHEKEV  177

Query  397  ISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKL  522
            +SGKGQF CGNKHC+EK+GL S+EVNF Y+E GE + ALVKL
Sbjct  178  VSGKGQFSCGNKHCDEKEGLKSWEVNFGYIEYGEKRNALVKL  219



>ref|XP_005804442.1| PREDICTED: protein FRA10AC1-like [Xiphophorus maculatus]
Length=332

 Score =   185 bits (469),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 120/171 (70%), Gaps = 3/171 (2%)
 Frame = +1

Query  37   TSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRST--QEVLPVKT  210
             + RS+     DRE  + + +A++  +NA++RHKKF+ DY+ YYG   +   + V   KT
Sbjct  52   VAHRSLHSCEVDREEARNR-RAHLISMNAFERHKKFVGDYILYYGGQMADFRRSVAKDKT  110

Query  211  DQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEK  390
            D D LRE +RF+  +ED+ + +WE+ + K+YYDKLFKEYCIAD++ YK  K G RWRTE 
Sbjct  111  DLDVLRENHRFLWRDEDEDDMTWEKEIAKKYYDKLFKEYCIADLSRYKENKFGFRWRTEN  170

Query  391  EVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            EV+SGKGQF CGNKHC +++GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  171  EVVSGKGQFQCGNKHCGKEEGLKSWEVNFAYVEHGEKRNALVKLRLCPECS  221



>ref|XP_009483548.1| PREDICTED: protein FRA10AC1, partial [Pelecanus crispus]
 gb|KFQ52734.1| Protein FRA10AC1, partial [Pelecanus crispus]
Length=318

 Score =   184 bits (468),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 120/162 (74%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY+RHKKF+ DY+ YYG   +   +     KTD D +RE +
Sbjct  55   WDREEARKRRF--HLIAMDAYERHKKFVKDYILYYGGKIEDFRRSGANDKTDLDVIRENH  112

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  E+D+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  113  RFLWNEDDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQF  172

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC+E++GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  173  SCGNKHCDEREGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  214



>ref|XP_006755147.1| PREDICTED: protein FRA10AC1 isoform X1 [Myotis davidii]
 ref|XP_006755148.1| PREDICTED: protein FRA10AC1 isoform X2 [Myotis davidii]
 ref|XP_006755149.1| PREDICTED: protein FRA10AC1 isoform X3 [Myotis davidii]
Length=315

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 123/174 (71%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  +     L   
Sbjct  44   GKVVHKQVAEELLDREEARNRRF--HLIAMDAYQRHAKFVNDYILYYGGKKEDFRRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+++ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDMDVIRENHRFLWNEEDEVDMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK+C++KD L S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFFCGNKYCDKKDNLKSWEVNFGYIEHGEKRNALVKLRLCQECS  215



>ref|XP_005884113.1| PREDICTED: protein FRA10AC1 isoform X1 [Myotis brandtii]
 ref|XP_005884114.1| PREDICTED: protein FRA10AC1 isoform X2 [Myotis brandtii]
 ref|XP_005884115.1| PREDICTED: protein FRA10AC1 isoform X3 [Myotis brandtii]
Length=315

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 123/174 (71%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  +     L   
Sbjct  44   GKVVHKQVAEELLDREEARNRRF--HLIAMDAYQRHAKFVNDYILYYGGKKEDFRRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+++ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDMDVIRENHRFLWNEEDEVDMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK+C++KD L S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFFCGNKYCDKKDNLKSWEVNFGYIEHGEKRNALVKLRLCQECS  215



>ref|NP_001074544.1| protein FRA10AC1 homolog [Mus musculus]
 ref|XP_006527397.1| PREDICTED: protein FRA10AC1 homolog isoform X1 [Mus musculus]
 ref|XP_006527398.1| PREDICTED: protein FRA10AC1 homolog isoform X2 [Mus musculus]
 sp|Q8BP78.3|F10C1_MOUSE RecName: Full=Protein FRA10AC1 homolog [Mus musculus]
 gb|AAI48556.1| RIKEN cDNA 5730455O13 gene, partial [synthetic construct]
 gb|AAI53142.1| RIKEN cDNA 5730455O13 gene [synthetic construct]
Length=315

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 121/174 (70%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +    ++   EAR +++  ++  ++AY RH KF++DY+ YYG  R   + L   
Sbjct  44   GKVAHKQVAADLLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKREDFKRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDLDVIRENHRFLWNEEDEADMTWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK CNEK+GL S+EVNF Y E GE + ALVKL  C+ C+
Sbjct  162  IEKEVISGKGQFFCGNKCCNEKEGLRSWEVNFGYTEHGEKRNALVKLRLCQECS  215



>ref|XP_009572334.1| PREDICTED: protein FRA10AC1, partial [Fulmarus glacialis]
 gb|KFW01571.1| Protein FRA10AC1, partial [Fulmarus glacialis]
Length=318

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 121/162 (75%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY+RHKKF++DY+ YYG   +   +     KTD D +RE +
Sbjct  55   WDREEARKRRF--HLIAMDAYERHKKFVNDYILYYGGKIEDFRRSGANDKTDLDVIRENH  112

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  E+D+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  113  RFLWNEDDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQF  172

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC++K+GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  173  SCGNKHCDDKEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  214



>ref|XP_007478851.1| PREDICTED: protein FRA10AC1 isoform X1 [Monodelphis domestica]
Length=328

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 118/158 (75%), Gaps = 4/158 (3%)
 Frame = +1

Query  76   EARKQQYQANIQGLNAYDRHKKFLSDYVAYYG--KDRSTQEVLPVKTDQDTLREGYRFIR  249
            EAR +++  ++  +NAY+RHKK ++DY+ YYG  K+   +     KTD D +RE +RF+ 
Sbjct  71   EARNRRF--HLIAMNAYERHKKLVNDYILYYGGKKEDFRRSGENDKTDLDVIRENHRFLW  128

Query  250  TEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQFICGN  429
             EED+M+ +WE++L K+YYDKLFKEYCIAD++ YK  + G RWR E+EVISGKGQF CGN
Sbjct  129  NEEDEMDMTWEKKLAKKYYDKLFKEYCIADLSRYKDNQFGFRWRVEREVISGKGQFFCGN  188

Query  430  KHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            K C+EK+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  189  KRCDEKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  226



>ref|XP_010137183.1| PREDICTED: protein FRA10AC1, partial [Buceros rhinoceros silvestris]
Length=318

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 120/162 (74%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY+RHKK ++DY+ YYG   +   +     KTD D +RE +
Sbjct  55   WDREEARKRRF--HLIAMDAYERHKKLVNDYILYYGGKIEDFQRSGANDKTDLDVIRENH  112

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  EED+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  113  RFLWNEEDETDMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQF  172

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC+EK+GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  173  SCGNKHCDEKEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  214



>ref|XP_007961784.1| PREDICTED: protein FRA10AC1 isoform X1 [Chlorocebus sabaeus]
Length=406

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 125/174 (72%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  +   + L   
Sbjct  135  GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKEDFKRLGEN  192

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  193  DKTDLDVIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLFKEYCIADLSKYKENKFGFRWR  252

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK+C++K+GL S+EVNF YVE GE + ALVKL  C+ C+
Sbjct  253  VEKEVISGKGQFFCGNKYCDKKEGLKSWEVNFGYVEHGEKRNALVKLRLCQECS  306



>ref|XP_004567569.1| PREDICTED: protein FRA10AC1-like [Maylandia zebra]
Length=332

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 119/171 (70%), Gaps = 3/171 (2%)
 Frame = +1

Query  37   TSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRST--QEVLPVKT  210
             + RS+     DRE  + + +A++  +NA++RHKKF+ DY+ YYG       + V   KT
Sbjct  52   VAHRSLHSNEVDREEARNR-RAHLISMNAFERHKKFVGDYILYYGGQMVDFKRSVAKDKT  110

Query  211  DQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEK  390
            D D LRE +RF+  +ED+ + +WE+ L K+YYDKLFKEYCIAD++ YK  K G RWRTE 
Sbjct  111  DLDVLRENHRFLWRDEDEEDMTWEKELAKKYYDKLFKEYCIADLSRYKENKFGFRWRTEN  170

Query  391  EVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            EV+SGKGQF CGNKHC +++GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  171  EVVSGKGQFQCGNKHCEKEEGLKSWEVNFAYVEHGEKRNALVKLRLCPECS  221



