BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1343_g1_i2 len=486 path=[2764:0-72 2351:73-485]

Length=486
                                                                      Score     E

ref|XP_002525297.1|  GTP-binding protein engB, putative                 128   1e-32   Ricinus communis
gb|KDP32097.1|  hypothetical protein JCGZ_12558                         128   1e-32   
ref|XP_006366789.1|  PREDICTED: GTP-binding protein At2g22870-lik...    127   4e-32   
ref|XP_004246586.1|  PREDICTED: GTP-binding protein At2g22870           127   4e-32   
ref|XP_009771305.1|  PREDICTED: GTP-binding protein At2g22870           126   8e-32   
ref|XP_011073677.1|  PREDICTED: GTP-binding protein At2g22870           124   5e-31   
ref|XP_007047585.1|  P-loop containing nucleoside triphosphate hy...    123   1e-30   
ref|XP_007047584.1|  P-loop containing nucleoside triphosphate hy...    123   1e-30   
ref|XP_009600205.1|  PREDICTED: GTP-binding protein At2g22870           123   1e-30   
ref|XP_004151697.1|  PREDICTED: GTP-binding protein At2g22870-like      119   2e-30   
gb|KHN10003.1|  GTP-binding protein                                     122   2e-30   
ref|XP_003541533.1|  PREDICTED: GTP-binding protein At2g22870-like      122   3e-30   
ref|XP_007159327.1|  hypothetical protein PHAVU_002G228800g             121   4e-30   
ref|XP_004173055.1|  PREDICTED: GTP-binding protein At2g22870-like      119   5e-30   
ref|XP_002310331.2|  hypothetical protein POPTR_0007s14800g             121   6e-30   Populus trichocarpa [western balsam poplar]
emb|CDP10981.1|  unnamed protein product                                120   7e-30   
ref|XP_011031314.1|  PREDICTED: GTP-binding protein At2g22870           121   7e-30   
ref|XP_003529327.1|  PREDICTED: GTP-binding protein At2g22870-like      120   8e-30   
ref|XP_006374788.1|  hypothetical protein POPTR_0014s00860g             119   1e-29   
ref|XP_008457738.1|  PREDICTED: GTP-binding protein At2g22870           120   2e-29   
ref|XP_008237568.1|  PREDICTED: GTP-binding protein At2g22870           119   2e-29   
ref|XP_004289361.1|  PREDICTED: GTP-binding protein At2g22870-like      119   4e-29   
gb|KDO78937.1|  hypothetical protein CISIN_1g027757mg                   117   4e-29   
ref|XP_006466467.1|  PREDICTED: GTP-binding protein At2g22870-like      119   5e-29   
ref|XP_006426092.1|  hypothetical protein CICLE_v10026170mg             118   6e-29   
ref|XP_010692167.1|  PREDICTED: GTP-binding protein At2g22870           118   7e-29   
ref|XP_010531310.1|  PREDICTED: GTP-binding protein At2g22870           118   7e-29   
ref|XP_006404753.1|  hypothetical protein EUTSA_v10000265mg             118   8e-29   
ref|XP_010047333.1|  PREDICTED: GTP-binding protein At2g22870           117   1e-28   
ref|XP_004505058.1|  PREDICTED: GTP-binding protein At2g22870-like      117   1e-28   
ref|XP_008790252.1|  PREDICTED: GTP-binding protein At2g22870           118   1e-28   
ref|XP_007205637.1|  hypothetical protein PRUPE_ppa009227mg             117   1e-28   
gb|KEH31065.1|  P-loop nucleoside triphosphate hydrolase superfam...    117   1e-28   
gb|KFK32785.1|  hypothetical protein AALP_AA6G288100                    117   2e-28   
ref|XP_006294685.1|  hypothetical protein CARUB_v10023722mg             117   2e-28   
ref|XP_002878640.1|  EMB2001                                            117   2e-28   
ref|XP_010647075.1|  PREDICTED: GTP-binding protein At2g22870-like      117   3e-28   
emb|CDX89524.1|  BnaC04g35430D                                          116   3e-28   
ref|XP_009140400.1|  PREDICTED: GTP-binding protein At2g22870           116   3e-28   
ref|XP_010936165.1|  PREDICTED: GTP-binding protein At2g22870           116   4e-28   
ref|XP_010245163.1|  PREDICTED: GTP-binding protein At2g22870 iso...    116   4e-28   
ref|NP_565543.1|  GTP-binding protein EMB2001                           115   5e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010417047.1|  PREDICTED: GTP-binding protein At2g22870-like      116   6e-28   
ref|XP_010472286.1|  PREDICTED: GTP-binding protein At2g22870           115   6e-28   
gb|EPS71550.1|  hypothetical protein M569_03211                         114   7e-28   
ref|XP_010429222.1|  PREDICTED: GTP-binding protein At2g22870-like      115   7e-28   
ref|XP_008353774.1|  PREDICTED: GTP-binding protein At2g22870-like      115   1e-27   
ref|XP_009336229.1|  PREDICTED: GTP-binding protein At2g22870           114   1e-27   
gb|EYU41373.1|  hypothetical protein MIMGU_mgv1a010732mg                114   2e-27   
ref|XP_009394289.1|  PREDICTED: GTP-binding protein At2g22870           112   2e-26   
ref|XP_002886010.1|  EMB2001                                            111   3e-26   
ref|XP_006857104.1|  hypothetical protein AMTR_s00065p00125910          110   4e-26   
ref|XP_002465613.1|  hypothetical protein SORBIDRAFT_01g042170          110   6e-26   Sorghum bicolor [broomcorn]
ref|XP_006649684.1|  PREDICTED: GTP-binding protein At2g22870-like      110   6e-26   
ref|NP_001151819.1|  GTP-binding protein                                110   1e-25   Zea mays [maize]
ref|XP_003558441.1|  PREDICTED: GTP-binding protein At2g22870           109   2e-25   
ref|XP_004985126.1|  PREDICTED: GTP-binding protein At2g22870-like      108   2e-25   
ref|NP_001049468.1|  Os03g0232500                                       109   2e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008367956.1|  PREDICTED: LOW QUALITY PROTEIN: GTP-binding ...    108   2e-25   
gb|EEC74817.1|  hypothetical protein OsI_10639                          109   2e-25   Oryza sativa Indica Group [Indian rice]
gb|AAM19136.1|AC103891_16  Putative nucleotide binding protein          108   3e-25   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ90001.1|  predicted protein                                      103   2e-23   
gb|EMT16575.1|  GTP-binding protein                                     102   7e-23   
gb|ABK21971.1|  unknown                                                 100   3e-22   Picea sitchensis
ref|XP_010106913.1|  hypothetical protein L484_013007                 89.0    6e-20   
ref|XP_002308620.2|  hypothetical protein POPTR_0006s25980g           92.4    2e-19   Populus trichocarpa [western balsam poplar]
ref|XP_010249730.1|  PREDICTED: GTP-binding protein At2g22870         91.7    4e-19   
gb|ADE76113.1|  unknown                                               90.9    8e-19   
ref|XP_011013238.1|  PREDICTED: GTP-binding protein At2g22870-like    89.7    2e-18   
ref|XP_011019668.1|  PREDICTED: GTP-binding protein At2g22870         89.7    2e-18   
ref|XP_008810030.1|  PREDICTED: GTP-binding protein At2g22870         88.6    4e-18   
ref|XP_006833289.1|  hypothetical protein AMTR_s00109p00030450        87.4    1e-17   
ref|XP_004292863.1|  PREDICTED: GTP-binding protein At2g22870-like    86.3    3e-17   
ref|XP_007227713.1|  hypothetical protein PRUPE_ppa009961mg           85.9    3e-17   
ref|XP_004163505.1|  PREDICTED: LOW QUALITY PROTEIN: GTP-binding ...  85.9    4e-17   
ref|XP_008357419.1|  PREDICTED: GTP-binding protein At2g22870-like    85.9    4e-17   
ref|XP_009338720.1|  PREDICTED: GTP-binding protein At2g22870-like    85.9    5e-17   
ref|XP_008378219.1|  PREDICTED: GTP-binding protein At2g22870-like    85.9    5e-17   
ref|XP_008220023.1|  PREDICTED: LOW QUALITY PROTEIN: GTP-binding ...  85.5    5e-17   
ref|XP_007137167.1|  hypothetical protein PHAVU_009G105600g           85.1    7e-17   
ref|XP_009367924.1|  PREDICTED: LOW QUALITY PROTEIN: GTP-binding ...  84.3    1e-16   
emb|CDP16152.1|  unnamed protein product                              84.3    2e-16   
ref|XP_002516578.1|  GTP-binding protein engB, putative               84.0    2e-16   Ricinus communis
ref|XP_010112169.1|  GTP-binding protein                              83.2    3e-16   
gb|KCW72973.1|  hypothetical protein EUGRSUZ_E01422                   82.8    6e-16   
ref|XP_003522687.1|  PREDICTED: GTP-binding protein At2g22870-lik...  82.0    7e-16   
ref|XP_010056308.1|  PREDICTED: GTP-binding protein At2g22870         82.4    8e-16   
gb|KHN10234.1|  GTP-binding protein                                   82.0    8e-16   
ref|XP_010519913.1|  PREDICTED: GTP-binding protein At2g22870         81.6    1e-15   
ref|XP_002324249.1|  hypothetical protein POPTR_0018s00820g           81.3    2e-15   Populus trichocarpa [western balsam poplar]
ref|XP_009785703.1|  PREDICTED: GTP-binding protein At2g22870         81.3    2e-15   
ref|XP_011026575.1|  PREDICTED: GTP-binding protein At2g22870-like    81.3    2e-15   
ref|XP_007012043.1|  P-loop containing nucleoside triphosphate hy...  81.3    2e-15   
ref|XP_009410873.1|  PREDICTED: GTP-binding protein At2g22870         81.3    2e-15   
ref|XP_009131207.1|  PREDICTED: GTP-binding protein At2g22870-like    80.9    2e-15   
ref|XP_011081830.1|  PREDICTED: GTP-binding protein At2g22870         80.9    2e-15   
emb|CDX70395.1|  BnaC03g04790D                                        80.9    2e-15   
emb|CDX97114.1|  BnaC09g45110D                                        80.9    2e-15   
ref|XP_006288237.1|  hypothetical protein CARUB_v10001479mg           80.9    3e-15   
ref|XP_002873516.1|  GTP binding protein                              80.9    3e-15   
gb|EYU21879.1|  hypothetical protein MIMGU_mgv1a009994mg              80.9    3e-15   
ref|XP_006581419.1|  PREDICTED: GTP-binding protein At2g22870-lik...  80.5    3e-15   
emb|CDX69752.1|  BnaA10g21010D                                        80.9    3e-15   
ref|XP_009121941.1|  PREDICTED: GTP-binding protein At2g22870-like    80.9    3e-15   
ref|XP_006399654.1|  hypothetical protein EUTSA_v10014135mg           80.5    3e-15   
ref|XP_010667803.1|  PREDICTED: GTP-binding protein At2g22870         80.9    3e-15   
gb|KFK25410.1|  hypothetical protein AALP_AA8G111200                  80.5    3e-15   
ref|XP_010419720.1|  PREDICTED: GTP-binding protein At2g22870-like    80.5    3e-15   
ref|XP_010491882.1|  PREDICTED: GTP-binding protein At2g22870-like    80.5    3e-15   
ref|XP_010453192.1|  PREDICTED: GTP-binding protein At2g22870-like    80.5    4e-15   
ref|XP_006644662.1|  PREDICTED: GTP-binding protein At2g22870-like    80.1    4e-15   
ref|NP_001044154.1|  Os01g0732200                                     80.1    5e-15   Oryza sativa Japonica Group [Japonica rice]
gb|KHG18361.1|  GTP-binding -like protein                             79.7    5e-15   
ref|XP_002456299.1|  hypothetical protein SORBIDRAFT_03g033710        79.7    6e-15   Sorghum bicolor [broomcorn]
ref|XP_006450618.1|  hypothetical protein CICLE_v10009000mg           79.7    6e-15   
ref|XP_004501191.1|  PREDICTED: GTP-binding protein At2g22870-like    79.3    7e-15   
gb|KDP34218.1|  hypothetical protein JCGZ_07789                       79.7    7e-15   
ref|XP_004969851.1|  PREDICTED: GTP-binding protein At2g22870-like    79.7    7e-15   
ref|XP_003603604.1|  Ribosome biogenesis GTP-binding protein YsxC     79.3    8e-15   
ref|XP_009604483.1|  PREDICTED: GTP-binding protein At2g22870         79.3    8e-15   
gb|EEC71435.1|  hypothetical protein OsI_03633                        79.7    8e-15   Oryza sativa Indica Group [Indian rice]
gb|AAM64748.1|  putative GTP-binding protein                          78.6    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008672318.1|  PREDICTED: uncharacterized protein LOC100272...  78.6    2e-14   
ref|NP_196709.1|  P-loop containing nucleoside triphosphate hydro...  78.6    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008466251.1|  PREDICTED: GTP-binding protein At2g22870         78.6    2e-14   
ref|XP_003569733.1|  PREDICTED: GTP-binding protein At2g22870         78.6    2e-14   
ref|XP_006356644.1|  PREDICTED: GTP-binding protein At2g22870-like    78.2    2e-14   
ref|XP_004245257.1|  PREDICTED: GTP-binding protein At2g22870         78.2    3e-14   
ref|XP_002284246.1|  PREDICTED: GTP-binding protein At2g22870         77.8    3e-14   Vitis vinifera
ref|NP_001140242.1|  uncharacterized protein LOC100272283             78.2    3e-14   Zea mays [maize]
ref|XP_004136299.1|  PREDICTED: GTP-binding protein At2g22870-like    76.3    1e-13   
ref|XP_008337082.1|  PREDICTED: LOW QUALITY PROTEIN: GTP-binding ...  76.3    2e-13   
ref|XP_001776319.1|  predicted protein                                69.7    9e-12   
ref|XP_001759525.1|  predicted protein                                68.2    4e-11   
gb|EPS69928.1|  hypothetical protein M569_04833                       67.4    7e-11   
ref|XP_007026131.1|  Uncharacterized protein TCM_030265               57.8    2e-08   
ref|WP_022218785.1|  probable GTP-binding protein EngB                59.7    3e-08   
ref|WP_005653804.1|  MULTISPECIES: GTP-binding protein YsxC           58.9    6e-08   
ref|XP_005851375.1|  hypothetical protein CHLNCDRAFT_17068            58.9    6e-08   
ref|WP_016662884.1|  ribosome biogenesis GTP-binding protein YsxC     58.5    6e-08   
ref|WP_025069088.1|  GTP-binding protein                              57.4    2e-07   
ref|XP_003063845.1|  hypothetical protein MICPUCDRAFT_53567           59.3    2e-07   
ref|WP_031532645.1|  MULTISPECIES: GTP-binding protein                57.0    2e-07   
ref|WP_009121121.1|  GTP-binding protein YsxC                         57.0    2e-07   
ref|WP_004290834.1|  MULTISPECIES: GTP-binding protein YsxC           56.6    4e-07   
ref|XP_001422673.1|  predicted protein                                56.6    6e-07   Ostreococcus lucimarinus CCE9901
ref|XP_002505802.1|  predicted protein                                57.8    6e-07   Micromonas commoda
ref|XP_002978916.1|  hypothetical protein SELMODRAFT_110012           55.1    2e-06   
ref|XP_002991476.1|  hypothetical protein SELMODRAFT_133692           55.1    2e-06   
ref|WP_013548092.1|  GTP-binding protein YsxC                         53.5    5e-06   
ref|WP_004331577.1|  GTP-binding protein YsxC                         52.8    9e-06   
ref|XP_001697009.1|  hypothetical protein CHLREDRAFT_150723           53.1    1e-05   Chlamydomonas reinhardtii
ref|XP_001420069.1|  predicted protein                                52.4    1e-05   Ostreococcus lucimarinus CCE9901
ref|WP_007366088.1|  GTP-binding protein YsxC                         52.0    2e-05   
ref|WP_022339433.1|  probable GTP-binding protein EngB                51.6    2e-05   
gb|KGE86069.1|  GTP-binding protein                                   51.6    2e-05   
ref|WP_018709904.1|  GTP-binding protein YsxC                         51.6    3e-05   
ref|WP_022102609.1|  ribosome biogenesis GTP-binding protein YsxC     51.2    3e-05   
ref|WP_035123358.1|  GTP-binding protein                              51.2    3e-05   
ref|WP_021896428.1|  probable GTP-binding protein EngB                50.8    4e-05   
ref|WP_007133515.1|  GTP-binding protein YsxC                         50.8    4e-05   
ref|WP_021825503.1|  ribosome biogenesis GTP-binding protein YsxC     50.8    4e-05   
gb|ETZ20570.1|  GTP-binding protein YsxC                              50.8    5e-05   
ref|WP_008242992.1|  GTP-binding protein YsxC                         50.8    5e-05   
ref|WP_009036961.1|  GTP-binding protein YsxC                         50.8    5e-05   
gb|KDS50923.1|  ribosome biogenesis GTP-binding protein YsxC          50.4    5e-05   
ref|WP_005836522.1|  MULTISPECIES: GTP-binding protein YsxC           50.8    5e-05   
ref|WP_025835928.1|  GTP-binding protein                              50.8    5e-05   
ref|WP_022354146.1|  probable GTP-binding protein EngB                50.4    6e-05   
gb|EFV26692.1|  ribosome biogenesis GTP-binding protein YsxC          50.8    6e-05   
ref|WP_025882748.1|  GTP-binding protein                              50.4    7e-05   
ref|WP_027884343.1|  GTP-binding protein                              50.1    8e-05   
ref|WP_005777046.1|  MULTISPECIES: GTP-binding protein YsxC           50.1    8e-05   
ref|WP_008256349.1|  GTP-binding protein YsxC                         50.1    8e-05   
ref|WP_026724228.1|  GTP-binding protein                              50.1    8e-05   
ref|WP_004374149.1|  GTP-binding protein YsxC                         50.1    9e-05   
ref|XP_003064849.1|  predicted protein                                49.7    1e-04   
ref|WP_006744270.1|  GTP-binding protein YsxC                         49.7    1e-04   
ref|WP_004348314.1|  GTP-binding protein YsxC                         49.7    1e-04   
ref|WP_005787263.1|  GTP-binding protein YsxC                         49.3    1e-04   
ref|XP_003082903.1|  putative endonuclease (ISS)                      50.8    1e-04   
ref|WP_022039417.1|  probable GTP-binding protein EngB                49.3    1e-04   
ref|WP_005794469.1|  MULTISPECIES: GTP-binding protein YsxC           49.3    2e-04   
ref|WP_026718289.1|  GTP-binding protein                              49.3    2e-04   
ref|WP_032529464.1|  GTP-binding protein                              49.3    2e-04   
ref|XP_002953493.1|  hypothetical protein VOLCADRAFT_82197            50.1    2e-04   
ref|WP_010992848.1|  GTP-binding protein YsxC                         49.3    2e-04   
ref|WP_016562916.1|  probable GTP-binding protein EngB                49.3    2e-04   
ref|WP_032561286.1|  GTP-binding protein                              49.3    2e-04   
ref|WP_036879125.1|  MULTISPECIES: GTP-binding protein                48.9    2e-04   
gb|ERT56575.1|  ribosome biogenesis GTP-binding protein YsxC          48.9    2e-04   
ref|WP_025835978.1|  GTP-binding protein                              48.9    2e-04   
emb|CEG02022.1|  GTP-binding protein, ribosome biogenesis, YsxC       49.7    2e-04   
ref|XP_002958090.1|  hypothetical protein VOLCADRAFT_69046            48.9    3e-04   
ref|WP_026955150.1|  GTP-binding protein                              48.9    3e-04   
ref|WP_009346821.1|  GTP-binding protein YsxC                         48.5    3e-04   
ref|XP_007510135.1|  ribosome biogenesis GTP-binding protein YsxC     49.3    3e-04   
ref|WP_007663115.1|  MULTISPECIES: GTP-binding protein YsxC           48.5    3e-04   
ref|WP_006254991.1|  GTP-binding protein YsxC                         48.5    4e-04   
ref|WP_007570498.1|  GTP-binding protein YsxC                         48.5    4e-04   
ref|WP_022125826.1|  probable GTP-binding protein EngB                48.1    4e-04   
ref|WP_022507673.1|  ribosome biogenesis GTP-binding protein YsxC     48.1    4e-04   
ref|WP_005937659.1|  ribosome biogenesis GTP-binding protein YsxC     48.1    4e-04   
ref|XP_002504352.1|  predicted protein                                48.1    4e-04   Micromonas commoda
ref|WP_021971469.1|  probable GTP-binding protein EngB                48.1    4e-04   
ref|WP_022510945.1|  ribosome biogenesis GTP-binding protein YsxC     48.1    4e-04   
ref|WP_026711958.1|  GTP-binding protein                              48.1    5e-04   
ref|WP_007213813.1|  MULTISPECIES: GTP-binding protein YsxC           48.1    5e-04   
ref|WP_022231839.1|  probable GTP-binding protein EngB                48.1    5e-04   
ref|WP_028898033.1|  GTP-binding protein                              47.8    6e-04   
ref|WP_018357451.1|  hypothetical protein                             47.8    6e-04   
ref|WP_027393110.1|  GTP-binding protein                              47.8    6e-04   
ref|WP_036877480.1|  GTP-binding protein                              47.8    6e-04   
ref|WP_026704032.1|  GTP-binding protein                              47.8    7e-04   
ref|WP_007218064.1|  GTP-binding protein YsxC                         47.4    7e-04   
ref|WP_005467636.1|  ribosome biogenesis GTP-binding protein YsxC     47.4    7e-04   
ref|WP_021990637.1|  probable GTP-binding protein EngB                47.4    7e-04   
ref|WP_008566621.1|  GTP-binding protein YsxC                         47.4    8e-04   
gb|KGN82246.1|  GTP-binding protein                                   47.4    9e-04   
ref|WP_019969043.1|  GTP-binding protein YsxC                         47.4    9e-04   
gb|KGO00761.1|  GTP-binding protein                                   47.4    0.001   
ref|WP_026991326.1|  GTP-binding protein                              47.4    0.001   
ref|WP_025866419.1|  GTP-binding protein                              47.4    0.001   
ref|WP_022161745.1|  probable GTP-binding protein EngB                47.0    0.001   
ref|WP_025074227.1|  GTP-binding protein                              47.0    0.001   
dbj|GAL83016.1|  GTP-binding protein EngB                             47.4    0.001   



