BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1342_g1_i1 len=1074 path=[35:0-286 34:287-1073]

Length=1074
                                                                      Score     E

ref|XP_002275728.1|  PREDICTED: squamosa promoter-binding protein...    183   1e-52   Vitis vinifera
ref|XP_009626190.1|  PREDICTED: squamosa promoter-binding-like pr...    183   2e-52   
ref|XP_009781601.1|  PREDICTED: squamosa promoter-binding-like pr...    181   1e-51   
emb|CDP14818.1|  unnamed protein product                                180   7e-51   
gb|AGR34080.1|  squamosa promoter binding protein-like 3                179   7e-51   
gb|AAY16440.1|  squamosa promoter binding-like protein                  176   5e-50   Betula platyphylla [Asian white birch]
gb|AIE89792.1|  SQUAMOSA promoter binding protein-like 3                176   7e-50   
ref|XP_010656994.1|  PREDICTED: squamosa promoter-binding protein...    175   1e-49   
ref|XP_006447265.1|  hypothetical protein CICLE_v10016841mg             173   1e-48   
ref|XP_002517882.1|  Squamosa promoter-binding protein, putative        173   1e-48   Ricinus communis
gb|KDP24104.1|  hypothetical protein JCGZ_25761                         170   3e-48   
gb|KDO42134.1|  hypothetical protein CISIN_1g029650mg                   172   4e-48   
ref|XP_002309744.2|  hypothetical protein POPTR_0007s01030g             169   5e-47   Populus trichocarpa [western balsam poplar]
ref|XP_007043635.1|  Squamosa promoter binding protein-like 4           169   1e-46   
ref|XP_011047666.1|  PREDICTED: squamosa promoter-binding protein...    169   4e-46   
ref|XP_010091480.1|  Squamosa promoter-binding-like protein 5           165   4e-45   
ref|XP_007198845.1|  hypothetical protein PRUPE_ppa011968mg             163   1e-44   
ref|XP_008229071.1|  PREDICTED: squamosa promoter-binding-like pr...    160   9e-44   
ref|XP_007149828.1|  hypothetical protein PHAVU_005G101900g             157   1e-42   
ref|XP_010035775.1|  PREDICTED: squamosa promoter-binding protein...    156   2e-42   
gb|KCW47238.1|  hypothetical protein EUGRSUZ_K01046                     156   3e-42   
ref|XP_003540122.1|  PREDICTED: squamosa promoter-binding protein...    155   6e-42   
gb|KCW47237.1|  hypothetical protein EUGRSUZ_K01046                     156   1e-41   
ref|XP_008381596.1|  PREDICTED: squamosa promoter-binding-like pr...    153   6e-41   
ref|XP_006595445.1|  PREDICTED: squamosa promoter-binding-like pr...    151   1e-40   
ref|XP_008810376.1|  PREDICTED: squamosa promoter-binding protein...    151   2e-40   
gb|ADL36827.1|  SPL domain class transcription factor                   151   3e-40   
ref|XP_010260271.1|  PREDICTED: squamosa promoter-binding protein 1     150   5e-40   
ref|XP_003526029.1|  PREDICTED: squamosa promoter-binding protein...    150   5e-40   
ref|XP_009392815.1|  PREDICTED: squamosa promoter-binding-like pr...    150   5e-40   
ref|XP_010929104.1|  PREDICTED: squamosa promoter-binding protein...    150   6e-40   
ref|XP_006367482.1|  PREDICTED: squamosa promoter-binding protein...    149   7e-40   
gb|AAY33857.1|  putative squamosa promoter-binding protein              147   1e-39   Betula platyphylla [Asian white birch]
ref|XP_007133260.1|  hypothetical protein PHAVU_011G164800g             149   1e-39   
gb|KHN18285.1|  Squamosa promoter-binding protein 1                     148   4e-39   
ref|XP_010272389.1|  PREDICTED: squamosa promoter-binding protein...    148   4e-39   
gb|AGI62049.1|  SQUAMOSA promoter-binding-like 1                        147   7e-39   
ref|XP_006370233.1|  hypothetical protein POPTR_0001s40870g             147   9e-39   
ref|XP_002282598.1|  PREDICTED: squamosa promoter-binding-like pr...    147   1e-38   Vitis vinifera
ref|XP_004243367.2|  PREDICTED: squamosa promoter-binding-like pr...    146   1e-38   
ref|XP_004146058.1|  PREDICTED: squamosa promoter-binding-like pr...    147   2e-38   
ref|XP_009398957.1|  PREDICTED: squamosa promoter-binding protein...    146   2e-38   
ref|XP_011043824.1|  PREDICTED: squamosa promoter-binding protein...    146   2e-38   
ref|XP_003543233.1|  PREDICTED: squamosa promoter-binding protein...    145   3e-38   
ref|XP_010062855.1|  PREDICTED: squamosa promoter-binding-like pr...    145   4e-38   
ref|XP_002317486.2|  hypothetical protein POPTR_0011s11770g             145   7e-38   Populus trichocarpa [western balsam poplar]
ref|XP_008463797.1|  PREDICTED: squamosa promoter-binding protein...    144   8e-38   
gb|ACU24116.1|  unknown                                                 144   1e-37   Glycine max [soybeans]
ref|XP_009620386.1|  PREDICTED: squamosa promoter-binding-like pr...    143   2e-37   
ref|XP_011029504.1|  PREDICTED: squamosa promoter-binding-like pr...    145   2e-37   
ref|XP_011100353.1|  PREDICTED: squamosa promoter-binding protein...    143   2e-37   
ref|XP_010943949.1|  PREDICTED: squamosa promoter-binding protein...    142   5e-37   
gb|EYU42136.1|  hypothetical protein MIMGU_mgv1a014682mg                142   8e-37   
ref|XP_009765576.1|  PREDICTED: squamosa promoter-binding-like pr...    140   2e-36   
ref|XP_004303145.1|  PREDICTED: squamosa promoter-binding-like pr...    140   3e-36   
gb|KHG24779.1|  Squamosa promoter-binding-like protein 5                140   4e-36   
ref|XP_007149482.1|  hypothetical protein PHAVU_005G074000g             140   5e-36   
gb|AIE89804.1|  SQUAMOSA promoter binding protein-like 15               138   6e-36   
gb|KDP45880.1|  hypothetical protein JCGZ_15324                         140   9e-36   
gb|KEH19523.1|  squamosa promoter-binding-like protein                  139   9e-36   
ref|XP_003540473.1|  PREDICTED: squamosa promoter-binding protein 2     138   3e-35   
ref|XP_002533086.1|  Squamosa promoter-binding protein, putative        138   4e-35   Ricinus communis
ref|XP_009382775.1|  PREDICTED: squamosa promoter-binding protein...    137   5e-35   
gb|ADY75712.1|  SPL3-like protein                                       136   6e-35   
gb|AAV51939.1|  SBP transcription factor                                136   6e-35   Gossypium hirsutum [American cotton]
gb|AIL95850.1|  SQUAMOSA promoter binding-like transcription factor     137   8e-35   
emb|CDY25876.1|  BnaA05g14670D                                          136   9e-35   
ref|XP_009602314.1|  PREDICTED: squamosa promoter-binding protein...    135   1e-34   
ref|XP_010675500.1|  PREDICTED: squamosa promoter-binding-like pr...    138   1e-34   
ref|XP_004510032.1|  PREDICTED: squamosa promoter-binding-like pr...    136   1e-34   
ref|XP_009622640.1|  PREDICTED: squamosa promoter-binding protein 1     134   2e-34   
ref|XP_006858268.1|  hypothetical protein AMTR_s00062p00211520          136   2e-34   
ref|XP_010545847.1|  PREDICTED: squamosa promoter-binding-like pr...    136   2e-34   
ref|XP_009760116.1|  PREDICTED: squamosa promoter-binding protein 1     134   2e-34   
ref|XP_010057392.1|  PREDICTED: squamosa promoter-binding-like pr...    134   2e-34   
ref|XP_009763062.1|  PREDICTED: squamosa promoter-binding protein...    134   3e-34   
ref|XP_006295226.1|  hypothetical protein CARUB_v10024311mg             133   3e-34   
ref|XP_004293885.1|  PREDICTED: squamosa promoter-binding protein...    134   3e-34   
emb|CDY27935.1|  BnaCnng05200D                                          134   3e-34   
emb|CDO99517.1|  unnamed protein product                                134   3e-34   
ref|XP_006447264.1|  hypothetical protein CICLE_v10016841mg             135   4e-34   
ref|XP_007021544.1|  Squamosa promoter binding protein-like 3 iso...    137   4e-34   
ref|XP_009340759.1|  PREDICTED: squamosa promoter-binding protein...    135   4e-34   
gb|ADL36826.1|  SPL domain class transcription factor                   135   4e-34   
ref|XP_003560169.2|  PREDICTED: squamosa promoter-binding-like pr...    134   5e-34   
ref|XP_008386198.1|  PREDICTED: squamosa promoter-binding protein 1     135   5e-34   
ref|XP_007021543.1|  Squamosa promoter binding protein-like 3 iso...    136   6e-34   
ref|XP_009397190.1|  PREDICTED: LOW QUALITY PROTEIN: squamosa pro...    133   7e-34   
ref|XP_009144795.1|  PREDICTED: squamosa promoter-binding-like pr...    134   7e-34   
gb|KDO42133.1|  hypothetical protein CISIN_1g029650mg                   134   7e-34   
ref|XP_007025578.1|  Squamosa promoter binding protein-like 3           132   8e-34   
ref|XP_011096328.1|  PREDICTED: squamosa promoter-binding protein 1     132   1e-33   
ref|XP_010479860.1|  PREDICTED: squamosa promoter-binding-like pr...    133   2e-33   
ref|XP_010462181.1|  PREDICTED: squamosa promoter-binding-like pr...    133   2e-33   
ref|XP_007213489.1|  hypothetical protein PRUPE_ppa022739mg             132   2e-33   
ref|XP_008226482.1|  PREDICTED: squamosa promoter-binding-like pr...    132   2e-33   
gb|EYU27990.1|  hypothetical protein MIMGU_mgv1a015969mg                131   2e-33   
sp|Q38741.1|SBP1_ANTMA  RecName: Full=Squamosa promoter-binding p...    131   3e-33   Antirrhinum majus [garden snapdragon]
ref|XP_009356783.1|  PREDICTED: squamosa promoter-binding protein...    132   3e-33   
emb|CAB56584.1|  squamosa promoter binding protein-like 4               132   4e-33   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175723.1|  squamosa promoter binding protein-like 4              132   4e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002891731.1|  hypothetical protein ARALYDRAFT_474435             132   4e-33   
ref|XP_009143829.1|  PREDICTED: squamosa promoter-binding-like pr...    131   5e-33   
ref|XP_010469422.1|  PREDICTED: squamosa promoter-binding-like pr...    130   5e-33   
gb|ADG59812.1|  SQUAMOSA-promoter binding protein 1                     129   5e-33   
dbj|BAJ34525.1|  unnamed protein product                                132   5e-33   
ref|XP_006410530.1|  hypothetical protein EUTSA_v10017406mg             130   6e-33   
ref|XP_006303186.1|  hypothetical protein CARUB_v10010422mg             131   6e-33   
ref|XP_009602313.1|  PREDICTED: squamosa promoter-binding protein...    130   7e-33   
emb|CDP05939.1|  unnamed protein product                                130   7e-33   
ref|XP_009147623.1|  PREDICTED: squamosa promoter-binding-like pr...    131   7e-33   
emb|CDY61210.1|  BnaC06g41420D                                          131   8e-33   
ref|XP_002879473.1|  hypothetical protein ARALYDRAFT_482334             129   9e-33   
ref|XP_010500948.1|  PREDICTED: squamosa promoter-binding-like pr...    131   1e-32   
gb|KDP20990.1|  hypothetical protein JCGZ_21461                         130   1e-32   
gb|ABL89185.1|  squamosa promoter binding protein-like protein          129   1e-32   Capsicum annuum
ref|XP_010413803.1|  PREDICTED: squamosa promoter-binding-like pr...    129   2e-32   
ref|XP_010108163.1|  Squamosa promoter-binding protein 1                130   2e-32   
ref|XP_010542291.1|  PREDICTED: squamosa promoter-binding-like pr...    129   2e-32   
ref|XP_009763061.1|  PREDICTED: squamosa promoter-binding protein...    129   2e-32   
ref|XP_008367070.1|  PREDICTED: squamosa promoter-binding protein...    130   2e-32   
emb|CDY17204.1|  BnaA05g09840D                                          129   2e-32   
ref|XP_009336237.1|  PREDICTED: squamosa promoter-binding-like pr...    129   2e-32   
ref|XP_010487346.1|  PREDICTED: squamosa promoter-binding-like pr...    130   3e-32   
ref|XP_006298553.1|  hypothetical protein CARUB_v10014636mg             130   3e-32   
ref|XP_006392823.1|  hypothetical protein EUTSA_v10011728mg             132   3e-32   
emb|CDY24113.1|  BnaA06g01110D                                          129   4e-32   
gb|AIL95848.1|  SQUAMOSA promoter binding-like transcription factor     128   4e-32   
gb|AGP03028.1|  SQUAMOSA promoter binding protein-like protein 4        129   4e-32   
ref|XP_011043410.1|  PREDICTED: squamosa promoter-binding-like pr...    128   4e-32   
ref|XP_010462180.1|  PREDICTED: squamosa promoter-binding-like pr...    129   5e-32   
ref|XP_009141347.1|  PREDICTED: squamosa promoter-binding-like pr...    128   5e-32   
ref|XP_004248108.1|  PREDICTED: squamosa promoter-binding protein...    127   6e-32   
ref|XP_006451806.1|  hypothetical protein CICLE_v10009879mg             127   6e-32   
ref|XP_010549337.1|  PREDICTED: squamosa promoter-binding-like pr...    128   6e-32   
dbj|BAM15478.1|  SBP-box protein                                        129   7e-32   
gb|AFK42236.1|  unknown                                                 127   8e-32   
gb|KFK38868.1|  spl5                                                    128   9e-32   
ref|XP_010500947.1|  PREDICTED: squamosa promoter-binding-like pr...    128   1e-31   
ref|XP_006406996.1|  hypothetical protein EUTSA_v10021617mg             128   1e-31   
emb|CDY57212.1|  BnaC04g44230D                                          127   1e-31   
ref|XP_007159345.1|  hypothetical protein PHAVU_002G230300g             129   1e-31   
gb|AGR34081.1|  squamosa promoter binding protein-like 4                128   1e-31   
ref|XP_002280052.1|  PREDICTED: squamosa promoter-binding protein...    127   1e-31   Vitis vinifera
gb|AGP03027.1|  SQUAMOSA promoter binding protein-like protein 3        126   1e-31   
ref|XP_009147622.1|  PREDICTED: squamosa promoter-binding-like pr...    128   1e-31   
ref|XP_009596192.1|  PREDICTED: squamosa promoter-binding-like pr...    127   2e-31   
ref|XP_010465475.1|  PREDICTED: squamosa promoter-binding-like pr...    128   2e-31   
emb|CDY50515.1|  BnaC06g10070D                                          127   2e-31   
ref|XP_009132954.1|  PREDICTED: squamosa promoter-binding-like pr...    126   2e-31   
ref|XP_006449372.1|  hypothetical protein CICLE_v10017104mg             126   2e-31   
emb|CAB56772.1|  Squamosa promoter binding protein-like 5               126   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009146272.1|  PREDICTED: squamosa promoter-binding-like pr...    127   2e-31   
emb|CDX98540.1|  BnaC05g38350D                                          127   2e-31   
emb|CDY37684.1|  BnaA04g19840D                                          126   2e-31   
ref|XP_011027797.1|  PREDICTED: squamosa promoter-binding-like pr...    126   3e-31   
ref|XP_010509826.1|  PREDICTED: squamosa promoter-binding-like pr...    126   3e-31   
pdb|1UL4|A  Chain A, Solution Structure Of The Dna-Binding Domain...    124   3e-31   
ref|NP_188145.1|  squamosa promoter-binding-like protein 5              127   4e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008342891.1|  PREDICTED: squamosa promoter-binding protein...    126   4e-31   
dbj|BAM15475.1|  SBP-box protein                                        125   4e-31   
ref|XP_010316764.1|  PREDICTED: squamosa promoter-binding protein...    125   4e-31   
emb|CDX79544.1|  BnaC03g18800D                                          127   5e-31   
ref|XP_010502692.1|  PREDICTED: squamosa promoter-binding-like pr...    126   5e-31   
ref|XP_006582910.1|  PREDICTED: uncharacterized protein LOC100789...    125   5e-31   
gb|KHN15472.1|  Squamosa promoter-binding protein 1                     125   5e-31   
gb|KEH38697.1|  squamosa promoter-binding-like protein                  126   6e-31   
gb|ABK23519.1|  unknown                                                 127   6e-31   Picea sitchensis
ref|XP_006467766.1|  PREDICTED: squamosa promoter-binding-like pr...    127   6e-31   
ref|NP_565771.1|  squamosa promoter-binding-like protein 3              124   7e-31   Arabidopsis thaliana [mouse-ear cress]
gb|KDO77620.1|  hypothetical protein CISIN_1g032310mg                   125   7e-31   
emb|CAB94233.1|  Squamosa promoter binding protein-like 3               124   8e-31   Arabidopsis thaliana [mouse-ear cress]
gb|AAM67271.1|  putative squamosa-promoter binding protein              124   9e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006361029.1|  PREDICTED: squamosa promoter-binding protein...    124   9e-31   
ref|XP_010106183.1|  hypothetical protein L484_009607                   125   1e-30   
ref|XP_003541730.1|  PREDICTED: squamosa promoter-binding protein...    124   1e-30   
ref|XP_003547153.1|  PREDICTED: squamosa promoter-binding protein...    124   1e-30   
ref|XP_006347010.1|  PREDICTED: squamosa promoter-binding protein...    124   1e-30   
ref|XP_006828742.1|  hypothetical protein AMTR_s00001p00058370          125   1e-30   
ref|NP_001236309.1|  uncharacterized protein LOC100527199               124   2e-30   
gb|KHN09987.1|  Squamosa promoter-binding protein 1                     124   2e-30   
ref|XP_004488737.1|  PREDICTED: squamosa promoter-binding-like pr...    124   2e-30   
ref|XP_002509450.1|  Squamosa promoter-binding protein, putative        124   2e-30   Ricinus communis
ref|XP_009788885.1|  PREDICTED: squamosa promoter-binding-like pr...    124   2e-30   
ref|XP_004488736.1|  PREDICTED: squamosa promoter-binding-like pr...    124   2e-30   
ref|XP_002305783.2|  hypothetical protein POPTR_0004s04630g             124   2e-30   Populus trichocarpa [western balsam poplar]
ref|XP_008439842.1|  PREDICTED: squamosa promoter-binding protein 1     123   3e-30   
ref|XP_004134953.1|  PREDICTED: squamosa promoter-binding protein...    123   3e-30   
ref|XP_007148144.1|  hypothetical protein PHAVU_006G183900g             122   4e-30   
gb|KHN36843.1|  Squamosa promoter-binding-like protein 12               124   4e-30   
ref|XP_004164023.1|  PREDICTED: squamosa promoter-binding protein...    122   5e-30   
ref|XP_004505078.1|  PREDICTED: squamosa promoter-binding protein...    122   6e-30   
ref|XP_004146615.1|  PREDICTED: squamosa promoter-binding protein...    122   6e-30   
gb|KGN64693.1|  hypothetical protein Csa_1G074980                       123   6e-30   
ref|XP_009115660.1|  PREDICTED: squamosa promoter-binding-like pr...    123   6e-30   
emb|CDY20128.1|  BnaA01g28740D                                          123   6e-30   
gb|AHC08502.1|  SBP-box transcription factor                            123   7e-30   
ref|XP_008383704.1|  PREDICTED: squamosa promoter-binding-like pr...    122   9e-30   
ref|XP_004957796.1|  PREDICTED: squamosa promoter-binding-like pr...    124   9e-30   
ref|XP_004140489.1|  PREDICTED: squamosa promoter-binding-like pr...    126   9e-30   
ref|XP_008442764.1|  PREDICTED: squamosa promoter-binding-like pr...    122   1e-29   
ref|XP_008458127.1|  PREDICTED: squamosa promoter-binding-like pr...    125   1e-29   
ref|XP_009352877.1|  PREDICTED: squamosa promoter-binding-like pr...    122   1e-29   
gb|EAZ39937.1|  hypothetical protein OsJ_24374                          122   2e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006445349.1|  hypothetical protein CICLE_v10021106mg             124   3e-29   
ref|XP_007212177.1|  hypothetical protein PRUPE_ppa012607mg             121   3e-29   
ref|XP_011017436.1|  PREDICTED: squamosa promoter-binding-like pr...    125   3e-29   
ref|XP_010913682.1|  PREDICTED: squamosa promoter-binding-like pr...    126   3e-29   
gb|KHN34486.1|  Squamosa promoter-binding-like protein 8                122   3e-29   
ref|XP_009398983.1|  PREDICTED: squamosa promoter-binding-like pr...    125   3e-29   
ref|NP_001175217.1|  Os07g0505200                                       122   4e-29   
ref|XP_010913684.1|  PREDICTED: squamosa promoter-binding-like pr...    125   4e-29   
ref|XP_004163755.1|  PREDICTED: squamosa promoter-binding-like pr...    124   4e-29   
ref|XP_006845685.1|  hypothetical protein AMTR_s00019p00235390          123   4e-29   
ref|XP_008781929.1|  PREDICTED: squamosa promoter-binding-like pr...    126   4e-29   
ref|XP_006445348.1|  hypothetical protein CICLE_v10021106mg             125   4e-29   
emb|CDY32310.1|  BnaC01g36290D                                          121   4e-29   
ref|XP_008225122.1|  PREDICTED: squamosa promoter-binding-like pr...    120   4e-29   
emb|CAD90156.1|  squamosa promoter binding like-protein                 119   4e-29   Betula pendula [white birch]
ref|XP_007140981.1|  hypothetical protein PHAVU_008G157200g             124   4e-29   
ref|XP_006445347.1|  hypothetical protein CICLE_v10021106mg             124   5e-29   
ref|XP_009118853.1|  PREDICTED: squamosa promoter-binding-like pr...    125   5e-29   
ref|XP_010480322.1|  PREDICTED: squamosa promoter-binding-like pr...    122   5e-29   
emb|CDY38043.1|  BnaCnng09040D                                          125   5e-29   
ref|XP_009408821.1|  PREDICTED: squamosa promoter-binding-like pr...    125   5e-29   
ref|XP_003593617.1|  Squamosa promoter binding-like protein             119   6e-29   
ref|XP_010496481.1|  PREDICTED: squamosa promoter-binding-like pr...    121   6e-29   
ref|XP_010692128.1|  PREDICTED: squamosa promoter-binding-like pr...    123   6e-29   
ref|XP_002892031.1|  hypothetical protein ARALYDRAFT_470069             124   6e-29   
gb|KDP28816.1|  hypothetical protein JCGZ_14587                         124   6e-29   
ref|XP_004229775.1|  PREDICTED: squamosa promoter-binding-like pr...    124   6e-29   
ref|XP_006375255.1|  hypothetical protein POPTR_0014s05680g             124   6e-29   
ref|XP_003626693.1|  Squamosa promoter binding protein                  124   7e-29   
ref|XP_011033165.1|  PREDICTED: squamosa promoter-binding-like pr...    124   7e-29   
ref|XP_004510110.1|  PREDICTED: squamosa promoter-binding-like pr...    123   7e-29   
ref|XP_002301256.2|  hypothetical protein POPTR_0002s14320g             124   8e-29   Populus trichocarpa [western balsam poplar]
ref|XP_011090046.1|  PREDICTED: squamosa promoter-binding-like pr...    124   8e-29   
dbj|BAC42797.1|  putative squamosa promoter binding protein 8 SPL8      124   9e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006348003.1|  PREDICTED: squamosa promoter-binding-like pr...    123   9e-29   
ref|NP_683267.1|  squamosa promoter binding protein-like 8              124   1e-28   Arabidopsis thaliana [mouse-ear cress]
gb|AFC17960.1|  squamosa promoter binding protein-like 8                123   1e-28   
gb|AGI62063.1|  SQUAMOSA promoter-binding-like 15                       124   1e-28   
ref|XP_006361511.1|  PREDICTED: squamosa promoter-binding-like pr...    123   1e-28   
ref|XP_003530168.1|  PREDICTED: squamosa promoter-binding-like pr...    124   1e-28   
gb|AIE89801.1|  SQUAMOSA promoter binding protein-like 12               123   1e-28   
ref|XP_006305139.1|  hypothetical protein CARUB_v10009506mg             124   1e-28   
ref|XP_006361510.1|  PREDICTED: squamosa promoter-binding-like pr...    123   1e-28   
ref|XP_008232622.1|  PREDICTED: squamosa promoter-binding-like pr...    122   1e-28   
gb|AEB71564.1|  squamosa promoter binding protein-like protein          123   1e-28   
ref|XP_010554861.1|  PREDICTED: squamosa promoter-binding-like pr...    124   1e-28   
ref|XP_007134545.1|  hypothetical protein PHAVU_010G056000g             123   1e-28   
ref|XP_004510109.1|  PREDICTED: squamosa promoter-binding-like pr...    123   1e-28   
ref|XP_004485802.1|  PREDICTED: squamosa promoter-binding-like pr...    119   1e-28   
ref|XP_009391170.1|  PREDICTED: squamosa promoter-binding-like pr...    123   1e-28   
ref|XP_010258891.1|  PREDICTED: squamosa promoter-binding-like pr...    123   1e-28   
ref|XP_002511636.1|  LIGULELESS1 protein, putative                      123   1e-28   Ricinus communis
ref|XP_009793968.1|  PREDICTED: squamosa promoter-binding-like pr...    122   2e-28   
ref|XP_009389111.1|  PREDICTED: squamosa promoter-binding-like pr...    123   2e-28   
ref|XP_004248549.1|  PREDICTED: squamosa promoter-binding-like pr...    122   2e-28   
ref|XP_010540239.1|  PREDICTED: squamosa promoter-binding-like pr...    122   2e-28   
ref|XP_003521087.1|  PREDICTED: squamosa promoter-binding-like pr...    123   2e-28   
ref|XP_006838197.1|  hypothetical protein AMTR_s00106p00142470          122   2e-28   
ref|XP_007046540.1|  Squamosa promoter-binding protein-like 12          120   2e-28   
dbj|BAM15476.1|  SBP-box protein                                        118   2e-28   
ref|XP_009607851.1|  PREDICTED: squamosa promoter-binding-like pr...    122   2e-28   
gb|AGP03031.1|  SQUAMOSA promoter binding protein-like protein 8        123   2e-28   
ref|XP_007052207.1|  Squamosa promoter binding protein-like 8           123   2e-28   
ref|XP_010655440.1|  PREDICTED: squamosa promoter-binding protein...    118   2e-28   
ref|XP_006348264.1|  PREDICTED: squamosa promoter-binding-like pr...    117   3e-28   
gb|EPS64133.1|  hypothetical protein M569_10651                         117   3e-28   
emb|CDX90071.1|  BnaA10g00110D                                          122   3e-28   
ref|XP_010089258.1|  Squamosa promoter-binding-like protein 8           123   3e-28   
ref|XP_009398934.1|  PREDICTED: squamosa promoter-binding-like pr...    122   3e-28   
ref|XP_009593420.1|  PREDICTED: squamosa promoter-binding-like pr...    120   3e-28   
ref|XP_009408055.1|  PREDICTED: squamosa promoter-binding-like pr...    122   3e-28   
ref|XP_002462902.1|  hypothetical protein SORBIDRAFT_02g034180          120   3e-28   Sorghum bicolor [broomcorn]
ref|XP_009119750.1|  PREDICTED: squamosa promoter-binding-like pr...    122   3e-28   
gb|EYU31932.1|  hypothetical protein MIMGU_mgv1a009702mg                122   3e-28   
gb|EPS59677.1|  hypothetical protein M569_15126                         115   3e-28   
ref|XP_011082696.1|  PREDICTED: squamosa promoter-binding protein...    119   4e-28   
ref|XP_007162307.1|  hypothetical protein PHAVU_001G141000g             122   4e-28   
ref|XP_008775519.1|  PREDICTED: squamosa promoter-binding-like pr...    123   4e-28   
ref|XP_007218335.1|  hypothetical protein PRUPE_ppa008560mg             122   4e-28   
ref|XP_010928678.1|  PREDICTED: squamosa promoter-binding-like pr...    123   5e-28   
ref|XP_010934135.1|  PREDICTED: squamosa promoter-binding-like pr...    122   5e-28   
ref|XP_008240879.1|  PREDICTED: squamosa promoter-binding-like pr...    122   5e-28   
gb|EYU31933.1|  hypothetical protein MIMGU_mgv1a020120mg                122   6e-28   
ref|XP_003553428.1|  PREDICTED: squamosa promoter-binding-like pr...    122   7e-28   
ref|XP_009612109.1|  PREDICTED: squamosa promoter-binding-like pr...    122   7e-28   
gb|EPS73836.1|  hypothetical protein M569_00920                         121   7e-28   
ref|XP_007205341.1|  hypothetical protein PRUPE_ppa007056mg             122   7e-28   
emb|CDP09489.1|  unnamed protein product                                121   7e-28   
ref|XP_008802805.1|  PREDICTED: squamosa promoter-binding-like pr...    122   7e-28   
emb|CAB56568.1|  squamosa promoter binding protein-homologue 3          121   7e-28   
ref|XP_003520534.1|  PREDICTED: squamosa promoter-binding-like pr...    122   8e-28   
ref|NP_001267898.1|  promoter-binding protein SPL9                      122   8e-28   
dbj|BAN89457.1|  squamosa promoter binding protein-like 1               122   8e-28   
gb|ABM67301.1|  SBP-domain protein 7                                    124   8e-28   
ref|XP_003633906.1|  PREDICTED: squamosa promoter-binding-like pr...    120   9e-28   
emb|CBI30036.3|  unnamed protein product                                121   9e-28   
gb|AIL95857.1|  SQUAMOSA promoter binding-like transcription factor     117   1e-27   
ref|XP_010672689.1|  PREDICTED: squamosa promoter-binding-like pr...    121   1e-27   
gb|KDO50160.1|  hypothetical protein CISIN_1g046416mg                   122   1e-27   
ref|XP_006429837.1|  hypothetical protein CICLE_v10011938mg             122   1e-27   
gb|EMT19900.1|  Squamosa promoter-binding-like protein 17               121   1e-27   
gb|AFK36644.1|  unknown                                                 116   1e-27   
ref|XP_009792000.1|  PREDICTED: squamosa promoter-binding-like pr...    121   1e-27   
gb|AHW57562.1|  squamosa promoter-binding-like protein 17               121   1e-27   
ref|XP_006429836.1|  hypothetical protein CICLE_v10011938mg             121   1e-27   
gb|AIE89797.1|  SQUAMOSA promoter binding protein-like 8                120   1e-27   
ref|XP_006492888.1|  PREDICTED: squamosa promoter-binding-like pr...    121   1e-27   
gb|ACL51015.1|  squamosa promoter-binding protein                       121   1e-27   
emb|CDP20025.1|  unnamed protein product                                121   1e-27   
emb|CAB56569.1|  squamosa promoter binding protein-homologue 4          119   1e-27   
ref|XP_010919591.1|  PREDICTED: squamosa promoter-binding-like pr...    121   1e-27   
ref|XP_010264333.1|  PREDICTED: squamosa promoter-binding-like pr...    120   1e-27   
ref|XP_009782498.1|  PREDICTED: squamosa promoter-binding-like pr...    120   1e-27   
ref|XP_006653653.1|  PREDICTED: squamosa promoter-binding-like pr...    119   1e-27   
gb|KCW73147.1|  hypothetical protein EUGRSUZ_E01600                     120   2e-27   
dbj|BAM15477.1|  SBP-box protein                                        115   2e-27   
ref|XP_004308485.1|  PREDICTED: squamosa promoter-binding-like pr...    120   2e-27   
gb|ADL36825.1|  SPL domain class transcription factor                   116   2e-27   
ref|XP_009782499.1|  PREDICTED: squamosa promoter-binding-like pr...    120   2e-27   
gb|EPS70852.1|  squamosa promoter-binding protein 2                     114   2e-27   
tpg|DAA62834.1|  TPA: squamosa promoter-binding protein-like (SBP...    117   2e-27   
ref|XP_010056422.1|  PREDICTED: squamosa promoter-binding-like pr...    120   2e-27   
ref|XP_004304380.1|  PREDICTED: squamosa promoter-binding-like pr...    120   2e-27   
ref|XP_008375792.1|  PREDICTED: squamosa promoter-binding-like pr...    120   2e-27   
ref|XP_010102560.1|  Squamosa promoter-binding-like protein 15          120   2e-27   
ref|XP_008392088.1|  PREDICTED: squamosa promoter-binding-like pr...    120   2e-27   
ref|XP_009373190.1|  PREDICTED: squamosa promoter-binding-like pr...    120   2e-27   
gb|AIS93133.1|  squamosa promoter binding protein                       120   3e-27   
emb|CAB56570.1|  squamosa promoter binding protein-homologue 5          119   3e-27   
ref|XP_004965676.1|  PREDICTED: squamosa promoter-binding-like pr...    120   3e-27   
ref|XP_007028954.1|  Promoter-binding protein SPL9                      120   3e-27   
emb|CBI16614.3|  unnamed protein product                                120   3e-27   
ref|XP_001779155.1|  predicted protein                                  124   3e-27   
ref|XP_003551421.1|  PREDICTED: squamosa promoter-binding-like pr...    120   3e-27   
gb|EMS47142.1|  Squamosa promoter-binding-like protein 10               120   3e-27   
ref|XP_009376108.1|  PREDICTED: squamosa promoter-binding-like pr...    120   3e-27   
ref|XP_004244240.1|  PREDICTED: squamosa promoter-binding-like pr...    114   3e-27   
ref|XP_008796149.1|  PREDICTED: squamosa promoter-binding-like pr...    120   3e-27   
gb|ABM67302.1|  SBP-domain protein 9                                    123   3e-27   
gb|AFW66312.1|  squamosa promoter-binding protein-like (SBP domai...    120   3e-27   
ref|XP_006656320.1|  PREDICTED: squamosa promoter-binding-like pr...    120   3e-27   
gb|AFW66313.1|  squamosa promoter-binding protein-like (SBP domai...    120   3e-27   
ref|NP_001132280.1|  squamosa promoter-binding protein-like (SBP ...    120   3e-27   
gb|AEW23126.1|  SQUAMOSA promoter binding protein-like protein          120   3e-27   
ref|NP_001053497.1|  Os04g0551500                                       120   3e-27   
gb|AAC34221.1|  putative squamosa-promoter binding protein              117   4e-27   
ref|XP_002532343.1|  LIGULELESS1 protein, putative                      119   4e-27   
ref|XP_004161490.1|  PREDICTED: squamosa promoter-binding-like pr...    120   4e-27   
gb|EYU39920.1|  hypothetical protein MIMGU_mgv1a009499mg                119   4e-27   
ref|XP_004136576.1|  PREDICTED: squamosa promoter-binding-like pr...    120   4e-27   
gb|ACG32386.1|  hypothetical protein                                    120   4e-27   
ref|XP_001782674.1|  predicted protein                                  122   4e-27   
ref|XP_010057993.1|  PREDICTED: squamosa promoter-binding-like pr...    120   4e-27   
emb|CAI91303.1|  squamosa promoter binding protein 1                    122   4e-27   
ref|XP_003625236.1|  Squamosa promoter-binding-like protein             119   4e-27   
gb|KHN31114.1|  Squamosa promoter-binding-like protein 9                120   4e-27   
gb|AHW57571.1|  squamosa promoter-binding-like protein 22               120   4e-27   
sp|Q01JD1.1|SPL7_ORYSI  RecName: Full=Squamosa promoter-binding-l...    119   4e-27   
ref|XP_010036477.1|  PREDICTED: squamosa promoter-binding-like pr...    120   4e-27   
ref|XP_011075166.1|  PREDICTED: squamosa promoter-binding-like pr...    119   5e-27   
ref|XP_006850048.1|  hypothetical protein AMTR_s00022p00198330          119   5e-27   
ref|XP_011090056.1|  PREDICTED: squamosa promoter-binding-like pr...    120   5e-27   
ref|XP_011090065.1|  PREDICTED: squamosa promoter-binding-like pr...    120   5e-27   
gb|AHW57563.1|  squamosa promoter-binding-like protein 20               120   5e-27   
dbj|BAK07638.1|  predicted protein                                      120   5e-27   
ref|NP_001150236.1|  LOC100283866                                       115   5e-27   
ref|XP_008443072.1|  PREDICTED: squamosa promoter-binding-like pr...    119   5e-27   
ref|XP_002511638.1|  Squamosa promoter-binding protein, putative        117   6e-27   
ref|XP_008240953.1|  PREDICTED: LOW QUALITY PROTEIN: squamosa pro...    119   6e-27   
ref|XP_003560391.1|  PREDICTED: squamosa promoter-binding-like pr...    120   6e-27   
ref|XP_010265853.1|  PREDICTED: squamosa promoter-binding-like pr...    119   6e-27   
gb|ABN08632.1|  SBP                                                     119   6e-27   
ref|XP_008371395.1|  PREDICTED: squamosa promoter-binding-like pr...    115   7e-27   
ref|XP_010256977.1|  PREDICTED: squamosa promoter-binding-like pr...    123   7e-27   
sp|Q38740.1|SBP2_ANTMA  RecName: Full=Squamosa promoter-binding p...    115   7e-27   
ref|XP_007203426.1|  hypothetical protein PRUPE_ppa021582mg             119   7e-27   
ref|XP_003538904.1|  PREDICTED: squamosa promoter-binding-like pr...    114   7e-27   
ref|NP_001105115.1|  SBP-domain protein2                                119   8e-27   
ref|XP_010059299.1|  PREDICTED: TMV resistance protein N-like           122   8e-27   
gb|KHG28478.1|  Squamosa promoter-binding-like protein 9                119   8e-27   
emb|CAI91313.1|  squamosa promoter binding protein 2                    117   9e-27   
gb|AHC08503.1|  SBP-box transcription factor                            119   9e-27   
gb|ADL36823.1|  SPL domain class transcription factor                   119   9e-27   
ref|XP_009369782.1|  PREDICTED: squamosa promoter-binding-like pr...    119   9e-27   
ref|XP_010257430.1|  PREDICTED: squamosa promoter-binding-like pr...    119   9e-27   
ref|XP_011042488.1|  PREDICTED: squamosa promoter-binding-like pr...    119   1e-26   
ref|NP_177077.3|  squamosa promoter-binding-like protein 6              119   1e-26   
gb|AAK43931.1|AF370612_1  similar to squamosa-promoter binding pr...    119   1e-26   
ref|XP_006362236.1|  PREDICTED: squamosa promoter-binding-like pr...    119   1e-26   
ref|XP_001781857.1|  predicted protein                                  111   1e-26   
gb|AIL95849.1|  SQUAMOSA promoter binding-like transcription factor     119   1e-26   
gb|AFW76141.1|  squamosa promoter-binding protein-like (SBP domai...    119   1e-26   
gb|AAF27058.1|AC008262_7  F4N2.13                                       119   1e-26   
gb|AFW76142.1|  squamosa promoter-binding protein-like (SBP domai...    119   1e-26   
ref|NP_001105116.1|  SBP-domain protein3                                119   1e-26   
gb|AHW57569.1|  squamosa promoter-binding-like protein 23               114   1e-26   
ref|XP_004308484.1|  PREDICTED: squamosa promoter-binding-like pr...    119   1e-26   
ref|XP_009415427.1|  PREDICTED: squamosa promoter-binding-like pr...    118   1e-26   
ref|XP_011070914.1|  PREDICTED: squamosa promoter-binding-like pr...    118   1e-26   
ref|XP_009415426.1|  PREDICTED: squamosa promoter-binding-like pr...    118   1e-26   
gb|KEH22349.1|  squamosa promoter-binding-like protein                  117   1e-26   
ref|XP_002451645.1|  hypothetical protein SORBIDRAFT_04g005180          119   1e-26   
ref|XP_001769751.1|  predicted protein                                  121   1e-26   
gb|KHG18515.1|  Squamosa promoter-binding-like protein 7                118   1e-26   
gb|KHG23697.1|  Squamosa promoter-binding-like protein 9                118   2e-26   
gb|AGP03025.1|  SQUAMOSA promoter binding protein-like protein 1        121   2e-26   
ref|XP_004249164.1|  PREDICTED: squamosa promoter-binding-like pr...    118   2e-26   
ref|XP_010507933.1|  PREDICTED: squamosa promoter-binding-like pr...    121   2e-26   
gb|AHW57567.1|  squamosa promoter-binding-like protein 21               119   2e-26   
ref|XP_009397654.1|  PREDICTED: squamosa promoter-binding-like pr...    117   2e-26   
ref|XP_002446904.1|  hypothetical protein SORBIDRAFT_06g024630          118   2e-26   
ref|XP_010649307.1|  PREDICTED: squamosa promoter-binding-like pr...    115   2e-26   
ref|XP_010928443.1|  PREDICTED: LOW QUALITY PROTEIN: squamosa pro...    118   2e-26   
ref|XP_006300490.1|  hypothetical protein CARUB_v10020369mg             118   2e-26   
gb|EMT11741.1|  Squamosa promoter-binding-like protein 10               116   2e-26   
ref|XP_002980130.1|  hypothetical protein SELMODRAFT_17777              111   2e-26   
ref|XP_002437398.1|  hypothetical protein SORBIDRAFT_10g026200          118   2e-26   
ref|XP_002880278.1|  hypothetical protein ARALYDRAFT_483883             121   2e-26   
ref|XP_006397898.1|  hypothetical protein EUTSA_v10001295mg             121   2e-26   
gb|AIE89795.1|  SQUAMOSA promoter binding protein-like 6                117   2e-26   
ref|XP_010053955.1|  PREDICTED: squamosa promoter-binding-like pr...    117   2e-26   
ref|XP_006397897.1|  hypothetical protein EUTSA_v10001295mg             121   2e-26   
ref|XP_009124485.1|  PREDICTED: squamosa promoter-binding-like pr...    121   2e-26   
ref|XP_001761751.1|  predicted protein                                  120   2e-26   
emb|CDX80078.1|  BnaA05g00780D                                          121   2e-26   
gb|AIL95855.1|  SQUAMOSA promoter binding-like transcription factor     117   2e-26   
ref|XP_009124484.1|  PREDICTED: squamosa promoter-binding-like pr...    121   2e-26   
gb|KHN01962.1|  Squamosa promoter-binding-like protein 8                115   2e-26   
ref|XP_004971091.1|  PREDICTED: squamosa promoter-binding-like pr...    118   2e-26   
ref|XP_004981153.1|  PREDICTED: squamosa promoter-binding-like pr...    121   2e-26   
gb|AIL95869.1|  SQUAMOSA promoter binding-like transcription factor     118   2e-26   
dbj|BAM15479.1|  SBP-box protein                                        117   2e-26   
ref|XP_006375256.1|  hypothetical protein POPTR_0014s05690g             118   2e-26   
ref|XP_002991886.1|  hypothetical protein SELMODRAFT_7674               110   2e-26   
ref|XP_002302512.1|  hypothetical protein POPTR_0002s14330g             118   2e-26   
gb|AIL95854.1|  SQUAMOSA promoter binding-like transcription factor     117   2e-26   
ref|XP_011078845.1|  PREDICTED: squamosa promoter-binding-like pr...    117   2e-26   
dbj|BAJ94319.1|  predicted protein                                      117   2e-26   
ref|XP_002887224.1|  hypothetical protein ARALYDRAFT_339154             118   3e-26   
ref|XP_009342532.1|  PREDICTED: squamosa promoter-binding-like pr...    114   3e-26   
ref|XP_010506733.1|  PREDICTED: squamosa promoter-binding-like pr...    120   3e-26   
ref|XP_004493567.1|  PREDICTED: squamosa promoter-binding-like pr...    117   3e-26   
gb|EAY95089.1|  hypothetical protein OsI_16903                          117   3e-26   
ref|XP_008795752.1|  PREDICTED: squamosa promoter-binding-like pr...    117   3e-26   
ref|XP_010469241.1|  PREDICTED: squamosa promoter-binding-like pr...    120   3e-26   
gb|ABM67305.1|  SBP-domain protein 13                                   120   3e-26   
ref|XP_008795751.1|  PREDICTED: squamosa promoter-binding-like pr...    117   3e-26   
gb|KEH41686.1|  squamosa promoter-binding-like protein                  117   3e-26   
ref|XP_001775628.1|  predicted protein                                  120   3e-26   
tpg|DAA35605.1|  TPA: liguleless1                                       117   3e-26   
ref|XP_002878311.1|  hypothetical protein ARALYDRAFT_907523             120   3e-26   
ref|XP_002447251.1|  hypothetical protein SORBIDRAFT_06g031290          117   3e-26   
gb|AIE89800.1|  SQUAMOSA promoter binding protein-like 11               117   3e-26   
ref|XP_010559216.1|  PREDICTED: squamosa promoter-binding-like pr...    120   3e-26   
ref|XP_009625592.1|  PREDICTED: squamosa promoter-binding-like pr...    117   3e-26   
ref|XP_008666603.1|  PREDICTED: uncharacterized protein LOC100272...    120   3e-26   
gb|EAZ32258.1|  hypothetical protein OsJ_16462                          117   4e-26   
ref|XP_004513942.1|  PREDICTED: squamosa promoter-binding-like pr...    116   4e-26   
ref|XP_010913913.1|  PREDICTED: squamosa promoter-binding-like pr...    117   4e-26   
ref|XP_009625590.1|  PREDICTED: squamosa promoter-binding-like pr...    117   4e-26   
gb|ABO80946.1|  SBP                                                     115   4e-26   
ref|XP_011017438.1|  PREDICTED: squamosa promoter-binding-like pr...    117   4e-26   
gb|EAY95872.1|  hypothetical protein OsI_17738                          116   4e-26   
ref|XP_007052205.1|  Squamosa promoter-binding-like protein 10, p...    117   4e-26   
gb|KHG07983.1|  Squamosa promoter-binding-like protein 8                116   4e-26   
ref|XP_006391054.1|  hypothetical protein EUTSA_v10018638mg             117   4e-26   
ref|XP_009418241.1|  PREDICTED: squamosa promoter-binding-like pr...    117   4e-26   
ref|XP_009625591.1|  PREDICTED: squamosa promoter-binding-like pr...    117   4e-26   
ref|XP_008796104.1|  PREDICTED: squamosa promoter-binding-like pr...    117   4e-26   
ref|NP_001105543.1|  protein LIGULELESS 1                               117   4e-26   
dbj|BAK05650.1|  predicted protein                                      120   4e-26   
emb|CBI16615.3|  unnamed protein product                                117   4e-26   
ref|XP_009587225.1|  PREDICTED: squamosa promoter-binding-like pr...    117   4e-26   
gb|EMS48286.1|  Squamosa promoter-binding-like protein 8                115   4e-26   
ref|XP_010661348.1|  PREDICTED: squamosa promoter-binding-like pr...    117   5e-26   
ref|XP_010559169.1|  PREDICTED: squamosa promoter-binding-like pr...    120   5e-26   
gb|ABM67300.1|  SBP-domain protein 6                                    119   5e-26   
ref|XP_004957197.1|  PREDICTED: squamosa promoter-binding-like pr...    117   5e-26   
gb|EYU44963.1|  hypothetical protein MIMGU_mgv1a015863mg                111   5e-26   
ref|XP_006418484.1|  hypothetical protein EUTSA_v10008083mg             112   5e-26   
ref|XP_010661347.1|  PREDICTED: squamosa promoter-binding-like pr...    117   5e-26   
emb|CDY50300.1|  BnaA02g14580D                                          116   5e-26   
ref|XP_009776998.1|  PREDICTED: squamosa promoter-binding-like pr...    116   5e-26   
ref|XP_010524403.1|  PREDICTED: squamosa promoter-binding-like pr...    116   5e-26   
ref|XP_011033246.1|  PREDICTED: squamosa promoter-binding-like pr...    117   5e-26   
dbj|BAK01070.1|  predicted protein                                      119   5e-26   
ref|XP_010559171.1|  PREDICTED: squamosa promoter-binding-like pr...    120   5e-26   
ref|NP_850468.1|  squamosa promoter-binding-like protein 1              120   5e-26   
gb|EMT03959.1|  Squamosa promoter-binding-like protein 7                113   5e-26   
ref|XP_002962307.1|  hypothetical protein SELMODRAFT_28626              109   5e-26   
ref|NP_001054119.1|  Os04g0656500                                       117   5e-26   
gb|EMS67887.1|  Squamosa promoter-binding-like protein 13               111   5e-26   
ref|NP_191562.1|  squamosa promoter-binding-like protein 12             120   5e-26   
dbj|BAM78642.1|  squamosa promoter-binding-like protein 8               117   5e-26   
ref|XP_001761750.1|  predicted protein                                  119   5e-26   
ref|XP_010678887.1|  PREDICTED: squamosa promoter-binding-like pr...    120   6e-26   