>ref|XP_008155116.1| PREDICTED: protein FRA10AC1 [Eptesicus fuscus]
Length=315

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 123/174 (71%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  +     L   
Sbjct  44   GKVVHKQVAEELLDREEARNRRF--HLIAMDAYQRHAKFVNDYILYYGGKKEDFRRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+++ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDMDVIRENHRFLWNEEDEVDMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK+C++KD L S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFFCGNKYCDKKDNLKSWEVNFGYIEHGEKRNALVKLRLCQECS  215



>ref|XP_005144100.1| PREDICTED: protein FRA10AC1 [Melopsittacus undulatus]
Length=328

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 116/158 (73%), Gaps = 4/158 (3%)
 Frame = +1

Query  76   EARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGYRFIR  249
            EARK++   ++  ++AY+RHKKF+ DY+ YYG   +   +     KTD D +RE +RF+ 
Sbjct  70   EARKRR--CHLIAMDAYERHKKFVKDYILYYGGKIEDFRRSGANDKTDLDVIRENHRFLW  127

Query  250  TEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQFICGN  429
             EED+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF CGN
Sbjct  128  DEEDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQFSCGN  187

Query  430  KHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            KHC+EK+GL S+EVNF YVE GE K ALVKL  C  C+
Sbjct  188  KHCDEKEGLKSWEVNFGYVEHGEKKNALVKLRLCPECS  225



>gb|KFM06491.1| Protein FRA10AC1, partial [Aptenodytes forsteri]
Length=318

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 120/162 (74%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY RHKKF++DY+ YYG   +   +     KTD D +RE +
Sbjct  58   WDREEARKRRF--HLIAMDAYQRHKKFVNDYILYYGGKIEDFRRSGANDKTDLDVIRENH  115

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  E+D+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  116  RFLWNEDDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQF  175

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC+E++GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  176  SCGNKHCDEEEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  217



>ref|XP_005520675.1| PREDICTED: protein FRA10AC1 [Pseudopodoces humilis]
Length=329

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 116/158 (73%), Gaps = 4/158 (3%)
 Frame = +1

Query  76   EARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGYRFIR  249
            EARK+++  ++  ++AY+RHKKF+ DY+ YYG   +   +     KTD D +RE +RF+ 
Sbjct  70   EARKRRF--HLISMDAYERHKKFVHDYILYYGGKIEDFRRSGANDKTDLDVIRENHRFLW  127

Query  250  TEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQFICGN  429
             EED+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF CGN
Sbjct  128  NEEDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQFSCGN  187

Query  430  KHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            KHC+E +GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  188  KHCDENEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  225



>gb|EMC85394.1| Protein FRA10AC1 like protein, partial [Columba livia]
Length=318

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 120/165 (73%), Gaps = 11/165 (7%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKD-----RSTQEVLPVKTDQDTLR  228
            +DRE ARK+++  ++  ++AY RHKK ++DY+ YYG       RS +     KTD D +R
Sbjct  55   WDREEARKRRF--HLISMDAYQRHKKLVNDYILYYGGKMEDFRRSGEND---KTDLDVIR  109

Query  229  EGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGK  408
            E +RF+  E+D+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGK
Sbjct  110  ENHRFLWNEDDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGK  169

Query  409  GQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            GQF CGNKHC+EK+GL S+EVNF YVE GE K ALVKL  C  C+
Sbjct  170  GQFSCGNKHCDEKEGLKSWEVNFGYVEHGEKKNALVKLRVCPECS  214



>gb|KFO70985.1| Protein FRA10AC1, partial [Cuculus canorus]
Length=305

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 120/162 (74%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY RHKKF+SDY+ YYG   +   +     KTD D +RE +
Sbjct  55   WDREEARKRRF--HLISMDAYARHKKFVSDYILYYGGKIEDFRRSGANDKTDLDVIRENH  112

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  E+D+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  113  RFLWNEDDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQF  172

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC E++GL S+EVNF YVE GE + ALVKL  C +C+
Sbjct  173  SCGNKHCEEEEGLKSWEVNFGYVEHGEKRNALVKLRLCPQCS  214



>ref|XP_008354924.1| PREDICTED: LOW QUALITY PROTEIN: protein FRA10AC1-like [Malus 
domestica]
Length=139

 Score =   178 bits (452),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 107/146 (73%), Gaps = 20/146 (14%)
 Frame = +1

Query  34   MTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVKTD  213
            M SF S++  I+DRE RKQQYQA+I GLNAYDRHKKF+ DYV++YG++ S+   LPVKTD
Sbjct  1    MASFGSLKYAIFDREERKQQYQAHILGLNAYDRHKKFVKDYVSFYGREASSHVKLPVKTD  60

Query  214  QDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKE  393
             DTLREG+RFIR+EED+M+ SWEQRLVKRYYDKLFKEYC   MT + +            
Sbjct  61   HDTLREGHRFIRSEEDBMDRSWEQRLVKRYYDKLFKEYC---MTCHITRVT---------  108

Query  394  VISGKGQFICGNKHCNEKDGLASYEV  471
                    ICGNKHC+ KDGLASYEV
Sbjct  109  --------ICGNKHCDVKDGLASYEV  126



>ref|XP_007614615.1| PREDICTED: protein FRA10AC1 isoform X4 [Cricetulus griseus]
Length=363

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 121/174 (70%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +    ++   EAR +++  ++  ++AY RH KF++DY+ YYG  R     L   
Sbjct  45   GKVVHKQVAADLLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKREDFRRLGEN  102

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  103  DKTDLDVIRENHRFLWNEEDEADMTWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWR  162

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK C+EK+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  163  IEKEVISGKGQFFCGNKRCDEKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  216



>ref|XP_005413550.1| PREDICTED: protein FRA10AC1-like isoform X1 [Chinchilla lanigera]
Length=312

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 122/174 (70%), Gaps = 5/174 (3%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+ S +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  +     L   
Sbjct  43   GKVASKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKEDFRRLGEN  100

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+R EED+M  +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  101  DKTDLDVIRENHRFLRNEEDEMEMTWEKRLAKKYYDKLFKEYCIADLSKYKENKFGFRWR  160

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK C+ K+GL S+EVNF Y E GE + ALVKL  C+ C+
Sbjct  161  VEKEVISGKGQFFCGNK-CDAKEGLKSWEVNFGYFEHGEKRNALVKLRLCQECS  213



>ref|XP_009498566.1| PREDICTED: protein FRA10AC1, partial [Phalacrocorax carbo]
 gb|KFW88003.1| Protein FRA10AC1, partial [Phalacrocorax carbo]
Length=318

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 119/162 (73%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  + AY+RHKKF++DY+ YYG   +   +     KTD D +RE +
Sbjct  55   WDREEARKRRF--HLIAMTAYERHKKFVNDYILYYGGKIEDFRRSGANDKTDLDVIRENH  112

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  E+D+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  113  RFLWNEDDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQF  172

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC EK+GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  173  SCGNKHCEEKEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  214



>ref|XP_004279463.1| PREDICTED: protein FRA10AC1 [Orcinus orca]
Length=315

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 122/174 (70%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  +     L   
Sbjct  44   GKVVHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKEDFRRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             K D D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYC+AD+T YK  K G RWR
Sbjct  102  DKIDMDIIRENHRFLWNEEDEMDMNWEKRLAKKYYDKLFKEYCVADLTRYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK C++K+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFCCGNKRCDKKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  215



>gb|KGL75013.1| Protein FRA10AC1, partial [Tinamus guttatus]
Length=315

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 122/165 (74%), Gaps = 11/165 (7%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKD-----RSTQEVLPVKTDQDTLR  228
            +DRE ARK+++  ++  ++AY+RHKKF+SDY+ YYG       RST      KTD D +R
Sbjct  52   WDREEARKRRF--HLISMDAYERHKKFVSDYILYYGGKMEDFRRSTAND---KTDLDVIR  106

Query  229  EGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGK  408
            E +RF+  E+D+++ +WE+RL K+YYDKLFKEYCIAD+  YK  K G RWR E+EV+SGK
Sbjct  107  ENHRFLWREDDEVDMNWEKRLAKKYYDKLFKEYCIADLRRYKENKFGFRWRHEEEVVSGK  166

Query  409  GQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            GQF CG+KHC+EK+GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  167  GQFSCGSKHCDEKEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  211



>ref|XP_004625544.1| PREDICTED: protein FRA10AC1 [Octodon degus]
Length=313

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 122/174 (70%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GKM + +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  +     L   
Sbjct  43   GKMATKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKEDFRRLGEN  100

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED++  +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  101  DKTDLDVIRENHRFLWHEEDEVEMTWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWR  160