>ref|XP_002525297.1| GTP-binding protein engB, putative [Ricinus communis]
 gb|EEF37125.1| GTP-binding protein engB, putative [Ricinus communis]
Length=296

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 63/68 (93%), Gaps = 1/68 (1%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGK-TKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            IP+TFVFTKCDKMKGGK T+PDENIR FQELIRQNY+  PPWI+TSSVTGLGRD LLLHM
Sbjct  228  IPLTFVFTKCDKMKGGKSTRPDENIRNFQELIRQNYQEHPPWIMTSSVTGLGRDELLLHM  287

Query  251  SQLRNYWD  274
            SQLRNYWD
Sbjct  288  SQLRNYWD  295



>gb|KDP32097.1| hypothetical protein JCGZ_12558 [Jatropha curcas]
Length=302

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 63/69 (91%), Gaps = 1/69 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGK-TKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
             IP+TFVFTKCDKMKGGK T+PDENIR FQELIRQNY+  PPWI+TSSVTGLGRD LLLH
Sbjct  233  NIPLTFVFTKCDKMKGGKGTRPDENIRNFQELIRQNYREHPPWIMTSSVTGLGRDELLLH  292

Query  248  MSQLRNYWD  274
            MSQLRNYWD
Sbjct  293  MSQLRNYWD  301



>ref|XP_006366789.1| PREDICTED: GTP-binding protein At2g22870-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006366790.1| PREDICTED: GTP-binding protein At2g22870-like isoform X2 [Solanum 
tuberosum]
Length=297

 Score =   127 bits (318),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 66/71 (93%), Gaps = 1/71 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
            +IP+TFVFTKCDKMKGGK K PD+NIR+FQELIRQNY H PPWI+TSSV+GLGRD LLLH
Sbjct  227  KIPITFVFTKCDKMKGGKAKRPDQNIRDFQELIRQNYNHQPPWIMTSSVSGLGRDELLLH  286

Query  248  MSQLRNYWDSD  280
            MSQLRNYW+++
Sbjct  287  MSQLRNYWNNE  297



>ref|XP_004246586.1| PREDICTED: GTP-binding protein At2g22870 [Solanum lycopersicum]
 ref|XP_010325946.1| PREDICTED: GTP-binding protein At2g22870 [Solanum lycopersicum]
 ref|XP_010325947.1| PREDICTED: GTP-binding protein At2g22870 [Solanum lycopersicum]
Length=297

 Score =   127 bits (318),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 66/71 (93%), Gaps = 1/71 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
            +IP+TFVFTKCDKMKGGK K PD+NIR+FQELIRQNY H PPWI+TSSV+GLGRD LLLH
Sbjct  227  KIPITFVFTKCDKMKGGKAKRPDQNIRDFQELIRQNYNHQPPWIMTSSVSGLGRDELLLH  286

Query  248  MSQLRNYWDSD  280
            MSQLRNYW+++
Sbjct  287  MSQLRNYWNNE  297



>ref|XP_009771305.1| PREDICTED: GTP-binding protein At2g22870 [Nicotiana sylvestris]
 ref|XP_009771306.1| PREDICTED: GTP-binding protein At2g22870 [Nicotiana sylvestris]
Length=307

 Score =   126 bits (316),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 66/71 (93%), Gaps = 1/71 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
            +IP+TFVFTKCDKMKGGK K PDENIR+FQELIRQNY+H P WI+TSSV+GLGRD LLLH
Sbjct  237  KIPITFVFTKCDKMKGGKAKRPDENIRDFQELIRQNYQHPPAWIMTSSVSGLGRDELLLH  296

Query  248  MSQLRNYWDSD  280
            MSQLRNYW+++
Sbjct  297  MSQLRNYWNNE  307



>ref|XP_011073677.1| PREDICTED: GTP-binding protein At2g22870 [Sesamum indicum]
Length=301

 Score =   124 bits (311),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 65/70 (93%), Gaps = 1/70 (1%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGK-TKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            IPMTFVFTKCDKMKGGK  +PD+NI++FQELIR+NY+  PPWI+TSSVTGLGRD LLLHM
Sbjct  232  IPMTFVFTKCDKMKGGKGRRPDQNIQDFQELIRENYRQHPPWIMTSSVTGLGRDELLLHM  291

Query  251  SQLRNYWDSD  280
            SQLRNYWD++
Sbjct  292  SQLRNYWDNE  301



>ref|XP_007047585.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOX91742.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 2 [Theobroma cacao]
Length=305

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 61/68 (90%), Gaps = 1/68 (1%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            IPMTFVFTKCDKMK  K K PDENIR+FQELIR+NY+  PPWI+TSSVTGLGRD LLLHM
Sbjct  237  IPMTFVFTKCDKMKASKGKRPDENIRDFQELIRENYRQHPPWIMTSSVTGLGRDELLLHM  296

Query  251  SQLRNYWD  274
            SQLRNYWD
Sbjct  297  SQLRNYWD  304



>ref|XP_007047584.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOX91741.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
Length=304

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 61/68 (90%), Gaps = 1/68 (1%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            IPMTFVFTKCDKMK  K K PDENIR+FQELIR+NY+  PPWI+TSSVTGLGRD LLLHM
Sbjct  236  IPMTFVFTKCDKMKASKGKRPDENIRDFQELIRENYRQHPPWIMTSSVTGLGRDELLLHM  295

Query  251  SQLRNYWD  274
            SQLRNYWD
Sbjct  296  SQLRNYWD  303



>ref|XP_009600205.1| PREDICTED: GTP-binding protein At2g22870 [Nicotiana tomentosiformis]
 ref|XP_009600206.1| PREDICTED: GTP-binding protein At2g22870 [Nicotiana tomentosiformis]
 ref|XP_009600207.1| PREDICTED: GTP-binding protein At2g22870 [Nicotiana tomentosiformis]
Length=307

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 65/71 (92%), Gaps = 1/71 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
            +IP+TFVFTKCDKMKGGK K PDENIR+FQELIRQNY+H   WI+TSSV+GLGRD LLLH
Sbjct  237  KIPITFVFTKCDKMKGGKAKRPDENIRDFQELIRQNYQHPSAWIMTSSVSGLGRDELLLH  296

Query  248  MSQLRNYWDSD  280
            MSQLRNYW+++
Sbjct  297  MSQLRNYWNNE  307



>ref|XP_004151697.1| PREDICTED: GTP-binding protein At2g22870-like, partial [Cucumis 
sativus]
Length=154

 Score =   119 bits (298),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            IPMTFVFTKCDKMK  K K PDENIREFQ+LIRQNYK  P WI+TSSVTGLGRD LLLHM
Sbjct  86   IPMTFVFTKCDKMKVSKGKRPDENIREFQQLIRQNYKVHPSWIMTSSVTGLGRDELLLHM  145

Query  251  SQLRNYWD  274
            SQLRNYWD
Sbjct  146  SQLRNYWD  153



>gb|KHN10003.1| GTP-binding protein [Glycine soja]
Length=305

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 61/68 (90%), Gaps = 1/68 (1%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            IP+TFVFTKCDKMK  K K PDENIR+FQELIRQNYK  PPWI+TSSVTG+GRD LLLHM
Sbjct  237  IPITFVFTKCDKMKVAKGKRPDENIRDFQELIRQNYKQHPPWIMTSSVTGMGRDELLLHM  296

Query  251  SQLRNYWD  274
            SQLRNYWD
Sbjct  297  SQLRNYWD  304



>ref|XP_003541533.1| PREDICTED: GTP-binding protein At2g22870-like [Glycine max]
Length=305

 Score =   122 bits (306),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 61/68 (90%), Gaps = 1/68 (1%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            IP+TFVFTKCDKMK  K K PDENIR+FQELIRQNYK  PPWI+TSSVTG+GRD LLLHM
Sbjct  237  IPITFVFTKCDKMKVAKGKRPDENIRDFQELIRQNYKQHPPWIMTSSVTGMGRDELLLHM  296

Query  251  SQLRNYWD  274
            SQLRNYWD
Sbjct  297  SQLRNYWD  304



>ref|XP_007159327.1| hypothetical protein PHAVU_002G228800g [Phaseolus vulgaris]
 gb|ESW31321.1| hypothetical protein PHAVU_002G228800g [Phaseolus vulgaris]
Length=289

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 61/69 (88%), Gaps = 1/69 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
             IP+TFVFTKCDKMK  K K PDENIR+FQELI+QNYK  PPWI+TSSVTGLGRD LLLH
Sbjct  220  NIPITFVFTKCDKMKVAKGKRPDENIRDFQELIKQNYKQHPPWIMTSSVTGLGRDELLLH  279

Query  248  MSQLRNYWD  274
            MSQLRNYWD
Sbjct  280  MSQLRNYWD  288



>ref|XP_004173055.1| PREDICTED: GTP-binding protein At2g22870-like [Cucumis sativus]
Length=219

 Score =   119 bits (299),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            IPMTFVFTKCDKMK  K K PDENIREFQ+LIRQNYK  P WI+TSSVTGLGRD LLLHM
Sbjct  151  IPMTFVFTKCDKMKVSKGKRPDENIREFQQLIRQNYKVHPSWIMTSSVTGLGRDELLLHM  210

Query  251  SQLRNYWD  274
            SQLRNYWD
Sbjct  211  SQLRNYWD  218



>ref|XP_002310331.2| hypothetical protein POPTR_0007s14800g [Populus trichocarpa]
 gb|EEE90781.2| hypothetical protein POPTR_0007s14800g [Populus trichocarpa]
Length=302

 Score =   121 bits (303),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 61/69 (88%), Gaps = 1/69 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGK-TKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
             IPMT VFTKCDKMKGGK T+PDENI+ FQEL+RQNY+  P WI+TSSVTGLGRD LLLH
Sbjct  233  NIPMTLVFTKCDKMKGGKRTRPDENIKNFQELMRQNYREHPAWIMTSSVTGLGRDELLLH  292

Query  248  MSQLRNYWD  274
            MSQLRNYWD
Sbjct  293  MSQLRNYWD  301



>emb|CDP10981.1| unnamed protein product [Coffea canephora]
Length=272

 Score =   120 bits (301),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 63/71 (89%), Gaps = 1/71 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
             IPMT VFTKCDKMKGGK K PDENIR FQ+LIR+NYK  PPWI+TSS+TGLGRD LLLH
Sbjct  202  NIPMTLVFTKCDKMKGGKAKRPDENIRNFQQLIRENYKRHPPWIMTSSMTGLGRDELLLH  261

Query  248  MSQLRNYWDSD  280
            +SQLRNYW+++
Sbjct  262  LSQLRNYWNNE  272



>ref|XP_011031314.1| PREDICTED: GTP-binding protein At2g22870 [Populus euphratica]
Length=322

 Score =   121 bits (304),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 61/69 (88%), Gaps = 1/69 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGK-TKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
             IPMT VFTKCDKMKGGK T+PDENI+ FQEL+RQNY+  P WI+TSSVTGLGRD LLLH
Sbjct  253  NIPMTLVFTKCDKMKGGKRTRPDENIKNFQELMRQNYREHPAWIMTSSVTGLGRDELLLH  312

Query  248  MSQLRNYWD  274
            MSQLRNYWD
Sbjct  313  MSQLRNYWD  321



>ref|XP_003529327.1| PREDICTED: GTP-binding protein At2g22870-like [Glycine max]
 gb|KHN07256.1| GTP-binding protein [Glycine soja]
Length=301

 Score =   120 bits (302),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            IP+TFVFTKCDKMK  K K PDENIR+FQELIRQNYK  PPWI+TSS TG+GRD LLLHM
Sbjct  233  IPITFVFTKCDKMKVAKGKRPDENIRDFQELIRQNYKQHPPWIMTSSATGMGRDELLLHM  292

Query  251  SQLRNYWD  274
            SQLRNYWD
Sbjct  293  SQLRNYWD  300



>ref|XP_006374788.1| hypothetical protein POPTR_0014s00860g [Populus trichocarpa]
 gb|ERP52585.1| hypothetical protein POPTR_0014s00860g [Populus trichocarpa]
Length=257

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 59/68 (87%), Gaps = 1/68 (1%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGK-TKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            IPMTFVFTKCDKMKGGK  +PDENIR FQELIRQNY+  P WI+TS V GLGRD LLLHM
Sbjct  189  IPMTFVFTKCDKMKGGKGIRPDENIRNFQELIRQNYQQHPAWIMTSIVIGLGRDELLLHM  248

Query  251  SQLRNYWD  274
            SQLRNYWD
Sbjct  249  SQLRNYWD  256



>ref|XP_008457738.1| PREDICTED: GTP-binding protein At2g22870 [Cucumis melo]
Length=293

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 60/69 (87%), Gaps = 1/69 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
             IPMTFVFTKCDKMK  K K PDENIREFQ+LIRQNYK  P WI+TSSVTGLGRD LLLH
Sbjct  224  NIPMTFVFTKCDKMKVSKGKRPDENIREFQQLIRQNYKVHPSWIMTSSVTGLGRDELLLH  283

Query  248  MSQLRNYWD  274
            MSQLRNYWD
Sbjct  284  MSQLRNYWD  292



>ref|XP_008237568.1| PREDICTED: GTP-binding protein At2g22870 [Prunus mume]
Length=301

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 60/69 (87%), Gaps = 1/69 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
             IPMTFVFTKCDKMK GK K PDEN+R+FQ+ IR+NY+  PPWI+TSSVTG GRD LLLH
Sbjct  232  NIPMTFVFTKCDKMKAGKGKRPDENLRDFQQFIRENYRVQPPWIMTSSVTGFGRDELLLH  291

Query  248  MSQLRNYWD  274
            MSQLRNYWD
Sbjct  292  MSQLRNYWD  300



>ref|XP_004289361.1| PREDICTED: GTP-binding protein At2g22870-like [Fragaria vesca 
subsp. vesca]
Length=293

 Score =   119 bits (297),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 61/69 (88%), Gaps = 1/69 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
             IP+TFVFTKCDKMKGGK K PDEN+R+F++ I +NYK  PPWI+TSSVTGLGRD LLLH
Sbjct  224  NIPVTFVFTKCDKMKGGKGKRPDENLRDFKQFIAENYKQHPPWIMTSSVTGLGRDELLLH  283

Query  248  MSQLRNYWD  274
            MSQLRNYWD
Sbjct  284  MSQLRNYWD  292



>gb|KDO78937.1| hypothetical protein CISIN_1g027757mg [Citrus sinensis]
Length=219

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGK-TKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            IP+TFVFTKCDKMK  K  +PDENI+ FQ+LIR+NY H PPWI+TSSVTGLGRD LLLHM
Sbjct  151  IPLTFVFTKCDKMKVAKGRRPDENIKSFQQLIRENYPHHPPWIMTSSVTGLGRDELLLHM  210

Query  251  SQLRNYWD  274
            SQLRNYWD
Sbjct  211  SQLRNYWD  218



>ref|XP_006466467.1| PREDICTED: GTP-binding protein At2g22870-like [Citrus sinensis]
Length=300

 Score =   119 bits (297),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGK-TKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            IP+TFVFTKCDKMK  K  +PDENI+ FQ+LIR+NY H PPWI+TSSVTGLGRD LLLHM
Sbjct  232  IPLTFVFTKCDKMKVAKGRRPDENIKSFQQLIRENYPHHPPWIMTSSVTGLGRDELLLHM  291

Query  251  SQLRNYWD  274
            SQLRNYWD
Sbjct  292  SQLRNYWD  299



>ref|XP_006426092.1| hypothetical protein CICLE_v10026170mg [Citrus clementina]
 gb|ESR39332.1| hypothetical protein CICLE_v10026170mg [Citrus clementina]
Length=300

 Score =   118 bits (296),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGK-TKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            IP+TFVFTKCDKMK  K  +PDENI+ FQ+LIR+NY H PPWI+TSSVTGLGRD LLLHM
Sbjct  232  IPLTFVFTKCDKMKVAKGRRPDENIKSFQQLIRENYPHHPPWIMTSSVTGLGRDELLLHM  291

Query  251  SQLRNYWD  274
            SQLRNYWD
Sbjct  292  SQLRNYWD  299



>ref|XP_010692167.1| PREDICTED: GTP-binding protein At2g22870 [Beta vulgaris subsp. 
vulgaris]
Length=303

 Score =   118 bits (296),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 1/68 (1%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGK-TKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            IP+TFVFTKCDKMKGGK  +P+ENIR FQ LIR NYK  PPWI+TSSVT LGRD LLLHM
Sbjct  235  IPITFVFTKCDKMKGGKGARPEENIRSFQGLIRDNYKQHPPWIMTSSVTNLGRDELLLHM  294

Query  251  SQLRNYWD  274
            SQLRNYWD
Sbjct  295  SQLRNYWD  302



>ref|XP_010531310.1| PREDICTED: GTP-binding protein At2g22870 [Tarenaya hassleriana]
 ref|XP_010531311.1| PREDICTED: GTP-binding protein At2g22870 [Tarenaya hassleriana]
Length=295

 Score =   118 bits (295),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
             IPMTFVFTKCDKMK GK +PDENI+ FQ++IR+NY   PPWILTSSV+GLGRD LLLHM
Sbjct  228  NIPMTFVFTKCDKMKKGK-RPDENIKTFQQIIRENYPRHPPWILTSSVSGLGRDELLLHM  286

Query  251  SQLRNYWD  274
            SQLRNYWD
Sbjct  287  SQLRNYWD  294



>ref|XP_006404753.1| hypothetical protein EUTSA_v10000265mg [Eutrema salsugineum]
 gb|ESQ46206.1| hypothetical protein EUTSA_v10000265mg [Eutrema salsugineum]
Length=303

 Score =   118 bits (295),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            +PMTFVFTKCDKMK  K K PDENI+ FQ++IR+N+K  PPWILTSSV+GLGRD LLLHM
Sbjct  235  VPMTFVFTKCDKMKAAKGKRPDENIKAFQQIIRENFKQHPPWILTSSVSGLGRDELLLHM  294

Query  251  SQLRNYWD  274
            SQLRNYWD
Sbjct  295  SQLRNYWD  302



>ref|XP_010047333.1| PREDICTED: GTP-binding protein At2g22870 [Eucalyptus grandis]
 gb|KCW79220.1| hypothetical protein EUGRSUZ_C00645 [Eucalyptus grandis]
Length=305

