BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13405_g1_i1 len=1145 path=[1:0-698 942:699-749 993:750-1144]

Length=1145
                                                                      Score     E

ref|XP_011089946.1|  PREDICTED: UDP-glycosyltransferase 86A2            386   9e-127   
ref|XP_007016838.1|  UDP-Glycosyltransferase superfamily protein        386   1e-126   
ref|XP_008465359.1|  PREDICTED: UDP-glycosyltransferase 86A2            380   2e-124   
emb|CDP07057.1|  unnamed protein product                                374   3e-122   
ref|XP_007206260.1|  hypothetical protein PRUPE_ppa015843mg             371   5e-121   
ref|XP_004145815.1|  PREDICTED: UDP-glycosyltransferase 86A2-like       370   7e-121   
emb|CBI17168.3|  unnamed protein product                                367   2e-120   
ref|XP_002314296.1|  glycosyltransferase family protein                 370   2e-120   Populus trichocarpa [western balsam poplar]
ref|XP_008355190.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       369   3e-120   
ref|XP_008363514.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       369   4e-120   
ref|XP_008226277.1|  PREDICTED: UDP-glycosyltransferase 86A2            369   4e-120   
ref|XP_010263435.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       368   7e-120   
ref|XP_003632262.1|  PREDICTED: UDP-glycosyltransferase 86A1            367   2e-119   
ref|XP_010253969.1|  PREDICTED: UDP-glycosyltransferase 86A2-like       363   5e-118   
ref|XP_006424499.1|  hypothetical protein CICLE_v10029902mg             362   1e-117   
ref|XP_006488636.1|  PREDICTED: UDP-glycosyltransferase 86A2-like       362   1e-117   
gb|KDO60213.1|  hypothetical protein CISIN_1g011789mg                   362   2e-117   
dbj|BAG80548.1|  UDP-glucose:glucosyltransferase                        360   4e-117   Lycium barbarum [goji berry]
ref|XP_011040925.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       360   9e-117   
ref|XP_006384937.1|  hypothetical protein POPTR_0004s22400g             360   1e-116   
ref|XP_004295617.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       359   2e-116   
ref|XP_010043797.1|  PREDICTED: UDP-glycosyltransferase 86A2            355   1e-114   
ref|XP_009376097.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       353   2e-114   
ref|XP_008809704.1|  PREDICTED: UDP-glycosyltransferase 86A2-like       350   3e-114   
ref|XP_002523692.1|  UDP-glucosyltransferase, putative                  353   6e-114   Ricinus communis
ref|XP_008809703.1|  PREDICTED: UDP-glycosyltransferase 86A2-like       352   5e-113   
gb|KDP43993.1|  hypothetical protein JCGZ_05460                         350   1e-112   
ref|XP_007027384.1|  UDP-Glycosyltransferase superfamily protein        345   7e-111   
ref|XP_010050978.1|  PREDICTED: UDP-glycosyltransferase 86A1            344   1e-110   
emb|CDP07058.1|  unnamed protein product                                343   2e-110   
gb|KDO49335.1|  hypothetical protein CISIN_1g011724mg                   343   3e-110   
ref|XP_006428406.1|  hypothetical protein CICLE_v10011571mg             343   4e-110   
gb|AFJ53011.1|  UDP-glycosyltransferase 1                               338   2e-108   
emb|CBI32766.3|  unnamed protein product                                331   7e-106   
ref|XP_002276858.1|  PREDICTED: UDP-glycosyltransferase 86A1            330   3e-105   Vitis vinifera
gb|AFJ53012.1|  UDP-glycosyltransferase 1                               327   6e-104   
gb|EMT03715.1|  Cytokinin-O-glucosyltransferase 2                       325   1e-103   
ref|XP_007205117.1|  hypothetical protein PRUPE_ppa004829mg             326   1e-103   
ref|XP_008243980.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       323   2e-102   
ref|XP_004304452.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       323   2e-102   
ref|XP_004983013.1|  PREDICTED: UDP-glycosyltransferase 86A1-like...    322   6e-102   
dbj|BAJ89293.1|  predicted protein                                      322   8e-102   
dbj|BAJ89423.1|  predicted protein                                      322   9e-102   
ref|XP_009785232.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       322   1e-101   
emb|CDP18343.1|  unnamed protein product                                321   1e-101   
ref|XP_009610181.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       320   4e-101   
ref|XP_007205115.1|  hypothetical protein PRUPE_ppa004816mg             319   1e-100   
ref|XP_004246641.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       319   1e-100   
ref|XP_003573976.1|  PREDICTED: UDP-glycosyltransferase 86A1 isof...    318   2e-100   
ref|XP_009401822.1|  PREDICTED: UDP-glycosyltransferase 86A1            318   5e-100   
ref|XP_009802698.1|  PREDICTED: UDP-glycosyltransferase 86A1            317   6e-100   
ref|XP_006354353.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       317   7e-100   
gb|EYU38553.1|  hypothetical protein MIMGU_mgv1a005283mg                316   1e-99    
ref|XP_006662391.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       315   2e-99    
ref|XP_009413144.1|  PREDICTED: UDP-glycosyltransferase 86A1            315   3e-99    
ref|XP_009616388.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       313   1e-98    
ref|XP_002464565.1|  hypothetical protein SORBIDRAFT_01g020920          311   1e-97    Sorghum bicolor [broomcorn]
ref|XP_011077327.1|  PREDICTED: UDP-glycosyltransferase 86A1            310   2e-97    
gb|AFJ53013.1|  UDP-glycosyltransferase 1                               310   3e-97    
ref|NP_001169578.1|  uncharacterized protein LOC100383459               310   3e-97    Zea mays [maize]
dbj|BAG80551.1|  UDP-glucose:glucosyltransferase                        309   5e-97    Lycium barbarum [goji berry]
ref|XP_008645070.1|  PREDICTED: uncharacterized protein LOC100383...    309   5e-97    
gb|AFJ53014.1|  UDP-glycosyltransferase 1                               309   7e-97    
gb|AFJ53015.1|  UDP-glycosyltransferase 1                               309   8e-97    
dbj|BAF75888.1|  glucosyltransferase                                    308   2e-96    Dianthus caryophyllus [carnation]
ref|XP_010107481.1|  UDP-glycosyltransferase 86A1                       308   2e-96    
gb|EYU34478.1|  hypothetical protein MIMGU_mgv1a020724mg                308   3e-96    
ref|XP_010907030.1|  PREDICTED: UDP-glycosyltransferase 86A1-like...    307   3e-96    
dbj|BAJ86664.1|  predicted protein                                      306   4e-96    
ref|XP_010907029.1|  PREDICTED: UDP-glycosyltransferase 86A1-like...    306   6e-96    
ref|XP_010557349.1|  PREDICTED: UDP-glycosyltransferase 86A2            306   1e-95    
ref|XP_010414605.1|  PREDICTED: UDP-glycosyltransferase 86A2-like       305   2e-95    
ref|XP_008243982.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       305   2e-95    
ref|XP_011094626.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       305   2e-95    
emb|CDP12501.1|  unnamed protein product                                305   2e-95    
ref|XP_010107482.1|  UDP-glycosyltransferase 86A1                       305   3e-95    
ref|XP_003573977.1|  PREDICTED: UDP-glycosyltransferase 86A1 isof...    304   7e-95    
ref|XP_006345817.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       303   1e-94    
ref|XP_004239693.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       303   1e-94    
ref|XP_009376819.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       301   4e-94    
ref|XP_004983012.1|  PREDICTED: UDP-glycosyltransferase 86A1-like...    301   8e-94    
gb|KFK32346.1|  udp-glycosyltransferase-like protein                    300   1e-93    
ref|XP_007206586.1|  hypothetical protein PRUPE_ppa020358mg             300   2e-93    
gb|EAY78678.1|  hypothetical protein OsI_33780                          300   3e-93    Oryza sativa Indica Group [Indian rice]
emb|CDX74999.1|  BnaA05g07450D                                          299   4e-93    
emb|CDY33211.1|  BnaC04g08280D                                          299   5e-93    
ref|XP_002879117.1|  glycosyltransferase family protein                 299   5e-93    
ref|NP_180375.1|  UDP-glycosyltransferase 86A2                          299   5e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002879636.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    299   6e-93    
gb|AAM61749.1|  putative glucosyltransferase                            298   8e-93    Arabidopsis thaliana [mouse-ear cress]
gb|KFK36574.1|  hypothetical protein AALP_AA4G141300                    298   9e-93    
emb|CDX75000.1|  BnaA05g07460D                                          298   1e-92    
ref|XP_010516934.1|  PREDICTED: UDP-glycosyltransferase 86A1            298   1e-92    
ref|XP_010510698.1|  PREDICTED: UDP-glycosyltransferase 86A2            297   2e-92    
gb|AAP53972.1|  UDP-glucoronosyl and UDP-glucosyl transferase fam...    298   2e-92    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009334655.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       297   2e-92    
ref|XP_006410874.1|  hypothetical protein EUTSA_v10016577mg             297   4e-92    
ref|XP_010470154.1|  PREDICTED: UDP-glycosyltransferase 86A2-like       295   9e-92    
ref|NP_181234.1|  UDP-glycosyltransferase 86A1                          296   1e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008359642.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       296   1e-91    
ref|XP_009143540.1|  PREDICTED: UDP-glycosyltransferase 86A1            295   1e-91    
ref|XP_008350360.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       295   2e-91    
ref|XP_006352303.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    295   2e-91    
ref|XP_010907028.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       294   2e-91    
ref|XP_007207842.1|  hypothetical protein PRUPE_ppa023014mg             295   2e-91    
ref|XP_008243981.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       294   3e-91    
ref|XP_006294108.1|  hypothetical protein CARUB_v10023101mg             295   3e-91    
gb|KDP29154.1|  hypothetical protein JCGZ_16543                         294   3e-91    
ref|XP_007206708.1|  hypothetical protein PRUPE_ppa024090mg             294   4e-91    
ref|XP_010505248.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       294   4e-91    
ref|XP_009376816.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       294   4e-91    
emb|CDX77151.1|  BnaC04g39460D                                          294   4e-91    
emb|CDY30510.1|  BnaA04g16230D                                          294   4e-91    
ref|XP_009140842.1|  PREDICTED: UDP-glycosyltransferase 86A2            293   5e-91    
ref|XP_006367686.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       293   6e-91    
ref|XP_008644820.1|  PREDICTED: UDP-glycosyltransferase 86A1            293   1e-90    
ref|XP_009376817.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       292   1e-90    
ref|XP_006409826.1|  hypothetical protein EUTSA_v10016590mg             291   6e-90    
ref|XP_009143541.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       291   6e-90    
ref|XP_010509409.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       291   7e-90    
ref|XP_004249621.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       284   4e-87    
ref|XP_011094625.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       282   2e-86    
emb|CDY33212.1|  BnaC04g08270D                                          282   2e-86    
gb|EYU34479.1|  hypothetical protein MIMGU_mgv1a005298mg                280   1e-85    
ref|XP_009623615.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       280   1e-85    
ref|XP_010107502.1|  UDP-glycosyltransferase 86A1                       281   2e-85    
ref|XP_009784463.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       277   2e-84    
ref|XP_010686253.1|  PREDICTED: UDP-glycosyltransferase 86A1-like...    275   1e-83    
ref|XP_006350954.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       274   1e-83    
ref|XP_010107499.1|  UDP-glycosyltransferase 86A1                       284   2e-83    
ref|XP_006833161.1|  hypothetical protein AMTR_s00072p00130550          277   3e-83    
dbj|BAJ85107.1|  predicted protein                                      273   5e-83    
ref|XP_008778580.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       272   7e-83    
gb|EYU34477.1|  hypothetical protein MIMGU_mgv1a005487mg                271   2e-82    
ref|XP_004304453.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       270   5e-82    
ref|XP_009770479.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       259   7e-82    
gb|EPS66574.1|  hypothetical protein M569_08200                         267   7e-81    
ref|XP_010686252.1|  PREDICTED: UDP-glycosyltransferase 86A1-like...    264   2e-79    
ref|XP_004246642.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       261   9e-79    
ref|XP_011094737.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       261   2e-78    
ref|XP_010107479.1|  UDP-glycosyltransferase 86A1                       261   2e-78    
ref|XP_006354352.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       258   3e-77    
ref|XP_009400676.1|  PREDICTED: UDP-glycosyltransferase 86A2-like       259   5e-77    
ref|XP_011094627.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       257   6e-77    
ref|XP_004249916.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       254   4e-76    
ref|XP_006350953.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       254   4e-76    
ref|XP_010669654.1|  PREDICTED: UDP-glycosyltransferase 86A2-like       251   1e-74    
ref|XP_011074004.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       249   6e-74    
ref|XP_009398946.1|  PREDICTED: UDP-glycosyltransferase 86A2-like       248   2e-73    
gb|KHG24976.1|  hypothetical protein F383_10689                         238   2e-73    
ref|XP_011094621.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       247   3e-73    
ref|XP_004172588.1|  PREDICTED: UDP-glycosyltransferase 86A2-like       237   4e-73    
ref|XP_009405745.1|  PREDICTED: UDP-glycosyltransferase 86A2-like       246   1e-72    
ref|XP_011091584.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       245   2e-72    
gb|EYU34484.1|  hypothetical protein MIMGU_mgv1a005271mg                243   2e-71    
ref|XP_010678487.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       242   2e-71    
ref|XP_008779947.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       231   8e-71    
ref|XP_011091585.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       238   8e-70    
gb|EYU34489.1|  hypothetical protein MIMGU_mgv1a005852mg                236   4e-69    
gb|EEE51029.1|  hypothetical protein OsJ_31675                          244   6e-69    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011094622.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       234   3e-68    
ref|XP_011074246.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       233   5e-68    
ref|XP_011069428.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       226   2e-67    
ref|XP_011094624.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       230   1e-66    
