BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13438_g1_i1 len=765 path=[75:0-375 74:376-764]

Length=765
                                                                      Score     E

ref|XP_011087860.1|  PREDICTED: early nodulin-93-like                   122   2e-31   
emb|CDP10372.1|  unnamed protein product                                121   1e-30   
gb|KHN27413.1|  Early nodulin-93                                        120   3e-30   
gb|EYU18492.1|  hypothetical protein MIMGU_mgv1a016647mg                117   2e-29   
ref|NP_001238685.1|  uncharacterized protein LOC100306683               116   5e-29   
ref|XP_009620110.1|  PREDICTED: early nodulin-93-like                   116   5e-29   
ref|XP_011092415.1|  PREDICTED: early nodulin-93-like                   115   2e-28   
ref|XP_003524537.2|  PREDICTED: early nodulin-93-like                   116   3e-28   
ref|NP_001240002.1|  uncharacterized protein LOC100820292               114   3e-28   
dbj|BAF63494.1|  nodule protein Dg93-like protein                       114   3e-28   Potamogeton distinctus
ref|XP_003609265.1|  Early nodulin 93 protein                           114   4e-28   
gb|KDP32914.1|  hypothetical protein JCGZ_13695                         114   4e-28   
ref|XP_009368814.1|  PREDICTED: early nodulin-93-like                   114   5e-28   
ref|XP_007013368.1|  Early nodulin-93 isoform 1                         114   5e-28   
ref|XP_007013365.1|  Early nodulin-93                                   114   5e-28   
ref|XP_004508526.1|  PREDICTED: early nodulin-93-like                   113   8e-28   
ref|XP_002305557.1|  hypothetical protein POPTR_0004s19470g             113   1e-27   Populus trichocarpa [western balsam poplar]
ref|XP_009403396.1|  PREDICTED: early nodulin-93-like                   112   1e-27   
gb|ABN47005.1|  early nodulin 93 protein                                112   2e-27   Populus alba x Populus glandulosa
ref|XP_009630090.1|  PREDICTED: early nodulin-93-like                   112   2e-27   
ref|XP_010250017.1|  PREDICTED: early nodulin-93-like isoform X2        112   2e-27   
ref|NP_001237669.1|  early nodulin-93                                   112   3e-27   
gb|KHG12431.1|  Early nodulin-93                                        112   3e-27   
ref|XP_009403394.1|  PREDICTED: early nodulin-93-like                   111   4e-27   
gb|KHG12433.1|  Early nodulin-93                                        111   4e-27   
ref|XP_002524454.1|  Early nodulin, putative                            111   5e-27   Ricinus communis
ref|XP_002313673.1|  hypothetical protein POPTR_0009s14600g             111   6e-27   Populus trichocarpa [western balsam poplar]
ref|XP_010250016.1|  PREDICTED: early nodulin-93-like isoform X1        111   6e-27   
ref|XP_004287357.1|  PREDICTED: early nodulin-93-like                   110   7e-27   
ref|XP_009773355.1|  PREDICTED: early nodulin-93-like                   110   8e-27   
ref|XP_009773354.1|  PREDICTED: early nodulin-93-like                   110   9e-27   
ref|XP_010254480.1|  PREDICTED: early nodulin-93-like                   110   1e-26   
gb|ACU16453.1|  unknown                                                 110   1e-26   Glycine max [soybeans]
ref|XP_010250013.1|  PREDICTED: early nodulin-93-like                   110   1e-26   
ref|XP_008809696.1|  PREDICTED: early nodulin-93-like                   110   1e-26   
ref|XP_010254343.1|  PREDICTED: early nodulin-93-like                   110   1e-26   
ref|XP_010250015.1|  PREDICTED: early nodulin-93-like                   110   2e-26   
ref|XP_008792075.1|  PREDICTED: early nodulin-93-like isoform X2        110   2e-26   
ref|XP_008775025.1|  PREDICTED: early nodulin-93-like                   109   2e-26   
ref|XP_006475805.1|  PREDICTED: early nodulin-93-like                   109   3e-26   
ref|XP_010250010.1|  PREDICTED: early nodulin-93-like                   109   3e-26   
ref|XP_009391602.1|  PREDICTED: early nodulin-93-like isoform X2        109   3e-26   
ref|XP_010254344.1|  PREDICTED: early nodulin-93-like                   108   4e-26   
gb|AFK44884.1|  unknown                                                 108   5e-26   
ref|XP_009630092.1|  PREDICTED: early nodulin-93-like                   108   6e-26   
ref|XP_011046280.1|  PREDICTED: early nodulin-93-like                   108   7e-26   
ref|XP_007154975.1|  hypothetical protein PHAVU_003G162200g             108   8e-26   
ref|XP_004964505.1|  PREDICTED: early nodulin-93-like                   108   9e-26   
ref|XP_010909459.1|  PREDICTED: early nodulin-93-like                   107   1e-25   
ref|XP_006450983.1|  hypothetical protein CICLE_v10009984mg             107   1e-25   
ref|XP_007202786.1|  hypothetical protein PRUPE_ppa013711mg             107   2e-25   
gb|AIE16049.1|  early nodulin 93 protein                                107   2e-25   
gb|ACG31347.1|  early nodulin 93                                        107   2e-25   Zea mays [maize]
gb|ACG45703.1|  early nodulin 93                                        107   2e-25   Zea mays [maize]
ref|NP_001131809.1|  uncharacterized protein LOC100193182               107   3e-25   Zea mays [maize]
ref|XP_004964506.1|  PREDICTED: early nodulin-93-like                   107   3e-25   
ref|XP_010914914.1|  PREDICTED: early nodulin-93-like                   106   3e-25   
ref|XP_002285052.1|  PREDICTED: early nodulin-93                        106   4e-25   Vitis vinifera
ref|XP_010688053.1|  PREDICTED: early nodulin-93-like                   105   7e-25   
ref|NP_001147053.1|  early nodulin 93                                   105   8e-25   Zea mays [maize]
ref|XP_011045025.1|  PREDICTED: early nodulin-93-like                   105   8e-25   
gb|ACG24704.1|  early nodulin 93                                        105   1e-24   Zea mays [maize]
gb|ACG23914.1|  early nodulin 93                                        105   1e-24   Zea mays [maize]
ref|XP_008658093.1|  PREDICTED: uncharacterized protein LOC100193...    105   1e-24   
ref|XP_010047806.1|  PREDICTED: early nodulin-93-like                   104   2e-24   
ref|XP_002436448.1|  hypothetical protein SORBIDRAFT_10g002890          104   2e-24   Sorghum bicolor [broomcorn]
ref|XP_004964504.1|  PREDICTED: early nodulin-93-like                   104   3e-24   
ref|XP_003524536.1|  PREDICTED: early nodulin-93-like                   103   3e-24   
ref|XP_008659310.1|  PREDICTED: uncharacterized protein LOC103638099    107   3e-24   
ref|XP_006842815.1|  hypothetical protein AMTR_s00081p00057480          104   3e-24   
ref|XP_008385798.1|  PREDICTED: early nodulin-93-like                   103   3e-24   
ref|XP_002437807.1|  hypothetical protein SORBIDRAFT_10g002880          103   4e-24   Sorghum bicolor [broomcorn]
ref|XP_010047808.1|  PREDICTED: early nodulin-93-like                   103   4e-24   
ref|XP_010688054.1|  PREDICTED: early nodulin-93-like                   104   5e-24   
ref|XP_010039609.1|  PREDICTED: early nodulin-93-like                   103   5e-24   
ref|XP_006364907.1|  PREDICTED: early nodulin-93-like                   102   6e-24   
ref|XP_006364894.1|  PREDICTED: early nodulin-93-like                   102   7e-24   
ref|XP_004964509.1|  PREDICTED: early nodulin-93-like                   103   9e-24   
ref|XP_004251574.1|  PREDICTED: early nodulin-93-like                   102   1e-23   
ref|XP_009392935.1|  PREDICTED: early nodulin-93-like                   102   1e-23   
ref|XP_010688052.1|  PREDICTED: early nodulin-93-like                   102   1e-23   
ref|XP_002436449.1|  hypothetical protein SORBIDRAFT_10g002900          102   1e-23   Sorghum bicolor [broomcorn]
ref|XP_010100940.1|  hypothetical protein L484_005949                   102   1e-23   
ref|XP_010047807.1|  PREDICTED: early nodulin-93-like                   102   1e-23   
ref|XP_010250011.1|  PREDICTED: early nodulin-93-like isoform X1        102   2e-23   
ref|XP_002437802.1|  hypothetical protein SORBIDRAFT_10g002820          102   2e-23   Sorghum bicolor [broomcorn]
ref|XP_010039608.1|  PREDICTED: early nodulin-93-like                   102   2e-23   
gb|ABL85058.1|  early nodulin protein                                   102   2e-23   Brachypodium sylvaticum
ref|XP_003557201.1|  PREDICTED: early nodulin-93-like                   102   2e-23   
dbj|BAA83559.1|  putative early nodulin                                 101   3e-23   Oryza sativa Japonica Group [Japonica rice]
gb|AAD28359.1|AF084573_1  root-nodule protein Dg93                      101   3e-23   Datisca glomerata
ref|XP_006655776.1|  PREDICTED: early nodulin-93-like                   101   3e-23   
ref|XP_007013369.1|  Early nodulin-93 isoform 2                         101   4e-23   
ref|XP_006364908.1|  PREDICTED: early nodulin-93-like                   100   4e-23   
ref|XP_010250012.1|  PREDICTED: early nodulin-93-like isoform X2        100   5e-23   
ref|XP_004251567.1|  PREDICTED: early nodulin-93-like                   100   6e-23   
ref|XP_002437803.1|  hypothetical protein SORBIDRAFT_10g002830          100   8e-23   Sorghum bicolor [broomcorn]
dbj|BAK07913.1|  predicted protein                                      100   9e-23   
gb|EMT32242.1|  hypothetical protein F775_18516                       99.8    1e-22   
ref|XP_007138316.1|  hypothetical protein PHAVU_009G198400g           99.8    1e-22   
ref|XP_006655774.1|  PREDICTED: early nodulin-93-like                 99.8    2e-22   
gb|ABL85059.1|  early nodulin protein                                   100   2e-22   Brachypodium sylvaticum
gb|EMS61130.1|  hypothetical protein TRIUR3_21694                     99.0    2e-22   
ref|NP_001056762.1|  Os06g0141700                                     99.4    2e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAD30134.1|AF140229_1  early nodulin                               99.8    3e-22   Oryza sativa [red rice]
ref|XP_006655775.1|  PREDICTED: early nodulin-93-like                 99.0    3e-22   
dbj|BAA83567.1|  putative early nodulin                               99.0    3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|EEE65062.1|  hypothetical protein OsJ_20076                          100   3e-22   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056766.2|  Os06g0142200                                     99.0    3e-22   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056768.1|  Os06g0142400                                     99.0    3e-22   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK06178.1|  predicted protein                                    99.4    4e-22   
gb|EMT32241.1|  hypothetical protein F775_18515                       98.2    4e-22   
ref|XP_010533179.1|  PREDICTED: early nodulin-93-like                 98.6    4e-22   
ref|XP_003557202.1|  PREDICTED: early nodulin-93-like                 98.6    5e-22   
ref|NP_001174593.1|  Os06g0142350                                     99.4    5e-22   
ref|XP_004964510.1|  PREDICTED: early nodulin-93-like                 98.2    6e-22   
ref|NP_001056767.2|  Os06g0142300                                     98.2    7e-22   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ35790.1|  hypothetical protein OsJ_20082                        98.2    7e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010049972.1|  PREDICTED: early nodulin-93-like                 97.4    7e-22   
gb|EMS50054.1|  hypothetical protein TRIUR3_13855                     97.8    9e-22   
ref|XP_008337324.1|  PREDICTED: early nodulin-93-like                 96.3    9e-22   
gb|EMT32244.1|  hypothetical protein F775_30863                       97.1    1e-21   
gb|EEC79963.1|  hypothetical protein OsI_21579                        97.4    1e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_008390004.1|  PREDICTED: early nodulin-93-like                 95.9    2e-21   
ref|XP_004139321.1|  PREDICTED: early nodulin-93-like                 96.3    3e-21   
ref|XP_002437804.1|  hypothetical protein SORBIDRAFT_10g002850        95.9    4e-21   Sorghum bicolor [broomcorn]
ref|XP_004167345.1|  PREDICTED: early nodulin-93-like                 95.5    6e-21   
gb|EMT32240.1|  hypothetical protein F775_30861                       95.1    9e-21   
ref|XP_008457774.1|  PREDICTED: early nodulin-93-like                 95.5    1e-20   
gb|EMT29548.1|  hypothetical protein F775_15200                       93.6    2e-20   
gb|ACH58421.1|  nodulin 93                                            91.3    4e-20   Prunus dulcis [sweet almond]
gb|KHN27414.1|  Early nodulin-93                                      90.9    6e-20   
ref|XP_004964508.1|  PREDICTED: early nodulin-93-like                 92.0    1e-19   
ref|XP_002437805.1|  hypothetical protein SORBIDRAFT_10g002860        92.0    1e-19   Sorghum bicolor [broomcorn]
ref|NP_001145575.1|  uncharacterized protein LOC100279040             91.7    1e-19   Zea mays [maize]
gb|EAY99605.1|  hypothetical protein OsI_21583                        91.7    2e-19   Oryza sativa Indica Group [Indian rice]
gb|EMS67158.1|  hypothetical protein TRIUR3_21254                     89.7    3e-19   
gb|AFW75469.1|  hypothetical protein ZEAMMB73_751741                  90.1    6e-19   
gb|EMT32243.1|  hypothetical protein F775_30862                       88.6    8e-19   
gb|EMS50052.1|  hypothetical protein TRIUR3_13853                     89.0    1e-18   
gb|ACG48865.1|  early nodulin 93                                      88.6    1e-18   Zea mays [maize]
gb|EMS50053.1|  hypothetical protein TRIUR3_13854                     88.2    2e-18   
gb|EMT32245.1|  hypothetical protein F775_08718                       87.0    3e-18   
gb|ACG24380.1|  early nodulin 93                                      87.4    3e-18   Zea mays [maize]
ref|XP_004964507.1|  PREDICTED: early nodulin-93-like                 84.7    4e-17   
gb|EAZ35784.1|  hypothetical protein OsJ_20075                        84.3    5e-17   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056761.1|  Os06g0141600                                     84.7    8e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010250018.1|  PREDICTED: early nodulin-93-like isoform X1      83.2    1e-16   
gb|EMT29547.1|  hypothetical protein F775_24367                       84.0    1e-16   
gb|EMS61159.1|  hypothetical protein TRIUR3_18822                     82.0    2e-16   
ref|XP_004148399.1|  PREDICTED: early nodulin-93-like                 81.6    6e-16   
gb|EMS35732.1|  hypothetical protein TRIUR3_26870                     79.3    1e-15   
ref|XP_008444985.1|  PREDICTED: early nodulin-93-like                 79.7    3e-15   
ref|XP_002525450.1|  Early nodulin, putative                          78.2    1e-14   Ricinus communis
gb|AFW85923.1|  hypothetical protein ZEAMMB73_318061                  76.3    2e-14   
gb|AFK36825.1|  unknown                                               77.0    3e-14   
gb|EMS61131.1|  hypothetical protein TRIUR3_21695                     75.5    5e-14   
ref|XP_004498454.1|  PREDICTED: early nodulin-93-like                 76.3    5e-14   
ref|XP_003588448.1|  Enod93 protein                                   76.3    6e-14   
ref|XP_006853715.1|  hypothetical protein AMTR_s00056p00156190        75.9    6e-14   
ref|XP_007012195.1|  Early nodulin-93, putative                       75.9    9e-14   
gb|EAY99599.1|  hypothetical protein OsI_21577                        75.1    1e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_010249474.1|  PREDICTED: early nodulin-93-like                 74.7    1e-13   
gb|KDP20271.1|  hypothetical protein JCGZ_06857                       75.1    1e-13   
gb|KHG21336.1|  Early nodulin-93                                      74.7    1e-13   
ref|NP_001235239.1|  uncharacterized protein LOC100500499             74.3    2e-13   
ref|XP_006288877.1|  hypothetical protein CARUB_v10002236mg           73.9    4e-13   
ref|XP_004291153.1|  PREDICTED: early nodulin-93-like                 73.6    4e-13   
ref|XP_010047293.1|  PREDICTED: early nodulin-93                      73.2    5e-13   
gb|AFK35976.1|  unknown                                               73.2    5e-13   
emb|CAB65283.1|  Enod93 protein                                       72.8    9e-13   Medicago sativa subsp. x varia
ref|XP_011081751.1|  PREDICTED: early nodulin-93-like                 72.0    9e-13   
ref|XP_010325064.1|  PREDICTED: early nodulin-93                      72.4    9e-13   
gb|AFR46651.1|  ENOD93-like protein                                   72.4    1e-12   
ref|XP_002325832.2|  hypothetical protein POPTR_0019s04930g           72.8    1e-12   Populus trichocarpa [western balsam poplar]
ref|XP_009796123.1|  PREDICTED: early nodulin-93                      72.4    1e-12   
ref|XP_006366687.1|  PREDICTED: early nodulin-93-like                 72.4    1e-12   
ref|XP_009602784.1|  PREDICTED: early nodulin-93                      72.0    1e-12   
ref|XP_011010128.1|  PREDICTED: early nodulin-93-like                 72.4    1e-12   
ref|XP_010421449.1|  PREDICTED: early nodulin-93-like                 72.0    1e-12   
gb|EPS65341.1|  hypothetical protein M569_09436                       71.6    2e-12   
emb|CDP08196.1|  unnamed protein product                              71.6    2e-12   
ref|XP_007161502.1|  hypothetical protein PHAVU_001G074600g           70.9    3e-12   
gb|ADE77942.1|  unknown                                               71.2    3e-12   
ref|NP_197966.1|  early nodulin-related protein                       70.9    4e-12   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63333.1|  nodulin-like protein                                  70.5    4e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009129938.1|  PREDICTED: early nodulin-93                      70.5    4e-12   
ref|XP_008220129.1|  PREDICTED: early nodulin-93-like                 70.5    5e-12   
ref|XP_011081738.1|  PREDICTED: early nodulin-93-like isoform X2      70.9    7e-12   
gb|EYU20409.1|  hypothetical protein MIMGU_mgv1a023606mg              68.6    9e-12   
gb|EPS59458.1|  hypothetical protein M569_15348                       68.9    1e-11   
ref|XP_008799774.1|  PREDICTED: early nodulin-93-like                 69.3    1e-11   
gb|KHG26243.1|  Early nodulin-93                                      68.9    2e-11   
ref|XP_007225829.1|  hypothetical protein PRUPE_ppa011550mg           70.9    2e-11   
emb|CDY05336.1|  BnaC02g40440D                                        68.9    2e-11   
ref|XP_010668768.1|  PREDICTED: early nodulin-93-like                 68.6    2e-11   
ref|XP_010914922.1|  PREDICTED: early nodulin-93-like                 68.6    2e-11   
ref|XP_006394840.1|  hypothetical protein EUTSA_v10005156mg           68.6    2e-11   
ref|XP_010495507.1|  PREDICTED: uncharacterized protein LOC104772610  68.9    3e-11   
ref|XP_002874285.1|  hypothetical protein ARALYDRAFT_910661           67.8    4e-11   
gb|KEH36097.1|  early nodulin 93                                      67.8    6e-11   
ref|XP_010536217.1|  PREDICTED: early nodulin-93                      67.0    6e-11   
ref|XP_011081737.1|  PREDICTED: uncharacterized protein LOC105164...  68.2    7e-11   
ref|XP_004517223.1|  PREDICTED: early nodulin-93-like                 66.2    8e-11   
emb|CAN71779.1|  hypothetical protein VITISV_015688                   67.0    8e-11   Vitis vinifera
ref|XP_009415371.1|  PREDICTED: early nodulin-93-like                 66.2    2e-10   
gb|ABQ42021.1|  Enod93 protein                                        65.1    2e-10   Sonneratia alba
dbj|BAJ94955.1|  predicted protein                                    65.5    2e-10   
ref|NP_001150497.1|  early nodulin 93                                 65.1    3e-10   Zea mays [maize]
ref|XP_002453560.1|  hypothetical protein SORBIDRAFT_04g008090        65.1    3e-10   Sorghum bicolor [broomcorn]
gb|ACG23999.1|  early nodulin 93                                      65.1    3e-10   Zea mays [maize]
gb|EMT24869.1|  hypothetical protein F775_32597                       65.1    3e-10   
gb|AFK34546.1|  unknown                                               65.5    4e-10   
gb|EMT14561.1|  hypothetical protein F775_30178                       64.7    4e-10   
ref|XP_006475988.1|  PREDICTED: early nodulin-93-like isoform X1      65.1    4e-10   
gb|AFK33958.1|  unknown                                               65.1    4e-10   
gb|EMS46857.1|  hypothetical protein TRIUR3_07600                     65.1    5e-10   
ref|XP_004951404.1|  PREDICTED: early nodulin-93-like                 64.3    5e-10   
ref|XP_008804878.1|  PREDICTED: uncharacterized protein LOC103718...  65.1    8e-10   
ref|XP_010917653.1|  PREDICTED: early nodulin-93-like isoform X1      64.7    1e-09   
ref|NP_001046351.1|  Os02g0227200                                     63.2    2e-09   Oryza sativa Japonica Group [Japonica rice]
gb|ABQ42024.1|  Enod93 protein                                        62.4    2e-09   Sonneratia apetala
ref|XP_009350245.1|  PREDICTED: early nodulin-93-like                 62.8    3e-09   
ref|XP_008357372.1|  PREDICTED: early nodulin-93-like                 62.8    3e-09   
ref|XP_006647086.1|  PREDICTED: early nodulin-93-like                 62.4    4e-09   
ref|XP_003571774.1|  PREDICTED: early nodulin-93                      62.0    4e-09   
ref|XP_001761950.1|  predicted protein                                61.2    5e-09   
ref|NP_001056760.1|  Os06g0141400                                     60.5    2e-08   Oryza sativa Japonica Group [Japonica rice]
gb|AFW75468.1|  hypothetical protein ZEAMMB73_751741                  58.9    5e-08   
ref|XP_002532958.1|  hypothetical protein RCOM_0639430                58.2    7e-08   Ricinus communis
ref|XP_001780085.1|  predicted protein                                57.4    1e-07   
ref|XP_002275030.1|  PREDICTED: early nodulin-93                      57.0    3e-07   Vitis vinifera