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK C+ K+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  161  VEKEVISGKGQFFCGNKCCDTKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  214



>ref|XP_009569054.1| PREDICTED: protein FRA10AC1 [Cuculus canorus]
Length=327

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 120/162 (74%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY RHKKF+SDY+ YYG   +   +     KTD D +RE +
Sbjct  64   WDREEARKRRF--HLISMDAYARHKKFVSDYILYYGGKIEDFRRSGANDKTDLDVIRENH  121

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  E+D+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  122  RFLWNEDDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQF  181

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC E++GL S+EVNF YVE GE + ALVKL  C +C+
Sbjct  182  SCGNKHCEEEEGLKSWEVNFGYVEHGEKRNALVKLRLCPQCS  223



>gb|KFO54296.1| Protein FRA10AC1, partial [Corvus brachyrhynchos]
Length=318

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 117/158 (74%), Gaps = 4/158 (3%)
 Frame = +1

Query  76   EARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGYRFIR  249
            EARK+++  ++  ++AY+RHKKF+ DY+ YYG   +   +     KTD D +RE +RF+ 
Sbjct  59   EARKRRF--HLISMDAYERHKKFVHDYILYYGGKIEDFRRSGANDKTDLDVIRENHRFLW  116

Query  250  TEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQFICGN  429
             EED+ + +WE+RL K+YYDKL+KEYCIAD++ YK  K G RWR EKEVISGKGQF CGN
Sbjct  117  NEEDEADMNWEKRLAKKYYDKLYKEYCIADLSRYKENKFGFRWRHEKEVISGKGQFSCGN  176

Query  430  KHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            KHC+E++GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  177  KHCDEEEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  214



>ref|XP_005890701.1| PREDICTED: protein FRA10AC1 [Bos mutus]
Length=315

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 116/162 (72%), Gaps = 3/162 (2%)
 Frame = +1

Query  64   IYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV--KTDQDTLREGY  237
            + DRE  K + + ++  ++AY RH KF++DY+ YYG  +     L    KTD D +RE +
Sbjct  55   LLDREEAKNR-RFHLIAMDAYQRHTKFVNDYILYYGGKKEDFRRLGENDKTDMDVIRENH  113

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  114  RFLWNEEDEMDMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRVEKEVISGKGQF  173

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNK C++K+GL S+EVNF Y E GE + ALVKL  C+ C+
Sbjct  174  CCGNKSCDKKEGLKSWEVNFGYTEHGEKRNALVKLRLCQECS  215



>ref|XP_005481279.1| PREDICTED: protein FRA10AC1 isoform X2 [Zonotrichia albicollis]
Length=327

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 115/158 (73%), Gaps = 4/158 (3%)
 Frame = +1

Query  76   EARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGYRFIR  249
            EARK+++  ++  ++AY+RHKKF+ DY+ YYG   +   +     KTD D +RE +RF+ 
Sbjct  70   EARKRRF--HLISMDAYERHKKFVHDYILYYGGKIEDFRRSGANDKTDLDVIRENHRFLW  127

Query  250  TEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQFICGN  429
             EED+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF CGN
Sbjct  128  NEEDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQFSCGN  187

Query  430  KHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            KHC E +GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  188  KHCEENEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  225



>ref|XP_009676209.1| PREDICTED: protein FRA10AC1 [Struthio camelus australis]
Length=342

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 124/172 (72%), Gaps = 5/172 (3%)
 Frame = +1

Query  37   TSFRSIRQVIYDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRST--QEVLPVK  207
             + R +    +DRE ARK+++  ++  ++AY+RHKKF++DY+ YYG  R    +     K
Sbjct  69   VAHRQVAAEEWDREEARKRRF--HLIAMDAYERHKKFVNDYILYYGGKREDFRRSRANDK  126

Query  208  TDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTE  387
            TD D +RE +RF+  E+D+++ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR E
Sbjct  127  TDLDVIRENHRFLWKEDDEVDMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHE  186

Query  388  KEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            KEV+SGKGQF CGNKHC+EK+GL S+EVNF YVE  E + ALVKL  C  C+
Sbjct  187  KEVVSGKGQFSCGNKHCDEKEGLKSWEVNFGYVEHDEKRNALVKLRLCPECS  238



>gb|KFW08204.1| Protein FRA10AC1, partial [Eurypyga helias]
Length=317

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 119/162 (73%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY RHKKF+SDY+ YYG   +   +     KTD D +RE +
Sbjct  54   WDREEARKRRF--HLISMDAYSRHKKFVSDYILYYGGKIEDFKRSGANDKTDLDVIRENH  111

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  E+D+ + +WE+RL K+YYDKL+KEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  112  RFLWNEDDEADMNWEKRLAKKYYDKLYKEYCIADLSRYKENKFGFRWRHEKEVISGKGQF  171

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC+E +GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  172  SCGNKHCDETEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  213



>ref|XP_005481278.1| PREDICTED: protein FRA10AC1 isoform X1 [Zonotrichia albicollis]
Length=329

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 115/158 (73%), Gaps = 4/158 (3%)
 Frame = +1

Query  76   EARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGYRFIR  249
            EARK+++  ++  ++AY+RHKKF+ DY+ YYG   +   +     KTD D +RE +RF+ 
Sbjct  70   EARKRRF--HLISMDAYERHKKFVHDYILYYGGKIEDFRRSGANDKTDLDVIRENHRFLW  127

Query  250  TEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQFICGN  429
             EED+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF CGN
Sbjct  128  NEEDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQFSCGN  187

Query  430  KHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            KHC E +GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  188  KHCEENEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  225



>ref|XP_010127628.1| PREDICTED: protein FRA10AC1, partial [Chlamydotis macqueenii]
 gb|KFP38760.1| Protein FRA10AC1, partial [Chlamydotis macqueenii]
Length=318

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 120/162 (74%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY+RHKKF+ DY+ YYG   +   +     KTD D +RE +
Sbjct  55   WDREEARKRRF--HLIAMDAYERHKKFVHDYILYYGGKIEDFRRSGANDKTDLDVIRENH  112

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  E+D+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  113  RFLWNEDDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQF  172

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC+E++GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  173  SCGNKHCDEEEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  214



>dbj|BAE42904.1| unnamed protein product [Mus musculus]
Length=315

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 121/174 (70%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +    ++   EAR +++  ++  ++AY RH KF++DY+ YYG  R   + L   
Sbjct  44   GKVAHKQVAADLLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKREDFKRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+ + +WE+R+ K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDLDVIRENHRFLWNEEDEADMTWEKRIAKKYYDKLFKEYCIADLSRYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK CNEK+GL S+EVNF Y E GE + ALVKL  C+ C+
Sbjct  162  IEKEVISGKGQFFCGNKCCNEKEGLRSWEVNFGYTEHGEKRNALVKLRLCQECS  215



>ref|NP_001014268.1| protein FRA10AC1 homolog [Rattus norvegicus]
 sp|Q5FVF1.1|F10C1_RAT RecName: Full=Protein FRA10AC1 homolog [Rattus norvegicus]
 gb|AAH90036.1| Similar to chromosome 10 open reading frame 4; similar to putative 
acid phosphatase F26C11.1 [Rattus norvegicus]
Length=315

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 123/178 (69%), Gaps = 4/178 (2%)
 Frame = +1

Query  16   RSNWGKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEV  195
            +  +GK+   +    ++   EAR +++  ++  ++AY RH KF++DY+ YYG  R   + 
Sbjct  40   KEKYGKVAHKQVAADLLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKREDFKR  97

Query  196  LPV--KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIG  369
            L    KTD D +RE +RF+  EED+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G
Sbjct  98   LGENDKTDLDVIRENHRFLWNEEDEADMTWEKRLAKKYYDKLFKEYCIADLSRYKENKFG  157

Query  370  LRWRTEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             RWR EKEVISGKGQF CGNK C+EK+GL S+EVNF Y E GE + ALVKL  C+ C+
Sbjct  158  FRWRIEKEVISGKGQFFCGNKCCDEKEGLKSWEVNFGYTEHGEKRNALVKLRLCQECS  215



>ref|XP_009954388.1| PREDICTED: protein FRA10AC1, partial [Leptosomus discolor]
 gb|KFQ00331.1| Protein FRA10AC1, partial [Leptosomus discolor]
Length=318

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 121/162 (75%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY+RHKKF++DY+ YYG   +   +     KTD D +RE +
Sbjct  55   WDREEARKRRF--HLIAMDAYERHKKFVNDYILYYGGKIEDFRRSGANDKTDLDVIRENH  112