>ref|XP_002275728.1| PREDICTED: squamosa promoter-binding protein 1 isoform X2 [Vitis 
vinifera]
 emb|CBI21879.3| unnamed protein product [Vitis vinifera]
Length=169

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 110/136 (81%), Gaps = 11/136 (8%)
 Frame = -2

Query  707  PVMRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFD  528
              MR CQAE+C+ADL +AKQYHRRHKVCE HAKAQVVVV G+RQRFCQQCSRFHEL EFD
Sbjct  45   AAMRCCQAERCTADLTDAKQYHRRHKVCEHHAKAQVVVVGGIRQRFCQQCSRFHELSEFD  104

Query  527  EAKRSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRI  348
            EAKRSCRRRLAGHNERRRK+SA  +E S            +   LK+I VCGQVDD+GRI
Sbjct  105  EAKRSCRRRLAGHNERRRKNSADHAEGSSR----------KGTQLKEI-VCGQVDDRGRI  153

Query  347  QMSIQENSSFKHFQIR  300
            Q++IQEN+++KHFQIR
Sbjct  154  QITIQENAAYKHFQIR  169



>ref|XP_009626190.1| PREDICTED: squamosa promoter-binding-like protein 4 [Nicotiana 
tomentosiformis]
Length=181

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 110/137 (80%), Gaps = 2/137 (1%)
 Frame = -2

Query  707  PVMRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFD  528
               R CQAEKCSADL +AKQYHRRHKVCE+HAKAQVVVVAG RQRFCQQCSRFHEL EFD
Sbjct  46   TTQRCCQAEKCSADLSDAKQYHRRHKVCEYHAKAQVVVVAGFRQRFCQQCSRFHELTEFD  105

Query  527  EAKRSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDIN-VCGQVDDKGR  351
            E+KRSCRRRLAGHNERRRK S+ S+  S      ++   T     KDIN +CGQV+DKGR
Sbjct  106  ESKRSCRRRLAGHNERRRK-SSSSTAESHNIAESSSRKGTVQLNNKDINMICGQVNDKGR  164

Query  350  IQMSIQENSSFKHFQIR  300
            IQ+SIQENS+FK+F +R
Sbjct  165  IQISIQENSTFKNFHLR  181



>ref|XP_009781601.1| PREDICTED: squamosa promoter-binding-like protein 4 [Nicotiana 
sylvestris]
Length=182

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 110/134 (82%), Gaps = 1/134 (1%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R CQAEKCSADL +AKQYHRRHKVCE+HAKAQVVVVAGLRQRFCQQCSRFHEL EFDE+K
Sbjct  49   RCCQAEKCSADLSDAKQYHRRHKVCEYHAKAQVVVVAGLRQRFCQQCSRFHELTEFDESK  108

Query  518  RSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDIN-VCGQVDDKGRIQM  342
            RSCRRRLAGHNERRRK S+ SS +       ++   T     KDIN +CGQV++KGRIQ+
Sbjct  109  RSCRRRLAGHNERRRKISSSSSAAESQIAESSSRKGTVQLNNKDINMMCGQVNEKGRIQI  168

Query  341  SIQENSSFKHFQIR  300
            SIQENS+FK+F  R
Sbjct  169  SIQENSTFKNFHPR  182



>emb|CDP14818.1| unnamed protein product [Coffea canephora]
Length=211

 Score =   180 bits (456),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 112/134 (84%), Gaps = 7/134 (5%)
 Frame = -2

Query  701  MRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEA  522
            M+ CQAEKC+ADL +AKQYHRRH+VCE HAKAQVV+V G+RQRFCQQCSRFHEL EFDEA
Sbjct  85   MKCCQAEKCTADLSDAKQYHRRHRVCEHHAKAQVVIVGGIRQRFCQQCSRFHELAEFDEA  144

Query  521  KRSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQM  342
            KRSCRRRLAGHNERRRK+SA S+++  ++             +K+I VCGQVDD+GRIQ+
Sbjct  145  KRSCRRRLAGHNERRRKNSADSTQAEGSSRKGT------GSQMKEI-VCGQVDDRGRIQI  197

Query  341  SIQENSSFKHFQIR  300
            ++QEN+++KHFQIR
Sbjct  198  TVQENATYKHFQIR  211



>gb|AGR34080.1| squamosa promoter binding protein-like 3, partial [Pogostemon 
cablin]
Length=175

 Score =   179 bits (453),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 106/134 (79%), Gaps = 7/134 (5%)
 Frame = -2

Query  704  VMRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDE  525
            +M+SCQAEKCSADL +AK YHRRHKVCE HAKAQVVVVAG RQRFCQQCSRFHEL EFDE
Sbjct  48   IMKSCQAEKCSADLSDAKTYHRRHKVCELHAKAQVVVVAGTRQRFCQQCSRFHELSEFDE  107

Query  524  AKRSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQ  345
             KRSCRRRLAGHNERRRK+ + +S    +       +       K++ VCGQVDD+GRIQ
Sbjct  108  TKRSCRRRLAGHNERRRKNPSDNSSCQGSTSKGGGGAG------KEM-VCGQVDDRGRIQ  160

Query  344  MSIQENSSFKHFQI  303
            MS+Q+NSS+KHF +
Sbjct  161  MSVQDNSSYKHFHV  174



>gb|AAY16440.1| squamosa promoter binding-like protein [Betula platyphylla]
Length=175

 Score =   176 bits (447),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 106/133 (80%), Gaps = 7/133 (5%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R CQAEKC+ADL + KQYH+RHKVCE HAKAQVV+V G+RQRFCQQCSRFHEL EFDE K
Sbjct  50   RCCQAEKCTADLSDGKQYHKRHKVCEHHAKAQVVLVGGMRQRFCQQCSRFHELSEFDETK  109

Query  518  RSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMS  339
            RSCRRRLAGHNERRR+       ++++    ++   T    LKDI VCGQVDD+GRIQ++
Sbjct  110  RSCRRRLAGHNERRRE------NTAESHAEGSSRKGTGTHQLKDI-VCGQVDDRGRIQIT  162

Query  338  IQENSSFKHFQIR  300
            I ENS++KHFQIR
Sbjct  163  IHENSTYKHFQIR  175



>gb|AIE89792.1| SQUAMOSA promoter binding protein-like 3, partial [Salvia miltiorrhiza]
Length=188

 Score =   176 bits (447),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 108/137 (79%), Gaps = 4/137 (3%)
 Frame = -2

Query  701  MRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEA  522
            M+SCQAEKCSADL  AK YHRRHKVCE HAKAQV VVAG+RQRFCQQCSRFHEL EFD+A
Sbjct  53   MKSCQAEKCSADLAAAKAYHRRHKVCEHHAKAQVAVVAGIRQRFCQQCSRFHELSEFDDA  112

Query  521  KRSCRRRLAGHNERRRKssaissessqaae---avaassSTRNQYLKDINVCGQVDDKGR  351
            KRSCRRRLAGHNERRRK+    S++  +          ++     LK++ VCGQVDD+GR
Sbjct  113  KRSCRRRLAGHNERRRKNPGDGSQAEGSTSGRIKGGGGTTAGGHQLKEM-VCGQVDDRGR  171

Query  350  IQMSIQENSSFKHFQIR  300
            IQM++QENS++KHF +R
Sbjct  172  IQMTVQENSTYKHFHVR  188



>ref|XP_010656994.1| PREDICTED: squamosa promoter-binding protein 1 isoform X1 [Vitis 
vinifera]
Length=177

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 131/193 (68%), Gaps = 24/193 (12%)
 Frame = -2

Query  854  MSSKVVLKREAMEGDAAAGERESPSSAISADDEkkkrggkkggggnngGPVMRSCQAEKC  675
            M +K ++K+E MEG     E +      S DD+KKK      G        MR CQAE+C
Sbjct  1    MEAKKMVKKE-MEGTEEVDEDDQL--GCSEDDKKKKAAAGGSGKKAA--AAMRCCQAERC  55

Query  674  SADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCS--------RFHELGEFDEAK  519
            +ADL +AKQYHRRHKVCE HAKAQVVVV G+RQRFCQQCS        RFHEL EFDEAK
Sbjct  56   TADLTDAKQYHRRHKVCEHHAKAQVVVVGGIRQRFCQQCSRFYSSGYCRFHELSEFDEAK  115

Query  518  RSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMS  339
            RSCRRRLAGHNERRRK+SA  +E S            +   LK+I VCGQVDD+GRIQ++
Sbjct  116  RSCRRRLAGHNERRRKNSADHAEGSSR----------KGTQLKEI-VCGQVDDRGRIQIT  164

Query  338  IQENSSFKHFQIR  300
            IQEN+++KHFQIR
Sbjct  165  IQENAAYKHFQIR  177



>ref|XP_006447265.1| hypothetical protein CICLE_v10016841mg [Citrus clementina]
 ref|XP_006469892.1| PREDICTED: squamosa promoter-binding-like protein 4-like isoform 
X1 [Citrus sinensis]
 gb|ESR60505.1| hypothetical protein CICLE_v10016841mg [Citrus clementina]
Length=189

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 108/134 (81%), Gaps = 6/134 (4%)
 Frame = -2

Query  701  MRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEA  522
            +RSCQ +KC+ADL +AKQYHRRHKVCE HAKAQVV++ G+RQRFCQQCSRFHEL EFDE 
Sbjct  62   LRSCQVDKCAADLSDAKQYHRRHKVCEVHAKAQVVLMGGMRQRFCQQCSRFHELSEFDET  121

Query  521  KRSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQM  342
            KRSCRRRLAGHNERRRK++A S+    + +            LKD+ VCG++DDKGRI++
Sbjct  122  KRSCRRRLAGHNERRRKNAAESNGEGSSCKGTGT-----GTQLKDL-VCGKLDDKGRIKI  175

Query  341  SIQENSSFKHFQIR  300
            SIQEN++ KHFQIR
Sbjct  176  SIQENATCKHFQIR  189



>ref|XP_002517882.1| Squamosa promoter-binding protein, putative [Ricinus communis]
 gb|EEF44400.1| Squamosa promoter-binding protein, putative [Ricinus communis]
Length=198

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 105/134 (78%), Gaps = 8/134 (6%)
 Frame = -2