>ref|XP_011087860.1| PREDICTED: early nodulin-93-like [Sesamum indicum]
Length=105

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +3

Query  270  VSLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVS  449
            VSLDQKLA+AKR SHEGVVAGAKAA V T+ATAIP LASVRMVPWAKANLNPTAQALI+S
Sbjct  17   VSLDQKLALAKRCSHEGVVAGAKAAVVATIATAIPTLASVRMVPWAKANLNPTAQALIIS  76

Query  450  TAAGMAYFIVADKTVLATARRNSFNRP  530
            T AGMAYFIVADKTVLATARRNSFN P
Sbjct  77   TVAGMAYFIVADKTVLATARRNSFNSP  103



>emb|CDP10372.1| unnamed protein product [Coffea canephora]
Length=109

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/85 (89%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLD KLAMAKR SHEGVVAGAKAAAV ++ATAIP LAS RMVPWA+ANLNPTAQALIVST
Sbjct  20   SLDHKLAMAKRCSHEGVVAGAKAAAVASIATAIPTLASARMVPWARANLNPTAQALIVST  79

Query  453  AAGMAYFIVADKTVLATARRNSFNR  527
             AGMAYFIVADKTVLATARRNSFNR
Sbjct  80   VAGMAYFIVADKTVLATARRNSFNR  104



>gb|KHN27413.1| Early nodulin-93 [Glycine soja]
Length=107

 Score =   120 bits (300),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLAMAKR SHEGV+AGAKAA V T+AT IP LASVRM+PWA+ANLN +AQALI+ST
Sbjct  19   SLDQKLAMAKRCSHEGVMAGAKAAVVATIATTIPTLASVRMLPWARANLNHSAQALIIST  78

Query  453  AAGMAYFIVADKTVLATARRNSFNRPAD  536
             AG AYFIVADKTVLATAR+NSFNRP++
Sbjct  79   VAGAAYFIVADKTVLATARKNSFNRPSN  106



>gb|EYU18492.1| hypothetical protein MIMGU_mgv1a016647mg [Erythranthe guttata]
Length=113

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 89/108 (82%), Gaps = 3/108 (3%)
 Frame = +3

Query  228  NTTSS*SITMASKNVSLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWA  407
            N   S  I   S + SL+QKLA+AKR SHEGV+AGAKAAAV T+ATAIP +ASVRM+PWA
Sbjct  5    NVGESSPIEKCSLSASLEQKLALAKRCSHEGVMAGAKAAAVATIATAIPTMASVRMLPWA  64

Query  408  KANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSFNRPA---DHR  542
            +ANLNPTAQALI+ST AGMAYFIVADKTVLATARRNSFN  A   DH+
Sbjct  65   RANLNPTAQALIISTVAGMAYFIVADKTVLATARRNSFNGGASLSDHK  112



>ref|NP_001238685.1| uncharacterized protein LOC100306683 [Glycine max]
 gb|ACU14979.1| unknown [Glycine max]
 gb|KHN15116.1| Early nodulin-93 [Glycine soja]
Length=107

 Score =   116 bits (291),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLAMAKR SHEG +AGAKAA   T+ATAIP LASVRM+PWA+ANLN TAQALI+ST
Sbjct  19   SLDQKLAMAKRCSHEGAMAGAKAAVAATIATAIPTLASVRMLPWARANLNHTAQALIIST  78

Query  453  AAGMAYFIVADKTVLATARRNSFNRPA  533
             AG AYFIVADKTVLATAR+NSFNRP+
Sbjct  79   VAGAAYFIVADKTVLATARKNSFNRPS  105



>ref|XP_009620110.1| PREDICTED: early nodulin-93-like [Nicotiana tomentosiformis]
Length=101

 Score =   116 bits (291),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 82/92 (89%), Gaps = 3/92 (3%)
 Frame = +3

Query  261  SKNVSL---DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTA  431
            +KNVSL   DQKLAMAKR SHEGVVAGAKAA V +VATAIP LA  +M PWA+ANLNPTA
Sbjct  2    AKNVSLASVDQKLAMAKRCSHEGVVAGAKAAVVASVATAIPTLACGKMSPWARANLNPTA  61

Query  432  QALIVSTAAGMAYFIVADKTVLATARRNSFNR  527
            +ALIVSTAAGMAYFIVADKTVLATAR+NSFNR
Sbjct  62   KALIVSTAAGMAYFIVADKTVLATARQNSFNR  93



>ref|XP_011092415.1| PREDICTED: early nodulin-93-like [Sesamum indicum]
Length=107

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/83 (87%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLA AKR SHEGVVAGAKAA V TVA AIP LAS RMVPWA+ANLNPTAQALI+ST
Sbjct  16   SLDQKLASAKRCSHEGVVAGAKAAVVATVAAAIPTLASARMVPWARANLNPTAQALIIST  75

Query  453  AAGMAYFIVADKTVLATARRNSF  521
              GMAYFIVADKTVLATARRNSF
Sbjct  76   VGGMAYFIVADKTVLATARRNSF  98



>ref|XP_003524537.2| PREDICTED: early nodulin-93-like [Glycine max]
Length=152

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLAMAKR SHEGV+AGAKAA V T+ATAIP LASVRM+PWA+ANLN +AQALI+ST
Sbjct  64   SLDQKLAMAKRCSHEGVMAGAKAAVVATIATAIPTLASVRMLPWARANLNHSAQALIIST  123

Query  453  AAGMAYFIVADKTVLATARRNSFNRPAD  536
             AG AYFIVADKTVLATAR+NSFNRP++
Sbjct  124  VAGAAYFIVADKTVLATARKNSFNRPSN  151



>ref|NP_001240002.1| uncharacterized protein LOC100820292 [Glycine max]
 gb|ACU20557.1| unknown [Glycine max]
 gb|KHN15115.1| Early nodulin-93 [Glycine soja]
Length=107

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/88 (83%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLAMAKR SHEGV+AGAKAA V T+ATAIP LASVRM+PWAKANLN TAQALI+ST
Sbjct  19   SLDQKLAMAKRCSHEGVMAGAKAAVVATIATAIPTLASVRMLPWAKANLNHTAQALIIST  78

Query  453  AAGMAYFIVADKTVLATARRNSFNRPAD  536
             AG AYFIVADKTVLATAR+NSFN P +
Sbjct  79   VAGAAYFIVADKTVLATARKNSFNPPTN  106



>dbj|BAF63494.1| nodule protein Dg93-like protein [Potamogeton distinctus]
Length=94

 Score =   114 bits (285),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            ++DQ++A+AKR SHEG+ AG KAA V TVA+AIP LASVRM+PWA+ NLNPTAQALIVST
Sbjct  8    AMDQQMALAKRCSHEGIKAGVKAAVVATVASAIPTLASVRMLPWARTNLNPTAQALIVST  67

Query  453  AAGMAYFIVADKTVLATARRNSFNR  527
            AAGMAYFIVADKT+LATAR+NSF R
Sbjct  68   AAGMAYFIVADKTILATARKNSFGR  92



>ref|XP_003609265.1| Early nodulin 93 protein [Medicago truncatula]
 gb|AES91462.1| early nodulin 93 [Medicago truncatula]
 gb|AFK49073.1| unknown [Medicago truncatula]
Length=107

 Score =   114 bits (285),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +3

Query  276  LDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTA  455
            LDQ+LAMAKR SHEGV+AGAKAA V T+ATAIP LASVRM+PWA+ANLNPTAQALI+ST 
Sbjct  20   LDQRLAMAKRCSHEGVMAGAKAAVVATIATAIPTLASVRMLPWARANLNPTAQALIISTV  79

Query  456  AGMAYFIVADKTVLATARRNSFNRPAD  536
            AG AYF+VADKTVLATAR+NS NRP++
Sbjct  80   AGAAYFVVADKTVLATARKNSINRPSN  106



>gb|KDP32914.1| hypothetical protein JCGZ_13695 [Jatropha curcas]
Length=108

 Score =   114 bits (285),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLAMAKR SHEGVVAGAKAA + T+ATAIP LAS RM+PWA+ANLN TAQALI+ST
Sbjct  18   SLDQKLAMAKRCSHEGVVAGAKAAVMATIATAIPTLASARMLPWARANLNHTAQALIIST  77

Query  453  AAGMAYFIVADKTVLATARRNSFNR  527
             AG AYFIVADKTVLATAR+NSFN+
Sbjct  78   VAGAAYFIVADKTVLATARKNSFNQ  102



>ref|XP_009368814.1| PREDICTED: early nodulin-93-like [Pyrus x bretschneideri]
Length=107

 Score =   114 bits (285),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 82/92 (89%), Gaps = 1/92 (1%)
 Frame = +3

Query  264  KNVSLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALI  443
            +N S+DQ LAMAKRYS EGV AGAKAA V T+ATAIP +ASVRM+PWA+ANLNPTAQALI
Sbjct  11   ENTSIDQ-LAMAKRYSREGVKAGAKAAVVATIATAIPTMASVRMLPWARANLNPTAQALI  69

Query  444  VSTAAGMAYFIVADKTVLATARRNSFNRPADH  539
            +ST AGMAYFIVADKT+LATARRNSFN+ A H
Sbjct  70   ISTVAGMAYFIVADKTILATARRNSFNQVAHH  101



>ref|XP_007013368.1| Early nodulin-93 isoform 1 [Theobroma cacao]
 gb|EOY30987.1| Early nodulin-93 isoform 1 [Theobroma cacao]
Length=103

 Score =   114 bits (284),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLAMAKR SHEGV+AGAKAA V ++ATAIP LASVRM+PWA+ANLN TAQALI+ST
Sbjct  13   SLDQKLAMAKRCSHEGVLAGAKAAVVASIATAIPTLASVRMLPWARANLNHTAQALIIST  72

Query  453  AAGMAYFIVADKTVLATARRNSF  521
             AG AYFIVADKTVLATAR+NSF
Sbjct  73   VAGAAYFIVADKTVLATARKNSF  95



>ref|XP_007013365.1| Early nodulin-93 [Theobroma cacao]
 gb|EOY30984.1| Early nodulin-93 [Theobroma cacao]
Length=103

 Score =   114 bits (284),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLAMAKR SHEGV+AGAKAA V ++ATAIP LASVRM+PWA+ANLN TAQALI+ST
Sbjct  13   SLDQKLAMAKRCSHEGVLAGAKAAVVASIATAIPTLASVRMLPWARANLNHTAQALIIST  72

Query  453  AAGMAYFIVADKTVLATARRNSF  521
             AG AYFIVADKTVLATAR+NSF
Sbjct  73   VAGAAYFIVADKTVLATARKNSF  95



>ref|XP_004508526.1| PREDICTED: early nodulin-93-like [Cicer arietinum]
Length=107

 Score =   113 bits (283),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQ+LA+AKR SHEGV+AGAKAA V T+ATAIP  ASVRM+PWAKANLN TAQALI+ST
Sbjct  19   SLDQRLAVAKRCSHEGVMAGAKAAVVATIATAIPTFASVRMLPWAKANLNHTAQALIIST  78

Query  453  AAGMAYFIVADKTVLATARRNSFNRPAD  536
             AG AYFIVADKTVLATAR+NSFNRP++
Sbjct  79   VAGAAYFIVADKTVLATARKNSFNRPSN  106



>ref|XP_002305557.1| hypothetical protein POPTR_0004s19470g [Populus trichocarpa]
 gb|ABK94914.1| unknown [Populus trichocarpa]
 gb|EEE86068.1| hypothetical protein POPTR_0004s19470g [Populus trichocarpa]
Length=109

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLAMAKR SHEGVVAGAKAA + T+ATAIP +AS RM+PWA+ANLN TAQALI+ST
Sbjct  18   SLDQKLAMAKRCSHEGVVAGAKAAVLATIATAIPTMASARMLPWARANLNHTAQALIIST  77

Query  453  AAGMAYFIVADKTVLATARRNSFNRPADH  539
             AG AYFIVADKTVLATAR+NSF  P+ +
Sbjct  78   VAGAAYFIVADKTVLATARKNSFKSPSSN  106



>ref|XP_009403396.1| PREDICTED: early nodulin-93-like [Musa acuminata subsp. malaccensis]
Length=96

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            +LDQKLAMAKR SHEG +AGAKAA V +VA AIP LASVRM+PWA++NLNPTAQALI+ST
Sbjct  5    ALDQKLAMAKRCSHEGAMAGAKAAVVASVAAAIPTLASVRMLPWARSNLNPTAQALIIST  64

Query  453  AAGMAYFIVADKTVLATARRNSF  521
            AAG AYFIVADKTVLA+AR+NSF
Sbjct  65   AAGAAYFIVADKTVLASARKNSF  87



>gb|ABN47005.1| early nodulin 93 protein [Populus alba x Populus glandulosa]
Length=109

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLAMAKR SHEGVVAGAKAA + T+ATAIP +AS RM+PWA+ANLN TAQALI+ST
Sbjct  18   SLDQKLAMAKRCSHEGVVAGAKAAVLATIATAIPTMASARMLPWARANLNHTAQALIIST  77

Query  453  AAGMAYFIVADKTVLATARRNSFNRP  530
             AG AYFIVADKTVLATAR+NSF  P
Sbjct  78   VAGAAYFIVADKTVLATARKNSFKSP  103



>ref|XP_009630090.1| PREDICTED: early nodulin-93-like [Nicotiana tomentosiformis]
Length=96

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 82/92 (89%), Gaps = 3/92 (3%)
 Frame = +3

Query  261  SKNVSL---DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTA  431
            +KNVSL   DQKLAMAKR SHEGVVAGAKAA V TVATAIP LA  +M+PWA+ANLNPTA
Sbjct  2    AKNVSLASVDQKLAMAKRCSHEGVVAGAKAAVVATVATAIPTLACGKMLPWARANLNPTA  61

Query  432  QALIVSTAAGMAYFIVADKTVLATARRNSFNR  527
            +ALI+STAAGMAYFIVADKT+LATAR+NSF +
Sbjct  62   KALIISTAAGMAYFIVADKTILATARQNSFKQ  93



>ref|XP_010250017.1| PREDICTED: early nodulin-93-like isoform X2 [Nelumbo nucifera]
Length=107

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +3

Query  270  VSLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVS  449
            VS+DQKLA+AKR  HEGVVAGAKAA + T A+A+P LASVRM+PWA+A+LNPTAQALI+S
Sbjct  16   VSVDQKLALAKRCGHEGVVAGAKAAVLATFASAVPTLASVRMLPWARAHLNPTAQALIIS  75

Query  450  TAAGMAYFIVADKTVLATARRNSF  521
            T AG AYFIVADKTVLATARRNSF
Sbjct  76   TVAGSAYFIVADKTVLATARRNSF  99



>ref|NP_001237669.1| early nodulin-93 [Glycine max]
 sp|Q02921.1|NO93_SOYBN RecName: Full=Early nodulin-93; Short=N-93 [Glycine max]
 dbj|BAA02724.1| early nodulin [Glycine max]
 dbj|BAA33816.1| early nodulin [Glycine max]
 gb|KHN35891.1| Early nodulin-93 [Glycine soja]
 prf||1913422D nodulin
Length=105

 Score =   112 bits (279),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLA AKR SHEGV+AGAKAA V +VA+AIP LASVRM+PWA+ANLN TAQALI+ST
Sbjct  15   SLDQKLAFAKRCSHEGVLAGAKAAVVASVASAIPTLASVRMLPWARANLNHTAQALIIST  74

Query  453  AAGMAYFIVADKTVLATARRNSFNRPAD  536
            A   AYFIVADKTVLATAR+NSFN+P++
Sbjct  75   ATAAAYFIVADKTVLATARKNSFNQPSN  102



>gb|KHG12431.1| Early nodulin-93 [Gossypium arboreum]
Length=103

 Score =   112 bits (279),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 72/83 (87%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLA+AKR SHEGVVAGAKAA V T+ATAIP LASVRM+PWAKANLN TAQALI+ST
Sbjct  13   SLDQKLALAKRCSHEGVVAGAKAAIVATIATAIPTLASVRMLPWAKANLNHTAQALIIST  72

Query  453  AAGMAYFIVADKTVLATARRNSF  521
            AAG AYFIVADKTVLATAR+NSF
Sbjct  73   AAGAAYFIVADKTVLATARKNSF  95



>ref|XP_009403394.1| PREDICTED: early nodulin-93-like [Musa acuminata subsp. malaccensis]
Length=103

 Score =   111 bits (278),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            +LDQK+AMAKR +HEGV+AGAKAA V +VA AIP LASVRM+PWA+ANLNPTAQALI+ST
Sbjct  8    ALDQKVAMAKRCAHEGVMAGAKAAVVASVAAAIPTLASVRMLPWARANLNPTAQALIIST  67

Query  453  AAGMAYFIVADKTVLATARRNSF  521
             AG AYFIVADKTVLATARRNSF
Sbjct  68   VAGAAYFIVADKTVLATARRNSF  90



>gb|KHG12433.1| Early nodulin-93 [Gossypium arboreum]
Length=103

 Score =   111 bits (278),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLAMAKR SHEGVVAGAKAA V T+ATAIP LASVRM+PWA+ANLN TAQALI+ST
Sbjct  13   SLDQKLAMAKRCSHEGVVAGAKAAVVATIATAIPTLASVRMLPWARANLNHTAQALIIST  72

Query  453  AAGMAYFIVADKTVLATARRNSFNR  527
            AAG AYFIVADKTVLATAR+NSF +
Sbjct  73   AAGAAYFIVADKTVLATARKNSFKQ  97



>ref|XP_002524454.1| Early nodulin, putative [Ricinus communis]
 gb|EEF37894.1| Early nodulin, putative [Ricinus communis]
Length=108

 Score =   111 bits (278),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLAMAKR SHEGVVAGAKAA V ++ATAIP LAS RM+PWA+ANLN TAQALI+ST
Sbjct  18   SLDQKLAMAKRCSHEGVVAGAKAAVVASIATAIPTLASARMLPWARANLNHTAQALIIST  77

Query  453  AAGMAYFIVADKTVLATARRNSFNR  527
             AG AYFIVADKTVLATARRNSF +
Sbjct  78   VAGAAYFIVADKTVLATARRNSFKQ  102



>ref|XP_002313673.1| hypothetical protein POPTR_0009s14600g [Populus trichocarpa]
 gb|EEE87628.1| hypothetical protein POPTR_0009s14600g [Populus trichocarpa]
Length=109

 Score =   111 bits (277),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLAMAKR SHEGVVAGAKAAA+ T+ATAIP LAS RM+PWA+ANLNPTAQALI+ST
Sbjct  18   SLDQKLAMAKRCSHEGVVAGAKAAALATIATAIPTLASARMLPWARANLNPTAQALIIST  77

Query  453  AAGMAYFIVADKTVLATARRNSF  521
             AG AYFIVADKTVLATAR+NSF
Sbjct  78   VAGAAYFIVADKTVLATARKNSF  100



>ref|XP_010250016.1| PREDICTED: early nodulin-93-like isoform X1 [Nelumbo nucifera]
Length=107

 Score =   111 bits (277),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +3

Query  270  VSLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVS  449
            VS+DQKLA+AKR  HEGVVAGAKAA + T A+A+P LASVRM+PWA+A+LNPTAQALI+S
Sbjct  16   VSVDQKLALAKRCGHEGVVAGAKAAVLATFASAVPTLASVRMLPWARAHLNPTAQALIIS  75

Query  450  TAAGMAYFIVADKTVLATARRNSF  521
            T AG  YFIVADKTVLATARRNSF
Sbjct  76   TVAGSTYFIVADKTVLATARRNSF  99



>ref|XP_004287357.1| PREDICTED: early nodulin-93-like [Fragaria vesca subsp. vesca]
Length=105