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  E+D+ + +WE+RL K+YYDKL+KEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  113  RFLWNEDDEADMNWEKRLAKKYYDKLYKEYCIADLSRYKENKFGFRWRHEKEVISGKGQF  172

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC+EK+GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  173  SCGNKHCDEKEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  214



>ref|XP_005407578.1| PREDICTED: protein FRA10AC1 isoform X2 [Chinchilla lanigera]
 ref|XP_005407579.1| PREDICTED: protein FRA10AC1 isoform X3 [Chinchilla lanigera]
Length=313

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 121/174 (70%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+ S +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  +     L   
Sbjct  43   GKVASKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKEDFRRLGEN  100

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M  +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  101  DKTDLDVIRENHRFLWNEEDEMEMTWEKRLAKKYYDKLFKEYCIADLSKYKENKFGFRWR  160

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK C+ K+GL S+EVNF Y E GE + ALVKL  C+ C+
Sbjct  161  VEKEVISGKGQFFCGNKCCDAKEGLKSWEVNFGYFEHGEKRNALVKLRLCQECS  214



>ref|XP_007949487.1| PREDICTED: protein FRA10AC1 [Orycteropus afer afer]
Length=291

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 121/174 (70%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +    ++   EAR +++  ++  ++AY RH KF++DY+ YYG  +     L   
Sbjct  20   GKVAHKQVAADLLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKEDFRRLGEN  77

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  78   DKTDLDVIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWR  137

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK C+ K+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  138  VEKEVISGKGQFFCGNKCCDVKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  191



>ref|NP_001069860.1| protein FRA10AC1 [Bos taurus]
 ref|XP_005225680.1| PREDICTED: protein FRA10AC1 isoform X1 [Bos taurus]
 ref|XP_010818223.1| PREDICTED: protein FRA10AC1 isoform X1 [Bos taurus]
 gb|AAI22579.1| Chromosome 10 open reading frame 4 ortholog [Bos taurus]
 tpg|DAA14832.1| TPA: FRA10AC1 protein [Bos taurus]
Length=315

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 116/162 (72%), Gaps = 3/162 (2%)
 Frame = +1

Query  64   IYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV--KTDQDTLREGY  237
            + DRE  K + + ++  ++AY RH KF++DY+ YYG  +     L    KTD D +RE +
Sbjct  55   LLDREEAKNR-RFHLIAMDAYQRHTKFVNDYILYYGGKKEDFRRLGENDKTDMDVIRENH  113

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  114  RFLWNEEDEMDMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRIEKEVISGKGQF  173

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNK C++K+GL S+EVNF Y E GE + ALVKL  C+ C+
Sbjct  174  CCGNKSCDKKEGLKSWEVNFGYTEHGEKRNALVKLRLCQECS  215



>ref|XP_010408850.1| PREDICTED: protein FRA10AC1 isoform X2 [Corvus cornix cornix]
Length=314

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 117/158 (74%), Gaps = 4/158 (3%)
 Frame = +1

Query  76   EARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGYRFIR  249
            EARK+++  ++  ++AY+RHKKF+ DY+ YYG   +   +     KTD D +RE +RF+ 
Sbjct  60   EARKRRF--HLISMDAYERHKKFVHDYILYYGGKIEDFRRSGANDKTDLDVIRENHRFLW  117

Query  250  TEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQFICGN  429
             EED+ + +WE+RL K+YYDKL+KEYCIAD++ YK  K G RWR EKEVISGKGQF CGN
Sbjct  118  NEEDEADMNWEKRLAKKYYDKLYKEYCIADLSRYKENKFGFRWRHEKEVISGKGQFSCGN  177

Query  430  KHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            KHC+E++GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  178  KHCDEEEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  215



>ref|XP_006090078.1| PREDICTED: protein FRA10AC1 isoform X1 [Myotis lucifugus]
Length=350

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 123/174 (71%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  +     L   
Sbjct  79   GKVVHKQVAEELLDREEARNRRF--HLIAMDAYQRHAKFVNDYILYYGGKKEDFRRLGEN  136

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+++ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  137  DKTDMDVIRENHRFLWNEEDEVDMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWR  196

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK+C++KD L S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  197  VEKEVISGKGQFFCGNKYCDKKDNLKSWEVNFGYIEHGEKRNALVKLRLCQECS  250



>gb|KFU91440.1| Protein FRA10AC1, partial [Chaetura pelagica]
Length=316

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 120/162 (74%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY+RHKK ++DY+ YYG   +   +     KTD D +RE +
Sbjct  55   WDREEARKRRF--HLIAMDAYERHKKLVNDYILYYGGKIEDFQRSGANDKTDLDVIRENH  112

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  E+D+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  113  RFLWNEDDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQF  172

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC+EK+GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  173  SCGNKHCDEKEGLKSWEVNFGYVEHGEKRNALVKLRLCPDCS  214



>ref|XP_008758593.1| PREDICTED: protein FRA10AC1 homolog isoform X1 [Rattus norvegicus]
Length=322

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 123/178 (69%), Gaps = 4/178 (2%)
 Frame = +1

Query  16   RSNWGKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEV  195
            +  +GK+   +    ++   EAR +++  ++  ++AY RH KF++DY+ YYG  R   + 
Sbjct  47   KEKYGKVAHKQVAADLLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKREDFKR  104

Query  196  LPV--KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIG  369
            L    KTD D +RE +RF+  EED+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G
Sbjct  105  LGENDKTDLDVIRENHRFLWNEEDEADMTWEKRLAKKYYDKLFKEYCIADLSRYKENKFG  164

Query  370  LRWRTEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             RWR EKEVISGKGQF CGNK C+EK+GL S+EVNF Y E GE + ALVKL  C+ C+
Sbjct  165  FRWRIEKEVISGKGQFFCGNKCCDEKEGLKSWEVNFGYTEHGEKRNALVKLRLCQECS  222



>ref|XP_004412623.1| PREDICTED: protein FRA10AC1 [Odobenus rosmarus divergens]
Length=315

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 122/174 (70%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  +     L   
Sbjct  44   GKVAHKQVASELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKEDFRRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+MN +WE++L K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDMDVIRENHRFLWNEEDEMNMNWEKKLAKKYYDKLFKEYCIADLSRYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK C++K+ L S+EVNF YVE GE + ALVKL  C+ C+
Sbjct  162  IEKEVISGKGQFFCGNKCCDKKEDLKSWEVNFGYVEHGEKRNALVKLRLCQECS  215



>gb|KFP79334.1| Protein FRA10AC1, partial [Acanthisitta chloris]
Length=273

 Score =   182 bits (461),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 116/161 (72%), Gaps = 10/161 (6%)
 Frame = +1

Query  76   EARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKD-----RSTQEVLPVKTDQDTLREGYR  240
            EARK+++  ++  ++AY RHKKF+ DY+ YYG       RS +     KTDQD +RE +R
Sbjct  59   EARKRRF--HLISMDAYQRHKKFVHDYILYYGGKIEDFRRSGEND---KTDQDVIRENHR  113

Query  241  FIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQFI  420
            F+  EED+ + +WE+RL K+YYDKL+KEYCIAD++ YK  K G RWR E+EVISGKGQF 
Sbjct  114  FLWNEEDEEDMNWEKRLAKKYYDKLYKEYCIADLSRYKENKFGFRWRHEQEVISGKGQFS  173

Query  421  CGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            CGNKHC E +GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  174  CGNKHCEENEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  214



>ref|XP_009998417.1| PREDICTED: protein FRA10AC1 [Chaetura pelagica]
Length=321

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 120/162 (74%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY+RHKK ++DY+ YYG   +   +     KTD D +RE +
Sbjct  60   WDREEARKRRF--HLIAMDAYERHKKLVNDYILYYGGKIEDFQRSGANDKTDLDVIRENH  117

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  E+D+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  118  RFLWNEDDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQF  177

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC+EK+GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  178  SCGNKHCDEKEGLKSWEVNFGYVEHGEKRNALVKLRLCPDCS  219



>ref|XP_010818224.1| PREDICTED: protein FRA10AC1 isoform X2 [Bos taurus]
Length=302

 Score =   182 bits (463),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 116/162 (72%), Gaps = 3/162 (2%)
 Frame = +1

Query  64   IYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV--KTDQDTLREGY  237
            + DRE  K + + ++  ++AY RH KF++DY+ YYG  +     L    KTD D +RE +
Sbjct  55   LLDREEAKNR-RFHLIAMDAYQRHTKFVNDYILYYGGKKEDFRRLGENDKTDMDVIRENH  113