ref|XP_011094740.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       228   7e-66    
ref|XP_011094623.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       228   1e-65    
gb|EYU36650.1|  hypothetical protein MIMGU_mgv1a004868mg                227   3e-65    
ref|XP_010107480.1|  UDP-glycosyltransferase 86A1                       226   3e-65    
ref|XP_011094738.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       225   1e-64    
gb|EYU34480.1|  hypothetical protein MIMGU_mgv1a004928mg                220   1e-62    
gb|ABR17327.1|  unknown                                                 219   3e-62    Picea sitchensis
gb|EYU34487.1|  hypothetical protein MIMGU_mgv1a005354mg                218   6e-62    
gb|EMS64309.1|  UDP-glycosyltransferase 86A1                            211   1e-60    
emb|CDP21275.1|  unnamed protein product                                202   2e-59    
gb|EYU34488.1|  hypothetical protein MIMGU_mgv1a005552mg                207   7e-58    
gb|EYU34486.1|  hypothetical protein MIMGU_mgv1a023861mg                204   9e-57    
gb|EAY78680.1|  hypothetical protein OsI_33782                          197   1e-56    Oryza sativa Indica Group [Indian rice]
gb|AAP53973.1|  Cytokinin-O-glucosyltransferase 2, putative, expr...    196   3e-56    Oryza sativa Japonica Group [Japonica rice]
gb|EPS68563.1|  hypothetical protein M569_06205                         200   2e-55    
gb|KFK36575.1|  hypothetical protein AALP_AA4G141400                    189   2e-54    
ref|XP_002519499.1|  UDP-glucosyltransferase, putative                  193   4e-54    Ricinus communis
gb|EYU34483.1|  hypothetical protein MIMGU_mgv1a005954mg                192   1e-52    
gb|EPS73117.1|  hypothetical protein M569_01639                         192   1e-52    
ref|XP_008350374.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       187   3e-51    
ref|XP_011094735.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       185   1e-50    
gb|ABK24777.1|  unknown                                                 181   3e-48    Picea sitchensis
ref|XP_011091588.1|  PREDICTED: UDP-glycosyltransferase 86A1-like...    179   1e-47    
ref|XP_011091587.1|  PREDICTED: UDP-glycosyltransferase 86A1-like...    180   1e-47    
gb|AGA84057.1|  UDP-glucosyltransferase isoform 1                       179   2e-47    
gb|ACN39829.1|  unknown                                                 178   4e-47    Picea sitchensis
gb|ABR17061.1|  unknown                                                 166   6e-43    Picea sitchensis
gb|EMT04157.1|  Cyanohydrin beta-glucosyltransferase                    160   5e-42    
gb|EMT33068.1|  Cytokinin-N-glucosyltransferase 1                       160   8e-42    
gb|EPS60356.1|  hypothetical protein M569_14447                         160   5e-41    
gb|EYU36656.1|  hypothetical protein MIMGU_mgv11b024665mg               158   7e-40    
gb|ADE76226.1|  unknown                                                 156   4e-39    
gb|ABK24601.1|  unknown                                                 150   1e-38    Picea sitchensis
gb|ADE76691.1|  unknown                                                 153   3e-38    
gb|EEC67042.1|  hypothetical protein OsI_33784                          145   1e-37    Oryza sativa Indica Group [Indian rice]
gb|ACN39827.1|  unknown                                                 145   2e-35    Picea sitchensis
ref|XP_009334676.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       143   3e-34    
ref|XP_004173864.1|  PREDICTED: UDP-glycosyltransferase 86A2-like       137   2e-33    
ref|XP_009794965.1|  PREDICTED: UDP-glycosyltransferase 86A2-like       135   2e-32    
ref|XP_002452527.1|  hypothetical protein SORBIDRAFT_04g027460          135   6e-32    Sorghum bicolor [broomcorn]
ref|XP_006647925.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       134   1e-31    
ref|XP_006649062.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       134   2e-31    
ref|XP_010107491.1|  UDP-glycosyltransferase 86A1                       125   1e-30    
ref|XP_003570607.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    131   1e-30    
ref|XP_008679293.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       131   1e-30    
gb|ABR16264.1|  unknown                                                 130   4e-30    Picea sitchensis
ref|NP_001048165.1|  Os02g0755900                                       129   7e-30    Oryza sativa Japonica Group [Japonica rice]
gb|AFW64428.1|  hypothetical protein ZEAMMB73_964153                    129   7e-30    
ref|XP_008679294.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       129   8e-30    
gb|EAY87581.1|  hypothetical protein OsI_08991                          129   8e-30    Oryza sativa Indica Group [Indian rice]
ref|NP_001048164.1|  Os02g0755600                                       129   8e-30    Oryza sativa Japonica Group [Japonica rice]
gb|EEC74033.1|  hypothetical protein OsI_08990                          129   1e-29    Oryza sativa Indica Group [Indian rice]
dbj|BAK01910.1|  predicted protein                                      128   1e-29    
ref|XP_004953968.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       128   2e-29    
ref|NP_001064696.2|  Os10g0442300                                       125   4e-29    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002454243.1|  hypothetical protein SORBIDRAFT_04g027420          127   4e-29    Sorghum bicolor [broomcorn]
ref|XP_008219313.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       127   4e-29    
ref|XP_008219317.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       127   5e-29    
gb|KEH35117.1|  UDP-glucosyltransferase family protein                  127   5e-29    
emb|CBI38429.3|  unnamed protein product                                125   5e-29    
ref|XP_010039907.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    126   6e-29    
ref|NP_001048163.1|  Os02g0755500                                       126   6e-29    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008219318.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       126   8e-29    
ref|XP_004953967.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       126   9e-29    
ref|XP_007042920.1|  UDP-glucosyl transferase 85A2                      126   1e-28    
ref|XP_002310553.1|  hypothetical protein POPTR_0007s05230g             125   1e-28    Populus trichocarpa [western balsam poplar]
gb|EPS62953.1|  hypothetical protein M569_11835                         125   1e-28    
gb|EMT15333.1|  Cytokinin-O-glucosyltransferase 2                       125   2e-28    
ref|XP_007224069.1|  hypothetical protein PRUPE_ppa015357mg             125   2e-28    
ref|XP_006366324.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       124   2e-28    
gb|EYU19971.1|  hypothetical protein MIMGU_mgv1a024760mg                124   3e-28    
ref|XP_010937418.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    124   3e-28    
gb|EYU34482.1|  hypothetical protein MIMGU_mgv1a026087mg                123   3e-28    
ref|XP_010040274.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    124   3e-28    
gb|EYU18463.1|  hypothetical protein MIMGU_mgv1a005662mg                124   4e-28    
ref|XP_010060020.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    124   5e-28    
gb|KCW66541.1|  hypothetical protein EUGRSUZ_F00338                     124   6e-28    
gb|AIL51400.1|  glycosyltransferase                                     124   6e-28    
ref|XP_010060017.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    124   6e-28    
gb|EMT18349.1|  Cytokinin-O-glucosyltransferase 2                       124   7e-28    
ref|XP_002268637.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    123   7e-28    Vitis vinifera
ref|XP_010060023.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    123   9e-28    
gb|ABR16342.1|  unknown                                                 123   1e-27    Picea sitchensis
gb|EAY87578.1|  hypothetical protein OsI_08989                          123   1e-27    Oryza sativa Indica Group [Indian rice]
ref|XP_008811180.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       122   1e-27    
ref|XP_004235064.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    122   1e-27    
dbj|BAJ85429.1|  predicted protein                                      122   1e-27    
ref|XP_010056398.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    122   1e-27    
dbj|BAK00666.1|  predicted protein                                      122   1e-27    
emb|CDP21827.1|  unnamed protein product                                122   1e-27    
gb|EYU18464.1|  hypothetical protein MIMGU_mgv1a005689mg                122   1e-27    
ref|XP_010035387.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    122   2e-27    
dbj|BAJ88498.1|  predicted protein                                      122   2e-27    
gb|ABR17105.1|  unknown                                                 122   2e-27    Picea sitchensis
emb|CDP01076.1|  unnamed protein product                                122   2e-27    
gb|EYU19972.1|  hypothetical protein MIMGU_mgv1a018325mg                121   2e-27    
ref|XP_002285767.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    122   2e-27    Vitis vinifera
ref|XP_011031049.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    122   2e-27    
ref|XP_003570610.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    122   3e-27    
ref|XP_010064217.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    122   3e-27    
ref|XP_002452530.1|  hypothetical protein SORBIDRAFT_04g027470          121   3e-27    Sorghum bicolor [broomcorn]
gb|AFW64425.1|  cytokinin-O-glucosyltransferase 2                       121   3e-27    
ref|XP_011023081.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    121   3e-27    
sp|F8WKW1.1|UGT2_GARJA  RecName: Full=7-deoxyloganetin glucosyltr...    121   3e-27    
ref|XP_004237929.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    121   3e-27    
ref|XP_011031048.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    121   4e-27    
gb|EMT15334.1|  Cytokinin-O-glucosyltransferase 2                       120   4e-27    
gb|ABR18044.1|  unknown                                                 121   4e-27    Picea sitchensis
ref|XP_006426368.1|  hypothetical protein CICLE_v10025476mg             121   4e-27    
ref|XP_007224375.1|  hypothetical protein PRUPE_ppa021058mg             121   5e-27    
ref|XP_008219319.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       121   5e-27    
ref|XP_006466245.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       121   5e-27    
gb|KCW73111.1|  hypothetical protein EUGRSUZ_E01562                     120   5e-27    
ref|XP_007141200.1|  hypothetical protein PHAVU_008G175500g             120   6e-27    
ref|XP_010060016.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    120   6e-27    
ref|XP_003542333.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       120   7e-27    
ref|XP_010056397.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    120   8e-27    
ref|XP_002306303.2|  hypothetical protein POPTR_0005s07500g             120   8e-27    
ref|XP_004237927.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    120   9e-27    
emb|CBI19181.3|  unnamed protein product                                122   1e-26    
ref|XP_010111809.1|  hypothetical protein L484_020598                   115   1e-26    
ref|XP_004237928.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    120   1e-26    
gb|AFW64426.1|  hypothetical protein ZEAMMB73_179381                    120   1e-26    
ref|XP_007207189.1|  hypothetical protein PRUPE_ppa017055mg             120   1e-26    
gb|ABK95289.1|  unknown                                                 119   1e-26    
ref|XP_010056400.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    119   1e-26    
ref|XP_003570608.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    119   1e-26    
ref|XP_007141191.1|  hypothetical protein PHAVU_008G174700g             119   1e-26    
gb|EMT21756.1|  Para-aminobenzoate synthase                             122   1e-26    
dbj|BAK02172.1|  predicted protein                                      119   2e-26    
ref|XP_007222804.1|  hypothetical protein PRUPE_ppa005043mg             119   2e-26    
ref|XP_008219315.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       119   2e-26    
ref|XP_002513938.1|  UDP-glucuronosyltransferase, putative              119   2e-26    
ref|XP_010647463.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    118   2e-26    
ref|XP_009341757.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    119   2e-26    
ref|XP_006363270.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       119   2e-26    
ref|XP_009387949.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       115   3e-26    
ref|XP_006366316.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       118   3e-26    
ref|XP_003635298.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    118   3e-26    
gb|EYU18461.1|  hypothetical protein MIMGU_mgv1a004968mg                118   4e-26    
ref|XP_008234196.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       118   4e-26    
ref|XP_007225655.1|  hypothetical protein PRUPE_ppa004945mg             118   4e-26    
emb|CBI23550.3|  unnamed protein product                                117   5e-26    
ref|NP_001277170.1|  UDP-glycosyltransferase 85A2-like                  118   5e-26    
ref|XP_007018744.1|  UDP-glucosyl transferase 85A2                      117   6e-26    
ref|XP_002285771.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    117   6e-26    
ref|XP_007227225.1|  hypothetical protein PRUPE_ppa018697mg             117   7e-26    
dbj|BAJ94765.1|  predicted protein                                      117   7e-26    
ref|XP_004299647.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       117   8e-26    
sp|F8WLS6.1|UGT6_CATRO  RecName: Full=7-deoxyloganetin glucosyltr...    117   8e-26    
ref|XP_007047910.1|  UDP-glucosyl transferase 85A2                      117   8e-26    
gb|ADG65641.1|  glycosyltransferase                                     117   9e-26    
ref|XP_010060024.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    117   1e-25    
dbj|BAO51842.1|  UDP-glycosyltransferase 85A32                          117   1e-25    
ref|XP_004235065.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    117   1e-25    
gb|KCW66555.1|  hypothetical protein EUGRSUZ_F00353                     117   1e-25    
ref|XP_010040275.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    117   1e-25    
ref|XP_009612691.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    117   1e-25    
gb|AAV32497.1|  UDP-glucuronosyltransferase                             116   1e-25    
ref|NP_973885.1|  UDP-glucosyl transferase 85A5                         116   1e-25    
ref|XP_006433961.1|  hypothetical protein CICLE_v10000958mg             116   2e-25    
ref|XP_002285779.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    116   2e-25    
ref|XP_007226586.1|  hypothetical protein PRUPE_ppa023851mg             116   2e-25    
ref|XP_009775754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    116   2e-25    