 Score =   110 bits (276),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 77/90 (86%), Gaps = 2/90 (2%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            S DQ+LA  KR SHEGV AG KAA V T+A+AIP  ASVRM+PWAKANLNPTAQALI+ST
Sbjct  17   SFDQQLA--KRCSHEGVKAGVKAAVVATIASAIPTFASVRMLPWAKANLNPTAQALIIST  74

Query  453  AAGMAYFIVADKTVLATARRNSFNRPADHR  542
            AAGMAYFIVADKT+LATARRNSF++  ++ 
Sbjct  75   AAGMAYFIVADKTILATARRNSFHQGPNYE  104



>ref|XP_009773355.1| PREDICTED: early nodulin-93-like [Nicotiana sylvestris]
Length=96

 Score =   110 bits (275),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 81/92 (88%), Gaps = 3/92 (3%)
 Frame = +3

Query  261  SKNVSL---DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTA  431
            +KNVSL   DQKLAMAKR SHEGVVAGAKAA V TVATAIP LA  +M+PWA+ANLNPTA
Sbjct  2    AKNVSLASVDQKLAMAKRCSHEGVVAGAKAAVVATVATAIPTLACGKMLPWARANLNPTA  61

Query  432  QALIVSTAAGMAYFIVADKTVLATARRNSFNR  527
            +ALIVSTAAGMAYFIVADKT+LA AR+NSF +
Sbjct  62   KALIVSTAAGMAYFIVADKTILAAARQNSFKQ  93



>ref|XP_009773354.1| PREDICTED: early nodulin-93-like [Nicotiana sylvestris]
Length=94

 Score =   110 bits (275),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 81/92 (88%), Gaps = 3/92 (3%)
 Frame = +3

Query  261  SKNVSL---DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTA  431
            +KNVSL   DQKLAMAKR SHEGVVAGAKAA V TVATAIP LA  +M PWA+ANLNPTA
Sbjct  2    AKNVSLASVDQKLAMAKRCSHEGVVAGAKAAVVATVATAIPTLAFGKMSPWARANLNPTA  61

Query  432  QALIVSTAAGMAYFIVADKTVLATARRNSFNR  527
            +ALIVSTAAGMAYFIVADKT+LATAR+NSF +
Sbjct  62   KALIVSTAAGMAYFIVADKTILATARQNSFKQ  93



>ref|XP_010254480.1| PREDICTED: early nodulin-93-like [Nelumbo nucifera]
Length=107

 Score =   110 bits (276),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLA+AKR  HEGVVAGAKAA + TVATAIP  ASVRM+PWA+ANLNPTAQALI+ST
Sbjct  17   SLDQKLALAKRCGHEGVVAGAKAALLATVATAIPTFASVRMLPWARANLNPTAQALIIST  76

Query  453  AAGMAYFIVADKTVLATARRNSF  521
             AG AYFIVADKTVLATAR+NSF
Sbjct  77   VAGSAYFIVADKTVLATARKNSF  99



>gb|ACU16453.1| unknown [Glycine max]
Length=105

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLA AKR SHEGV+AGAKAA V +VA+AIP LASVRM PWA+ANLN TAQALI+ST
Sbjct  15   SLDQKLAFAKRCSHEGVLAGAKAAVVASVASAIPTLASVRMRPWARANLNHTAQALIIST  74

Query  453  AAGMAYFIVADKTVLATARRNSFNRPAD  536
            A   AYFIVADKTVLATAR+NSFN+P++
Sbjct  75   ATAAAYFIVADKTVLATARKNSFNQPSN  102



>ref|XP_010250013.1| PREDICTED: early nodulin-93-like [Nelumbo nucifera]
Length=107

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLD KLA+AKR  HEGVVAGAKAA + T+A+A+P LASVRM+PWA+A+LNPTAQALI+ST
Sbjct  17   SLDHKLALAKRCGHEGVVAGAKAAVLATIASAVPTLASVRMLPWARAHLNPTAQALIIST  76

Query  453  AAGMAYFIVADKTVLATARRNSF  521
             AG AYFIVADKTVLATARRNSF
Sbjct  77   VAGSAYFIVADKTVLATARRNSF  99



>ref|XP_008809696.1| PREDICTED: early nodulin-93-like [Phoenix dactylifera]
Length=96

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLAMAKR SHEGVVAGAKAA V TVA+AIP LASVRM+PWA++ LNP AQALIVS+
Sbjct  8    SLDQKLAMAKRCSHEGVVAGAKAAMVATVASAIPTLASVRMIPWARSFLNPAAQALIVSS  67

Query  453  AAGMAYFIVADKTVLATARRNSF  521
            AAG AYFIVADKTVLA AR+NSF
Sbjct  68   AAGAAYFIVADKTVLAAARKNSF  90



>ref|XP_010254343.1| PREDICTED: early nodulin-93-like [Nelumbo nucifera]
Length=109

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            S DQKLAMAKR SHEGV+AG KAAA+  +ATAIP  ASVRM+PWA+ANLNPTAQALI+ST
Sbjct  17   SFDQKLAMAKRCSHEGVMAGVKAAALAAIATAIPTFASVRMLPWARANLNPTAQALIIST  76

Query  453  AAGMAYFIVADKTVLATARRNSFNRPAD  536
             AG AYFIVADKTVLATAR+NSF    D
Sbjct  77   VAGSAYFIVADKTVLATARKNSFKGHTD  104



>ref|XP_010250015.1| PREDICTED: early nodulin-93-like [Nelumbo nucifera]
Length=107

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLAMAKR  HEGVVAG KAA V T A+AIP  ASVRM+PWA+ANLNPTAQALI+S 
Sbjct  17   SLDQKLAMAKRCGHEGVVAGTKAAIVATFASAIPTFASVRMLPWARANLNPTAQALIISI  76

Query  453  AAGMAYFIVADKTVLATARRNSF  521
             AG AYF+VADKTVLATAR+NSF
Sbjct  77   VAGSAYFVVADKTVLATARKNSF  99



>ref|XP_008792075.1| PREDICTED: early nodulin-93-like isoform X2 [Phoenix dactylifera]
Length=104

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLAMAKR SHEGVVAGAKAA V + A AIP LASVRM+PWA++NLN TAQALI+ST
Sbjct  10   SLDQKLAMAKRCSHEGVVAGAKAAIVASAAAAIPTLASVRMLPWARSNLNHTAQALIIST  69

Query  453  AAGMAYFIVADKTVLATARRNSF  521
             AG AYFIVADKTVLA+AR+NSF
Sbjct  70   VAGAAYFIVADKTVLASARKNSF  92



>ref|XP_008775025.1| PREDICTED: early nodulin-93-like [Phoenix dactylifera]
Length=100

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLAMAKR SHEGVVAGAKAA V TVA+AIP LASVRM+PWA++ LNP AQALIVS+
Sbjct  8    SLDQKLAMAKRCSHEGVVAGAKAAMVATVASAIPTLASVRMIPWARSFLNPAAQALIVSS  67

Query  453  AAGMAYFIVADKTVLATARRNSFN  524
            AAG AYFIVADKTVLA AR+NSF 
Sbjct  68   AAGAAYFIVADKTVLAAARKNSFK  91



>ref|XP_006475805.1| PREDICTED: early nodulin-93-like [Citrus sinensis]
Length=107

 Score =   109 bits (273),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +3

Query  270  VSLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVS  449
            VSLD KLAMAKR SHEGV+AGAKAA V TVATAIP LASVRM+PWA+ANLN TAQALI+S
Sbjct  16   VSLDHKLAMAKRCSHEGVIAGAKAAVVATVATAIPTLASVRMLPWARANLNHTAQALIIS  75

Query  450  TAAGMAYFIVADKTVLATARRNSFNRPAD  536
            T AG AYFIVADKTVLATAR+NSF + ++
Sbjct  76   TVAGAAYFIVADKTVLATARKNSFQQASN  104



>ref|XP_010250010.1| PREDICTED: early nodulin-93-like [Nelumbo nucifera]
Length=107

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLA+AKR S EGV+AG KAAAV T+ATAIP LASVRM+PWA+ANLNPTAQALI+ST
Sbjct  17   SLDQKLALAKRCSREGVMAGMKAAAVATIATAIPTLASVRMLPWARANLNPTAQALIIST  76

Query  453  AAGMAYFIVADKTVLATARRNSF  521
             AG AYFIVADKTVLATARRNSF
Sbjct  77   VAGSAYFIVADKTVLATARRNSF  99



>ref|XP_009391602.1| PREDICTED: early nodulin-93-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=100

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLAMAKR SHEGVVAGAKAA V   A A+P LASVR++PWA+ NLNPTAQALIVST
Sbjct  8    SLDQKLAMAKRCSHEGVVAGAKAAVVAGFAAAVPTLASVRILPWARYNLNPTAQALIVST  67

Query  453  AAGMAYFIVADKTVLATARRNSF  521
            AAGM+YFIVADKTVLA AR+NSF
Sbjct  68   AAGMSYFIVADKTVLAAARKNSF  90



>ref|XP_010254344.1| PREDICTED: early nodulin-93-like [Nelumbo nucifera]
Length=103

 Score =   108 bits (271),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLA+AKR  HEGVVAGAKAA V  VA+A+P LASVRM+PWAKANLNPTAQALI+ST
Sbjct  17   SLDQKLALAKRCGHEGVVAGAKAAVVAAVASAVPTLASVRMLPWAKANLNPTAQALIIST  76

Query  453  AAGMAYFIVADKTVLATARRNSF  521
             AG AYF+VADKTVL TAR+NSF
Sbjct  77   VAGSAYFVVADKTVLKTARKNSF  99



>gb|AFK44884.1| unknown [Lotus japonicus]
Length=107

 Score =   108 bits (270),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQ+LA+AKR SHEGV+AGA+AA V ++ATAIP L SVRM+PWA+ANLN TAQAL++ST
Sbjct  19   SLDQRLAIAKRCSHEGVMAGARAAVVASIATAIPTLTSVRMLPWARANLNHTAQALLIST  78

Query  453  AAGMAYFIVADKTVLATARRNSFNRPAD  536
             AG AYFIVADKTVLATAR+NSF  P++
Sbjct  79   VAGAAYFIVADKTVLATARKNSFKPPSN  106



>ref|XP_009630092.1| PREDICTED: early nodulin-93-like [Nicotiana tomentosiformis]
Length=94

 Score =   108 bits (269),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 80/92 (87%), Gaps = 3/92 (3%)
 Frame = +3

Query  261  SKNVSL---DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTA  431
            +KNVSL   DQKLAMAKR SHEGVVAGAKAA + TVATAIP LA  +  PWA+ANLNPTA
Sbjct  2    AKNVSLASVDQKLAMAKRCSHEGVVAGAKAAVIATVATAIPTLACGKKSPWARANLNPTA  61

Query  432  QALIVSTAAGMAYFIVADKTVLATARRNSFNR  527
            +ALIVSTAAGMAYFIVADKT+LATAR+NSF +
Sbjct  62   KALIVSTAAGMAYFIVADKTILATARQNSFKQ  93



>ref|XP_011046280.1| PREDICTED: early nodulin-93-like [Populus euphratica]
Length=109

 Score =   108 bits (270),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLAMAKR SHEGVVAGAKAAA+ T+ATAIP +AS RM+PWA+ANLN TAQALI+ST
Sbjct  18   SLDQKLAMAKRCSHEGVVAGAKAAALATIATAIPTMASARMLPWARANLNHTAQALIIST  77

Query  453  AAGMAYFIVADKTVLATARRNSFNRPADH  539
             AG AYFIVADKTVLATAR+NSF  P+ +
Sbjct  78   VAGAAYFIVADKTVLATARKNSFKSPSSN  106



>ref|XP_007154975.1| hypothetical protein PHAVU_003G162200g [Phaseolus vulgaris]
 gb|ESW26969.1| hypothetical protein PHAVU_003G162200g [Phaseolus vulgaris]
Length=107

 Score =   108 bits (269),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLA+AKR S EGV+AGAKAA V T+ATAIP +ASV+M+PWAKANLN TAQALI+ST
Sbjct  19   SLDQKLALAKRCSREGVMAGAKAAVVATIATAIPTMASVKMLPWAKANLNHTAQALIIST  78

Query  453  AAGMAYFIVADKTVLATARRNSFNRPAD  536
             AG AYFIVADKTVLATAR+NSFN P++
Sbjct  79   VAGAAYFIVADKTVLATARKNSFNAPSN  106



>ref|XP_004964505.1| PREDICTED: early nodulin-93-like [Setaria italica]
Length=115

 Score =   108 bits (269),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLAMAKR S E  +AG KAAAV T+A+AIP LASVRM+PWAKAN+NPT QALI+ST
Sbjct  8    SLDQKLAMAKRCSREATLAGTKAAAVATIASAIPTLASVRMLPWAKANINPTGQALIIST  67

Query  453  AAGMAYFIVADKTVLATARRNSFNRPADH  539
             AGMAYFI ADK +L+ ARR+SF    DH
Sbjct  68   VAGMAYFIAADKKILSLARRHSFEEAPDH  96



>ref|XP_010909459.1| PREDICTED: early nodulin-93-like [Elaeis guineensis]
Length=100

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLAMAKR SHEGVVAGAKAA V TVA+AIP LASVRM+PWA++ LNP AQALIVS+
Sbjct  8    SLDQKLAMAKRCSHEGVVAGAKAAVVATVASAIPTLASVRMIPWARSFLNPAAQALIVSS  67

Query  453  AAGMAYFIVADKTVLATARRNSFN  524
            AAG AYFIVADKTVLA AR+NSF 
Sbjct  68   AAGAAYFIVADKTVLAAARKNSFK  91



>ref|XP_006450983.1| hypothetical protein CICLE_v10009984mg [Citrus clementina]
 gb|ESR64223.1| hypothetical protein CICLE_v10009984mg [Citrus clementina]
 gb|KDO80308.1| hypothetical protein CISIN_1g033978mg [Citrus sinensis]
Length=107

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLD KLAMAKR SHEGV+AGAKAA V TVATAIP LASVRM+PWA+ANLN TAQALI+ST
Sbjct  17   SLDHKLAMAKRCSHEGVIAGAKAAVVATVATAIPTLASVRMLPWARANLNHTAQALIIST  76

Query  453  AAGMAYFIVADKTVLATARRNSFNRPAD  536
             AG AYFIVADKTVLATAR+NSF + ++
Sbjct  77   VAGAAYFIVADKTVLATARKNSFQQASN  104



>ref|XP_007202786.1| hypothetical protein PRUPE_ppa013711mg [Prunus persica]
 ref|XP_008242731.1| PREDICTED: early nodulin-93-like [Prunus mume]
 gb|EMJ03985.1| hypothetical protein PRUPE_ppa013711mg [Prunus persica]
Length=107

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 79/91 (87%), Gaps = 1/91 (1%)
 Frame = +3

Query  270  VSLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVS  449
             S+DQ LA+AKR SHEGV AGAKAA V T+ATAIP +ASVRM+PWA+ANLNPTAQALI+S
Sbjct  17   TSIDQ-LALAKRCSHEGVKAGAKAAVVATIATAIPTMASVRMLPWARANLNPTAQALIIS  75

Query  450  TAAGMAYFIVADKTVLATARRNSFNRPADHR  542
            T AGMAYFIVADKTVLATARRNSF + A+  
Sbjct  76   TVAGMAYFIVADKTVLATARRNSFKQAANRE  106



>gb|AIE16049.1| early nodulin 93 protein [Elaeis guineensis]
Length=102

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLAMAKR SHEGVVAGAKAA V +VA A+P+LASVRM+PWA++NLN TAQALI+ST
Sbjct  8    SLDQKLAMAKRCSHEGVVAGAKAAVVASVAAAVPILASVRMLPWARSNLNHTAQALIIST  67

Query  453  AAGMAYFIVADKTVLATARRNSF  521
             AG AYFIVADKTVLA+AR+NSF
Sbjct  68   VAGAAYFIVADKTVLASARKNSF  90



>gb|ACG31347.1| early nodulin 93 [Zea mays]
Length=116

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +3

Query  249  ITMASKNVSLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPT  428
            ++M     SLDQKLA+AKR S E  +AGAKAAAV T+A+AIP LASVRM+PWAKAN+NPT
Sbjct  1    MSMTVSRASLDQKLALAKRCSREATLAGAKAAAVATIASAIPTLASVRMLPWAKANINPT  60

Query  429  AQALIVSTAAGMAYFIVADKTVLATARRNSFNRPADH  539
             QALIVST AGMAYFI ADK +L+ ARR+SF +  +H
Sbjct  61   GQALIVSTVAGMAYFIAADKKILSLARRHSFEQAPEH  97



>gb|ACG45703.1| early nodulin 93 [Zea mays]
Length=116

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLA+AKR S E  +AGAKAAAV T+A+AIP LASVRM+PWAKAN+NPT QALIVST
Sbjct  9    SLDQKLALAKRCSREATLAGAKAAAVATIASAIPTLASVRMLPWAKANINPTGQALIVST  68

Query  453  AAGMAYFIVADKTVLATARRNSFNRPADH  539
             AGMAYFI ADK +L+ ARR+SF++  DH
Sbjct  69   VAGMAYFIAADKKILSLARRHSFDQAPDH  97



>ref|NP_001131809.1| uncharacterized protein LOC100193182 [Zea mays]
 ref|XP_008658094.1| PREDICTED: uncharacterized protein LOC100193182 isoform X2 [Zea 
mays]
 gb|ACF80385.1| unknown [Zea mays]
 gb|ACG48862.1| early nodulin 93 [Zea mays]
Length=115

 Score =   107 bits (266),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLA+AKR S E  +AGAKAAAV T+A+AIP LASVRM+PWAKAN+NPT QALIVST
Sbjct  8    SLDQKLALAKRCSREATLAGAKAAAVATIASAIPTLASVRMLPWAKANINPTGQALIVST  67

Query  453  AAGMAYFIVADKTVLATARRNSFNRPADH  539
             AGMAYFI ADK +L+ ARR+SF +  DH
Sbjct  68   VAGMAYFIAADKKILSLARRHSFEQAPDH  96



>ref|XP_004964506.1| PREDICTED: early nodulin-93-like [Setaria italica]
Length=115

 Score =   107 bits (266),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLAMAKR S E  +AG KAAAV T+ +AIP LASVRM+PWAKAN+NPT QALI+ST
Sbjct  8    SLDQKLAMAKRCSREATLAGTKAAAVATIVSAIPTLASVRMLPWAKANINPTGQALIIST  67

Query  453  AAGMAYFIVADKTVLATARRNSFNRPADH  539
             AGMAYFI ADK +L+ ARR+S+    +H
Sbjct  68   VAGMAYFIAADKKILSLARRHSYEEAPEH  96



>ref|XP_010914914.1| PREDICTED: early nodulin-93-like [Elaeis guineensis]
Length=102

 Score =   106 bits (265),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLAMAKR SHEGVVAGAKAA V +VA A+P LASVRM+PWA++NLN TAQALI+ST
Sbjct  8    SLDQKLAMAKRCSHEGVVAGAKAAVVASVAAAVPTLASVRMLPWARSNLNHTAQALIIST  67

Query  453  AAGMAYFIVADKTVLATARRNSF  521
             AG AYFIVADKTVLA+AR+NSF
Sbjct  68   VAGAAYFIVADKTVLASARKNSF  90



>ref|XP_002285052.1| PREDICTED: early nodulin-93 [Vitis vinifera]
 emb|CBI28165.3| unnamed protein product [Vitis vinifera]
Length=107

 Score =   106 bits (264),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            S DQKLAMAKR SHEGVVAGAKAA V ++ATAIP +AS R +PWAKANLN TAQALI+ST
Sbjct  17   SFDQKLAMAKRCSHEGVVAGAKAAVVASIATAIPTMASARWLPWAKANLNHTAQALIIST  76

Query  453  AAGMAYFIVADKTVLATARRNSFNRPA  533
             AG AYFIVADKTVLA+ARRNS  +P 
Sbjct  77   VAGAAYFIVADKTVLASARRNSLKKPC  103



>ref|XP_010688053.1| PREDICTED: early nodulin-93-like [Beta vulgaris subsp. vulgaris]
Length=100

 Score =   105 bits (262),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +3

Query  261  SKNVSLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQAL  440
            SK+   DQ+LAMAK+YSHEGVVAGAKAA V  V TAIP +AS RM+PWA+ANLN TAQAL
Sbjct  10   SKSSLTDQRLAMAKQYSHEGVVAGAKAAIVAGVVTAIPTIASARMLPWARANLNSTAQAL  69

Query  441  IVSTAAGMAYFIVADKTVLATARRNSF  521
            I+ST AG AYFIVADKTVL +ARRNS+
Sbjct  70   IISTVAGAAYFIVADKTVLKSARRNSY  96



>ref|NP_001147053.1| early nodulin 93 [Zea mays]
 gb|ACG25286.1| early nodulin 93 [Zea mays]
 gb|ACG48867.1| early nodulin 93 [Zea mays]
Length=116

 Score =   105 bits (263),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLA+AKR S E  +AGAKAAAV T+A+AIP LASVRM+PWAKAN+NPT QALIVST
Sbjct  9    SLDQKLALAKRCSREATLAGAKAAAVATIASAIPTLASVRMLPWAKANINPTGQALIVST  68