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  114  RFLWNEEDEMDMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRIEKEVISGKGQF  173

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNK C++K+GL S+EVNF Y E GE + ALVKL  C+ C+
Sbjct  174  CCGNKSCDKKEGLKSWEVNFGYTEHGEKRNALVKLRLCQECS  215



>ref|XP_005698282.1| PREDICTED: protein FRA10AC1 isoform X1 [Capra hircus]
 ref|XP_005698283.1| PREDICTED: protein FRA10AC1 isoform X2 [Capra hircus]
 ref|XP_005698285.1| PREDICTED: protein FRA10AC1 isoform X4 [Capra hircus]
Length=315

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 116/162 (72%), Gaps = 3/162 (2%)
 Frame = +1

Query  64   IYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV--KTDQDTLREGY  237
            + DRE  K + + ++  ++AY RH KF++DY+ YYG  +     L    KTD D +RE +
Sbjct  55   LLDREEAKNR-RFHLIAMDAYQRHTKFVNDYILYYGGKKEDFRRLGENDKTDMDVIRENH  113

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  114  RFLWNEEDEMDMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRVEKEVISGKGQF  173

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNK C+EK+GL S+EVNF Y E GE + ALVKL  C+ C+
Sbjct  174  CCGNKCCDEKEGLKSWEVNFGYTEHGEKRNALVKLRLCQECS  215



>ref|XP_004020091.1| PREDICTED: protein FRA10AC1 [Ovis aries]
Length=315

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 116/162 (72%), Gaps = 3/162 (2%)
 Frame = +1

Query  64   IYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV--KTDQDTLREGY  237
            + DRE  K + + ++  ++AY RH KF++DY+ YYG  +     L    KTD D +RE +
Sbjct  55   LLDREEAKNR-RFHLIAMDAYQRHTKFVNDYILYYGGKKEDFRRLGENDKTDMDVIRENH  113

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  114  RFLWNEEDEMDMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRVEKEVISGKGQF  173

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNK C+EK+GL S+EVNF Y E GE + ALVKL  C+ C+
Sbjct  174  CCGNKCCDEKEGLKSWEVNFGYTEHGEKRNALVKLRLCQECS  215



>ref|XP_010209675.1| PREDICTED: protein FRA10AC1 [Tinamus guttatus]
Length=330

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 122/165 (74%), Gaps = 11/165 (7%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKD-----RSTQEVLPVKTDQDTLR  228
            +DRE ARK+++  ++  ++AY+RHKKF+SDY+ YYG       RST      KTD D +R
Sbjct  67   WDREEARKRRF--HLISMDAYERHKKFVSDYILYYGGKMEDFRRSTAND---KTDLDVIR  121

Query  229  EGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGK  408
            E +RF+  E+D+++ +WE+RL K+YYDKLFKEYCIAD+  YK  K G RWR E+EV+SGK
Sbjct  122  ENHRFLWREDDEVDMNWEKRLAKKYYDKLFKEYCIADLRRYKENKFGFRWRHEEEVVSGK  181

Query  409  GQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            GQF CG+KHC+EK+GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  182  GQFSCGSKHCDEKEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  226



>ref|XP_007439948.1| PREDICTED: protein FRA10AC1, partial [Python bivittatus]
Length=286

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 121/169 (72%), Gaps = 8/169 (5%)
 Frame = +1

Query  55   RQVIYDR----EARKQQYQANIQGLNAYDRHKKFLSDYVAYYG--KDRSTQEVLPVKTDQ  216
            RQV  D     EAR +++  ++  ++AY RHKKF++DY+ YYG  K+   +     KTD 
Sbjct  57   RQVATDEWDREEARNRRF--HLIAMDAYARHKKFVNDYILYYGGKKEDFKRSGENDKTDL  114

Query  217  DTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEV  396
            D +RE +RF+  EED+++ +WE+RL K+YYDKLFKEYCIAD+  Y+  K G RWR E+EV
Sbjct  115  DVIRENHRFLWREEDEVDMNWEKRLSKKYYDKLFKEYCIADLRKYQENKFGFRWRHEQEV  174

Query  397  ISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            +SGKGQF CG+KHCNEK+GL S+EVNF YVE G+ K ALVKL  C  C+
Sbjct  175  VSGKGQFFCGSKHCNEKEGLKSWEVNFGYVEHGKKKNALVKLRLCPECS  223



>ref|XP_007187539.1| PREDICTED: protein FRA10AC1 isoform X1 [Balaenoptera acutorostrata 
scammoni]
 ref|XP_007187540.1| PREDICTED: protein FRA10AC1 isoform X2 [Balaenoptera acutorostrata 
scammoni]
Length=302

 Score =   182 bits (463),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 122/174 (70%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  +     L   
Sbjct  44   GKVVHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKEDFRRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             K D D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYC+AD+T YK  K G RWR
Sbjct  102  DKIDMDVIRENHRFLWNEEDEMDMNWEKRLAKKYYDKLFKEYCVADLTRYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK C++K+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFCCGNKCCDKKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  215



>ref|XP_010840487.1| PREDICTED: protein FRA10AC1 [Bison bison bison]
 ref|XP_010840488.1| PREDICTED: protein FRA10AC1 [Bison bison bison]
 ref|XP_010840489.1| PREDICTED: protein FRA10AC1 [Bison bison bison]
Length=315

 Score =   183 bits (464),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 116/162 (72%), Gaps = 3/162 (2%)
 Frame = +1

Query  64   IYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV--KTDQDTLREGY  237
            + DRE  K + + ++  ++AY RH KF++DY+ YYG  +     L    KTD D +RE +
Sbjct  55   LLDREEAKNR-RFHLIAMDAYQRHTKFVNDYILYYGGKKEDFRRLGENDKTDMDVIRENH  113

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  114  RFLWNEEDEMDMNWEKRLAKKYYDKLFKEYCIADLSRYKEKKFGFRWRVEKEVISGKGQF  173

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNK C++K+GL S+EVNF Y E GE + ALVKL  C+ C+
Sbjct  174  CCGNKSCDKKEGLKSWEVNFGYTEHGEKRNALVKLRLCQECS  215



>dbj|BAC36871.1| unnamed protein product [Mus musculus]
Length=363

 Score =   184 bits (467),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 121/174 (70%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +    ++   EAR +++  ++  ++AY RH KF++DY+ YYG  R   + L   
Sbjct  92   GKVAHKQVAADLLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKREDFKRLGEN  149

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  150  DKTDLDVIRENHRFLWNEEDEADMTWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWR  209

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK CNEK+GL S+EVNF Y E GE + ALVKL  C+ C+
Sbjct  210  IEKEVISGKGQFFCGNKCCNEKEGLRSWEVNFGYTEHGEKRNALVKLRLCQECS  263



>ref|XP_008434924.1| PREDICTED: protein FRA10AC1 [Poecilia reticulata]
Length=332

 Score =   183 bits (465),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 119/171 (70%), Gaps = 3/171 (2%)
 Frame = +1

Query  37   TSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRST--QEVLPVKT  210
             + RS+     DRE  + + +A++  +NA++RHKKF+ DY+ YYG   +   +     KT
Sbjct  52   VAHRSLHSCEVDREEARNR-RAHLISMNAFERHKKFVGDYILYYGGQMADFRRSAAKDKT  110

Query  211  DQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEK  390
            D D LRE +RF+  +ED+ + +WE+ + K+YYDKLFKEYCIAD++ YK  K G RWRTE 
Sbjct  111  DLDVLRENHRFLWRDEDEDDMTWEKEIAKKYYDKLFKEYCIADLSRYKENKFGFRWRTEN  170

Query  391  EVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            EV+SGKGQF CGNKHC +++GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  171  EVVSGKGQFQCGNKHCGKEEGLKSWEVNFAYVEHGEKRNALVKLRLCPECS  221



>ref|XP_007471638.1| PREDICTED: protein FRA10AC1 isoform X1 [Lipotes vexillifer]
Length=315

 Score =   183 bits (464),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 122/174 (70%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  +     L   
Sbjct  44   GKVVHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKEDFRRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             K D D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYC+AD+T YK  K G RWR
Sbjct  102  DKIDMDVIRENHRFLWNEEDEMDMNWEKRLAKKYYDKLFKEYCVADLTRYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK C++K+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFCCGNKCCDKKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  215



>ref|XP_007571197.1| PREDICTED: protein FRA10AC1 isoform X1 [Poecilia formosa]
Length=332

 Score =   183 bits (465),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 119/171 (70%), Gaps = 3/171 (2%)
 Frame = +1