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 61/68 (90%), Gaps = 1/68 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            +IP+T VFTKCDKMK GK +PDENIR FQE+IR+NY+  PPWI+TSSVTGLGRD LLLHM
Sbjct  238  KIPLTLVFTKCDKMKRGK-RPDENIRSFQEVIRENYRAHPPWIMTSSVTGLGRDELLLHM  296

Query  251  SQLRNYWD  274
            SQLRNYWD
Sbjct  297  SQLRNYWD  304



>ref|XP_004505058.1| PREDICTED: GTP-binding protein At2g22870-like [Cicer arietinum]
Length=293

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 61/68 (90%), Gaps = 1/68 (1%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            IP+TFVFTKCDKMK  K K PDENI++FQE+I+QNYK  PPWI+TSSVTGLGRD LLLH+
Sbjct  225  IPITFVFTKCDKMKVAKGKIPDENIKDFQEIIKQNYKQHPPWIMTSSVTGLGRDELLLHV  284

Query  251  SQLRNYWD  274
            SQLRNYWD
Sbjct  285  SQLRNYWD  292



>ref|XP_008790252.1| PREDICTED: GTP-binding protein At2g22870 [Phoenix dactylifera]
Length=320

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 63/70 (90%), Gaps = 1/70 (1%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGK-TKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            I MTFVFTKCDKMKGGK T+P+ENI++FQ+LI + YK  PPWI+TSSVTGLGRD LLLHM
Sbjct  248  IGMTFVFTKCDKMKGGKGTRPEENIKQFQDLISEYYKEPPPWIMTSSVTGLGRDELLLHM  307

Query  251  SQLRNYWDSD  280
            SQLRNYWD++
Sbjct  308  SQLRNYWDNN  317



>ref|XP_007205637.1| hypothetical protein PRUPE_ppa009227mg [Prunus persica]
 gb|EMJ06836.1| hypothetical protein PRUPE_ppa009227mg [Prunus persica]
Length=301

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 59/69 (86%), Gaps = 1/69 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
             IPMTFVFTKCDKMK  K K PDEN+R+FQ+ IR+NY+  PPWI+TSSVTG GRD LLLH
Sbjct  232  NIPMTFVFTKCDKMKASKGKRPDENLRDFQQFIRENYRVQPPWIMTSSVTGFGRDELLLH  291

Query  248  MSQLRNYWD  274
            MSQLRNYWD
Sbjct  292  MSQLRNYWD  300



>gb|KEH31065.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=297

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 61/68 (90%), Gaps = 1/68 (1%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            IP+TFVFTKCDKMK  K K P+ENIR+FQE+I+QNYK  PPWI+TSSVTGLGRD LLLH+
Sbjct  229  IPVTFVFTKCDKMKVAKGKIPEENIRDFQEIIKQNYKQHPPWIMTSSVTGLGRDDLLLHV  288

Query  251  SQLRNYWD  274
            SQLRNYWD
Sbjct  289  SQLRNYWD  296



>gb|KFK32785.1| hypothetical protein AALP_AA6G288100 [Arabis alpina]
Length=307

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            +PMTFVFTKCDKMK  K K PDENI+ FQ++IR+N+K  PPWI+TSSV+GLGRD LLLHM
Sbjct  239  VPMTFVFTKCDKMKAAKGKRPDENIKAFQQIIRENFKQHPPWIMTSSVSGLGRDELLLHM  298

Query  251  SQLRNYWD  274
            SQLRNYWD
Sbjct  299  SQLRNYWD  306



>ref|XP_006294685.1| hypothetical protein CARUB_v10023722mg [Capsella rubella]
 gb|EOA27583.1| hypothetical protein CARUB_v10023722mg [Capsella rubella]
Length=301

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 60/69 (87%), Gaps = 1/69 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
             +PMTFVFTKCDKMK  K K PDENI+ FQ++IR+N+K  PPWILTSSV+GLGRD LLLH
Sbjct  232  NVPMTFVFTKCDKMKAAKGKRPDENIKAFQQIIRENFKVHPPWILTSSVSGLGRDELLLH  291

Query  248  MSQLRNYWD  274
            MSQLRNYWD
Sbjct  292  MSQLRNYWD  300



>ref|XP_002878640.1| EMB2001 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54899.1| EMB2001 [Arabidopsis lyrata subsp. lyrata]
Length=300

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 60/69 (87%), Gaps = 1/69 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
             +PMTFVFTKCDKMK  K K PDENI+ FQ++IR+N+K  PPWILTSSV+GLGRD LLLH
Sbjct  231  NVPMTFVFTKCDKMKAAKGKRPDENIKAFQQIIRENFKVHPPWILTSSVSGLGRDELLLH  290

Query  248  MSQLRNYWD  274
            MSQLRNYWD
Sbjct  291  MSQLRNYWD  299



>ref|XP_010647075.1| PREDICTED: GTP-binding protein At2g22870-like [Vitis vinifera]
 ref|XP_010647289.1| PREDICTED: GTP-binding protein At2g22870 [Vitis vinifera]
Length=316

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 60/69 (87%), Gaps = 1/69 (1%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            IPMTFVFTKCDKMKGGK K PDENI+ FQ ++ QNY   PPWI+TSSVTGLGRD LLLHM
Sbjct  248  IPMTFVFTKCDKMKGGKGKRPDENIKNFQVMMGQNYGKHPPWIMTSSVTGLGRDELLLHM  307

Query  251  SQLRNYWDS  277
            SQLRNYWD+
Sbjct  308  SQLRNYWDN  316



>emb|CDX89524.1| BnaC04g35430D [Brassica napus]
Length=299

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            +P+TFVFTKCDKMK  K K PDENI+ FQ++IR+N+K  PPWILTSSV+GLGRD LLLHM
Sbjct  231  VPLTFVFTKCDKMKAAKGKRPDENIKAFQQIIRENFKQHPPWILTSSVSGLGRDELLLHM  290

Query  251  SQLRNYWD  274
            SQLRNYWD
Sbjct  291  SQLRNYWD  298



>ref|XP_009140400.1| PREDICTED: GTP-binding protein At2g22870 [Brassica rapa]
 emb|CDY25642.1| BnaA04g13340D [Brassica napus]
Length=299

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            +P+TFVFTKCDKMK  K K PDENI+ FQ++IR+N+K  PPWILTSSV+GLGRD LLLHM
Sbjct  231  VPLTFVFTKCDKMKAAKGKRPDENIKAFQQIIRENFKQHPPWILTSSVSGLGRDELLLHM  290

Query  251  SQLRNYWD  274
            SQLRNYWD
Sbjct  291  SQLRNYWD  298



>ref|XP_010936165.1| PREDICTED: GTP-binding protein At2g22870 [Elaeis guineensis]
Length=320

 Score =   116 bits (291),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 64/73 (88%), Gaps = 1/73 (1%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGK-TKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            I MTFVFTKCDKMKGGK T+P+ENI++FQ+LI + YK  PPWI+TSS+TGLGRD LLLHM
Sbjct  248  IGMTFVFTKCDKMKGGKGTRPEENIKQFQDLISKYYKEPPPWIMTSSITGLGRDELLLHM  307

Query  251  SQLRNYWDSDSPD  289
            SQLRNYWD++  D
Sbjct  308  SQLRNYWDNNELD  320



>ref|XP_010245163.1| PREDICTED: GTP-binding protein At2g22870 isoform X1 [Nelumbo 
nucifera]
Length=305

 Score =   116 bits (290),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 62/69 (90%), Gaps = 1/69 (1%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            IP+TFVFTKCDK+K  K K PDENI++FQELIR+NY+  PPWI+TSSVTGLGR+ LLLHM
Sbjct  237  IPLTFVFTKCDKVKKSKGKRPDENIKDFQELIRKNYQEPPPWIMTSSVTGLGRNELLLHM  296

Query  251  SQLRNYWDS  277
            SQLRNYWD+
Sbjct  297  SQLRNYWDN  305



>ref|NP_565543.1| GTP-binding protein EMB2001 [Arabidopsis thaliana]
 sp|O81004.2|Y2287_ARATH RecName: Full=GTP-binding protein At2g22870; AltName: Full=Protein 
EMBRYO DEFECTIVE 2001 [Arabidopsis thaliana]
 gb|AAC32434.2| putative nucleotide-binding protein [Arabidopsis thaliana]
 gb|AAM64830.1| putative nucleotide-binding protein [Arabidopsis thaliana]
 gb|AAU44455.1| hypothetical protein AT2G22870 [Arabidopsis thaliana]
 gb|AAV63878.1| hypothetical protein At2g22870 [Arabidopsis thaliana]
 gb|AEC07367.1| GTP-binding protein [Arabidopsis thaliana]
Length=300

 Score =   115 bits (289),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            +PMTFVFTKCDKMK  K K PDENI+ FQ++IR+N+K  PPWILTSSV+GLGRD LLLHM
Sbjct  232  VPMTFVFTKCDKMKATKGKRPDENIKAFQQIIRENFKVHPPWILTSSVSGLGRDELLLHM  291

Query  251  SQLRNYWD  274
            SQLRNYWD
Sbjct  292  SQLRNYWD  299



>ref|XP_010417047.1| PREDICTED: GTP-binding protein At2g22870-like [Camelina sativa]
Length=310

 Score =   116 bits (290),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 60/69 (87%), Gaps = 1/69 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
             +PMTFVFTKCDKMK  K K PDENI+ FQ++IR+N+K  PPWILTSSV+GLGRD LLLH
Sbjct  241  NVPMTFVFTKCDKMKATKGKRPDENIKAFQQIIRENFKVHPPWILTSSVSGLGRDELLLH  300

Query  248  MSQLRNYWD  274
            MSQLRNYWD
Sbjct  301  MSQLRNYWD  309



>ref|XP_010472286.1| PREDICTED: GTP-binding protein At2g22870 [Camelina sativa]
Length=305

 Score =   115 bits (289),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 60/69 (87%), Gaps = 1/69 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
             +PMTFVFTKCDKMK  K K PDENI+ FQ++IR+N+K  PPWILTSSV+GLGRD LLLH
Sbjct  236  NVPMTFVFTKCDKMKATKGKRPDENIKAFQQIIRENFKVHPPWILTSSVSGLGRDELLLH  295

Query  248  MSQLRNYWD  274
            MSQLRNYWD
Sbjct  296  MSQLRNYWD  304



>gb|EPS71550.1| hypothetical protein M569_03211, partial [Genlisea aurea]
Length=242

 Score =   114 bits (286),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 61/70 (87%), Gaps = 2/70 (3%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHI-PPWILTSSVTGLGRDGLLL  244
             IP+TFVFTKCDK+KGGK K PDENIR+FQ LI +N++H  PPWI+TSS TGLGRD LLL
Sbjct  173  NIPLTFVFTKCDKIKGGKGKRPDENIRDFQRLIGENFRHHHPPWIMTSSATGLGRDDLLL  232

Query  245  HMSQLRNYWD  274
            HMSQLRNYWD
Sbjct  233  HMSQLRNYWD  242



>ref|XP_010429222.1| PREDICTED: GTP-binding protein At2g22870-like [Camelina sativa]
Length=305

 Score =   115 bits (289),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 60/69 (87%), Gaps = 1/69 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
             +PMTFVFTKCDKMK  K K PDENI+ FQ++IR+N+K  PPWILTSSV+GLGRD LLLH
Sbjct  236  NVPMTFVFTKCDKMKATKGKRPDENIKAFQQIIRENFKVHPPWILTSSVSGLGRDELLLH  295

Query  248  MSQLRNYWD  274
            MSQLRNYWD
Sbjct  296  MSQLRNYWD  304



>ref|XP_008353774.1| PREDICTED: GTP-binding protein At2g22870-like [Malus domestica]
 ref|XP_008362446.1| PREDICTED: GTP-binding protein At2g22870-like [Malus domestica]
 ref|XP_008362447.1| PREDICTED: GTP-binding protein At2g22870-like [Malus domestica]
 ref|XP_008362448.1| PREDICTED: GTP-binding protein At2g22870-like [Malus domestica]
 ref|XP_008362449.1| PREDICTED: GTP-binding protein At2g22870-like [Malus domestica]
Length=304

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 59/69 (86%), Gaps = 1/69 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
             IPMTFVFTKCDKM+ GK K  DEN+R+FQ+ I+ NY+  PPWI+TSSVTGLGRD LLLH
Sbjct  235  NIPMTFVFTKCDKMRAGKGKRADENLRDFQQFIKDNYRVPPPWIMTSSVTGLGRDELLLH  294

Query  248  MSQLRNYWD  274
            MSQLRNYWD
Sbjct  295  MSQLRNYWD  303



>ref|XP_009336229.1| PREDICTED: GTP-binding protein At2g22870 [Pyrus x bretschneideri]
 ref|XP_009336230.1| PREDICTED: GTP-binding protein At2g22870 [Pyrus x bretschneideri]
Length=304

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 59/69 (86%), Gaps = 1/69 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
             IPMTFVFTKCDKM+ GK K  DEN+R+FQ+ I+ NY+  PPWI+TSSVTGLGRD LLLH
Sbjct  235  NIPMTFVFTKCDKMRAGKGKRADENLRDFQQFIKDNYRVPPPWIMTSSVTGLGRDELLLH  294

Query  248  MSQLRNYWD  274
            MSQLRNYWD
Sbjct  295  MSQLRNYWD  303



>gb|EYU41373.1| hypothetical protein MIMGU_mgv1a010732mg [Erythranthe guttata]
Length=303

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 61/72 (85%), Gaps = 2/72 (3%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGK-TKPDENIREFQELIRQNYKHI-PPWILTSSVTGLGRDGLLL  244
             IP+TFVFTKCDK K  K  +PDENIREFQELI+ NY+   PPWI+TSSVTGLGRD LLL
Sbjct  232  NIPLTFVFTKCDKTKAAKGRRPDENIREFQELIKDNYRQKHPPWIMTSSVTGLGRDELLL  291

Query  245  HMSQLRNYWDSD  280
            HMSQLRNYWD++
Sbjct  292  HMSQLRNYWDNE  303



>ref|XP_009394289.1| PREDICTED: GTP-binding protein At2g22870 [Musa acuminata subsp. 
malaccensis]
Length=310

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 60/71 (85%), Gaps = 1/71 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
             I MTFVFTKCDK+KGGK K  D+NI+ FQ+LI + YK  PPWI+TSSVTGLGRD LLLH
Sbjct  237  NIGMTFVFTKCDKIKGGKGKRSDDNIKHFQDLISKYYKEPPPWIMTSSVTGLGRDELLLH  296

Query  248  MSQLRNYWDSD  280
            MSQLRNYWD+D
Sbjct  297  MSQLRNYWDND  307



>ref|XP_002886010.1| EMB2001 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62269.1| EMB2001 [Arabidopsis lyrata subsp. lyrata]
Length=300

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 59/69 (86%), Gaps = 1/69 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
             + MTFVFTKCDKMK  K K PDENI+ FQ++I++N+K  PPWILTSSV+GLGRD LLLH
Sbjct  231  NVQMTFVFTKCDKMKATKGKRPDENIKAFQQIIKENFKVHPPWILTSSVSGLGRDELLLH  290

Query  248  MSQLRNYWD  274
            MSQLRNYWD
Sbjct  291  MSQLRNYWD  299



>ref|XP_006857104.1| hypothetical protein AMTR_s00065p00125910 [Amborella trichopoda]
 gb|ERN18571.1| hypothetical protein AMTR_s00065p00125910 [Amborella trichopoda]
Length=309

 Score =   110 bits (276),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 60/70 (86%), Gaps = 1/70 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
             IP+T+VFTKCDK K GK K PDENI++FQE I+++Y+  PPWI+TSS TGLGRD LLLH
Sbjct  240  NIPLTYVFTKCDKKKSGKGKRPDENIKDFQEFIKKSYREPPPWIMTSSFTGLGRDELLLH  299

Query  248  MSQLRNYWDS  277
            MSQLRNYWD+
Sbjct  300  MSQLRNYWDN  309



>ref|XP_002465613.1| hypothetical protein SORBIDRAFT_01g042170 [Sorghum bicolor]
 gb|EER92611.1| hypothetical protein SORBIDRAFT_01g042170 [Sorghum bicolor]
Length=310

 Score =   110 bits (275),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 60/72 (83%), Gaps = 1/72 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKT-KPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
             I +TFVFTKCDK+K GK  +PDENI++FQE I   Y   PPWI+TSSVTGLGRDGLLLH
Sbjct  238  NIGLTFVFTKCDKVKKGKGGRPDENIKQFQETISGLYPDPPPWIMTSSVTGLGRDGLLLH  297

Query  248  MSQLRNYWDSDS  283
            MSQLRNYWD+++
Sbjct  298  MSQLRNYWDNEA  309



>ref|XP_006649684.1| PREDICTED: GTP-binding protein At2g22870-like [Oryza brachyantha]
Length=311

 Score =   110 bits (275),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 59/72 (82%), Gaps = 1/72 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKT-KPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
             I +TFVFTKCDK K GK  +P+ENI+EFQE I   Y   PPWI+TSSVTGLGRDGLLLH
Sbjct  236  NIGLTFVFTKCDKSKKGKGGRPEENIKEFQETISSLYPEPPPWIMTSSVTGLGRDGLLLH  295

Query  248  MSQLRNYWDSDS  283
            MSQLRNYWD+++
Sbjct  296  MSQLRNYWDNEA  307



>ref|NP_001151819.1| GTP-binding protein [Zea mays]
 gb|ACF84544.1| unknown [Zea mays]
 gb|ACG44448.1| GTP-binding protein [Zea mays]
 gb|AFW89110.1| GTP-binding protein [Zea mays]
Length=308

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 59/72 (82%), Gaps = 1/72 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKT-KPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
             I +TFVFTKCDK+K GK  +PDENI+EF E I   Y   PPWI+TSSVTGLGRDGLLLH
Sbjct  236  NIGLTFVFTKCDKVKKGKGGRPDENIKEFHETISGLYPDPPPWIMTSSVTGLGRDGLLLH  295

Query  248  MSQLRNYWDSDS  283
            MSQLRNYWD+++
Sbjct  296  MSQLRNYWDNEA  307



>ref|XP_003558441.1| PREDICTED: GTP-binding protein At2g22870 [Brachypodium distachyon]
 ref|XP_010228934.1| PREDICTED: GTP-binding protein At2g22870 [Brachypodium distachyon]
Length=306

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 59/72 (82%), Gaps = 1/72 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKT-KPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
             + +TFVFTKCDK+K GK  +PDENI+EFQE I   Y   PPWI+TSS TGLGRDGLLLH
Sbjct  234  NVGLTFVFTKCDKVKKGKGGRPDENIKEFQENISSLYPEPPPWIMTSSTTGLGRDGLLLH  293

Query  248  MSQLRNYWDSDS  283
            MSQLRNYWD+++
Sbjct  294  MSQLRNYWDNEA  305



>ref|XP_004985126.1| PREDICTED: GTP-binding protein At2g22870-like [Setaria italica]
Length=300

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 59/72 (82%), Gaps = 1/72 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKT-KPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
             I +TFVFTKCDK+K GK  +PDENI+ FQE I   Y   PPWI+TSSVTGLGRDGLLLH
Sbjct  228  NIGLTFVFTKCDKVKKGKGGRPDENIKVFQETISGLYPEPPPWIMTSSVTGLGRDGLLLH  287

Query  248  MSQLRNYWDSDS  283
            MSQLRNYWD+++
Sbjct  288  MSQLRNYWDNEA  299



>ref|NP_001049468.1| Os03g0232500 [Oryza sativa Japonica Group]
 gb|ABF94806.1| GTP-binding protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11382.1| Os03g0232500 [Oryza sativa Japonica Group]
 dbj|BAG99105.1| unnamed protein product [Oryza sativa Japonica Group]
Length=318

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 59/72 (82%), Gaps = 1/72 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKT-KPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
             I +T+VFTKCDK K GK  +P+ENI+EFQE I   Y   PPWI+TSSVTGLGRDGLLLH
Sbjct  243  NIGLTYVFTKCDKSKKGKGGRPEENIKEFQETISSLYPEPPPWIMTSSVTGLGRDGLLLH  302