Query  453  AAGMAYFIVADKTVLATARRNSFNRPADH  539
             AGMAYFI ADK +L+ ARR+SF++  +H
Sbjct  69   VAGMAYFIAADKKILSLARRHSFDQAPEH  97



>ref|XP_011045025.1| PREDICTED: early nodulin-93-like [Populus euphratica]
Length=109

 Score =   105 bits (262),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLA+AKR SHEGVVAGAKAAA+ T+ATAIP LAS RM+PWA+ANLN TAQALI+ST
Sbjct  18   SLDQKLALAKRCSHEGVVAGAKAAALATIATAIPTLASARMLPWARANLNHTAQALIIST  77

Query  453  AAGMAYFIVADKTVLATARRNSF  521
             AG AYFIVADKTVLATAR+NSF
Sbjct  78   VAGAAYFIVADKTVLATARKNSF  100



>gb|ACG24704.1| early nodulin 93 [Zea mays]
Length=115

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLA+AKR S E  +AGAKAAAV T+A+AIP LASVRM+PWAKAN+NPT QALIVST
Sbjct  8    SLDQKLALAKRCSREATLAGAKAAAVATIASAIPTLASVRMLPWAKANINPTGQALIVST  67

Query  453  AAGMAYFIVADKTVLATARRNSFNRPADH  539
             AGMAYFI ADK +L+ ARR+SF +  +H
Sbjct  68   VAGMAYFIAADKKILSLARRHSFEQAPEH  96



>gb|ACG23914.1| early nodulin 93 [Zea mays]
 gb|ACG24450.1| early nodulin 93 [Zea mays]
 gb|ACG24741.1| early nodulin 93 [Zea mays]
 gb|AFW85921.1| early nodulin 93 [Zea mays]
Length=116

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLA+AKR S E  +AGAKAAAV T+A+AIP LASVRM+PWAKAN+NPT QALIVST
Sbjct  9    SLDQKLALAKRCSREATLAGAKAAAVATIASAIPTLASVRMLPWAKANINPTGQALIVST  68

Query  453  AAGMAYFIVADKTVLATARRNSFNRPADH  539
             AGMAYFI ADK +L+ ARR+SF +  +H
Sbjct  69   VAGMAYFIAADKKILSLARRHSFEQAPEH  97



>ref|XP_008658093.1| PREDICTED: uncharacterized protein LOC100193182 isoform X1 [Zea 
mays]
 gb|AFW85920.1| early nodulin 93 [Zea mays]
Length=115

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLA+AKR S E  +AGAKAAAV T+A+AIP LASVRM+PWAKAN+NPT QALIVST
Sbjct  8    SLDQKLALAKRCSREATLAGAKAAAVATIASAIPTLASVRMLPWAKANINPTGQALIVST  67

Query  453  AAGMAYFIVADKTVLATARRNSFNRPADH  539
             AGMAYFI ADK +L+ ARR+SF    +H
Sbjct  68   VAGMAYFIAADKKILSLARRHSFEEAPEH  96



>ref|XP_010047806.1| PREDICTED: early nodulin-93-like [Eucalyptus grandis]
 ref|XP_010039614.1| PREDICTED: early nodulin-93-like [Eucalyptus grandis]
 gb|KCW45866.1| hypothetical protein EUGRSUZ_L00290 [Eucalyptus grandis]
Length=108

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQ+LAMAKR S EGV AGAKAA +  +ATAIP LAS RM+PWA+ANLN +AQALI+ST
Sbjct  18   SLDQRLAMAKRCSREGVKAGAKAAVLAGIATAIPTLASARMLPWARANLNHSAQALIIST  77

Query  453  AAGMAYFIVADKTVLATARRNSFNR  527
             AG AYFIVADKT+LATAR+NSF +
Sbjct  78   VAGAAYFIVADKTILATARQNSFKQ  102



>ref|XP_002436448.1| hypothetical protein SORBIDRAFT_10g002890 [Sorghum bicolor]
 gb|EER87815.1| hypothetical protein SORBIDRAFT_10g002890 [Sorghum bicolor]
Length=115

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLA+AKR S E  +AGAKAAAV T+A+AIP LASVRM+PWAKAN+NPT QALI+ST
Sbjct  8    SLDQKLALAKRCSREATLAGAKAAAVATIASAIPTLASVRMLPWAKANINPTGQALIIST  67

Query  453  AAGMAYFIVADKTVLATARRNSFNRPADH  539
             AGMAYFI ADK +L+ ARR+SF    +H
Sbjct  68   VAGMAYFIAADKKILSLARRHSFEEAPEH  96



>ref|XP_004964504.1| PREDICTED: early nodulin-93-like [Setaria italica]
Length=115

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  267  NVSLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIV  446
            + SLDQKLA+AKR S E  +AGAKAAAV T+A+A+P LASVRM+PWAKAN+NPT QALI+
Sbjct  6    HASLDQKLALAKRCSREATLAGAKAAAVATIASAVPTLASVRMLPWAKANINPTGQALII  65

Query  447  STAAGMAYFIVADKTVLATARRNSFNRPADH  539
            ST AGMAYFI ADK +L+ ARR+SF    +H
Sbjct  66   STVAGMAYFIAADKKILSLARRHSFEEAPEH  96



>ref|XP_003524536.1| PREDICTED: early nodulin-93-like [Glycine max]
 gb|KHN27412.1| Early nodulin-93 [Glycine soja]
Length=106

 Score =   103 bits (258),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 75/88 (85%), Gaps = 1/88 (1%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SL QKLAMAKR S +GV+AGAK A   ++ATAIP LASVRM+PWA+ANLN TAQALI+ST
Sbjct  19   SLHQKLAMAKRCS-QGVMAGAKTAVAASIATAIPTLASVRMLPWARANLNHTAQALIIST  77

Query  453  AAGMAYFIVADKTVLATARRNSFNRPAD  536
              G AYFI ADKTVLATAR+NSFN+P++
Sbjct  78   VTGAAYFIEADKTVLATARKNSFNQPSN  105



>ref|XP_008659310.1| PREDICTED: uncharacterized protein LOC103638099 [Zea mays]
Length=215

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLA+AKR S E  +AGAKAAAV T+A+AIP LASVRM+PWAKAN+NPT QALIVST
Sbjct  108  SLDQKLALAKRCSREATLAGAKAAAVATIASAIPTLASVRMLPWAKANINPTGQALIVST  167

Query  453  AAGMAYFIVADKTVLATARRNSFNRPADH  539
             AGMAYFI ADK +L+ ARR+SF +  +H
Sbjct  168  VAGMAYFIAADKKILSLARRHSFEQAPEH  196



>ref|XP_006842815.1| hypothetical protein AMTR_s00081p00057480 [Amborella trichopoda]
 gb|ERN04490.1| hypothetical protein AMTR_s00081p00057480 [Amborella trichopoda]
Length=113

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLAMAKR SHEGV+AGAKAA V ++ATAIP LASVRM  WA+++LN TAQALI+ST
Sbjct  25   SLDQKLAMAKRCSHEGVIAGAKAAVVASIATAIPTLASVRMSRWARSHLNHTAQALIIST  84

Query  453  AAGMAYFIVADKTVLATARRNSF  521
             AG AYFIVADKTVLA+AR+NSF
Sbjct  85   VAGAAYFIVADKTVLASARKNSF  107



>ref|XP_008385798.1| PREDICTED: early nodulin-93-like [Malus domestica]
 ref|XP_008354378.1| PREDICTED: early nodulin-93-like [Malus domestica]
Length=103

 Score =   103 bits (258),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 77/93 (83%), Gaps = 1/93 (1%)
 Frame = +3

Query  264  KNVSLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALI  443
            +  S+DQ LA+AK  S EGV AGAKAA V T+ATAIP L SVRM+PWA+ NLNPTAQALI
Sbjct  11   EKTSIDQ-LALAKHCSREGVKAGAKAAVVATIATAIPTLVSVRMLPWARTNLNPTAQALI  69

Query  444  VSTAAGMAYFIVADKTVLATARRNSFNRPADHR  542
            +ST AGMAYFIVADKTVLATARRNSFN+ A H 
Sbjct  70   ISTVAGMAYFIVADKTVLATARRNSFNQVAHHE  102



>ref|XP_002437807.1| hypothetical protein SORBIDRAFT_10g002880 [Sorghum bicolor]
 gb|EER89174.1| hypothetical protein SORBIDRAFT_10g002880 [Sorghum bicolor]
Length=115

 Score =   103 bits (258),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLA+AKR S E  +AGAKAAAV T+A+AIP LASVRM+PWAKAN+NPT QALI+ST
Sbjct  8    SLDQKLALAKRCSREATLAGAKAAAVATIASAIPTLASVRMLPWAKANINPTGQALIIST  67

Query  453  AAGMAYFIVADKTVLATARRNSFNRPADH  539
             AGMAYFI ADK +L+ ARR+SF    +H
Sbjct  68   VAGMAYFIAADKKILSLARRHSFEGAPEH  96



>ref|XP_010047808.1| PREDICTED: early nodulin-93-like [Eucalyptus grandis]
 gb|KCW79789.1| hypothetical protein EUGRSUZ_C01130 [Eucalyptus grandis]
Length=108

 Score =   103 bits (257),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQ+LAMAKR S EGV AGAKAA +  +ATAIP LAS RM+PWA+ N N +AQALI+ST
Sbjct  18   SLDQRLAMAKRCSREGVKAGAKAAVLAGIATAIPTLASARMLPWARTNFNHSAQALIIST  77

Query  453  AAGMAYFIVADKTVLATARRNSFNR  527
             AG AYFIVADKTVLATARRNSF +
Sbjct  78   VAGAAYFIVADKTVLATARRNSFEQ  102



>ref|XP_010688054.1| PREDICTED: early nodulin-93-like [Beta vulgaris subsp. vulgaris]
Length=147

 Score =   104 bits (260),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +3

Query  276  LDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTA  455
             DQ+L MAKR +HEGV+AGAKAA V+  A AIP +AS RM+PWAKANLN TAQALI+ST 
Sbjct  56   FDQRLTMAKRCAHEGVLAGAKAAVVSGFAAAIPTIASARMLPWAKANLNHTAQALIISTV  115

Query  456  AGMAYFIVADKTVLATARRNSFNRPAD  536
            AG AYFIVADKTVL +ARRNSFN+  +
Sbjct  116  AGAAYFIVADKTVLKSARRNSFNQAGN  142



>ref|XP_010039609.1| PREDICTED: early nodulin-93-like [Eucalyptus grandis]
 gb|KCW45868.1| hypothetical protein EUGRSUZ_L00293 [Eucalyptus grandis]
Length=108

 Score =   103 bits (257),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQ+LAMAKR S EGV+AGAKAA +  +ATAIP LAS RM+PWA+ N N +AQALI+ST
Sbjct  18   SLDQRLAMAKRCSREGVIAGAKAAVLAGIATAIPTLASARMLPWARTNFNHSAQALIIST  77

Query  453  AAGMAYFIVADKTVLATARRNSFNR  527
             AG AYFIVADKTVLATARRNSF +
Sbjct  78   VAGAAYFIVADKTVLATARRNSFEQ  102



>ref|XP_006364907.1| PREDICTED: early nodulin-93-like [Solanum tuberosum]
Length=95

 Score =   102 bits (255),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 75/92 (82%), Gaps = 3/92 (3%)
 Frame = +3

Query  261  SKNVSLD---QKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTA  431
            +KNVSLD   QKLA+AKR SHEG  AGAKAA   TVATAIP  A  +M PWA+A+LNPTA
Sbjct  2    AKNVSLDSMDQKLALAKRCSHEGAKAGAKAAVFATVATAIPTYACGKMSPWARAHLNPTA  61

Query  432  QALIVSTAAGMAYFIVADKTVLATARRNSFNR  527
            +ALIVST AGMAYFIVADKT+L TAR+NSF +
Sbjct  62   KALIVSTVAGMAYFIVADKTILKTARQNSFKQ  93



>ref|XP_006364894.1| PREDICTED: early nodulin-93-like [Solanum tuberosum]
Length=94

 Score =   102 bits (255),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 78/92 (85%), Gaps = 3/92 (3%)
 Frame = +3

Query  261  SKNVSL---DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTA  431
            +KNVSL   DQKLAMAKR SHEGV+AGAKAA V +VATAIP  A  +M+PWA+  LNPTA
Sbjct  2    AKNVSLASMDQKLAMAKRCSHEGVIAGAKAAVVASVATAIPTFAIGKMLPWARTYLNPTA  61

Query  432  QALIVSTAAGMAYFIVADKTVLATARRNSFNR  527
            +ALIVSTAAGMAYF+VADKT+L TAR+NSF +
Sbjct  62   KALIVSTAAGMAYFVVADKTILKTARQNSFKQ  93



>ref|XP_004964509.1| PREDICTED: early nodulin-93-like [Setaria italica]
Length=112

 Score =   103 bits (256),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLA+AKR S E  +AGAKAAAV T+A+AIP +ASVRM+PWAKAN+NPT QALI+ST
Sbjct  5    SLDQKLALAKRCSREATLAGAKAAAVATIASAIPTMASVRMLPWAKANINPTGQALIIST  64

Query  453  AAGMAYFIVADKTVLATARRNSFNRPADH  539
             AGMAYFI ADK +L+ ARR+SF    +H
Sbjct  65   VAGMAYFIAADKKILSLARRHSFENAPEH  93



>ref|XP_004251574.1| PREDICTED: early nodulin-93-like [Solanum lycopersicum]
Length=95

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 74/92 (80%), Gaps = 3/92 (3%)
 Frame = +3

Query  261  SKNVSLD---QKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTA  431
            +KNVSLD   QKLA AKR SHEG  AGAKAA   TV TAIP  A  ++ PWA+A+LNPTA
Sbjct  2    AKNVSLDSIDQKLAYAKRCSHEGAKAGAKAAVFATVVTAIPTYACGKISPWARAHLNPTA  61

Query  432  QALIVSTAAGMAYFIVADKTVLATARRNSFNR  527
            +ALIVSTAAGMAYFIVADKT+L TAR+NSF +
Sbjct  62   KALIVSTAAGMAYFIVADKTILKTARQNSFKQ  93



>ref|XP_009392935.1| PREDICTED: early nodulin-93-like [Musa acuminata subsp. malaccensis]
Length=101

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            +LDQKLAMAK  SHEGVVAGAKAA V TVA AIP LAS +++PWA++NLNPTAQALI+ST
Sbjct  8    ALDQKLAMAKLCSHEGVVAGAKAAVVATVAAAIPTLASFKILPWARSNLNPTAQALIIST  67

Query  453  AAGMAYFIVADKTVLATARRNSF  521
             AG AYFIVADKTVLA+AR+NSF
Sbjct  68   VAGAAYFIVADKTVLASARKNSF  90



>ref|XP_010688052.1| PREDICTED: early nodulin-93-like [Beta vulgaris subsp. vulgaris]
Length=109

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +3

Query  270  VSLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVS  449
            V+LDQ+LA+AK+ SH+GV+AGAKAA V   ATAIP +AS RM+PWA+ANLN TAQALI+S
Sbjct  16   VALDQRLAIAKQCSHDGVLAGAKAAVVAGFATAIPTIASARMLPWARANLNHTAQALIIS  75

Query  450  TAAGMAYFIVADKTVLATARRNSFNRPADH  539
            T AG AYFIVADKTVL +AR+NSFN+   H
Sbjct  76   TVAGAAYFIVADKTVLKSARQNSFNQKEMH  105



>ref|XP_002436449.1| hypothetical protein SORBIDRAFT_10g002900 [Sorghum bicolor]
 gb|EER87816.1| hypothetical protein SORBIDRAFT_10g002900 [Sorghum bicolor]
Length=115

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SL+QKLA+AKR S E  +AGAKAAAV T+A+AIP LASVRM+PWAKAN+NPT QALI+ST
Sbjct  8    SLEQKLALAKRCSREATLAGAKAAAVATIASAIPTLASVRMLPWAKANINPTGQALIIST  67

Query  453  AAGMAYFIVADKTVLATARRNSFNRPADH  539
             AGMAYFI ADK +L+ ARR+SF    +H
Sbjct  68   VAGMAYFIAADKKILSLARRHSFENAPEH  96



>ref|XP_010100940.1| hypothetical protein L484_005949 [Morus notabilis]
 gb|EXB86238.1| hypothetical protein L484_005949 [Morus notabilis]
Length=108

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            +LDQKLAMA+R + EGV AGAKAA V ++ATAIP  ASVR++PWAKA+LN TAQALI+ST
Sbjct  17   ALDQKLAMAQRCAQEGVKAGAKAAVVASIATAIPTFASVRLLPWAKAHLNHTAQALIIST  76

Query  453  AAGMAYFIVADKTVLATARRNSFNRPADH  539
             AG AYFIVADKTVLATAR+NSF + +++
Sbjct  77   VAGAAYFIVADKTVLATARKNSFKQASNN  105



>ref|XP_010047807.1| PREDICTED: early nodulin-93-like [Eucalyptus grandis]
Length=108

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQ+LAMAKR S EGV AGAKAA +  +ATAIP LAS RM+PWA+ANLN +AQALI+ST
Sbjct  18   SLDQRLAMAKRCSREGVKAGAKAAVLAGIATAIPTLASARMLPWARANLNHSAQALIIST  77

Query  453  AAGMAYFIVADKTVLATARRNSFNR  527
             AG AYFIVADKT+LA AR+NSF +
Sbjct  78   VAGAAYFIVADKTILAKARQNSFKQ  102



>ref|XP_010250011.1| PREDICTED: early nodulin-93-like isoform X1 [Nelumbo nucifera]
Length=104

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKL+MAKR   EGVVAGAKAA V T+ATAIP  ASVR +PWA+ANLNPTAQALI+ST
Sbjct  17   SLDQKLSMAKRCGLEGVVAGAKAAVVATIATAIPTFASVRSLPWARANLNPTAQALIIST  76

Query  453  AAGMAYFIVADKTVLATARRNSF  521
             AG AYFIVADKTVLATARRNSF
Sbjct  77   VAGSAYFIVADKTVLATARRNSF  99



>ref|XP_002437802.1| hypothetical protein SORBIDRAFT_10g002820 [Sorghum bicolor]
 gb|EER89169.1| hypothetical protein SORBIDRAFT_10g002820 [Sorghum bicolor]
Length=115

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLA+AKR S E  +AG KAAAV TVA+A+P LASVRM+PWAKAN+NPT QALI+ST
Sbjct  8    SLDQKLALAKRCSREATMAGFKAAAVATVASAVPTLASVRMLPWAKANINPTGQALIIST  67

Query  453  AAGMAYFIVADKTVLATARRNSFNRPADH  539
             AGMAYFI ADK +L+ ARR+SF    +H
Sbjct  68   VAGMAYFIAADKKILSLARRHSFENAPEH  96



>ref|XP_010039608.1| PREDICTED: early nodulin-93-like [Eucalyptus grandis]
 gb|KCW45867.1| hypothetical protein EUGRSUZ_L00292 [Eucalyptus grandis]
Length=108

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQ+LAMAKR S EGV AGAKAA +  +ATAIP LAS RM+PWA+ANLN +AQALI+ST
Sbjct  18   SLDQRLAMAKRCSREGVKAGAKAAVLAGIATAIPTLASARMLPWARANLNHSAQALIIST  77

Query  453  AAGMAYFIVADKTVLATARRNSFNR  527
             AG AYFIVADK +LATAR+NSF +
Sbjct  78   VAGAAYFIVADKPILATARQNSFKQ  102



>gb|ABL85058.1| early nodulin protein [Brachypodium sylvaticum]
Length=111

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +3

Query  276  LDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTA  455
            LDQ+LA AKR S E  +AGAKAAAV TVA A+P LASVRMVPWA+A+LNPT QALI+ST 
Sbjct  10   LDQRLAAAKRCSKEAAMAGAKAAAVATVAAAVPTLASVRMVPWARAHLNPTGQALIISTV  69

Query  456  AGMAYFIVADKTVLATARRNSFNRPADH  539
            AGMAYFIVADKTVL+ AR++SF+   DH
Sbjct  70   AGMAYFIVADKTVLSMARKHSFDAAPDH  97



>ref|XP_003557201.1| PREDICTED: early nodulin-93-like [Brachypodium distachyon]
Length=127

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +3

Query  276  LDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTA  455
            LD+KLA+AKR S E  +AGAKAAAV TVA+A+P LASVRM+PWAKANLNPT QALIV TA
Sbjct  9    LDRKLALAKRCSREATLAGAKAAAVATVASAVPTLASVRMLPWAKANLNPTGQALIVCTA  68

Query  456  AGMAYFIVADKTVLATARRNSFNRPADH  539
            AGMAYF+ ADKT+L+ ARR+SF    +H
Sbjct  69   AGMAYFVAADKTILSLARRHSFEEAPEH  96



>dbj|BAA83559.1| putative early nodulin [Oryza sativa Japonica Group]
 gb|EAY99600.1| hypothetical protein OsI_21578 [Oryza sativa Indica Group]
Length=116