Query  37   TSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRST--QEVLPVKT  210
             + RS+     DRE  + + +A++  +NA++RHKKF+ DY+ YYG   +   +     KT
Sbjct  52   VAHRSLHSCEVDREEARNR-RAHLISMNAFERHKKFVGDYILYYGGQMADFRRSAAKDKT  110

Query  211  DQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEK  390
            D D LRE +RF+  +ED+ + +WE+ + K+YYDKLFKEYCIAD++ YK  K G RWRTE 
Sbjct  111  DLDVLRENHRFLWRDEDEDDMTWEKEIAKKYYDKLFKEYCIADLSRYKENKFGFRWRTEN  170

Query  391  EVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            EV+SGKGQF CGNKHC +++GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  171  EVVSGKGQFQCGNKHCGKEEGLKSWEVNFAYVEHGEKRNALVKLRLCPECS  221



>ref|XP_004080319.1| PREDICTED: protein FRA10AC1 homolog [Oryzias latipes]
Length=303

 Score =   182 bits (463),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 118/171 (69%), Gaps = 3/171 (2%)
 Frame = +1

Query  37   TSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPVK--T  210
             + RS+     DRE  + + +A++  LNA++RHKKF+ DY+ YYG   +  +   VK  T
Sbjct  23   VAHRSLHSSEVDREEARNR-RAHLISLNAFERHKKFVGDYILYYGGQMADFKRSGVKDKT  81

Query  211  DQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEK  390
            D D LRE +RF+  +ED+ + +WE+ L K+YYDKLFKEYCIAD++ YK  K G RWRTE 
Sbjct  82   DLDVLRENHRFLWRDEDEEDMTWEKELAKKYYDKLFKEYCIADLSRYKENKFGFRWRTEN  141

Query  391  EVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            EV+SGKGQF CGNK C + +GL S+EVNF YVE GE K ALVKL  C  C+
Sbjct  142  EVVSGKGQFQCGNKRCEKNEGLKSWEVNFAYVEHGEKKNALVKLRLCPECS  192



>ref|XP_009887096.1| PREDICTED: protein FRA10AC1 [Charadrius vociferus]
Length=396

 Score =   185 bits (469),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 120/162 (74%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY+RHKKF+ DY+ YYG   +   +     KTD D +RE +
Sbjct  133  WDREEARKRRF--HLIAMDAYERHKKFVKDYILYYGGKIEDFRRSGANDKTDLDVIRENH  190

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  E+D+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  191  RFLWNEDDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQF  250

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC+EK+GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  251  SCGNKHCDEKEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  292



>ref|XP_005432475.1| PREDICTED: protein FRA10AC1 [Falco cherrug]
Length=354

 Score =   184 bits (466),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 121/162 (75%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY+RHKKF++DY+ YYG   +   +     KTD D +RE +
Sbjct  91   WDREEARKRRF--HLIAMDAYERHKKFVNDYILYYGGKIEDFRRSGANDKTDLDVIRENH  148

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  E+D+ + +WE+RL K+YYDKL+KEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  149  RFLWDEDDEADMNWEKRLAKKYYDKLYKEYCIADLSRYKENKFGFRWRHEKEVISGKGQF  208

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC+EK+GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  209  SCGNKHCDEKEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  250



>gb|EDM13215.1| rCG47325 [Rattus norvegicus]
Length=312

 Score =   182 bits (463),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 123/178 (69%), Gaps = 4/178 (2%)
 Frame = +1

Query  16   RSNWGKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEV  195
            +  +GK+   +    ++   EAR +++  ++  ++AY RH KF++DY+ YYG  R   + 
Sbjct  40   KEKYGKVAHKQVAADLLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKREDFKR  97

Query  196  LPV--KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIG  369
            L    KTD D +RE +RF+  EED+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G
Sbjct  98   LGENDKTDLDVIRENHRFLWNEEDEADMTWEKRLAKKYYDKLFKEYCIADLSRYKENKFG  157

Query  370  LRWRTEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             RWR EKEVISGKGQF CGNK C+EK+GL S+EVNF Y E GE + ALVKL  C+ C+
Sbjct  158  FRWRIEKEVISGKGQFFCGNKCCDEKEGLKSWEVNFGYTEHGEKRNALVKLRLCQECS  215



>gb|EDL41804.1| mCG15397 [Mus musculus]
Length=340

 Score =   183 bits (465),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 121/174 (70%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +    ++   EAR +++  ++  ++AY RH KF++DY+ YYG  R   + L   
Sbjct  160  GKVAHKQVAADLLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKREDFKRLGEN  217

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  218  DKTDLDVIRENHRFLWNEEDEADMTWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWR  277

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK CNEK+GL S+EVNF Y E GE + ALVKL  C+ C+
Sbjct  278  IEKEVISGKGQFFCGNKCCNEKEGLRSWEVNFGYTEHGEKRNALVKLRLCQECS  331



>ref|XP_005671347.1| PREDICTED: protein FRA10AC1 isoform X1 [Sus scrofa]
 ref|XP_005671348.1| PREDICTED: protein FRA10AC1 isoform X2 [Sus scrofa]
 ref|XP_005671349.1| PREDICTED: protein FRA10AC1 isoform X3 [Sus scrofa]
Length=316

 Score =   182 bits (463),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 124/174 (71%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYG--KDRSTQEVLP  201
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  K+   +    
Sbjct  49   GKVVHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKEDFRRSREN  106

Query  202  VKTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  107  DKTDMDVIRENHRFLWNEEDEMDMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWR  166

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             E+EVISGKGQF CGNK C++K+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  167  VEREVISGKGQFCCGNKCCDKKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  220



>ref|XP_006183717.1| PREDICTED: protein FRA10AC1 [Camelus ferus]
 ref|XP_010969511.1| PREDICTED: protein FRA10AC1 isoform X2 [Camelus bactrianus]
 ref|XP_010972599.1| PREDICTED: protein FRA10AC1 [Camelus dromedarius]
Length=315

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 123/174 (71%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYG--KDRSTQEVLP  201
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  K+   +    
Sbjct  44   GKVVHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKEDFRRSGEN  101

Query  202  VKTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDMDVIRENHRFLWNEEDEMDMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK C +K+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFCCGNKCCEKKEGLKSWEVNFGYIEHGEKRSALVKLRLCQECS  215



>ref|XP_005507073.1| PREDICTED: protein FRA10AC1 [Columba livia]
Length=344

 Score =   183 bits (465),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 120/165 (73%), Gaps = 11/165 (7%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKD-----RSTQEVLPVKTDQDTLR  228
            +DRE ARK+++  ++  ++AY RHKK ++DY+ YYG       RS +     KTD D +R
Sbjct  81   WDREEARKRRF--HLISMDAYQRHKKLVNDYILYYGGKMEDFRRSGEND---KTDLDVIR  135

Query  229  EGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGK  408
            E +RF+  E+D+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGK
Sbjct  136  ENHRFLWNEDDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGK  195

Query  409  GQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            GQF CGNKHC+EK+GL S+EVNF YVE GE K ALVKL  C  C+
Sbjct  196  GQFSCGNKHCDEKEGLKSWEVNFGYVEHGEKKNALVKLRVCPECS  240



>gb|KFQ85688.1| Protein FRA10AC1, partial [Phoenicopterus ruber ruber]
Length=318

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 121/162 (75%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY+RHKKF++DY+ YYG   +   +     KTD D +RE +
Sbjct  55   WDREEARKRRF--HLIAMDAYERHKKFVNDYILYYGGKIEDFRRSGANDKTDLDVIRENH  112

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  E+D+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF
Sbjct  113  RFLWNEDDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQF  172

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNK+C+EK+GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  173  SCGNKYCDEKEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  214



>ref|XP_006211087.1| PREDICTED: protein FRA10AC1 [Vicugna pacos]
Length=316

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 123/174 (71%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYG--KDRSTQEVLP  201
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  K+   +    
Sbjct  45   GKVVHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKEDFRRSGEN  102

Query  202  VKTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  103  DKTDMDVIRENHRFLWNEEDEMDMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWR  162

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK C +K+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  163  VEKEVISGKGQFCCGNKCCEKKEGLKSWEVNFGYIEHGEKRSALVKLRLCQECS  216



>ref|XP_005417433.1| PREDICTED: protein FRA10AC1 [Geospiza fortis]
Length=331

 Score =   183 bits (464),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 116/158 (73%), Gaps = 4/158 (3%)
 Frame = +1