Query  248  MSQLRNYWDSDS  283
            MSQLRNYWD+++
Sbjct  303  MSQLRNYWDNEA  314



>ref|XP_008367956.1| PREDICTED: LOW QUALITY PROTEIN: GTP-binding protein At2g22870-like 
[Malus domestica]
Length=308

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 57/69 (83%), Gaps = 1/69 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK-PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
             I MTFVFTKCDKM+ GK K  DEN+R+FQ+ I+ NY   PPWI+TSSVTGLGRD LLLH
Sbjct  239  NILMTFVFTKCDKMRAGKGKRADENLRDFQQFIKDNYHVPPPWIMTSSVTGLGRDELLLH  298

Query  248  MSQLRNYWD  274
            MSQLRNYWD
Sbjct  299  MSQLRNYWD  307



>gb|EEC74817.1| hypothetical protein OsI_10639 [Oryza sativa Indica Group]
Length=348

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 59/72 (82%), Gaps = 1/72 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKT-KPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
             I +T+VFTKCDK K GK  +P+ENI+EFQE I   Y   PPWI+TSSVTGLGRDGLLLH
Sbjct  273  NIGLTYVFTKCDKSKKGKGGRPEENIKEFQETISSLYPEPPPWIMTSSVTGLGRDGLLLH  332

Query  248  MSQLRNYWDSDS  283
            MSQLRNYWD+++
Sbjct  333  MSQLRNYWDNEA  344



>gb|AAM19136.1|AC103891_16 Putative nucleotide binding protein [Oryza sativa Japonica Group]
 gb|AAO00694.1| Putative nucleotide binding protein [Oryza sativa Japonica Group]
 gb|EAZ26168.1| hypothetical protein OsJ_10034 [Oryza sativa Japonica Group]
Length=255

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 59/72 (82%), Gaps = 1/72 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKT-KPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
             I +T+VFTKCDK K GK  +P+ENI+EFQE I   Y   PPWI+TSSVTGLGRDGLLLH
Sbjct  180  NIGLTYVFTKCDKSKKGKGGRPEENIKEFQETISSLYPEPPPWIMTSSVTGLGRDGLLLH  239

Query  248  MSQLRNYWDSDS  283
            MSQLRNYWD+++
Sbjct  240  MSQLRNYWDNEA  251



>dbj|BAJ90001.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85840.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=307

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKT-KPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
             + +TFVFTKCDK+K GK  +PDENI+EF E I   Y   PPWI+TSS TGLGR+GLLLH
Sbjct  235  NVGLTFVFTKCDKVKKGKGGRPDENIKEFLENIGSLYPRPPPWIMTSSTTGLGREGLLLH  294

Query  248  MSQLRNYWDSDS  283
            MSQLRNYWD+++
Sbjct  295  MSQLRNYWDNEA  306



>gb|EMT16575.1| GTP-binding protein [Aegilops tauschii]
Length=410

 Score =   102 bits (255),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 56/69 (81%), Gaps = 1/69 (1%)
 Frame = +2

Query  80   MTFVFTKCDKMKGGKT-KPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMSQ  256
            +TFVFTKCDK+K GK  +PDENI+ F E I   Y   PPWI+TSS TGLGRDGLLLHMSQ
Sbjct  341  LTFVFTKCDKVKKGKGGRPDENIKVFLENIGSLYPRPPPWIMTSSTTGLGRDGLLLHMSQ  400

Query  257  LRNYWDSDS  283
            LRNYWD+++
Sbjct  401  LRNYWDNEA  409



>gb|ABK21971.1| unknown [Picea sitchensis]
Length=317

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 60/72 (83%), Gaps = 3/72 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKT---KPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
             IP+TFVFTKCDK K GK+   +P+ENI+EFQ+LI + Y+  PPWI+TSSVT LGRD LL
Sbjct  246  NIPLTFVFTKCDKKKSGKSGVKRPEENIKEFQDLISKKYREPPPWIMTSSVTNLGRDDLL  305

Query  242  LHMSQLRNYWDS  277
            LH+SQLRNYWD+
Sbjct  306  LHLSQLRNYWDN  317



>ref|XP_010106913.1| hypothetical protein L484_013007 [Morus notabilis]
 gb|EXC12629.1| hypothetical protein L484_013007 [Morus notabilis]
Length=56

 Score = 89.0 bits (219),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  110  MKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMSQLRNYWD  274
            MKG   KP ENIR+FQ+ I QNY   PPWI+TSSVTGLGRD LLLHMSQLRNYW+
Sbjct  1    MKGKGKKPAENIRDFQQFIAQNYPKHPPWIMTSSVTGLGRDELLLHMSQLRNYWN  55



>ref|XP_002308620.2| hypothetical protein POPTR_0006s25980g [Populus trichocarpa]
 gb|EEE92143.2| hypothetical protein POPTR_0006s25980g [Populus trichocarpa]
Length=336

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 53/70 (76%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            Q+PMTF+FTKCDK K  +     P+EN+ EFQELIR  ++  PPWI+TS VT  GRD +L
Sbjct  264  QVPMTFIFTKCDKRKKKRNGGKRPEENVNEFQELIRGFFETAPPWIMTSGVTNQGRDEML  323

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  324  LHMAQLRNYW  333



>ref|XP_010249730.1| PREDICTED: GTP-binding protein At2g22870 [Nelumbo nucifera]
Length=329

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 55/70 (79%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            QIPMT +FTKCDK K  +     P+EN+++FQELIR+ ++  PPWI+TSSVT  GR+ +L
Sbjct  257  QIPMTLIFTKCDKRKKKRNGGKRPEENVQDFQELIREFFQAAPPWIMTSSVTNQGREEIL  316

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  317  LHMAQLRNYW  326



>gb|ADE76113.1| unknown [Picea sitchensis]
Length=335

 Score = 90.9 bits (224),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 53/70 (76%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            QIPM FVFTKCDK K  K     P+ENI +FQ LIR+ Y+  PPWI+TSSVT  GRD LL
Sbjct  263  QIPMAFVFTKCDKRKKRKNGNKRPEENIYDFQNLIREFYQETPPWIMTSSVTNQGRDELL  322

Query  242  LHMSQLRNYW  271
            LH++QL+NYW
Sbjct  323  LHIAQLKNYW  332



>ref|XP_011013238.1| PREDICTED: GTP-binding protein At2g22870-like [Populus euphratica]
Length=311

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            Q+PMT +FTKCDK K  +     P+EN+ EFQELIR  ++  PPWI+TS VT  GRD +L
Sbjct  239  QVPMTLIFTKCDKRKKKRNGGKRPEENVNEFQELIRGFFETAPPWIMTSGVTNQGRDEML  298

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  299  LHMAQLRNYW  308



>ref|XP_011019668.1| PREDICTED: GTP-binding protein At2g22870 [Populus euphratica]
Length=311

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            Q+PMT +FTKCDK K  +     P+EN+ EFQELIR  ++  PPWI+TS VT  GRD +L
Sbjct  239  QVPMTLIFTKCDKRKKKRNGGKRPEENVNEFQELIRGFFETAPPWIMTSGVTNQGRDEML  298

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  299  LHMAQLRNYW  308



>ref|XP_008810030.1| PREDICTED: GTP-binding protein At2g22870 [Phoenix dactylifera]
Length=325

 Score = 88.6 bits (218),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 53/70 (76%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            QIPMT +FTKCDK +  K     P+EN+ +FQ LIR+ ++  PPWI+TSSVT  GRD +L
Sbjct  253  QIPMTLIFTKCDKRRKKKNGGKRPEENVEDFQTLIREFFQAAPPWIMTSSVTNQGRDEIL  312

Query  242  LHMSQLRNYW  271
            LH++QLRNYW
Sbjct  313  LHIAQLRNYW  322



>ref|XP_006833289.1| hypothetical protein AMTR_s00109p00030450 [Amborella trichopoda]
 gb|ERM98567.1| hypothetical protein AMTR_s00109p00030450 [Amborella trichopoda]
Length=310

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 51/70 (73%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDK---MKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            QIPMT +FTKCDK    K G  + +EN+ +F  ++ + ++  PPWI+TSSVT  GRD +L
Sbjct  238  QIPMTLIFTKCDKRKKQKNGGKRAEENVEDFHVMMHEYFQEAPPWIMTSSVTNQGRDEIL  297

Query  242  LHMSQLRNYW  271
            LH++QLRNYW
Sbjct  298  LHIAQLRNYW  307



>ref|XP_004292863.1| PREDICTED: GTP-binding protein At2g22870-like [Fragaria vesca 
subsp. vesca]
Length=316

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 51/70 (73%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            QIPMT +FTKCDK K  +      +EN+ +FQELIR  +   PPWI+TSS+T  GRD +L
Sbjct  244  QIPMTLIFTKCDKRKKKRNGGKRAEENVNDFQELIRGYFDTTPPWIMTSSLTNQGRDEML  303

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  304  LHMAQLRNYW  313



>ref|XP_007227713.1| hypothetical protein PRUPE_ppa009961mg [Prunus persica]
 gb|EMJ28912.1| hypothetical protein PRUPE_ppa009961mg [Prunus persica]
Length=270

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 53/70 (76%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            QIPMT +FTKCDK K  +      +EN+++FQELI   ++ +PPWI+TSS+T  GRD +L
Sbjct  198  QIPMTLIFTKCDKRKKKRHGGKKAEENVQDFQELISGFFETVPPWIMTSSLTNQGRDEML  257

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  258  LHMAQLRNYW  267



>ref|XP_004163505.1| PREDICTED: LOW QUALITY PROTEIN: GTP-binding protein At2g22870-like 
[Cucumis sativus]
Length=315

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 52/69 (75%), Gaps = 2/69 (3%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK--PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLL  244
            QIPMT +FTKCDK K  +    P+EN+ +FQELI   ++  PPWI+TSSVT  GRD +LL
Sbjct  244  QIPMTIIFTKCDKRKKKRMGKRPEENVSDFQELISGFFQTTPPWIMTSSVTHQGRDEILL  303

Query  245  HMSQLRNYW  271
            H++QLRNYW
Sbjct  304  HIAQLRNYW  312



>ref|XP_008357419.1| PREDICTED: GTP-binding protein At2g22870-like [Malus domestica]
Length=323

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 53/70 (76%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            QIPMT +FTKCDK K  +      +EN+++FQELI   ++ +PPWI+TSS+T  GRD +L
Sbjct  251  QIPMTLIFTKCDKRKKKRHGGKKAEENVQDFQELISGFFETVPPWIMTSSLTNQGRDEML  310

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  311  LHMAQLRNYW  320



>ref|XP_009338720.1| PREDICTED: GTP-binding protein At2g22870-like [Pyrus x bretschneideri]
Length=323

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 53/70 (76%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            QIPMT +FTKCDK K  +      +EN+++FQELI   ++ +PPWI+TSS+T  GRD +L
Sbjct  251  QIPMTLIFTKCDKRKKKRHGGKKAEENVQDFQELISGFFETVPPWIMTSSLTNQGRDEML  310

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  311  LHMAQLRNYW  320



>ref|XP_008378219.1| PREDICTED: GTP-binding protein At2g22870-like [Malus domestica]
Length=323

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 53/70 (76%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            QIPMT +FTKCDK K  +      +EN+++FQELI   ++ +PPWI+TSS+T  GRD +L
Sbjct  251  QIPMTLIFTKCDKRKKKRHGGKKAEENVQDFQELISGFFETVPPWIMTSSLTNQGRDEML  310

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  311  LHMAQLRNYW  320



>ref|XP_008220023.1| PREDICTED: LOW QUALITY PROTEIN: GTP-binding protein At2g22870 
[Prunus mume]
Length=321

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 53/70 (76%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            QIPMT +FTKCDK K  +      +EN+++FQELI   ++ +PPWI+TSS+T  GRD +L
Sbjct  249  QIPMTLIFTKCDKRKKKRHGGKKAEENVQDFQELISGFFETVPPWIMTSSLTNQGRDEML  308

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  309  LHMAQLRNYW  318



>ref|XP_007137167.1| hypothetical protein PHAVU_009G105600g [Phaseolus vulgaris]
 gb|ESW09161.1| hypothetical protein PHAVU_009G105600g [Phaseolus vulgaris]
Length=298

 Score = 85.1 bits (209),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 55/70 (79%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMK---GGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            QIPMT +FTKCDK K    G  +P+EN+ +FQ+LIR  ++ +PPWI+TSSVT  GRD +L
Sbjct  226  QIPMTIIFTKCDKRKKKKNGGQRPEENVDDFQDLIRGFFQSVPPWIMTSSVTNQGRDEIL  285

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  286  LHMAQLRNYW  295



>ref|XP_009367924.1| PREDICTED: LOW QUALITY PROTEIN: GTP-binding protein At2g22870 
[Pyrus x bretschneideri]
Length=323

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 53/70 (76%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            QIPMT +FTKCDK K  +      +EN+++F+ELI   ++ +PPWI+TSS+T  GRD +L
Sbjct  251  QIPMTLIFTKCDKRKKKRHGGKKAEENVQDFRELISGFFETVPPWIMTSSLTNQGRDEML  310

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  311  LHMAQLRNYW  320



>emb|CDP16152.1| unnamed protein product [Coffea canephora]
Length=322

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 54/70 (77%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            QIPMT VFTKCDK K  K     P+ENI+ FQELIR+ ++  PPWI+TSS+T  GRD +L
Sbjct  250  QIPMTLVFTKCDKRKKKKHGGRRPEENIQNFQELIREFFQTAPPWIMTSSITNQGRDEIL  309

Query  242  LHMSQLRNYW  271
            LHMSQLRNYW
Sbjct  310  LHMSQLRNYW  319



>ref|XP_002516578.1| GTP-binding protein engB, putative [Ricinus communis]
 gb|EEF45919.1| GTP-binding protein engB, putative [Ricinus communis]
Length=317

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            QIPMT +FTKCDK K  K     PDEN+ +FQELIR  +K  PPWI+TSS T  GRD +L
Sbjct  245  QIPMTLIFTKCDKRKKKKNGGKRPDENVNDFQELIRSFFKTAPPWIMTSSTTNQGRDEML  304

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  305  LHMAQLRNYW  314



>ref|XP_010112169.1| GTP-binding protein [Morus notabilis]
 gb|EXC32794.1| GTP-binding protein [Morus notabilis]
Length=304

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 53/70 (76%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            QIPMT +FTKCDK K  K     P+EN+ +FQEL+R  +K  PPWI+TSSVT  GRD +L
Sbjct  232  QIPMTLIFTKCDKRKKKKNGGKRPEENVNDFQELVRGFFKSAPPWIMTSSVTNQGRDEIL  291

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  292  LHMAQLRNYW  301



>gb|KCW72973.1| hypothetical protein EUGRSUZ_E01422 [Eucalyptus grandis]
Length=323

 Score = 82.8 bits (203),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 55/70 (79%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            Q+PMT VFTKCDK K  K     P+EN+++FQELIR  ++  PPWI+TSSV+ +GRD +L
Sbjct  251  QVPMTLVFTKCDKRKKKKNGGKRPEENVQDFQELIRGFFETAPPWIMTSSVSSMGRDEVL  310

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  311  LHMAQLRNYW  320



>ref|XP_003522687.1| PREDICTED: GTP-binding protein At2g22870-like isoform X1 [Glycine 
max]
 ref|XP_006578210.1| PREDICTED: GTP-binding protein At2g22870-like isoform X2 [Glycine 
max]
Length=293

 Score = 82.0 bits (201),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 54/70 (77%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            QIPMT +FTKCDK K  K     P+EN+ +FQ+LIR  ++ +PPWI+TSSVT  GRD +L
Sbjct  221  QIPMTLIFTKCDKRKKKKNGGKRPEENVNDFQDLIRGFFQSVPPWIMTSSVTNQGRDEIL  280

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  281  LHMAQLRNYW  290



>ref|XP_010056308.1| PREDICTED: GTP-binding protein At2g22870 [Eucalyptus grandis]
Length=340

 Score = 82.4 bits (202),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 55/70 (79%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            Q+PMT VFTKCDK K  K     P+EN+++FQELIR  ++  PPWI+TSSV+ +GRD +L
Sbjct  268  QVPMTLVFTKCDKRKKKKNGGKRPEENVQDFQELIRGFFETAPPWIMTSSVSSMGRDEVL  327

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  328  LHMAQLRNYW  337



>gb|KHN10234.1| GTP-binding protein [Glycine soja]
Length=293

 Score = 82.0 bits (201),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 54/70 (77%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            QIPMT +FTKCDK K  K     P+EN+ +FQ+LIR  ++ +PPWI+TSSVT  GRD +L
Sbjct  221  QIPMTLIFTKCDKRKKKKNGGKRPEENVNDFQDLIRGFFQSVPPWIMTSSVTNQGRDEIL  280

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  281  LHMAQLRNYW  290



>ref|XP_010519913.1| PREDICTED: GTP-binding protein At2g22870 [Tarenaya hassleriana]
Length=318

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 54/70 (77%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            QIPMT VFTKCDK K  K     P+EN+++FQ+LIR  ++  PPWI+TSSVT  GRD +L
Sbjct  246  QIPMTLVFTKCDKRKKKKNGGKRPEENMKDFQDLIRGFFETAPPWIMTSSVTNQGRDEIL  305

Query  242  LHMSQLRNYW  271
            LHMSQLRNYW
Sbjct  306  LHMSQLRNYW  315



>ref|XP_002324249.1| hypothetical protein POPTR_0018s00820g [Populus trichocarpa]
 gb|EEF02814.1| hypothetical protein POPTR_0018s00820g [Populus trichocarpa]
Length=316

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            Q+PMT +FTKCDK K  K     P+EN+ EFQELIR  ++  PPWI+TS VT  GRD +L
Sbjct  244  QVPMTLIFTKCDKRKKKKNGGKRPEENVNEFQELIRDFFETAPPWIMTSGVTNQGRDEML  303

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  304  LHMAQLRNYW  313



>ref|XP_009785703.1| PREDICTED: GTP-binding protein At2g22870 [Nicotiana sylvestris]
Length=319

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 55/70 (79%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            QIPMT VFTKCDK K  K     P+EN+++F ELI++ ++ +PPWI+TSSVT  GRD +L
Sbjct  247  QIPMTLVFTKCDKRKKKKNGGRRPEENLQDFLELIQKFFQTVPPWIMTSSVTNQGRDEIL  306

Query  242  LHMSQLRNYW  271
            LHMSQLRNYW
Sbjct  307  LHMSQLRNYW  316



>ref|XP_011026575.1| PREDICTED: GTP-binding protein At2g22870-like [Populus euphratica]
 ref|XP_011026576.1| PREDICTED: GTP-binding protein At2g22870-like [Populus euphratica]
 ref|XP_011026577.1| PREDICTED: GTP-binding protein At2g22870-like [Populus euphratica]
Length=318

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            Q+PMT +FTKCDK K  K     P+EN+ EFQELIR  ++  PPWI+TS VT  GRD +L
Sbjct  246  QVPMTLIFTKCDKRKKKKNGGKRPEENVNEFQELIRDFFETAPPWIMTSGVTNQGRDEML  305

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  306  LHMAQLRNYW  315



>ref|XP_007012043.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY29662.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
Length=311

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 53/70 (76%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            QIPMT +FTKCDK K  K     P+EN+ +FQELIR  ++  PPWI+TSSVT  GRD +L
Sbjct  239  QIPMTLIFTKCDKRKKKKNGGKRPEENVSDFQELIRGFFQTAPPWIMTSSVTNQGRDEIL  298

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  299  LHMAQLRNYW  308



>ref|XP_009410873.1| PREDICTED: GTP-binding protein At2g22870 [Musa acuminata subsp. 
malaccensis]
Length=332

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 54/70 (77%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            QIPMT +FTKCDK K  K     P+EN+ +FQ+LIR+ +K  PPWI+TSSVT  GR+ +L
Sbjct  260  QIPMTLLFTKCDKRKKKKNGGKRPEENVEDFQKLIREYFKEAPPWIMTSSVTNQGREEIL  319

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  320  LHMAQLRNYW  329



>ref|XP_009131207.1| PREDICTED: GTP-binding protein At2g22870-like [Brassica rapa]
 emb|CDX78424.1| BnaA03g03360D [Brassica napus]
Length=313

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 54/70 (77%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            Q+PMT VFTKCDK K  K     P+ENI+EFQ+LI+  ++  PPWI+TSSVT  GRD +L
Sbjct  241  QVPMTMVFTKCDKRKKKKNGGKRPEENIKEFQDLIQGFFETTPPWIMTSSVTNQGRDEIL  300