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +3

Query  276  LDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTA  455
            LDQ+LA+AKR S E  +AG KAAAV T+A+A+P LASVRMVPWAKAN+NPT QALI+ TA
Sbjct  10   LDQRLALAKRCSREANLAGVKAAAVATIASAVPTLASVRMVPWAKANINPTGQALIICTA  69

Query  456  AGMAYFIVADKTVLATARRNSFNRPADH  539
            AGMAYF+ ADK +L+ ARR+SF    +H
Sbjct  70   AGMAYFVAADKKILSLARRHSFENAPEH  97



>gb|AAD28359.1|AF084573_1 root-nodule protein Dg93 [Datisca glomerata]
Length=105

 Score =   101 bits (251),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            S D KLA+AKR +HEGV+AGAKAAA+ ++ATAIP LASVRM+PWA+ANLN TAQALIVST
Sbjct  17   SSDPKLALAKRCAHEGVMAGAKAAAIASIATAIPTLASVRMMPWARANLNHTAQALIVST  76

Query  453  AAGMAYFIVADKTVLATARRNSFN  524
             AG+AYFIVADKTVLATAR+NS N
Sbjct  77   VAGLAYFIVADKTVLATARKNSLN  100



>ref|XP_006655776.1| PREDICTED: early nodulin-93-like [Oryza brachyantha]
Length=116

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +3

Query  276  LDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTA  455
            LDQKLA+AKR S E  +AG KAAA  T+A+A+P LASVRM+PWAKAN+NPT QALI+ TA
Sbjct  10   LDQKLALAKRCSKEANIAGVKAAAGATIASAVPTLASVRMLPWAKANINPTGQALIICTA  69

Query  456  AGMAYFIVADKTVLATARRNSFNRPADH  539
            AGMAYF+ ADK +L+ ARR+SF    +H
Sbjct  70   AGMAYFVAADKKILSLARRHSFENAPEH  97



>ref|XP_007013369.1| Early nodulin-93 isoform 2 [Theobroma cacao]
 gb|EOY30988.1| Early nodulin-93 isoform 2 [Theobroma cacao]
Length=106

 Score =   101 bits (251),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  288  LAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTAAGMA  467
            LAMAKR SHEGV+AGAKAA V ++ATAIP LASVRM+PWA+ANLN TAQALI+ST AG A
Sbjct  21   LAMAKRCSHEGVLAGAKAAVVASIATAIPTLASVRMLPWARANLNHTAQALIISTVAGAA  80

Query  468  YFIVADKTVLATARRNSF  521
            YFIVADKTVLATAR+NSF
Sbjct  81   YFIVADKTVLATARKNSF  98



>ref|XP_006364908.1| PREDICTED: early nodulin-93-like [Solanum tuberosum]
Length=94

 Score =   100 bits (249),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 77/91 (85%), Gaps = 3/91 (3%)
 Frame = +3

Query  264  KNVSLD---QKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQ  434
            KNVSLD   QKLA+AK+YSHEGVVAGAKAA V +VATAIP+ A  +M PWAK  LNPTA+
Sbjct  3    KNVSLDAVDQKLALAKQYSHEGVVAGAKAAVVASVATAIPIYAFGKMSPWAKTYLNPTAK  62

Query  435  ALIVSTAAGMAYFIVADKTVLATARRNSFNR  527
            ALI+STAAGMAYF+VADKT+L  AR+NSF +
Sbjct  63   ALIISTAAGMAYFVVADKTILKIARQNSFKQ  93



>ref|XP_010250012.1| PREDICTED: early nodulin-93-like isoform X2 [Nelumbo nucifera]
Length=107

 Score =   100 bits (250),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 75/89 (84%), Gaps = 3/89 (3%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKL+MAKR   EGVVAGAKAA V T+ATAIP  ASVR +PWA+ANLNPTAQALI+ST
Sbjct  17   SLDQKLSMAKRCGLEGVVAGAKAAVVATIATAIPTFASVRSLPWARANLNPTAQALIIST  76

Query  453  AAGMAYFIVADKTVLATARRNSFNRPADH  539
             AG AYF+VADKTVLATAR+NSF    DH
Sbjct  77   VAGSAYFVVADKTVLATARKNSFK---DH  102



>ref|XP_004251567.1| PREDICTED: early nodulin-93-like [Solanum lycopersicum]
Length=92

 Score =   100 bits (248),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 76/90 (84%), Gaps = 3/90 (3%)
 Frame = +3

Query  261  SKNVSL---DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTA  431
            +KNVSL   DQKLAMAKRYS+EGVVAGAKAA V +VATAIP  A  +M PWA+  LNPTA
Sbjct  2    AKNVSLASMDQKLAMAKRYSYEGVVAGAKAAVVASVATAIPTFAIGKMSPWARTYLNPTA  61

Query  432  QALIVSTAAGMAYFIVADKTVLATARRNSF  521
            +ALI+ST AGMAYF+VADKT+L TAR+NSF
Sbjct  62   KALIISTVAGMAYFVVADKTILKTARQNSF  91



>ref|XP_002437803.1| hypothetical protein SORBIDRAFT_10g002830 [Sorghum bicolor]
 gb|EER89170.1| hypothetical protein SORBIDRAFT_10g002830 [Sorghum bicolor]
Length=115

 Score =   100 bits (249),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLA+AKR S E  +AGAKAAAV TVA+AIP LASVRM+PWAKAN+NPT QALI+ST
Sbjct  8    SLDQKLALAKRCSREATLAGAKAAAVATVASAIPTLASVRMLPWAKANINPTGQALIIST  67

Query  453  AAGMAYFIVADKTVLATARRNSFN  524
             AGMAYFI ADK +L+ AR++SF 
Sbjct  68   VAGMAYFIAADKKILSLARQHSFE  91



>dbj|BAK07913.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=120

 Score =   100 bits (249),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +3

Query  276  LDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTA  455
            LD KLA+AKR S E  +AGAKAAAV TVA+A+P LASVRM+PWAKANLNPT QALIV T 
Sbjct  9    LDHKLALAKRCSREATLAGAKAAAVATVASAVPTLASVRMLPWAKANLNPTGQALIVCTV  68

Query  456  AGMAYFIVADKTVLATARRNSFNRPADH  539
            AGMAYFI ADKT+L+ ARR+S+    DH
Sbjct  69   AGMAYFIAADKTILSLARRHSYESAPDH  96



>gb|EMT32242.1| hypothetical protein F775_18516 [Aegilops tauschii]
Length=103

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +3

Query  276  LDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTA  455
            LDQ+LA AKR S E  +AGAKAAAV TVA A+P LASVRM+PWA+A+LNPT QALI+ST 
Sbjct  9    LDQRLAAAKRCSKEATMAGAKAAAVATVAAAVPTLASVRMLPWARAHLNPTGQALIISTV  68

Query  456  AGMAYFIVADKTVLATARRNSFNRPADH  539
            AGMAYFIVADKT+L+ ARR+SF+   +H
Sbjct  69   AGMAYFIVADKTILSMARRHSFDDAPEH  96



>ref|XP_007138316.1| hypothetical protein PHAVU_009G198400g [Phaseolus vulgaris]
 gb|ESW10310.1| hypothetical protein PHAVU_009G198400g [Phaseolus vulgaris]
Length=112

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQKLA A++ SHEGV+AGAKAA V  VA+AIP +ASVRMVPWA+ANLN TAQALI+ST
Sbjct  15   SLDQKLAFAQQSSHEGVLAGAKAAVVAGVASAIPTVASVRMVPWARANLNHTAQALIIST  74

Query  453  AAGMAYFIVADKTVLATARRNSFNRPA  533
            A   A+FIV+DKT+LATARRNSF  P+
Sbjct  75   AMAAAFFIVSDKTILATARRNSFIPPS  101



>ref|XP_006655774.1| PREDICTED: early nodulin-93-like [Oryza brachyantha]
Length=116

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +3

Query  276  LDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTA  455
            LDQ+LA+AKR S E  +AG KAAAV T+A+A+P LASVRM+PWAKAN+NPT QALI+ TA
Sbjct  10   LDQRLALAKRCSREANLAGVKAAAVATIASAVPTLASVRMLPWAKANINPTGQALIICTA  69

Query  456  AGMAYFIVADKTVLATARRNSFNRPADH  539
            AGMAYF+ ADK +L+ ARR+SF    +H
Sbjct  70   AGMAYFVAADKKILSLARRHSFEAAPEH  97



>gb|ABL85059.1| early nodulin protein [Brachypodium sylvaticum]
Length=133

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +3

Query  276  LDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTA  455
            LD+KLA+AKR S E  +AGAKAAAV TVA+A+P LASVRM+PWAKA+LNPT QALIV TA
Sbjct  9    LDRKLALAKRCSREATLAGAKAAAVATVASAVPTLASVRMLPWAKAHLNPTGQALIVCTA  68

Query  456  AGMAYFIVADKTVLATARRNSFNRPADH  539
            AGMAYF+ ADKT+L+ ARR+SF    +H
Sbjct  69   AGMAYFVAADKTILSLARRHSFEEAPEH  96



>gb|EMS61130.1| hypothetical protein TRIUR3_21694 [Triticum urartu]
Length=103

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +3

Query  276  LDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTA  455
            LDQ+LA AKR S E  +AGAKAAAV TVA A+P LASVRM+PWAKA+LNPT QALI+ST 
Sbjct  9    LDQRLAAAKRCSKEAAMAGAKAAAVATVAAAVPTLASVRMLPWAKAHLNPTGQALIISTV  68

Query  456  AGMAYFIVADKTVLATARRNSFNRPADH  539
            AGMAYFIVADKT+L+ AR++SF    +H
Sbjct  69   AGMAYFIVADKTILSMARKHSFEDAPEH  96



>ref|NP_001056762.1| Os06g0141700 [Oryza sativa Japonica Group]
 dbj|BAA83560.1| putative early nodulin [Oryza sativa Japonica Group]
 dbj|BAF18676.1| Os06g0141700 [Oryza sativa Japonica Group]
 dbj|BAH00659.1| unnamed protein product [Oryza sativa Japonica Group]
Length=115

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +3

Query  276  LDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTA  455
            LDQKLA+AKR S E  +AGAKAAAV TVA+A+P LASVRM+PWAKAN+NPT QALI+ TA
Sbjct  9    LDQKLALAKRCSREATLAGAKAAAVATVASAVPTLASVRMLPWAKANINPTGQALIICTA  68

Query  456  AGMAYFIVADKTVLATARRNSFNRPADH  539
            AGMAYF+ ADK +L+ ARR+SF    +H
Sbjct  69   AGMAYFVAADKKILSLARRHSFENAPEH  96



>gb|AAD30134.1|AF140229_1 early nodulin [Oryza sativa]
Length=136

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +3

Query  276  LDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTA  455
            L+Q+LA+AKR S E  +AG KAAAV T+A+A+P LASVRM+PWAKAN+NPT QALI+ TA
Sbjct  44   LEQRLALAKRCSREANIAGVKAAAVATIASAVPTLASVRMLPWAKANINPTGQALIICTA  103

Query  456  AGMAYFIVADKTVLATARRNSFNRPADH  539
            AGMAYF+ ADK +L+ ARR+SF    +H
Sbjct  104  AGMAYFVAADKKILSLARRHSFENAPEH  131



>ref|XP_006655775.1| PREDICTED: early nodulin-93-like [Oryza brachyantha]
Length=115

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +3

Query  276  LDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTA  455
            LDQKLA+AKR S E  +AGAKAAAV TVA+A+P LASVRM+PWAKAN+NPT QALI+ TA
Sbjct  9    LDQKLALAKRCSREATLAGAKAAAVATVASAVPTLASVRMLPWAKANINPTGQALIICTA  68

Query  456  AGMAYFIVADKTVLATARRNSFNRPADH  539
            AGMAYF+ ADK +L+ ARR+SF    +H
Sbjct  69   AGMAYFVAADKKILSLARRHSFEAAPEH  96



>dbj|BAA83567.1| putative early nodulin [Oryza sativa Japonica Group]
 gb|EAY99607.1| hypothetical protein OsI_21585 [Oryza sativa Indica Group]
 gb|EAZ35791.1| hypothetical protein OsJ_20083 [Oryza sativa Japonica Group]
Length=116

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +3

Query  276  LDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTA  455
            L+Q+LA+AKR S E  +AG KAAAV T+A+A+P LASVRM+PWAKAN+NPT QALI+ TA
Sbjct  10   LEQRLALAKRCSREANLAGVKAAAVATIASAVPTLASVRMLPWAKANINPTGQALIICTA  69

Query  456  AGMAYFIVADKTVLATARRNSFNRPADH  539
            AGMAYF+ ADK +L+ ARR+SF    +H
Sbjct  70   AGMAYFVAADKKILSLARRHSFENAPEH  97



>gb|EEE65062.1| hypothetical protein OsJ_20076 [Oryza sativa Japonica Group]
Length=157

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +3

Query  276  LDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTA  455
            LDQKLA+AKR S E  +AGAKAAAV TVA+A+P LASVRM+PWAKAN+NPT QALI+ TA
Sbjct  51   LDQKLALAKRCSREATLAGAKAAAVATVASAVPTLASVRMLPWAKANINPTGQALIICTA  110

Query  456  AGMAYFIVADKTVLATARRNSFNRPADH  539
            AGMAYF+ ADK +L+ ARR+SF    +H
Sbjct  111  AGMAYFVAADKKILSLARRHSFENAPEH  138



>ref|NP_001056766.2| Os06g0142200 [Oryza sativa Japonica Group]
 dbj|BAA33813.1| early nodulin [Oryza sativa Japonica Group]
 dbj|BAA33814.1| early nodulin [Oryza sativa Japonica Group]
 dbj|BAA83565.1| putative early nodulin [Oryza sativa Japonica Group]
 dbj|BAH00828.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF18680.2| Os06g0142200 [Oryza sativa Japonica Group]
Length=115

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +3

Query  276  LDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTA  455
            L+Q+LA+AKR S E  +AG KAAAV T+A+A+P LASVRM+PWAKAN+NPT QALI+ TA
Sbjct  9    LEQRLALAKRCSREANIAGVKAAAVATIASAVPTLASVRMLPWAKANINPTGQALIICTA  68

Query  456  AGMAYFIVADKTVLATARRNSFNRPADH  539
            AGMAYF+ ADK +L+ ARR+SF    +H
Sbjct  69   AGMAYFVAADKKILSLARRHSFENAPEH  96



>ref|NP_001056768.1| Os06g0142400 [Oryza sativa Japonica Group]
 dbj|BAA83568.1| putative early nodulin [Oryza sativa Japonica Group]
 dbj|BAF18682.1| Os06g0142400 [Oryza sativa Japonica Group]
 gb|EAY99608.1| hypothetical protein OsI_21586 [Oryza sativa Indica Group]
 gb|EAZ35792.1| hypothetical protein OsJ_20084 [Oryza sativa Japonica Group]
 dbj|BAH00986.1| unnamed protein product [Oryza sativa Japonica Group]
Length=115

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +3

Query  276  LDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTA  455
            L+Q+LA+AKR S E  +AG KAAAV T+A+A+P LASVRM+PWAKAN+NPT QALI+ TA
Sbjct  9    LEQRLALAKRCSREANIAGVKAAAVATIASAVPTLASVRMLPWAKANINPTGQALIICTA  68

Query  456  AGMAYFIVADKTVLATARRNSFNRPADH  539
            AGMAYF+ ADK +L+ ARR+SF    +H
Sbjct  69   AGMAYFVAADKKILSLARRHSFENAPEH  96



>dbj|BAK06178.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=133

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +3

Query  276  LDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTA  455
            LD KLA+AKR S E  +AGAKAAAV TVA+A+P LASVRM+PWAKANLNPT QALIV T 
Sbjct  24   LDHKLALAKRCSREATLAGAKAAAVATVASAVPTLASVRMLPWAKANLNPTGQALIVCTV  83

Query  456  AGMAYFIVADKTVLATARRNSFNRPADH  539
            AGMAYF+ ADKT+L+ ARR+S+    DH
Sbjct  84   AGMAYFVAADKTILSLARRHSYESAPDH  111



>gb|EMT32241.1| hypothetical protein F775_18515 [Aegilops tauschii]
Length=103

 Score = 98.2 bits (243),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +3

Query  276  LDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTA  455
            LDQ+LA AKR S E  +AGAKAAAV TVA A+P LASVRM+PWAKA+LNPT QALI+ST 
Sbjct  9    LDQRLAAAKRSSKEAAMAGAKAAAVATVAAAVPTLASVRMLPWAKAHLNPTGQALIISTV  68

Query  456  AGMAYFIVADKTVLATARRNSFNRPADH  539
            AGMAYFIVADKT+L+ AR++S+    +H
Sbjct  69   AGMAYFIVADKTILSMARKHSYETAPEH  96



>ref|XP_010533179.1| PREDICTED: early nodulin-93-like [Tarenaya hassleriana]
Length=109

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 73/91 (80%), Gaps = 2/91 (2%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            +LD  LA+AKR + EGV+AGAKAA V   A A+P +ASVRM+PWA+ANLN TAQALI+ST
Sbjct  18   ALDHNLAIAKRCAQEGVLAGAKAAIVAGFAAAVPTMASVRMLPWARANLNHTAQALIIST  77

Query  453  AAGMAYFIVADKTVLATARRNSFN--RPADH  539
            AAG AYFIVADKTVL TAR+NSF   +  DH
Sbjct  78   AAGAAYFIVADKTVLKTARKNSFKQVQEMDH  108



>ref|XP_003557202.1| PREDICTED: early nodulin-93-like [Brachypodium distachyon]
Length=121

 Score = 98.6 bits (244),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +3

Query  276  LDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTA  455
            LDQ+LA AKR S E  +AGAKAAAV TVA A+P LASVRM+PWA+A+LNPT QALI+ST 
Sbjct  10   LDQRLAAAKRCSKEAAMAGAKAAAVATVAAAVPTLASVRMLPWARAHLNPTGQALIISTV  69

Query  456  AGMAYFIVADKTVLATARRNSFNRPADH  539
            AGMAYFIVADKT+L+ AR++SF    +H
Sbjct  70   AGMAYFIVADKTILSMARKHSFEEAPEH  97



>ref|NP_001174593.1| Os06g0142350 [Oryza sativa Japonica Group]
 dbj|BAH93321.1| Os06g0142350, partial [Oryza sativa Japonica Group]
Length=154

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +3

Query  276  LDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTA  455
            L+Q+LA+AKR S E  +AG KAAAV T+A+A+P LASVRM+PWAKAN+NPT QALI+ TA
Sbjct  48   LEQRLALAKRCSREANLAGVKAAAVATIASAVPTLASVRMLPWAKANINPTGQALIICTA  107

Query  456  AGMAYFIVADKTVLATARRNSFNRPADH  539
            AGMAYF+ ADK +L+ ARR+SF    +H
Sbjct  108  AGMAYFVAADKKILSLARRHSFENAPEH  135



>ref|XP_004964510.1| PREDICTED: early nodulin-93-like [Setaria italica]
Length=115

 Score = 98.2 bits (243),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +3

Query  276  LDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTA  455
            LDQ+LAMAKR S E  +AGAKAAAV TVA+A+P LASVRM+PWAKANLNPT QALI+ T 
Sbjct  9    LDQRLAMAKRCSREATLAGAKAAAVATVASAVPTLASVRMLPWAKANLNPTGQALIICTV  68

Query  456  AGMAYFIVADKTVLATARRNSFNRPADH  539
            AGMAYF+  DK +L+ ARR+SF    +H
Sbjct  69   AGMAYFVATDKKILSLARRHSFEEAPEH  96



>ref|NP_001056767.2| Os06g0142300 [Oryza sativa Japonica Group]
 dbj|BAA83566.1| putative early nodulin [Oryza sativa Japonica Group]
 gb|EEC79966.1| hypothetical protein OsI_21584 [Oryza sativa Indica Group]
 dbj|BAF18681.2| Os06g0142300 [Oryza sativa Japonica Group]
Length=115

 Score = 98.2 bits (243),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +3

Query  276  LDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTA  455
            LDQKLA+AKR S E  +AGAKAAAV TVA+A+P LASVRM+PWAKAN+NPT QALI+ TA
Sbjct  9    LDQKLALAKRCSREATLAGAKAAAVATVASAVPTLASVRMLPWAKANINPTGQALIICTA  68

Query  456  AGMAYFIVADKTVLATARRNSFNRPADH  539
            AGMAYF+ ADK +L+ AR++SF    +H
Sbjct  69   AGMAYFVAADKKILSLARKHSFEGAPEH  96



>gb|EAZ35790.1| hypothetical protein OsJ_20082 [Oryza sativa Japonica Group]
Length=122

 Score = 98.2 bits (243),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +3

Query  276  LDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTA  455
            LDQKLA+AKR S E  +AGAKAAAV TVA+A+P LASVRM+PWAKAN+NPT QALI+ TA
Sbjct  16   LDQKLALAKRCSREATLAGAKAAAVATVASAVPTLASVRMLPWAKANINPTGQALIICTA  75