Query  701  MRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEA  522
            MR CQAEKC ADL++AK YHRRHKVCE+HAKAQ+V+VAG+RQRFCQQCSRFHEL EFDE 
Sbjct  73   MRCCQAEKCMADLNDAKPYHRRHKVCEYHAKAQIVLVAGIRQRFCQQCSRFHELIEFDET  132

Query  521  KRSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQM  342
            KRSCRRRLAGHNERRRK++  S     +              LKD+ V GQVDD GRI++
Sbjct  133  KRSCRRRLAGHNERRRKNTTESHTEGSSHRGTGTQ-------LKDM-VFGQVDDSGRIKI  184

Query  341  SIQENSSFKHFQIR  300
            +IQEN+++KHFQIR
Sbjct  185  TIQENTTYKHFQIR  198



>gb|KDP24104.1| hypothetical protein JCGZ_25761 [Jatropha curcas]
Length=127

 Score =   170 bits (431),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 104/134 (78%), Gaps = 12/134 (9%)
 Frame = -2

Query  701  MRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEA  522
            MR CQAEKC+ADL  AK YH+RHKVCE+H+KAQ+VVV G+RQRFCQQCSRFHEL EFDE 
Sbjct  1    MRCCQAEKCTADLTYAKPYHKRHKVCEYHSKAQIVVVDGIRQRFCQQCSRFHELSEFDET  60

Query  521  KRSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQM  342
            KRSCRRRLAGHNERRRK+   +S                   LK++ VCGQVDD+GRI++
Sbjct  61   KRSCRRRLAGHNERRRKTHTENSIHKGTGTQ-----------LKNM-VCGQVDDRGRIKI  108

Query  341  SIQENSSFKHFQIR  300
            +IQ+N+++KHFQIR
Sbjct  109  TIQDNATYKHFQIR  122



>gb|KDO42134.1| hypothetical protein CISIN_1g029650mg [Citrus sinensis]
Length=190

 Score =   172 bits (436),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 107/134 (80%), Gaps = 6/134 (4%)
 Frame = -2

Query  701  MRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEA  522
            +RSCQ +KC ADL +AKQYHRRHKVCE HAKAQVV++ G+RQRFCQQCSRFHEL EFDE 
Sbjct  63   LRSCQVDKCGADLSDAKQYHRRHKVCEVHAKAQVVLMGGIRQRFCQQCSRFHELSEFDET  122

Query  521  KRSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQM  342
            KRSCRRRLAGHNERRRK++A S+    + +            LKD+ VCG++DDKGRI++
Sbjct  123  KRSCRRRLAGHNERRRKNAAESNGEGSSCKGTGT-----GTQLKDL-VCGKLDDKGRIKI  176

Query  341  SIQENSSFKHFQIR  300
            SIQEN++ KHFQIR
Sbjct  177  SIQENATCKHFQIR  190



>ref|XP_002309744.2| hypothetical protein POPTR_0007s01030g [Populus trichocarpa]
 gb|EEE90194.2| hypothetical protein POPTR_0007s01030g [Populus trichocarpa]
Length=202

 Score =   169 bits (429),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 104/133 (78%), Gaps = 5/133 (4%)
 Frame = -2

Query  701  MRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEA  522
            MR CQ EKC+A+L +AKQYHRRHKVC  HAKAQVV+VAG+RQRFCQQCSRFHEL EFDE 
Sbjct  74   MRCCQVEKCTANLTDAKQYHRRHKVCGHHAKAQVVLVAGIRQRFCQQCSRFHELSEFDET  133

Query  521  KRSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQM  342
            KRSCRRRLAGHNERRRK    +   S    +    + T    LKD+ VCGQ D++GRI++
Sbjct  134  KRSCRRRLAGHNERRRK----NVVESHVEGSSRKVNGTHGTQLKDM-VCGQADERGRIKI  188

Query  341  SIQENSSFKHFQI  303
            +IQEN+++KHFQI
Sbjct  189  TIQENATYKHFQI  201



>ref|XP_007043635.1| Squamosa promoter binding protein-like 4 [Theobroma cacao]
 gb|EOX99466.1| Squamosa promoter binding protein-like 4 [Theobroma cacao]
Length=235

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 103/135 (76%), Gaps = 8/135 (6%)
 Frame = -2

Query  704  VMRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDE  525
             MR CQAE C+ADL +AKQYHRRHKVCE H+KAQVV+VAG RQRFCQQCSRFH L EFDE
Sbjct  109  AMRCCQAENCTADLSDAKQYHRRHKVCENHSKAQVVLVAGFRQRFCQQCSRFHVLSEFDE  168

Query  524  AKRSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQ  345
            AKRSCRRRLAGHNERRRK+S  S       +            LKD+ +CGQVDD+GRI+
Sbjct  169  AKRSCRRRLAGHNERRRKNSTESHGEGSGRKGT-------GTQLKDM-ICGQVDDRGRIK  220

Query  344  MSIQENSSFKHFQIR  300
            ++IQE S+++ FQIR
Sbjct  221  LTIQETSTYEQFQIR  235



>ref|XP_011047666.1| PREDICTED: squamosa promoter-binding protein 2-like isoform X1 
[Populus euphratica]
Length=257

 Score =   169 bits (428),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 104/133 (78%), Gaps = 5/133 (4%)
 Frame = -2

Query  701  MRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEA  522
            MR CQ EKC+A+L +AKQYHRRHKVC  HAKAQVV+VAG+RQRFCQQCSRFHEL EFDE 
Sbjct  129  MRCCQVEKCTANLTDAKQYHRRHKVCGHHAKAQVVLVAGIRQRFCQQCSRFHELSEFDET  188

Query  521  KRSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQM  342
            KRSCRRRLAGHNERRRK    +   S    +    + T +  LKD+ VCGQ D++GRI++
Sbjct  189  KRSCRRRLAGHNERRRK----NVVESHVEGSSRKVNGTHSTQLKDM-VCGQADERGRIKI  243

Query  341  SIQENSSFKHFQI  303
            +IQE +++KHFQI
Sbjct  244  TIQETATYKHFQI  256



>ref|XP_010091480.1| Squamosa promoter-binding-like protein 5 [Morus notabilis]
 gb|EXB44631.1| Squamosa promoter-binding-like protein 5 [Morus notabilis]
Length=209

 Score =   165 bits (417),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 102/132 (77%), Gaps = 8/132 (6%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R CQAEKC+ADL +AKQYHRRHKVCE HAKAQVV+VAG+RQRFCQQCSRFHEL EFDE +
Sbjct  85   RCCQAEKCAADLSDAKQYHRRHKVCEHHAKAQVVLVAGVRQRFCQQCSRFHELSEFDETR  144

Query  518  RSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMS  339
            RSCRRRLAGHNERRRKSSA +       + + A        LKD   CGQ DD+ RIQ++
Sbjct  145  RSCRRRLAGHNERRRKSSAETHAEGSGRKGIGAQ-------LKD-TACGQADDRARIQIA  196

Query  338  IQENSSFKHFQI  303
             QEN+++KHF I
Sbjct  197  PQENATYKHFHI  208



>ref|XP_007198845.1| hypothetical protein PRUPE_ppa011968mg [Prunus persica]
 gb|EMJ00044.1| hypothetical protein PRUPE_ppa011968mg [Prunus persica]
Length=189

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 100/134 (75%), Gaps = 9/134 (7%)
 Frame = -2

Query  701  MRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEA  522
             R CQA++C ADL +AKQYHRRHKVC+ H+KAQVV+V+GLRQRFCQQCSRFHEL EFD+ 
Sbjct  65   TRCCQADRCPADLSDAKQYHRRHKVCDLHSKAQVVLVSGLRQRFCQQCSRFHELPEFDDT  124

Query  521  KRSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQM  342
            KRSCRRRLAGHNERRRK+S  S+                   LKD  VCGQ D+ GRI++
Sbjct  125  KRSCRRRLAGHNERRRKNSVESNAEGPNRNGT-------GTPLKD--VCGQGDNSGRIRI  175

Query  341  SIQENSSFKHFQIR  300
            +IQ NS +KHFQIR
Sbjct  176  TIQGNSPYKHFQIR  189



>ref|XP_008229071.1| PREDICTED: squamosa promoter-binding-like protein 3 [Prunus mume]
Length=189

 Score =   160 bits (406),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 101/134 (75%), Gaps = 9/134 (7%)
 Frame = -2

Query  701  MRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEA  522
             R CQA++C ADL +AKQYHRRHKVC+ H+KAQVV+V+GLRQRFCQQCSRFHEL EFD+ 
Sbjct  65   TRCCQADRCPADLSDAKQYHRRHKVCDLHSKAQVVLVSGLRQRFCQQCSRFHELPEFDDT  124

Query  521  KRSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQM  342
            KRSCRRRLAGHNERRRK+S  S     +           +  LKD   CGQ D+ GRI++
Sbjct  125  KRSCRRRLAGHNERRRKNSVESHAEGPSRNGT-------DTQLKD--GCGQGDNSGRIRI  175

Query  341  SIQENSSFKHFQIR  300
            +IQ NS++KHFQIR
Sbjct  176  TIQGNSTYKHFQIR  189



>ref|XP_007149828.1| hypothetical protein PHAVU_005G101900g [Phaseolus vulgaris]
 gb|ESW21822.1| hypothetical protein PHAVU_005G101900g [Phaseolus vulgaris]
Length=169

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 103/134 (77%), Gaps = 6/134 (4%)
 Frame = -2

Query  701  MRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEA  522
            M  CQAEKC+ADLHEAKQYHRRHKVCE HAKAQVV+V G++QRFCQQCSRFHEL EFD+A
Sbjct  42   MLCCQAEKCNADLHEAKQYHRRHKVCECHAKAQVVLVHGIKQRFCQQCSRFHELSEFDDA  101

Query  521  KRSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQM  342
            KRSCRRRLA HNERRRK     + S Q+    ++   +    LKDI  C Q +++GR  +
Sbjct  102  KRSCRRRLAVHNERRRK-----NSSDQSQAEGSSHKGSEAPQLKDI-ACVQANERGRTHI  155

Query  341  SIQENSSFKHFQIR  300
            +IQ+NS +K+FQIR
Sbjct  156  TIQQNSPYKNFQIR  169



>ref|XP_010035775.1| PREDICTED: squamosa promoter-binding protein 1-like [Eucalyptus 
grandis]
 gb|KCW47239.1| hypothetical protein EUGRSUZ_K01046 [Eucalyptus grandis]
Length=178

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 102/133 (77%), Gaps = 11/133 (8%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R+CQAEKC+ADL EA+QYHRRHKVCE HAKA  VVV GL QRFCQQCSRFHEL EFDE K
Sbjct  57   RNCQAEKCTADLTEARQYHRRHKVCEQHAKAPAVVVGGLYQRFCQQCSRFHELLEFDENK  116

Query  518  RSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMS  339
            RSCRRRLAGHNERRRK+ A       + +A  ++       +K++ VCGQVD++GR    
Sbjct  117  RSCRRRLAGHNERRRKNPAEPHIEGSSGKAGGSTQ------MKEL-VCGQVDNRGR----  165

Query  338  IQENSSFKHFQIR  300
            IQEN+++KHFQIR
Sbjct  166  IQENATYKHFQIR  178



>gb|KCW47238.1| hypothetical protein EUGRSUZ_K01046 [Eucalyptus grandis]
Length=189

 Score =   156 bits (395),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 101/133 (76%), Gaps = 11/133 (8%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R+CQAEKC+ADL EA+QYHRRHKVCE HAKA  VVV GL QRFCQQCSRFHEL EFDE K
Sbjct  68   RNCQAEKCTADLTEARQYHRRHKVCEQHAKAPAVVVGGLYQRFCQQCSRFHELLEFDENK  127

Query  518  RSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMS  339
            RSCRRRLAGHNERRRK+ A       + +A        +  +K++ VCGQVD++GR    
Sbjct  128  RSCRRRLAGHNERRRKNPAEPHIEGSSGKAGG------STQMKEL-VCGQVDNRGR----  176

Query  338  IQENSSFKHFQIR  300
            IQEN+++KHFQIR
Sbjct  177  IQENATYKHFQIR  189



>ref|XP_003540122.1| PREDICTED: squamosa promoter-binding protein 2-like [Glycine 
max]
 gb|KHN05763.1| Squamosa promoter-binding protein 1 [Glycine soja]
Length=190

 Score =   155 bits (393),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 96/131 (73%), Gaps = 10/131 (8%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE+C ADL +AK+YHRRHKVCEFH+KA VVVVAGLRQRFCQQCSRFH+L EFDE+KRS
Sbjct  70   CQAERCGADLTDAKRYHRRHKVCEFHSKAPVVVVAGLRQRFCQQCSRFHDLAEFDESKRS  129

Query  512  CRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMSIQ  333
            CRRRLAGHNERRRK               A   +++ Q+ K+   C   D++GRIQM++ 
Sbjct  130  CRRRLAGHNERRRK----------TNPEAANEGNSKGQHPKETTHCRLADERGRIQMNLT  179

Query  332  ENSSFKHFQIR  300
             +S +K F IR
Sbjct  180  GSSEYKSFNIR  190



>gb|KCW47237.1| hypothetical protein EUGRSUZ_K01046 [Eucalyptus grandis]
Length=236

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 104/140 (74%), Gaps = 15/140 (11%)
 Frame = -2

Query  707  PVM----RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHEL  540
            PV+    R+CQAEKC+ADL EA+QYHRRHKVCE HAKA  VVV GL QRFCQQCSRFHEL
Sbjct  108  PVLGAASRNCQAEKCTADLTEARQYHRRHKVCEQHAKAPAVVVGGLYQRFCQQCSRFHEL  167

Query  539  GEFDEAKRSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDD  360
             EFDE KRSCRRRLAGHNERRRK+ A       + +A        +  +K++ VCGQVD+
Sbjct  168  LEFDENKRSCRRRLAGHNERRRKNPAEPHIEGSSGKAGG------STQMKEL-VCGQVDN  220

Query  359  KGRIQMSIQENSSFKHFQIR  300
            +GR    IQEN+++KHFQIR
Sbjct  221  RGR----IQENATYKHFQIR  236



>ref|XP_008381596.1| PREDICTED: squamosa promoter-binding-like protein 3 [Malus domestica]
Length=188

 Score =   153 bits (386),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 101/135 (75%), Gaps = 7/135 (5%)
 Frame = -2

Query  704  VMRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDE  525
             MR CQA++C+ADL E KQYHR+HKVC+ H+K+QVV+V+GL QRFCQQCSRFH+L EFD+
Sbjct  61   AMRRCQADRCTADLSEEKQYHRKHKVCDLHSKSQVVLVSGLHQRFCQQCSRFHQLPEFDD  120

Query  524  AKRSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQ  345
             KRSCRRRLAGHNERRRK+ A S     ++  V A +  +       +VCGQVDD GRI+
Sbjct  121  TKRSCRRRLAGHNERRRKNPAESHAVEGSSCNVGAGTQFK-------DVCGQVDDSGRIR  173

Query  344  MSIQENSSFKHFQIR  300
            ++I  NS  KHF IR
Sbjct  174  ITIPGNSIHKHFHIR  188



>ref|XP_006595445.1| PREDICTED: squamosa promoter-binding-like protein 4-like [Glycine 
max]
Length=158

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 96/125 (77%), Gaps = 6/125 (5%)
 Frame = -2

Query  674  SADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRSCRRRLA  495
            +ADLHEAKQYHRRH+VCE+H KAQVV+V  +RQRFCQQCSRFHEL EFD+ KRSCR  LA
Sbjct  40   NADLHEAKQYHRRHRVCEYHVKAQVVLVDEVRQRFCQQCSRFHELAEFDDTKRSCRSSLA  99

Query  494  GHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMSIQENSSFK  315
            GHNERRRK     +     AE  + +  T +  LKDI  CGQ D++GRIQ++I EN+++K
Sbjct  100  GHNERRRK-----NSDQSQAEGSSRNKGTGHPQLKDI-TCGQADERGRIQITIHENAAYK  153

Query  314  HFQIR  300
            HFQIR
Sbjct  154  HFQIR  158



>ref|XP_008810376.1| PREDICTED: squamosa promoter-binding protein 1-like [Phoenix 
dactylifera]
Length=172

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 93/131 (71%), Gaps = 19/131 (15%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAEKC+ADL EAK+YHRRHKVCE H+KA VV+VAGLRQRFCQQCSRFHEL EFD++KRS
Sbjct  61   CQAEKCTADLTEAKRYHRRHKVCEAHSKAPVVIVAGLRQRFCQQCSRFHELSEFDDSKRS  120

Query  512  CRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMSIQ  333
            CRRRLAGHNERRRK                   S+     +  + C Q D  GRIQ+S+ 
Sbjct  121  CRRRLAGHNERRRK-------------------SSSESQGEGSSRCRQADQDGRIQISLP  161

Query  332  ENSSFKHFQIR  300
             N ++KHFQIR
Sbjct  162  GNPTYKHFQIR  172



>gb|ADL36827.1| SPL domain class transcription factor [Malus domestica]
Length=188

 Score =   151 bits (382),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 100/135 (74%), Gaps = 7/135 (5%)
 Frame = -2

Query  704  VMRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDE  525
             MR CQA++C+ADL E KQYHR+HKVC+ H+K+QVV+V+GL QRFCQQCSRFH+L EFD+
Sbjct  61   AMRRCQADRCTADLSEEKQYHRKHKVCDLHSKSQVVLVSGLHQRFCQQCSRFHQLPEFDD  120

Query  524  AKRSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQ  345
             KRSCRR LAGHNERRRK+ A S     ++  V A +  +       +VCGQVDD GRI+
Sbjct  121  TKRSCRRHLAGHNERRRKNPAESHAVEGSSCNVGAGTQFK-------DVCGQVDDSGRIR  173

Query  344  MSIQENSSFKHFQIR  300
            ++I  NS  KHF IR
Sbjct  174  ITIPGNSIHKHFHIR  188



>ref|XP_010260271.1| PREDICTED: squamosa promoter-binding protein 1 [Nelumbo nucifera]
Length=189

 Score =   150 bits (380),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 97/131 (74%), Gaps = 8/131 (6%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAEKC+ADL EAK+YHRRHKVCE HAKA VV+VA LRQRFCQQCSRFHEL EFDEAKRS
Sbjct  67   CQAEKCTADLTEAKRYHRRHKVCEQHAKAPVVLVASLRQRFCQQCSRFHELSEFDEAKRS  126

Query  512  CRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMSIQ  333
            CRRRLAGHNERRRKSS  S     + + V          LK+ N C Q D  GR+Q+   
Sbjct  127  CRRRLAGHNERRRKSSTESHGEGSSHKGVVPQ-------LKE-NHCRQADQSGRMQVPHT  178

Query  332  ENSSFKHFQIR  300
             ++++KHFQIR
Sbjct  179  GSTTYKHFQIR  189



>ref|XP_003526029.1| PREDICTED: squamosa promoter-binding protein 2-like [Glycine 
max]
Length=185

 Score =   150 bits (380),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 95/131 (73%), Gaps = 10/131 (8%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE+C ADL +AK+YHRRHKVCEFH+KA VVVVAGLRQRFCQQCSRFH+L EFDE+KRS
Sbjct  65   CQAERCGADLTDAKRYHRRHKVCEFHSKAPVVVVAGLRQRFCQQCSRFHDLAEFDESKRS  124

Query  512  CRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMSIQ  333
            CRRRLAGHNERRRK          +    +   ST+  + K+   C   +++ RIQM++ 
Sbjct  125  CRRRLAGHNERRRK----------SNPEASNEGSTKGHHPKETTHCRLANERERIQMNLP  174

Query  332  ENSSFKHFQIR  300
             +S +K F IR
Sbjct  175  GSSGYKSFNIR  185



>ref|XP_009392815.1| PREDICTED: squamosa promoter-binding-like protein 3 [Musa acuminata 
subsp. malaccensis]
Length=187

 Score =   150 bits (380),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 93/131 (71%), Gaps = 18/131 (14%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C+ADL EAK+YHRRHKVCE H+KA VV+VAG RQRFCQQCSRFHEL EFD++KRS
Sbjct  75   CQAENCTADLTEAKRYHRRHKVCEAHSKAAVVMVAGFRQRFCQQCSRFHELAEFDDSKRS  134

Query  512  CRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMSIQ  333
            CRRRLAGHNERRRKSS+ +                  Q  +  N C Q D  GR+Q+S+ 
Sbjct  135  CRRRLAGHNERRRKSSSDA------------------QAGEGSNRCRQADQDGRMQISLP  176

Query  332  ENSSFKHFQIR  300
               ++KHFQIR
Sbjct  177  GKPTYKHFQIR  187



>ref|XP_010929104.1| PREDICTED: squamosa promoter-binding protein 1 isoform X1 [Elaeis 
guineensis]
Length=181

 Score =   150 bits (379),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 95/131 (73%), Gaps = 19/131 (15%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAEKC+ADL EAK+YHRRHKVCE H+KA VV+VAGLRQRFCQQCSRFHE+ EFD++KRS
Sbjct  70   CQAEKCTADLTEAKRYHRRHKVCEAHSKAPVVIVAGLRQRFCQQCSRFHEISEFDDSKRS  129

Query  512  CRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMSIQ  333
            CRRRLAGHNERRRKSSA S                     +  + C Q D  GRIQ+++ 
Sbjct  130  CRRRLAGHNERRRKSSAESQG-------------------EGSSRCRQADQDGRIQINLP  170

Query  332  ENSSFKHFQIR  300
             N ++KHFQIR
Sbjct  171  GNPTYKHFQIR  181



>ref|XP_006367482.1| PREDICTED: squamosa promoter-binding protein 1-like [Solanum 
tuberosum]
Length=165

 Score =   149 bits (377),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 95/134 (71%), Gaps = 24/134 (18%)
 Frame = -2

Query  701  MRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEA  522
            +RSCQAEKC+ DL +AKQYH+RHKVCE+HAKAQVVVVAGLRQRFCQQCSRFHEL EFDE+
Sbjct  56   IRSCQAEKCNVDLSDAKQYHKRHKVCEYHAKAQVVVVAGLRQRFCQQCSRFHELTEFDES  115

Query  521  KRSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQM  342
            KRSCRRRLAGHNERRRKS++ SS S                           D   RI +
Sbjct  116  KRSCRRRLAGHNERRRKSTSSSSSS------------------------SSTDQSHRIHI  151

Query  341  SIQENSSFKHFQIR  300
            SIQENS+ K+  +R
Sbjct  152  SIQENSTHKNIHLR  165



>gb|AAY33857.1| putative squamosa promoter-binding protein [Betula platyphylla]
Length=108

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 90/115 (78%), Gaps = 7/115 (6%)
 Frame = -2

Query  644  HRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRSCRRRLAGHNERRRKss  465
            H+RHKVCE H KAQVV+V G+RQRFCQQCSRFHEL EFDE KRSCRRRLAGHNERRRK  
Sbjct  1    HKRHKVCEHHPKAQVVLVGGMRQRFCQQCSRFHELSEFDETKRSCRRRLAGHNERRRK--  58

Query  464  aissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMSIQENSSFKHFQIR  300
                 ++++    ++   T    LKDI VCGQVDD+GRIQ++I ENS++KHFQIR
Sbjct  59   ----NTAESHAEGSSRKGTGTHQLKDI-VCGQVDDRGRIQITIHENSTYKHFQIR  108



>ref|XP_007133260.1| hypothetical protein PHAVU_011G164800g [Phaseolus vulgaris]
 gb|ESW05254.1| hypothetical protein PHAVU_011G164800g [Phaseolus vulgaris]
Length=186

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 94/131 (72%), Gaps = 10/131 (8%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE+C ADL +AK+YHRRHKVCEFH+KA  VVVAGLRQRFCQQCSRFH+L EFDE+KRS
Sbjct  66   CQAERCGADLTDAKRYHRRHKVCEFHSKAPAVVVAGLRQRFCQQCSRFHDLAEFDESKRS  125

Query  512  CRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMSIQ  333
            CRRRLAGHNERRRKS+  +                 + + K+   C   D++GRIQM++ 
Sbjct  126  CRRRLAGHNERRRKSNPEACSDGSKG----------HHHPKETTHCRLADERGRIQMNLP  175

Query  332  ENSSFKHFQIR  300
             +S +K F IR
Sbjct  176  GSSGYKSFNIR  186



>gb|KHN18285.1| Squamosa promoter-binding protein 1 [Glycine soja]
Length=181

 Score =   148 bits (374),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 94/131 (72%), Gaps = 14/131 (11%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE+C ADL +AK+YHRRHKVCEFH+KA VVVVAGLRQRFCQQCSRFH+L EFDE+KRS
Sbjct  65   CQAERCGADLTDAKRYHRRHKVCEFHSKAPVVVVAGLRQRFCQQCSRFHDLAEFDESKRS  124

Query  512  CRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMSIQ  333
            CRRRLAGHNERRR+               +   ST+  + K+   C   +++ RIQM++ 
Sbjct  125  CRRRLAGHNERRRE--------------ASNEGSTKGHHPKETTHCRLANERERIQMNLP  170

Query  332  ENSSFKHFQIR  300
             +S +K F IR
Sbjct  171  GSSGYKSFNIR  181



>ref|XP_010272389.1| PREDICTED: squamosa promoter-binding protein 1-like [Nelumbo 
nucifera]
Length=187

 Score =   148 bits (374),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 98/131 (75%), Gaps = 8/131 (6%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAEKC+ADL EAK+YHRRHKVCE H+KA VV+VAGL+QRFCQQCSRFHEL EFDE KRS
Sbjct  65   CQAEKCTADLSEAKRYHRRHKVCEQHSKAPVVLVAGLKQRFCQQCSRFHELSEFDETKRS  124

Query  512  CRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMSIQ  333
            CRRRLAGHNERRRK+S  S     + + VA         LK+ N C Q D  GR+Q+   
Sbjct  125  CRRRLAGHNERRRKNSTESHGEGSSRKGVATQ-------LKE-NHCRQADQSGRMQIPHT  176

Query  332  ENSSFKHFQIR  300
             ++++KHFQIR
Sbjct  177  GSANYKHFQIR  187



>gb|AGI62049.1| SQUAMOSA promoter-binding-like 1 [Erycina pusilla]
Length=169

 Score =   147 bits (371),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 89/131 (68%), Gaps = 19/131 (15%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAEKC+ADL EAK+YHRRHKVCE HAKA  V+VAGLRQRFCQQCSRFHEL EFDE KRS
Sbjct  58   CQAEKCTADLTEAKRYHRRHKVCEAHAKAATVIVAGLRQRFCQQCSRFHELPEFDEVKRS  117

Query  512  CRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMSIQ  333
            CRRRLAGHNERRRKSS+       +                    C Q D  G+  +S+ 
Sbjct  118  CRRRLAGHNERRRKSSSEPQGEGSSR-------------------CLQADQGGKAPISLP  158

Query  332  ENSSFKHFQIR  300
             N ++KHFQIR
Sbjct  159  GNQNYKHFQIR  169



>ref|XP_006370233.1| hypothetical protein POPTR_0001s40870g [Populus trichocarpa]
 gb|ERP66802.1| hypothetical protein POPTR_0001s40870g [Populus trichocarpa]
Length=196

 Score =   147 bits (372),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 98/134 (73%), Gaps = 10/134 (7%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQ EKC A+L +AK+YHRRHKVCE HAK+  VVVAGLRQRFCQQCSRFHEL EFDE KR
Sbjct  71   SCQVEKCGANLTDAKRYHRRHKVCEVHAKSPAVVVAGLRQRFCQQCSRFHELVEFDETKR  130

Query  515  SCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMSI  336
            SCRRRLAGHNERRRKS+A S       + V       N  LK+ N C Q D++GR Q++I
Sbjct  131  SCRRRLAGHNERRRKSTAESYGEGSNRKGV-------NTPLKE-NPCRQADERGRFQINI  182

Query  335  --QENSSFKHFQIR  300
              Q +SS+K  QIR
Sbjct  183  PPQGSSSYKRSQIR  196



>ref|XP_002282598.1| PREDICTED: squamosa promoter-binding-like protein 3 [Vitis vinifera]
 emb|CBI20271.3| unnamed protein product [Vitis vinifera]
Length=204

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 95/133 (71%), Gaps = 14/133 (11%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAEKC ADL +AK+YHRRHKVCE HAKA +V VAGLRQRFCQQCSRFHEL EFDEAKRS
Sbjct  84   CQAEKCGADLTDAKRYHRRHKVCEVHAKAAMVEVAGLRQRFCQQCSRFHELSEFDEAKRS  143

Query  512  CRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDK--GRIQMS  339
            CRRRLAGHNERRRK ++ S  +  +                  N C Q +++  GR++++
Sbjct  144  CRRRLAGHNERRRKGASESQNAEGSGGKEKE------------NQCRQAEERAAGRVEIN  191

Query  338  IQENSSFKHFQIR  300
            +   SS+KHFQIR
Sbjct  192  LPGTSSYKHFQIR  204



>ref|XP_004243367.2| PREDICTED: squamosa promoter-binding-like protein 3 [Solanum 
lycopersicum]
Length=157

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 97/134 (72%), Gaps = 26/134 (19%)
 Frame = -2

Query  701  MRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEA  522
            +RSCQAEKC+ DL +AKQYH+RHKVCE+HAK+QVVVVAGLRQRFCQQCSRFHEL EFDE+
Sbjct  50   IRSCQAEKCNVDLSDAKQYHKRHKVCEYHAKSQVVVVAGLRQRFCQQCSRFHELTEFDES  109

Query  521  KRSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQM  342
            KRSCRRRLAGHNERRRKS++ SS SS +A                           RI +
Sbjct  110  KRSCRRRLAGHNERRRKSTSSSSSSSSSA--------------------------DRIHI  143