ref|XP_002268845.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    116   2e-25    
gb|EYU43443.1|  hypothetical protein MIMGU_mgv1a018722mg                116   2e-25    
ref|XP_011092429.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    115   2e-25    
ref|XP_004252533.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    115   3e-25    
gb|EYU18465.1|  hypothetical protein MIMGU_mgv1a006002mg                115   3e-25    
ref|XP_004299648.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       115   3e-25    
emb|CDP01479.1|  unnamed protein product                                115   3e-25    
ref|XP_010242477.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       115   3e-25    
gb|EYU45043.1|  hypothetical protein MIMGU_mgv1a020141mg                114   3e-25    
ref|XP_002285778.2|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    115   3e-25    
ref|XP_002513937.1|  UDP-glucuronosyltransferase, putative              115   4e-25    
ref|XP_010089824.1|  UDP-glycosyltransferase 85A1                       115   4e-25    
gb|KDP29702.1|  hypothetical protein JCGZ_18637                         115   4e-25    
ref|XP_006367932.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       115   4e-25    
ref|XP_008455233.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       115   4e-25    
ref|XP_010060018.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    115   4e-25    
dbj|BAO51833.1|  UDP-glycosyltransferase 85K10                          115   4e-25    
ref|XP_002532877.1|  UDP-glucuronosyltransferase, putative              115   5e-25    
emb|CAN65645.1|  hypothetical protein VITISV_012510                     116   5e-25    
emb|CBI38430.3|  unnamed protein product                                117   5e-25    
ref|XP_004252532.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    115   5e-25    
gb|EPS63474.1|  hypothetical protein M569_11308                         114   6e-25    
ref|XP_004299646.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       115   6e-25    
gb|KEH35119.1|  UDP-glucosyltransferase family protein                  114   7e-25    
gb|ABR16243.1|  unknown                                                 114   7e-25    
ref|XP_002268162.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    114   7e-25    
ref|XP_011100190.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    114   8e-25    
emb|CDY41486.1|  BnaA08g20880D                                          114   8e-25    
gb|KDP41396.1|  hypothetical protein JCGZ_15803                         114   9e-25    
ref|XP_009413654.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    111   9e-25    
ref|XP_006296293.1|  hypothetical protein CARUB_v10025463mg             112   9e-25    
ref|XP_004252531.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    114   1e-24    
ref|XP_003544213.2|  PREDICTED: UDP-glycosyltransferase 85A2-like       114   1e-24    
ref|XP_006363269.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       114   1e-24    
gb|KHN42553.1|  UDP-glycosyltransferase 85A2                            114   1e-24    
gb|KHN24339.1|  UDP-glycosyltransferase 85A2                            114   1e-24    
ref|XP_006307682.1|  hypothetical protein CARUB_v10009316mg             113   1e-24    
ref|XP_007141198.1|  hypothetical protein PHAVU_008G175300g             114   1e-24    
ref|XP_003544800.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       114   1e-24    
ref|NP_173656.1|  UDP-glycosyltransferase 85A1                          114   1e-24    
ref|XP_010030030.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    114   1e-24    
ref|XP_010459992.1|  PREDICTED: UDP-glycosyltransferase 85A5            113   2e-24    
dbj|BAG80547.1|  glycosyltransferase                                    114   2e-24    
gb|EYU19973.1|  hypothetical protein MIMGU_mgv1a005383mg                113   2e-24    
ref|XP_009341756.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    113   2e-24    
ref|XP_007047909.1|  UDP-glucosyl transferase 85A2                      113   2e-24    
emb|CDP01078.1|  unnamed protein product                                113   2e-24    
gb|AEO45781.1|  cyanohydrin UDP-glucosyltransferase UGT85K4             113   2e-24    
ref|XP_003618643.1|  Cytokinin-O-glucosyltransferase                    113   2e-24    
emb|CDY62992.1|  BnaC07g48400D                                          113   3e-24    
dbj|BAO51844.1|  UDP-glycosyltransferase 85A28                          113   3e-24    
ref|XP_010477497.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       113   3e-24    
ref|XP_006304973.1|  hypothetical protein CARUB_v10011467mg             113   3e-24    
ref|XP_008359346.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       110   3e-24    
ref|XP_003608449.1|  Cytokinin-O-glucosyltransferase                    112   3e-24    
ref|XP_008455196.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       112   3e-24    
ref|XP_004155505.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       112   3e-24    
ref|XP_004953966.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       112   3e-24    
dbj|BAG80542.1|  glycosyltransferase                                    112   3e-24    
ref|XP_011016634.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    112   4e-24    
ref|XP_010273031.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    112   4e-24    
gb|AID16084.1|  flavonoid 3-O-glucosyltransferase                       110   4e-24    
ref|XP_009590778.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    112   4e-24    
dbj|BAD93690.1|  glycosyltransferase                                    112   4e-24    
dbj|BAO51840.1|  UDP-glycosyltransferase 85K12                          112   5e-24    
ref|XP_006366313.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       112   5e-24    
ref|XP_008219322.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       112   6e-24    
ref|XP_002966076.1|  hypothetical protein SELMODRAFT_407312             112   6e-24    
ref|XP_010534080.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       112   6e-24    
ref|XP_009612740.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    112   6e-24    
emb|CDY46644.1|  BnaA07g10520D                                          110   6e-24    
ref|XP_006472584.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       112   6e-24    
ref|XP_002525850.1|  UDP-glucuronosyltransferase, putative              112   7e-24    
gb|EPS66053.1|  hypothetical protein M569_08723                         111   7e-24    
ref|XP_002893219.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    112   7e-24    
ref|XP_002285770.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    111   7e-24    
ref|XP_009391314.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    111   8e-24    
ref|XP_008350015.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       110   8e-24    
ref|XP_008808008.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       111   1e-23    
ref|XP_006366314.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       111   1e-23    
dbj|BAJ89621.1|  predicted protein                                      111   1e-23    
emb|CDP13142.1|  unnamed protein product                                111   1e-23    
ref|XP_006433964.1|  hypothetical protein CICLE_v10004031mg             112   1e-23    
gb|KDP33203.1|  hypothetical protein JCGZ_12725                         110   1e-23    
ref|XP_008359320.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       111   1e-23    
ref|XP_009791953.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    111   1e-23    
ref|XP_006472583.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       111   1e-23    
ref|XP_008386104.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       110   1e-23    
ref|XP_008466222.1|  PREDICTED: UDP-glycosyltransferase 85A2            110   1e-23    
emb|CDP01079.1|  unnamed protein product                                110   2e-23    
ref|XP_007146161.1|  hypothetical protein PHAVU_006G017500g             110   2e-23    
ref|XP_009348490.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    110   2e-23    
ref|XP_010927262.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    110   2e-23    
gb|KDP41397.1|  hypothetical protein JCGZ_15804                         110   2e-23    
gb|KFK44334.1|  hypothetical protein AALP_AA1G244600                    110   2e-23    
ref|XP_002302305.1|  UDP-glucuronosyltransferase family protein         110   2e-23    
gb|AFI71901.1|  flavonol 3-O-glucosyltransferase                        110   2e-23    
ref|XP_010027305.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    110   2e-23    
ref|XP_009341754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    110   2e-23    
ref|NP_173652.1|  UDP-glucosyl transferase 85A7                         110   2e-23    
ref|XP_010040276.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    111   2e-23    
ref|XP_006304493.1|  hypothetical protein CARUB_v10011262mg             110   2e-23    
ref|XP_004289310.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       109   2e-23    
gb|EMT26410.1|  Cytokinin-O-glucosyltransferase 2                       109   2e-23    
dbj|BAJ95395.1|  predicted protein                                      110   3e-23    
ref|XP_011087902.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    110   3e-23    
ref|XP_002323976.2|  hypothetical protein POPTR_0017s07920g             110   3e-23    
gb|KDP41399.1|  hypothetical protein JCGZ_15806                         110   3e-23    
ref|XP_004136284.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       110   3e-23    
ref|XP_009128289.1|  PREDICTED: UDP-glycosyltransferase 85A4            110   3e-23    
gb|AEO45782.1|  cyanohydrin UDP-glucosyltransferase UGT85K5             110   3e-23    
ref|XP_003547073.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       110   3e-23    
dbj|BAO51839.1|  UDP-glycosyltransferase 85A34                          110   3e-23    
ref|XP_009103241.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       110   3e-23    
gb|KHN33502.1|  UDP-glycosyltransferase 85A2                            110   3e-23    
dbj|BAO51834.1|  UDP-glycosyltransferase 85K11                          110   3e-23    
ref|XP_003618666.1|  Cytokinin-O-glucosyltransferase                    109   3e-23    
gb|KDP29705.1|  hypothetical protein JCGZ_18640                         110   3e-23    
gb|KCW45698.1|  hypothetical protein EUGRSUZ_L00502                     109   4e-23    
gb|AAR06913.1|  UDP-glycosyltransferase 85A8                            109   4e-23    
ref|XP_006360268.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       109   4e-23    
gb|KGN43695.1|  hypothetical protein Csa_7G059660                       109   4e-23    
gb|KDP45150.1|  hypothetical protein JCGZ_19350                         109   4e-23    
dbj|BAO51838.1|  UDP-glycosyltransferase 85A36                          109   4e-23    
dbj|BAO51841.1|  UDP-glycosyltransferase 85A35                          109   4e-23    
ref|XP_002263989.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    109   4e-23    
ref|XP_010039816.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    109   4e-23    
ref|XP_011069754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    109   5e-23    
gb|KDP41398.1|  hypothetical protein JCGZ_15805                         109   5e-23    
ref|XP_010039829.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    109   5e-23    
ref|XP_006416204.1|  hypothetical protein EUTSA_v10007489mg             109   6e-23    
ref|XP_004502000.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       109   6e-23    
gb|KFK44332.1|  hypothetical protein AALP_AA1G244400                    108   6e-23    
ref|XP_006473006.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       105   6e-23    
emb|CDO97426.1|  unnamed protein product                                109   7e-23    
gb|EMT22184.1|  Cytokinin-O-glucosyltransferase 2                       110   7e-23    
ref|XP_002885822.1|  hypothetical protein ARALYDRAFT_319356             109   7e-23    
dbj|BAB86928.1|  glucosyltransferase-10                                 108   7e-23    
ref|XP_011037069.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       108   8e-23    
ref|XP_002525852.1|  UDP-glucuronosyltransferase, putative              108   8e-23    
gb|EYU18467.1|  hypothetical protein MIMGU_mgv1a005587mg                108   8e-23    
gb|ADV71371.1|  glycosyltransferase GT14M03                             108   8e-23    
gb|EMS58460.1|  UDP-glycosyltransferase 85A2                            109   8e-23    
gb|EMS57769.1|  UDP-glycosyltransferase 85A2                            109   8e-23    
ref|XP_008372493.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       108   8e-23    
ref|XP_002971410.1|  hypothetical protein SELMODRAFT_441496             108   8e-23    
ref|XP_002893224.1|  UDP-glucosyl transferase 85A1                      108   9e-23    
gb|EMT26409.1|  Cytokinin-O-glucosyltransferase 2                       108   9e-23    
ref|XP_002300186.1|  hypothetical protein POPTR_0001s31950g             108   1e-22    
ref|XP_010937416.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    108   1e-22    
ref|XP_006433960.1|  hypothetical protein CICLE_v10000925mg             108   1e-22    
dbj|BAJ90736.1|  predicted protein                                      108   1e-22    
dbj|BAJ92065.1|  predicted protein                                      108   1e-22    
gb|EMT13628.1|  Cytokinin-O-glucosyltransferase 2                       110   1e-22    
ref|XP_009380209.1|  PREDICTED: LOW QUALITY PROTEIN: 7-deoxylogan...    108   1e-22    
gb|ABR16170.1|  unknown                                                 108   1e-22    
emb|CDX91674.1|  BnaC08g05930D                                          108   1e-22    
ref|XP_010025429.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    108   1e-22    
gb|KCW62086.1|  hypothetical protein EUGRSUZ_H04754                     108   2e-22    
ref|XP_007141201.1|  hypothetical protein PHAVU_008G175600g             107   2e-22    
ref|NP_001277168.1|  UDP-glycosyltransferase 85A2-like                  107   2e-22    
gb|KCW62089.1|  hypothetical protein EUGRSUZ_H04760                     107   2e-22    
gb|AES74860.2|  UDP-glucosyltransferase family protein                  107   2e-22    
ref|XP_009110142.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       107   2e-22    
emb|CDY21359.1|  BnaA09g30680D                                          107   2e-22    
ref|XP_010676160.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    107   2e-22    
ref|XP_008386313.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       107   2e-22    
ref|XP_007042950.1|  UDP-glycosyltransferase 85A1                       107   2e-22    
ref|XP_002893223.1|  transcription factor/ transferase, transferr...    107   2e-22    
gb|ABW96222.1|  glucosyltransferase                                     107   2e-22    
gb|KCW73114.1|  hypothetical protein EUGRSUZ_E01567                     106   2e-22    
ref|XP_010535401.1|  PREDICTED: UDP-glycosyltransferase 85A1-like...    107   2e-22    