Query  456  AGMAYFIVADKTVLATARRNSFNRPADH  539
            AGMAYF+ ADK +L+ AR++SF    +H
Sbjct  76   AGMAYFVAADKKILSLARKHSFEGAPEH  103



>ref|XP_010049972.1| PREDICTED: early nodulin-93-like [Eucalyptus grandis]
 gb|KCW82808.1| hypothetical protein EUGRSUZ_C04179 [Eucalyptus grandis]
Length=100

 Score = 97.4 bits (241),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +3

Query  291  AMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTAAGMAY  470
            ++AK+ +HEGV+AGAKAA + ++ATAIP +ASVRM+PWA+ANLN TAQALI+ST AG AY
Sbjct  16   SVAKQCAHEGVMAGAKAAVIASIATAIPTMASVRMLPWARANLNHTAQALIISTVAGAAY  75

Query  471  FIVADKTVLATARRNSFNRPAD  536
            FIVADKTVLATARRNSF R ++
Sbjct  76   FIVADKTVLATARRNSFKRASN  97



>gb|EMS50054.1| hypothetical protein TRIUR3_13855 [Triticum urartu]
Length=122

 Score = 97.8 bits (242),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 73/98 (74%), Gaps = 0/98 (0%)
 Frame = +3

Query  246  SITMASKNVSLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNP  425
            S T       L+ KLA+AKR S E  +AGAKAAAV TVA+A+P LASVRM+PWAKANLNP
Sbjct  2    STTATVTRAHLENKLALAKRCSREATLAGAKAAAVATVASAVPTLASVRMLPWAKANLNP  61

Query  426  TAQALIVSTAAGMAYFIVADKTVLATARRNSFNRPADH  539
            T QALIV T AGMAYFI ADK +L+ ARR+S+    DH
Sbjct  62   TGQALIVCTVAGMAYFIAADKAILSLARRHSYESAPDH  99



>ref|XP_008337324.1| PREDICTED: early nodulin-93-like [Malus domestica]
Length=60

 Score = 96.3 bits (238),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  378  LASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSFNRPADH  539
            +ASVRM+PWA+ANLNPTAQALI+ST AGMAYFIVADKT+LATARRNSFN+ A H
Sbjct  1    MASVRMLPWARANLNPTAQALIISTVAGMAYFIVADKTILATARRNSFNQVAHH  54



>gb|EMT32244.1| hypothetical protein F775_30863 [Aegilops tauschii]
Length=103

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +3

Query  276  LDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTA  455
            LDQ+LA A R S E  +AGAKAAAV TVA A+P LASVRM+PWAKA+LNPT QALI+ST 
Sbjct  9    LDQRLAAANRCSKEAAMAGAKAAAVATVAAAVPTLASVRMLPWAKAHLNPTGQALIISTV  68

Query  456  AGMAYFIVADKTVLATARRNSFNRPADH  539
            AGMAYFIVADKT+L+ AR++SF+   +H
Sbjct  69   AGMAYFIVADKTILSMARKHSFDDAPEH  96



>gb|EEC79963.1| hypothetical protein OsI_21579 [Oryza sativa Indica Group]
Length=112

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 67/88 (76%), Gaps = 3/88 (3%)
 Frame = +3

Query  276  LDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTA  455
            LDQKLA+AKR S E  +AGAKAA V +    +P LASVRM+PWAKAN+NPT QALI+ TA
Sbjct  9    LDQKLALAKRCSREATLAGAKAATVASA---VPTLASVRMLPWAKANINPTGQALIICTA  65

Query  456  AGMAYFIVADKTVLATARRNSFNRPADH  539
            AGM YF+ ADK +L+ ARR+SF    +H
Sbjct  66   AGMTYFVAADKKILSLARRHSFENAPEH  93



>ref|XP_008390004.1| PREDICTED: early nodulin-93-like, partial [Malus domestica]
Length=78

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +3

Query  372  PMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSFNRPADH  539
            P LASVRM+PWA+ANLNP AQALI+ST AGMAYFIVADKT+LATARRNSFN+   H
Sbjct  21   PTLASVRMLPWARANLNPXAQALIISTVAGMAYFIVADKTILATARRNSFNQVXRH  76



>ref|XP_004139321.1| PREDICTED: early nodulin-93-like [Cucumis sativus]
 gb|KGN60663.1| Early nodulin 93 protein [Cucumis sativus]
Length=111

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 77/89 (87%), Gaps = 1/89 (1%)
 Frame = +3

Query  264  KNV-SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQAL  440
            KN+ S D K+AMAKR + EGV+AGAKAAA+ ++ATAIP  ASVRM+PWAKA+LN TAQAL
Sbjct  13   KNIASHDPKVAMAKRCAKEGVIAGAKAAAIASIATAIPTFASVRMLPWAKAHLNHTAQAL  72

Query  441  IVSTAAGMAYFIVADKTVLATARRNSFNR  527
            I+ST AG AYFIVADKTVLATARRNSF +
Sbjct  73   IISTVAGAAYFIVADKTVLATARRNSFKQ  101



>ref|XP_002437804.1| hypothetical protein SORBIDRAFT_10g002850 [Sorghum bicolor]
 gb|EER89171.1| hypothetical protein SORBIDRAFT_10g002850 [Sorghum bicolor]
Length=117

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            S+DQ LA+AK+ S E  +AG KAAA+ TVA+ IP L SVRM+PWAKAN+NP  QALI+ST
Sbjct  10   SVDQNLALAKQCSREAAIAGFKAAAIGTVASGIPTLVSVRMLPWAKANINPAGQALIIST  69

Query  453  AAGMAYFIVADKTVLATARRNSFNRPADH  539
             AGMAYFI ADK +LA AR++S+    DH
Sbjct  70   VAGMAYFIAADKKILALARQHSYENAPDH  98



>ref|XP_004167345.1| PREDICTED: early nodulin-93-like [Cucumis sativus]
Length=111

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            S D K+AMAKR + EGV+AGAKAAA+ ++ATAIP  ASVRM+PWAKA+LN TAQALI+ST
Sbjct  17   SHDPKVAMAKRCAKEGVIAGAKAAAIASIATAIPTFASVRMLPWAKAHLNHTAQALIIST  76

Query  453  AAGMAYFIVADKTVLATARRNSFNR  527
             AG AYFIVADKTVLATARRNSF +
Sbjct  77   VAGAAYFIVADKTVLATARRNSFKQ  101



>gb|EMT32240.1| hypothetical protein F775_30861 [Aegilops tauschii]
Length=127

 Score = 95.1 bits (235),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +3

Query  276  LDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTA  455
            L+ KLA+AKR S E  +AGAKAAA+ TVA+A+P LASVRM+PWA+A+LNPT QAL+V T 
Sbjct  15   LENKLALAKRCSREATLAGAKAAAIATVASAVPTLASVRMLPWARAHLNPTGQALVVCTV  74

Query  456  AGMAYFIVADKTVLATARRNSFNRPADH  539
            AGMAYF+ ADK +L+ ARR+S+    DH
Sbjct  75   AGMAYFVAADKAILSLARRHSYESAPDH  102



>ref|XP_008457774.1| PREDICTED: early nodulin-93-like [Cucumis melo]
Length=149

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 77/89 (87%), Gaps = 1/89 (1%)
 Frame = +3

Query  264  KNV-SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQAL  440
            KN+ S D K+AMAKR + EGV+AGAKAAA+ ++ATAIP  ASVRM+PWAKA+LN TAQAL
Sbjct  51   KNLASHDPKVAMAKRCAREGVIAGAKAAAIASIATAIPTFASVRMLPWAKAHLNHTAQAL  110

Query  441  IVSTAAGMAYFIVADKTVLATARRNSFNR  527
            I+ST AG AYFIVADKTVLATARRNSF +
Sbjct  111  IISTVAGAAYFIVADKTVLATARRNSFKQ  139



>gb|EMT29548.1| hypothetical protein F775_15200 [Aegilops tauschii]
Length=103

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +3

Query  276  LDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTA  455
            LDQ+LA+A R S E  +AGAKAAAV TVA A+P LAS RM+PWA+A+LNPT QALI+ST 
Sbjct  9    LDQRLAVANRCSKEAAMAGAKAAAVATVAAAVPTLASARMLPWARAHLNPTGQALIISTV  68

Query  456  AGMAYFIVADKTVLATARRNSFNRPADH  539
            AGMAYFIVADKT+L+ AR++S+    +H
Sbjct  69   AGMAYFIVADKTILSMARKHSYETAPEH  96



>gb|ACH58421.1| nodulin 93 [Prunus dulcis]
Length=50

 Score = 91.3 bits (225),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +3

Query  378  LASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSFNR  527
            +ASVRM+PWA+ANLNPTAQALI+ST AGMAYFIVADKTVLATARRNSF +
Sbjct  1    MASVRMLPWARANLNPTAQALIISTVAGMAYFIVADKTVLATARRNSFKQ  50



>gb|KHN27414.1| Early nodulin-93 [Glycine soja]
Length=56

 Score = 90.9 bits (224),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  375  MLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSFNRPAD  536
            +LASVR +PWA+ANLNPTAQALI+ST AG AYFIVADKTVLATAR+NSFN P++
Sbjct  2    LLASVRTIPWARANLNPTAQALIISTVAGAAYFIVADKTVLATARKNSFNPPSN  55



>ref|XP_004964508.1| PREDICTED: early nodulin-93-like [Setaria italica]
Length=116

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            +L+Q+LAMAK+ S E  + GAKAA   T+ +AIP LASVRM PWA AN+NP  QALI+ST
Sbjct  9    NLEQQLAMAKKSSREAALTGAKAAVAATIVSAIPTLASVRMSPWATANINPAGQALIIST  68

Query  453  AAGMAYFIVADKTVLATARRNSFNRPADH  539
             AGMAYFI ADK +L  AR++S+    +H
Sbjct  69   VAGMAYFIAADKKILLLARKHSYENAPEH  97



>ref|XP_002437805.1| hypothetical protein SORBIDRAFT_10g002860 [Sorghum bicolor]
 gb|EER89172.1| hypothetical protein SORBIDRAFT_10g002860 [Sorghum bicolor]
Length=117

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            S+DQ LA+AK+ S E  +AG KAAA+ TVA+ I  L SVRM+PWAKAN+NP  QALI+ST
Sbjct  10   SVDQNLALAKQCSREAALAGFKAAAIGTVASGIATLVSVRMLPWAKANINPAGQALIIST  69

Query  453  AAGMAYFIVADKTVLATARRNSFNRPADH  539
             AGMAYFI ADK +LA AR++S+    DH
Sbjct  70   VAGMAYFIAADKKILALARQHSYENAPDH  98



>ref|NP_001145575.1| uncharacterized protein LOC100279040 [Zea mays]
 gb|ACG48626.1| hypothetical protein [Zea mays]
Length=116

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +3

Query  267  NVSLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIV  446
            + SLDQ L +AK+ S E  +AG KAAAV TVA+A+P LASVRM+PWAKAN+NP  QALIV
Sbjct  7    SASLDQNLELAKQCSREAALAGFKAAAVATVASAVPTLASVRMLPWAKANINPAGQALIV  66

Query  447  STAAGMAYFIVADKTVLATARRNSFNRPADH  539
            ST AGMAYFI ADK +L+ AR++S+    +H
Sbjct  67   STVAGMAYFIAADKKILSLARQHSYENAPEH  97



>gb|EAY99605.1| hypothetical protein OsI_21583 [Oryza sativa Indica Group]
 gb|EAZ35789.1| hypothetical protein OsJ_20081 [Oryza sativa Japonica Group]
Length=124

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 72/97 (74%), Gaps = 9/97 (9%)
 Frame = +3

Query  276  LDQKLAMAKRYSHEgvvagakaaavttvataIP---------MLASVRMVPWAKANLNPT  428
            L+Q+LA+AKR S E  +AG KAAAV T+A+A+P          LASVRM+PWAKAN+NPT
Sbjct  9    LEQRLALAKRCSREANIAGVKAAAVATIASAVPTSSFISRAHQLASVRMLPWAKANINPT  68

Query  429  AQALIVSTAAGMAYFIVADKTVLATARRNSFNRPADH  539
             QALI+ TAAGMAYF+ ADK +L+ ARR+SF    +H
Sbjct  69   GQALIICTAAGMAYFVAADKKILSLARRHSFENAPEH  105



>gb|EMS67158.1| hypothetical protein TRIUR3_21254 [Triticum urartu]
Length=79

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +3

Query  372  PMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSFNRPADH  539
            P LASVRM+PWAKANLNPT QALI+ST AGMAYFIVADKT+L+ AR++SF    +H
Sbjct  17   PTLASVRMLPWAKANLNPTGQALIISTVAGMAYFIVADKTILSMARKHSFQDAPEH  72



>gb|AFW75469.1| hypothetical protein ZEAMMB73_751741 [Zea mays]
Length=116

 Score = 90.1 bits (222),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQ L +AK+ S E  +AG KAAAV TVA+A+P L SVRM+PWAKAN+NP  QALIVST
Sbjct  9    SLDQNLELAKQCSREAALAGFKAAAVATVASAVPTLVSVRMLPWAKANINPAGQALIVST  68

Query  453  AAGMAYFIVADKTVLATARRNSFNRPADH  539
             AGMAYFI ADK +L+ AR++S+    +H
Sbjct  69   VAGMAYFIAADKKILSLARQHSYENAPEH  97



>gb|EMT32243.1| hypothetical protein F775_30862 [Aegilops tauschii]
Length=79

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +3

Query  372  PMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSFNRPADH  539
            P LASVRM+PWA+A+LNPT QALI+ST AGMAYFIVADKT+L+ AR++SF+   DH
Sbjct  17   PTLASVRMLPWARAHLNPTGQALIISTVAGMAYFIVADKTILSMARKHSFDDAPDH  72



>gb|EMS50052.1| hypothetical protein TRIUR3_13853 [Triticum urartu]
Length=109

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 66/93 (71%), Gaps = 6/93 (6%)
 Frame = +3

Query  279  DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTAA  458
            DQ+LA  +R S E  +AG+KAAAV  VA  +P LASVRM+PW KA+LNPT Q L++ST A
Sbjct  10   DQRLAAGRRCSKEAAMAGSKAAAVAIVAAVVPTLASVRMLPWVKAHLNPTGQVLVISTVA  69

Query  459  GMAYFIVADKTVLAT------ARRNSFNRPADH  539
            GMAYFIVADKT+LA       AR NSF    DH
Sbjct  70   GMAYFIVADKTILADKTILSMARNNSFEDAPDH  102



>gb|ACG48865.1| early nodulin 93 [Zea mays]
 gb|ACG48983.1| early nodulin 93 [Zea mays]
 gb|AFW85922.1| early nodulin 93 [Zea mays]
Length=105

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +3

Query  369  IPMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSFNRPADH  539
            IP LASVRM+PWAKAN+NPT QALIVST AGMAYFI ADK +L+ ARR+SF +  +H
Sbjct  30   IPTLASVRMLPWAKANINPTGQALIVSTVAGMAYFIAADKKILSLARRHSFEQAPEH  86



>gb|EMS50053.1| hypothetical protein TRIUR3_13854 [Triticum urartu]
Length=101

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  276  LDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTA  455
            L+ KLA+A+R S E  +AGAKAAA+ TVA+A+P LASVRM+PWAKANLNPT QALIV T 
Sbjct  12   LENKLALARRCSREATLAGAKAAAIATVASAVPTLASVRMLPWAKANLNPTGQALIVCTV  71

Query  456  AGMAYFIVADKTVLATARRN  515
            AGMAYF+ ADKT+L+ A ++
Sbjct  72   AGMAYFVAADKTLLSPATKS  91



>gb|EMT32245.1| hypothetical protein F775_08718 [Aegilops tauschii]
Length=79

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +3

Query  369  IPMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSFNRPADH  539
            IP LASVRM+PWA+A+LNPT +ALI+ST AGMAYFIVADKT+L+ AR++SF+   +H
Sbjct  16   IPTLASVRMLPWARAHLNPTGKALIISTVAGMAYFIVADKTILSMARKHSFDDAPEH  72



>gb|ACG24380.1| early nodulin 93 [Zea mays]
Length=101

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +3

Query  369  IPMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSFNRPADH  539
            IP LASVRM+PW KAN+NPT QALIVST AGMAYFI ADK +L+ ARR+SF++  +H
Sbjct  26   IPTLASVRMLPWVKANINPTGQALIVSTVAGMAYFIAADKKILSLARRHSFDQAPEH  82



>ref|XP_004964507.1| PREDICTED: early nodulin-93-like [Setaria italica]
Length=116

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLD++ A+AK+ S E  +AGAKAAA+ TVATAIP LASVRM  WAKAN+NP  QALI+ST
Sbjct  9    SLDEQRALAKQCSREAALAGAKAAAIATVATAIPTLASVRMSRWAKANINPAGQALIIST  68

Query  453  AAGMAYFIVADKTVLATARRNSFNRPADH  539
             AGMAYFI ADK VL+ AR++S+    +H
Sbjct  69   VAGMAYFIAADKKVLSLARQHSYENAPEH  97



>gb|EAZ35784.1| hypothetical protein OsJ_20075 [Oryza sativa Japonica Group]
Length=97

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +3

Query  378  LASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSFNRPADH  539
            LASVRMVPWAKAN+NPT QALI+ TAAGMAYF+ ADK +L+ ARR+SF    +H
Sbjct  25   LASVRMVPWAKANINPTGQALIICTAAGMAYFVAADKKILSLARRHSFENAPEH  78



>ref|NP_001056761.1| Os06g0141600 [Oryza sativa Japonica Group]
 dbj|BAF18675.1| Os06g0141600 [Oryza sativa Japonica Group]
 dbj|BAG87116.1| unnamed protein product [Oryza sativa Japonica Group]
Length=139

 Score = 84.7 bits (208),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +3

Query  378  LASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSFNRPADH  539
            LASVRMVPWAKAN+NPT QALI+ TAAGMAYF+ ADK +L+ ARR+SF    +H
Sbjct  67   LASVRMVPWAKANINPTGQALIICTAAGMAYFVAADKKILSLARRHSFENAPEH  120



>ref|XP_010250018.1| PREDICTED: early nodulin-93-like isoform X1 [Nelumbo nucifera]
Length=92

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +3

Query  387  VRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSF  521
            VRM PWA+ANLNPTAQALI+ST AG AYFIVADKTVLATARRNSF
Sbjct  40   VRMFPWARANLNPTAQALIISTVAGSAYFIVADKTVLATARRNSF  84



>gb|EMT29547.1| hypothetical protein F775_24367 [Aegilops tauschii]
Length=142

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 75/124 (60%), Gaps = 36/124 (29%)
 Frame = +3

Query  276  LDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTA  455
            L+ KLA+AKR S E  +AGAKAAAV TVA+A+P LASVRM+PWAKANLNPT QALIV TA
Sbjct  12   LENKLALAKRCSREATLAGAKAAAVATVASAVPTLASVRMLPWAKANLNPTGQALIVCTA  71

Query  456  ---------------------------------AGMAYFIVADKTVLATARRNSFNR---  527
                                             AGMAYF+VADKT+L+ AR++SF     
Sbjct  72   GDGVAEAAMAGAKAAAVATVAAAVPIALIISTVAGMAYFVVADKTILSMARKHSFQDVRA  131

Query  528  PADH  539
            P +H
Sbjct  132  PQEH  135



>gb|EMS61159.1| hypothetical protein TRIUR3_18822 [Triticum urartu]
Length=77

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +3

Query  372  PMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSFNRPADH  539
            P LASVRM+PW  A+LNPT QALI+ST AGMAYFI+ADK +L  AR++SF    DH
Sbjct  15   PKLASVRMLPWESAHLNPTGQALIISTVAGMAYFIIADKIILLMARKHSFEDAPDH  70



>ref|XP_004148399.1| PREDICTED: early nodulin-93-like [Cucumis sativus]
 ref|XP_004162973.1| PREDICTED: early nodulin-93-like [Cucumis sativus]
 gb|KGN62792.1| hypothetical protein Csa_2G372870 [Cucumis sativus]
Length=116

 Score = 81.6 bits (200),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  279  DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTAA  458
            D+K+A AKR + EGV AG K A++  VA+A+P L +VR+VPWAKANLN TAQALI+S A+
Sbjct  26   DRKIANAKRCTQEGVRAGFKNASIACVASAVPTLVAVRVVPWAKANLNYTAQALIISAAS  85

Query  459  GMAYFIVADKTVLATARRNS  518
              AYFI ADKT+L  ARRNS
Sbjct  86   IAAYFITADKTILECARRNS  105



>gb|EMS35732.1| hypothetical protein TRIUR3_26870 [Triticum urartu]
Length=61

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +3

Query  378  LASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSFNRPADH  539
            +ASVRM+PW +A+LNPT QALI+ST AGMAYFIVADKT+L+ AR++S     +H
Sbjct  1    MASVRMLPWVRAHLNPTGQALIISTVAGMAYFIVADKTILSMARKHSHEMAPEH  54



>ref|XP_008444985.1| PREDICTED: early nodulin-93-like [Cucumis melo]
Length=116

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  279  DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTAA  458
            ++K+A AKR + EGV AG K A++  VA+A+P L +VR+VPWAKANLN TAQALI+S A+
Sbjct  26   ERKIANAKRCTQEGVRAGFKNASIACVASAVPTLVAVRVVPWAKANLNYTAQALIISAAS  85