Query  341  SIQENSSFKHFQIR  300
            SIQEN + K+F +R
Sbjct  144  SIQENPTHKNFHLR  157



>ref|XP_004146058.1| PREDICTED: squamosa promoter-binding-like protein 4-like [Cucumis 
sativus]
 ref|XP_004165557.1| PREDICTED: squamosa promoter-binding-like protein 4-like [Cucumis 
sativus]
 gb|KGN55117.1| Squamosa promoter-binding protein [Cucumis sativus]
Length=202

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 99/134 (74%), Gaps = 4/134 (3%)
 Frame = -2

Query  701  MRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEA  522
            + SCQA  C+ADL EAK+YHRRHKVCEFH+KA +V+VAG+RQRFCQQCSRFHEL EFDEA
Sbjct  73   LPSCQAHNCAADLSEAKRYHRRHKVCEFHSKAAIVMVAGIRQRFCQQCSRFHELTEFDEA  132

Query  521  KRSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQM  342
            KRSCRRRLAGHNERRRKSSA S   S + +  A  + ++  + + +      D + RIQM
Sbjct  133  KRSCRRRLAGHNERRRKSSAESQGESTSRKGSAPQAQSKESHCRQL----VEDQRSRIQM  188

Query  341  SIQENSSFKHFQIR  300
            +   +S +KH  IR
Sbjct  189  APPGSSGYKHLHIR  202



>ref|XP_009398957.1| PREDICTED: squamosa promoter-binding protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=166

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 93/131 (71%), Gaps = 19/131 (15%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAEKC+ADL EAK+YHRRH+VCE H+KA VV+VAGLRQRFCQQCSRFHE+ EFD++KRS
Sbjct  55   CQAEKCAADLAEAKRYHRRHRVCEAHSKAAVVIVAGLRQRFCQQCSRFHEVSEFDDSKRS  114

Query  512  CRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMSIQ  333
            CRRRLAGHNERRRK                   S+ +     ++   Q D+ GR+QMS  
Sbjct  115  CRRRLAGHNERRRK-------------------SSSDSQGDGLSRFRQPDEDGRMQMSDS  155

Query  332  ENSSFKHFQIR  300
             NS+ KHFQI+
Sbjct  156  GNSTHKHFQIK  166



>ref|XP_011043824.1| PREDICTED: squamosa promoter-binding protein 1-like [Populus 
euphratica]
Length=196

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 97/134 (72%), Gaps = 10/134 (7%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQ EKC A+L +AK+YHRRHKVCE HAK+  VVVAGLRQRFCQQCSRFHEL EFDE KR
Sbjct  71   SCQVEKCGANLTDAKRYHRRHKVCEVHAKSPAVVVAGLRQRFCQQCSRFHELAEFDETKR  130

Query  515  SCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMSI  336
            SCRRRLAGHNERRRKS+A S       + V       N  LK+   C Q D++GR Q++I
Sbjct  131  SCRRRLAGHNERRRKSTAESYGEGSNRKGV-------NTPLKE-RPCRQADERGRFQINI  182

Query  335  --QENSSFKHFQIR  300
              Q +SS+K  QIR
Sbjct  183  PPQGSSSYKRSQIR  196



>ref|XP_003543233.1| PREDICTED: squamosa promoter-binding protein 2-like [Glycine 
max]
Length=187

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 93/132 (70%), Gaps = 9/132 (7%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQAE C ADL  AK+YHRRHKVCE H+KA  V+VAGLRQRFCQQCSRFHEL EFDEAKR
Sbjct  65   SCQAEICGADLTVAKRYHRRHKVCELHSKAPSVMVAGLRQRFCQQCSRFHELAEFDEAKR  124

Query  515  SCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMSI  336
            SCRRRLA HNERRRK        S A       S ++ Q+  + + C   DD GRIQM+I
Sbjct  125  SCRRRLARHNERRRK--------SNAETCNEGCSGSKGQHPAETH-CRNTDDWGRIQMNI  175

Query  335  QENSSFKHFQIR  300
             +NS +K F IR
Sbjct  176  AKNSGYKFFHIR  187



>ref|XP_010062855.1| PREDICTED: squamosa promoter-binding-like protein 3 [Eucalyptus 
grandis]
 gb|KCW69992.1| hypothetical protein EUGRSUZ_F03303 [Eucalyptus grandis]
Length=186

 Score =   145 bits (367),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 91/131 (69%), Gaps = 11/131 (8%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE+C  DL +AK+YHRRHKVCE HAKA VV+VAGLRQRFCQQCSRFHEL EFDE+KRS
Sbjct  67   CQAERCGTDLTDAKRYHRRHKVCEVHAKAPVVMVAGLRQRFCQQCSRFHELMEFDESKRS  126

Query  512  CRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMSIQ  333
            CRRRLAGHNERRRK          ++       S+R      +  C   D +GR   +I 
Sbjct  127  CRRRLAGHNERRRK----------SSCEYYGEGSSRRMSGPQLKECRPADSRGR-GTAIP  175

Query  332  ENSSFKHFQIR  300
             NS+FKHFQIR
Sbjct  176  GNSTFKHFQIR  186



>ref|XP_002317486.2| hypothetical protein POPTR_0011s11770g [Populus trichocarpa]
 gb|EEE98098.2| hypothetical protein POPTR_0011s11770g [Populus trichocarpa]
Length=193

 Score =   145 bits (366),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 98/134 (73%), Gaps = 10/134 (7%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQ EKC A+L +AK+YHRRHKVCE HAK+  VVVAGLRQRFCQQCSRFHEL EFDE KR
Sbjct  68   SCQVEKCGANLTDAKRYHRRHKVCEVHAKSPAVVVAGLRQRFCQQCSRFHELLEFDETKR  127

Query  515  SCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMSI  336
            SCRRRLAGHNERRRK++A S     + + V          LK+ + C Q D++GR QMSI
Sbjct  128  SCRRRLAGHNERRRKNTAESYGEGSSRKGVGTQ-------LKE-SPCRQADERGRYQMSI  179

Query  335  --QENSSFKHFQIR  300
              Q +SS+K  QIR
Sbjct  180  PSQGSSSYKRSQIR  193



>ref|XP_008463797.1| PREDICTED: squamosa promoter-binding protein 1-like [Cucumis 
melo]
Length=176

 Score =   144 bits (364),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 98/134 (73%), Gaps = 9/134 (7%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQA  C+ADL EAK+YHRRHKVCEFH+KA +V+VAG+RQRFCQQCSRFHEL EFDEAKR
Sbjct  50   SCQAHNCAADLSEAKRYHRRHKVCEFHSKAAIVMVAGIRQRFCQQCSRFHELTEFDEAKR  109

Query  515  SCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQV--DDKGRIQM  342
            SCRRRLAGHNERRRK+SA S   S + ++   + S  +        C Q+  D + RIQM
Sbjct  110  SCRRRLAGHNERRRKNSAESQGESTSRKSAPQAQSKESH-------CRQLVEDQRSRIQM  162

Query  341  SIQENSSFKHFQIR  300
            +   +S +KH  IR
Sbjct  163  APPGSSGYKHLHIR  176



>gb|ACU24116.1| unknown [Glycine max]
Length=187

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 93/132 (70%), Gaps = 9/132 (7%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQAE C ADL  AK++HRRHKVCE H+KA  V+VAGLRQRFCQQCSRFHEL EFDEAKR
Sbjct  65   SCQAEICGADLTVAKRFHRRHKVCELHSKAPSVMVAGLRQRFCQQCSRFHELAEFDEAKR  124

Query  515  SCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMSI  336
            SCRRRLA HNERRRK        S A       S ++ Q+  + + C   DD GRIQM+I
Sbjct  125  SCRRRLARHNERRRK--------SNAETCNEGCSGSKGQHPAETH-CRNTDDWGRIQMNI  175

Query  335  QENSSFKHFQIR  300
             +NS +K F IR
Sbjct  176  AKNSGYKFFHIR  187



>ref|XP_009620386.1| PREDICTED: squamosa promoter-binding-like protein 3 [Nicotiana 
tomentosiformis]
Length=172

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = -2

Query  701  MRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEA  522
            MR CQA+KC+ DL +AKQYH+RHKVCE+HAKAQ VVVAGLRQRFCQQCSRFHE+GEFDE+
Sbjct  48   MRCCQADKCTVDLSDAKQYHKRHKVCEYHAKAQAVVVAGLRQRFCQQCSRFHEVGEFDES  107

Query  521  KRSCRRRLAGHNERRRK  471
            KRSCRRRLAGHNERRRK
Sbjct  108  KRSCRRRLAGHNERRRK  124



>ref|XP_011029504.1| PREDICTED: squamosa promoter-binding-like protein 4 [Populus 
euphratica]
Length=241

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 97/133 (73%), Gaps = 9/133 (7%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQ EKC A+L +AK+YH+RHKVCE HAK+  VVVAGLRQRFCQQCSRFHEL EFDE KR
Sbjct  117  SCQVEKCGANLTDAKRYHKRHKVCEVHAKSPAVVVAGLRQRFCQQCSRFHELPEFDETKR  176

Query  515  SCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMSI  336
            SCRRRLAGHNERRRK++A S     + + V          LK+ + C Q D++GR QMSI
Sbjct  177  SCRRRLAGHNERRRKNTAESYGEGSSRKGV-------GTQLKE-SPCRQADERGRFQMSI  228

Query  335  -QENSSFKHFQIR  300
              + SS+K  QIR
Sbjct  229  PSQGSSYKRSQIR  241



>ref|XP_011100353.1| PREDICTED: squamosa promoter-binding protein 1-like [Sesamum 
indicum]
Length=183

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 87/113 (77%), Gaps = 2/113 (2%)
 Frame = -2

Query  701  MRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEA  522
             +SCQAEKCSADL EAK YHR HKVCE HAKAQVVVVAG+RQRFCQQCSRFHEL EFDEA
Sbjct  72   TKSCQAEKCSADLSEAKTYHRLHKVCEHHAKAQVVVVAGIRQRFCQQCSRFHELSEFDEA  131

Query  521  KRSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQ-YLKDINVCGQV  366
            KRSCRRRLAGHNERRRK+   ++++  +  +     +T     LKDI  CG V
Sbjct  132  KRSCRRRLAGHNERRRKNPTENTQAEGSTGSRIKGGNTPGSGQLKDI-FCGHV  183



>ref|XP_010943949.1| PREDICTED: squamosa promoter-binding protein 1-like [Elaeis guineensis]
Length=178

 Score =   142 bits (359),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 91/131 (69%), Gaps = 20/131 (15%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAEKC+ADL EAK+YHRRHKVCE H+KA +V+VAGLRQRFCQQCSRFHEL EFD++KRS
Sbjct  68   CQAEKCTADLTEAKRYHRRHKVCEAHSKASIVIVAGLRQRFCQQCSRFHELSEFDDSKRS  127

Query  512  CRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMSIQ  333
            CRRRLAGHNERRRK                   S+     +  + C Q D + RIQ S+ 
Sbjct  128  CRRRLAGHNERRRK-------------------SSSESQGEGSSQCRQADPEERIQ-SLP  167

Query  332  ENSSFKHFQIR  300
             N + KHFQIR
Sbjct  168  GNPTCKHFQIR  178



>gb|EYU42136.1| hypothetical protein MIMGU_mgv1a014682mg [Erythranthe guttata]
Length=181

 Score =   142 bits (358),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = -2

Query  704  VMRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDE  525
             M+SCQAEKCSADL +AK YHRRHKVCE HAKAQVVVVAG+RQRFCQQCSRFH++ EFDE
Sbjct  52   TMKSCQAEKCSADLSDAKTYHRRHKVCEHHAKAQVVVVAGIRQRFCQQCSRFHDILEFDE  111

Query  524  AKRSCRRRLAGHNERRRK  471
            +KRSCRRRLAGHNERRRK
Sbjct  112  SKRSCRRRLAGHNERRRK  129



>ref|XP_009765576.1| PREDICTED: squamosa promoter-binding-like protein 3 [Nicotiana 
sylvestris]
Length=167

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = -2

Query  701  MRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEA  522
            MR CQA+KC+ +L +AKQYH+RHKVCE+HAK+Q VVVAGLRQRFCQQCSRFHE+GEFDE+
Sbjct  44   MRCCQADKCTVNLSDAKQYHKRHKVCEYHAKSQAVVVAGLRQRFCQQCSRFHEVGEFDES  103

Query  521  KRSCRRRLAGHNERRRK  471
            KRSCRRRLAGHNERRRK
Sbjct  104  KRSCRRRLAGHNERRRK  120



>ref|XP_004303145.1| PREDICTED: squamosa promoter-binding-like protein 4-like [Fragaria 
vesca subsp. vesca]
Length=178

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 99/138 (72%), Gaps = 15/138 (11%)
 Frame = -2

Query  704  VMRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDE  525
            +MR CQA+KC+ADL +AK YHRRHKVC+ H+KA VV+V+G+ QRFCQQCSRFHEL EFD+
Sbjct  53   MMRCCQADKCTADLSDAKLYHRRHKVCDQHSKAPVVLVSGISQRFCQQCSRFHELSEFDD  112

Query  524  AKRSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDD--KGR  351
             KRSCRRRLAGHNERRRK+ + +     + +  +  S            C +V+D   GR
Sbjct  113  TKRSCRRRLAGHNERRRKNLSETYAGGSSRKGTSTES------------CRRVEDMGSGR  160

Query  350  IQMSIQENSS-FKHFQIR  300
            IQ++IQE S+  KHFQIR
Sbjct  161  IQINIQEMSTRNKHFQIR  178



>gb|KHG24779.1| Squamosa promoter-binding-like protein 5 [Gossypium arboreum]
Length=182

 Score =   140 bits (353),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 96/133 (72%), Gaps = 9/133 (7%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQ EKC  DL  AK+YHRRHKVCE HAKA +VVVAG+RQRFCQQCSRFHEL EFDEAKR
Sbjct  58   SCQVEKCGVDLSVAKRYHRRHKVCEIHAKAPIVVVAGIRQRFCQQCSRFHELSEFDEAKR  117

Query  515  SCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDD-KGRIQMS  339
            SCR RLAGHNERRRKSSA SS    + +         +  LK+ + C QVDD + R+ ++
Sbjct  118  SCRSRLAGHNERRRKSSAESSAEGSSRKGT-------SPQLKEGH-CRQVDDQRARVPIT  169

Query  338  IQENSSFKHFQIR  300
            I  NSSFK   IR
Sbjct  170  IPGNSSFKRSHIR  182



>ref|XP_007149482.1| hypothetical protein PHAVU_005G074000g [Phaseolus vulgaris]
 gb|ESW21476.1| hypothetical protein PHAVU_005G074000g [Phaseolus vulgaris]
Length=191

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 92/132 (70%), Gaps = 9/132 (7%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            +CQAE C ADL  AK+YHRRHKVCE H+KA  V+VAG+RQRFCQQCSRFHEL EFDEAKR
Sbjct  69   ACQAEMCCADLTVAKRYHRRHKVCELHSKAPFVMVAGMRQRFCQQCSRFHELAEFDEAKR  128

Query  515  SCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMSI  336
            SCRRRLA HNERRRK        S A       S ++ Q+  + ++C   DD GRIQM++
Sbjct  129  SCRRRLARHNERRRK--------SNAETCNEGCSGSKGQHPAE-SLCRNADDWGRIQMNM  179

Query  335  QENSSFKHFQIR  300
              NS ++ F  R
Sbjct  180  ARNSGYRSFHFR  191



>gb|AIE89804.1| SQUAMOSA promoter binding protein-like 15, partial [Salvia miltiorrhiza]
Length=133

 Score =   138 bits (348),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = -2

Query  704  VMRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDE  525
              RSCQAE C+AD+ +AK YHRRHKVCEFHAKA VV+++GLRQRFCQQCSRFHEL EFDE
Sbjct  51   TQRSCQAEDCTADMADAKPYHRRHKVCEFHAKAAVVLLSGLRQRFCQQCSRFHELSEFDE  110

Query  524  AKRSCRRRLAGHNERRRK  471
            AKRSCRRRLAGHNERRRK
Sbjct  111  AKRSCRRRLAGHNERRRK  128



>gb|KDP45880.1| hypothetical protein JCGZ_15324 [Jatropha curcas]
Length=211

 Score =   140 bits (353),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 97/135 (72%), Gaps = 3/135 (2%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQ EKC ADL +AK+YHRRHKVCE HAKA  V+VAGLRQRFCQQCSRFHEL EFDEAKR
Sbjct  76   SCQVEKCGADLSDAKRYHRRHKVCEVHAKAPAVIVAGLRQRFCQQCSRFHELSEFDEAKR  135

Query  515  SCRRRLAGHNERRRKssaissessqaaeavaassSTR-NQYLKDINVCGQVDDKGRIQMS  339
            SCRRRLAGHNERRRKS +  S    ++ + ++ S       LK+     QV+++ + Q++
Sbjct  136  SCRRRLAGHNERRRKSLSAESNGESSSLSSSSRSKGAFGAQLKETQCLRQVEERPKYQIT  195

Query  338  I--QENSSFKHFQIR  300
            I    NS +K  Q+R
Sbjct  196  IPLPGNSDYKRSQLR  210



>gb|KEH19523.1| squamosa promoter-binding-like protein [Medicago truncatula]
Length=180

 Score =   139 bits (350),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 92/131 (70%), Gaps = 15/131 (11%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE+C ADL +AK+YHRRHKVCEFH+KA VVVVAG+RQRFCQQCSRFH+L EFDE+KRS
Sbjct  65   CQAERCGADLTDAKRYHRRHKVCEFHSKAPVVVVAGMRQRFCQQCSRFHDLVEFDESKRS  124

Query  512  CRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMSIQ  333
            CRRRLAGHNERRRK        +    A   SS ++ Q+      C       RIQM++ 
Sbjct  125  CRRRLAGHNERRRK--------TNPETANEGSSHSKGQHQPKETQC-------RIQMNLP  169

Query  332  ENSSFKHFQIR  300
             +S +K F IR
Sbjct  170  GSSGYKSFNIR  180



>ref|XP_003540473.1| PREDICTED: squamosa promoter-binding protein 2 [Glycine max]
 gb|KHN28074.1| Squamosa promoter-binding-like protein 12 [Glycine soja]
Length=187

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 90/132 (68%), Gaps = 9/132 (7%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQAE C ADL  AK+YHRRHKVCE H+KA  V+VAGLRQRFCQQCSRF EL EFDEAKR
Sbjct  65   SCQAEMCGADLTVAKRYHRRHKVCELHSKAPSVMVAGLRQRFCQQCSRFQELAEFDEAKR  124

Query  515  SCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMSI  336
            SCRRRLA HNERRRK        S A       S ++ Q+  + + C   D  GRIQM+I
Sbjct  125  SCRRRLARHNERRRK--------SNAETCNEGCSGSKGQHPTESH-CRNADVWGRIQMNI  175

Query  335  QENSSFKHFQIR  300
             +NS +  F IR
Sbjct  176  AKNSGYNSFHIR  187



>ref|XP_002533086.1| Squamosa promoter-binding protein, putative [Ricinus communis]
 gb|EEF29301.1| Squamosa promoter-binding protein, putative [Ricinus communis]
Length=198

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 94/133 (71%), Gaps = 9/133 (7%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQ E+C ADL +AK+YHRRHKVCE HAKA  VVVAGLRQRFCQQCSRFHEL EFDEAKRS
Sbjct  73   CQVERCGADLTDAKRYHRRHKVCEIHAKAPAVVVAGLRQRFCQQCSRFHELVEFDEAKRS  132

Query  512  CRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMSIQ  333
            CRRRLAGHNERRRKSSA S     + +   +     +        C  VD++G+ Q++I 
Sbjct  133  CRRRLAGHNERRRKSSAESYGEGSSRKGPFSGQLKESH-------CRHVDERGKYQITIP  185

Query  332  E--NSSFKHFQIR  300
               +S++K  QIR
Sbjct  186  TAGSSAYKRSQIR  198



>ref|XP_009382775.1| PREDICTED: squamosa promoter-binding protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=178

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 86/131 (66%), Gaps = 27/131 (21%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQ + C+ADL EAK+YHRRHKVCE H+KA VVVVAGLRQRFCQQCSRFHEL EFD++KRS
Sbjct  75   CQVDDCAADLREAKRYHRRHKVCEAHSKAAVVVVAGLRQRFCQQCSRFHELAEFDDSKRS  134

Query  512  CRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMSIQ  333
            CRRRLAGHNERRRK                   S+ +   +  N C + D  G       
Sbjct  135  CRRRLAGHNERRRK-------------------SSTDTQPEGSNRCREADLPG-------  168

Query  332  ENSSFKHFQIR  300
             N ++KHFQIR
Sbjct  169  -NPAYKHFQIR  178



>gb|ADY75712.1| SPL3-like protein [Eucalyptus globulus]
Length=147

 Score =   136 bits (342),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 70/79 (89%), Gaps = 2/79 (3%)
 Frame = -2

Query  707  PVMRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFD  528
            P M  CQAE CS D+ +AK+YHRRHKVCEFHAKA V +VAGLRQRFCQQCSRFHEL EFD
Sbjct  60   PPM--CQAENCSIDMTDAKRYHRRHKVCEFHAKASVAMVAGLRQRFCQQCSRFHELSEFD  117

Query  527  EAKRSCRRRLAGHNERRRK  471
            EAKRSCRRRLAGHNERRRK
Sbjct  118  EAKRSCRRRLAGHNERRRK  136



>gb|AAV51939.1| SBP transcription factor [Gossypium hirsutum]
Length=169

 Score =   136 bits (343),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 98/136 (72%), Gaps = 11/136 (8%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            +CQ EKC  DL +AK+YHRRHKVCE HAKA  VVVAGLRQRFCQQCSRFHEL EFDEAKR
Sbjct  41   ACQVEKCGLDLSDAKRYHRRHKVCEIHAKAPFVVVAGLRQRFCQQCSRFHELPEFDEAKR  100

Query  515  SCRRRLAGHNERRRKssaissessqaaeavaassSTR---NQYLKDINVCGQVDDKGRIQ  345
            SCRRRLAGHNERRRKSSA SS +++++       S +   + YL D       D + R+ 
Sbjct  101  SCRRRLAGHNERRRKSSAESSSAAESSNRRGMMISAQLKESHYLAD-------DQRARVN  153

Query  344  -MSIQENSSFKHFQIR  300
             M+I  +SSFK  QIR
Sbjct  154  PMAIHGSSSFKRSQIR  169



>gb|AIL95850.1| SQUAMOSA promoter binding-like transcription factor [Gossypium 
hirsutum]
 gb|KHG05742.1| Squamosa promoter-binding-like protein 5 [Gossypium arboreum]
Length=182

 Score =   137 bits (344),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 98/136 (72%), Gaps = 11/136 (8%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            +CQ EKC  DL +AK+YHRRHKVCE HAKA  VVVAGLRQRFCQQCSRFHEL EFDEAKR
Sbjct  54   ACQVEKCGLDLSDAKRYHRRHKVCEIHAKAPFVVVAGLRQRFCQQCSRFHELPEFDEAKR  113

Query  515  SCRRRLAGHNERRRKssaissessqaaeavaassSTR---NQYLKDINVCGQVDDKGRIQ  345
            SCRRRLAGHNERRRKSSA SS +++++       S +   + YL D       D + R+ 
Sbjct  114  SCRRRLAGHNERRRKSSAESSSAAESSNRRGMMISAQLKESHYLAD-------DQRARVN  166

Query  344  -MSIQENSSFKHFQIR  300
             M+I  +SSFK  QIR
Sbjct  167  PMAIHGSSSFKRSQIR  182



>emb|CDY25876.1| BnaA05g14670D [Brassica napus]
Length=176

 Score =   136 bits (343),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 90/134 (67%), Gaps = 13/134 (10%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R CQ ++C+ DL EAKQYHRRHKVCE HAKA  V +AG++QRFCQQCSRFHEL EFDEAK
Sbjct  55   RLCQVDRCTTDLKEAKQYHRRHKVCEVHAKASSVYLAGVKQRFCQQCSRFHELPEFDEAK  114

Query  518  RSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMS  339
            RSCRRRLAGHNERRRKSS  S            S   +NQ            ++ R++M+
Sbjct  115  RSCRRRLAGHNERRRKSSGESFGEGAGGRRGVTSQVMQNQ------------ERSRVEMT  162

Query  338  I-QENSSFKHFQIR  300
            +   NSSFK  QIR
Sbjct  163  LPMSNSSFKRPQIR  176



>ref|XP_009602314.1| PREDICTED: squamosa promoter-binding protein 1-like isoform X2 
[Nicotiana tomentosiformis]
Length=136

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = -2

Query  707  PVMRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFD  528
            P + SCQ E+C+AD+ +AK YHRRHKVCEFH+KA VV+++G++QRFCQQCSRFH+L EFD
Sbjct  47   PALPSCQIEQCTADMADAKPYHRRHKVCEFHSKAPVVLISGIQQRFCQQCSRFHQLAEFD  106

Query  527  EAKRSCRRRLAGHNERRRK  471
            EAKRSCRRRLAGHNERRRK
Sbjct  107  EAKRSCRRRLAGHNERRRK  125



>ref|XP_010675500.1| PREDICTED: squamosa promoter-binding-like protein 4 [Beta vulgaris 
subsp. vulgaris]
Length=252

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQAEKC+ADL +AK+YHRRHKVCEFHAKA  V+V+ LRQRFCQQCSRFHEL EFDE KR
Sbjct  125  SCQAEKCTADLTDAKRYHRRHKVCEFHAKAPSVLVSNLRQRFCQQCSRFHELSEFDETKR  184

Query  515  SCRRRLAGHNERRRK  471
            SCRRRLAGHNERRRK
Sbjct  185  SCRRRLAGHNERRRK  199



>ref|XP_004510032.1| PREDICTED: squamosa promoter-binding-like protein 13-like [Cicer 
arietinum]
Length=187

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQAE+C ADL +AK+YHRRHKVCEFH+KA VVVVAGLRQRFCQQCSRFH+L EFDE+KR
Sbjct  70   SCQAERCGADLTDAKRYHRRHKVCEFHSKAPVVVVAGLRQRFCQQCSRFHDLVEFDESKR  129

Query  515  SCRRRLAGHNERRRK  471
            SCRRRLAGHNERRRK
Sbjct  130  SCRRRLAGHNERRRK  144



>ref|XP_009622640.1| PREDICTED: squamosa promoter-binding protein 1 [Nicotiana tomentosiformis]
 ref|XP_009622641.1| PREDICTED: squamosa promoter-binding protein 1 [Nicotiana tomentosiformis]
Length=140

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = -2

Query  701  MRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEA  522
            + SCQ E C+AD+  AK YHRRHKVCEFHAKA  V++ GLRQRFCQQCSRFH+LGEFDEA
Sbjct  53   LPSCQIEDCTADMANAKTYHRRHKVCEFHAKAPAVLIGGLRQRFCQQCSRFHQLGEFDEA  112

Query  521  KRSCRRRLAGHNERRRK  471
            KRSCRRRLAGHNERRRK
Sbjct  113  KRSCRRRLAGHNERRRK  129



>ref|XP_006858268.1| hypothetical protein AMTR_s00062p00211520 [Amborella trichopoda]
 gb|ERN19735.1| hypothetical protein AMTR_s00062p00211520 [Amborella trichopoda]
Length=195

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 94/143 (66%), Gaps = 12/143 (8%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE+C ADL  AK+YHRRHKVCE H+K+   +VAGL QRFCQQCSRFHEL EFDEAKRS
Sbjct  53   CQAERCRADLSAAKRYHRRHKVCEVHSKSPSTLVAGLLQRFCQQCSRFHELSEFDEAKRS  112

Query  512  CRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKD-INVC--------GQVDD  360
            CRRRLAGHNERRRK+ +     +       A +   N  LKD  N+C             
Sbjct  113  CRRRLAGHNERRRKTPSTEGGVNGRRGGAVAIAIDHNHQLKDNSNICRHNTTDQVATAAA  172

Query  359  KGRIQMS-IQEN--SSFKHFQIR  300
              R+Q++ +Q N  SS+KHFQIR
Sbjct  173  ATRMQINPLQPNPTSSYKHFQIR  195



>ref|XP_010545847.1| PREDICTED: squamosa promoter-binding-like protein 5 [Tarenaya 
hassleriana]
Length=187

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 89/135 (66%), Gaps = 20/135 (15%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQ EKC+ADL EAKQYHRRHKVCE HAKA   +VAG+RQRFCQQCSRFHEL EFDEAKRS
Sbjct  69   CQVEKCTADLMEAKQYHRRHKVCEVHAKATAAMVAGVRQRFCQQCSRFHELLEFDEAKRS  128

Query  512  CRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQV---DDKGRIQM  342
            CRRRLAGHNERRRKSS  S                         V GQ+    ++ R++M
Sbjct  129  CRRRLAGHNERRRKSSGDSFGEGSGRR----------------GVSGQLMQTQERNRVEM  172

Query  341  SI-QENSSFKHFQIR  300
            ++   N SFK  QIR
Sbjct  173  TLPMSNPSFKRSQIR  187



>ref|XP_009760116.1| PREDICTED: squamosa promoter-binding protein 1 [Nicotiana sylvestris]
Length=136

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = -2

Query  701  MRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEA  522
            + SCQ E C+AD+  AK YHRRHKVCEFHAKA  V++ GLRQRFCQQCSRFH+LGEFDEA
Sbjct  49   LPSCQIEDCTADMANAKTYHRRHKVCEFHAKAPAVLIGGLRQRFCQQCSRFHQLGEFDEA  108