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  301  LHMAQLRNYW  310



>ref|XP_011081830.1| PREDICTED: GTP-binding protein At2g22870 [Sesamum indicum]
Length=325

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 54/70 (77%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            QIPMT +FTKCDK K  K     P+EN+++FQELIR  ++  PPWI+TSSVT  GR+ +L
Sbjct  253  QIPMTLIFTKCDKRKKKKNGGKRPEENVQDFQELIRGFFQTAPPWIMTSSVTNQGREEIL  312

Query  242  LHMSQLRNYW  271
            LHMSQLRNYW
Sbjct  313  LHMSQLRNYW  322



>emb|CDX70395.1| BnaC03g04790D [Brassica napus]
Length=313

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 54/70 (77%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            Q+PMT VFTKCDK K  K     P+ENI+EFQ+LI+  ++  PPWI+TSSVT  GRD +L
Sbjct  241  QVPMTMVFTKCDKRKKKKNGGKRPEENIKEFQDLIQGFFETTPPWIMTSSVTNQGRDEIL  300

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  301  LHMAQLRNYW  310



>emb|CDX97114.1| BnaC09g45110D [Brassica napus]
Length=321

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 54/70 (77%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            Q+PMT VFTKCDK K  K     P+ENI+EFQ+LI+  ++  PPWI+TSSVT  GRD +L
Sbjct  249  QVPMTMVFTKCDKRKKKKNGGKRPEENIKEFQDLIQGFFEATPPWIMTSSVTNQGRDEIL  308

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  309  LHMAQLRNYW  318



>ref|XP_006288237.1| hypothetical protein CARUB_v10001479mg [Capsella rubella]
 gb|EOA21135.1| hypothetical protein CARUB_v10001479mg [Capsella rubella]
Length=318

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 54/70 (77%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            Q+PMT +FTKCDK K  K     P+ENI+EFQ+LI+  ++  PPWI+TSSVT  GRD +L
Sbjct  246  QVPMTLIFTKCDKRKKKKNGGKKPEENIKEFQDLIQGFFETTPPWIMTSSVTNQGRDEIL  305

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  306  LHMAQLRNYW  315



>ref|XP_002873516.1| GTP binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49775.1| GTP binding protein [Arabidopsis lyrata subsp. lyrata]
Length=318

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 54/70 (77%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            Q+PMT +FTKCDK K  K     P+ENI+EFQ+LI+  ++  PPWI+TSSVT  GRD +L
Sbjct  246  QVPMTLIFTKCDKRKKKKNGGKKPEENIKEFQDLIQGFFETTPPWIMTSSVTNQGRDEIL  305

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  306  LHMAQLRNYW  315



>gb|EYU21879.1| hypothetical protein MIMGU_mgv1a009994mg [Erythranthe guttata]
Length=325

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 51/70 (73%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            QIPMT VFTKCDK K  K     P+EN+ +FQ LIR  +   PPWI+TSSVT  GRD +L
Sbjct  253  QIPMTLVFTKCDKRKKKKNGGKRPEENVHDFQALIRDFFTTAPPWIMTSSVTNQGRDEIL  312

Query  242  LHMSQLRNYW  271
            LHMSQLRNYW
Sbjct  313  LHMSQLRNYW  322



>ref|XP_006581419.1| PREDICTED: GTP-binding protein At2g22870-like isoform X1 [Glycine 
max]
 ref|XP_006581420.1| PREDICTED: GTP-binding protein At2g22870-like isoform X2 [Glycine 
max]
 ref|XP_006581421.1| PREDICTED: GTP-binding protein At2g22870-like isoform X3 [Glycine 
max]
Length=293

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 54/70 (77%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            QIPMT +FTKCDK K  K     P++N+ +FQ+LIR  ++ +PPWI+TSSVT  GRD +L
Sbjct  221  QIPMTLIFTKCDKRKKKKNGGKRPEDNVNDFQDLIRGFFQSVPPWIMTSSVTNQGRDEIL  280

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  281  LHMAQLRNYW  290



>emb|CDX69752.1| BnaA10g21010D [Brassica napus]
Length=321

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 54/70 (77%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            Q+PMT VFTKCDK K  K     P+ENI+EFQ+LI+  ++  PPWI+TSSVT  GRD +L
Sbjct  249  QVPMTMVFTKCDKRKKKKNGGKRPEENIKEFQDLIQGFFETTPPWIMTSSVTNQGRDEIL  308

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  309  LHMAQLRNYW  318



>ref|XP_009121941.1| PREDICTED: GTP-binding protein At2g22870-like [Brassica rapa]
Length=322

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 54/70 (77%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            Q+PMT VFTKCDK K  K     P+ENI+EFQ+LI+  ++  PPWI+TSSVT  GRD +L
Sbjct  250  QVPMTMVFTKCDKRKKKKNGGKRPEENIKEFQDLIQGFFETTPPWIMTSSVTNQGRDEIL  309

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  310  LHMAQLRNYW  319



>ref|XP_006399654.1| hypothetical protein EUTSA_v10014135mg [Eutrema salsugineum]
 gb|ESQ41107.1| hypothetical protein EUTSA_v10014135mg [Eutrema salsugineum]
Length=318

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 54/70 (77%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            Q+PMT VFTKCDK K  K     P+ENI+EFQ+LI+  ++  PPWI+TSSVT  GRD +L
Sbjct  246  QVPMTMVFTKCDKRKKKKNGGKKPEENIKEFQDLIQGFFETTPPWIMTSSVTNQGRDEIL  305

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  306  LHMAQLRNYW  315



>ref|XP_010667803.1| PREDICTED: GTP-binding protein At2g22870 [Beta vulgaris subsp. 
vulgaris]
Length=331

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 54/70 (77%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            +IPMT VFTKCDK K  K     P+EN++ FQELIR+ ++  PPWI+TSSVT  GRD +L
Sbjct  259  KIPMTLVFTKCDKRKKKKNGGKRPEENVQYFQELIREFFEAAPPWIMTSSVTNQGRDEIL  318

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  319  LHMAQLRNYW  328



>gb|KFK25410.1| hypothetical protein AALP_AA8G111200 [Arabis alpina]
Length=317

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 54/70 (77%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            Q+PMT VFTKCDK K  K     P+ENI+EFQ+LI+  ++  PPWI+TSSVT  GRD +L
Sbjct  245  QVPMTMVFTKCDKRKKKKNGGKRPEENIKEFQDLIQGFFETTPPWIMTSSVTNQGRDEIL  304

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  305  LHMAQLRNYW  314



>ref|XP_010419720.1| PREDICTED: GTP-binding protein At2g22870-like [Camelina sativa]
Length=318

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 54/70 (77%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            Q+PMT +FTKCDK K  K     P+ENI+EFQ+LI+  ++  PPWI+TSSVT  GRD +L
Sbjct  246  QVPMTMIFTKCDKRKKKKNGGKRPEENIKEFQDLIQGFFETTPPWIMTSSVTNQGRDEIL  305

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  306  LHMAQLRNYW  315



>ref|XP_010491882.1| PREDICTED: GTP-binding protein At2g22870-like [Camelina sativa]
Length=318

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 54/70 (77%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            Q+PMT +FTKCDK K  K     P+ENI+EFQ+LI+  ++  PPWI+TSSVT  GRD +L
Sbjct  246  QVPMTMIFTKCDKRKKKKNGGKRPEENIKEFQDLIQGFFETTPPWIMTSSVTNQGRDEIL  305

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  306  LHMAQLRNYW  315



>ref|XP_010453192.1| PREDICTED: GTP-binding protein At2g22870-like [Camelina sativa]
Length=318

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 54/70 (77%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            Q+PMT +FTKCDK K  K     P+ENI+EFQ+LI+  ++  PPWI+TSSVT  GRD +L
Sbjct  246  QVPMTMIFTKCDKRKKKKNGGKRPEENIKEFQDLIQGFFETTPPWIMTSSVTNQGRDEIL  305

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  306  LHMAQLRNYW  315



>ref|XP_006644662.1| PREDICTED: GTP-binding protein At2g22870-like [Oryza brachyantha]
Length=309

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            ++PMT VFTKCDK K  K     P+EN+  FQ LIR+ ++  PPWI+TSSVT  GRD +L
Sbjct  237  KVPMTLVFTKCDKRKKKKNGGKRPEENVENFQSLIREYFEAAPPWIMTSSVTNQGRDEIL  296

Query  242  LHMSQLRNYW  271
            LHMSQLRNYW
Sbjct  297  LHMSQLRNYW  306



>ref|NP_001044154.1| Os01g0732200 [Oryza sativa Japonica Group]
 dbj|BAD87429.1| putative GTP-binding protein [Oryza sativa Japonica Group]
 dbj|BAF06068.1| Os01g0732200 [Oryza sativa Japonica Group]
 dbj|BAG90474.1| unnamed protein product [Oryza sativa Japonica Group]
Length=316

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            ++PMT VFTKCDK K  K     P+EN+  FQ LIR+ ++  PPWI+TSSVT  GRD +L
Sbjct  244  KVPMTLVFTKCDKRKKKKNGGKRPEENVENFQSLIREYFEAAPPWIMTSSVTNQGRDEIL  303

Query  242  LHMSQLRNYW  271
            LHMSQLRNYW
Sbjct  304  LHMSQLRNYW  313



>gb|KHG18361.1| GTP-binding -like protein [Gossypium arboreum]
Length=311

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 54/70 (77%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            Q+PMT +FTKCDK K  K     P+EN+++FQELI   ++ +PPWI+TSSVT  GRD +L
Sbjct  239  QVPMTLIFTKCDKRKKKKNGGKRPEENVKDFQELICGFFQTVPPWIMTSSVTNQGRDEIL  298

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  299  LHMAQLRNYW  308



>ref|XP_002456299.1| hypothetical protein SORBIDRAFT_03g033710 [Sorghum bicolor]
 gb|EES01419.1| hypothetical protein SORBIDRAFT_03g033710 [Sorghum bicolor]
Length=312

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            ++PMT VFTKCDK K  K     P+EN+  FQ LIR+ ++  PPWI+TSSVT  GRD +L
Sbjct  240  KVPMTLVFTKCDKRKKKKNGGRRPEENVETFQSLIREYFEAAPPWIMTSSVTNQGRDEIL  299

Query  242  LHMSQLRNYW  271
            LHMSQLRNYW
Sbjct  300  LHMSQLRNYW  309



>ref|XP_006450618.1| hypothetical protein CICLE_v10009000mg [Citrus clementina]
 ref|XP_006476147.1| PREDICTED: GTP-binding protein At2g22870-like isoform X1 [Citrus 
sinensis]
 ref|XP_006476148.1| PREDICTED: GTP-binding protein At2g22870-like isoform X2 [Citrus 
sinensis]
 gb|ESR63858.1| hypothetical protein CICLE_v10009000mg [Citrus clementina]
 gb|KDO79708.1| hypothetical protein CISIN_1g021764mg [Citrus sinensis]
 gb|KDO79709.1| hypothetical protein CISIN_1g021764mg [Citrus sinensis]
 gb|KDO79710.1| hypothetical protein CISIN_1g021764mg [Citrus sinensis]
Length=308

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 53/70 (76%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            QIPMT VFTKCDK K  K     P+EN+ +FQELI+  ++  PPWI+TSSVT  GRD +L
Sbjct  236  QIPMTLVFTKCDKRKKKKNGGKRPEENLNDFQELIQGFFQTAPPWIMTSSVTNQGRDEIL  295

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  296  LHMAQLRNYW  305



>ref|XP_004501191.1| PREDICTED: GTP-binding protein At2g22870-like [Cicer arietinum]
Length=300

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 55/70 (79%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            QIPMT +FTKCDK K  K     P++N+ +FQ+LIR +++ +PPWI+TS+VT  GRD +L
Sbjct  228  QIPMTLIFTKCDKRKKKKNGGKRPEDNVNDFQDLIRGSFETVPPWIMTSNVTHQGRDEIL  287

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  288  LHMAQLRNYW  297



>gb|KDP34218.1| hypothetical protein JCGZ_07789 [Jatropha curcas]
Length=317

 Score = 79.7 bits (195),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 53/70 (76%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            QIPMT +FTKCDK K  K     P+EN+ +FQELIR  ++  PPWI+TSSVT  GRD +L
Sbjct  245  QIPMTLIFTKCDKRKKKKNGGKRPEENVSDFQELIRGFFETAPPWIMTSSVTNQGRDEIL  304

Query  242  LHMSQLRNYW  271
            LH++QLRNYW
Sbjct  305  LHVAQLRNYW  314



>ref|XP_004969851.1| PREDICTED: GTP-binding protein At2g22870-like [Setaria italica]
Length=315

 Score = 79.7 bits (195),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            ++PMT VFTKCDK K  K     P+EN+  FQ LIR+ ++  PPWI+TSSVT  GRD +L
Sbjct  243  KVPMTLVFTKCDKRKKKKNGGRRPEENVETFQSLIREYFEAAPPWIMTSSVTNQGRDEIL  302

Query  242  LHMSQLRNYW  271
            LHMSQLRNYW
Sbjct  303  LHMSQLRNYW  312



>ref|XP_003603604.1| Ribosome biogenesis GTP-binding protein YsxC [Medicago truncatula]
 gb|AES73855.1| ribosome biogenesis GTP-binding protein YsxC [Medicago truncatula]
Length=301

 Score = 79.3 bits (194),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 55/70 (79%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            +IPMT +FTKCDK K  K     P++N+ +FQELIR +++ +PPWI+TS+VT  GRD +L
Sbjct  229  KIPMTLIFTKCDKRKKKKNGGKRPEDNVNDFQELIRGSFETVPPWIMTSNVTHQGRDEIL  288

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  289  LHMAQLRNYW  298



>ref|XP_009604483.1| PREDICTED: GTP-binding protein At2g22870 [Nicotiana tomentosiformis]
Length=319

 Score = 79.3 bits (194),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 55/70 (79%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            QIPMT VFTKCDK K  K     P+EN+++F +LI++ ++ +PPWI+TSSVT  GRD +L
Sbjct  247  QIPMTLVFTKCDKRKKKKNGGRRPEENLQDFLKLIQKFFQTVPPWIMTSSVTNQGRDEIL  306

Query  242  LHMSQLRNYW  271
            LHMSQLRNYW
Sbjct  307  LHMSQLRNYW  316



>gb|EEC71435.1| hypothetical protein OsI_03633 [Oryza sativa Indica Group]
 gb|EEE55341.1| hypothetical protein OsJ_03357 [Oryza sativa Japonica Group]
Length=344

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 51/69 (74%), Gaps = 3/69 (4%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLL  244
            +PMT VFTKCDK K  K     P+EN+  FQ LIR+ ++  PPWI+TSSVT  GRD +LL
Sbjct  273  VPMTLVFTKCDKRKKKKNGGKRPEENVENFQSLIREYFEAAPPWIMTSSVTNQGRDEILL  332

Query  245  HMSQLRNYW  271
            HMSQLRNYW
Sbjct  333  HMSQLRNYW  341



>gb|AAM64748.1| putative GTP-binding protein [Arabidopsis thaliana]
Length=318

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 53/70 (76%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            Q+PMT +FTKCDK K  K     P+ NI+EFQ+LI+  ++  PPWI+TSSVT  GRD +L
Sbjct  246  QVPMTLIFTKCDKRKKKKNGGKKPEANIKEFQDLIQGFFETTPPWIMTSSVTNQGRDEIL  305

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  306  LHMAQLRNYW  315



>ref|XP_008672318.1| PREDICTED: uncharacterized protein LOC100272283 isoform X1 [Zea 
mays]
 gb|ACF79056.1| unknown [Zea mays]
 gb|ACF80832.1| unknown [Zea mays]
 gb|ACG34972.1| GTP-binding protein [Zea mays]
 gb|ACN27435.1| unknown [Zea mays]
 tpg|DAA57770.1| TPA: GTP-binding protein [Zea mays]
Length=313

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            ++PMT VFTKCDK K  K     P+EN+  FQ LIR+ ++  PPWI+TSSVT  GRD +L
Sbjct  241  KVPMTLVFTKCDKRKKKKNGGRKPEENVETFQGLIREYFEAAPPWIMTSSVTNQGRDEIL  300

Query  242  LHMSQLRNYW  271
            LHMSQLRNYW
Sbjct  301  LHMSQLRNYW  310



>ref|NP_196709.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
 emb|CAB87708.1| putative GTP-binding protein [Arabidopsis thaliana]
 gb|AAL25554.1| AT5g11480/F15N18_70 [Arabidopsis thaliana]
 gb|AAN28859.1| At5g11480/F15N18_70 [Arabidopsis thaliana]
 gb|AED91684.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
Length=318

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 53/70 (76%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            Q+PMT +FTKCDK K  K     P+ NI+EFQ+LI+  ++  PPWI+TSSVT  GRD +L
Sbjct  246  QVPMTLIFTKCDKRKKKKNGGKKPEANIKEFQDLIQGFFETTPPWIMTSSVTNQGRDEIL  305

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  306  LHMAQLRNYW  315



>ref|XP_008466251.1| PREDICTED: GTP-binding protein At2g22870 [Cucumis melo]
 ref|XP_008466252.1| PREDICTED: GTP-binding protein At2g22870 [Cucumis melo]
 ref|XP_008466253.1| PREDICTED: GTP-binding protein At2g22870 [Cucumis melo]
Length=315

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 53/69 (77%), Gaps = 2/69 (3%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK--PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLL  244
            QIPMT +FTKCDK K  KT   P+EN+ +FQELI   ++  PPWI+TSSVT  GRD +LL
Sbjct  244  QIPMTIIFTKCDKRKKKKTGKRPEENVSDFQELISGFFQTTPPWIMTSSVTHQGRDEILL  303

Query  245  HMSQLRNYW  271
            HM+QLRNYW
Sbjct  304  HMAQLRNYW  312



>ref|XP_003569733.1| PREDICTED: GTP-binding protein At2g22870 [Brachypodium distachyon]
Length=335

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            ++PMT VFTKCDK K  K     P+EN+  FQ LIR+ ++  PPWI+TSSVT  GRD +L
Sbjct  263  KVPMTLVFTKCDKRKKKKNGGRRPEENVEYFQNLIREYFEAAPPWIMTSSVTNQGRDEIL  322

Query  242  LHMSQLRNYW  271
            LHMSQLRNYW
Sbjct  323  LHMSQLRNYW  332



>ref|XP_006356644.1| PREDICTED: GTP-binding protein At2g22870-like [Solanum tuberosum]
Length=319

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 55/70 (79%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            +IPMT VFTKCDK K  KT    P+EN+++F ELI++ ++  PPWI+TSSVT  GRD +L
Sbjct  247  KIPMTIVFTKCDKRKKKKTGGKKPEENLQDFLELIQKFFQTAPPWIMTSSVTNQGRDEIL  306

Query  242  LHMSQLRNYW  271
            LHMSQLRNYW
Sbjct  307  LHMSQLRNYW  316



>ref|XP_004245257.1| PREDICTED: GTP-binding protein At2g22870 [Solanum lycopersicum]
Length=319

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 55/70 (79%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            +IPMT VFTKCDK K  KT    P+EN+++F ELI++ ++  PPWI+TSSVT  GRD +L
Sbjct  247  KIPMTIVFTKCDKRKKKKTGGKKPEENLQDFLELIQKFFQTAPPWIMTSSVTNQGRDEIL  306

Query  242  LHMSQLRNYW  271
            LHMSQLRNYW
Sbjct  307  LHMSQLRNYW  316



>ref|XP_002284246.1| PREDICTED: GTP-binding protein At2g22870 [Vitis vinifera]
 emb|CBI20898.3| unnamed protein product [Vitis vinifera]
Length=307

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            QIPMT +FTKCDK K  K     P+EN+ +FQ LIR  ++  PPWI+TSSV+  GRD +L
Sbjct  235  QIPMTLIFTKCDKRKKKKNGGKRPEENVEDFQGLIRDFFQTAPPWIMTSSVSNQGRDEIL  294

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  295  LHMAQLRNYW  304



>ref|NP_001140242.1| uncharacterized protein LOC100272283 [Zea mays]
 gb|ACF83417.1| unknown [Zea mays]
 tpg|DAA57771.1| TPA: hypothetical protein ZEAMMB73_007341 [Zea mays]
Length=354