Query  459  GMAYFIVADKTVLATARRNS  518
              AYFI ADKT+L  ARRNS
Sbjct  86   IAAYFITADKTILECARRNS  105



>ref|XP_002525450.1| Early nodulin, putative [Ricinus communis]
 gb|EEF36940.1| Early nodulin, putative [Ricinus communis]
Length=128

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  279  DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTAA  458
            DQ++  A+R + EGV AGAKAAAV  VA+AIP L +VR++PWAKANLN TAQALI+S A+
Sbjct  43   DQRILEARRCTQEGVKAGAKAAAVAAVASAIPTLVAVRVIPWAKANLNYTAQALIISAAS  102

Query  459  GMAYFIVADKTVLATARRNS  518
              AYFI ADKT+L  ARRN+
Sbjct  103  ISAYFITADKTILECARRNA  122



>gb|AFW85923.1| hypothetical protein ZEAMMB73_318061 [Zea mays]
Length=68

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +3

Query  393  MVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSFNRPADH  539
            M+PWAKAN+NPT QALIVST AGMAYFI ADK +L+ ARR+SF +  +H
Sbjct  1    MLPWAKANINPTGQALIVSTVAGMAYFIAADKKILSLARRHSFEQAPEH  49



>gb|AFK36825.1| unknown [Lotus japonicus]
Length=120

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  279  DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTAA  458
            + KL  +K+ ++EGV AG KAA +  VA+A+P LA+VRM+PWAKANLN TAQALI+S A+
Sbjct  27   ESKLLRSKQCTNEGVRAGLKAATIACVASAVPTLAAVRMIPWAKANLNYTAQALIISAAS  86

Query  459  GMAYFIVADKTVLATARRNS  518
              +YFIVADKT+L  AR+N+
Sbjct  87   IASYFIVADKTILECARKNA  106



>gb|EMS61131.1| hypothetical protein TRIUR3_21695 [Triticum urartu]
Length=90

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +3

Query  372  PMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSFNRPADH  539
            P LASVRM+ WA+A+L P  Q LI+ST  GMAYFIVA+KT+L+ AR++SF    DH
Sbjct  17   PTLASVRMLSWARAHLIPNGQGLIISTVTGMAYFIVANKTILSMARKHSFEDAPDH  72



>ref|XP_004498454.1| PREDICTED: early nodulin-93-like [Cicer arietinum]
Length=120

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  279  DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTAA  458
            ++KL  +K+ +HEGV+AG KAA+V  V +A+P L +VR +PWAKANLN TAQALI+S A+
Sbjct  26   ERKLLRSKKCTHEGVIAGFKAASVACVVSAVPTLTAVRKIPWAKANLNYTAQALIISAAS  85

Query  459  GMAYFIVADKTVLATARRNS  518
              AYFI ADKT+L  AR+N+
Sbjct  86   IAAYFITADKTILECARKNA  105



>ref|XP_003588448.1| Enod93 protein [Medicago truncatula]
 gb|AES58699.1| early nodulin 93 [Medicago truncatula]
 gb|AFK42368.1| unknown [Medicago truncatula]
Length=120

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  279  DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTAA  458
            ++K+   K+ ++EGV AG KAAAV  V + +P LA+VRMVPWAKANLN TAQALI+S A+
Sbjct  26   ERKILRTKKCTNEGVRAGFKAAAVACVVSTVPTLAAVRMVPWAKANLNYTAQALIISAAS  85

Query  459  GMAYFIVADKTVLATARRNS  518
              AYFI ADKT+L  AR+N+
Sbjct  86   IAAYFITADKTILECARKNA  105



>ref|XP_006853715.1| hypothetical protein AMTR_s00056p00156190 [Amborella trichopoda]
 gb|ERN15182.1| hypothetical protein AMTR_s00056p00156190 [Amborella trichopoda]
Length=114

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = +3

Query  279  DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTAA  458
            +Q+   +KR + EGV AG KAA++  VA+A+P L  VR++PWAKANLN TAQALI+S A+
Sbjct  27   EQRALNSKRCTEEGVRAGIKAASIACVASAVPTLIGVRVIPWAKANLNYTAQALIISAAS  86

Query  459  GMAYFIVADKTVLATARRNSF  521
              AYFI ADKT+L  ARRNS 
Sbjct  87   IAAYFITADKTILECARRNSI  107



>ref|XP_007012195.1| Early nodulin-93, putative [Theobroma cacao]
 gb|EOY29814.1| Early nodulin-93, putative [Theobroma cacao]
Length=129

 Score = 75.9 bits (185),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  279  DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTAA  458
            ++K + A+R+S EGV AG KAAA+  V +A+P L +VR +PWAKANLN TAQALI+S A+
Sbjct  42   EEKRSRAERFSQEGVRAGVKAAAIAAVVSAVPTLIAVRKIPWAKANLNHTAQALIISGAS  101

Query  459  GMAYFIVADKTVLATARRNS  518
              AYFI  DKTVL +ARRNS
Sbjct  102  IAAYFITVDKTVLESARRNS  121



>gb|EAY99599.1| hypothetical protein OsI_21577 [Oryza sativa Indica Group]
 gb|EAZ35783.1| hypothetical protein OsJ_20074 [Oryza sativa Japonica Group]
Length=111

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 62/84 (74%), Gaps = 1/84 (1%)
 Frame = +3

Query  276  LDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANL-NPTAQALIVST  452
            ++QK AMAK+ SHE  +AG KAAAVT V TAIP  ASVRM  WAKANL NP A+ +I++ 
Sbjct  12   IEQKFAMAKQSSHEAAIAGLKAAAVTAVCTAIPTFASVRMSKWAKANLGNPVAKTVIITY  71

Query  453  AAGMAYFIVADKTVLATARRNSFN  524
            AAGMAYFI  +K V+  +R++S  
Sbjct  72   AAGMAYFIAGEKKVVELSRKHSLE  95



>ref|XP_010249474.1| PREDICTED: early nodulin-93-like [Nelumbo nucifera]
Length=113

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = +3

Query  279  DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTAA  458
            +QK+  +KR + EGV AGAKAAAV  V +A+P L +VR++PWAKANLN TAQ LI+S A+
Sbjct  26   EQKILRSKRCTEEGVRAGAKAAAVACVVSAVPTLVAVRVIPWAKANLNYTAQTLIISAAS  85

Query  459  GMAYFIVADKTVLATARRNSF  521
              AYFI ADKT+L  ARRNS 
Sbjct  86   IAAYFITADKTILECARRNSI  106



>gb|KDP20271.1| hypothetical protein JCGZ_06857 [Jatropha curcas]
Length=125

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  279  DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTAA  458
            DQ++  A+R + EGV AGAKAAAV  VA+ +P L +VR++PWAKANLN TAQALI+S A+
Sbjct  35   DQRILEARRCTQEGVRAGAKAAAVACVASTVPTLVAVRVIPWAKANLNYTAQALIISAAS  94

Query  459  GMAYFIVADKTVLATARRNS  518
              AYFI ADKT+L  ARRN+
Sbjct  95   IAAYFITADKTILECARRNA  114



>gb|KHG21336.1| Early nodulin-93 [Gossypium arboreum]
Length=114

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +3

Query  279  DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTAA  458
            D+K   AK++S EG+ AG KAAAV  V +A+P L +VR +PWAKANLN TAQALI+S A+
Sbjct  27   DEKNLRAKQFSQEGIRAGVKAAAVAAVVSAVPTLIAVRKIPWAKANLNHTAQALIISGAS  86

Query  459  GMAYFIVADKTVLATARRNS  518
              AYFI  DKTVL +ARRNS
Sbjct  87   IAAYFITVDKTVLESARRNS  106



>ref|NP_001235239.1| uncharacterized protein LOC100500499 [Glycine max]
 gb|ACU15599.1| unknown [Glycine max]
 gb|KHN02163.1| Early nodulin-93 [Glycine soja]
Length=116

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  279  DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTAA  458
            D+K   +K+ + EGV AG KAA++  VA+A+P LA+VRM+PWAKANLN TAQALI+S A+
Sbjct  26   DRKTLRSKQCTREGVRAGFKAASIAGVASAVPTLAAVRMIPWAKANLNYTAQALIISAAS  85

Query  459  GMAYFIVADKTVLATARRNS  518
              +YFI ADKT+L  AR+N+
Sbjct  86   IASYFITADKTILECARKNA  105



>ref|XP_006288877.1| hypothetical protein CARUB_v10002236mg, partial [Capsella rubella]
 gb|EOA21775.1| hypothetical protein CARUB_v10002236mg, partial [Capsella rubella]
Length=135

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +3

Query  372  PMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNS  518
            P LA+VRM+PWAKANLN TAQALIVS+A+  A+FI ADKT+L  ARRN+
Sbjct  75   PTLAAVRMIPWAKANLNYTAQALIVSSASIAAFFITADKTILQGARRNT  123



>ref|XP_004291153.1| PREDICTED: early nodulin-93-like [Fragaria vesca subsp. vesca]
Length=119

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +3

Query  276  LDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTA  455
            + QK   AK  + EG   G KAA +    +A+P L +VRM+PWAKANLN TAQALI+S A
Sbjct  29   IQQKALRAKTCTQEGARKGFKAACIWGAVSAVPTLTAVRMIPWAKANLNYTAQALIISAA  88

Query  456  AGMAYFIVADKTVLATARRNS  518
            +  AYFI ADKT+L  AR+N+
Sbjct  89   SIAAYFITADKTILECARKNA  109



>ref|XP_010047293.1| PREDICTED: early nodulin-93 [Eucalyptus grandis]
 gb|KCW79178.1| hypothetical protein EUGRSUZ_C00614 [Eucalyptus grandis]
Length=113

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +3

Query  369  IPMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNS  518
            +P LA+ RMVPWAKANLN TAQALI+S A+  AYFI ADKT+L  ARRN+
Sbjct  58   VPTLAACRMVPWAKANLNYTAQALIISAASIAAYFITADKTILECARRNT  107



>gb|AFK35976.1| unknown [Lotus japonicus]
Length=120

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  279  DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTAA  458
            + KL  +K+ ++EGV AG KAA +  V++A+P LA+VR++PWAKANLN TAQALI+S A+
Sbjct  27   ESKLLRSKQCTNEGVRAGFKAATIACVSSAVPTLAAVRIIPWAKANLNYTAQALIISAAS  86

Query  459  GMAYFIVADKTVLATARRNS  518
              +YFI ADKT+L  AR+N+
Sbjct  87   IASYFIAADKTILECARKNA  106



>emb|CAB65283.1| Enod93 protein [Medicago sativa subsp. x varia]
Length=117

 Score = 72.8 bits (177),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 67/96 (70%), Gaps = 7/96 (7%)
 Frame = +3

Query  255  MASKNVSL-------DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKA  413
            +A+KN SL       +QK+  + + + EGV AG KAA +  VA+ +P L +VRM+PWAKA
Sbjct  12   IANKNTSLLIASPAEEQKMLRSSQCTAEGVRAGFKAAGIGCVASTVPTLVAVRMIPWAKA  71

Query  414  NLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSF  521
            NLN TAQALI+S  + +++F+ ADKT+LA AR+ S 
Sbjct  72   NLNYTAQALIISAVSVVSFFVAADKTILACARKQSL  107



>ref|XP_011081751.1| PREDICTED: early nodulin-93-like [Sesamum indicum]
Length=94

 Score = 72.0 bits (175),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +3

Query  369  IPMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSFNR  527
            IP LA+VR +PWAKANLN T QALI+S A+  AYFI ADKT+L TAR+N+  R
Sbjct  37   IPTLAAVRTIPWAKANLNYTGQALIISGASIAAYFITADKTILETARKNADAR  89



>ref|XP_010325064.1| PREDICTED: early nodulin-93 [Solanum lycopersicum]
 ref|XP_010325065.1| PREDICTED: early nodulin-93 [Solanum lycopersicum]
Length=113

 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +3

Query  369  IPMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNS  518
            IP L +VR +PWAKANLN TAQALI+S A+  AYFI ADKT+L  ARRN+
Sbjct  58   IPTLVAVRTIPWAKANLNYTAQALIISAASIAAYFITADKTILECARRNT  107



>gb|AFR46651.1| ENOD93-like protein [Chimonanthus praecox]
Length=110

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = +3

Query  279  DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTAA  458
            ++++  AKR   EGV AG +AAA+  VA+A+P L  VR++PWAKANLN TAQALI+S A+
Sbjct  25   EERILRAKRCQDEGVRAGLRAAAIACVASAVPTLVGVRVIPWAKANLNYTAQALIISAAS  84

Query  459  GMAYFIVADKTVLATARRNSF  521
              AYFI ADKT+L  AR+N+ 
Sbjct  85   ISAYFITADKTILECARKNAI  105



>ref|XP_002325832.2| hypothetical protein POPTR_0019s04930g [Populus trichocarpa]
 gb|ABK93223.1| unknown [Populus trichocarpa]
 gb|EEF00214.2| hypothetical protein POPTR_0019s04930g [Populus trichocarpa]
Length=129

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +3

Query  279  DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTAA  458
            +QK+  A+  + EGV AG KAA +T VATA+P L +VR++PWAKANLN TAQALI+S A+
Sbjct  44   EQKILQARLCTQEGVRAGVKAAVITCVATAVPTLTAVRVIPWAKANLNYTAQALIISAAS  103

Query  459  GMAYFIVADKTVLATARRNSFNRPAD  536
              AYFI  DKT+L  ARRN+     D
Sbjct  104  IAAYFITVDKTILECARRNAHYNKRD  129



>ref|XP_009796123.1| PREDICTED: early nodulin-93 [Nicotiana sylvestris]
 ref|XP_009796124.1| PREDICTED: early nodulin-93 [Nicotiana sylvestris]
Length=111

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +3

Query  369  IPMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNS  518
            IP L +VR +PWAKANLN TAQALI+S A+  AYFI ADKT+L  ARRN+
Sbjct  56   IPTLVAVRTIPWAKANLNYTAQALIISAASIAAYFITADKTILECARRNT  105



>ref|XP_006366687.1| PREDICTED: early nodulin-93-like [Solanum tuberosum]
Length=113

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +3

Query  369  IPMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNS  518
            IP L +VR +PWAKANLN TAQALI+S A+  AYFI ADKT+L  ARRN+
Sbjct  58   IPTLVAVRTIPWAKANLNYTAQALIISAASIAAYFITADKTILECARRNT  107



>ref|XP_009602784.1| PREDICTED: early nodulin-93 [Nicotiana tomentosiformis]
Length=111

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +3

Query  369  IPMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNS  518
            IP L +VR +PWAKANLN TAQALI+S A+  AYFI ADKT+L  ARRN+
Sbjct  56   IPTLVAVRTIPWAKANLNYTAQALIISAASIAAYFITADKTILECARRNT  105



>ref|XP_011010128.1| PREDICTED: early nodulin-93-like [Populus euphratica]
Length=129

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +3

Query  279  DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTAA  458
            +QK+  A+  + EGV AG KAA +T VATA+P L +VR++PWAKANLN TAQALI+S A+
Sbjct  44   EQKILQARLCTQEGVRAGVKAAVITCVATAVPTLTAVRVIPWAKANLNYTAQALIISAAS  103

Query  459  GMAYFIVADKTVLATARRNSFNRPAD  536
              AYFI  DKT+L  ARRN+     D
Sbjct  104  IAAYFITVDKTILECARRNAHYNKRD  129



>ref|XP_010421449.1| PREDICTED: early nodulin-93-like [Camelina sativa]
 ref|XP_010454933.1| PREDICTED: early nodulin-93-like [Camelina sativa]
Length=109

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +3

Query  372  PMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNS  518
            P LA+VRM+PWAKANLN TAQALIVS+A+  A+FI ADKT+L  AR+N+
Sbjct  49   PTLAAVRMIPWAKANLNYTAQALIVSSASIAAFFITADKTILHGARKNT  97



>gb|EPS65341.1| hypothetical protein M569_09436 [Genlisea aurea]
Length=101

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +3

Query  372  PMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSFNRPA  533
            P L +VR +PWAKANLN TAQALIVS+A+  AYFI ADKT+LA AR+N+  + A
Sbjct  48   PTLMAVRRIPWAKANLNYTAQALIVSSASVAAYFIAADKTILACARKNTHYKSA  101



>emb|CDP08196.1| unnamed protein product [Coffea canephora]
Length=112

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  279  DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTAA  458
            ++K+  ++  + EGV AGAKAAA+  VA+AIP L +VR +PWAKANLN TAQALI+S A+
Sbjct  27   EEKIRRSRECTREGVRAGAKAAAIACVASAIPTLTAVRTIPWAKANLNYTAQALIISGAS  86

Query  459  GMAYFIVADKTVLATARRNS  518
              AYFI ADKT+L  ARRN+
Sbjct  87   IAAYFITADKTILECARRNT  106



>ref|XP_007161502.1| hypothetical protein PHAVU_001G074600g [Phaseolus vulgaris]
 gb|ESW33496.1| hypothetical protein PHAVU_001G074600g [Phaseolus vulgaris]
Length=116

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  279  DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTAA  458
            ++K+   K+ + EGV AG KAA++  VA+A+P L +VR++PWAKANLN TAQALI+S A+
Sbjct  26   ERKILRTKQCTSEGVRAGFKAASIACVASAVPTLTAVRVIPWAKANLNYTAQALIISAAS  85

Query  459  GMAYFIVADKTVLATARRNS  518
              AYFI ADKT+L  AR+N+
Sbjct  86   IAAYFITADKTILECARKNA  105



>gb|ADE77942.1| unknown [Picea sitchensis]
Length=128

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +3

Query  279  DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTAA  458
            ++K   AKR S EGV  G KAA +  VA+AIP L  VR++PWAKANLN  AQALI+S A+
Sbjct  39   EEKAVRAKRCSDEGVKEGLKAAGIACVASAIPTLTVVRVIPWAKANLNYVAQALIISAAS  98

Query  459  GMAYFIVADKTVLATARRNSFNR  527
              +YFIVA+KT+L  +R+N+  +
Sbjct  99   IASYFIVAEKTILKCSRQNTIKQ  121



>ref|NP_197966.1| early nodulin-related protein [Arabidopsis thaliana]
 gb|AAD40124.1|AF149413_5 contains similarity to soybean early nodulin 93 (N-93) (SW:Q02921) 
[Arabidopsis thaliana]
 gb|AAP04129.1| putative nodulin protein [Arabidopsis thaliana]
 gb|AAP40397.1| putative nodulin protein [Arabidopsis thaliana]
 dbj|BAF01524.1| nodulin - like protein [Arabidopsis thaliana]
 gb|AED93503.1| early nodulin-related protein [Arabidopsis thaliana]
Length=115

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +3

Query  372  PMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNS  518
            P +A+VRM PWAKANLN TAQALI+S+A+  A+FI ADKT+L  ARRN+
Sbjct  55   PTVAAVRMFPWAKANLNYTAQALIISSASIAAFFITADKTILQGARRNT  103



>gb|AAM63333.1| nodulin-like protein [Arabidopsis thaliana]
Length=109

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +3

Query  372  PMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNS  518
            P +A+VRM PWAKANLN TAQALI+S+A+  A+FI ADKT+L  ARRN+
Sbjct  49   PTVAAVRMFPWAKANLNYTAQALIISSASIAAFFITADKTILQGARRNT  97



>ref|XP_009129938.1| PREDICTED: early nodulin-93 [Brassica rapa]
 emb|CDY05510.1| BnaA02g31810D [Brassica napus]
Length=109

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +3

Query  372  PMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNS  518
            P LA+VR+ PWAKANLN TAQALI+S+A+  A+FI ADKT+L  ARRN+
Sbjct  49   PTLAAVRVFPWAKANLNYTAQALIISSASIAAFFITADKTILQGARRNT  97



>ref|XP_008220129.1| PREDICTED: early nodulin-93-like [Prunus mume]
Length=116

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = +3

Query  279  DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTAA  458
            +QK   + + + EG   G KAAA+    T +P LA+VRM+PWAK NLN TAQALI+  A+
Sbjct  26   EQKRLRSAKCTQEGAKEGFKAAAIACALTTVPTLAAVRMIPWAKHNLNYTAQALIICGAS  85

Query  459  GMAYFIVADKTVLATARRNS  518
              +YFI ADKT+LA AR+N+
Sbjct  86   IASYFITADKTILACARKNA  105



>ref|XP_011081738.1| PREDICTED: early nodulin-93-like isoform X2 [Sesamum indicum]
Length=149

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  279  DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTAA  458
            D+K+   ++ + EGV AGAKAAAV  VA+A+P L +VR +PWAKANLN TAQALI+S A+
Sbjct  65   DEKMLRTRQCTQEGVRAGAKAAAVACVASAVPTLVAVRTIPWAKANLNYTAQALIISAAS  124