Query  521  KRSCRRRLAGHNERRRK  471
            KRSCRRRLAGHNERRRK
Sbjct  109  KRSCRRRLAGHNERRRK  125



>ref|XP_010057392.1| PREDICTED: squamosa promoter-binding-like protein 3 [Eucalyptus 
grandis]
 gb|KCW74549.1| hypothetical protein EUGRSUZ_E03260 [Eucalyptus grandis]
Length=147

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE CS D+ +AK+YHRRHKVCEFHAKA V +VAGLRQRFCQQCSRFHEL EFDE KRS
Sbjct  63   CQAENCSVDMTDAKRYHRRHKVCEFHAKASVAMVAGLRQRFCQQCSRFHELSEFDETKRS  122

Query  512  CRRRLAGHNERRRK  471
            CRRRLAGHNERRRK
Sbjct  123  CRRRLAGHNERRRK  136



>ref|XP_009763062.1| PREDICTED: squamosa promoter-binding protein 1-like isoform X2 
[Nicotiana sylvestris]
Length=133

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = -2

Query  707  PVMRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFD  528
            P + SCQ E+C+AD+  AK YHRRHKVCEFH+KA VV+++G++QRFCQQCSRFH+L EFD
Sbjct  44   PALPSCQVEQCTADMAGAKPYHRRHKVCEFHSKAPVVLISGIQQRFCQQCSRFHQLPEFD  103

Query  527  EAKRSCRRRLAGHNERRRK  471
            EAKRSCRRRLAGHNERRRK
Sbjct  104  EAKRSCRRRLAGHNERRRK  122



>ref|XP_006295226.1| hypothetical protein CARUB_v10024311mg [Capsella rubella]
 gb|EOA28124.1| hypothetical protein CARUB_v10024311mg [Capsella rubella]
Length=130

 Score =   133 bits (335),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R CQ E C+AD+ +AKQYH+RHKVCEFHAKA +V ++GL QRFCQQCSRFHELGEFDEAK
Sbjct  51   RVCQVESCTADMSKAKQYHKRHKVCEFHAKAPIVRISGLHQRFCQQCSRFHELGEFDEAK  110

Query  518  RSCRRRLAGHNERRRK  471
            RSCRRRLAGHNERRRK
Sbjct  111  RSCRRRLAGHNERRRK  126



>ref|XP_004293885.1| PREDICTED: squamosa promoter-binding protein 1-like [Fragaria 
vesca subsp. vesca]
Length=157

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQA+ C+ADL +AKQY+RRHKVC+FH+KA VVV+ GLRQRFCQQCSRFH+L EFDE KR
Sbjct  76   SCQAQSCNADLSDAKQYYRRHKVCDFHSKAPVVVIGGLRQRFCQQCSRFHDLSEFDENKR  135

Query  515  SCRRRLAGHNERRRK  471
            SCRRRLAGHNERRRK
Sbjct  136  SCRRRLAGHNERRRK  150



>emb|CDY27935.1| BnaCnng05200D [Brassica napus]
Length=147

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            +CQ E+C+AD+  AKQYHRRHKVCEFHAKA VV + GL QRFCQQCSRFHELGEFDE+KR
Sbjct  54   ACQVERCTADMSRAKQYHRRHKVCEFHAKAPVVRIYGLHQRFCQQCSRFHELGEFDESKR  113

Query  515  SCRRRLAGHNERRRK  471
            SCRRRLAGHNERRRK
Sbjct  114  SCRRRLAGHNERRRK  128



>emb|CDO99517.1| unnamed protein product [Coffea canephora]
Length=137

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = -2

Query  707  PVMRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFD  528
            P+  SCQ + CSAD+ ++K YHRRHKVCE H+KA +V+VAG+RQRFCQQCSRFH+L EFD
Sbjct  50   PIQPSCQVDDCSADMKDSKPYHRRHKVCEHHSKAPIVLVAGVRQRFCQQCSRFHDLSEFD  109

Query  527  EAKRSCRRRLAGHNERRRK  471
            EAKRSCRRRLAGHNERRRK
Sbjct  110  EAKRSCRRRLAGHNERRRK  128



>ref|XP_006447264.1| hypothetical protein CICLE_v10016841mg [Citrus clementina]
 gb|ESR60504.1| hypothetical protein CICLE_v10016841mg [Citrus clementina]
Length=173

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 94/134 (70%), Gaps = 22/134 (16%)
 Frame = -2

Query  701  MRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEA  522
            +RSCQ +KC+ADL +AKQYHRRHKVCE HAKAQVV++ G+RQRFCQQCS           
Sbjct  62   LRSCQVDKCAADLSDAKQYHRRHKVCEVHAKAQVVLMGGMRQRFCQQCS-----------  110

Query  521  KRSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQM  342
                 RRLAGHNERRRK++A S+    + +            LKD+ VCG++DDKGRI++
Sbjct  111  -----RRLAGHNERRRKNAAESNGEGSSCKGTGT-----GTQLKDL-VCGKLDDKGRIKI  159

Query  341  SIQENSSFKHFQIR  300
            SIQEN++ KHFQIR
Sbjct  160  SIQENATCKHFQIR  173



>ref|XP_007021544.1| Squamosa promoter binding protein-like 3 isoform 2, partial [Theobroma 
cacao]
 gb|EOY13069.1| Squamosa promoter binding protein-like 3 isoform 2, partial [Theobroma 
cacao]
Length=258

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQ EKC  DL +AK+YHRRHKVCE HAKA  VVVAGLRQRFCQQCSRFHEL EFDEAKR
Sbjct  112  SCQVEKCGLDLSDAKRYHRRHKVCEIHAKAPFVVVAGLRQRFCQQCSRFHELSEFDEAKR  171

Query  515  SCRRRLAGHNERRRK  471
            SCRRRLAGHNERRRK
Sbjct  172  SCRRRLAGHNERRRK  186



>ref|XP_009340759.1| PREDICTED: squamosa promoter-binding protein 1-like [Pyrus x 
bretschneideri]
Length=189

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQAE+C ADL +AK+YHRRHKVCEFH+KA VV+V+G RQRFCQQCSRFHEL EFDEAKR
Sbjct  73   SCQAERCGADLVDAKRYHRRHKVCEFHSKAAVVIVSGTRQRFCQQCSRFHELIEFDEAKR  132

Query  515  SCRRRLAGHNERRRK  471
            SCRRRLAGHNERRRK
Sbjct  133  SCRRRLAGHNERRRK  147



>gb|ADL36826.1| SPL domain class transcription factor [Malus domestica]
Length=189

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 92/132 (70%), Gaps = 15/132 (11%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQAE+C ADL +AK+YHRRHKVCEFH+KA VV+V+G RQRFCQQCSRFHEL EFDEAKR
Sbjct  73   SCQAERCGADLVDAKRYHRRHKVCEFHSKAAVVIVSGTRQRFCQQCSRFHELIEFDEAKR  132

Query  515  SCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMSI  336
            SCRRRLAGHNERRRKSS      S +   V       +QY          + + R Q++ 
Sbjct  133  SCRRRLAGHNERRRKSSGEPYGESSSRRVVG------HQYK---------ESQTRYQITP  177

Query  335  QENSSFKHFQIR  300
              NSS KH QIR
Sbjct  178  PGNSSSKHCQIR  189



>ref|XP_003560169.2| PREDICTED: squamosa promoter-binding-like protein 13 [Brachypodium 
distachyon]
Length=176

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQAE+C ADL EAK+YHRRHKVCE HAKA VV+VAGLRQRFCQQCSRFHEL EFD+ KR
Sbjct  68   SCQAERCPADLTEAKRYHRRHKVCEAHAKAAVVLVAGLRQRFCQQCSRFHELLEFDDTKR  127

Query  515  SCRRRLAGHNERRRK  471
            SCRRRLAGHNERRRK
Sbjct  128  SCRRRLAGHNERRRK  142



>ref|XP_008386198.1| PREDICTED: squamosa promoter-binding protein 1 [Malus domestica]
Length=189

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 92/132 (70%), Gaps = 15/132 (11%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQAE+C ADL +AK+YHRRHKVCEFH+KA VV+V+G RQRFCQQCSRFHEL EFDEAKR
Sbjct  73   SCQAERCGADLVDAKRYHRRHKVCEFHSKAAVVIVSGTRQRFCQQCSRFHELIEFDEAKR  132

Query  515  SCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMSI  336
            SCRRRLAGHNERRRKSS      S +   V       +QY          + + R Q++ 
Sbjct  133  SCRRRLAGHNERRRKSSGEPYGESSSRRVVG------HQYK---------ESQTRYQITP  177

Query  335  QENSSFKHFQIR  300
              NSS KH QIR
Sbjct  178  PGNSSSKHCQIR  189



>ref|XP_007021543.1| Squamosa promoter binding protein-like 3 isoform 1 [Theobroma 
cacao]
 gb|EOY13068.1| Squamosa promoter binding protein-like 3 isoform 1 [Theobroma 
cacao]
Length=232

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQ EKC  DL +AK+YHRRHKVCE HAKA  VVVAGLRQRFCQQCSRFHEL EFDEAKR
Sbjct  67   SCQVEKCGLDLSDAKRYHRRHKVCEIHAKAPFVVVAGLRQRFCQQCSRFHELSEFDEAKR  126

Query  515  SCRRRLAGHNERRRK  471
            SCRRRLAGHNERRRK
Sbjct  127  SCRRRLAGHNERRRK  141



>ref|XP_009397190.1| PREDICTED: LOW QUALITY PROTEIN: squamosa promoter-binding protein 
1 [Musa acuminata subsp. malaccensis]
Length=155

 Score =   133 bits (335),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAEKC+ADL EAK+Y+RRHKVCE H+KA VV+VAGLRQRFCQQCSRFHEL EFD++KRS
Sbjct  72   CQAEKCTADLAEAKRYYRRHKVCEAHSKAAVVIVAGLRQRFCQQCSRFHELSEFDDSKRS  131

Query  512  CRRRLAGHNERRRK  471
            CRRRLAGHNERRRK
Sbjct  132  CRRRLAGHNERRRK  145



>ref|XP_009144795.1| PREDICTED: squamosa promoter-binding-like protein 5 [Brassica 
rapa]
Length=183

 Score =   134 bits (337),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 89/134 (66%), Gaps = 13/134 (10%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R CQ ++C+ DL EAKQYHRRHKVCE HAKA  V +AG++QRFCQQCSRFHEL EFDEAK
Sbjct  62   RLCQVDRCTTDLKEAKQYHRRHKVCEVHAKASSVYLAGVKQRFCQQCSRFHELPEFDEAK  121

Query  518  RSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMS  339
            RSCRRRLAGHNERRRKSS  S            S   + Q            ++ R++M+
Sbjct  122  RSCRRRLAGHNERRRKSSGESFGEGAGGRRGVTSQGMQKQ------------ERSRVEMT  169

Query  338  I-QENSSFKHFQIR  300
            +   NSSFK  QIR
Sbjct  170  LPMSNSSFKRPQIR  183



>gb|KDO42133.1| hypothetical protein CISIN_1g029650mg [Citrus sinensis]
Length=174

 Score =   134 bits (336),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 93/134 (69%), Gaps = 22/134 (16%)
 Frame = -2

Query  701  MRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEA  522
            +RSCQ +KC ADL +AKQYHRRHKVCE HAKAQVV++ G+RQRFCQQCS           
Sbjct  63   LRSCQVDKCGADLSDAKQYHRRHKVCEVHAKAQVVLMGGIRQRFCQQCS-----------  111

Query  521  KRSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQM  342
                 RRLAGHNERRRK++A S+    + +            LKD+ VCG++DDKGRI++
Sbjct  112  -----RRLAGHNERRRKNAAESNGEGSSCKGTGT-----GTQLKDL-VCGKLDDKGRIKI  160

Query  341  SIQENSSFKHFQIR  300
            SIQEN++ KHFQIR
Sbjct  161  SIQENATCKHFQIR  174



>ref|XP_007025578.1| Squamosa promoter binding protein-like 3 [Theobroma cacao]
 gb|EOY28200.1| Squamosa promoter binding protein-like 3 [Theobroma cacao]
Length=141

 Score =   132 bits (333),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -2

Query  704  VMRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDE  525
             + SCQ E C+ D+++AK+YHRRHKVCEFHAKA VV V+GL+QRFCQQCSRFHEL EFDE
Sbjct  52   ALPSCQVENCTTDMNDAKRYHRRHKVCEFHAKAPVVRVSGLQQRFCQQCSRFHELSEFDE  111

Query  524  AKRSCRRRLAGHNERRRK  471
            AKRSCRRRLAGHNERRRK
Sbjct  112  AKRSCRRRLAGHNERRRK  129



>ref|XP_011096328.1| PREDICTED: squamosa promoter-binding protein 1 [Sesamum indicum]
Length=131

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -2

Query  704  VMRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDE  525
              RSCQ E C+AD+ +A+ YHRRHKVCEFHAKA VV +AGL+QRFCQQCSRFHEL EFDE
Sbjct  48   TQRSCQVEDCTADMADARPYHRRHKVCEFHAKAAVVFLAGLQQRFCQQCSRFHELQEFDE  107

Query  524  AKRSCRRRLAGHNERRRK  471
            AKRSCRRRLAGHNERRRK
Sbjct  108  AKRSCRRRLAGHNERRRK  125



>ref|XP_010479860.1| PREDICTED: squamosa promoter-binding-like protein 4 [Camelina 
sativa]
Length=180

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 90/137 (66%), Gaps = 20/137 (15%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R CQ ++C+ADL EAKQYHRRHKVCE HAKA  V ++G+ QRFCQQCSRFHEL EFDEAK
Sbjct  60   RLCQVDRCTADLKEAKQYHRRHKVCEVHAKASSVFLSGVSQRFCQQCSRFHELQEFDEAK  119

Query  518  RSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQV---DDKGRI  348
            RSCRRRLAGHNERRRKSS  S                         + GQV    ++ R+
Sbjct  120  RSCRRRLAGHNERRRKSSGESFGEGSGRR----------------GITGQVIQNQERSRV  163

Query  347  QMSI-QENSSFKHFQIR  300
            +M++   NSSFK  QIR
Sbjct  164  EMTLPMPNSSFKRPQIR  180



>ref|XP_010462181.1| PREDICTED: squamosa promoter-binding-like protein 4 isoform X2 
[Camelina sativa]
Length=182

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 90/137 (66%), Gaps = 20/137 (15%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R CQ ++C+ADL EAKQYHRRHKVCE HAKA  V ++G+ QRFCQQCSRFHEL EFDEAK
Sbjct  62   RLCQVDRCTADLKEAKQYHRRHKVCEVHAKASSVFLSGVSQRFCQQCSRFHELQEFDEAK  121

Query  518  RSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQV---DDKGRI  348
            RSCRRRLAGHNERRRKSS  S                         + GQV    ++ R+
Sbjct  122  RSCRRRLAGHNERRRKSSGESFGEGSGRRV----------------ITGQVIQNQERSRV  165

Query  347  QMSI-QENSSFKHFQIR  300
            +M++   NSSFK  QIR
Sbjct  166  EMTLPMPNSSFKRPQIR  182



>ref|XP_007213489.1| hypothetical protein PRUPE_ppa022739mg [Prunus persica]
 gb|EMJ14688.1| hypothetical protein PRUPE_ppa022739mg [Prunus persica]
Length=162

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE+C AD  EAK+Y+RRHKVCEFH+KA VV+V+GLRQRFCQQCSRFHEL EFDEAKRS
Sbjct  66   CQAERCGADFVEAKRYYRRHKVCEFHSKAPVVMVSGLRQRFCQQCSRFHELTEFDEAKRS  125

Query  512  CRRRLAGHNERRRK  471
            CRRRLAGHNERRRK
Sbjct  126  CRRRLAGHNERRRK  139



>ref|XP_008226482.1| PREDICTED: squamosa promoter-binding-like protein 3 [Prunus mume]
Length=162

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE+C AD  EAK+Y+RRHKVCEFH+KA VV+V+GLRQRFCQQCSRFHEL EFDEAKRS
Sbjct  66   CQAERCGADFVEAKRYYRRHKVCEFHSKAPVVMVSGLRQRFCQQCSRFHELTEFDEAKRS  125

Query  512  CRRRLAGHNERRRK  471
            CRRRLAGHNERRRK
Sbjct  126  CRRRLAGHNERRRK  139



>gb|EYU27990.1| hypothetical protein MIMGU_mgv1a015969mg [Erythranthe guttata]
Length=139

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = -2

Query  707  PVMRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFD  528
               RSCQ E C AD++ AK YHRRHKVCEFHAKA VV+++ LRQRFCQQCSRFHEL EFD
Sbjct  55   STQRSCQVEDCLADMNAAKAYHRRHKVCEFHAKATVVLLSELRQRFCQQCSRFHELSEFD  114

Query  527  EAKRSCRRRLAGHNERRRK  471
            EAKRSCRRRLAGHNERRRK
Sbjct  115  EAKRSCRRRLAGHNERRRK  133



>sp|Q38741.1|SBP1_ANTMA RecName: Full=Squamosa promoter-binding protein 1 [Antirrhinum 
majus]
 emb|CAA63113.1| squamosa-promoter binding protein 1 [Antirrhinum majus]
Length=131

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -2

Query  704  VMRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDE  525
              RSCQ E C+A++  AK YHRRHKVCEFHAKA VV+ +GL+QRFCQQCSRFHEL EFDE
Sbjct  48   TQRSCQVENCAAEMTNAKPYHRRHKVCEFHAKAPVVLHSGLQQRFCQQCSRFHELSEFDE  107

Query  524  AKRSCRRRLAGHNERRRK  471
            AKRSCRRRLAGHNERRRK
Sbjct  108  AKRSCRRRLAGHNERRRK  125



>ref|XP_009356783.1| PREDICTED: squamosa promoter-binding protein 1-like [Pyrus x 
bretschneideri]
Length=189

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQAE+C ADL +AK+Y+RRHKVCEFH+KA VV+V+G++QRFCQQCSRFHEL EFDEAKR
Sbjct  73   SCQAERCGADLVDAKRYNRRHKVCEFHSKAAVVIVSGIQQRFCQQCSRFHELTEFDEAKR  132

Query  515  SCRRRLAGHNERRRK  471
            SCRRRLAGHNERRRK
Sbjct  133  SCRRRLAGHNERRRK  147



>emb|CAB56584.1| squamosa promoter binding protein-like 4 [Arabidopsis thaliana]
Length=167

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 93/137 (68%), Gaps = 16/137 (12%)
 Frame = -2

Query  701  MRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEA  522
            +R CQ ++C+AD+ EAK YHRRHKVCE HAKA  V ++GL QRFCQQCSRFH+L EFDEA
Sbjct  44   LRLCQVDRCTADMKEAKLYHRRHKVCEVHAKASSVFLSGLNQRFCQQCSRFHDLQEFDEA  103

Query  521  KRSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDIN--VCGQVDDKGRI  348
            KRSCRRRLAGHNERRRKSS  S+    +               + IN  V  Q  ++ R+
Sbjct  104  KRSCRRRLAGHNERRRKSSGESTYGEGSGR-------------RGINGQVVMQNQERSRV  150

Query  347  QMSI-QENSSFKHFQIR  300
            +M++   NSSFK  QIR
Sbjct  151  EMTLPMPNSSFKRPQIR  167



>ref|NP_175723.1| squamosa promoter binding protein-like 4 [Arabidopsis thaliana]
 ref|NP_974014.1| squamosa promoter binding protein-like 4 [Arabidopsis thaliana]
 sp|Q9S7A9.1|SPL4_ARATH RecName: Full=Squamosa promoter-binding-like protein 4 [Arabidopsis 
thaliana]
 gb|AAF69527.1|AC008007_2 F12M16.2 [Arabidopsis thaliana]
 emb|CAB56582.1| squamosa promoter binding protein-like 4 [Arabidopsis thaliana]
 emb|CAB56583.1| squamosa promoter binding protein-like 4 [Arabidopsis thaliana]
 gb|AAM61465.1| transcription factor, putative [Arabidopsis thaliana]
 gb|AAO22673.1| putative transcription factor [Arabidopsis thaliana]
 gb|AAO42385.1| putative transcription factor [Arabidopsis thaliana]
 gb|AEE32896.1| squamosa promoter binding protein-like 4 [Arabidopsis thaliana]
 gb|AEE32897.1| squamosa promoter binding protein-like 4 [Arabidopsis thaliana]
Length=174

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 93/137 (68%), Gaps = 16/137 (12%)
 Frame = -2

Query  701  MRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEA  522
            +R CQ ++C+AD+ EAK YHRRHKVCE HAKA  V ++GL QRFCQQCSRFH+L EFDEA
Sbjct  51   LRLCQVDRCTADMKEAKLYHRRHKVCEVHAKASSVFLSGLNQRFCQQCSRFHDLQEFDEA  110

Query  521  KRSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDIN--VCGQVDDKGRI  348
            KRSCRRRLAGHNERRRKSS  S+    +               + IN  V  Q  ++ R+
Sbjct  111  KRSCRRRLAGHNERRRKSSGESTYGEGSGR-------------RGINGQVVMQNQERSRV  157

Query  347  QMSI-QENSSFKHFQIR  300
            +M++   NSSFK  QIR
Sbjct  158  EMTLPMPNSSFKRPQIR  174



>ref|XP_002891731.1| hypothetical protein ARALYDRAFT_474435 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67990.1| hypothetical protein ARALYDRAFT_474435 [Arabidopsis lyrata subsp. 
lyrata]
Length=173

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 90/134 (67%), Gaps = 13/134 (10%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R CQ ++C++D+ EAK YHRRHKVCE HAKA  V ++GL QRFCQQCSRFHEL EFDEAK
Sbjct  52   RLCQVDRCTSDMKEAKLYHRRHKVCEVHAKASSVFLSGLNQRFCQQCSRFHELQEFDEAK  111

Query  518  RSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMS  339
            RSCRRRLAGHNERRRKSS  SS    +          +NQ            ++ R++M+
Sbjct  112  RSCRRRLAGHNERRRKSSGESSFGEGSGRRGITGQVIQNQ------------ERSRVEMT  159

Query  338  I-QENSSFKHFQIR  300
            +   NSSFK  QIR
Sbjct  160  LPMPNSSFKRPQIR  173



>ref|XP_009143829.1| PREDICTED: squamosa promoter-binding-like protein 3 [Brassica 
rapa]
Length=150

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            +CQ E+C+AD+  AKQYHRRHKVCEFHAKA VV + GL QRFCQQCSRFH+LGEFDE+KR
Sbjct  60   ACQVERCTADMSRAKQYHRRHKVCEFHAKAPVVRIYGLHQRFCQQCSRFHDLGEFDESKR  119

Query  515  SCRRRLAGHNERRRK  471
            SCRRRLAGHNERRRK
Sbjct  120  SCRRRLAGHNERRRK  134



>ref|XP_010469422.1| PREDICTED: squamosa promoter-binding-like protein 3 [Camelina 
sativa]
Length=135

 Score =   130 bits (327),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQ + C+AD+ +AKQYH+RHKVCEFHAKA +V ++GL QRFCQQCSRFHELGEFDEAKRS
Sbjct  58   CQVQSCTADVSKAKQYHKRHKVCEFHAKAPLVRISGLHQRFCQQCSRFHELGEFDEAKRS  117

Query  512  CRRRLAGHNERRRK  471
            CRRRLAGHNERRRK
Sbjct  118  CRRRLAGHNERRRK  131



>gb|ADG59812.1| SQUAMOSA-promoter binding protein 1, partial [Erythranthe guttata]
Length=93

 Score =   129 bits (324),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = -2

Query  707  PVMRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFD  528
               RSCQ E C AD++ AK YHRRHKVCEFHAKA VV+ + LRQRFCQQCSRFHEL EFD
Sbjct  9    STQRSCQVEDCLADMNAAKAYHRRHKVCEFHAKATVVLPSELRQRFCQQCSRFHELSEFD  68

Query  527  EAKRSCRRRLAGHNERRRK  471
            EAKRSCRRRLAGHNERRRK
Sbjct  69   EAKRSCRRRLAGHNERRRK  87



>dbj|BAJ34525.1| unnamed protein product [Thellungiella halophila]
Length=186

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 84/133 (63%), Gaps = 9/133 (7%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R CQ ++C+ADL EAKQYHRRHKVCE HAKA  V +AG+ QRFCQQCSRFHEL EFDEAK
Sbjct  63   RLCQVDRCTADLKEAKQYHRRHKVCEVHAKASSVFLAGISQRFCQQCSRFHELLEFDEAK  122

Query  518  RSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMS  339
            RSCRRRLAGHNERRRKSS  S                +NQ    + +   +         
Sbjct  123  RSCRRRLAGHNERRRKSSGESFGEGSGGRRGITGQMIQNQERSRVEIMTTLP--------  174

Query  338  IQENSSFKHFQIR  300
               NSSFK  QIR
Sbjct  175  -MSNSSFKRPQIR  186



>ref|XP_006410530.1| hypothetical protein EUTSA_v10017406mg [Eutrema salsugineum]
 gb|ESQ51983.1| hypothetical protein EUTSA_v10017406mg [Eutrema salsugineum]
Length=135

 Score =   130 bits (327),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQ E+C+AD+  AK YH+RHKVCEFHAKA +V ++GL QRFCQQCSRFHELGEFDEAKRS
Sbjct  58   CQVERCTADMSRAKNYHKRHKVCEFHAKAPLVRISGLHQRFCQQCSRFHELGEFDEAKRS  117

Query  512  CRRRLAGHNERRRK  471
            CRRRLAGHNERRRK
Sbjct  118  CRRRLAGHNERRRK  131



>ref|XP_006303186.1| hypothetical protein CARUB_v10010422mg [Capsella rubella]
 gb|EOA36084.1| hypothetical protein CARUB_v10010422mg [Capsella rubella]
Length=180

 Score =   131 bits (330),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 90/138 (65%), Gaps = 20/138 (14%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R CQ ++C+ADL EAKQYHRRHKVCE HAKA  V ++G+ QRFCQQCSRFHE+ EFDEAK
Sbjct  58   RLCQVDRCTADLKEAKQYHRRHKVCEVHAKASSVFLSGVSQRFCQQCSRFHEIQEFDEAK  117

Query  518  RSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQV----DDKGR  351
            RSCRRRLAGHNERRRKSS  S                         + GQV     ++ R
Sbjct  118  RSCRRRLAGHNERRRKSSGESFGEGSGRRG---------------GITGQVLIQNQERSR  162

Query  350  IQMSI-QENSSFKHFQIR  300
            ++M++   NSSFK  QIR
Sbjct  163  VEMTLPMPNSSFKRPQIR  180



>ref|XP_009602313.1| PREDICTED: squamosa promoter-binding protein 1-like isoform X1 
[Nicotiana tomentosiformis]
Length=138

 Score =   130 bits (327),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 72/81 (89%), Gaps = 2/81 (2%)
 Frame = -2

Query  707  PVMRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQC--SRFHELGE  534
            P + SCQ E+C+AD+ +AK YHRRHKVCEFH+KA VV+++G++QRFCQQC  SRFH+L E
Sbjct  47   PALPSCQIEQCTADMADAKPYHRRHKVCEFHSKAPVVLISGIQQRFCQQCSRSRFHQLAE  106

Query  533  FDEAKRSCRRRLAGHNERRRK  471
            FDEAKRSCRRRLAGHNERRRK
Sbjct  107  FDEAKRSCRRRLAGHNERRRK  127



>emb|CDP05939.1| unnamed protein product [Coffea canephora]
Length=158

 Score =   130 bits (328),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 84/128 (66%), Gaps = 8/128 (6%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            C+AE C ADL ++K YH+RHKVCE+HAKA+VVVV GL+QRFCQQCSRFH+L EFDEAKRS
Sbjct  38   CRAENCKADLTDSKSYHKRHKVCEYHAKAEVVVVEGLKQRFCQQCSRFHDLSEFDEAKRS  97

Query  512  CRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMSIQ  333
            CRRRLAGHNERRRK    S             +          + C QVD++GR  + + 
Sbjct  98   CRRRLAGHNERRRKHFTESRGEGSGRRGSNPGTKK--------DQCRQVDERGRTPIVLP  149

Query  332  ENSSFKHF  309
            EN    H 
Sbjct  150  ENHQKLHI  157



>ref|XP_009147623.1| PREDICTED: squamosa promoter-binding-like protein 4 isoform X2 
[Brassica rapa]
 ref|XP_009147624.1| PREDICTED: squamosa promoter-binding-like protein 4 isoform X2 
[Brassica rapa]
Length=180

 Score =   131 bits (330),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 89/135 (66%), Gaps = 14/135 (10%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R CQ ++C+ADL EAKQYHRRHKVCE HAKA  V + G++QRFCQQCSRFHEL EFDEAK
Sbjct  58   RLCQVDRCTADLKEAKQYHRRHKVCEVHAKASSVYLTGVKQRFCQQCSRFHELLEFDEAK  117

Query  518  RSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMS  339
            RSCR+RLAGHNERRRKSS  S            +   +NQ            ++ R++M+
Sbjct  118  RSCRKRLAGHNERRRKSSGESIGEGSGGRRGITAQMIQNQ------------ERSRVEMT  165

Query  338  I--QENSSFKHFQIR  300
            +     SSFK  QIR
Sbjct  166  LPMSNTSSFKRPQIR  180



>emb|CDY61210.1| BnaC06g41420D [Brassica napus]
Length=179

 Score =   131 bits (330),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 90/134 (67%), Gaps = 13/134 (10%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R CQ ++C+ADL EAKQYHRRHKVCE HAKA  V + G++QRFCQQCSRFHEL EFDEAK
Sbjct  58   RLCQVDRCTADLKEAKQYHRRHKVCEVHAKASSVYLTGVKQRFCQQCSRFHELLEFDEAK  117