>ref|XP_011089946.1| PREDICTED: UDP-glycosyltransferase 86A2 [Sesamum indicum]
Length=487

 Score =   386 bits (991),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 186/285 (65%), Positives = 232/285 (81%), Gaps = 8/285 (3%)
 Frame = +1

Query  166   KAMADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDD  345
             K M D+ +KPHAIL+SYPLQGH+ PSVHLA  LA +GFT+TFINTHS+H+ +T ++   D
Sbjct  2     KEMVDAREKPHAILVSYPLQGHVNPSVHLAINLASRGFTITFINTHSIHHQITSTSSAAD  61

Query  346   ---DIFSGIRKP-GLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILT  513
                DIFS +R+  GLDIRY T+SDGLP  +DR+++HDQFMA+LLH++SAHVEEA++KI+ 
Sbjct  62    GEGDIFSELRQSHGLDIRYATVSDGLPVGFDRSLHHDQFMAALLHVFSAHVEEAIEKIVR  121

Query  514   SSANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFG  693
              S     P VNCLIADT+FV+PGKLAKKY LLY+SFWTE AL+FTLYYH+ LLRLNGHFG
Sbjct  122   HSQ----PAVNCLIADTYFVWPGKLAKKYGLLYVSFWTEAALIFTLYYHMDLLRLNGHFG  177

Query  694   CIDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQE  873
             C+D RED I+Y+PGV SI+ KDL S++QET+T TVCHQIIYK+F DA+ ADFVLCNTVQE
Sbjct  178   CVDTREDEIKYIPGVESIEPKDLTSFLQETDTTTVCHQIIYKAFMDAKTADFVLCNTVQE  237

Query  874   LEHETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             LEHET++ALQ+K  FF VGP+F   F ++ + TSL +ESDC   L
Sbjct  238   LEHETISALQQKIPFFAVGPVFSTGFTRTTITTSLWAESDCSRWL  282



>ref|XP_007016838.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY34457.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=497

 Score =   386 bits (991),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 181/280 (65%), Positives = 229/280 (82%), Gaps = 6/280 (2%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNP-RDDD  348
             MAD+ QKPHAI I YPLQGH+IPSVHLA +LA KGFT+TFINTHS+H+  +++ P +  D
Sbjct  20    MADTAQKPHAIFIPYPLQGHVIPSVHLAIKLASKGFTITFINTHSIHHQTSEAEPGKGPD  79

Query  349   IFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANS  528
             IF+ +R+ GLDIRY T+SDGLP  +DR++NHDQFMA+LLH++SAHVEE + +I+ S    
Sbjct  80    IFASVRESGLDIRYTTVSDGLPLGFDRSLNHDQFMAALLHVFSAHVEEVVSQIVKS----  135

Query  529   GGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVR  708
              G  V+CLIADTFFV+P K+AKK+ LLYIS+WTEPALVFTLYYHL LLR+NGHFG  D R
Sbjct  136   -GDRVHCLIADTFFVWPSKIAKKFGLLYISYWTEPALVFTLYYHLDLLRMNGHFGLQDCR  194

Query  709   EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHET  888
             ED+I+Y+PGV++I+ +DLMSY+QET+  TVCHQII+ +F+DA+NADFVLCNTVQELE  T
Sbjct  195   EDSIDYIPGVQAIEPRDLMSYLQETDVTTVCHQIIFNAFEDAKNADFVLCNTVQELEPVT  254

Query  889   VAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             ++AL+    F+ +GPIFP  F +S VATSL SESDC   L
Sbjct  255   ISALRATVPFYAIGPIFPSGFTKSIVATSLWSESDCTQWL  294



>ref|XP_008465359.1| PREDICTED: UDP-glycosyltransferase 86A2 [Cucumis melo]
Length=487

 Score =   380 bits (975),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 176/272 (65%), Positives = 223/272 (82%), Gaps = 7/272 (3%)
 Frame = +1

Query  184  GQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPR-DDDIFSG  360
             QKPH I I+YPLQGH+IPSVHLA  LA +GFTVTFINTH++H      +    DD+FS 
Sbjct  7    NQKPHVIFIAYPLQGHVIPSVHLAIDLAARGFTVTFINTHAIHQQTCSGHSSAGDDLFSA  66

Query  361  IRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPP  540
            +RK GLDIRY T+SDGLP  +DR++NHDQFMASLLH++SAHVEEA++ I+ + A      
Sbjct  67   VRKSGLDIRYRTVSDGLPVGFDRSLNHDQFMASLLHVFSAHVEEAVEGIVKTEA------  120

Query  541  VNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAI  720
            V+CLIADTFFV+P K+AKK+ LLY+SFWTEPALVFTLYYHL+LLR+N HF C D+REDAI
Sbjct  121  VSCLIADTFFVWPSKVAKKFGLLYVSFWTEPALVFTLYYHLNLLRINRHFACQDIREDAI  180

Query  721  EYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAAL  900
            +Y+PGV +ID KD+MSY+QET+T +VCHQII+ +FQD R ADFVLCNT+Q+LE++T++AL
Sbjct  181  DYIPGVPTIDPKDMMSYLQETDTTSVCHQIIFAAFQDVRKADFVLCNTIQDLENDTISAL  240

Query  901  QEKTSFFTVGPIFPPVFAQSAVATSL*SESDC  996
            Q +T F+ +GP+FPP F +S+V TSL  ESDC
Sbjct  241  QAQTQFYAIGPLFPPGFTKSSVPTSLWPESDC  272



>emb|CDP07057.1| unnamed protein product [Coffea canephora]
Length=483

 Score =   374 bits (960),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 179/278 (64%), Positives = 225/278 (81%), Gaps = 8/278 (3%)
 Frame = +1

Query  172  MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPR---D  342
            MA S Q+PHAIL+SYPLQGH+IPSVHLA +LA +GFT+TF+NT S+H ++T  +      
Sbjct  1    MAISPQRPHAILVSYPLQGHVIPSVHLAIKLASRGFTITFLNTQSIHNNITSGDKTINGQ  60

Query  343  DDIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSA  522
             DIF+ +RK GLDIRY T+ DGLP  +DR++NHDQFMA+LLH++SAHVEE ++KI+ S  
Sbjct  61   GDIFAEVRKSGLDIRYTTVPDGLPLGFDRSLNHDQFMAALLHVFSAHVEEEVQKIVKS--  118

Query  523  NSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCID  702
               GPPV+ LIADTFFV+PG LAKKY L+YIS WTE ALVF+LYYHL LLRLNGHFGCID
Sbjct  119  ---GPPVSYLIADTFFVWPGMLAKKYGLVYISLWTEAALVFSLYYHLDLLRLNGHFGCID  175

Query  703  VREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEH  882
            +RED I+Y+PGV+ ++  D+ SY+QE    +VCH+IIYK+F+DA++ADFVLCNTV+ELE 
Sbjct  176  MREDPIDYIPGVKPLEPLDMPSYLQEMYPSSVCHKIIYKAFKDAQDADFVLCNTVEELEP  235

Query  883  ETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDC  996
            ET++ALQEK   F VGP+FP  F +S VATSL SESDC
Sbjct  236  ETISALQEKLPIFPVGPLFPSGFTKSCVATSLWSESDC  273



>ref|XP_007206260.1| hypothetical protein PRUPE_ppa015843mg [Prunus persica]
 gb|EMJ07459.1| hypothetical protein PRUPE_ppa015843mg [Prunus persica]
Length=480

 Score =   371 bits (952),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 179/287 (62%), Positives = 226/287 (79%), Gaps = 10/287 (3%)
 Frame = +1

Query  172   MADS------GQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSN  333
             MADS       ++PHAI I+YPLQGH+IPSVHLA +LA +GF +TFINTHS+H+  +K+ 
Sbjct  1     MADSVHNTHHQKRPHAIFIAYPLQGHVIPSVHLAIKLASRGFKITFINTHSIHHQTSKAQ  60

Query  334   PRD-DDIFSGIRKP-GLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKI  507
             P    D F+ +R+  GLDI Y T+SDGLP E+DR++NHDQFMASLLH++SAH EE + K+
Sbjct  61    PDSGSDPFAYVRESSGLDIDYTTVSDGLPLEFDRSLNHDQFMASLLHVFSAHAEEVVGKV  120

Query  508   LTSSANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGH  687
             + SSA+    PV C+IADTFFV+P K+AKK+ LLY+SFWTEPALVFTLYYHL LLR NGH
Sbjct  121   VKSSADIT--PVTCMIADTFFVWPSKIAKKFGLLYVSFWTEPALVFTLYYHLDLLRKNGH  178

Query  688   FGCIDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTV  867
             F C DVRED I+YVPGVR+I+ KD+ S++QET+T +VCH II+ +F+DAR A F LCNTV
Sbjct  179   FACQDVREDTIDYVPGVRAIEPKDMTSFLQETDTTSVCHHIIFNAFKDARGAHFHLCNTV  238

Query  868   QELEHETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             QE+E ET++ALQ KT F+ +GPIFP  F ++ VATSL SESDC   L
Sbjct  239   QEIEAETISALQSKTPFYAIGPIFPSKFNKNIVATSLWSESDCTQWL  285



>ref|XP_004145815.1| PREDICTED: UDP-glycosyltransferase 86A2-like [Cucumis sativus]
 gb|KGN46865.1| hypothetical protein Csa_6G147580 [Cucumis sativus]
Length=482

 Score =   370 bits (951),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 171/276 (62%), Positives = 222/276 (80%), Gaps = 7/276 (3%)
 Frame = +1

Query  184   GQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPR-DDDIFSG  360
              QKPHAI I+YPLQGH+IPSVHLA  LA +GF VTFINTH++H      +    DD+FS 
Sbjct  7     NQKPHAIFIAYPLQGHVIPSVHLAIHLAARGFIVTFINTHAIHQQTCNGHSSAGDDLFSA  66

Query  361   IRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPP  540
             +RK GLDIRY T+SDGLP  +DR++NHDQFM SLLH++SAHVEEA+++I+ + A      
Sbjct  67    VRKSGLDIRYKTVSDGLPVGFDRSLNHDQFMGSLLHVFSAHVEEAVERIVKTEA------  120

Query  541   VNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAI  720
             V+CLIADTFFV+P K+AKK+ LLY+SFWTEPALVFTLYYHL+LLR+N HF C D+R+DAI
Sbjct  121   VSCLIADTFFVWPSKVAKKFDLLYVSFWTEPALVFTLYYHLNLLRINRHFDCQDIRDDAI  180

Query  721   EYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAAL  900
             +Y+PGV +I+ +D+ SY+QE++T +VCHQII  +FQD R ADFVLCNT+Q+LE++T++AL
Sbjct  181   DYIPGVPTINPQDMTSYLQESDTTSVCHQIISAAFQDVRKADFVLCNTIQDLENDTISAL  240

Query  901   QEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             Q +T F+ +GP+FPP F +S+V TSL  ESDC   L
Sbjct  241   QAQTQFYAIGPVFPPGFTKSSVPTSLWPESDCTNWL  276



>emb|CBI17168.3| unnamed protein product [Vitis vinifera]
Length=416

 Score =   367 bits (943),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/276 (62%), Positives = 219/276 (79%), Gaps = 5/276 (2%)
 Frame = +1

Query  172  MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSN-PRDDD  348
            MA + Q PHAIL++YPLQGH+IP+VHLA  LA +GFT+TF+NT S+H   +++     DD
Sbjct  1    MASTHQNPHAILVAYPLQGHVIPAVHLAINLASRGFTITFVNTLSIHQQTSRAQGAGSDD  60

Query  349  IFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANS  528
            IFSG R+ GLDIRY T+SDGLP  +DR++NHDQFMA+LLH+ SAHVEE +++++  +A  
Sbjct  61   IFSGSREAGLDIRYTTVSDGLPVGFDRSLNHDQFMAALLHVLSAHVEELVERVVAEAA--  118