Query  459  GMAYFIVADKTVLATARRNS  518
              AYFI ADKT+L  ARRN+
Sbjct  125  IAAYFITADKTILECARRNA  144



>gb|EYU20409.1| hypothetical protein MIMGU_mgv1a023606mg, partial [Erythranthe 
guttata]
Length=75

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +3

Query  369  IPMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSFNR  527
            IP LA+VR +PWAKANLN T QALI+S A+  AYFI ADKT+L   R+N+  R
Sbjct  18   IPTLAAVRTIPWAKANLNYTGQALIISGASIAAYFITADKTILEATRKNADAR  70



>gb|EPS59458.1| hypothetical protein M569_15348 [Genlisea aurea]
Length=101

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = +3

Query  279  DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTAA  458
            D+K+  +++ + EGV AGAKAAA+  VA A+P L  VR + WAKANLN TAQALI+S A+
Sbjct  14   DEKILRSRQCTQEGVRAGAKAAAIAGVAAAVPTLIGVRKIAWAKANLNYTAQALIISGAS  73

Query  459  GMAYFIVADKTVLATARRNSFNRPA  533
              AYFI ADKT+LA AR+N+  + A
Sbjct  74   IAAYFITADKTILACARKNTHYKSA  98



>ref|XP_008799774.1| PREDICTED: early nodulin-93-like [Phoenix dactylifera]
Length=112

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +3

Query  369  IPMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSFNR  527
            +P L   R++PWAKANLN TAQALI+S+A+   +FI AD+T+L +AR NSF +
Sbjct  55   VPTLVGCRVIPWAKANLNYTAQALIISSASIAGFFIAADQTILESARENSFQK  107



>gb|KHG26243.1| Early nodulin-93 [Gossypium arboreum]
Length=115

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +3

Query  279  DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTAA  458
            DQK   A++ S EG+ AG KAAA+T V TA+P L +VR V WAKANLN TAQALI++ A+
Sbjct  27   DQKKLRAQQSSQEGIRAGLKAAAITGVFTAVPTLIAVRKVVWAKANLNHTAQALIINGAS  86

Query  459  GMAYFIVADKTVLATARRNS  518
              AYFI  DKTVL +AR+NS
Sbjct  87   IAAYFITVDKTVLESARKNS  106



>ref|XP_007225829.1| hypothetical protein PRUPE_ppa011550mg [Prunus persica]
 gb|EMJ27028.1| hypothetical protein PRUPE_ppa011550mg [Prunus persica]
Length=206

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = +3

Query  279  DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTAA  458
            +QK   + + + EG   G KAA +    T +P LA+VRM+PWAK NLN TAQALI+  A+
Sbjct  116  EQKRLRSAKCTQEGAKEGFKAAVIACALTTVPTLAAVRMIPWAKHNLNYTAQALIICGAS  175

Query  459  GMAYFIVADKTVLATARRNS  518
              +YFI ADKT+LA AR+N+
Sbjct  176  IASYFITADKTILACARKNA  195



>emb|CDY05336.1| BnaC02g40440D [Brassica napus]
Length=109

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +3

Query  372  PMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNS  518
            P LA+VR+ PWAK NLN TAQALI+S+A+  A+FI ADKT+L  ARRN+
Sbjct  49   PTLAAVRVFPWAKVNLNYTAQALIISSASIAAFFITADKTILQGARRNT  97



>ref|XP_010668768.1| PREDICTED: early nodulin-93-like [Beta vulgaris subsp. vulgaris]
Length=110

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +3

Query  369  IPMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNS  518
            +P L   R++PWAK+NLN TAQALI+S A+  AYFI ADKT+L  ARRN+
Sbjct  55   VPTLVGCRVIPWAKSNLNYTAQALIISGASIAAYFITADKTILECARRNA  104



>ref|XP_010914922.1| PREDICTED: early nodulin-93-like [Elaeis guineensis]
Length=112

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +3

Query  369  IPMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSFNR  527
            +P L   R++PWAKANLN TAQALI+S A+   +FI AD+T+L +AR NSF +
Sbjct  55   VPTLVGCRVIPWAKANLNYTAQALIISAASIAGFFIAADQTILESARENSFQK  107



>ref|XP_006394840.1| hypothetical protein EUTSA_v10005156mg [Eutrema salsugineum]
 gb|ESQ32126.1| hypothetical protein EUTSA_v10005156mg [Eutrema salsugineum]
Length=115

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +3

Query  372  PMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNS  518
            P +A+VR+ PWAKANLN TAQALIVS A+  A+FI ADKT+L  ARRN+
Sbjct  55   PTIAAVRVFPWAKANLNYTAQALIVSAASIAAFFITADKTILQGARRNT  103



>ref|XP_010495507.1| PREDICTED: uncharacterized protein LOC104772610 [Camelina sativa]
Length=147

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  378  LASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNS  518
            LA+VRM+PWAKANLN TAQALIVS+A+  A+FI ADKT+L  AR+N+
Sbjct  89   LAAVRMIPWAKANLNYTAQALIVSSASIAAFFITADKTILHGARKNT  135



>ref|XP_002874285.1| hypothetical protein ARALYDRAFT_910661 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50544.1| hypothetical protein ARALYDRAFT_910661 [Arabidopsis lyrata subsp. 
lyrata]
Length=115

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +3

Query  372  PMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNS  518
            P +A+VR+ PWAKANLN TAQALI+S A+  A+FI ADKT+L  ARRN+
Sbjct  55   PTVAAVRVFPWAKANLNYTAQALIISAASIAAFFITADKTILQGARRNT  103



>gb|KEH36097.1| early nodulin 93 [Medicago truncatula]
Length=122

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 63/96 (66%), Gaps = 7/96 (7%)
 Frame = +3

Query  255  MASKNVSL-------DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKA  413
            +A+KN SL       +QK+  + + + EGV AG KAA +  V +  P L +VRM+PWAKA
Sbjct  12   IANKNTSLQIASPAEEQKMLRSSQCTAEGVRAGFKAAGIGCVTSTGPTLVAVRMIPWAKA  71

Query  414  NLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSF  521
            NLN TAQALI+S  +  ++F+ ADK +LA AR+ S 
Sbjct  72   NLNYTAQALIISAVSVASFFVAADKIILACARKQSL  107



>ref|XP_010536217.1| PREDICTED: early nodulin-93 [Tarenaya hassleriana]
Length=104

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  369  IPMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNS  518
            IP L +VR +PWAK NLN TAQALI+S A+   +FI ADKT+L  ARRN+
Sbjct  43   IPTLVAVRKIPWAKKNLNYTAQALIISAASIAGFFITADKTILEGARRNN  92



>ref|XP_011081737.1| PREDICTED: uncharacterized protein LOC105164713 isoform X1 [Sesamum 
indicum]
Length=162

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +3

Query  375  MLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNS  518
            +L +VR +PWAKANLN TAQALI+S A+  AYFI ADKT+L  ARRN+
Sbjct  110  LLVAVRTIPWAKANLNYTAQALIISAASIAAYFITADKTILECARRNA  157



>ref|XP_004517223.1| PREDICTED: early nodulin-93-like [Cicer arietinum]
Length=81

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +3

Query  369  IPMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSF  521
            + +LASVRM+PWAKANLN TAQALI+S A+  ++F+VA+KT+LA AR+ S 
Sbjct  21   VQLLASVRMIPWAKANLNYTAQALIISAASVASFFVVAEKTILACARKQSL  71



>emb|CAN71779.1| hypothetical protein VITISV_015688 [Vitis vinifera]
Length=107

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            S DQKLAMAKR SHEGVVAGAKAA V ++ATAIP +AS R +PWAKANLN TAQALI+ST
Sbjct  17   SFDQKLAMAKRCSHEGVVAGAKAAVVASIATAIPTMASARWLPWAKANLNHTAQALIIST  76

Query  453  AAGMAYFIVADKTV  494
                 +      +V
Sbjct  77   GRSGLFHSCGQDSV  90



>ref|XP_009415371.1| PREDICTED: early nodulin-93-like [Musa acuminata subsp. malaccensis]
Length=116

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  369  IPMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSFNR  527
            +P L   R++PWAKANLN TAQALI+S A+   +FI ADKT+L  AR NS  +
Sbjct  59   VPTLVGCRVIPWAKANLNYTAQALIISAASVAGFFITADKTILQNARGNSIGK  111



>gb|ABQ42021.1| Enod93 protein [Sonneratia alba]
 gb|ABQ42022.1| Enod93 protein [Sonneratia caseolaris]
 gb|ABQ42023.1| Enod93 protein [Sonneratia ovata]
 gb|ACS68675.1| Enod93 protein [Sonneratia alba]
 gb|ACS68745.1| Enod93 protein [Sonneratia alba]
Length=82

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            S +QK+  A+  + EGV AG KAAA+  VA+A+P L +VR+VPWAKANLN TAQALI+  
Sbjct  8    SEEQKVLNARNCTQEGVRAGVKAAAIAGVASAVPTLVAVRVVPWAKANLNYTAQALIICA  67

Query  453  AAGMAYFIVADKTVL  497
            A+  AYFI ADKT+L
Sbjct  68   ASIAAYFITADKTIL  82



>dbj|BAJ94955.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=97

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  369  IPMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSFNR  527
            +P L S R++PWAK NLN TAQALI+S A    +FI ADKT+L  AR+N+  R
Sbjct  40   VPTLVSCRVLPWAKHNLNYTAQALIISAACIAGFFITADKTILRNARQNTIGR  92



>ref|NP_001150497.1| early nodulin 93 [Zea mays]
 gb|ACF83725.1| unknown [Zea mays]
 gb|ACG39282.1| early nodulin 93 [Zea mays]
 gb|AFW66007.1| early nodulin 93 [Zea mays]
Length=97

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  369  IPMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSFNR  527
            +P L   R++PWAKANLN TAQALI+S A    +FI ADKT+L  AR+N+  +
Sbjct  40   VPTLVGCRVLPWAKANLNYTAQALIISAACIAGFFITADKTILRNARQNTIGK  92



>ref|XP_002453560.1| hypothetical protein SORBIDRAFT_04g008090 [Sorghum bicolor]
 gb|EES06536.1| hypothetical protein SORBIDRAFT_04g008090 [Sorghum bicolor]
Length=97

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  369  IPMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSFNR  527
            +P L   R++PWAKANLN TAQALI+S A    +FI ADKT+L  AR+N+  +
Sbjct  40   VPTLVGCRVLPWAKANLNYTAQALIISAACISGFFITADKTILRNARQNTIGK  92



>gb|ACG23999.1| early nodulin 93 [Zea mays]
 gb|ACG32802.1| early nodulin 93 [Zea mays]
Length=97

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  369  IPMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSFNR  527
            +P L   R++PWAKANLN TAQALI+S A    +FI ADKT+L  AR+N+  +
Sbjct  40   VPTLVGCRVLPWAKANLNYTAQALIISAACIAGFFITADKTILRNARQNTIGK  92



>gb|EMT24869.1| hypothetical protein F775_32597 [Aegilops tauschii]
Length=97

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  369  IPMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSFNR  527
            +P   + R++PWAK NLN TAQALI+STA    +FI ADKT+L  AR+N+  R
Sbjct  40   VPTFVACRVLPWAKHNLNYTAQALIISTACVAGFFITADKTILRNARQNTIGR  92



>gb|AFK34546.1| unknown [Medicago truncatula]
Length=122

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  372  PMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSF  521
            P L +VRM+PWAKANLN TAQALI+S  +  ++F+ ADK +LA AR+ S 
Sbjct  58   PTLVAVRMIPWAKANLNYTAQALIISAVSVASFFVAADKIILACARKQSL  107



>gb|EMT14561.1| hypothetical protein F775_30178 [Aegilops tauschii]
Length=94

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  369  IPMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSFNR  527
            +P   + R++PWAK NLN TAQALI+STA    +FI ADKT+L  AR+N+  R
Sbjct  40   VPTFVACRVLPWAKHNLNYTAQALIISTACVAGFFITADKTILRNARQNTIGR  92



>ref|XP_006475988.1| PREDICTED: early nodulin-93-like isoform X1 [Citrus sinensis]
 ref|XP_006475989.1| PREDICTED: early nodulin-93-like isoform X2 [Citrus sinensis]
 gb|KDO79932.1| hypothetical protein CISIN_1g033692mg [Citrus sinensis]
Length=113

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +3

Query  369  IPMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNS-FNRP  530
            +P L +VR +PWAKANLN T QALI+S  +  +YFI  DKT+L  ARRN+ + +P
Sbjct  58   VPTLVAVRKIPWAKANLNYTGQALIISAVSIASYFITVDKTILECARRNAQYGKP  112



>gb|AFK33958.1| unknown [Medicago truncatula]
 gb|KEH36098.1| early nodulin 93 [Medicago truncatula]
Length=121

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  372  PMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSF  521
            P L +VRM+PWAKANLN TAQALI+S  +  ++F+ ADK +LA AR+ S 
Sbjct  57   PTLVAVRMIPWAKANLNYTAQALIISAVSVASFFVAADKIILACARKQSL  106



>gb|EMS46857.1| hypothetical protein TRIUR3_07600 [Triticum urartu]
Length=121

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  369  IPMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSFNR  527
            +P   + R++PWAK NLN TAQALI+STA    +FI ADKT+L  AR+N+  R
Sbjct  64   VPTFVACRVLPWAKHNLNYTAQALIISTACVAGFFITADKTILRNARQNTIGR  116



>ref|XP_004951404.1| PREDICTED: early nodulin-93-like [Setaria italica]
Length=97

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  369  IPMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSFNR  527
            +P L   R++PWAKANLN TAQALI+S A    +FI ADKT+L  AR+N+  +
Sbjct  40   VPTLIGCRVLPWAKANLNYTAQALIISAACIAGFFITADKTILRNARQNTIGK  92



>ref|XP_008804878.1| PREDICTED: uncharacterized protein LOC103718023 isoform X2 [Phoenix 
dactylifera]
Length=147

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  369  IPMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSFNR  527
            +P L   R++PWAKANLN TAQALI+S A+   +FI AD+T+L  AR N+  +
Sbjct  90   VPTLIGCRVIPWAKANLNHTAQALIISAASIAGFFITADRTILQNARENTMGK  142



>ref|XP_010917653.1| PREDICTED: early nodulin-93-like isoform X1 [Elaeis guineensis]
Length=149

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  369  IPMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSFNR  527
            +P L   R++PWAKANLN TAQALI+S A+   +FI AD+T+L  AR N+  +
Sbjct  92   VPTLIGCRVIPWAKANLNHTAQALIISAASIAGFFITADRTILQNARENTMGK  144



>ref|NP_001046351.1| Os02g0227200 [Oryza sativa Japonica Group]
 dbj|BAA33815.1| early nodulin [Oryza sativa Japonica Group]
 dbj|BAD25664.1| early nodulin [Oryza sativa Japonica Group]
 dbj|BAD25860.1| early nodulin [Oryza sativa Japonica Group]
 dbj|BAF08265.1| Os02g0227200 [Oryza sativa Japonica Group]
 dbj|BAG92969.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00214.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC72776.1| hypothetical protein OsI_06438 [Oryza sativa Indica Group]
 gb|EEE56598.1| hypothetical protein OsJ_05958 [Oryza sativa Japonica Group]
Length=96

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +3

Query  312  HEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKT  491
            HE V  G K AA++    A+P L   R++PWAKANLN TAQALI+S A    +FI ADK 
Sbjct  20   HEAVTLGLKNAAISGTVVAVPTLVGCRVLPWAKANLNYTAQALIISAACIAGFFITADKA  79

Query  492  VLATARRNSFNR  527
            +L  AR+N+  +
Sbjct  80   ILRNARQNTIGK  91



>gb|ABQ42024.1| Enod93 protein [Sonneratia apetala]
Length=82

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            S +QK+  A+  + EGV AG KAAA+  VA+A+P L +VR+VPWAKANL  TAQALI+  
Sbjct  8    SEEQKVLNARNCTQEGVRAGVKAAAIAGVASAVPTLVAVRVVPWAKANLKYTAQALIICA  67

Query  453  AAGMAYFIVADKTVL  497
            A+  AYFI ADKT+L
Sbjct  68   ASIAAYFITADKTIL  82



>ref|XP_009350245.1| PREDICTED: early nodulin-93-like [Pyrus x bretschneideri]
Length=117

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = +3

Query  279  DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTAA  458
            + KL  +K+   EGV  G K AAV  V +++  L +VR VPWAK NLN TAQALI+S A 
Sbjct  26   EAKLLRSKKCIDEGVQEGFKYAAVAAVISSVATLGAVRTVPWAKYNLNYTAQALIISAAT  85

Query  459  GMAYFIVADKTVLATARRNSF  521
               YFI  DKT+LA AR+N+ 
Sbjct  86   ISTYFITVDKTILACARKNAL  106



>ref|XP_008357372.1| PREDICTED: early nodulin-93-like [Malus domestica]
Length=117

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = +3

Query  279  DQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVSTAA  458
            + KL  +K+   EGV  G K  AV  V +++  L +VR VPWAK NLN TAQALI+S A 
Sbjct  26   EAKLLRSKKCIDEGVQEGFKYGAVAAVISSVATLGAVRTVPWAKYNLNYTAQALIISAAT  85

Query  459  GMAYFIVADKTVLATARRNSF  521
               YFI  DKT+LA AR+N+ 
Sbjct  86   ISTYFITVDKTILACARKNAL  106



>ref|XP_006647086.1| PREDICTED: early nodulin-93-like [Oryza brachyantha]
Length=97

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +3

Query  369  IPMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSFNR  527
            +P L   R++PWAKANLN TAQALI+S A    +FI ADK +L  AR+N+  +
Sbjct  40   VPTLVGCRVLPWAKANLNYTAQALIISAACIAGFFITADKAILRNARQNTIGK  92



>ref|XP_003571774.1| PREDICTED: early nodulin-93 [Brachypodium distachyon]
Length=97

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  369  IPMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSFNR  527
            +P L   R+ PWAK NLN TAQALI++ A    +FI ADKT+L  AR+N+  R
Sbjct  40   VPTLVGCRVFPWAKRNLNYTAQALIITAACIAGFFITADKTILRNARQNTIGR  92



>ref|XP_001761950.1| predicted protein [Physcomitrella patens]
 gb|EDQ73391.1| predicted protein [Physcomitrella patens]
Length=69

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  369  IPMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNS  518
            IP L +VRMVPW KAN+N T QALI+S A    YF+VA++T+L  +R+ +
Sbjct  14   IPTLTAVRMVPWVKANVNYTGQALIISGATIATYFVVAEQTILECSRKQN  63



>ref|NP_001056760.1| Os06g0141400 [Oryza sativa Japonica Group]
 dbj|BAF18674.1| Os06g0141400, partial [Oryza sativa Japonica Group]
Length=119

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = +3

Query  369  IPMLASVRMVPWAKANL-NPTAQALIVSTAAGMAYFIVADKTVLATARRNSFN  524
            IP  ASVRM  WAKANL NP A+ +I++ AAGMAYFI  +K V+  +R++S  
Sbjct  51   IPTFASVRMSKWAKANLGNPVAKTVIITYAAGMAYFIAGEKKVVELSRKHSLE  103



>gb|AFW75468.1| hypothetical protein ZEAMMB73_751741 [Zea mays]
Length=83

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = +3

Query  273  SLDQKLAMAKRYSHEgvvagakaaavttvataIPMLASVRMVPWAKANLNPTAQALIVST  452
            SLDQ L +AK+ S E  +AG KAAAV TVA+A+P L SVRM+PWAKAN+NP  QALIVST
Sbjct  9    SLDQNLELAKQCSREAALAGFKAAAVATVASAVPTLVSVRMLPWAKANINPAGQALIVST  68

Query  453  AAGMAYFIV  479
               +   ++
Sbjct  69   GRSLNLSLI  77



>ref|XP_002532958.1| hypothetical protein RCOM_0639430 [Ricinus communis]
 gb|EEF29424.1| hypothetical protein RCOM_0639430 [Ricinus communis]
Length=75

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  369  IPMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADK  488
            +P LASVRM+PWA+ANLN TAQAL +ST AG A+FIV  +
Sbjct  21   LPNLASVRMLPWARANLNHTAQALTISTVAGAAHFIVCRQ  60



>ref|XP_001780085.1| predicted protein [Physcomitrella patens]
 gb|EDQ55094.1| predicted protein [Physcomitrella patens]
Length=73

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  369  IPMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRNSF  521
            IP L +VRM P  KA+LN T QALIVS A+  +YFIV+D+T+   +R++S+
Sbjct  18   IPTLTAVRMFPKVKASLNYTGQALIVSAASIASYFIVSDQTIHECSRKSSY  68



>ref|XP_002275030.1| PREDICTED: early nodulin-93 [Vitis vinifera]
 emb|CBI20593.3| unnamed protein product [Vitis vinifera]
Length=108

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +3

Query  369  IPMLASVRMVPWAKANLNPTAQALIVSTAAGMAYFIVADKTVLATARRN-SFNRP  530
            +  L +VR VPW K ++N T +ALI+S A+  A+FI ADKT+L   +RN ++++P
Sbjct  53   VATLGAVRYVPWVKQHINYTGRALIISAASVAAFFITADKTILECGKRNTTYDKP  107



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1371696120284