Query  518  RSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMS  339
            +SCR+RLAGHNERRRKSS  S            +   +NQ            ++ R++M+
Sbjct  118  KSCRKRLAGHNERRRKSSGESIGEGSGGRRGITAQMIQNQ------------ERSRVEMT  165

Query  338  I-QENSSFKHFQIR  300
            +   N+SFK  QI+
Sbjct  166  LPMSNTSFKRPQIK  179



>ref|XP_002879473.1| hypothetical protein ARALYDRAFT_482334 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55732.1| hypothetical protein ARALYDRAFT_482334 [Arabidopsis lyrata subsp. 
lyrata]
Length=130

 Score =   129 bits (325),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQ E C+AD+ +AKQYH+RHKVCEFHAKA +V + GL QRFCQQCSRFHEL EFDEAKRS
Sbjct  53   CQVESCTADMSKAKQYHKRHKVCEFHAKAPLVRIYGLHQRFCQQCSRFHELSEFDEAKRS  112

Query  512  CRRRLAGHNERRRK  471
            CRRRLAGHNERRRK
Sbjct  113  CRRRLAGHNERRRK  126



>ref|XP_010500948.1| PREDICTED: squamosa promoter-binding-like protein 4 isoform X2 
[Camelina sativa]
Length=177

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 88/136 (65%), Gaps = 22/136 (16%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R CQ ++C++DL EAKQYHRRHKVCE HAKA  V ++G+ QRFCQQCSRFHEL EFDEAK
Sbjct  61   RLCQVDRCTSDLKEAKQYHRRHKVCEVHAKASSVFLSGVSQRFCQQCSRFHELQEFDEAK  120

Query  518  RSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQV---DDKGRI  348
            RSCRRRLAGHNERRRKSS  S                         + GQV    ++ R+
Sbjct  121  RSCRRRLAGHNERRRKSSGESFGEGSGR----------------TGITGQVIQNQERSRV  164

Query  347  QMSIQENSSFKHFQIR  300
            +M    NSSFK  QIR
Sbjct  165  EMP---NSSFKRPQIR  177



>gb|KDP20990.1| hypothetical protein JCGZ_21461 [Jatropha curcas]
Length=142

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 71/79 (90%), Gaps = 2/79 (3%)
 Frame = -2

Query  707  PVMRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFD  528
            PV  SCQA+ C+AD+ +AK+YHRRHKVCEFHAKA +VVVAG++QRFCQQCSRFH L EFD
Sbjct  54   PV--SCQADNCTADMTDAKRYHRRHKVCEFHAKAPLVVVAGIQQRFCQQCSRFHGLSEFD  111

Query  527  EAKRSCRRRLAGHNERRRK  471
            + KRSCRRRLAGHNERRRK
Sbjct  112  DNKRSCRRRLAGHNERRRK  130



>gb|ABL89185.1| squamosa promoter binding protein-like protein [Capsicum annuum]
Length=136

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQ E+C+AD+  AK YHRRHKVCEFH+K+ +V+++GL+QRFCQQCSRFH L EFDEAKR
Sbjct  51   SCQVEQCTADMANAKPYHRRHKVCEFHSKSSIVLISGLQQRFCQQCSRFHLLAEFDEAKR  110

Query  515  SCRRRLAGHNERRRK  471
            SCRRRLAGHNERRRK
Sbjct  111  SCRRRLAGHNERRRK  125



>ref|XP_010413803.1| PREDICTED: squamosa promoter-binding-like protein 3 [Camelina 
sativa]
Length=141

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQ + C+ D+ +AKQYH+RHKVCEFHAKA +V ++GL QRFCQQCSRFHELGEFD+AKRS
Sbjct  64   CQVQSCTVDMSKAKQYHKRHKVCEFHAKAPIVRISGLHQRFCQQCSRFHELGEFDKAKRS  123

Query  512  CRRRLAGHNERRRK  471
            CRRRLAGHNERRRK
Sbjct  124  CRRRLAGHNERRRK  137



>ref|XP_010108163.1| Squamosa promoter-binding protein 1 [Morus notabilis]
 gb|EXC18088.1| Squamosa promoter-binding protein 1 [Morus notabilis]
Length=170

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQA+ CS DL ++KQYHRRHK+CEFHAKA VV+V GL+QRFCQQCSRFH L EFD+ KR
Sbjct  85   SCQADNCSVDLTDSKQYHRRHKICEFHAKATVVLVNGLQQRFCQQCSRFHGLAEFDDTKR  144

Query  515  SCRRRLAGHNERRRK  471
            SCRRRLAGHNERRRK
Sbjct  145  SCRRRLAGHNERRRK  159



>ref|XP_010542291.1| PREDICTED: squamosa promoter-binding-like protein 5 [Tarenaya 
hassleriana]
Length=128

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R CQAEKC+ADL EAKQYHRRH+VCE HAKA   +VAG+RQRFCQQCSRFHEL EFD AK
Sbjct  36   RLCQAEKCTADLTEAKQYHRRHRVCEVHAKALSAMVAGVRQRFCQQCSRFHELVEFDGAK  95

Query  518  RSCRRRLAGHNERRRK  471
            RSCR RLAGHNERRRK
Sbjct  96   RSCRGRLAGHNERRRK  111



>ref|XP_009763061.1| PREDICTED: squamosa promoter-binding protein 1-like isoform X1 
[Nicotiana sylvestris]
Length=135

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 71/81 (88%), Gaps = 2/81 (2%)
 Frame = -2

Query  707  PVMRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQC--SRFHELGE  534
            P + SCQ E+C+AD+  AK YHRRHKVCEFH+KA VV+++G++QRFCQQC  SRFH+L E
Sbjct  44   PALPSCQVEQCTADMAGAKPYHRRHKVCEFHSKAPVVLISGIQQRFCQQCSRSRFHQLPE  103

Query  533  FDEAKRSCRRRLAGHNERRRK  471
            FDEAKRSCRRRLAGHNERRRK
Sbjct  104  FDEAKRSCRRRLAGHNERRRK  124



>ref|XP_008367070.1| PREDICTED: squamosa promoter-binding protein 1-like [Malus domestica]
 ref|XP_008355373.1| PREDICTED: squamosa promoter-binding protein 1-like [Malus domestica]
Length=191

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQ E+C ADL +AK+Y+RRHKVCEFH+KA VV+V+G++QRFCQQCSRFHEL EFDEAKR
Sbjct  75   SCQVERCGADLVDAKRYYRRHKVCEFHSKAAVVIVSGIQQRFCQQCSRFHELIEFDEAKR  134

Query  515  SCRRRLAGHNERRRK  471
            SCRRRLAGHNERRRK
Sbjct  135  SCRRRLAGHNERRRK  149



>emb|CDY17204.1| BnaA05g09840D [Brassica napus]
Length=142

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            +CQ E+C+AD+  AKQYHRRHKVCEFHAKA VV +  L QRFCQQCSRFH+LGEFDE+KR
Sbjct  52   TCQVERCTADMSRAKQYHRRHKVCEFHAKAPVVRIYSLHQRFCQQCSRFHDLGEFDESKR  111

Query  515  SCRRRLAGHNERRRK  471
            SCRRRLAGHNERRRK
Sbjct  112  SCRRRLAGHNERRRK  126



>ref|XP_009336237.1| PREDICTED: squamosa promoter-binding-like protein 3 [Pyrus x 
bretschneideri]
Length=163

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -2

Query  704  VMRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDE  525
             MR CQA++C+ADL + K+YHR+HKVC+ H+K+QVV+VAGL QRFCQQCSRFHEL EFD+
Sbjct  57   AMRRCQADRCTADLSDEKKYHRKHKVCDLHSKSQVVLVAGLHQRFCQQCSRFHELSEFDD  116

Query  524  AKRSCRRRLAGHNERRRK  471
             KRSCRRRL+GHNERRRK
Sbjct  117  TKRSCRRRLSGHNERRRK  134



>ref|XP_010487346.1| PREDICTED: squamosa promoter-binding-like protein 5 [Camelina 
sativa]
Length=181

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 85/134 (63%), Gaps = 14/134 (10%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R CQ ++C+A+L EAKQY+RRH+VCE HAKA    V G+RQRFCQQCSRFHEL EFDEAK
Sbjct  61   RLCQVDRCTANLTEAKQYYRRHRVCEVHAKASAATVTGVRQRFCQQCSRFHELPEFDEAK  120

Query  518  RSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMS  339
            RSCRRRLAGHNERRRK S             ++                Q  ++ RI+M 
Sbjct  121  RSCRRRLAGHNERRRKISGDIYGEGSGRRGFSSQLV-------------QTQERNRIEMK  167

Query  338  I-QENSSFKHFQIR  300
            +   NSSFK  QIR
Sbjct  168  LPMTNSSFKRSQIR  181



>ref|XP_006298553.1| hypothetical protein CARUB_v10014636mg, partial [Capsella rubella]
 gb|EOA31451.1| hypothetical protein CARUB_v10014636mg, partial [Capsella rubella]
Length=208

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 86/134 (64%), Gaps = 14/134 (10%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R CQ ++C+A+L EAKQY+RRH+VCE HAKA    V G+RQRFCQQCSRFHEL EFDEAK
Sbjct  88   RLCQVDRCTANLTEAKQYYRRHRVCEVHAKASAATVTGVRQRFCQQCSRFHELPEFDEAK  147

Query  518  RSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMS  339
            RSCRRRLAGHNERRRK S             +       Q +       Q  +K R++M 
Sbjct  148  RSCRRRLAGHNERRRKISGDIYGEGSGRRGFS------GQLI-------QTQEKNRVEMK  194

Query  338  I-QENSSFKHFQIR  300
            +   NSSFK  QIR
Sbjct  195  LPMTNSSFKRPQIR  208



>ref|XP_006392823.1| hypothetical protein EUTSA_v10011728mg [Eutrema salsugineum]
 gb|ESQ30109.1| hypothetical protein EUTSA_v10011728mg [Eutrema salsugineum]
Length=255

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 84/133 (63%), Gaps = 9/133 (7%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R CQ ++C+ADL EAKQYHRRHKVCE HAKA  V +AG+ QRFCQQCSRFHEL EFDEAK
Sbjct  132  RLCQVDRCTADLKEAKQYHRRHKVCEVHAKASSVFLAGISQRFCQQCSRFHELLEFDEAK  191

Query  518  RSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMS  339
            RSCRRRLAGHNERRRKSS  S                +NQ    + +   +         
Sbjct  192  RSCRRRLAGHNERRRKSSGESFGEGSGGRRGITGQMIQNQERSRVEIMTTLP--------  243

Query  338  IQENSSFKHFQIR  300
               NSSFK  QIR
Sbjct  244  -MSNSSFKRPQIR  255



>emb|CDY24113.1| BnaA06g01110D [Brassica napus]
Length=161

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R CQ ++C+ADL EAKQYHRRHKVCE HAKA  V + G++QRFCQQCSRFHEL EFDEAK
Sbjct  58   RLCQVDRCTADLKEAKQYHRRHKVCEVHAKASSVYLTGVKQRFCQQCSRFHELLEFDEAK  117

Query  518  RSCRRRLAGHNERRRK  471
            RSCR+RLAGHNERRRK
Sbjct  118  RSCRKRLAGHNERRRK  133



>gb|AIL95848.1| SQUAMOSA promoter binding-like transcription factor [Gossypium 
hirsutum]
Length=141

 Score =   128 bits (321),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = -2

Query  701  MRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEA  522
            + +CQ E C+AD+ +AK+YHRRHKVCEFHAKA VV VAG+ QRFCQQCSRFHEL E DE 
Sbjct  53   LPACQVENCTADMTDAKRYHRRHKVCEFHAKAAVVRVAGIHQRFCQQCSRFHELSESDET  112

Query  521  KRSCRRRLAGHNERRRK  471
            KRSCRRRLAGHNERRRK
Sbjct  113  KRSCRRRLAGHNERRRK  129



>gb|AGP03028.1| SQUAMOSA promoter binding protein-like protein 4 [Arabis alpina]
 gb|KFK35743.1| hypothetical protein AALP_AA4G030800 [Arabis alpina]
Length=181

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R CQ ++C++DL EAKQYHRRHKVCE HAKA  V ++G+ QRFCQQCSRFHEL EFDEAK
Sbjct  55   RLCQVDRCTSDLKEAKQYHRRHKVCEVHAKASYVFLSGINQRFCQQCSRFHELLEFDEAK  114

Query  518  RSCRRRLAGHNERRRK  471
            RSCRRRLAGHNERRRK
Sbjct  115  RSCRRRLAGHNERRRK  130



>ref|XP_011043410.1| PREDICTED: squamosa promoter-binding-like protein 3 [Populus 
euphratica]
Length=144

 Score =   128 bits (321),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -2

Query  704  VMRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDE  525
            ++ SCQA+ C++DL +AK+YHRRHKVCEFHAKA  V V GL+QRFCQQCSRFH+L EFD+
Sbjct  56   LLVSCQADNCTSDLTDAKRYHRRHKVCEFHAKAPFVPVNGLQQRFCQQCSRFHDLSEFDD  115

Query  524  AKRSCRRRLAGHNERRRK  471
            +KRSCRRRLAGHNERRRK
Sbjct  116  SKRSCRRRLAGHNERRRK  133



>ref|XP_010462180.1| PREDICTED: squamosa promoter-binding-like protein 4 isoform X1 
[Camelina sativa]
Length=186

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R CQ ++C+ADL EAKQYHRRHKVCE HAKA  V ++G+ QRFCQQCSRFHEL EFDEAK
Sbjct  62   RLCQVDRCTADLKEAKQYHRRHKVCEVHAKASSVFLSGVSQRFCQQCSRFHELQEFDEAK  121

Query  518  RSCRRRLAGHNERRRK  471
            RSCRRRLAGHNERRRK
Sbjct  122  RSCRRRLAGHNERRRK  137



>ref|XP_009141347.1| PREDICTED: squamosa promoter-binding-like protein 3 [Brassica 
rapa]
Length=141

 Score =   128 bits (321),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            +CQ E+C+AD+  AKQYH+RH+VCEFHAKA +V ++GL QRFCQQCSRFHELGEFD+ KR
Sbjct  63   ACQVERCTADMSRAKQYHKRHRVCEFHAKAPLVRISGLYQRFCQQCSRFHELGEFDDTKR  122

Query  515  SCRRRLAGHNERRRK  471
            SCRRRLAGHNERRR+
Sbjct  123  SCRRRLAGHNERRRR  137



>ref|XP_004248108.1| PREDICTED: squamosa promoter-binding protein 1-like [Solanum 
lycopersicum]
Length=135

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQ E+C+AD+  AK YHRRHKVCEFHAKA  V++ GLRQRFCQQCSRFH+L EFD+AK+
Sbjct  50   SCQVEECTADMVNAKTYHRRHKVCEFHAKAPEVLIDGLRQRFCQQCSRFHQLAEFDDAKK  109

Query  515  SCRRRLAGHNERRRK  471
            SCRRRLAGHNERRRK
Sbjct  110  SCRRRLAGHNERRRK  124



>ref|XP_006451806.1| hypothetical protein CICLE_v10009879mg [Citrus clementina]
 ref|XP_006464784.1| PREDICTED: squamosa promoter-binding-like protein 13-like [Citrus 
sinensis]
 gb|ESR65046.1| hypothetical protein CICLE_v10009879mg [Citrus clementina]
 gb|KDO62546.1| hypothetical protein CISIN_1g032937mg [Citrus sinensis]
Length=130

 Score =   127 bits (319),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            C  EKC  DL +A++YHRRHKVCE H+KA VV+VAGLRQRFCQQCSRFHEL EFDE KRS
Sbjct  39   CMVEKCGTDLTDARRYHRRHKVCETHSKAPVVIVAGLRQRFCQQCSRFHELYEFDETKRS  98

Query  512  CRRRLAGHNERRRK  471
            CRRRLAGHNERRRK
Sbjct  99   CRRRLAGHNERRRK  112



>ref|XP_010549337.1| PREDICTED: squamosa promoter-binding-like protein 3 [Tarenaya 
hassleriana]
Length=166

 Score =   128 bits (322),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQ E C+ D+  AK+YH+RHKVC+FHAKA VV V+GL QRFCQQCSRFHE+GEFDEAKRS
Sbjct  79   CQVENCNVDMTGAKRYHKRHKVCDFHAKAPVVNVSGLHQRFCQQCSRFHEIGEFDEAKRS  138

Query  512  CRRRLAGHNERRRK  471
            CRRRLAGHNERRRK
Sbjct  139  CRRRLAGHNERRRK  152



>dbj|BAM15478.1| SBP-box protein [Torenia fournieri]
Length=177

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQ +KC ADL+ +K YHRRH+VCE HAKAQVV+++G+RQRFCQQCSRFHEL EFDEAKRS
Sbjct  81   CQVDKCLADLNVSKAYHRRHRVCEQHAKAQVVLLSGIRQRFCQQCSRFHELSEFDEAKRS  140

Query  512  CRRRLAGHNERRRK  471
            CRRRLAGHNERRRK
Sbjct  141  CRRRLAGHNERRRK  154



>gb|AFK42236.1| unknown [Medicago truncatula]
 gb|KEH31025.1| squamosa promoter-binding-like protein [Medicago truncatula]
Length=144

 Score =   127 bits (320),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQ E C ADL EAKQYHRRHKVCE+HAKA  V +AGL+QRFCQQCSRFH L EFD+AKRS
Sbjct  63   CQVENCDADLSEAKQYHRRHKVCEYHAKAPAVHIAGLQQRFCQQCSRFHGLSEFDDAKRS  122

Query  512  CRRRLAGHNERRRK  471
            CRRRLAGHNERRRK
Sbjct  123  CRRRLAGHNERRRK  136



>gb|KFK38868.1| spl5 [Arabis alpina]
Length=181

 Score =   128 bits (322),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R CQ ++C+A+L EAKQYHRRH+VCE HAKA    VAG+RQRFCQQCSRFHEL EFDE K
Sbjct  61   RLCQVDRCAANLTEAKQYHRRHRVCEVHAKASAATVAGVRQRFCQQCSRFHELPEFDETK  120

Query  518  RSCRRRLAGHNERRRK  471
            RSCRRRLAGHNERRRK
Sbjct  121  RSCRRRLAGHNERRRK  136



>ref|XP_010500947.1| PREDICTED: squamosa promoter-binding-like protein 4 isoform X1 
[Camelina sativa]
Length=185

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R CQ ++C++DL EAKQYHRRHKVCE HAKA  V ++G+ QRFCQQCSRFHEL EFDEAK
Sbjct  61   RLCQVDRCTSDLKEAKQYHRRHKVCEVHAKASSVFLSGVSQRFCQQCSRFHELQEFDEAK  120

Query  518  RSCRRRLAGHNERRRK  471
            RSCRRRLAGHNERRRK
Sbjct  121  RSCRRRLAGHNERRRK  136



>ref|XP_006406996.1| hypothetical protein EUTSA_v10021617mg [Eutrema salsugineum]
 gb|ESQ48449.1| hypothetical protein EUTSA_v10021617mg [Eutrema salsugineum]
Length=181

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 89/134 (66%), Gaps = 14/134 (10%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R CQ ++C+A+L EAKQY+RRHKVCE HAKA    VAG++QRFCQQCSRFHEL EFDE K
Sbjct  61   RLCQVDRCTANLTEAKQYYRRHKVCEVHAKATAATVAGVKQRFCQQCSRFHELPEFDETK  120

Query  518  RSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMS  339
            RSCRRRLAGHNERRRKSS  +        A +       Q +++        ++ R+ M 
Sbjct  121  RSCRRRLAGHNERRRKSSGDTFGEGSGRRAFS------GQLIQN-------QERNRVDMK  167

Query  338  IQ-ENSSFKHFQIR  300
             Q  NSSFK  QIR
Sbjct  168  FQMTNSSFKRSQIR  181



>emb|CDY57212.1| BnaC04g44230D [Brassica napus]
Length=141

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            +CQ E+C+AD+  AKQYH+RHKVCEFHAKA +V ++GL QRFCQQCSRFHEL EFD+ KR
Sbjct  63   ACQVERCTADMSRAKQYHKRHKVCEFHAKAPLVRISGLYQRFCQQCSRFHELSEFDDTKR  122

Query  515  SCRRRLAGHNERRRK  471
            SCRRRLAGHNERRR+
Sbjct  123  SCRRRLAGHNERRRR  137



>ref|XP_007159345.1| hypothetical protein PHAVU_002G230300g [Phaseolus vulgaris]
 gb|ESW31339.1| hypothetical protein PHAVU_002G230300g [Phaseolus vulgaris]
Length=200

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQ + C ADL EAKQYHRRHKVCE+HAK   V++AGL+QRFCQQCSRFHEL EFDE+KR
Sbjct  118  SCQVDNCDADLSEAKQYHRRHKVCEYHAKVHSVLMAGLQQRFCQQCSRFHELSEFDESKR  177

Query  515  SCRRRLAGHNERRRK  471
            SCR RL GHNERRRK
Sbjct  178  SCRTRLVGHNERRRK  192



>gb|AGR34081.1| squamosa promoter binding protein-like 4, partial [Pogostemon 
cablin]
Length=182

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            RSCQ E C+AD+++ K YHRRHKVCE+HAKA VV+++G+RQRFCQQCSRFH++ EFDEAK
Sbjct  101  RSCQVEDCTADMNDVKPYHRRHKVCEYHAKAAVVLLSGIRQRFCQQCSRFHDVSEFDEAK  160

Query  518  RSCRRRLAGHNERRRK  471
            RSCR RLAGHNERRRK
Sbjct  161  RSCRGRLAGHNERRRK  176



>ref|XP_002280052.1| PREDICTED: squamosa promoter-binding protein 1 isoform X2 [Vitis 
vinifera]
 emb|CBI30591.3| unnamed protein product [Vitis vinifera]
Length=140

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQ + C+AD+ EAK+YH+RH+VCE HAKA V+++AG++QRFCQQCSRFHEL EFD+ KR
Sbjct  55   SCQVDNCTADMSEAKRYHKRHRVCEHHAKAPVILIAGIQQRFCQQCSRFHELSEFDDTKR  114

Query  515  SCRRRLAGHNERRRK  471
            SCRRRLAGHNERRRK
Sbjct  115  SCRRRLAGHNERRRK  129



>gb|AGP03027.1| SQUAMOSA promoter binding protein-like protein 3 [Arabis alpina]
 gb|KFK24430.1| squamosa promoter binding 4 [Arabis alpina]
Length=131

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQ E CS D+  AK+YH+RH+VCE HAKA +V ++GL QRFCQQCSRFHELGEFDEAKRS
Sbjct  53   CQVESCSVDMSTAKRYHKRHRVCEVHAKAPLVWISGLHQRFCQQCSRFHELGEFDEAKRS  112

Query  512  CRRRLAGHNERRRK  471
            CRRRLAGHNERRRK
Sbjct  113  CRRRLAGHNERRRK  126



>ref|XP_009147622.1| PREDICTED: squamosa promoter-binding-like protein 4 isoform X1 
[Brassica rapa]
Length=190

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R CQ ++C+ADL EAKQYHRRHKVCE HAKA  V + G++QRFCQQCSRFHEL EFDEAK
Sbjct  58   RLCQVDRCTADLKEAKQYHRRHKVCEVHAKASSVYLTGVKQRFCQQCSRFHELLEFDEAK  117

Query  518  RSCRRRLAGHNERRRK  471
            RSCR+RLAGHNERRRK
Sbjct  118  RSCRKRLAGHNERRRK  133



>ref|XP_009596192.1| PREDICTED: squamosa promoter-binding-like protein 3 [Nicotiana 
tomentosiformis]
Length=172

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 85/132 (64%), Gaps = 21/132 (16%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQ EKC  DL  AK+Y++ HKVC+ HAKA +VVVA LRQRFCQQCSRFHE+ EFD  KR
Sbjct  60   SCQVEKCKVDLSGAKKYYKSHKVCQVHAKAPIVVVAALRQRFCQQCSRFHEVSEFDGTKR  119

Query  515  SCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMSI  336
            SCRRRLAGHNERRRK                         L+D N C Q++ + R Q+++
Sbjct  120  SCRRRLAGHNERRRKIPLSIK-------------------LED-NQCRQINGEDRPQITL  159

Query  335  QE-NSSFKHFQI  303
               N+SFK++ I
Sbjct  160  TNRNASFKNYHI  171



>ref|XP_010465475.1| PREDICTED: squamosa promoter-binding-like protein 5 [Camelina 
sativa]
Length=181

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 87/134 (65%), Gaps = 14/134 (10%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R CQ ++C+A+L EAKQY+RRH+VCE HAKA    V G+RQRFCQQCSRFHEL EFDEAK
Sbjct  61   RLCQVDRCTANLTEAKQYYRRHRVCEVHAKASAATVTGVRQRFCQQCSRFHELPEFDEAK  120

Query  518  RSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMS  339
            RSCRRRLAGHNERRRK S             +      +Q +       Q  ++ R++M 
Sbjct  121  RSCRRRLAGHNERRRKISGDIYGEGSGRRGFS------SQLI-------QTQERNRVEMK  167

Query  338  I-QENSSFKHFQIR  300
            +   N+SFK  QIR
Sbjct  168  LPMTNASFKRPQIR  181



>emb|CDY50515.1| BnaC06g10070D [Brassica napus]
Length=157

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R CQ ++C+ DL E KQYHRRHKVCE HAKA  V +AG++QRFCQQCSRFHEL EFDEAK
Sbjct  52   RLCQVDRCTTDLKEDKQYHRRHKVCEVHAKASSVYLAGVKQRFCQQCSRFHELPEFDEAK  111

Query  518  RSCRRRLAGHNERRRK  471
            RSCRRRLAGHNERRRK
Sbjct  112  RSCRRRLAGHNERRRK  127



>ref|XP_009132954.1| PREDICTED: squamosa promoter-binding-like protein 3 [Brassica 
rapa]
Length=137

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQ E+C+AD+  AKQYH+RHKVCEFHAKA VV ++G  QRFCQQCSRFHEL EFDEAKRS
Sbjct  60   CQVERCTADMSRAKQYHKRHKVCEFHAKAPVVRISGGYQRFCQQCSRFHELREFDEAKRS  119

Query  512  CRRRLAGHNERRRK  471
            CRRRLAGHNERRRK
Sbjct  120  CRRRLAGHNERRRK  133



>ref|XP_006449372.1| hypothetical protein CICLE_v10017104mg [Citrus clementina]
 gb|ESR62612.1| hypothetical protein CICLE_v10017104mg [Citrus clementina]
Length=143

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQ E C AD+ +AK+YHRRHKVC+FHAKA VV V GL QRFCQQCSRFHEL EFD+ KR
Sbjct  58   SCQVENCGADMTDAKKYHRRHKVCDFHAKAPVVRVEGLAQRFCQQCSRFHELSEFDDTKR  117

Query  515  SCRRRLAGHNERRRK  471
            SCRRRLAGHNERRRK
Sbjct  118  SCRRRLAGHNERRRK  132



>emb|CAB56772.1| Squamosa promoter binding protein-like 5 [Arabidopsis thaliana]
Length=138

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R CQ ++C+ +L EAKQY+RRH+VCE HAKA    VAG+RQRFCQQCSRFHEL EFDEAK
Sbjct  61   RLCQVDRCTVNLTEAKQYYRRHRVCEVHAKASAATVAGVRQRFCQQCSRFHELPEFDEAK  120

Query  518  RSCRRRLAGHNERRRK  471
            RSCRRRLAGHNERRRK
Sbjct  121  RSCRRRLAGHNERRRK  136



>ref|XP_009146272.1| PREDICTED: squamosa promoter-binding-like protein 5 [Brassica 
rapa]
 emb|CDX97645.1| BnaA05g24340D [Brassica napus]
Length=179

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 86/135 (64%), Gaps = 16/135 (12%)
 Frame = -2

Query  701  MRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEA  522
            +R C  ++C+A+L EAKQY+RRHKVCE HAKA    VAG++QRFCQQCSRFHEL EFDE 
Sbjct  60   LRLCLVDRCTANLSEAKQYYRRHKVCEVHAKASSATVAGVKQRFCQQCSRFHELAEFDET  119

Query  521  KRSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQM  342
            KRSCRRRLAGHNERRRK S  S                     + +++  Q  ++ RI M
Sbjct  120  KRSCRRRLAGHNERRRKISGDSYGEGSGR--------------RGVSLT-QTQERNRIDM  164

Query  341  SI-QENSSFKHFQIR  300
             +   NS FK  QIR
Sbjct  165  KLPMTNSPFKRPQIR  179



>emb|CDX98540.1| BnaC05g38350D [Brassica napus]
Length=179

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 86/135 (64%), Gaps = 16/135 (12%)
 Frame = -2

Query  701  MRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEA  522
            +R C  ++C+A+L EAKQY+RRHKVCE HAKA    VAG++QRFCQQCSRFHEL EFDE 
Sbjct  60   LRLCLVDRCTANLTEAKQYYRRHKVCEVHAKASSATVAGVKQRFCQQCSRFHELAEFDET  119

Query  521  KRSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQM  342
            KRSCRRRLAGHNERRRK S  S                     + +++  Q  ++ RI M
Sbjct  120  KRSCRRRLAGHNERRRKISGDSYGEGSGR--------------RGVSLT-QTQERNRIDM  164

Query  341  SI-QENSSFKHFQIR  300
             +   NS FK  QIR
Sbjct  165  KLPMTNSPFKRPQIR  179



>emb|CDY37684.1| BnaA04g19840D [Brassica napus]
Length=141

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            +CQ E+C+AD++ AKQYH+RH+VCEFHAKA +V ++GL QRFCQQCSRFHEL EFD+ KR
Sbjct  63   ACQVERCTADMNRAKQYHKRHRVCEFHAKAPLVRISGLYQRFCQQCSRFHELSEFDDTKR  122