Query  529  GGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVR  708
              PPV+CLIADTFFV+P  LAKK+ LLY+SFWTEPALVFTLYYH+ LLR +GHF C + R
Sbjct  119  --PPVSCLIADTFFVWPSALAKKFGLLYVSFWTEPALVFTLYYHMDLLRKHGHFDCSETR  176

Query  709  EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHET  888
            +D I+Y+PGV +I  +D+ SY+Q T+T TVCHQII  +FQDA+ ADFVLCNTV+ELE  T
Sbjct  177  KDVIDYIPGVEAIHPRDMTSYLQATDTSTVCHQIISTAFQDAKGADFVLCNTVEELELHT  236

Query  889  VAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDC  996
            ++ALQ K   + VGPIFPP F +S VATSL +ESDC
Sbjct  237  ISALQAKKKLYAVGPIFPPGFTKSIVATSLWAESDC  272



>ref|XP_002314296.1| glycosyltransferase family protein [Populus trichocarpa]
 gb|EEE88251.1| glycosyltransferase family protein [Populus trichocarpa]
Length=486

 Score =   370 bits (949),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 169/277 (61%), Positives = 225/277 (81%), Gaps = 6/277 (2%)
 Frame = +1

Query  181   SGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDD-DIFS  357
             + +KPHAIL+ YPLQGH+IPSVHLA +LA +GFT+TFINTH+ H+ ++K+ P  + DIF+
Sbjct  5     TSKKPHAILVPYPLQGHVIPSVHLAIKLASQGFTITFINTHAFHHQISKAQPNSEPDIFT  64

Query  358   GIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGP  537
              +R+ GLDIRY TISDGLP  +DR++NHDQ+MA+LLH++SAHV+E + +I+ S  +    
Sbjct  65    KVRESGLDIRYATISDGLPVGFDRSLNHDQYMAALLHVFSAHVDEVVGQIVKSDDS----  120

Query  538   PVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDA  717
              V CLIADTFFV+P K+AKK+ LLY+SFWTEPALVF+LYYH+ LLR+NGHFGC D RED 
Sbjct  121   -VRCLIADTFFVWPSKIAKKFGLLYVSFWTEPALVFSLYYHMDLLRINGHFGCQDCREDI  179

Query  718   IEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAA  897
             I+Y+PGV++I+ KD+ SY+QE ET +VCHQII+ +F D R+ADFV+CN+VQELE ET++A
Sbjct  180   IDYIPGVKAIEPKDMTSYLQEAETTSVCHQIIFNAFNDTRSADFVVCNSVQELEVETLSA  239

Query  898   LQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             LQ +  ++ +GP+FP  F +S VATSL SESDC   L
Sbjct  240   LQAEMPYYAIGPLFPNGFTKSFVATSLWSESDCTQWL  276



>ref|XP_008355190.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Malus domestica]
Length=480

 Score =   369 bits (946),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 174/307 (57%), Positives = 239/307 (78%), Gaps = 8/307 (3%)
 Frame = +1

Query  187   QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD-DDIFSGI  363
             ++PHAI I+YPLQGH+IPSVHLA +LA  GF +TFINTH + +H +K+ P+   + F+ +
Sbjct  13    KRPHAIFIAYPLQGHVIPSVHLAIKLASHGFKITFINTHFIQHHTSKAQPKSAGNPFAYL  72

Query  364   RKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPV  543
              + GLDI Y T+SDGLP E+DR++NHDQFMASLLH++SAHVEE + K + SSA++   PV
Sbjct  73    HESGLDIDYTTVSDGLPVEFDRSLNHDQFMASLLHVFSAHVEEVVGKAVKSSADT--TPV  130

Query  544   NCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIE  723
              C+IADTFFV+P K+A+K+ ++Y+SFWTEPALVF+LYYHL LLR++GHF C DVRED I+
Sbjct  131   TCIIADTFFVWPSKIARKFGIIYVSFWTEPALVFSLYYHLDLLRMHGHFACQDVREDTID  190

Query  724   YVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQ  903
             Y+PGVR+ID KD+MSY+Q+T+T +VCHQII+ +F+DAR A F LCNTVQE+E ET++ALQ
Sbjct  191   YIPGVRAIDPKDMMSYLQDTDTTSVCHQIIFNAFKDARGAHFHLCNTVQEIESETISALQ  250

Query  904   EKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLLILP----LLHCSYRWFAGGVAGRTV  1071
              K  F+ +GPIFP  F+++  ATSL SESDC   L       +L+ S+  +A  VA + +
Sbjct  251   AKMKFYAIGPIFPTTFSKNIAATSLWSESDCTQWLNTKPHGSVLYVSFGSYA-HVAKKDL  309

Query  1072  VSLLDGV  1092
             + + +G+
Sbjct  310   IEITNGL  316



>ref|XP_008363514.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Malus domestica]
Length=480

 Score =   369 bits (946),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 174/307 (57%), Positives = 239/307 (78%), Gaps = 8/307 (3%)
 Frame = +1

Query  187   QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD-DDIFSGI  363
             ++PHAI I+YPLQGH+IPSVHLA +LA  GF +TFINTH + +H +K+ P+   + F+ +
Sbjct  13    KRPHAIFIAYPLQGHVIPSVHLAIKLASHGFKITFINTHFIQHHTSKAQPKSAGNPFAYL  72

Query  364   RKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPV  543
              + GLDI Y T+SDGLP E+DR++NHDQFMASLLH++SAHVEE + K + SSA++   PV
Sbjct  73    HESGLDIDYTTVSDGLPVEFDRSLNHDQFMASLLHVFSAHVEEVVGKAVKSSADT--TPV  130

Query  544   NCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIE  723
              C+IADTFFV+P K+A+K+ ++Y+SFWTEPALVF+LYYHL LLR++GHF C DVRED I+
Sbjct  131   TCIIADTFFVWPSKIARKFGIIYVSFWTEPALVFSLYYHLDLLRMHGHFACQDVREDTID  190

Query  724   YVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQ  903
             Y+PGVR+ID KD+MSY+Q+T+T +VCHQII+ +F+DAR A F LCNTVQE+E ET++ALQ
Sbjct  191   YIPGVRAIDPKDMMSYLQDTDTTSVCHQIIFNAFKDARGAHFHLCNTVQEIESETISALQ  250

Query  904   EKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLLILP----LLHCSYRWFAGGVAGRTV  1071
              K  F+ +GPIFP  F+++  ATSL SESDC   L       +L+ S+  +A  VA + +
Sbjct  251   AKMKFYAIGPIFPTTFSKNIAATSLWSESDCTQWLNTKPHGSVLYVSFGSYA-HVAKKDL  309

Query  1072  VSLLDGV  1092
             + + +G+
Sbjct  310   IEITNGL  316



>ref|XP_008226277.1| PREDICTED: UDP-glycosyltransferase 86A2 [Prunus mume]
Length=480

 Score =   369 bits (946),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 177/287 (62%), Positives = 226/287 (79%), Gaps = 10/287 (3%)
 Frame = +1

Query  172   MADS------GQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSN  333
             MADS       ++PHAI I+YPLQGH+IPSVHLA +LA +GF +TFINTHS+H+  +K+ 
Sbjct  1     MADSVHNTHHQKRPHAIFIAYPLQGHVIPSVHLAIKLASRGFKITFINTHSIHHQTSKAQ  60

Query  334   PRD-DDIFSGIRKP-GLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKI  507
             P    D F+ +R+  GLDI Y T+SDGLP E+DR++NHDQFMASLLH++SAH EE + ++
Sbjct  61    PDSGSDPFAYVRESSGLDIDYATVSDGLPLEFDRSLNHDQFMASLLHVFSAHAEEVVGRV  120

Query  508   LTSSANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGH  687
             +  SA++   PV C+IADTFFV+P K+AKK+ LLY+SFWTEPALVFTLYYHL LLR NGH
Sbjct  121   VKFSADTT--PVTCIIADTFFVWPSKIAKKFGLLYVSFWTEPALVFTLYYHLDLLRKNGH  178

Query  688   FGCIDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTV  867
             F C DVRED I+YVPGVR+I+ KD+ S++QET+T +VCH II+ +F+DAR A F LCNTV
Sbjct  179   FACQDVREDTIDYVPGVRAIEPKDMTSFLQETDTTSVCHHIIFNAFKDARGAHFHLCNTV  238

Query  868   QELEHETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             QE+E ET++ALQ KT F+ +GPIFP  F ++ VATSL SESDC   L
Sbjct  239   QEIEAETISALQSKTPFYAIGPIFPSKFNKNIVATSLWSESDCTQWL  285



>ref|XP_010263435.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Nelumbo nucifera]
Length=478

 Score =   368 bits (944),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 171/277 (62%), Positives = 222/277 (80%), Gaps = 5/277 (2%)
 Frame = +1

Query  181   SGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNP-RDDDIFS  357
             +GQKPHAI I YPLQGH+IPSV+LA +LA KGF VTF+NT S+H+ ++K+ P    DIF+
Sbjct  6     TGQKPHAIFIPYPLQGHVIPSVNLALKLASKGFIVTFVNTQSIHHKISKAQPGSGGDIFA  65

Query  358   GIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGP  537
               RK G+DIRY T+ DGLP ++DR++NHDQFMASLLH++SAHVEE +++I+  ++    P
Sbjct  66    DARKSGIDIRYETVCDGLPIDFDRSLNHDQFMASLLHVFSAHVEELIRRIVQQAS----P  121

Query  538   PVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDA  717
             P+ CLIADTFFV+P  LAKK+ L+Y+SFWTE ALV+ LYYH+ LLRLNGHFGCID RED 
Sbjct  122   PLTCLIADTFFVWPSILAKKFGLVYVSFWTEAALVYALYYHVDLLRLNGHFGCIDKREDT  181

Query  718   IEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAA  897
             I+Y+PGV S++  DLMSY+Q+T+T TV HQ+I+K+FQD + ADFV+CNT+QELE ET++A
Sbjct  182   IDYIPGVSSLEPTDLMSYLQDTDTSTVVHQLIFKAFQDDKGADFVICNTIQELEPETISA  241

Query  898   LQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             LQ +  FF +GPIF   F +S VATSL +ESDC   L
Sbjct  242   LQLEKPFFAIGPIFSSGFTKSMVATSLWAESDCAQWL  278



>ref|XP_003632262.1| PREDICTED: UDP-glycosyltransferase 86A1 [Vitis vinifera]
Length=474

 Score =   367 bits (941),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 171/276 (62%), Positives = 219/276 (79%), Gaps = 5/276 (2%)
 Frame = +1

Query  172  MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSN-PRDDD  348
            MA + Q PHAIL++YPLQGH+IP+VHLA  LA +GFT+TF+NT S+H   +++     DD
Sbjct  1    MASTHQNPHAILVAYPLQGHVIPAVHLAINLASRGFTITFVNTLSIHQQTSRAQGAGSDD  60

Query  349  IFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANS  528
            IFSG R+ GLDIRY T+SDGLP  +DR++NHDQFMA+LLH+ SAHVEE +++++  +A  
Sbjct  61   IFSGSREAGLDIRYTTVSDGLPVGFDRSLNHDQFMAALLHVLSAHVEELVERVVAEAA--  118

Query  529  GGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVR  708
              PPV+CLIADTFFV+P  LAKK+ LLY+SFWTEPALVFTLYYH+ LLR +GHF C + R
Sbjct  119  --PPVSCLIADTFFVWPSALAKKFGLLYVSFWTEPALVFTLYYHMDLLRKHGHFDCSETR  176

Query  709  EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHET  888
            +D I+Y+PGV +I  +D+ SY+Q T+T TVCHQII  +FQDA+ ADFVLCNTV+ELE  T
Sbjct  177  KDVIDYIPGVEAIHPRDMTSYLQATDTSTVCHQIISTAFQDAKGADFVLCNTVEELELHT  236

Query  889  VAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDC  996
            ++ALQ K   + VGPIFPP F +S VATSL +ESDC
Sbjct  237  ISALQAKKKLYAVGPIFPPGFTKSIVATSLWAESDC  272



>ref|XP_010253969.1| PREDICTED: UDP-glycosyltransferase 86A2-like [Nelumbo nucifera]
Length=492

 Score =   363 bits (933),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 172/276 (62%), Positives = 215/276 (78%), Gaps = 4/276 (1%)
 Frame = +1

Query  172  MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNP-RDDD  348
            M  S QKPHAILI++PLQGH+IP+VHLA  LA KGFT+TFINT S+H+  TK+ P    D
Sbjct  1    MVGSDQKPHAILIAFPLQGHVIPAVHLAMNLASKGFTITFINTQSIHHQTTKAQPDSGGD  60

Query  349  IFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANS  528
            IF+G RK GLDIRY T+SDGLP  +DR++NHDQFM SLLH+ SAH EE ++ I+ S    
Sbjct  61   IFAGARKSGLDIRYKTVSDGLPIGFDRSLNHDQFMYSLLHVSSAHAEELIRDIVMSDLP-  119