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            ++PMT VFTKCDK K  K     P+EN+  FQ LIR+ ++  PPWI+TSSVT  GRD +L
Sbjct  282  KVPMTLVFTKCDKRKKKKNGGRKPEENVETFQGLIREYFEAAPPWIMTSSVTNQGRDEIL  341

Query  242  LHMSQLRNYW  271
            LHMSQLRNYW
Sbjct  342  LHMSQLRNYW  351



>ref|XP_004136299.1| PREDICTED: GTP-binding protein At2g22870-like [Cucumis sativus]
 gb|KGN60199.1| hypothetical protein Csa_3G888580 [Cucumis sativus]
Length=316

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            QIPMT +FTKCDK K  K     P+EN+ +FQELI   ++  PPWI+TSSVT  GRD +L
Sbjct  244  QIPMTIIFTKCDKRKKKKNGGKRPEENVSDFQELISGFFQTTPPWIMTSSVTHQGRDEIL  303

Query  242  LHMSQLRNYW  271
            LH++QLRNYW
Sbjct  304  LHIAQLRNYW  313



>ref|XP_008337082.1| PREDICTED: LOW QUALITY PROTEIN: GTP-binding protein At2g22870-like 
[Malus domestica]
Length=346

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            QIPMT +F KCDK K  +      +EN+++FQELI   +K +PPWI+TSS+T  GRD +L
Sbjct  274  QIPMTMIFXKCDKRKKKRHGGKKAEENVQDFQELISSFFKTVPPWIMTSSLTNQGRDEML  333

Query  242  LHMSQLRNYW  271
            LHM+QLRNYW
Sbjct  334  LHMAQLRNYW  343



>ref|XP_001776319.1| predicted protein [Physcomitrella patens]
 gb|EDQ58818.1| predicted protein [Physcomitrella patens]
Length=222

 Score = 69.7 bits (169),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 47/70 (67%), Gaps = 3/70 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            +IP+T VFTKCD+ K  K     P ENI +F + ++  Y  IPPW++TSS T  GR+ LL
Sbjct  151  KIPVTIVFTKCDRKKKKKNGGRKPQENIEDFLDRLKPLYDEIPPWVMTSSATNQGREELL  210

Query  242  LHMSQLRNYW  271
             H++QLR +W
Sbjct  211  RHIAQLRIFW  220



>ref|XP_001759525.1| predicted protein [Physcomitrella patens]
 gb|EDQ75827.1| predicted protein [Physcomitrella patens]
Length=222

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 3/72 (4%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            +IP+T VFTKCD+ K  K     P+ENI++F + I+  Y   PPWI+TSS T  G++ LL
Sbjct  151  KIPVTIVFTKCDRKKKKKNGGRKPEENIKDFLDRIKPLYAETPPWIMTSSETNQGKEELL  210

Query  242  LHMSQLRNYWDS  277
             H++QLR  W S
Sbjct  211  RHIAQLRILWAS  222



>gb|EPS69928.1| hypothetical protein M569_04833, partial [Genlisea aurea]
Length=249

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 51/71 (72%), Gaps = 4/71 (6%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTK---PDENIREFQELIRQNYKHIPP-WILTSSVTGLGRDGL  238
            QIP T VFTKCDK K  K+     +EN+ +FQ L+  +  H PP WI+TSSVT +GR+ +
Sbjct  176  QIPTTLVFTKCDKRKKKKSGGKRAEENVEDFQRLMIGDVFHTPPPWIMTSSVTNVGREEI  235

Query  239  LLHMSQLRNYW  271
            LLHMSQLRNYW
Sbjct  236  LLHMSQLRNYW  246



>ref|XP_007026131.1| Uncharacterized protein TCM_030265 [Theobroma cacao]
 gb|EOY28753.1| Uncharacterized protein TCM_030265 [Theobroma cacao]
Length=61

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  131  PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            P+EN+  FQELIR  ++  PPWI+TS+VT  GRD +LLHM+
Sbjct  21   PEENVSAFQELIRGFFQTAPPWIMTSNVTNQGRDEILLHMA  61



>ref|WP_022218785.1| probable GTP-binding protein EngB [Bacteroides clarus CAG:160]
 emb|CDB81551.1| probable GTP-binding protein EngB [Bacteroides clarus CAG:160]
Length=202

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P   VFTK DK+KGG+   + NIR + E +R+ ++ +PP+ +TSS   +GRD LL ++ 
Sbjct  135  VPFAIVFTKADKLKGGRI--NSNIRHYLEKLREQWEELPPYFVTSSENRMGRDELLGYIE  192

Query  254  QL  259
            Q+
Sbjct  193  QI  194



>ref|WP_005653804.1| MULTISPECIES: GTP-binding protein YsxC [Bacteroides]
 gb|EDS15777.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides stercoris 
ATCC 43183]
 emb|CDA49379.1| probable GTP-binding protein EngB [Bacteroides stercoris CAG:120]
Length=202

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 44/70 (63%), Gaps = 2/70 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P   VFTK DK+KGG+   + NIR + E +R+ ++ +PP  +TSS   +GRD LL ++ 
Sbjct  135  VPFAIVFTKADKLKGGRI--NSNIRHYLEKLREQWEELPPHFITSSENRMGRDELLGYIE  192

Query  254  QLRNYWDSDS  283
            Q+    +S S
Sbjct  193  QINKEINSKS  202



>ref|XP_005851375.1| hypothetical protein CHLNCDRAFT_17068, partial [Chlorella variabilis]
 gb|EFN59273.1| hypothetical protein CHLNCDRAFT_17068, partial [Chlorella variabilis]
Length=205

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQEL-IRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            IP T VFTK DK K G +  D+NI  F+++ +     + PP +LTSS +G GR  LL H+
Sbjct  137  IPFTVVFTKLDKRKKGASPSDDNIAAFEQVWLGWACGYAPPTVLTSSKSGKGRSELLAHV  196

Query  251  SQLRNYWD  274
            +QLR  ++
Sbjct  197  AQLRELFN  204



>ref|WP_016662884.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides stercoris]
 gb|EPH14950.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides stercoris 
CC31F]
Length=202

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 44/70 (63%), Gaps = 2/70 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P   VFTK DK+KGG+   + NIR + E +R+ ++ +PP  +TSS   +GRD LL ++ 
Sbjct  135  VPFAIVFTKADKLKGGRI--NSNIRHYLEKLREQWEELPPHFITSSENRMGRDELLDYIE  192

Query  254  QLRNYWDSDS  283
            Q+    +S S
Sbjct  193  QINKEINSKS  202



>ref|WP_025069088.1| GTP-binding protein [Bacteroides gallinarum]
Length=202

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P   VFTK DK+KGGK   + NIR + E + + ++ +PP+ +TSS + +GRD LL ++ 
Sbjct  135  VPFAIVFTKADKLKGGKV--NSNIRRYLEKLHEQWEELPPYFVTSSESRMGRDELLDYIE  192

Query  254  QL  259
            ++
Sbjct  193  RI  194



>ref|XP_003063845.1| hypothetical protein MICPUCDRAFT_53567 [Micromonas pusilla CCMP1545]
 gb|EEH52218.1| hypothetical protein MICPUCDRAFT_53567 [Micromonas pusilla CCMP1545]
Length=526

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 44/70 (63%), Gaps = 4/70 (6%)
 Frame = +2

Query  74   IPMTFVFTKCDKMK----GGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            IP++ VFTK DK +    G + KP+EN+  F   + + ++ +PP I TSS TG G+  LL
Sbjct  449  IPVSIVFTKVDKKRKVKSGKRAKPEENVEAFCREVSEYWEEMPPMIFTSSKTGDGKAALL  508

Query  242  LHMSQLRNYW  271
             H++ LR ++
Sbjct  509  NHVATLRQFF  518



>ref|WP_031532645.1| MULTISPECIES: GTP-binding protein [Bacteroides]
Length=202

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            IP   VFTK DK+  GK K   N++++   I+Q+++ +PP+ +TSS + LGRD LL ++ 
Sbjct  135  IPFAIVFTKADKLTNGKNKS--NVQKYLAKIKQSWEELPPYFITSSESRLGRDELLDYID  192

Query  254  QL  259
            Q+
Sbjct  193  QI  194



>ref|WP_009121121.1| GTP-binding protein YsxC [Bacteroides clarus]
 gb|EGF53417.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides clarus 
YIT 12056]
Length=202

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P   VFTK DK+KGG+   + NIR + E + + ++ +PP+ +TSS   +GRD LL ++ 
Sbjct  135  VPFAIVFTKADKLKGGRI--NSNIRHYLEKLHEQWEELPPYFVTSSENRMGRDELLGYIE  192

Query  254  QL  259
            Q+
Sbjct  193  QI  194



>ref|WP_004290834.1| MULTISPECIES: GTP-binding protein YsxC [Bacteroides]
 gb|EEC53593.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides eggerthii 
DSM 20697]
 gb|EFV29343.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides eggerthii 
1_2_48FAA]
 emb|CCY57443.1| probable GTP-binding protein EngB [Bacteroides eggerthii CAG:109]
Length=202

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P   VFTK DK+KGGK   + NIR + E + + ++ +PP+ +TSS   +GR+ LL ++ 
Sbjct  135  VPFAIVFTKADKLKGGKI--NSNIRHYLEKLHEQWEELPPYFVTSSENRMGREELLNYIE  192

Query  254  QL  259
            Q+
Sbjct  193  QI  194



>ref|XP_001422673.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00990.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=253

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 42/70 (60%), Gaps = 4/70 (6%)
 Frame = +2

Query  74   IPMTFVFTKCDKMK----GGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            +P+T VFTK DK K    G +  P EN+ EF   + + +  +PP + TSSV G G+  +L
Sbjct  144  VPVTVVFTKVDKRKKVGAGKRANPAENVEEFCREVSEYWDELPPMLYTSSVNGEGKREVL  203

Query  242  LHMSQLRNYW  271
             H++ LR ++
Sbjct  204  NHIATLRQFF  213



>ref|XP_002505802.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67060.1| predicted protein [Micromonas sp. RCC299]
Length=531

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 27/70 (39%), Positives = 42/70 (60%), Gaps = 4/70 (6%)
 Frame = +2

Query  74   IPMTFVFTKCDKMK----GGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            IP+T VFTK DK +    G +  P+EN+  F   + + +  +PP I TSS TG G+  +L
Sbjct  436  IPVTVVFTKVDKKRKVKSGKRANPEENVEAFCREVSEYWDELPPMIFTSSKTGDGKQAVL  495

Query  242  LHMSQLRNYW  271
             H++ LR ++
Sbjct  496  NHVATLRQFF  505



>ref|XP_002978916.1| hypothetical protein SELMODRAFT_110012 [Selaginella moellendorffii]
 gb|EFJ19873.1| hypothetical protein SELMODRAFT_110012 [Selaginella moellendorffii]
Length=244

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  131  PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMSQLRNYWDS  277
            P +N+ EF + +R       PWILTS VTG GRD L++H+ + RNYW S
Sbjct  196  PVDNVVEFLQQMRLVTTQTYPWILTSCVTGQGRDELMMHIEEFRNYWHS  244



>ref|XP_002991476.1| hypothetical protein SELMODRAFT_133692 [Selaginella moellendorffii]
 gb|EFJ07398.1| hypothetical protein SELMODRAFT_133692 [Selaginella moellendorffii]
Length=244

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  131  PDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMSQLRNYWDS  277
            P +N+ EF + +R       PWILTS VTG GRD L++H+ + RNYW S
Sbjct  196  PVDNVVEFLQEMRLVTTQTYPWILTSCVTGQGRDELMMHIEEFRNYWHS  244



>ref|WP_013548092.1| GTP-binding protein YsxC [Bacteroides helcogenes]
 ref|YP_004162090.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides helcogenes 
P 36-108]
 gb|ADV44504.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides helcogenes 
P 36-108]
Length=201

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 44/68 (65%), Gaps = 2/68 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P   VFTK DKMKGG+   + NIR++ + + + ++ +PP+ +TSS   +GR+ LL ++ 
Sbjct  135  VPFAIVFTKGDKMKGGRL--NANIRQYLKKLEEQWEELPPYFITSSENRMGREELLDYIE  192

Query  254  QLRNYWDS  277
            ++    +S
Sbjct  193  KINKELNS  200



>ref|WP_004331577.1| GTP-binding protein YsxC [Porphyromonas asaccharolytica]
 ref|YP_004442346.1| GTP-binding protein engB [Porphyromonas asaccharolytica DSM 20707]
 gb|EFR34156.1| ribosome biogenesis GTP-binding protein YsxC [Porphyromonas asaccharolytica 
PR426713P-I]
 gb|AEE13178.1| GTP-binding protein engB [Porphyromonas asaccharolytica DSM 20707]
Length=203

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            IP + VFTK DK+  GK    + +  +Q  + ++++ +PP  +TS+ TGLGRD LL ++ 
Sbjct  135  IPFSIVFTKADKI--GKQVQRDAVEAYQSRLLEDWEELPPLFVTSASTGLGRDELLDYIE  192

Query  254  QL  259
            QL
Sbjct  193  QL  194



>ref|XP_001697009.1| hypothetical protein CHLREDRAFT_150723 [Chlamydomonas reinhardtii]
 gb|EDP00701.1| predicted protein [Chlamydomonas reinhardtii]
Length=276

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 42/70 (60%), Gaps = 2/70 (3%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTKP--DENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLL  244
            ++P T VFTK DK + G T    D ++  F+  + Q+  ++PP +LTS+  GLGR  LL 
Sbjct  194  EVPFTIVFTKADKRRKGLTAAVRDSHVTAFKRALLQDLAYLPPSLLTSAAKGLGRGELLS  253

Query  245  HMSQLRNYWD  274
             ++ LR  ++
Sbjct  254  FIAGLRVAYE  263



>ref|XP_001420069.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO98362.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=201

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 36/66 (55%), Gaps = 0/66 (0%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            + P T VFTKCD+ K G    DEN    +  + + +  +P  I TSSVT  GRD +L  +
Sbjct  136  ETPFTIVFTKCDRDKPGMPSVDENKAALRRKLDEKWHRLPSMISTSSVTAEGRDEVLKFV  195

Query  251  SQLRNY  268
            S L  Y
Sbjct  196  SSLIVY  201



>ref|WP_007366088.1| GTP-binding protein YsxC [Porphyromonas uenonis]
 gb|EEK16022.1| ribosome biogenesis GTP-binding protein YsxC [Porphyromonas uenonis 
60-3]
Length=203

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            IP + VFTK DK+  GK    E +  ++  + ++++ +PP  +TS+ TG+GRD LL ++ 
Sbjct  135  IPFSIVFTKADKI--GKQVQQEAVEAYRSRLLEDWEELPPLFVTSASTGMGRDELLDYID  192

Query  254  QL  259
            QL
Sbjct  193  QL  194



>ref|WP_022339433.1| probable GTP-binding protein EngB [Bacteroides sp. CAG:714]
 emb|CDD32872.1| probable GTP-binding protein EngB [Bacteroides sp. CAG:714]
Length=202

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 37/62 (60%), Gaps = 2/62 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            IP   VFTK DK   GKTK   N+  + E +RQ ++ +PP+ +TSS    GR  LL ++ 
Sbjct  135  IPFAIVFTKADKQSVGKTKA--NVTRYLETLRQQWEELPPYFVTSSEKKTGRQELLDYIE  192

Query  254  QL  259
            ++
Sbjct  193  EI  194



>gb|KGE86069.1| GTP-binding protein [Phaeodactylibacter xiamenensis]
Length=205

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 43/63 (68%), Gaps = 2/63 (3%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            QIP   V+TK D++K  +   ++N+ + ++ I Q+++ +PP  +TSS TGLGR+ LL ++
Sbjct  134  QIPFAIVYTKADRLKPQEL--EDNLAQIRKAILQHWESLPPEFITSSNTGLGREELLAYI  191

Query  251  SQL  259
             Q+
Sbjct  192  DQV  194



>ref|WP_018709904.1| GTP-binding protein YsxC [Bacteroides barnesiae]
Length=202

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 37/62 (60%), Gaps = 2/62 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            IP   VFTK DK   GKTK   N+  + E +RQ ++ +PP+ +TSS    GR  LL ++ 
Sbjct  135  IPFAIVFTKADKQSVGKTKT--NVTRYLETLRQQWEELPPYFVTSSEKKTGRQELLDYIE  192

Query  254  QL  259
            ++
Sbjct  193  EI  194



>ref|WP_022102609.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella sp. 
CAG:5226]
 emb|CDA44163.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella sp. 
CAG:5226]
Length=199

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 39/62 (63%), Gaps = 2/62 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P   +FTK DK K G+ K  +N+  F + + + ++ +PP+ +TSS TG GRD  L ++ 
Sbjct  135  VPFGIIFTKADKPKRGELK--KNVERFLQTLHEEWEELPPYFITSSDTGQGRDEFLDYIE  192

Query  254  QL  259
            Q+
Sbjct  193  QI  194



>ref|WP_035123358.1| GTP-binding protein [Flavobacterium aquatile]
 gb|KGD69299.1| GTP-binding protein [Flavobacterium aquatile LMG 4008]
Length=206

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 42/64 (66%), Gaps = 3/64 (5%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTKPDENIREFQ-ELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
            +IP   VFTK DK+   KTK D ++  ++ +LI  N++ +PP+ +TS+  G G+D LL +
Sbjct  134  EIPFCIVFTKADKI--SKTKIDSHVAAYKKQLIAHNWEEMPPYFVTSATEGTGKDTLLNY  191

Query  248  MSQL  259
            + ++
Sbjct  192  IEEI  195



>ref|WP_021896428.1| probable GTP-binding protein EngB [Prevotella sp. CAG:924]
 emb|CCY03514.1| probable GTP-binding protein EngB [Prevotella sp. CAG:924]
Length=198

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 39/63 (62%), Gaps = 2/63 (3%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            QIP + +FTK DK+  G+ K  EN   + E ++  ++ +PP+ +TSS    GRD +L ++
Sbjct  134  QIPFSIIFTKADKL--GRVKARENAEAWMEALKDTWETLPPYFITSSQDRTGRDEVLDYI  191

Query  251  SQL  259
             Q+
Sbjct  192  EQI  194



>ref|WP_007133515.1| GTP-binding protein YsxC [Prevotella salivae]
 gb|EFV05645.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella salivae 
DSM 15606]
Length=198

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P T VFTK DK+  GK K  +N +++   ++  ++ +PP+ +TSS   LGRD LL ++ 
Sbjct  135  VPFTIVFTKADKLGAGKAK--QNAQKWMNQLKDRWETLPPYFITSSEKKLGRDELLDYID  192

Query  254  QL  259
            ++
Sbjct  193  EI  194



>ref|WP_021825503.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella salivae]
 gb|ERK00764.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella salivae 
F0493]
Length=198

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P T VFTK DK+  GK K  +N +++   ++  ++ +PP+ +TSS   LGRD LL ++ 
Sbjct  135  VPFTIVFTKADKLGAGKAK--QNAQKWMNQLKDRWETLPPYFITSSEKKLGRDELLDYID  192

Query  254  QL  259
            ++
Sbjct  193  EI  194



>gb|ETZ20570.1| GTP-binding protein YsxC [Pedobacter sp. V48]
Length=209

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%), Gaps = 2/63 (3%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            QIP   VFTK DK    KT  D+N+  F++ ++  ++ IPP+ +TS+    GRD +L  +
Sbjct  134  QIPFALVFTKADKQSAVKT--DQNVSAFKKALKGWFEEIPPYFVTSAEKSTGRDQVLDFI  191

Query  251  SQL  259
             Q+
Sbjct  192  DQV  194



>ref|WP_008242992.1| GTP-binding protein YsxC [Pedobacter sp. BAL39]
 gb|EDM35827.1| GTPase EngB [Pedobacter sp. BAL39]
Length=209

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%), Gaps = 2/63 (3%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            QIP   +FTK DK    K K D+N+  F++ +   ++ IPP+ +TS+   LGRD +L  +
Sbjct  134  QIPFALIFTKADKQ--SKVKTDQNVAAFKKALGGWFEEIPPYFVTSAEKALGRDEVLKFI  191

Query  251  SQL  259
            S +
Sbjct  192  SDV  194



>ref|WP_009036961.1| GTP-binding protein YsxC [Bacteroides sp. D20]
 gb|EFA21477.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides sp. 
D20]
Length=202