Query  515  SCRRRLAGHNERRRK  471
            SCRRRLAGHNERRR+
Sbjct  123  SCRRRLAGHNERRRR  137



>ref|XP_011027797.1| PREDICTED: squamosa promoter-binding-like protein 3 isoform X1 
[Populus euphratica]
Length=148

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 70/79 (89%), Gaps = 2/79 (3%)
 Frame = -2

Query  707  PVMRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFD  528
            P+  SCQA+ C+AD+ +AK+YH+RHKVCEFHAKA  V+V G++QRFCQQCSRFH+L EFD
Sbjct  61   PI--SCQAKNCTADMTDAKRYHKRHKVCEFHAKASSVIVNGVQQRFCQQCSRFHDLSEFD  118

Query  527  EAKRSCRRRLAGHNERRRK  471
            ++KRSCR RLAGHNERRRK
Sbjct  119  DSKRSCRMRLAGHNERRRK  137



>ref|XP_010509826.1| PREDICTED: squamosa promoter-binding-like protein 3 [Camelina 
sativa]
Length=142

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQ + C+AD+ +AKQYH+RHKVCE HAKA +V ++GL QRFCQQCSRFHELGEFD AKRS
Sbjct  65   CQVQSCTADMSKAKQYHKRHKVCESHAKAPIVRISGLHQRFCQQCSRFHELGEFDLAKRS  124

Query  512  CRRRLAGHNERRRK  471
            CRRRLAGHNERRRK
Sbjct  125  CRRRLAGHNERRRK  138



>pdb|1UL4|A Chain A, Solution Structure Of The Dna-Binding Domain Of Squamosa 
Promoter Binding Protein-Like 4
Length=94

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = -2

Query  701  MRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEA  522
            +R CQ ++C+AD+ EAK YHRRHKVCE HAKA  V ++GL QRFCQQCSRFH+L EFDEA
Sbjct  8    LRLCQVDRCTADMKEAKLYHRRHKVCEVHAKASSVFLSGLNQRFCQQCSRFHDLQEFDEA  67

Query  521  KRSCRRRLAGHNERRRK  471
            KRSCRRRLAGHNERRRK
Sbjct  68   KRSCRRRLAGHNERRRK  84



>ref|NP_188145.1| squamosa promoter-binding-like protein 5 [Arabidopsis thaliana]
 sp|Q9S758.1|SPL5_ARATH RecName: Full=Squamosa promoter-binding-like protein 5 [Arabidopsis 
thaliana]
 emb|CAB56571.1| squamosa promoter binding protein-like 5 [Arabidopsis thaliana]
 emb|CAB56572.1| squamosa promoter binding protein-like 5 [Arabidopsis thaliana]
 dbj|BAB02156.1| squamosa promoter binding protein-like [Arabidopsis thaliana]
 dbj|BAC43210.1| putative squamosa promoter binding protein-like 5 [Arabidopsis 
thaliana]
 gb|AAO39942.1| At3g15270 [Arabidopsis thaliana]
 gb|AEE75639.1| squamosa promoter-binding-like protein 5 [Arabidopsis thaliana]
Length=181

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R CQ ++C+ +L EAKQY+RRH+VCE HAKA    VAG+RQRFCQQCSRFHEL EFDEAK
Sbjct  61   RLCQVDRCTVNLTEAKQYYRRHRVCEVHAKASAATVAGVRQRFCQQCSRFHELPEFDEAK  120

Query  518  RSCRRRLAGHNERRRK  471
            RSCRRRLAGHNERRRK
Sbjct  121  RSCRRRLAGHNERRRK  136



>ref|XP_008342891.1| PREDICTED: squamosa promoter-binding protein 1-like [Malus domestica]
 ref|XP_008362441.1| PREDICTED: squamosa promoter-binding protein 1-like [Malus domestica]
Length=163

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -2

Query  704  VMRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDE  525
             MR CQA++C+ADL + K+YHR+HKVC+ H+K+QVV+V+GL QRFCQQCSRFHE  EFD+
Sbjct  57   AMRRCQADRCTADLSDEKKYHRKHKVCDLHSKSQVVLVSGLHQRFCQQCSRFHEJSEFDD  116

Query  524  AKRSCRRRLAGHNERRRK  471
             KRSCR RL+GHNERRRK
Sbjct  117  TKRSCRSRLSGHNERRRK  134



>dbj|BAM15475.1| SBP-box protein [Torenia fournieri]
Length=134

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R+CQ E C AD+  AK YHRRHKVCEFHAKA VVV  GL+QRFCQQCSRFHEL EFD+AK
Sbjct  57   RTCQIEGCLADMACAKPYHRRHKVCEFHAKASVVVHVGLQQRFCQQCSRFHELSEFDDAK  116

Query  518  RSCRRRLAGHNERRRK  471
            RSCRRRLAGHNERRR+
Sbjct  117  RSCRRRLAGHNERRRR  132



>ref|XP_010316764.1| PREDICTED: squamosa promoter-binding protein 1 isoform X2 [Solanum 
lycopersicum]
 gb|ABH07904.1| squamosa promoter binding-like protein [Solanum lycopersicum]
Length=136

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQ ++C+AD+ +AK YHRRHKVCEFH+K+ +V+++GL++RFCQQCSRFH L EFD+AKR
Sbjct  51   SCQVDQCTADMADAKPYHRRHKVCEFHSKSPIVLISGLQKRFCQQCSRFHLLAEFDDAKR  110

Query  515  SCRRRLAGHNERRRK  471
            SCRRRLAGHNERRRK
Sbjct  111  SCRRRLAGHNERRRK  125



>emb|CDX79544.1| BnaC03g18800D [Brassica napus]
Length=187

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQ E+C+AD+  AKQYH+RHKVCEFHAKA VV ++G  QRFCQQCSRFH+L EFDEAKRS
Sbjct  110  CQVERCTADMSRAKQYHKRHKVCEFHAKAPVVRISGGYQRFCQQCSRFHDLREFDEAKRS  169

Query  512  CRRRLAGHNERRRK  471
            CRRRLAGHNERRRK
Sbjct  170  CRRRLAGHNERRRK  183



>ref|XP_010502692.1| PREDICTED: squamosa promoter-binding-like protein 5 [Camelina 
sativa]
Length=181

 Score =   126 bits (317),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 87/134 (65%), Gaps = 14/134 (10%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R CQ ++C+A+L +AKQY+RRH+VCE HAKA    V G+RQRFCQQCSRFHEL EFDEAK
Sbjct  61   RLCQVDRCTANLTDAKQYYRRHRVCEVHAKASAATVTGVRQRFCQQCSRFHELPEFDEAK  120

Query  518  RSCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMS  339
            RSCRRRLAGHNERRRK S             +      +Q +       Q  ++ R++M 
Sbjct  121  RSCRRRLAGHNERRRKISCDIYGEGSGRRGFS------SQLI-------QTQERNRVEMK  167

Query  338  I-QENSSFKHFQIR  300
            +   NSSFK  QIR
Sbjct  168  LPMTNSSFKRPQIR  181



>ref|XP_006582910.1| PREDICTED: uncharacterized protein LOC100789055 isoform X1 [Glycine 
max]
Length=146

 Score =   125 bits (314),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQ + C ADL EAKQYHRRHKVCE+HAKA  V +AGL+QRFCQQCSRFHEL EFD++KR
Sbjct  64   SCQVDNCDADLSEAKQYHRRHKVCEYHAKAPSVHMAGLQQRFCQQCSRFHELSEFDDSKR  123

Query  515  SCRRRLAGHNERRRK  471
            SCR RLAGHNERRRK
Sbjct  124  SCRTRLAGHNERRRK  138



>gb|KHN15472.1| Squamosa promoter-binding protein 1 [Glycine soja]
Length=146

 Score =   125 bits (314),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQ + C ADL EAKQYHRRHKVCE+HAKA  V +AGL+QRFCQQCSRFHEL EFD++KR
Sbjct  64   SCQVDNCDADLSEAKQYHRRHKVCEYHAKAPSVHMAGLQQRFCQQCSRFHELSEFDDSKR  123

Query  515  SCRRRLAGHNERRRK  471
            SCR RLAGHNERRRK
Sbjct  124  SCRTRLAGHNERRRK  138



>gb|KEH38697.1| squamosa promoter-binding-like protein [Medicago truncatula]
Length=171

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQ E C ADL  +K+YHRRHKVCE H+KA VVVVAG+RQRFCQQCSRFHEL EFDE+KRS
Sbjct  58   CQVESCGADLTFSKRYHRRHKVCEVHSKASVVVVAGMRQRFCQQCSRFHELAEFDESKRS  117

Query  512  CRRRLAGHNERRRK  471
            CRRRLA HNERRRK
Sbjct  118  CRRRLARHNERRRK  131



>gb|ABK23519.1| unknown [Picea sitchensis]
Length=198

 Score =   127 bits (318),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 90/127 (71%), Gaps = 11/127 (9%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            +CQ EKC+ADL +AK+Y+RRH+VCE H+KA+VV+V GL+QRFCQQCSRFH L EFDEAKR
Sbjct  75   ACQVEKCAADLADAKEYYRRHRVCEQHSKARVVLVLGLQQRFCQQCSRFHVLEEFDEAKR  134

Query  515  SCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMSI  336
            SCRRRLAGHNERRRK+ + SS     +          N +L D N    + +  ++ M +
Sbjct  135  SCRRRLAGHNERRRKTPSDSSVDRLDS----------NHHLND-NWLRHMTESDKMTMVL  183

Query  335  QENSSFK  315
            + N++ K
Sbjct  184  ERNTTAK  190



>ref|XP_006467766.1| PREDICTED: squamosa promoter-binding-like protein 3-like [Citrus 
sinensis]
Length=195

 Score =   127 bits (318),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 91/144 (63%), Gaps = 15/144 (10%)
 Frame = -2

Query  857  IMSSKVVLKREAMEGDAAAGERE--------------SPSSAISADDEkkkrggkkgggg  720
            +++  + +KR+ ME   A G+R               S       +D+ KK+G +     
Sbjct  41   LVTCFLFIKRKKMEASRAEGKRSLKEDDQEEEEDDEDSGGGIAGEEDKIKKKGKRGSSSA  100

Query  719  nngGPV-MRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHE  543
              GGP    SCQ E C AD+ +AK+YHRRHKVC+FHAKA VV V GL QRFCQQCSRFHE
Sbjct  101  GAGGPTTFVSCQVENCRADMTDAKKYHRRHKVCDFHAKAPVVRVEGLAQRFCQQCSRFHE  160

Query  542  LGEFDEAKRSCRRRLAGHNERRRK  471
            L EFD+ KRSCRRRLAGHNERRRK
Sbjct  161  LSEFDDTKRSCRRRLAGHNERRRK  184



>ref|NP_565771.1| squamosa promoter-binding-like protein 3 [Arabidopsis thaliana]
 sp|P93015.2|SPL3_ARATH RecName: Full=Squamosa promoter-binding-like protein 3 [Arabidopsis 
thaliana]
 emb|CAA70578.1| squamosa-promoter binding protein like 3 [Arabidopsis thaliana]
 emb|CAB56579.1| squamosa promoter binding protein-like 3 [Arabidopsis thaliana]
 emb|CAB56585.1| squamosa promoter binding protein-like 3 [Arabidopsis thaliana]
 gb|AAC69133.2| putative squamosa-promoter binding protein [Arabidopsis thaliana]
 dbj|BAC42802.1| putative squamosa-promoter binding protein [Arabidopsis thaliana]
 gb|AAO63863.1| putative squamosa-promoter binding protein [Arabidopsis thaliana]
 gb|AEC08889.1| squamosa promoter-binding-like protein 3 [Arabidopsis thaliana]
Length=131

 Score =   124 bits (312),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQ E C+AD+ +AKQYH+RHKVC+FHAKA  V ++GL QRFCQQCSRFH L EFDEAKRS
Sbjct  54   CQVESCTADMSKAKQYHKRHKVCQFHAKAPHVRISGLHQRFCQQCSRFHALSEFDEAKRS  113

Query  512  CRRRLAGHNERRRK  471
            CRRRLAGHNERRRK
Sbjct  114  CRRRLAGHNERRRK  127



>gb|KDO77620.1| hypothetical protein CISIN_1g032310mg [Citrus sinensis]
Length=143

 Score =   125 bits (313),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQ E C A++ +AK+YHRRHKVC+FHAKA VV V GL QRFCQQCSRFHEL EFD+ KR
Sbjct  58   SCQVENCRANMTDAKKYHRRHKVCDFHAKAPVVRVEGLAQRFCQQCSRFHELSEFDDTKR  117

Query  515  SCRRRLAGHNERRRK  471
            SCRRRLAGHNERRRK
Sbjct  118  SCRRRLAGHNERRRK  132



>emb|CAB94233.1| Squamosa promoter binding protein-like 3 [Arabidopsis thaliana]
Length=129

 Score =   124 bits (311),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQ E C+AD+ +AKQYH+RHKVC+FHAKA  V ++GL QRFCQQCSRFH L EFDEAKRS
Sbjct  52   CQVESCTADMSKAKQYHKRHKVCQFHAKAPHVRISGLHQRFCQQCSRFHALSEFDEAKRS  111

Query  512  CRRRLAGHNERRRK  471
            CRRRLAGHNERRRK
Sbjct  112  CRRRLAGHNERRRK  125



>gb|AAM67271.1| putative squamosa-promoter binding protein [Arabidopsis thaliana]
Length=131

 Score =   124 bits (311),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQ E C+AD+ +AKQYH+RHKVC+FHAKA  V ++GL QRFCQQCSRFH L EFDEAKRS
Sbjct  54   CQVESCTADISKAKQYHKRHKVCQFHAKAPHVRISGLHQRFCQQCSRFHALSEFDEAKRS  113

Query  512  CRRRLAGHNERRRK  471
            CRRRLAGHNERRRK
Sbjct  114  CRRRLAGHNERRRK  127



>ref|XP_006361029.1| PREDICTED: squamosa promoter-binding protein 1-like [Solanum 
tuberosum]
Length=135

 Score =   124 bits (312),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQ E C+AD+  AK YH RHKVCEFHAKA  V++ GLRQRFCQQCSRFH+L EFD+AK+
Sbjct  50   SCQVEDCTADMVNAKTYHCRHKVCEFHAKAPAVLIDGLRQRFCQQCSRFHQLAEFDDAKK  109

Query  515  SCRRRLAGHNERRRK  471
            SCRRRLAGHNERRRK
Sbjct  110  SCRRRLAGHNERRRK  124



>ref|XP_010106183.1| hypothetical protein L484_009607 [Morus notabilis]
 gb|EXC08464.1| hypothetical protein L484_009607 [Morus notabilis]
Length=159

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQA +  AD  +AK+ HRRHKVCE H+KA VV+VAGLRQRFCQQCSRFHE+ EFDEAKR
Sbjct  67   SCQAGRGGADPSDAKRSHRRHKVCEVHSKAPVVLVAGLRQRFCQQCSRFHEVSEFDEAKR  126

Query  515  SCRRRLAGHNERRRK  471
            SCRRRLAGHNERRRK
Sbjct  127  SCRRRLAGHNERRRK  141



>ref|XP_003541730.1| PREDICTED: squamosa promoter-binding protein 1-like isoform X1 
[Glycine max]
 gb|KHN08505.1| Squamosa promoter-binding protein 1 [Glycine soja]
Length=138

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -2

Query  704  VMRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDE  525
            V  SCQ + C+ADL EAK YHRRHKVCE+HAKA  VV+    QRFCQQCSRFHEL EFD+
Sbjct  53   VPPSCQVDGCNADLSEAKPYHRRHKVCEYHAKAPAVVIGDQHQRFCQQCSRFHELSEFDD  112

Query  524  AKRSCRRRLAGHNERRRK  471
            +KRSCRRRLAGHNERRRK
Sbjct  113  SKRSCRRRLAGHNERRRK  130



>ref|XP_003547153.1| PREDICTED: squamosa promoter-binding protein 1-like [Glycine 
max]
 gb|KHN24765.1| Squamosa promoter-binding protein 1 [Glycine soja]
Length=138

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -2

Query  704  VMRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDE  525
            V  SCQ + CSADL EAK YHRRHKVCE+HAKA  V++    QRFCQQCSRFHEL EFD+
Sbjct  53   VPPSCQVDGCSADLSEAKPYHRRHKVCEYHAKAPAVLIGDQHQRFCQQCSRFHELSEFDD  112

Query  524  AKRSCRRRLAGHNERRRK  471
            +KRSCRRRLAGHNERRRK
Sbjct  113  SKRSCRRRLAGHNERRRK  130



>ref|XP_006347010.1| PREDICTED: squamosa promoter-binding protein 1-like isoform X2 
[Solanum tuberosum]
Length=136

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQ ++C+A++ +AK YHRRHKVCEFH+K+ +V+++GL+QRFCQQCSRFH L EFD AKR
Sbjct  51   SCQVDQCTANMADAKPYHRRHKVCEFHSKSPIVLISGLQQRFCQQCSRFHLLAEFDGAKR  110

Query  515  SCRRRLAGHNERRRK  471
            SCRRRLAGHNERRRK
Sbjct  111  SCRRRLAGHNERRRK  125



>ref|XP_006828742.1| hypothetical protein AMTR_s00001p00058370 [Amborella trichopoda]
 gb|ERM96158.1| hypothetical protein AMTR_s00001p00058370 [Amborella trichopoda]
Length=182

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 89/130 (68%), Gaps = 15/130 (12%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQA+KC  DL  AK+YHRRHKVCE HAKA VV+V G+ QRFCQQCSRFH+L +FDEAKRS
Sbjct  66   CQADKCEVDLRMAKRYHRRHKVCEAHAKASVVLVCGINQRFCQQCSRFHDLSQFDEAKRS  125

Query  512  CRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMSIQ  333
            CR RLAGHN+RRRK+ + +   S+            +++ K+ N C  +D     Q ++Q
Sbjct  126  CRSRLAGHNKRRRKTVSEAQAESKKM----------SKHAKE-NTCRHLDR----QDTLQ  170

Query  332  ENSSFKHFQI  303
               +FKHFQI
Sbjct  171  GGPNFKHFQI  180



>ref|NP_001236309.1| uncharacterized protein LOC100527199 [Glycine max]
 gb|ACU16251.1| unknown [Glycine max]
Length=142

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -2

Query  704  VMRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDE  525
            +  SCQ + C ADL EAKQYHRRHKVCE+HAKA  V +AGL+QRFCQQCSRFH L EFD+
Sbjct  61   ITPSCQVDNCDADLSEAKQYHRRHKVCEYHAKAPSVHMAGLQQRFCQQCSRFHVLSEFDD  120

Query  524  AKRSCRRRLAGHNERRRK  471
            +KRSCR RLAGHNERRRK
Sbjct  121  SKRSCRTRLAGHNERRRK  138



>gb|KHN09987.1| Squamosa promoter-binding protein 1 [Glycine soja]
Length=141

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -2

Query  704  VMRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDE  525
            +  SCQ + C ADL EAKQYHRRHKVCE+HAKA  V +AGL+QRFCQQCSRFH L EFD+
Sbjct  60   ITPSCQVDNCDADLSEAKQYHRRHKVCEYHAKAPSVHMAGLQQRFCQQCSRFHVLSEFDD  119

Query  524  AKRSCRRRLAGHNERRRK  471
            +KRSCR RLAGHNERRRK
Sbjct  120  SKRSCRTRLAGHNERRRK  137



>ref|XP_004488737.1| PREDICTED: squamosa promoter-binding-like protein 5-like isoform 
X2 [Cicer arietinum]
Length=171

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C AD   +K+YHRRHKVCE H+KA  VVVAGLRQRFCQQCSRFHEL EFDEAKRS
Sbjct  55   CQAESCDADFTLSKRYHRRHKVCEVHSKAPSVVVAGLRQRFCQQCSRFHELMEFDEAKRS  114

Query  512  CRRRLAGHNERRRK  471
            CRRRLA HNERRRK
Sbjct  115  CRRRLARHNERRRK  128



>ref|XP_002509450.1| Squamosa promoter-binding protein, putative [Ricinus communis]
 gb|EEF50837.1| Squamosa promoter-binding protein, putative [Ricinus communis]
Length=141

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 68/79 (86%), Gaps = 2/79 (3%)
 Frame = -2

Query  707  PVMRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFD  528
            PV  SCQAE C+ D+ EAK+YHRRHKVCE HAKA  V+V+G+ QRFCQQCSRFHE+ EFD
Sbjct  54   PV--SCQAENCTFDMTEAKRYHRRHKVCEHHAKAPCVLVSGIHQRFCQQCSRFHEVSEFD  111

Query  527  EAKRSCRRRLAGHNERRRK  471
            + KRSCRRRLAGHNERRRK
Sbjct  112  DTKRSCRRRLAGHNERRRK  130



>ref|XP_009788885.1| PREDICTED: squamosa promoter-binding-like protein 3 [Nicotiana 
sylvestris]
Length=165

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 85/131 (65%), Gaps = 21/131 (16%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQ EKC  DL  AK+Y++RHK+C+ HAKA +V VAGLRQRFCQQCSRFHE+ EFD  KRS
Sbjct  54   CQVEKCGLDLSGAKKYYKRHKLCQVHAKAPIVFVAGLRQRFCQQCSRFHEVSEFDGTKRS  113

Query  512  CRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMSIQ  333
            CRRRLAGHNERRRK+                        L+D N C Q++ + R Q+++ 
Sbjct  114  CRRRLAGHNERRRKTPLAIK-------------------LED-NQCRQINGEDRPQLTLT  153

Query  332  E-NSSFKHFQI  303
               +SFK++ I
Sbjct  154  NRKASFKNYHI  164



>ref|XP_004488736.1| PREDICTED: squamosa promoter-binding-like protein 5-like isoform 
X1 [Cicer arietinum]
Length=181

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C AD   +K+YHRRHKVCE H+KA  VVVAGLRQRFCQQCSRFHEL EFDEAKRS
Sbjct  65   CQAESCDADFTLSKRYHRRHKVCEVHSKAPSVVVAGLRQRFCQQCSRFHELMEFDEAKRS  124

Query  512  CRRRLAGHNERRRK  471
            CRRRLA HNERRRK
Sbjct  125  CRRRLARHNERRRK  138



>ref|XP_002305783.2| hypothetical protein POPTR_0004s04630g [Populus trichocarpa]
 gb|EEE86294.2| hypothetical protein POPTR_0004s04630g [Populus trichocarpa]
Length=148

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQ + C+ D+ +AK+YH+RHKVCEFHAKA  V+V G+ QRFCQQCSRFH+L EFD++KR
Sbjct  63   SCQVKNCTTDMTDAKRYHKRHKVCEFHAKASSVLVNGVEQRFCQQCSRFHDLSEFDDSKR  122

Query  515  SCRRRLAGHNERRRK  471
            SCRRRLAGHNERRRK
Sbjct  123  SCRRRLAGHNERRRK  137



>ref|XP_008439842.1| PREDICTED: squamosa promoter-binding protein 1 [Cucumis melo]
Length=142

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQA+ C+ADL  A+ YHRRHKVCEFHAKA VV++AGL QRFCQQCSRFH + EFD+ KRS
Sbjct  57   CQADGCNADLTGARPYHRRHKVCEFHAKAAVVILAGLEQRFCQQCSRFHAVSEFDDTKRS  116

Query  512  CRRRLAGHNERRRK  471
            CR RLAGHNERRRK
Sbjct  117  CRSRLAGHNERRRK  130



>ref|XP_004134953.1| PREDICTED: squamosa promoter-binding protein 1-like [Cucumis 
sativus]
 ref|XP_004155646.1| PREDICTED: squamosa promoter-binding protein 1-like [Cucumis 
sativus]
 gb|KGN49239.1| hypothetical protein Csa_6G517960 [Cucumis sativus]
Length=141

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQA+ C+ADL  AK YHRRHKVCEFH++A VV++AGL QRFCQQCSRFH L EFD+ KRS
Sbjct  56   CQADGCNADLTGAKPYHRRHKVCEFHSRAAVVILAGLEQRFCQQCSRFHALSEFDDTKRS  115

Query  512  CRRRLAGHNERRRK  471
            CR RLAGHNERRRK
Sbjct  116  CRMRLAGHNERRRK  129



>ref|XP_007148144.1| hypothetical protein PHAVU_006G183900g [Phaseolus vulgaris]
 gb|ESW20138.1| hypothetical protein PHAVU_006G183900g [Phaseolus vulgaris]
Length=138

 Score =   122 bits (307),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQ + C+ADL +AK YHRRHKVCE+HAKA  V++A   QRFCQQCSRFHEL EFDE+KR
Sbjct  57   SCQVDGCNADLSDAKPYHRRHKVCEYHAKAPAVLIAEHHQRFCQQCSRFHELSEFDESKR  116

Query  515  SCRRRLAGHNERRRK  471
            SCRRRLAGHNERRRK
Sbjct  117  SCRRRLAGHNERRRK  131



>gb|KHN36843.1| Squamosa promoter-binding-like protein 12 [Glycine soja]
Length=180

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 86/132 (65%), Gaps = 16/132 (12%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQAE C ADL  AK+YHRRHKVCE H+KA  V+VAGLRQ       RFHEL EFDEAKR
Sbjct  65   SCQAEICGADLTVAKRYHRRHKVCELHSKAPSVMVAGLRQ-------RFHELAEFDEAKR  117

Query  515  SCRRRLAGHNERRRKssaissessqaaeavaassSTRNQYLKDINVCGQVDDKGRIQMSI  336
            SCRRRLA HNERRRK        S A       S ++ Q+  + + C   DD GRIQM+I
Sbjct  118  SCRRRLARHNERRRK--------SNAETCNEGCSGSKGQHPAETH-CRNTDDWGRIQMNI  168

Query  335  QENSSFKHFQIR  300
             +NS +K F IR
Sbjct  169  AKNSGYKFFHIR  180



>ref|XP_004164023.1| PREDICTED: squamosa promoter-binding protein 1-like [Cucumis 
sativus]
Length=142

 Score =   122 bits (307),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQA+ C+ADL  +K+YHRRHKVCEFHAKA VV V G+ QRFCQQCSRFH L EFDE KRS
Sbjct  58   CQADNCNADLSSSKRYHRRHKVCEFHAKAPVVPVTGIDQRFCQQCSRFHGLQEFDETKRS  117

Query  512  CRRRLAGHNERRRK  471
            CR+RLAGHN+RRRK
Sbjct  118  CRKRLAGHNQRRRK  131



>ref|XP_004505078.1| PREDICTED: squamosa promoter-binding protein 1-like [Cicer arietinum]
Length=121

 Score =   122 bits (305),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQ E C ADL EAKQYHRRHKVCE+HAKA  V ++GL+QRFCQQCSRFHEL EFD++KRS
Sbjct  44   CQVENCDADLSEAKQYHRRHKVCEYHAKAPAVHISGLQQRFCQQCSRFHELSEFDDSKRS  103

Query  512  CRRRLAGHNERRRK  471
            CRRRLA HN RRRK
Sbjct  104  CRRRLAEHNLRRRK  117



>ref|XP_004146615.1| PREDICTED: squamosa promoter-binding protein 1-like [Cucumis 
sativus]
Length=139

 Score =   122 bits (306),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQA+ C+ADL  +K+YHRRHKVCEFHAKA VV V G+ QRFCQQCSRFH L EFDE KRS
Sbjct  55   CQADNCNADLSSSKRYHRRHKVCEFHAKAPVVPVTGIDQRFCQQCSRFHGLQEFDETKRS  114

Query  512  CRRRLAGHNERRRK  471
            CR+RLAGHN+RRRK
Sbjct  115  CRKRLAGHNQRRRK  128



>gb|KGN64693.1| hypothetical protein Csa_1G074980 [Cucumis sativus]
Length=162

 Score =   123 bits (308),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQA+ C+ADL  +K+YHRRHKVCEFHAKA VV V G+ QRFCQQCSRFH L EFDE KRS
Sbjct  78   CQADNCNADLSSSKRYHRRHKVCEFHAKAPVVPVTGIDQRFCQQCSRFHGLQEFDETKRS  137

Query  512  CRRRLAGHNERRRK  471
            CR+RLAGHN+RRRK
Sbjct  138  CRKRLAGHNQRRRK  151



>ref|XP_009115660.1| PREDICTED: squamosa promoter-binding-like protein 5 [Brassica 
rapa]
Length=176

 Score =   123 bits (309),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R CQ  +C+A+L EAKQY+RRHKVCE HAKA    V+G +QRFCQQCSRFHEL EFDEAK
Sbjct  59   RLCQVHRCTANLTEAKQYYRRHKVCEVHAKASAATVSGAKQRFCQQCSRFHELPEFDEAK  118

Query  518  RSCRRRLAGHNERRRK  471
            RSCR RLAGHNERRRK
Sbjct  119  RSCRMRLAGHNERRRK  134



>emb|CDY20128.1| BnaA01g28740D [Brassica napus]
Length=176

 Score =   123 bits (309),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R CQ  +C+A+L EAKQY+RRHKVCE HAKA    V+G +QRFCQQCSRFHEL EFDEAK
Sbjct  59   RLCQVHRCTANLTEAKQYYRRHKVCEVHAKASAATVSGAKQRFCQQCSRFHELPEFDEAK  118

Query  518  RSCRRRLAGHNERRRK  471
            RSCR RLAGHNERRRK
Sbjct  119  RSCRMRLAGHNERRRK  134



>gb|AHC08502.1| SBP-box transcription factor [Malus domestica]
Length=168

 Score =   123 bits (308),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQ + C+ADL + KQY+RRHKVC+ HAKA  +VV G RQRFCQQCSRFH L EFD++KRS
Sbjct  82   CQVDNCTADLSDLKQYYRRHKVCDVHAKAPSIVVGGFRQRFCQQCSRFHSLSEFDDSKRS  141