Query  529  GGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVR  708
              PP  CLIADTFFV+P  +AKK  L Y+SFWTEPALVFTLYYH++LLR+NGHF C   R
Sbjct  120  --PPATCLIADTFFVWPSMIAKKLGLAYVSFWTEPALVFTLYYHMNLLRMNGHFDCNSKR  177

Query  709  EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHET  888
            +D I Y+PGV +I+  DLMSY+QET+T +V HQ+I+K+F+D +NADFV+CNT+QELE ET
Sbjct  178  DDTINYIPGVPAIEPTDLMSYLQETDTSSVVHQVIFKAFEDVKNADFVVCNTIQELEPET  237

Query  889  VAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDC  996
            ++ALQ +  F+ +GPIF   F +S VATSL SESDC
Sbjct  238  ISALQVEKPFYAIGPIFVSGFTKSTVATSLWSESDC  273



>ref|XP_006424499.1| hypothetical protein CICLE_v10029902mg [Citrus clementina]
 gb|ESR37739.1| hypothetical protein CICLE_v10029902mg [Citrus clementina]
Length=477

 Score =   362 bits (929),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/311 (57%), Positives = 230/311 (74%), Gaps = 11/311 (4%)
 Frame = +1

Query  175   ADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPR-DDDI  351
              +  QKPHAI ISYPLQGH+ PSV LA +LA +GFT+TF+NTH +H  +TK++P    DI
Sbjct  3     GNKTQKPHAIFISYPLQGHVNPSVQLALKLASQGFTITFVNTHFIHQQMTKASPEMGSDI  62

Query  352   FSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSG  531
             F+G+RK GLDIRY+T+SDGLP  +DR++NH+QFM+SLLH++SAH EE + +I+ S  N  
Sbjct  63    FAGVRKSGLDIRYMTLSDGLPLGFDRSLNHEQFMSSLLHVFSAHAEEVIGQIVRSGEN--  120

Query  532   GPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVRE  711
                V+CLIADT+FV+P KLAKK+ L YISFWTE ALVFTLYYHL LL +NGHF C D RE
Sbjct  121   ---VHCLIADTYFVWPSKLAKKFGLYYISFWTESALVFTLYYHLDLLTINGHFQCYDCRE  177

Query  712   DAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETV  891
             D I+Y+PGV++I+ KD  SY+QET+T + CHQII+ SFQD RNAD+VLCNTV ELE E V
Sbjct  178   DTIDYIPGVKAINPKDTTSYLQETDTTSACHQIIFNSFQDTRNADYVLCNTVHELESEAV  237

Query  892   AALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLLIL----PLLHCSYRWFAGGVA  1059
              AL+ K  F T+GPI    F+   VATSL SESDC   L       +L+ S+  +A  V+
Sbjct  238   TALKAKIPFITMGPISLNKFSDRVVATSLWSESDCSQWLDKQPKGSVLYVSFGSYA-HVS  296

Query  1060  GRTVVSLLDGV  1092
              R ++ + +G+
Sbjct  297   KRDLIEIANGI  307



>ref|XP_006488636.1| PREDICTED: UDP-glycosyltransferase 86A2-like [Citrus sinensis]
Length=477

 Score =   362 bits (928),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/311 (57%), Positives = 230/311 (74%), Gaps = 11/311 (4%)
 Frame = +1

Query  175   ADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPR-DDDI  351
              +  QKPHAI ISYPLQGH+ PSV LA +LA +GFT+TF+NTH +H  +TK++P    DI
Sbjct  3     GNKTQKPHAIFISYPLQGHVNPSVQLALKLASQGFTITFVNTHFIHQQMTKASPEMGSDI  62

Query  352   FSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSG  531
             F+G+RK GLDIRY+T+SDGLP  +DR++NH+QFM+SLLH++SAH EE + +I+ S  N  
Sbjct  63    FAGVRKSGLDIRYMTLSDGLPLGFDRSLNHEQFMSSLLHVFSAHAEEVIGQIVRSGEN--  120

Query  532   GPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVRE  711
                V+CLIADT+FV+P KLAKK+ L YISFWTE ALVFTLYYHL LL +NGHF C D RE
Sbjct  121   ---VHCLIADTYFVWPSKLAKKFGLYYISFWTESALVFTLYYHLDLLTINGHFQCYDCRE  177

Query  712   DAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETV  891
             D I+Y+PGV++I+ KD  SY+QET+T + CHQII+ SFQD RNAD+VLCNTV ELE E V
Sbjct  178   DTIDYIPGVKAINPKDTTSYLQETDTTSACHQIIFNSFQDTRNADYVLCNTVHELESEAV  237

Query  892   AALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLLIL----PLLHCSYRWFAGGVA  1059
              AL+ K  F T+GPI    F+   VATSL SESDC   L       +L+ S+  +A  V+
Sbjct  238   TALKAKIPFITMGPISLNKFSDRVVATSLWSESDCSQWLDKQPEGSVLYVSFGSYA-HVS  296

Query  1060  GRTVVSLLDGV  1092
              R ++ + +G+
Sbjct  297   KRDLIEIANGI  307



>gb|KDO60213.1| hypothetical protein CISIN_1g011789mg [Citrus sinensis]
Length=477

 Score =   362 bits (928),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 178/311 (57%), Positives = 230/311 (74%), Gaps = 11/311 (4%)
 Frame = +1

Query  175   ADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPR-DDDI  351
              +  QKPHAI ISYPLQGH+ PSV LA +LA +GFT+TF+NTH +H  +TK++P    DI
Sbjct  3     GNKTQKPHAIFISYPLQGHVNPSVQLALKLASQGFTITFVNTHFIHQQMTKASPEMGSDI  62

Query  352   FSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSG  531
             F+G+RK GLDIRY+T+SDGLP  +DR++NH+QFM+SLLH++SAH EE + +I+ S  N  
Sbjct  63    FAGVRKSGLDIRYMTLSDGLPLGFDRSLNHEQFMSSLLHVFSAHAEEVIGQIVRSGEN--  120

Query  532   GPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVRE  711
                V+CLIADT+FV+P KLAKK+ L YISFWTE ALVFTLYYHL LL +NGHF C D RE
Sbjct  121   ---VHCLIADTYFVWPSKLAKKFGLYYISFWTESALVFTLYYHLDLLTINGHFQCYDCRE  177

Query  712   DAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETV  891
             D I+Y+PGV++I+ KD  SY+QET+T + CHQII+ SFQD RNAD+VLCNTV ELE E V
Sbjct  178   DTIDYIPGVKAINPKDTTSYLQETDTTSACHQIIFNSFQDTRNADYVLCNTVHELESEAV  237

Query  892   AALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLLIL----PLLHCSYRWFAGGVA  1059
              AL+ K  F T+GPI    F+   VATSL SESDC   L       +L+ S+  +A  V+
Sbjct  238   TALKAKIPFITMGPISLNKFSDRVVATSLWSESDCSQWLDKQPKGSVLYVSFGSYA-HVS  296

Query  1060  GRTVVSLLDGV  1092
              R ++ + +G+
Sbjct  297   KRDLIEIANGI  307



>dbj|BAG80548.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=470

 Score =   360 bits (925),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 186/280 (66%), Positives = 226/280 (81%), Gaps = 4/280 (1%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLT-KSNPRDDD  348
             M  S  KPHAIL+ YPLQGH+IP++HLA +LA KGFT+TFINT S H  +T KS   ++D
Sbjct  1     MDSSSPKPHAILVCYPLQGHVIPTIHLAIKLARKGFTITFINTQSTHTQITRKSGDGEED  60

Query  349   IFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANS  528
             IFS +R   LDIRY+T+SDGLP  +DR++NHDQFMA LLH++SAHVEEAL KI+ S  + 
Sbjct  61    IFSSVRGQDLDIRYITVSDGLPVNFDRSLNHDQFMACLLHVFSAHVEEALLKIVQSKVD-  119

Query  529   GGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVR  708
               PPV+CLIAD+FFVFPGKLAKKY L YI+FWTE ALVFTLYYHLHLL+L+GHF CI +R
Sbjct  120   --PPVSCLIADSFFVFPGKLAKKYGLRYIAFWTETALVFTLYYHLHLLKLHGHFDCIGMR  177

Query  709   EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHET  888
             ED I+Y+PGV+SI  KDLMSY+QET+T +VCH II+ +FQD RNADF+LCNTVQELE ET
Sbjct  178   EDPIDYIPGVKSIKPKDLMSYVQETDTTSVCHHIIFSAFQDVRNADFILCNTVQELEPET  237

Query  889   VAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             ++ALQ +  FF +GPIFPP FA S VATS+ SE +C   L
Sbjct  238   ISALQIEKPFFAIGPIFPPEFATSGVATSMCSEYECTQWL  277



>ref|XP_011040925.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Populus euphratica]
Length=485

 Score =   360 bits (924),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 173/312 (55%), Positives = 236/312 (76%), Gaps = 11/312 (4%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDD-D  348
             M ++ +KPH I I +PLQGH+IP+VHLA +LA +GFT+TFINT ++H+ ++ + P  + D
Sbjct  1     MVETLKKPHVIFIPFPLQGHVIPAVHLAIKLASRGFTITFINTQAIHHQISNAQPSSEPD  60

Query  349   IFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANS  528
             IF+ +R+ GLDIRY T+SDGLP  +DR++NHDQF A+LLH+ SAHV+E + +I+ S  + 
Sbjct  61    IFAKVRESGLDIRYTTVSDGLPIGFDRSLNHDQFTAALLHVLSAHVDEVVGQIVKSDDS-  119

Query  529   GGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVR  708
                 + CLIADTFFV+P K+AKK+ LLY+SFWTEPALVF+LYYH+ LL  NGHF C D R
Sbjct  120   ----IRCLIADTFFVWPSKIAKKFGLLYVSFWTEPALVFSLYYHMDLLMRNGHFACQDCR  175

Query  709   EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHET  888
             ED I+Y+PGV++I+ KD++SY+QET+T +  HQ+I+K+F DARNADF+LCNTVQELE ET
Sbjct  176   EDTIDYIPGVKAIEPKDMVSYLQETDTTSTIHQLIFKAFNDARNADFLLCNTVQELEVET  235

Query  889   VAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLLILP----LLHCSYRWFAGGV  1056
             ++ALQ K   + +GPIFP  F +S+VATSL SESDC   L       +L+ S+  FA  V
Sbjct  236   LSALQAKMPCYAIGPIFPNGFTESSVATSLWSESDCTQWLDKKPHGSVLYVSFGSFA-HV  294

Query  1057  AGRTVVSLLDGV  1092
             A R +V +  G+
Sbjct  295   AKRDLVEIAKGL  306



>ref|XP_006384937.1| hypothetical protein POPTR_0004s22400g [Populus trichocarpa]
 gb|ERP62734.1| hypothetical protein POPTR_0004s22400g [Populus trichocarpa]
Length=488

 Score =   360 bits (923),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 173/312 (55%), Positives = 237/312 (76%), Gaps = 11/312 (4%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDD-D  348
             MA++ +KPH I I +PLQGH+IP+VHLA +LA +GFT+TFINT ++H+  + + P  + D
Sbjct  1     MAETHKKPHVIFIPFPLQGHVIPAVHLAIKLASQGFTITFINTQAIHHQTSNAQPSSEPD  60

Query  349   IFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANS  528
             IF+ +R+ GLDIRY T+SDGLP  +DR++N DQF A+LLH++SAHV+E + +I+ S  + 
Sbjct  61    IFAKVRESGLDIRYTTVSDGLPIGFDRSLNFDQFTAALLHVFSAHVDEVVGQIVKSDDS-  119

Query  529   GGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVR  708
                 + CLIADTFFV+P K+AKK+ LLY+SFWTEPALVF+LYYH+ LL +NGHF C D R
Sbjct  120   ----IRCLIADTFFVWPSKIAKKFGLLYVSFWTEPALVFSLYYHMDLLMINGHFACQDCR  175

Query  709   EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHET  888
             ED I+Y+PGV++I+ KD++SY+QET+T ++ HQ+I+K+F DARNADF+LCNTVQELE ET
Sbjct  176   EDTIDYIPGVKAIEPKDMVSYLQETDTTSISHQLIFKAFNDARNADFLLCNTVQELEVET  235

Query  889   VAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLLILP----LLHCSYRWFAGGV  1056
             ++ALQ K   + +GPIFP  F +S VATSL SESDC   L       +L+ S+  FA  V
Sbjct  236   LSALQAKMPCYAIGPIFPNGFTKSFVATSLWSESDCTQWLDKKPHGSVLYVSFGSFA-HV  294

Query  1057  AGRTVVSLLDGV  1092
             A R +V +  G+
Sbjct  295   AKRDLVEIAKGL  306



>ref|XP_004295617.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Fragaria vesca 
subsp. vesca]
Length=476

 Score =   359 bits (921),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 174/313 (56%), Positives = 233/313 (74%), Gaps = 9/313 (3%)
 Frame = +1