Query  76   EARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGYRFIR  249
            EARK+++  ++  ++AY+RHKKF+ DY+ YYG   +   +     KTD D +RE +RF+ 
Sbjct  72   EARKRRF--HLISMDAYERHKKFVHDYILYYGGKIEDFRRSGANDKTDLDVIRENHRFLW  129

Query  250  TEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQFICGN  429
             EED+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF CGN
Sbjct  130  NEEDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQFSCGN  189

Query  430  KHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            KHC+E +GL S+EVNF Y+E GE + ALVKL  C  C+
Sbjct  190  KHCDENEGLKSWEVNFGYIEHGEKRNALVKLRLCPECS  227



>ref|XP_007471639.1| PREDICTED: protein FRA10AC1 isoform X2 [Lipotes vexillifer]
Length=302

 Score =   182 bits (461),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 122/174 (70%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  +     L   
Sbjct  44   GKVVHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKEDFRRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             K D D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYC+AD+T YK  K G RWR
Sbjct  102  DKIDMDVIRENHRFLWNEEDEMDMNWEKRLAKKYYDKLFKEYCVADLTRYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK C++K+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFCCGNKCCDKKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  215



>gb|KFV65237.1| Protein FRA10AC1, partial [Picoides pubescens]
Length=318

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 120/162 (74%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY+RHKKF+SDY+ YYG   +   +     KTD D +RE +
Sbjct  55   WDREEARKRRF--HLISMDAYERHKKFVSDYILYYGGKIEDFRRSGANDKTDLDVIRENH  112

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  E+D+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEV+SGKGQF
Sbjct  113  RFLWNEDDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVVSGKGQF  172

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNK C+E++GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  173  SCGNKQCDEQEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  214



>gb|EHB07596.1| Protein FRA10AC1, partial [Heterocephalus glaber]
Length=261

 Score =   181 bits (458),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 120/174 (69%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+ S + +   + DRE  K + + ++  ++AY RH KF++DY+ YYG  +     L   
Sbjct  44   GKVAS-KQVAAELLDREEAKNR-RFHLIAMDAYQRHTKFVNDYILYYGGKKEDFRRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+   +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDLDVIRENHRFLWNEEDETEMTWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK C+ K+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFFCGNKCCDTKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  215



>ref|XP_009896039.1| PREDICTED: protein FRA10AC1 [Picoides pubescens]
Length=327

 Score =   182 bits (463),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 120/162 (74%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY+RHKKF+SDY+ YYG   +   +     KTD D +RE +
Sbjct  66   WDREEARKRRF--HLISMDAYERHKKFVSDYILYYGGKIEDFRRSGANDKTDLDVIRENH  123

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  E+D+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEV+SGKGQF
Sbjct  124  RFLWNEDDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVVSGKGQF  183

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNK C+E++GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  184  SCGNKQCDEQEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  225



>ref|XP_004749699.1| PREDICTED: protein FRA10AC1 [Mustela putorius furo]
 ref|XP_004794693.1| PREDICTED: protein FRA10AC1 [Mustela putorius furo]
Length=315

 Score =   182 bits (462),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 122/174 (70%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  +     L   
Sbjct  44   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKEDFRRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE++L K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDMDVIRENHRFLWNEEDEMDMNWEKKLAKKYYDKLFKEYCIADLSRYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK C++KD L S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFFCGNKCCDKKDDLKSWEVNFGYIEHGEKRNALVKLRLCQECS  215



>ref|NP_001230583.1| protein FRA10AC1 [Sus scrofa]
 ref|XP_005671350.1| PREDICTED: protein FRA10AC1 isoform X4 [Sus scrofa]
 ref|XP_005671351.1| PREDICTED: protein FRA10AC1 isoform X5 [Sus scrofa]
Length=311

 Score =   182 bits (462),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 124/174 (71%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYG--KDRSTQEVLP  201
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  K+   +    
Sbjct  44   GKVVHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKEDFRRSREN  101

Query  202  VKTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDMDVIRENHRFLWNEEDEMDMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             E+EVISGKGQF CGNK C++K+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  VEREVISGKGQFCCGNKCCDKKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  215



>ref|XP_005407577.1| PREDICTED: protein FRA10AC1 isoform X1 [Chinchilla lanigera]
Length=362

 Score =   183 bits (465),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 121/174 (70%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+ S +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  +     L   
Sbjct  92   GKVASKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKEDFRRLGEN  149

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M  +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  150  DKTDLDVIRENHRFLWNEEDEMEMTWEKRLAKKYYDKLFKEYCIADLSKYKENKFGFRWR  209

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK C+ K+GL S+EVNF Y E GE + ALVKL  C+ C+
Sbjct  210  VEKEVISGKGQFFCGNKCCDAKEGLKSWEVNFGYFEHGEKRNALVKLRLCQECS  263



>ref|XP_008642135.1| PREDICTED: protein FRA10AC1 [Corvus brachyrhynchos]
Length=339

 Score =   183 bits (464),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 117/158 (74%), Gaps = 4/158 (3%)
 Frame = +1

Query  76   EARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGYRFIR  249
            EARK+++  ++  ++AY+RHKKF+ DY+ YYG   +   +     KTD D +RE +RF+ 
Sbjct  82   EARKRRF--HLISMDAYERHKKFVHDYILYYGGKIEDFRRSGANDKTDLDVIRENHRFLW  139

Query  250  TEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQFICGN  429
             EED+ + +WE+RL K+YYDKL+KEYCIAD++ YK  K G RWR EKEVISGKGQF CGN
Sbjct  140  NEEDEADMNWEKRLAKKYYDKLYKEYCIADLSRYKENKFGFRWRHEKEVISGKGQFSCGN  199

Query  430  KHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            KHC+E++GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  200  KHCDEEEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  237



>ref|XP_010408841.1| PREDICTED: protein FRA10AC1 isoform X1 [Corvus cornix cornix]
Length=352

 Score =   183 bits (465),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 117/158 (74%), Gaps = 4/158 (3%)
 Frame = +1

Query  76   EARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGYRFIR  249
            EARK+++  ++  ++AY+RHKKF+ DY+ YYG   +   +     KTD D +RE +RF+ 
Sbjct  98   EARKRRF--HLISMDAYERHKKFVHDYILYYGGKIEDFRRSGANDKTDLDVIRENHRFLW  155

Query  250  TEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQFICGN  429
             EED+ + +WE+RL K+YYDKL+KEYCIAD++ YK  K G RWR EKEVISGKGQF CGN
Sbjct  156  NEEDEADMNWEKRLAKKYYDKLYKEYCIADLSRYKENKFGFRWRHEKEVISGKGQFSCGN  215

Query  430  KHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            KHC+E++GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  216  KHCDEEEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  253



>gb|KFR11564.1| Protein FRA10AC1, partial [Opisthocomus hoazin]
Length=318

 Score =   182 bits (462),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 119/162 (73%), Gaps = 5/162 (3%)
 Frame = +1

Query  67   YDRE-ARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGY  237
            +DRE ARK+++  ++  ++AY+RHKK ++DY+ YYG   +   +     KTD D +RE +
Sbjct  55   WDREEARKRRF--HLIAMDAYERHKKLVNDYILYYGGKIEDFRRSGANDKTDLDVIRENH  112

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RF+  E+D+ + +WE+RL K+YYDKLFKEYCIAD+  YK  K G RWR EKEVISGKGQF
Sbjct  113  RFLWNEDDEADMNWEKRLAKKYYDKLFKEYCIADLGRYKENKFGFRWRHEKEVISGKGQF  172

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             CGNKHC+EK+GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  173  SCGNKHCDEKEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  214



>ref|XP_010909904.1| PREDICTED: protein FRA10AC1 homolog isoform X4 [Elaeis guineensis]
Length=212

 Score =   179 bits (453),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +1

Query  238  RFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQF  417
            RFI +EEDDM+ +WE+RLVKRYYDKLFKEYCIADM+ YK G+IGLRWRTEKEVISGKGQF
Sbjct  17   RFIISEEDDMDSTWEKRLVKRYYDKLFKEYCIADMSQYKMGQIGLRWRTEKEVISGKGQF  76

Query  418  ICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            ICGN+ CNE   L SYEVNF Y EAGE+KQALVKLV C+RCA
Sbjct  77   ICGNRACNENKSLGSYEVNFSYTEAGESKQALVKLVACKRCA  118



>ref|XP_008851308.1| PREDICTED: protein FRA10AC1 isoform X1 [Nannospalax galili]
 ref|XP_008851309.1| PREDICTED: protein FRA10AC1 isoform X1 [Nannospalax galili]
Length=314