Query  512  CRRRLAGHNERRRK  471
            CRRRLAGHNERRRK
Sbjct  142  CRRRLAGHNERRRK  155



>ref|XP_008383704.1| PREDICTED: squamosa promoter-binding-like protein 3 [Malus domestica]
Length=168

 Score =   122 bits (307),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQ + C+ADL + KQY+RRHKVC+ HAKA  +VV G RQRFCQQCSRFH L EFD++KRS
Sbjct  82   CQVDNCTADLSDLKQYYRRHKVCDVHAKAPSIVVGGFRQRFCQQCSRFHSLSEFDDSKRS  141

Query  512  CRRRLAGHNERRRK  471
            CRRRLAGHNERRRK
Sbjct  142  CRRRLAGHNERRRK  155



>ref|XP_004957796.1| PREDICTED: squamosa promoter-binding-like protein 13-like [Setaria 
italica]
Length=199

 Score =   124 bits (310),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE+C+ADL +A  Y+RRHKVC+ H+KA VV+VAGLRQRFCQQCSRFHEL EFDE +RS
Sbjct  83   CQAERCNADLSDAATYNRRHKVCQTHSKAPVVLVAGLRQRFCQQCSRFHELSEFDETRRS  142

Query  512  CRRRLAGHNERRRK  471
            CR RLAGHNERRRK
Sbjct  143  CRLRLAGHNERRRK  156



>ref|XP_004140489.1| PREDICTED: squamosa promoter-binding-like protein 8-like [Cucumis 
sativus]
 gb|KGN46565.1| hypothetical protein Csa_6G109120 [Cucumis sativus]
Length=297

 Score =   126 bits (316),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C+ADL +AK YHRRHKVCEFH+KA  V+ AGL QRFCQQCSRFH +GEFD  KRS
Sbjct  161  CQAEGCNADLSQAKHYHRRHKVCEFHSKASTVITAGLTQRFCQQCSRFHVVGEFDNGKRS  220

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  221  CRKRLADHNRRRRK  234



>ref|XP_008442764.1| PREDICTED: squamosa promoter-binding-like protein 3 isoform X1 
[Cucumis melo]
Length=167

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQA+ C+ADL  +K+YHRRHKVCEFHAKA  V VAG+ QRFCQQCSRFH L EFD+ KRS
Sbjct  83   CQADNCNADLSGSKRYHRRHKVCEFHAKAPAVAVAGIDQRFCQQCSRFHGLQEFDDTKRS  142

Query  512  CRRRLAGHNERRRK  471
            CR+RLAGHN+RRRK
Sbjct  143  CRKRLAGHNQRRRK  156



>ref|XP_008458127.1| PREDICTED: squamosa promoter-binding-like protein 8 [Cucumis 
melo]
 ref|XP_008458128.1| PREDICTED: squamosa promoter-binding-like protein 8 [Cucumis 
melo]
Length=297

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C+ADL +AK YHRRHKVCEFH+KA  V+ AGL QRFCQQCSRFH +GEFD  KRS
Sbjct  162  CQAEGCNADLSQAKHYHRRHKVCEFHSKASTVITAGLTQRFCQQCSRFHVVGEFDNGKRS  221

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  222  CRKRLADHNRRRRK  235



>ref|XP_009352877.1| PREDICTED: squamosa promoter-binding-like protein 3 [Pyrus x 
bretschneideri]
Length=174

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQ + C+ADL + KQY+RRHKVC+ HAKA  +VV G RQRFCQQCSRFH L EFD++KRS
Sbjct  88   CQVDNCTADLSDLKQYYRRHKVCDVHAKASSIVVGGFRQRFCQQCSRFHSLSEFDDSKRS  147

Query  512  CRRRLAGHNERRRK  471
            CRRRLAGHNERRRK
Sbjct  148  CRRRLAGHNERRRK  161



>gb|EAZ39937.1| hypothetical protein OsJ_24374 [Oryza sativa Japonica Group]
Length=175

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQ E+C  DL EA +Y+RRHKVC+ H+K  VV+VAGLRQRFCQQCSRFHEL EFD+AKRS
Sbjct  69   CQVERCGVDLSEAGRYNRRHKVCQTHSKEPVVLVAGLRQRFCQQCSRFHELTEFDDAKRS  128

Query  512  CRRRLAGHNERRRK  471
            CRRRLAGHNERRRK
Sbjct  129  CRRRLAGHNERRRK  142



>ref|XP_006445349.1| hypothetical protein CICLE_v10021106mg [Citrus clementina]
 gb|ESR58589.1| hypothetical protein CICLE_v10021106mg [Citrus clementina]
 gb|KDO85637.1| hypothetical protein CISIN_1g020302mg [Citrus sinensis]
Length=282

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE CSADL  AK YHRRHKVCEFH+KA  V+ AGL QRFCQQCSRFH L EFD  KRS
Sbjct  182  CQAEGCSADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHLLSEFDNGKRS  241

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  242  CRKRLADHNRRRRK  255



>ref|XP_007212177.1| hypothetical protein PRUPE_ppa012607mg [Prunus persica]
 gb|EMJ13376.1| hypothetical protein PRUPE_ppa012607mg [Prunus persica]
Length=162

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQA+ C+ADL +AKQY+RRHKVC  HAKA  V V G++QRFCQQCSRFH L EFD+ KR
Sbjct  80   SCQADDCNADLSDAKQYYRRHKVCGVHAKAPAVRVGGVQQRFCQQCSRFHSLSEFDDNKR  139

Query  515  SCRRRLAGHNERRRK  471
            SCRRRLAGHNERRRK
Sbjct  140  SCRRRLAGHNERRRK  154



>ref|XP_011017436.1| PREDICTED: squamosa promoter-binding-like protein 8 [Populus 
euphratica]
Length=326

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C+ADL  AK YHRRHKVCEFH+KA  V+ AGL QRFCQQCSRFH L EFD  KRS
Sbjct  176  CQAEGCNADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHNLSEFDNGKRS  235

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  236  CRKRLADHNRRRRK  249



>ref|XP_010913682.1| PREDICTED: squamosa promoter-binding-like protein 10 isoform 
X1 [Elaeis guineensis]
 ref|XP_010913683.1| PREDICTED: squamosa promoter-binding-like protein 10 isoform 
X1 [Elaeis guineensis]
Length=396

 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C ADL  AK YHRRHKVCEFH+KA VV+  GL+QRFCQQCSRFH L EFDEAKRS
Sbjct  155  CQAEGCKADLSGAKHYHRRHKVCEFHSKATVVIAGGLQQRFCQQCSRFHVLTEFDEAKRS  214

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  215  CRKRLADHNRRRRK  228



>gb|KHN34486.1| Squamosa promoter-binding-like protein 8 [Glycine soja]
Length=214

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C+ADL +AK YHRRHKVCEFH+KA  V+ AGL QRFCQQCSRFH L EFD  KRS
Sbjct  75   CQAEGCNADLSQAKHYHRRHKVCEFHSKAATVIAAGLTQRFCQQCSRFHLLSEFDNGKRS  134

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  135  CRKRLADHNRRRRK  148



>ref|XP_009398983.1| PREDICTED: squamosa promoter-binding-like protein 10 [Musa acuminata 
subsp. malaccensis]
Length=356

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C ADL  AK YHRRH+VCEFH+KA VV+V GL+QRFCQQCSRFH L EFDEAKRS
Sbjct  138  CQAEGCKADLSGAKHYHRRHRVCEFHSKATVVIVGGLQQRFCQQCSRFHVLAEFDEAKRS  197

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  198  CRKRLADHNRRRRK  211



>ref|NP_001175217.1| Os07g0505200 [Oryza sativa Japonica Group]
 sp|Q6Z461.1|SPL13_ORYSJ RecName: Full=Squamosa promoter-binding-like protein 13 [Oryza 
sativa Japonica Group]
 dbj|BAC84006.1| putative squamosa-promoter binding protein [Oryza sativa Japonica 
Group]
 gb|EEC82110.1| hypothetical protein OsI_26129 [Oryza sativa Indica Group]
 dbj|BAH93945.1| Os07g0505200 [Oryza sativa Japonica Group]
Length=216

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQ E+C  DL EA +Y+RRHKVC+ H+K  VV+VAGLRQRFCQQCSRFHEL EFD+AKRS
Sbjct  110  CQVERCGVDLSEAGRYNRRHKVCQTHSKEPVVLVAGLRQRFCQQCSRFHELTEFDDAKRS  169

Query  512  CRRRLAGHNERRRK  471
            CRRRLAGHNERRRK
Sbjct  170  CRRRLAGHNERRRK  183



>ref|XP_010913684.1| PREDICTED: squamosa promoter-binding-like protein 10 isoform 
X2 [Elaeis guineensis]
Length=318

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C ADL  AK YHRRHKVCEFH+KA VV+  GL+QRFCQQCSRFH L EFDEAKRS
Sbjct  155  CQAEGCKADLSGAKHYHRRHKVCEFHSKATVVIAGGLQQRFCQQCSRFHVLTEFDEAKRS  214

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  215  CRKRLADHNRRRRK  228



>ref|XP_004163755.1| PREDICTED: squamosa promoter-binding-like protein 8-like [Cucumis 
sativus]
Length=297

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C+ADL +AK YHRRHKVCEFH+ A  V+ AGL QRFCQQCSRFH +GEFD  KRS
Sbjct  161  CQAEGCNADLSQAKHYHRRHKVCEFHSTASTVITAGLTQRFCQQCSRFHVVGEFDNGKRS  220

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  221  CRKRLADHNRRRRK  234



>ref|XP_006845685.1| hypothetical protein AMTR_s00019p00235390 [Amborella trichopoda]
 gb|ERN07360.1| hypothetical protein AMTR_s00019p00235390 [Amborella trichopoda]
Length=248

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = -2

Query  707  PVMRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFD  528
            PV+  CQAE C  DL  AK YHRRHKVCEFH+KA  V+  GL QRFCQQCSRFH L EFD
Sbjct  36   PVVPRCQAEGCGNDLTNAKHYHRRHKVCEFHSKATRVIANGLEQRFCQQCSRFHVLAEFD  95

Query  527  EAKRSCRRRLAGHNERRRK  471
            E KRSCRRRLA HN RRRK
Sbjct  96   EVKRSCRRRLADHNRRRRK  114



>ref|XP_008781929.1| PREDICTED: squamosa promoter-binding-like protein 10 [Phoenix 
dactylifera]
Length=404

 Score =   126 bits (316),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C ADL  AK YHRRHKVCEFH+KA VV+  GL+QRFCQQCSRFH L EFDEAKRS
Sbjct  157  CQAEGCKADLSGAKHYHRRHKVCEFHSKATVVIAGGLQQRFCQQCSRFHVLTEFDEAKRS  216

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  217  CRKRLADHNRRRRK  230



>ref|XP_006445348.1| hypothetical protein CICLE_v10021106mg [Citrus clementina]
 ref|XP_006464477.1| PREDICTED: squamosa promoter-binding-like protein 8-like [Citrus 
sinensis]
 gb|ESR58588.1| hypothetical protein CICLE_v10021106mg [Citrus clementina]
 gb|KDO85636.1| hypothetical protein CISIN_1g020302mg [Citrus sinensis]
Length=328

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE CSADL  AK YHRRHKVCEFH+KA  V+ AGL QRFCQQCSRFH L EFD  KRS
Sbjct  182  CQAEGCSADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHLLSEFDNGKRS  241

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  242  CRKRLADHNRRRRK  255



>emb|CDY32310.1| BnaC01g36290D [Brassica napus]
Length=176

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  698  RSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAK  519
            R CQ  +C+A+L EAKQY+RRHKVCE HAKA    V+G + RFCQQCSRFHEL EFDEAK
Sbjct  59   RLCQVHRCTANLTEAKQYYRRHKVCEVHAKASAATVSGAKHRFCQQCSRFHELPEFDEAK  118

Query  518  RSCRRRLAGHNERRRK  471
            RSCR RLAGHNERRRK
Sbjct  119  RSCRMRLAGHNERRRK  134



>ref|XP_008225122.1| PREDICTED: squamosa promoter-binding-like protein 3 [Prunus mume]
Length=161

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            SCQA+ C+ADL +AKQY+RRHKVC  HAKA  V V G++QRFCQQCSRFH L EFD+ KR
Sbjct  79   SCQADDCNADLSDAKQYYRRHKVCGVHAKAPAVRVGGVQQRFCQQCSRFHSLPEFDDNKR  138

Query  515  SCRRRLAGHNERRRK  471
            SCRRRLAGHNERRRK
Sbjct  139  SCRRRLAGHNERRRK  153



>emb|CAD90156.1| squamosa promoter binding like-protein [Betula pendula]
 emb|CAD90157.1| squamosa promoter binding like-protein [Betula pendula]
Length=134

 Score =   119 bits (299),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -2

Query  695  SCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKR  516
            +CQ E C+ADL +AK YHRRHKVCE HAKA +V VAG ++RFCQQCSRFH+L EFDE K+
Sbjct  49   TCQVENCNADLTDAKHYHRRHKVCESHAKAPIVYVAGGQKRFCQQCSRFHDLSEFDEYKK  108

Query  515  SCRRRLAGHNERRRK  471
            SCR+RLAGHNERRRK
Sbjct  109  SCRKRLAGHNERRRK  123



>ref|XP_007140981.1| hypothetical protein PHAVU_008G157200g [Phaseolus vulgaris]
 ref|XP_007140982.1| hypothetical protein PHAVU_008G157200g [Phaseolus vulgaris]
 gb|ESW12975.1| hypothetical protein PHAVU_008G157200g [Phaseolus vulgaris]
 gb|ESW12976.1| hypothetical protein PHAVU_008G157200g [Phaseolus vulgaris]
Length=325

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C+ DL EAK YHRRHKVCEFH+KA  V+ AGL QRFCQQCSRFH L EFD  KRS
Sbjct  181  CQAEGCNTDLSEAKHYHRRHKVCEFHSKAATVIAAGLTQRFCQQCSRFHLLSEFDNGKRS  240

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  241  CRKRLADHNRRRRK  254



>ref|XP_006445347.1| hypothetical protein CICLE_v10021106mg [Citrus clementina]
 gb|ESR58587.1| hypothetical protein CICLE_v10021106mg [Citrus clementina]
Length=324

 Score =   124 bits (312),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE CSADL  AK YHRRHKVCEFH+KA  V+ AGL QRFCQQCSRFH L EFD  KRS
Sbjct  182  CQAEGCSADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHLLSEFDNGKRS  241

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  242  CRKRLADHNRRRRK  255



>ref|XP_009118853.1| PREDICTED: squamosa promoter-binding-like protein 8 [Brassica 
rapa]
Length=334

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE+C+ADL  AK YHRRHKVCEFH+KA  VV AGL QRFCQQCSRFH L EFD  KRS
Sbjct  189  CQAERCNADLSHAKHYHRRHKVCEFHSKASTVVAAGLSQRFCQQCSRFHLLSEFDNGKRS  248

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  249  CRKRLADHNRRRRK  262



>ref|XP_010480322.1| PREDICTED: squamosa promoter-binding-like protein 8, partial 
[Camelina sativa]
Length=209

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C+ADL  AK YHRRHKVCEFH+KA  VV AGL QRFCQQCSRFH L EFD  KRS
Sbjct  65   CQAEGCNADLSHAKHYHRRHKVCEFHSKASTVVAAGLSQRFCQQCSRFHLLSEFDNGKRS  124

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  125  CRKRLADHNRRRRK  138



>emb|CDY38043.1| BnaCnng09040D [Brassica napus]
Length=335

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE+C+ADL  AK YHRRHKVCEFH+KA  VV AGL QRFCQQCSRFH L EFD  KRS
Sbjct  190  CQAERCNADLSHAKHYHRRHKVCEFHSKASTVVAAGLSQRFCQQCSRFHLLSEFDNGKRS  249

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  250  CRKRLADHNRRRRK  263



>ref|XP_009408821.1| PREDICTED: squamosa promoter-binding-like protein 8 [Musa acuminata 
subsp. malaccensis]
Length=372

 Score =   125 bits (314),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C ADL  AK YHRRHKVCEFH+KA VV+  GL+QRFCQQCSRFH L EFDEAKRS
Sbjct  144  CQAEGCKADLSGAKHYHRRHKVCEFHSKATVVIAHGLQQRFCQQCSRFHALAEFDEAKRS  203

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  204  CRKRLADHNRRRRK  217



>ref|XP_003593617.1| Squamosa promoter binding-like protein [Medicago truncatula]
 gb|AES63868.1| squamosa promoter-binding-like protein [Medicago truncatula]
 gb|AFK46131.1| unknown [Medicago truncatula]
 gb|AFK48393.1| unknown [Medicago truncatula]
Length=143

 Score =   119 bits (299),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = -2

Query  707  PVMRSCQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFD  528
             V  SCQ + C+ADL  AKQYH+RHKVCE H+KA  V+++ L+QRFCQQCSRFHE+ EFD
Sbjct  59   SVTPSCQVDNCNADLSAAKQYHKRHKVCENHSKAHSVLISELQQRFCQQCSRFHEVSEFD  118

Query  527  EAKRSCRRRLAGHNERRRK  471
            + KRSCRRRLAGHNERRRK
Sbjct  119  DLKRSCRRRLAGHNERRRK  137



>ref|XP_010496481.1| PREDICTED: squamosa promoter-binding-like protein 8 [Camelina 
sativa]
Length=202

 Score =   121 bits (304),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C+ADL  AK YHRRHKVCEFH+KA  VV AGL QRFCQQCSRFH L EFD  KRS
Sbjct  58   CQAEGCNADLSHAKHYHRRHKVCEFHSKASTVVAAGLSQRFCQQCSRFHLLSEFDNGKRS  117

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  118  CRKRLADHNRRRRK  131



>ref|XP_010692128.1| PREDICTED: squamosa promoter-binding-like protein 8 [Beta vulgaris 
subsp. vulgaris]
Length=286

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C+ADL+ AK YHRRHKVCEFH+KA  V+ AGL QRFCQQCSRFH L EFD  KRS
Sbjct  150  CQAEGCNADLNHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHLLSEFDNGKRS  209

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  210  CRKRLADHNRRRRK  223



>ref|XP_002892031.1| hypothetical protein ARALYDRAFT_470069 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68290.1| hypothetical protein ARALYDRAFT_470069 [Arabidopsis lyrata subsp. 
lyrata]
Length=323

 Score =   124 bits (311),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C+ADL  AK YHRRHKVCEFH+KA  VV AGL QRFCQQCSRFH L EFD  KRS
Sbjct  181  CQAEGCNADLSHAKHYHRRHKVCEFHSKASTVVAAGLSQRFCQQCSRFHLLSEFDNGKRS  240

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  241  CRKRLADHNRRRRK  254



>gb|KDP28816.1| hypothetical protein JCGZ_14587 [Jatropha curcas]
Length=305

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C+ADL  AK YHRRHKVCEFH+KA  V+ AGL QRFCQQCSRFH L EFD  KRS
Sbjct  154  CQAEGCNADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHLLSEFDNGKRS  213

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  214  CRKRLADHNRRRRK  227



>ref|XP_004229775.1| PREDICTED: squamosa promoter-binding-like protein 8 [Solanum 
lycopersicum]
Length=299

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C+ADL  AK YHRRHKVCEFH+KA  V+ AGL QRFCQQCSRFH L EFD  KRS
Sbjct  166  CQAEGCNADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHVLSEFDNGKRS  225

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  226  CRKRLADHNRRRRK  239



>ref|XP_006375255.1| hypothetical protein POPTR_0014s05680g [Populus trichocarpa]
 gb|ERP53052.1| hypothetical protein POPTR_0014s05680g [Populus trichocarpa]
Length=328

 Score =   124 bits (312),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C+ADL  AK YHRRHKVCEFH+KA  V+ AGL QRFCQQCSRFH L EFD  KRS
Sbjct  179  CQAEGCNADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHLLSEFDNGKRS  238

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  239  CRKRLADHNRRRRK  252



>ref|XP_003626693.1| Squamosa promoter binding protein [Medicago truncatula]
 gb|AET01169.1| squamosa promoter-binding-like protein [Medicago truncatula]
Length=327

 Score =   124 bits (311),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C+ADL +AK YHRRHKVCEFH+KA  VV AGL QRFCQQCSRFH L EFD  KRS
Sbjct  187  CQAEGCNADLSQAKHYHRRHKVCEFHSKAATVVAAGLTQRFCQQCSRFHLLSEFDNGKRS  246

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  247  CRKRLADHNRRRRK  260



>ref|XP_011033165.1| PREDICTED: squamosa promoter-binding-like protein 8 [Populus 
euphratica]
Length=328

 Score =   124 bits (311),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C+ADL  AK YHRRHKVCEFH+KA  V+ AGL QRFCQQCSRFH L EFD  KRS
Sbjct  179  CQAEGCNADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHLLSEFDNGKRS  238

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  239  CRKRLADHNRRRRK  252



>ref|XP_004510110.1| PREDICTED: squamosa promoter-binding-like protein 8-like isoform 
X2 [Cicer arietinum]
Length=281

 Score =   123 bits (309),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C+ADL +AK YHRRHKVCEFH+KA  V+ AGL QRFCQQCSRFH L EFD  KRS
Sbjct  185  CQAEGCNADLSQAKHYHRRHKVCEFHSKAATVIAAGLTQRFCQQCSRFHLLSEFDNGKRS  244

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  245  CRKRLADHNRRRRK  258



>ref|XP_002301256.2| hypothetical protein POPTR_0002s14320g [Populus trichocarpa]
 gb|EEE80529.2| hypothetical protein POPTR_0002s14320g [Populus trichocarpa]
Length=325

 Score =   124 bits (311),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C+ADL  AK YHRRHKVCEFH+KA  V+ AGL QRFCQQCSRFH L EFD  KRS
Sbjct  175  CQAEGCNADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHILSEFDNGKRS  234

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  235  CRKRLADHNRRRRK  248



>ref|XP_011090046.1| PREDICTED: squamosa promoter-binding-like protein 8 [Sesamum 
indicum]
Length=326

 Score =   124 bits (311),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C+ADL  AK YHRRHKVCEFH+KA  V+ AGL QRFCQQCSRFH L EFD  KRS
Sbjct  172  CQAEGCNADLTHAKHYHRRHKVCEFHSKAATVIAAGLTQRFCQQCSRFHLLSEFDNGKRS  231

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  232  CRKRLADHNRRRRK  245



>dbj|BAC42797.1| putative squamosa promoter binding protein 8 SPL8 [Arabidopsis 
thaliana]
Length=333

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C+ADL  AK YHRRHKVCEFH+KA  VV AGL QRFCQQCSRFH L EFD  KRS
Sbjct  188  CQAEGCNADLSHAKHYHRRHKVCEFHSKASTVVAAGLSQRFCQQCSRFHLLSEFDNGKRS  247

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  248  CRKRLADHNRRRRK  261



>ref|XP_006348003.1| PREDICTED: squamosa promoter-binding-like protein 8-like [Solanum 
tuberosum]
Length=302

 Score =   123 bits (309),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C+ADL  AK YHRRHKVCEFH+KA  V+ AGL QRFCQQCSRFH L EFD  KRS
Sbjct  166  CQAEGCNADLTHAKHYHRRHKVCEFHSKAATVIAAGLTQRFCQQCSRFHVLSEFDNGKRS  225

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  226  CRKRLADHNRRRRK  239



>ref|NP_683267.1| squamosa promoter binding protein-like 8 [Arabidopsis thaliana]
 sp|Q8GXL3.2|SPL8_ARATH RecName: Full=Squamosa promoter-binding-like protein 8 [Arabidopsis 
thaliana]
 emb|CAB56593.1| squamosa promoter binding protein-like 8 [Arabidopsis thaliana]
 emb|CAB56594.1| squamosa promoter binding protein-like 8 [Arabidopsis thaliana]
 gb|AEE27374.1| squamosa promoter-binding-like protein 8 [Arabidopsis thaliana]
Length=333

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C+ADL  AK YHRRHKVCEFH+KA  VV AGL QRFCQQCSRFH L EFD  KRS
Sbjct  188  CQAEGCNADLSHAKHYHRRHKVCEFHSKASTVVAAGLSQRFCQQCSRFHLLSEFDNGKRS  247

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  248  CRKRLADHNRRRRK  261



>gb|AFC17960.1| squamosa promoter binding protein-like 8 [Betula platyphylla]
Length=309

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C+ADL  AK YHRRHKVCEFH+KA  V+ AGL QRFCQQCSRFH L EFD  KRS
Sbjct  164  CQAEGCNADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHLLSEFDNGKRS  223

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  224  CRKRLADHNRRRRK  237



>gb|AGI62063.1| SQUAMOSA promoter-binding-like 15 [Erycina pusilla]
Length=339

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C ADL  AK YHRRHKVCEFH+KA +V+ AGL QRFCQQCSRFH L EFD+ KRS
Sbjct  106  CQAEGCGADLSHAKHYHRRHKVCEFHSKASIVIAAGLSQRFCQQCSRFHVLSEFDQGKRS  165

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  166  CRKRLADHNRRRRK  179



>ref|XP_006361511.1| PREDICTED: squamosa promoter-binding-like protein 8-like isoform 
X2 [Solanum tuberosum]
Length=290

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C+ADL  AK YHRRHKVCEFH+KA  V+ AGL QRFCQQCSRFH L EFD  KRS
Sbjct  163  CQAEGCNADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHLLSEFDNGKRS  222

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  223  CRKRLADHNRRRRK  236



>ref|XP_003530168.1| PREDICTED: squamosa promoter-binding-like protein 8-like [Glycine 
max]
Length=338

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C+ADL +AK YHRRHKVCEFH+KA  V+ AGL QRFCQQCSRFH L EFD  KRS
Sbjct  199  CQAEGCNADLSQAKHYHRRHKVCEFHSKAATVIAAGLTQRFCQQCSRFHLLSEFDNGKRS  258

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  259  CRKRLADHNRRRRK  272



>gb|AIE89801.1| SQUAMOSA promoter binding protein-like 12, partial [Salvia miltiorrhiza]
Length=312

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C+ADL  AK YHRRHKVCEFH+KA  V+ AGL QRFCQQCSRFH L EFD  KRS
Sbjct  163  CQAEGCNADLTHAKHYHRRHKVCEFHSKAATVIAAGLTQRFCQQCSRFHLLSEFDNGKRS  222

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  223  CRKRLADHNRRRRK  236



>ref|XP_006305139.1| hypothetical protein CARUB_v10009506mg [Capsella rubella]
 gb|EOA38037.1| hypothetical protein CARUB_v10009506mg [Capsella rubella]
Length=367

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE CSADL  AK YHRRHKVCEFH+KA  VV AGL QRFCQQCSRFH L EFD  KRS
Sbjct  218  CQAEGCSADLSHAKHYHRRHKVCEFHSKASTVVAAGLSQRFCQQCSRFHLLSEFDNGKRS  277

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  278  CRKRLADHNRRRRK  291



>ref|XP_006361510.1| PREDICTED: squamosa promoter-binding-like protein 8-like isoform 
X1 [Solanum tuberosum]
Length=293

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C+ADL  AK YHRRHKVCEFH+KA  V+ AGL QRFCQQCSRFH L EFD  KRS
Sbjct  163  CQAEGCNADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHLLSEFDNGKRS  222

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  223  CRKRLADHNRRRRK  236



>ref|XP_008232622.1| PREDICTED: squamosa promoter-binding-like protein 8 [Prunus mume]
Length=282

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 70/123 (57%), Gaps = 23/123 (19%)
 Frame = -2

Query  839  VLKREAMEGDAAAGERESPSSAISADDEkkkrggkkggggnngGPVMRSCQAEKCSADLH  660
            +L  + + G AA G    P S                       P    CQAE C+ADL 
Sbjct  102  LLSLDPIHGGAAHGPAPDPGS-----------------------PHAPRCQAEGCTADLS  138

Query  659  EAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRSCRRRLAGHNER  480
             AK YHRRHKVCEFH+KA  V+  GL QRFCQQCSRFH L EFD  KRSCRRRLA HN R
Sbjct  139  HAKHYHRRHKVCEFHSKASTVIANGLTQRFCQQCSRFHLLPEFDNGKRSCRRRLADHNRR  198

Query  479  RRK  471
            RRK
Sbjct  199  RRK  201



>gb|AEB71564.1| squamosa promoter binding protein-like protein [Solanum chacoense]
Length=293

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQAE C+ADL  AK YHRRHKVCEFH+KA  V+ AGL QRFCQQCSRFH L EFD  KRS
Sbjct  163  CQAEGCNADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHLLSEFDNGKRS  222

Query  512  CRRRLAGHNERRRK  471
            CR+RLA HN RRRK
Sbjct  223  CRKRLADHNRRRRK  236



>ref|XP_010554861.1| PREDICTED: squamosa promoter-binding-like protein 9 [Tarenaya 
hassleriana]
Length=349

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -2

Query  692  CQAEKCSADLHEAKQYHRRHKVCEFHAKAQVVVVAGLRQRFCQQCSRFHELGEFDEAKRS  513
            CQ E CS DL + K Y+ RHKVC  H+K+ +V VAGLRQRFCQQCSRFH+L EFD+ KRS
Sbjct  64   CQVEGCSVDLSDVKAYYSRHKVCAIHSKSPIVTVAGLRQRFCQQCSRFHQLVEFDQEKRS  123

Query  512  CRRRLAGHNERRRK  471
            CRRRLAGHNERRRK
Sbjct  124  CRRRLAGHNERRRK  137



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2508968796672