Query  172   MADSGQ-KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPR-DD  345
             MA+S   KPHAI I YPLQGH+IPSV LA +LA +GF +TF+NT S+H+H +K+ P+   
Sbjct  1     MAESDNLKPHAIFIPYPLQGHVIPSVELAIKLASRGFKITFVNTQSIHHHTSKAQPKTGG  60

Query  346   DIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSAN  525
             ++F+  R+ G DI Y T+SDGLP E+DR++NHDQFMASLLH++SAHV+E + K++ SS N
Sbjct  61    NLFAAAREAGQDIDYTTVSDGLPVEFDRSLNHDQFMASLLHVFSAHVDELVGKLVKSSVN  120

Query  526   SGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDV  705
             +   PV CLIADTFFV+PGK+AKKY LLY+SFWTEPALV++LY+H+ LLR NGHF C DV
Sbjct  121   TA--PVTCLIADTFFVWPGKVAKKYDLLYVSFWTEPALVYSLYFHVDLLRKNGHFACHDV  178

Query  706   REDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHE  885
             RED I Y+PGV+SID  D+MSY+Q+    TVCHQII+ +F+D R + +VLCNTV+E+E E
Sbjct  179   REDDINYIPGVKSIDPSDMMSYLQDANVTTVCHQIIFNAFKDVRESHYVLCNTVEEIESE  238

Query  886   TVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLLILP----LLHCSYRWFAGG  1053
             T+  L  K  F+ +GP+FP  F +S VATSL SESD    L       +L+ S+  +A  
Sbjct  239   TITPLHAKIPFYAIGPLFPNRFNKSIVATSLWSESDRSQWLNTKPQGSVLYVSFGSYA-H  297

Query  1054  VAGRTVVSLLDGV  1092
             V+ R ++ + DG+
Sbjct  298   VSKRDLIEIADGL  310



>ref|XP_010043797.1| PREDICTED: UDP-glycosyltransferase 86A2 [Eucalyptus grandis]
 gb|KCW85785.1| hypothetical protein EUGRSUZ_B02537 [Eucalyptus grandis]
Length=490

 Score =   355 bits (910),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 171/289 (59%), Positives = 217/289 (75%), Gaps = 14/289 (5%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKS---NPRD  342
             MAD+ +KPHAI+I YPLQGH+ PSVHLA +LA +GF VTFINT S+H+H  K+    P  
Sbjct  1     MADNHRKPHAIIIPYPLQGHVNPSVHLAIKLASRGFAVTFINTQSIHHHTVKALDQKPDG  60

Query  343   D-------DIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALK  501
             D       DIF+ +R+ G DIRY T+SDGLP  +DR++NHDQFMASLLH++SAHVEE + 
Sbjct  61    DGDGNGSYDIFANVRRSGHDIRYTTVSDGLPVGFDRSLNHDQFMASLLHVFSAHVEEIVG  120

Query  502   KILTSSANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLN  681
              I+ +     G   + LIADTFFV+P K+A+K+ LLY+SFWTEPALVFTLYYH+ LLR+N
Sbjct  121   NIVATP----GEGADFLIADTFFVWPSKVAEKFGLLYVSFWTEPALVFTLYYHMDLLRIN  176

Query  682   GHFGCIDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCN  861
             GHF C D RED I+Y+PGV  +  KD+ SY+QE++T + CHQII+  FQD + ADF+LCN
Sbjct  177   GHFACQDCREDPIDYIPGVPPLQPKDMTSYLQESDTSSTCHQIIFNGFQDVKAADFILCN  236

Query  862   TVQELEHETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             TVQELE  TVAALQE+  F+++GP+FP  F +S VATSL  ESDC   L
Sbjct  237   TVQELEPGTVAALQEQKPFYSIGPVFPEGFTRSDVATSLWPESDCSQWL  285



>ref|XP_009376097.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Pyrus x bretschneideri]
Length=480

 Score =   353 bits (907),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/307 (56%), Positives = 239/307 (78%), Gaps = 8/307 (3%)
 Frame = +1

Query  187   QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD-DDIFSGI  363
             ++PHAI I+YPLQGH+IPSVHLA +LA  GF +TFINTH + +H +K+ P+   + F+ +
Sbjct  13    KRPHAIFIAYPLQGHVIPSVHLAIKLASHGFKITFINTHFIQHHTSKAQPKSAGNPFAYL  72

Query  364   RKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPV  543
              + GL+I Y T+SDGLP E+DR++NHDQFMASLLH++SAHVEE + K++ SSA++   PV
Sbjct  73    HESGLNIDYTTVSDGLPVEFDRSLNHDQFMASLLHVFSAHVEEVVGKVVKSSADT--TPV  130

Query  544   NCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIE  723
              C+IADTFFV+P K+A+K+ ++Y+SFWTEPALVF+LYYHL LLR +GHF C DVRED I+
Sbjct  131   TCIIADTFFVWPSKIARKFGIIYVSFWTEPALVFSLYYHLDLLRRHGHFACQDVREDTID  190

Query  724   YVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQ  903
             Y+PGVR+ID KD+MSY+Q+T+T +VCHQII+ +F+DAR A F LCNTVQE+E ET++ALQ
Sbjct  191   YIPGVRAIDPKDMMSYLQDTDTTSVCHQIIFNAFKDARGAHFHLCNTVQEIESETISALQ  250

Query  904   EKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLLILP----LLHCSYRWFAGGVAGRTV  1071
              K  F+ +GPIFP +F+++  A SL SESDC   L       +L+ S+  +A  VA + +
Sbjct  251   AKMKFYAIGPIFPTIFSKNIAARSLWSESDCTQWLNTKPHGSVLYVSFGSYA-HVAKKDL  309

Query  1072  VSLLDGV  1092
             + + +G+
Sbjct  310   IEIANGL  316



>ref|XP_008809704.1| PREDICTED: UDP-glycosyltransferase 86A2-like, partial [Phoenix 
dactylifera]
Length=396

 Score =   350 bits (899),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 164/279 (59%), Positives = 219/279 (78%), Gaps = 6/279 (2%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDI  351
             MA+ GQKPHA++I+YPLQGHIIP VHLA +LA KGFT+TF NT +VH+  T+++   DDI
Sbjct  1     MAEQGQKPHALIIAYPLQGHIIPVVHLAIKLASKGFTITFANTEAVHHQTTQAH-NSDDI  59

Query  352   FSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSG  531
             F+G R  GLDIRY  +SDGLP  +DR++NHDQFMA+LLH+ SAHVEE ++K+  +S    
Sbjct  60    FAGARASGLDIRYELVSDGLPVSFDRSLNHDQFMAALLHVLSAHVEELMQKLSHAS----  115

Query  532   GPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVRE  711
              PP+ CLI DTFFV+P  +AKK+ + Y+S+WTE A++F LYYH++LL  +GHF  ++ R+
Sbjct  116   -PPITCLITDTFFVWPSTIAKKFGVPYVSYWTEAAIIFALYYHMNLLTKHGHFASLENRK  174

Query  712   DAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETV  891
             DAI Y+PGV  I+  +LMSY+QET+T +V HQII+KSF++A+ ADFVLCNTVQELE ET+
Sbjct  175   DAITYIPGVPKIEPTELMSYLQETDTSSVVHQIIFKSFEEAKGADFVLCNTVQELEPETI  234

Query  892   AALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             +ALQ++  F+ +GPIFP  F +S VATSL +ESDC   L
Sbjct  235   SALQKEKPFYAIGPIFPAGFTKSTVATSLWTESDCSQWL  273



>ref|XP_002523692.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF38632.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=487

 Score =   353 bits (905),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 164/279 (59%), Positives = 217/279 (78%), Gaps = 9/279 (3%)
 Frame = +1

Query  172  MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKS----NPR  339
            MAD  +KPHAI I YPLQGH+IPSVHLA +LA +GFT+TFINT+S+H+  +K+       
Sbjct  1    MADKPKKPHAIFIPYPLQGHLIPSVHLAIKLASQGFTITFINTYSIHHQTSKAALTKTGA  60

Query  340  DDDIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSS  519
              D+F+  R+ GLDIRY T+SDGLP  +DR++NHDQFMA+LLH++SAHVEEA+ +I++S 
Sbjct  61   GPDMFTTARESGLDIRYTTVSDGLPIGFDRSLNHDQFMAALLHVFSAHVEEAVAEIVSS-  119

Query  520  ANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCI  699
                G  V+CLIADTFFV+P K+A K+ L+++SFWTEPALVFTLYYH+ LLR++GHF C 
Sbjct  120  ----GEDVHCLIADTFFVWPSKIASKFGLVHVSFWTEPALVFTLYYHMDLLRIHGHFACQ  175

Query  700  DVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELE  879
            D RED I+Y+PGV  I+ KD  SY+QET+T +VCHQII+  F D +NADFV+CN+VQELE
Sbjct  176  DCREDTIDYIPGVEGIEPKDTTSYLQETDTTSVCHQIIFNCFNDTKNADFVICNSVQELE  235

Query  880  HETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDC  996
             + ++A+  K  F+ +GPI P  F +S ++TSL SESDC
Sbjct  236  SDVLSAIHAKIPFYAIGPILPNDFGKSILSTSLWSESDC  274



>ref|XP_008809703.1| PREDICTED: UDP-glycosyltransferase 86A2-like [Phoenix dactylifera]
Length=548

 Score =   352 bits (904),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 164/279 (59%), Positives = 219/279 (78%), Gaps = 6/279 (2%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDI  351
             MA+ GQKPHA++I+YPLQGHIIP VHLA +LA KGFT+TF NT +VH+  T+++   DDI
Sbjct  1     MAEQGQKPHALIIAYPLQGHIIPVVHLAIKLASKGFTITFANTEAVHHQTTQAH-NSDDI  59

Query  352   FSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSG  531
             F+G R  GLDIRY  +SDGLP  +DR++NHDQFMA+LLH+ SAHVEE ++K+  +S    
Sbjct  60    FAGARASGLDIRYELVSDGLPVSFDRSLNHDQFMAALLHVLSAHVEELMQKLSHAS----  115

Query  532   GPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVRE  711
              PP+ CLI DTFFV+P  +AKK+ + Y+S+WTE A++F LYYH++LL  +GHF  ++ R+
Sbjct  116   -PPITCLITDTFFVWPSTIAKKFGVPYVSYWTEAAIIFALYYHMNLLTKHGHFASLENRK  174

Query  712   DAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETV  891
             DAI Y+PGV  I+  +LMSY+QET+T +V HQII+KSF++A+ ADFVLCNTVQELE ET+
Sbjct  175   DAITYIPGVPKIEPTELMSYLQETDTSSVVHQIIFKSFEEAKGADFVLCNTVQELEPETI  234

Query  892   AALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             +ALQ++  F+ +GPIFP  F +S VATSL +ESDC   L
Sbjct  235   SALQKEKPFYAIGPIFPAGFTKSTVATSLWTESDCSQWL  273



>gb|KDP43993.1| hypothetical protein JCGZ_05460 [Jatropha curcas]
Length=491

 Score =   350 bits (897),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 167/284 (59%), Positives = 216/284 (76%), Gaps = 10/284 (4%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDD-D  348
             MAD  ++PHAI I YPLQGH+IPSVHLA +LA +GFT+TFINT  +H   +K+      D
Sbjct  1     MADKPKRPHAIFIPYPLQGHVIPSVHLAIKLASQGFTITFINTQYIHQQTSKAGSTAGPD  60

Query  349   IFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANS  528
             +F+ +R  GLDIRY T+SDGLP  +DR++NHDQFMA+LLH++SAHVEE + +I+ S    
Sbjct  61    LFTKVRGSGLDIRYTTVSDGLPIGFDRSLNHDQFMAALLHVFSAHVEEVVGQIIAS----  116

Query  529   GGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGC----  696
              G  V+CLIADTFFV+P K+AKK+ LLY+SFWTE ALVFTLYYHL LLR+NGHF C    
Sbjct  117   -GEDVHCLIADTFFVWPSKVAKKFGLLYVSFWTEAALVFTLYYHLDLLRINGHFDCNGFV  175

Query  697   IDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQEL  876
              D RED I  +PGV++I++KD MSY+QE +  +VCHQII+  F+D +NADFVLCNTV+EL
Sbjct  176   SDRREDVINCIPGVKAIELKDTMSYLQEKDATSVCHQIIFNCFEDTKNADFVLCNTVEEL  235

Query  877   EHETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             E ET++AL+ K  ++ +GPIF   F+++ V TSL SESDC   L
Sbjct  236   EPETISALKAKIPYYAIGPIFSSDFSKTIVVTSLWSESDCTQWL  279



>ref|XP_007027384.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY07886.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=484

 Score =   345 bits (885),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 160/284 (56%), Positives = 213/284 (75%), Gaps = 10/284 (4%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD---  342
             M  + QKPHAI+I+YPLQGH+IPSV LA +LA KGFT+TF+NT S+H+ +TKS+P     
Sbjct  1     MEKNHQKPHAIMIAYPLQGHVIPSVQLAMKLASKGFTITFVNTQSIHHQITKSHPNTTTS  60