 Score =   182 bits (462),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 122/174 (70%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  R     +   
Sbjct  43   GKVVHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKREDFRRVGEN  100

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  101  DKTDLDVIRENHRFLWNEEDEEDMTWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWR  160

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK C+EK+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  161  IEKEVISGKGQFFCGNKCCDEKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  214



>ref|XP_009071848.1| PREDICTED: protein FRA10AC1, partial [Acanthisitta chloris]
Length=312

 Score =   182 bits (461),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 116/161 (72%), Gaps = 10/161 (6%)
 Frame = +1

Query  76   EARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKD-----RSTQEVLPVKTDQDTLREGYR  240
            EARK+++  ++  ++AY RHKKF+ DY+ YYG       RS +     KTDQD +RE +R
Sbjct  59   EARKRRF--HLISMDAYQRHKKFVHDYILYYGGKIEDFRRSGEND---KTDQDVIRENHR  113

Query  241  FIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQFI  420
            F+  EED+ + +WE+RL K+YYDKL+KEYCIAD++ YK  K G RWR E+EVISGKGQF 
Sbjct  114  FLWNEEDEEDMNWEKRLAKKYYDKLYKEYCIADLSRYKENKFGFRWRHEQEVISGKGQFS  173

Query  421  CGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            CGNKHC E +GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  174  CGNKHCEENEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  214



>gb|KFW85955.1| Protein FRA10AC1, partial [Manacus vitellinus]
Length=305

 Score =   182 bits (461),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 116/158 (73%), Gaps = 4/158 (3%)
 Frame = +1

Query  76   EARKQQYQANIQGLNAYDRHKKFLSDYVAYYGK--DRSTQEVLPVKTDQDTLREGYRFIR  249
            EARK+++  ++  ++AY+RHKK + DY+ YYG   +   +     KTD D +RE +RF+ 
Sbjct  59   EARKRRF--HLISMSAYERHKKLVHDYILYYGGKIEDFRRTGANDKTDLDVIRENHRFLW  116

Query  250  TEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQFICGN  429
             EED+ + +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEVISGKGQF CGN
Sbjct  117  NEEDEADMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRHEKEVISGKGQFSCGN  176

Query  430  KHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            KHC+E++GL S+EVNF YVE GE + ALVKL  C  C+
Sbjct  177  KHCDEQEGLKSWEVNFGYVEHGEKRNALVKLRLCPECS  214



>gb|AEB61310.1| FRA10AC1-like protein, partial [Equus caballus]
Length=314

 Score =   182 bits (461),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 120/172 (70%), Gaps = 5/172 (3%)
 Frame = +1

Query  37   TSFRSIRQVIYDR-EARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRST--QEVLPVK  207
             + + +   + DR EAR +++  ++  ++AY RH KF++DY+ YYG  R    +     K
Sbjct  46   VAHKQVAAELLDRVEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKREDFRRSGENDK  103

Query  208  TDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTE  387
            TD D +RE +RF+  EED+M+  WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR E
Sbjct  104  TDMDVIRENHRFLWNEEDEMDMDWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRVE  163

Query  388  KEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            KEVISGKGQF CGNK C++K+GL  +EVNF YVE GE + ALVKL  C+ C+
Sbjct  164  KEVISGKGQFFCGNKCCDKKEGLKGWEVNFGYVEHGEKRNALVKLRLCQECS  215



>ref|XP_534970.4| PREDICTED: protein FRA10AC1 isoform X6 [Canis lupus familiaris]
Length=314

 Score =   182 bits (461),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 122/174 (70%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  +     L   
Sbjct  45   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKEDFRRLGEN  102

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  103  DKTDMDVIRENHRFLWNEEDEMDMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWR  162

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK C++K+ L S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  163  VEKEVISGKGQFFCGNKCCDKKEDLKSWEVNFGYIEHGEKRNALVKLRLCKECS  216



>gb|ESA04681.1| hypothetical protein GLOINDRAFT_38978 [Rhizophagus irregularis 
DAOM 181602]
Length=243

 Score =   179 bits (455),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 106/240 (44%), Positives = 154/240 (64%), Gaps = 9/240 (4%)
 Frame = +1

Query  64   IYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRS---TQEVLPVKTDQDTLREG  234
            +   E  K+ ++ N+QGL+AY RHKKF+ DYV +YG++R    T   +  KT+ D L+E 
Sbjct  3    VVQSEHSKKIFRNNLQGLDAYARHKKFMKDYVNFYGRERGVGQTSTSIETKTEFDILKEN  62

Query  235  YRFIRTEEDDMNP-SWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKG  411
            ++F+RTE+++    SWEQR+ K+YYDKLFKEYCIA++ +YK G+I LRWR EKEVISGKG
Sbjct  63   HKFLRTEDEEEEELSWEQRVAKKYYDKLFKEYCIAELKYYKEGRIALRWRIEKEVISGKG  122

Query  412  QFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCAekllykkrkeeqlkek  591
            QF+C +  C+  + L S+EVNF Y+E GE K ALVK+  C +C++KL Y K+ +E   EK
Sbjct  123  QFVCASTRCSSTNELKSWEVNFAYMEDGEKKNALVKIRLCPKCSDKLNYNKQHQEIKTEK  182

Query  592  errkrerseSNdqeddehdrrrerKKGSKASASAEDRNKTDEDD-----ENFDEYLEGMF  756
            E  + E  + + +   +       KK   ++ S   R+ T   D     E+FDE+  G+F
Sbjct  183  ETYRDEDEDKHKKRKGKSFEESNSKKKKHSTDSIGTRSPTPIRDDQRAIEDFDEFFTGLF  242



>ref|XP_005637602.1| PREDICTED: protein FRA10AC1 isoform X1 [Canis lupus familiaris]
 ref|XP_005637603.1| PREDICTED: protein FRA10AC1 isoform X2 [Canis lupus familiaris]
 ref|XP_005637604.1| PREDICTED: protein FRA10AC1 isoform X3 [Canis lupus familiaris]
 ref|XP_005637605.1| PREDICTED: protein FRA10AC1 isoform X4 [Canis lupus familiaris]
 ref|XP_005637606.1| PREDICTED: protein FRA10AC1 isoform X5 [Canis lupus familiaris]
Length=313

 Score =   182 bits (461),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 122/174 (70%), Gaps = 4/174 (2%)
 Frame = +1

Query  28   GKMTSFRSIRQVIYDREARKQQYQANIQGLNAYDRHKKFLSDYVAYYGKDRSTQEVLPV-  204
            GK+   +   +++   EAR +++  ++  ++AY RH KF++DY+ YYG  +     L   
Sbjct  44   GKVAHKQVAAELLDREEARNRRF--HLIAMDAYQRHTKFVNDYILYYGGKKEDFRRLGEN  101

Query  205  -KTDQDTLREGYRFIRTEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWR  381
             KTD D +RE +RF+  EED+M+ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR
Sbjct  102  DKTDMDVIRENHRFLWNEEDEMDMNWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWR  161

Query  382  TEKEVISGKGQFICGNKHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
             EKEVISGKGQF CGNK C++K+ L S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  162  VEKEVISGKGQFFCGNKCCDKKEDLKSWEVNFGYIEHGEKRNALVKLRLCKECS  215



>ref|XP_003755310.1| PREDICTED: protein FRA10AC1 [Sarcophilus harrisii]
Length=420

 Score =   184 bits (468),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 118/158 (75%), Gaps = 4/158 (3%)
 Frame = +1

Query  76   EARKQQYQANIQGLNAYDRHKKFLSDYVAYYG--KDRSTQEVLPVKTDQDTLREGYRFIR  249
            EAR +++  ++  +NAY+RHKK ++DY+ YYG  K+   +     KTD D +RE +RF+ 
Sbjct  163  EARNRRF--HLIAMNAYERHKKLVNDYILYYGGKKEDFRRSGENDKTDLDVIRENHRFLW  220

Query  250  TEEDDMNPSWEQRLVKRYYDKLFKEYCIADMTHYKSGKIGLRWRTEKEVISGKGQFICGN  429
             EED+++ +WE+RL K+YYDKLFKEYCIAD++ YK  K G RWR EKEV+SGKGQF CGN
Sbjct  221  NEEDEIDMTWEKRLAKKYYDKLFKEYCIADLSRYKDNKFGFRWRVEKEVVSGKGQFFCGN  280

Query  430  KHCNEKDGLASYEVNFCYVEAGENKQALVKLVTCERCA  543
            K C+EK+GL S+EVNF Y+E GE + ALVKL  C+ C+
Sbjct  281  KRCDEKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECS  318



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2072554376814