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/68 (34%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P   VFTK DK+KGG+   + +I E+ E +++ ++ +PP+ +TSS   +GR  LL ++ 
Sbjct  135  VPFAIVFTKADKLKGGRL--NTHINEYLEQLKEQWEELPPYFITSSENRMGRKELLDYIE  192

Query  254  QLRNYWDS  277
             +    +S
Sbjct  193  SINKSLNS  200



>gb|KDS50923.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides uniformis 
str. 3978 T3 ii]
 gb|KDS56011.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides uniformis 
str. 3978 T3 i]
 gb|KDS56988.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides uniformis 
str. 3978 T3 i]
 gb|KDS61349.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides uniformis 
str. 3978 T3 i]
Length=188

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/68 (34%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P   VFTK DK+KGG+   + +I E+ E +++ ++ +PP+ +TSS   +GR  LL ++ 
Sbjct  121  VPFAIVFTKADKLKGGRL--NTHINEYLEQLKEQWEELPPYFITSSENRMGRKELLDYIE  178

Query  254  QLRNYWDS  277
             +    +S
Sbjct  179  SINKSLNS  186



>ref|WP_005836522.1| MULTISPECIES: GTP-binding protein YsxC [Bacteroides]
 gb|EIY72308.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides uniformis 
CL03T00C23]
 gb|EIY79057.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides uniformis 
CL03T12C37]
 gb|EOS09645.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides uniformis 
dnLKV2]
 emb|CDE03265.1| probable GTP-binding protein EngB [Bacteroides uniformis CAG:3]
Length=202

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/68 (34%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P   VFTK DK+KGG+   + +I E+ E +++ ++ +PP+ +TSS   +GR  LL ++ 
Sbjct  135  VPFAIVFTKADKLKGGRL--NTHINEYLEQLKEQWEELPPYFITSSENRMGRKELLDYIE  192

Query  254  QLRNYWDS  277
             +    +S
Sbjct  193  SINKSLNS  200



>ref|WP_025835928.1| GTP-binding protein [Bacteroides rodentium]
Length=202

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/68 (34%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P   VFTK DK+KGG+   + +I E+ E +++ ++ +PP+ +TSS   +GR  LL ++ 
Sbjct  135  VPFAIVFTKADKLKGGRL--NTHINEYLEQLKEQWEELPPYFITSSENRMGRKELLDYIE  192

Query  254  QLRNYWDS  277
             +    +S
Sbjct  193  SINKSLNS  200



>ref|WP_022354146.1| probable GTP-binding protein EngB [Bacteroides sp. CAG:875]
 emb|CDD48797.1| probable GTP-binding protein EngB [Bacteroides sp. CAG:875]
Length=203

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 39/62 (63%), Gaps = 2/62 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            IP   +FTK DK   GKTK   N+  + E +++ ++ +PP+ ++SS   +GR+ +L ++ 
Sbjct  135  IPFALIFTKADKQSAGKTKV--NVNRYLEKLKEQWEELPPYFVSSSENKIGREEILNYIE  192

Query  254  QL  259
            Q+
Sbjct  193  QI  194



>gb|EFV26692.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides sp. 
4_1_36]
Length=219

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/68 (34%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P   VFTK DK+KGG+   + +I E+ E +++ ++ +PP+ +TSS   +GR  LL ++ 
Sbjct  152  VPFAIVFTKADKLKGGRL--NTHINEYLEQLKEQWEELPPYFITSSENRMGRKELLDYIE  209

Query  254  QLRNYWDS  277
             +    +S
Sbjct  210  SINKSLNS  217



>ref|WP_025882748.1| GTP-binding protein [Porphyromonas uenonis]
Length=203

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            IP + VFTK DK+  GK    E +  ++  + ++++ +PP  +TS+ TG+GRD +L ++ 
Sbjct  135  IPFSIVFTKADKI--GKQVQREAVEAYRSRLLEDWEELPPLFVTSASTGMGRDEVLDYID  192

Query  254  QL  259
            QL
Sbjct  193  QL  194



>ref|WP_027884343.1| GTP-binding protein [Mesonia mobilis]
Length=198

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 39/64 (61%), Gaps = 2/64 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            IP   +FTK DK+K      + NI ++Q+ + + +  +PP+ +TSS   +GRD LL ++ 
Sbjct  135  IPFAIIFTKVDKLKPNAL--ERNIEDYQKKLLETWASVPPYFVTSSSKEIGRDELLNYIE  192

Query  254  QLRN  265
            ++ N
Sbjct  193  EINN  196



>ref|WP_005777046.1| MULTISPECIES: GTP-binding protein YsxC [Bacteroides]
 gb|EFR52831.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
3_1_12]
 gb|EKA81723.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
HMW 616]
 gb|EKA92036.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
HMW 610]
 emb|CCZ38780.1| probable GTP-binding protein EngB [Bacteroides fragilis CAG:558]
 gb|KER50579.1| GTP-binding protein [Bacteroides fragilis]
 gb|KER53433.1| GTP-binding protein [Bacteroides fragilis]
 gb|KER61235.1| GTP-binding protein [Bacteroides fragilis]
 gb|KER75751.1| GTP-binding protein [Bacteroides fragilis]
 gb|KFX75218.1| GTP-binding protein [Bacteroides fragilis]
Length=201

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            IP + +FTK DK+KGG+ K   NI  + + +R+ ++ +PP+ +TSS   LGR  +L ++ 
Sbjct  135  IPFSIIFTKADKLKGGRLKM--NINAYLKELRKQWEELPPYFITSSEECLGRTEVLNYIE  192

Query  254  QL  259
             +
Sbjct  193  SI  194



>ref|WP_008256349.1| GTP-binding protein YsxC [Flavobacteria bacterium BAL38]
 gb|EAZ95572.1| GTPase EngB [Flavobacteria bacterium BAL38]
Length=206

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 44/64 (69%), Gaps = 3/64 (5%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTKPDENIREFQ-ELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
            +IP   +FTK DK+  GK K + ++  ++ +L+  ++  +PP+ +TSS+  +GR+G+L +
Sbjct  134  EIPFAIIFTKSDKL--GKNKVNNHVEAYKKQLLAGDWAEMPPYFVTSSLEAIGREGILEY  191

Query  248  MSQL  259
            ++Q+
Sbjct  192  INQI  195



>ref|WP_026724228.1| GTP-binding protein [Flavobacterium sasangense]
Length=206

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 44/64 (69%), Gaps = 3/64 (5%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTKPDENIREFQ-ELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
            +IP   +FTK DK+  GK K + ++  ++ +L+  ++  +PP+ +TSS+  +GR+G+L +
Sbjct  134  EIPFAIIFTKSDKL--GKNKVNNHVEAYKKQLLAGDWAEMPPYFVTSSLEAIGREGILEY  191

Query  248  MSQL  259
            ++Q+
Sbjct  192  INQI  195



>ref|WP_004374149.1| GTP-binding protein YsxC [Prevotella oris]
 gb|EFB31539.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella oris 
F0302]
 gb|EFI47730.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella oris 
C735]
Length=198

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P T VFTK DK+  GK K  +N +++ E ++  ++ +PP+ +TSS   LGR+ LL ++ 
Sbjct  135  VPFTIVFTKADKLGPGKAK--QNAQKWLEQLKDRWETLPPYYITSSEKKLGREELLAYID  192

Query  254  QL  259
            ++
Sbjct  193  EI  194



>ref|XP_003064849.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH51183.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=196

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
             +P T VFTKCD+ K G    +EN  EF+  + + +   P  I TSSV   GR+ +L  +
Sbjct  134  NVPFTIVFTKCDRDKPGMPSVEENKAEFEARLEERWHRSPSMIPTSSVNADGREDVLKFI  193

Query  251  SQL  259
            S +
Sbjct  194  SSI  196



>ref|WP_006744270.1| GTP-binding protein YsxC [Bacteroides coprosuis]
 gb|EGJ71113.1| GTP-binding protein engB [Bacteroides coprosuis DSM 18011]
Length=200

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 39/62 (63%), Gaps = 2/62 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            IP + VFTK DK+   K K D N+  F   +++ ++ +PP+ +TSS   +GRD +L ++ 
Sbjct  135  IPFSIVFTKGDKLT--KNKLDSNVEAFLNELKKQWEELPPYFITSSEKRMGRDEMLNYIE  192

Query  254  QL  259
            Q+
Sbjct  193  QI  194



>ref|WP_004348314.1| GTP-binding protein YsxC [Prevotella buccalis]
 gb|EFA92684.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella buccalis 
ATCC 35310]
Length=199

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 38/63 (60%), Gaps = 2/63 (3%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            +IP T VFTK DK+  G  K   N  ++ E +R  ++ +PP+ +TSS    GR+ LL ++
Sbjct  134  EIPFTIVFTKADKL--GTVKAKANAAQWMEQLRDAWEELPPYFITSSEKRTGREELLAYI  191

Query  251  SQL  259
             ++
Sbjct  192  DEI  194



>ref|WP_005787263.1| GTP-binding protein YsxC [Bacteroides fragilis]
 gb|EIY44770.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
CL03T12C07]
 gb|EIY47671.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
CL03T00C08]
 gb|EXZ14247.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. Ds-233]
Length=201

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 40/68 (59%), Gaps = 2/68 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            IP   +FTK DK+KGG+ K   NI  +   +R+ ++ +PP+ +TSS   LGR  +L ++ 
Sbjct  135  IPFAIIFTKADKLKGGRLKI--NINAYLRELRKQWEELPPYFITSSEERLGRTEVLNYIE  192

Query  254  QLRNYWDS  277
             +    +S
Sbjct  193  SINKELNS  200



>ref|XP_003082903.1| putative endonuclease (ISS), partial [Ostreococcus tauri]
Length=820

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/72 (38%), Positives = 41/72 (57%), Gaps = 6/72 (8%)
 Frame = +2

Query  74   IPMTFVFTKCDKMK----GGKTKPDENIREF--QELIRQNYKHIPPWILTSSVTGLGRDG  235
            IP+T VFTK DK K    G +  P E + EF  + +   ++  +PP I TSS T  G+  
Sbjct  63   IPVTIVFTKVDKRKKIAAGKRANPQETMEEFCREAMDNWDWDELPPMIYTSSETAEGKRE  122

Query  236  LLLHMSQLRNYW  271
            +L H++ LR ++
Sbjct  123  VLNHIASLRQFF  134



>ref|WP_022039417.1| probable GTP-binding protein EngB [Bacteroides sp. CAG:702]
 emb|CCZ71447.1| probable GTP-binding protein EngB [Bacteroides sp. CAG:702]
Length=199

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 34/56 (61%), Gaps = 2/56 (4%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLL  241
            +P   VFTK DK   GKTK  +N+  F + +++ ++ +PP+ +TSS    GR  LL
Sbjct  135  VPFALVFTKSDKQSAGKTK--QNVERFLDTLKEQWEELPPYFITSSEKKTGRQELL  188



>ref|WP_005794469.1| MULTISPECIES: GTP-binding protein YsxC [Bacteroides]
 ref|YP_099329.1| putative GTP-binding protein [Bacteroides fragilis YCH46]
 ref|YP_005111232.1| putative GTP-binding cell division protein [Bacteroides fragilis 
638R]
 sp|Q64UN4.1|ENGB_BACFR RecName: Full=Probable GTP-binding protein EngB [Bacteroides 
fragilis YCH46]
 dbj|BAD48795.1| putative GTP-binding protein [Bacteroides fragilis YCH46]
 gb|EES86002.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides sp. 
3_2_5]
 gb|EEZ27365.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides sp. 
2_1_16]
 emb|CBW22690.1| putative GTP-binding cell division protein [Bacteroides fragilis 
638R]
 gb|EGN07914.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides sp. 
2_1_56FAA]
 gb|EIK40117.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
CL07T00C01]
 gb|EIY96182.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
CL07T12C05]
 gb|EIY98071.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
CL05T00C42]
 gb|EIY98731.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
CL05T12C13]
 gb|EKA83230.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
HMW 615]
 emb|CDD45531.1| probable GTP-binding protein EngB [Bacteroides fragilis CAG:47]
 gb|EXY13383.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 1007-1-F #8]
 gb|EXY18451.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 2-F-2 #5]
 gb|EXY18531.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 2-F-2 #5]
 gb|EXY22357.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 2-F-2 #7]
 gb|EXY27728.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 3397 T10]
 gb|EXY36071.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 34-F-2 #13]
 gb|EXY41034.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 3774 T13]
 gb|EXY46651.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 3783N1-2]
 gb|EXY51436.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 3783N2-1]
 gb|EXY56230.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 3976T7]
 gb|EXY60679.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 3986T(B)10]
 gb|EXY63164.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 3986 N(B)19]
 gb|EXY74466.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 3988T(B)14]
 gb|EXY77818.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 3988 T1]
 gb|EXY84900.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 3996 N(B) 6]
 gb|EXY90778.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 3998T(B)3]
 gb|EXY95696.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 3998 T(B) 4]
 gb|EXZ00807.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. DS-166]
 gb|EXZ05742.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. DS-208]
 gb|EXZ10108.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. DS-71]
 gb|EXZ19469.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. J-143-4]
 gb|EXZ28762.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. S36L11]
 gb|EXZ34157.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 1007-1-F #4]
 gb|EXZ39379.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 1007-1-F #7]
 gb|EXZ44887.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 2-F-2 #4]
 gb|EXZ50130.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 3397 N2]
 gb|EXZ54201.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 3397 T14]
 gb|EXZ57942.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 3719 A10]
 gb|EXZ64189.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 3725 D9(v)]
 gb|EXZ67861.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 3783N1-8]
 gb|EXZ73503.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 3976T8]
 gb|EXZ78666.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 3-F-2 #6]
 gb|EXZ94742.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. Korea 419]
 gb|EYA00570.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. S23 R14]
 gb|EYA04870.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. S6L3]
 gb|EYA09509.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. S6R6]
 gb|EYA14933.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 1007-1-F #10]
 gb|EYA19058.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 1007-1-F #3]
 gb|EYA24682.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 1007-1-F #9]
 gb|EYA28121.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 1009-4-F #10]
 gb|EYA33897.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 1009-4-F #7]
 gb|EYA39186.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 20793-3]
 gb|EYA43517.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 3397 N3]
 gb|EYA48342.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 3719 T6]
 gb|EYA52832.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 3986 N(B)22]
 gb|EYA57526.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 3986 T(B)13]
 gb|EYA61540.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. A7 (UDC12-2)]
 gb|EYA66608.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. S23L24]
 gb|EYA71452.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. S24L15]
 gb|EYA75817.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. S24L26]
 gb|EYA80265.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. S24L34]
 gb|EYA85642.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. S36L12]
 gb|EYA90962.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. S36L5]
 gb|EYA96108.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. S38L5]
 gb|EYB00711.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. S6L8]
 gb|EYB05367.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. S6R5]
 gb|EYB10257.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 3783N1-6]
 gb|EYB14100.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. S38L3]
 gb|EYB19022.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. I1345]
 gb|EYE45302.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. S23L17]
 gb|EYE51149.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. S6L5]
 gb|EYE54469.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. S6R8]
 gb|EYE54893.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 1007-1-F #5]
 gb|EYE63967.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 1007-1-F #6]
 gb|EYE68215.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. 3986 N3]
Length=201

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 40/68 (59%), Gaps = 2/68 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            IP   +FTK DK+KGG+ K   NI  +   +R+ ++ +PP+ +TSS   LGR  +L ++ 
Sbjct  135  IPFAIIFTKADKLKGGRLKI--NISAYLRELRKQWEELPPYFITSSEERLGRTEVLNYIE  192

Query  254  QLRNYWDS  277
             +    +S
Sbjct  193  SINKELNS  200



>ref|WP_026718289.1| GTP-binding protein [Flavobacterium gelidilacus]
Length=206

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 38/58 (66%), Gaps = 3/58 (5%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTKPDENIREFQE-LIRQNYKHIPPWILTSSVTGLGRDGLL  241
            ++P   +FTK DK+  GKTK D +I  +++ L+  N+  +P +  TSS  GLGR+G+L
Sbjct  134  EVPFCIIFTKADKI--GKTKVDSHIAAYKKKLLANNWAEMPQYFTTSSTEGLGREGVL  189



>ref|WP_032529464.1| GTP-binding protein [Bacteroides fragilis]
 gb|KER48530.1| GTP-binding protein [Bacteroides fragilis]
Length=201

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 40/68 (59%), Gaps = 2/68 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            IP   +FTK DK+KGG+ K   NI  +   +R+ ++ +PP+ +TSS   LGR  +L ++ 
Sbjct  135  IPFAIIFTKADKLKGGRLKI--NISAYLRELRKQWEELPPYFITSSEERLGRTEVLNYIE  192

Query  254  QLRNYWDS  277
             +    +S
Sbjct  193  SINKELNS  200



>ref|XP_002953493.1| hypothetical protein VOLCADRAFT_82197 [Volvox carteri f. nagariensis]
 gb|EFJ45466.1| hypothetical protein VOLCADRAFT_82197 [Volvox carteri f. nagariensis]
Length=295

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 39/66 (59%), Gaps = 2/66 (3%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGG--KTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLL  244
            ++P T VFTK DK + G   +  D ++  F+  + Q+   +PP +LTS   GLGR  +L 
Sbjct  213  EVPFTLVFTKVDKRRKGVSSSACDSHVTAFKRALLQDLAFLPPSVLTSCAKGLGRGEMLN  272

Query  245  HMSQLR  262
             +++LR
Sbjct  273  FIARLR  278



>ref|WP_010992848.1| GTP-binding protein YsxC [Bacteroides fragilis]
 ref|YP_211727.1| putative GTP-binding cell division protein [Bacteroides fragilis 
NCTC 9343]
 sp|Q5LDL2.1|ENGB_BACFN RecName: Full=Probable GTP-binding protein EngB [Bacteroides 
fragilis NCTC 9343]
 emb|CAH07797.1| putative GTP-binding cell division protein [Bacteroides fragilis 
NCTC 9343]
Length=201

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 40/68 (59%), Gaps = 2/68 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            IP   +FTK DK+KGG+ K   NI  +   +R+ ++ +PP+ +TSS   LGR  +L ++ 
Sbjct  135  IPFAIIFTKADKLKGGRLKI--NISAYLRELRKQWEELPPYFITSSEERLGRTEVLNYIE  192

Query  254  QLRNYWDS  277
             +    +S
Sbjct  193  SINKELNS  200



>ref|WP_016562916.1| probable GTP-binding protein EngB [Bacteroides sp. CAG:927]
 emb|CCX47183.1| probable GTP-binding protein EngB [Bacteroides sp. CAG:927]
Length=200

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            IP + VFTK DKM  G     ++I ++ E + + ++ +PP  +TSS TG GR+ LL ++S
Sbjct  135  IPFSIVFTKTDKM--GTEVAKKHIADYCEKLLETWEELPPVFVTSSQTGRGREELLDYIS  192

Query  254  QL  259
            QL
Sbjct  193  QL  194



>ref|WP_032561286.1| GTP-binding protein [Bacteroides fragilis]
 gb|EXZ89079.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides fragilis 
str. J38-1]
Length=201

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 40/68 (59%), Gaps = 2/68 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            IP   +FTK DK+KGG+ K   NI  +   +R+ ++ +PP+ +TSS   LGR  +L ++ 
Sbjct  135  IPFAIIFTKADKLKGGRLKI--NISAYLRELRKQWEELPPYFITSSEERLGRTEVLNYIK  192

Query  254  QLRNYWDS  277
             +    +S
Sbjct  193  SINKELNS  200



>ref|WP_036879125.1| MULTISPECIES: GTP-binding protein [Prevotella]
 gb|KGF40863.1| GTP-binding protein [Prevotella buccalis DNF00985]
Length=199

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 38/63 (60%), Gaps = 2/63 (3%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            ++P T VFTK DK+  G  K   N  ++ E +R  ++ +PP+ +TSS    GR+ LL ++
Sbjct  134  EVPFTIVFTKADKL--GTVKAKANAAQWMEQLRDAWEELPPYFITSSEKRTGREELLAYI  191

Query  251  SQL  259
             ++
Sbjct  192  DEI  194



>gb|ERT56575.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella sp. 
BV3P1]
Length=206

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 38/63 (60%), Gaps = 2/63 (3%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            ++P T VFTK DK+  G  K   N  ++ E +R  ++ +PP+ +TSS    GR+ LL ++
Sbjct  141  EVPFTIVFTKADKL--GTVKAKANAAQWMEQLRDAWEELPPYFITSSEKRTGREELLAYI  198

Query  251  SQL  259
             ++
Sbjct  199  DEI  201



>ref|WP_025835978.1| GTP-binding protein [Bacteroides stercorirosoris]
Length=201

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P + VFTK DK+KGG+   + NI+++ + +++ ++ +PP+ +TSS   +GR  LL ++ 
Sbjct  135  VPFSIVFTKGDKLKGGRL--NTNIQQYLKKLKEQWEELPPYFVTSSENRMGRKELLDYIE  192

Query  254  QL  259
             +
Sbjct  193  SI  194



>emb|CEG02022.1| GTP-binding protein, ribosome biogenesis, YsxC [Ostreococcus 
tauri]
Length=329

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 41/72 (57%), Gaps = 6/72 (8%)
 Frame = +2

Query  74   IPMTFVFTKCDKMK----GGKTKPDENIREF--QELIRQNYKHIPPWILTSSVTGLGRDG  235
            IP+T VFTK DK K    G +  P E + EF  + +   ++  +PP I TSS T  G+  
Sbjct  198  IPVTIVFTKVDKRKKIAAGKRANPQETMEEFCREAMDNWDWDELPPMIYTSSETAEGKRE  257

Query  236  LLLHMSQLRNYW  271
            +L H++ LR ++
Sbjct  258  VLNHIASLRQFF  269



>ref|XP_002958090.1| hypothetical protein VOLCADRAFT_69046 [Volvox carteri f. nagariensis]
 gb|EFJ40821.1| hypothetical protein VOLCADRAFT_69046 [Volvox carteri f. nagariensis]
Length=214

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 37/64 (58%), Gaps = 0/64 (0%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            ++P   VFTK D  K       +NIR F++L+ + ++ +P    TSS TG GR  LL ++
Sbjct  144  EVPFCIVFTKIDNRKRDMPPNAQNIRAFKQLMAEEWEELPRCFETSSRTGAGRSDLLGYV  203

Query  251  SQLR  262
            + LR
Sbjct  204  ASLR  207



>ref|WP_026955150.1| GTP-binding protein [Algoriphagus vanfongensis]
Length=203

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 43/70 (61%), Gaps = 2/70 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P   VFTK DK    KT+  +NI++F + +R+ ++  P + +TSS TG G++ LL  + 
Sbjct  134  VPTAIVFTKADKQSKNKTQ--QNIQKFLKKMREVFEETPDFFITSSETGEGKEELLAFLE  191

Query  254  QLRNYWDSDS  283
             L N ++++ 
Sbjct  192  GLVNEYENEE  201



>ref|WP_009346821.1| GTP-binding protein YsxC [Alloprevotella rava]
 gb|EHG24209.1| GTP-binding protein engB [Alloprevotella rava F0323]
Length=204

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P + +FTK DK K G+ +  +N+  F + +R+ ++ +PP  +TSS + LGR+ LL ++ 
Sbjct  135  VPFSIIFTKADKNKKGELR--KNVETFLDTLREQWEELPPHFITSSESRLGREELLNYID  192

Query  254  QL  259
             +
Sbjct  193  NI  194



>ref|XP_007510135.1| ribosome biogenesis GTP-binding protein YsxC [Bathycoccus prasinos]
 emb|CCO18480.1| ribosome biogenesis GTP-binding protein YsxC [Bathycoccus prasinos]
Length=353

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 36/64 (56%), Gaps = 2/64 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKP--DENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
            IP T VFTKCD+ K G   P  +ENI   +  + + +  +P  I TSSV+  GR  +L  
Sbjct  230  IPFTIVFTKCDRKKKGPNTPTVEENIEALENRLEETWHRLPSIIKTSSVSKEGRGDILKF  289

Query  248  MSQL  259
            +S +
Sbjct  290  ISSI  293



>ref|WP_007663115.1| MULTISPECIES: GTP-binding protein YsxC [Bacteroides]
 gb|EDV03311.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides intestinalis 
DSM 17393]
 emb|CDD90875.1| probable GTP-binding protein EngB [Bacteroides intestinalis CAG:315]
Length=201

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            IP + VFTK DK+KGG+   + NI+++ + +++ ++ +PP+ +TSS   +G+  LL ++ 
Sbjct  135  IPFSIVFTKGDKLKGGRL--NSNIQQYLKKLKEQWEELPPYFVTSSENRMGKKELLDYIE  192

Query  254  QL  259
             +
Sbjct  193  SI  194



>ref|WP_006254991.1| GTP-binding protein YsxC [Alloprevotella tannerae]
 gb|EEX71684.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella tannerae 
ATCC 51259]
Length=204

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 41/69 (59%), Gaps = 2/69 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P + +FTK DK K G  K   N++ F   +++ ++ +PP+ ++SS + LGR+ +L ++ 
Sbjct  135  VPFSIIFTKADKNKRGVLK--SNVQGFLATLKEEWEELPPYFISSSTSKLGREDILNYIE  192

Query  254  QLRNYWDSD  280
            Q+      D
Sbjct  193  QINGSLQQD  201



>ref|WP_007570498.1| GTP-binding protein YsxC [Bacteroides coprocola]
 gb|EDV00197.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides coprocola 
DSM 17136]
Length=239

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 38/64 (59%), Gaps = 2/64 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P   +FTK DK   GKTK   N+  + E++++ ++ +PP+ ++SS    GR  +L ++ 
Sbjct  174  VPFAIIFTKSDKQSSGKTKF--NVNRYMEVLKEQWEELPPYFISSSEKKTGRKEILDYIE  231

Query  254  QLRN  265
             + N
Sbjct  232  SINN  235



>ref|WP_022125826.1| probable GTP-binding protein EngB [Bacteroides coprocola CAG:162]
 emb|CDA70434.1| probable GTP-binding protein EngB [Bacteroides coprocola CAG:162]
Length=200

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 38/64 (59%), Gaps = 2/64 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P   +FTK DK   GKTK   N+  + E++++ ++ +PP+ ++SS    GR  +L ++ 
Sbjct  135  VPFAIIFTKSDKQSSGKTKF--NVNRYMEVLKEQWEELPPYFISSSEKKTGRKEILDYIE  192

Query  254  QLRN  265
             + N
Sbjct  193  SINN  196



>ref|WP_022507673.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides sp. 
CAG:98]
 emb|CDF14416.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides sp. 
CAG:98]
Length=200

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 39/62 (63%), Gaps = 2/62 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P   +FTK DK+ GGK K  +N+ ++ + + + ++ +PP+ L+SS   LGR  +L ++ 
Sbjct  135  VPFAIIFTKADKLSGGKAK--DNVNKYLKKLSEQWEELPPYFLSSSEKKLGRKEILDYIE  192

Query  254  QL  259
             +
Sbjct  193  SI  194



>ref|WP_005937659.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides massiliensis]
 gb|EOA56728.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides massiliensis 
B84634 = Timone 84634 = DSM 17679 = JCM 13223]
Length=200

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 39/62 (63%), Gaps = 2/62 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P   +FTK DK+ GGK K  +N+ ++ + + + ++ +PP+ L+SS   LGR  +L ++ 
Sbjct  135  VPFAIIFTKADKLSGGKAK--DNVNKYLKKLSEQWEELPPYFLSSSEKKLGRKEILDYIE  192

Query  254  QL  259
             +
Sbjct  193  SI  194



>ref|XP_002504352.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO65610.1| predicted protein, partial [Micromonas sp. RCC299]
Length=195

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
             +P T V TKCD+ K G    D NI E + ++ + +  +P  I TSSV+  GR+ +L  +
Sbjct  133  NVPFTIVHTKCDRNKPGMPAVDTNIDELRRILDEKWHRLPSMISTSSVSHDGREDVLKFI  192

Query  251  SQL  259
            S +
Sbjct  193  SSI  195



>ref|WP_021971469.1| probable GTP-binding protein EngB [Bacteroides sp. CAG:1076]
 emb|CCY90441.1| probable GTP-binding protein EngB [Bacteroides sp. CAG:1076]
Length=203

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 38/64 (59%), Gaps = 2/64 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P   +FTK DK   GKTK   N+  + E++++ ++ +PP+ ++SS    GR  +L ++ 
Sbjct  135  VPFAIIFTKADKQSSGKTKF--NVDRYMEVLKEQWEELPPYFVSSSEKKTGRKEILDYIE  192

Query  254  QLRN  265
             + N
Sbjct  193  SINN  196



>ref|WP_022510945.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella sp. 
CAG:617]
 emb|CDF22733.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella sp. 
CAG:617]
Length=198

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/62 (31%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P + VFTK DK+K   T   + +  F + +R+ ++ +PP+ ++S+ +G GR+ +L ++ 
Sbjct  135  VPFSIVFTKADKLKA--TALQQGVNRFLDRLREQWEELPPYFVSSAESGKGREEILSYIE  192

Query  254  QL  259
            Q+
Sbjct  193  QI  194



>ref|WP_026711958.1| GTP-binding protein [Flavobacterium filum]
Length=203

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/65 (34%), Positives = 43/65 (66%), Gaps = 3/65 (5%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTKPDENIREFQ-ELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
            +IP   +FTK DK+  GKTK   +I  ++ +L+  +++ +PP+ ++SS+ G G+D +L +
Sbjct  134  EIPFCLIFTKADKI--GKTKVQNHIAAYKKQLLANDWEEMPPFFVSSSLEGTGKDEILHY  191

Query  248  MSQLR  262
            + Q+ 
Sbjct  192  IDQIN  196



>ref|WP_007213813.1| MULTISPECIES: GTP-binding protein YsxC [Bacteroides]
 gb|EEF87905.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides cellulosilyticus 
DSM 14838]
 emb|CDB73626.1| probable GTP-binding protein EngB [Bacteroides cellulosilyticus 
CAG:158]
Length=201

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            IP + VFTK DK+KGG+   + NI+++ + +++ ++ +PP+ +TSS   +G+  LL ++ 
Sbjct  135  IPFSIVFTKGDKLKGGRL--NTNIQQYLKKLKEQWEELPPYFVTSSENRMGKKELLDYIE  192

Query  254  QL  259
             +
Sbjct  193  SI  194



>ref|WP_022231839.1| probable GTP-binding protein EngB [Bacteroides sp. CAG:443]
 emb|CDB99788.1| probable GTP-binding protein EngB [Bacteroides sp. CAG:443]
Length=202

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 38/64 (59%), Gaps = 2/64 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P   +FTK DK   GKTK   N+  + E++++ ++ +PP+ ++SS    GR  +L ++ 
Sbjct  135  VPFAIIFTKADKQSSGKTKF--NVDRYMEVLKEQWEELPPYFISSSEKKTGRKEILDYIE  192

Query  254  QLRN  265
             + N
Sbjct  193  SVNN  196



>ref|WP_028898033.1| GTP-binding protein [Prevotella sp. HUN102]
Length=212

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/72 (31%), Positives = 42/72 (58%), Gaps = 2/72 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P + +FTK DK+  G+ K   N  ++   ++  ++ +PP+ LTS+ T LGRD +L ++ 
Sbjct  135  VPFSIIFTKADKLTAGRAKT--NALQWMNALKDRWEMLPPYFLTSAETKLGRDEVLDYID  192

Query  254  QLRNYWDSDSPD  289
            ++      DS +
Sbjct  193  EINASLYEDSKE  204



>ref|WP_018357451.1| hypothetical protein [Porphyromonas levii]
Length=196

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P + VFTK DK+   K+    ++  +Q ++R++++ +PP  +TSS  G GR+ L+ ++ 
Sbjct  135  VPFSIVFTKADKL--SKSALKLHVEAYQNVLRESWEELPPIFVTSSEKGTGREELVAYIE  192

Query  254  QL  259
            Q+
Sbjct  193  QI  194



>ref|WP_027393110.1| GTP-binding protein [Aquimarina latercula]
Length=201

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 41/63 (65%), Gaps = 2/63 (3%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            QIP + +FTK DK+   KTK   NI  ++  + Q ++ +P + +TSS +GLG++ +L ++
Sbjct  134  QIPFSIIFTKADKL--TKTKLPSNIEAYKNEMLQYWEEMPNYFITSSSSGLGKEEVLNYI  191

Query  251  SQL  259
             ++
Sbjct  192  EEI  194



>ref|WP_036877480.1| GTP-binding protein [Prevotella oryzae]
Length=200

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 39/62 (63%), Gaps = 2/62 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            IP + +FTK DK+  G  K  +N+  + E +++ ++ +PP+ LTSS    GR+ +L ++ 
Sbjct  135  IPFSIIFTKADKL--GAVKAKQNVGSYMEKLKETWEELPPYFLTSSEKRTGREEVLDYIE  192

Query  254  QL  259
            ++
Sbjct  193  KI  194



>ref|WP_026704032.1| GTP-binding protein [Flavobacterium soli]
Length=205

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 42/66 (64%), Gaps = 3/66 (5%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTKPDENIREFQ-ELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
            +IP   VFTK DK+   KTK D +I  ++ ++   N+  +PP+ +TSS+  +G++ LL +
Sbjct  134  EIPFCIVFTKADKI--SKTKIDSHIAAYKKQMFANNWAEMPPYFVTSSLDAIGKEELLDY  191

Query  248  MSQLRN  265
            + ++ +
Sbjct  192  IGEIND  197



>ref|WP_007218064.1| GTP-binding protein YsxC [Bacteroides cellulosilyticus]
 gb|EIY27565.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides cellulosilyticus 
CL02T12C19]
Length=201

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P + VFTK DK+KGG+   + NI+++ + +++ ++ +PP+ +TSS   +G+  LL ++ 
Sbjct  135  VPFSIVFTKGDKLKGGRL--NTNIQQYLKKLKEQWEELPPYFVTSSENRMGKKELLDYIE  192

Query  254  QL  259
             +
Sbjct  193  SI  194



>ref|WP_005467636.1| ribosome biogenesis GTP-binding protein YsxC [Porphyromonas catoniae]
 gb|EKY00194.1| ribosome biogenesis GTP-binding protein YsxC [Porphyromonas catoniae 
F0037]
Length=198

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 36/64 (56%), Gaps = 2/64 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P   VFTK DK+  GK     NI  ++E + + ++ +PP  +TSS    GRD LL ++ 
Sbjct  135  VPFALVFTKADKLSKGKLSA--NISAYKERLLEGWEELPPLFITSSEARTGRDELLDYIE  192

Query  254  QLRN  265
             + N
Sbjct  193  GINN  196



>ref|WP_021990637.1| probable GTP-binding protein EngB [Prevotella sp. CAG:1092]
 emb|CCZ11792.1| probable GTP-binding protein EngB [Prevotella sp. CAG:1092]
Length=199

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/62 (31%), Positives = 39/62 (63%), Gaps = 2/62 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P + +FTK DK+    TK  EN +++ + ++  ++ +PP+ +TSS   +GRD +L ++ 
Sbjct  135  VPFSIIFTKADKV--SMTKAKENAKKWMDALKDTWEELPPYFITSSEKAIGRDEVLDYIE  192

Query  254  QL  259
             +
Sbjct  193  SI  194



>ref|WP_008566621.1| GTP-binding protein YsxC [Prevotella maculosa]
 gb|EHO65958.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella maculosa 
OT 289]
Length=198

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 40/64 (63%), Gaps = 2/64 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P T VFTK DK+  GK K  +N  ++ + ++  ++ +PP+ +TSS    GR+ LL ++ 
Sbjct  135  VPFTIVFTKADKLTPGKAK--QNAAQWLDRLKDRWETLPPYYITSSEKKQGREELLNYIE  192

Query  254  QLRN  265
            ++ N
Sbjct  193  EINN  196



>gb|KGN82246.1| GTP-binding protein [Porphyromonas sp. COT-290_OH860]
Length=198

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 38/62 (61%), Gaps = 2/62 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P   VFTK DK+  G+     N+  +++ +R++++ +PP  +TSS    GRD LL ++ 
Sbjct  135  VPFALVFTKADKLSRGRLSA--NVEAYKQKLRESWEELPPIFVTSSEKKEGRDELLAYID  192

Query  254  QL  259
            ++
Sbjct  193  EI  194



>ref|WP_019969043.1| GTP-binding protein YsxC [Prevotella maculosa]
Length=198

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 40/64 (63%), Gaps = 2/64 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P T VFTK DK+  GK K  +N  ++ + ++  ++ +PP+ +TSS    GR+ LL ++ 
Sbjct  135  VPFTIVFTKADKLTPGKAK--QNAAQWLDRLKDRWETLPPYYITSSEKKQGREELLNYIE  192

Query  254  QLRN  265
            ++ N
Sbjct  193  EINN  196



>gb|KGO00761.1| GTP-binding protein [Porphyromonas sp. COT-290_OH3588CRE]
Length=198

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 38/62 (61%), Gaps = 2/62 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            +P   VFTK DK+  G+     N+  +++ +R++++ +PP  +TSS    GRD LL ++ 
Sbjct  135  VPFALVFTKADKLSRGRLSA--NVEAYKQKLRESWEELPPIFVTSSEKKEGRDELLAYID  192

Query  254  QL  259
            ++
Sbjct  193  EI  194



>ref|WP_026991326.1| GTP-binding protein [Flavobacterium subsaxonicum]
 gb|KGO92065.1| GTP-binding protein [Flavobacterium subsaxonicum WB 4.1-42 = 
DSM 21790]
Length=206

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 40/64 (63%), Gaps = 3/64 (5%)
 Frame = +2

Query  71   QIPMTFVFTKCDKMKGGKTKPDENIREF-QELIRQNYKHIPPWILTSSVTGLGRDGLLLH  247
            ++P   VFTK DK+  GK   D++I  + ++L+  N++ +P   +TSS  G GRD LL +
Sbjct  134  EVPFCIVFTKADKISRGKV--DQHIAAYRKKLLANNWEEMPQHFVTSSTEGTGRDALLSY  191

Query  248  MSQL  259
            + ++
Sbjct  192  IEEV  195



>ref|WP_025866419.1| GTP-binding protein [Bacteroides nordii]
Length=201

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 39/62 (63%), Gaps = 2/62 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            IP + +FTK DK+KGG+ K   NI  +   +R+ ++ +PP+ ++SS   +GR  +L ++ 
Sbjct  135  IPFSIIFTKADKLKGGRLKM--NINAYIRELRKQWEELPPYFVSSSEDRMGRTEILDYIE  192

Query  254  QL  259
             +
Sbjct  193  SI  194



>ref|WP_022161745.1| probable GTP-binding protein EngB [Bacteroides sp. CAG:633]
 emb|CDB11839.1| probable GTP-binding protein EngB [Bacteroides sp. CAG:633]
Length=200

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 39/59 (66%), Gaps = 2/59 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM  250
            IP + +FTK DK+KGGK     NI+ + + +++ ++ +PP+ +TSS    GR+ +L ++
Sbjct  135  IPFSLIFTKADKLKGGKL--GANIKLYLKRLKEQWEELPPYFITSSEDKTGREEVLNYI  191



>ref|WP_025074227.1| GTP-binding protein [Bacteroides faecichinchillae]
Length=201

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 39/62 (63%), Gaps = 2/62 (3%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHMS  253
            IP + VFTK DK+KGG+ K   NI  + + +R+ ++ +PP+ ++SS    GR  +L ++ 
Sbjct  135  IPFSIVFTKSDKLKGGRLKM--NINAYLQDLRKQWEELPPYFISSSENHTGRTEILDYIE  192

Query  254  QL  259
             +
Sbjct  193  TI  194



>dbj|GAL83016.1| GTP-binding protein EngB [Sporocytophaga myxococcoides]
Length=203

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 44/66 (67%), Gaps = 3/66 (5%)
 Frame = +2

Query  74   IPMTFVFTKCDKMKGGKTKPDENIREFQELIRQNYKHIPPWILTSSVTGLGRDGLLLHM-  250
            IP + +FTK DK+   KT+ + N+ +F+  + + ++ +PP  +TSS TG G++ +L ++ 
Sbjct  135  IPFSLIFTKYDKL--SKTQANNNLLKFENEMSKTWQELPPRFVTSSETGFGKEEVLNYLD  192

Query  251  SQLRNY  268
            S ++N+
Sbjct  193  SMVKNF  198



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 515526136792