Query  343   --DDIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTS  516
               +DIF+  RK GLDIRY  +SDG P  +DR++NHDQF+  +LH+ SAH++E +   + +
Sbjct  61    DAEDIFTEARKSGLDIRYNVVSDGFPLGFDRSLNHDQFLEGVLHVMSAHIDELVANTIKT  120

Query  517   SANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGC  696
             +     PP  CLIADTFFV+   ++ KY L+ +SFWTEPALVFTLYYHL LLR NGHF  
Sbjct  121   N-----PPPTCLIADTFFVWSSMISNKYNLVNVSFWTEPALVFTLYYHLDLLRSNGHFAS  175

Query  697   IDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQEL  876
             ID R+D I+Y+PGVR+++ KDLMSY+Q ++  TV H+II+K+F+D + ADF++CNTVQEL
Sbjct  176   IDNRDDVIDYIPGVRAVEPKDLMSYLQASDISTVVHRIIFKAFEDVKKADFIICNTVQEL  235

Query  877   EHETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             EHET++AL +K   + +GPIF   F +S VATSL SESDC   L
Sbjct  236   EHETISALNKKQPTYAIGPIFRTGFTKSVVATSLWSESDCTQWL  279



>ref|XP_010050978.1| PREDICTED: UDP-glycosyltransferase 86A1 [Eucalyptus grandis]
 gb|KCW89399.1| hypothetical protein EUGRSUZ_A01691 [Eucalyptus grandis]
Length=480

 Score =   344 bits (883),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 168/285 (59%), Positives = 214/285 (75%), Gaps = 11/285 (4%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDD--  345
             M +S QK HA++I+YPLQGH+IPSVHLA +LA  GFT+TF+NT S+H+ LTKS+  +D  
Sbjct  1     MENSHQKLHALMIAYPLQGHVIPSVHLAMKLASMGFTITFVNTQSIHHQLTKSHHHNDGP  60

Query  346   ----DIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILT  513
                 DIF+G RK GLDIRY T+SDG P  +DR+++HDQFM  LLH+ SAHV+E + K+  
Sbjct  61    EAAEDIFAGARKSGLDIRYATVSDGFPLGFDRSLHHDQFMEGLLHVMSAHVDEFVGKLAA  120

Query  514   SSANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFG  693
             S      PPVNCLI DTF+V+   + +KY L+ ISFWTEPALV T+YYHL LLR+NGHFG
Sbjct  121   SE-----PPVNCLIVDTFYVWSSMICEKYHLVNISFWTEPALVLTVYYHLDLLRINGHFG  175

Query  694   CIDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQE  873
              ID REDAI+YVPGVRSI  KDL SY+Q   T TV H+II ++F++ + AD ++CNTVQE
Sbjct  176   AIDNREDAIDYVPGVRSIQRKDLASYLQADNTGTVVHRIINEAFENVKKADVIICNTVQE  235

Query  874   LEHETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             LE +T+ ALQ+K   + +GP+FP  FA+S VATSL SESDC   L
Sbjct  236   LEPDTLLALQKKQPVYAIGPVFPIGFAKSPVATSLWSESDCTEWL  280



>emb|CDP07058.1| unnamed protein product [Coffea canephora]
Length=482

 Score =   343 bits (881),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/276 (58%), Positives = 213/276 (77%), Gaps = 7/276 (3%)
 Frame = +1

Query  187   QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD--DDIFSG  360
             QKPHAIL+ +PLQGH+ P+V LA +LA KGFT+TFINT S+H+ +T +  +D  +DIFS 
Sbjct  6     QKPHAILVCFPLQGHLNPAVQLAIKLASKGFTITFINTQSIHHQITSNTQKDSDEDIFSD  65

Query  361   IRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPP  540
              RK GLDI Y T+SDGLP E+DR++NHDQFMA++ H++SAH++EA+++++ S     GPP
Sbjct  66    ARKSGLDIHYTTVSDGLPLEFDRSLNHDQFMAAMFHVFSAHIDEAIQRLMES-----GPP  120

Query  541   VNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAI  720
             V+CLIAD+F V  G++AKK+ LLY SFWT+PA VFT+YYHL LLRLNGHF CID REDAI
Sbjct  121   VSCLIADSFLVQLGRVAKKHGLLYASFWTQPATVFTIYYHLDLLRLNGHFDCIDRREDAI  180

Query  721   EYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAAL  900
             +Y+PGV+SI+ KDL SY+QE +T T+CHQI +K+  DA+ ADFVL N + ELE + +  L
Sbjct  181   DYIPGVQSIEPKDLTSYLQEEQTNTICHQITFKAIHDAKKADFVLSNNIHELELQAMTDL  240

Query  901   QEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             ++K  F+ +GP+      + AVATSL S+SDC   L
Sbjct  241   RKKVPFYAIGPLLEFTKCRVAVATSLWSKSDCTQWL  276



>gb|KDO49335.1| hypothetical protein CISIN_1g011724mg [Citrus sinensis]
Length=478

 Score =   343 bits (880),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/275 (59%), Positives = 208/275 (76%), Gaps = 7/275 (3%)
 Frame = +1

Query  190   KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTK--SNPRDDDIFSGI  363
             KPHAI I YPLQGH+IP V+LA +LA  GFT+TF+NTHS+H+ +TK  SN  +DDIF+G 
Sbjct  9     KPHAIAICYPLQGHVIPFVNLALKLASSGFTITFVNTHSIHHQITKAQSNGDEDDIFAGA  68

Query  364   RKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPV  543
             RK GLDIRY T+SDGLP  +DR++NHDQFM  LLH++SAHV+E +  ++  +     P +
Sbjct  69    RKAGLDIRYATVSDGLPLNFDRSLNHDQFMECLLHVFSAHVDELVGNLIQLN-----PEM  123

Query  544   NCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIE  723
             NCL+ DTFFV+   +AKKY L+ ISFWTEPALV TLYYH+ LLR +GHF   D RED I+
Sbjct  124   NCLVTDTFFVWSSMIAKKYNLVNISFWTEPALVLTLYYHMDLLRSHGHFASTDNREDTID  183

Query  724   YVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQ  903
             Y+PGVR+I+ KDLMSY+Q T+T TV H+II K+F+D +  DF+LCNTV ELE ET++AL 
Sbjct  184   YIPGVRAIERKDLMSYLQATDTSTVVHRIIQKAFEDVKRVDFILCNTVHELESETISALH  243

Query  904   EKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             +K   + +GPIFP  F +S V TSL SES+C   L
Sbjct  244   QKQPTYAIGPIFPAGFTKSLVPTSLWSESECTQWL  278



>ref|XP_006428406.1| hypothetical protein CICLE_v10011571mg [Citrus clementina]
 ref|XP_006493026.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Citrus sinensis]
 gb|ESR41646.1| hypothetical protein CICLE_v10011571mg [Citrus clementina]
Length=492

 Score =   343 bits (880),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 162/275 (59%), Positives = 208/275 (76%), Gaps = 7/275 (3%)
 Frame = +1

Query  190   KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTK--SNPRDDDIFSGI  363
             KPHAI I YPLQGH+IP V+LA +LA  GFT+TF+NTHS+H+ +TK  SN  +DDIF+G 
Sbjct  9     KPHAIAICYPLQGHVIPFVNLALKLASSGFTITFVNTHSIHHQITKAQSNGDEDDIFAGA  68

Query  364   RKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPV  543
             RK GLDIRY T+SDGLP  +DR++NHDQFM  LLH++SAHV+E +  ++  +     P +
Sbjct  69    RKAGLDIRYATVSDGLPLNFDRSLNHDQFMECLLHVFSAHVDELVGNLIQLN-----PEM  123

Query  544   NCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIE  723
             NCL+ DTFFV+   +AKKY L+ ISFWTEPALV TLYYH+ LLR +GHF   D RED I+
Sbjct  124   NCLVTDTFFVWSSMIAKKYNLVNISFWTEPALVITLYYHMDLLRSHGHFASTDNREDTID  183

Query  724   YVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQ  903
             Y+PGVR+I+ KDLMSY+Q T+T TV H+II K+F+D +  DF+LCNTV ELE ET++AL 
Sbjct  184   YIPGVRAIERKDLMSYLQATDTSTVVHRIIQKAFEDVKRVDFILCNTVHELESETISALH  243

Query  904   EKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             +K   + +GPIFP  F +S V TSL SES+C   L
Sbjct  244   QKQPTYAIGPIFPAGFTKSLVPTSLWSESECTQWL  278



>gb|AFJ53011.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=489

 Score =   338 bits (868),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 156/278 (56%), Positives = 214/278 (77%), Gaps = 4/278 (1%)
 Frame = +1

Query  184   GQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD-DDIFSG  360
             G KPHAIL+ YPLQGHIIP+VHLA +LA +GFT+T+INT  +H+  + +     DD+FSG
Sbjct  13    GSKPHAILVPYPLQGHIIPAVHLAIKLASQGFTITYINTEYIHHKTSSAAAGGGDDVFSG  72

Query  361   IRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPP  540
             +R  GLDIRY T+SDG P  +DR++NHD+FMAS+LH+   +VEE +  I+ S+       
Sbjct  73    VRDSGLDIRYKTVSDGKPVGFDRSLNHDEFMASILHVLPGNVEEVIAGIV-SAGEEEDEE  131

Query  541   VNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAI  720
             V+CL+ADTFFV+P K+AKK+ L+Y+S WTEP LV+TLY+H+HLLR NGH+GC D R+DAI
Sbjct  132   VSCLVADTFFVWPSKVAKKFGLVYVSVWTEPILVYTLYHHVHLLRQNGHYGCKDRRKDAI  191

Query  721   EYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAAL  900
             +Y+PGV+ I+ KD MS++QE +  T+ HQII+ +FQDAR ADF+L NTVQELE +T++ L
Sbjct  192   DYIPGVKRIEPKDTMSFLQEADENTIIHQIIFPAFQDARGADFILANTVQELEQDTISGL  251

Query  901   QE--KTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             ++  K   +++GPIFPP F +S+V+TSL +ESDC   L
Sbjct  252   KQAHKGQVYSIGPIFPPRFTKSSVSTSLWAESDCTKWL  289



>emb|CBI32766.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   331 bits (849),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 151/271 (56%), Positives = 202/271 (75%), Gaps = 7/271 (3%)
 Frame = +1

Query  190  KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD--DDIFSGI  363
             PHAILI YPLQGH+IP VHLA +LA  GFT+TF+NT SVH+ ++++ P +  +DIF+G 
Sbjct  8    NPHAILIPYPLQGHVIPFVHLAIKLASNGFTITFVNTQSVHHQISQAQPHNSPEDIFAGA  67

Query  364  RKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPV  543
            R  GLDIRY T+SDG P  +DR++NHDQFM  +LH+YSAHV+E +  I+ S      PP 
Sbjct  68   RNSGLDIRYATVSDGFPVGFDRSLNHDQFMEGILHVYSAHVDELVGSIVHSD-----PPA  122

Query  544  NCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIE  723
             CLIADTF+V+P K++ KY L+ +SFWTEPALV +LYYH+HLLR +GHF   D REDAI+
Sbjct  123  TCLIADTFYVWPSKISNKYNLVNVSFWTEPALVLSLYYHMHLLRSHGHFASFDNREDAID  182

Query  724  YVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQ  903
            Y+PGV  I   DL SY+Q T+  TV H+IIYK+F D + ADF++CNTV+ELE  T++A+ 
Sbjct  183  YIPGVPEIKPTDLTSYLQATDITTVVHRIIYKAFDDVKRADFIICNTVEELESNTISAIH  242

Query  904  EKTSFFTVGPIFPPVFAQSAVATSL*SESDC  996
            +K  ++ +GP+FP  F +S V  ++ SESDC
Sbjct  243  QKQPYYAIGPLFPTGFTKSPVPMNMWSESDC  273



>ref|XP_002276858.1| PREDICTED: UDP-glycosyltransferase 86A1 [Vitis vinifera]
Length=481

 Score =   330 bits (847),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 151/271 (56%), Positives = 202/271 (75%), Gaps = 7/271 (3%)
 Frame = +1

Query  190  KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD--DDIFSGI  363
             PHAILI YPLQGH+IP VHLA +LA  GFT+TF+NT SVH+ ++++ P +  +DIF+G 
Sbjct  8    NPHAILIPYPLQGHVIPFVHLAIKLASNGFTITFVNTQSVHHQISQAQPHNSPEDIFAGA  67

Query  364  RKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPV  543
            R  GLDIRY T+SDG P  +DR++NHDQFM  +LH+YSAHV+E +  I+ S      PP 
Sbjct  68   RNSGLDIRYATVSDGFPVGFDRSLNHDQFMEGILHVYSAHVDELVGSIVHSD-----PPA  122

Query  544  NCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIE  723
             CLIADTF+V+P K++ KY L+ +SFWTEPALV +LYYH+HLLR +GHF   D REDAI+
Sbjct  123  TCLIADTFYVWPSKISNKYNLVNVSFWTEPALVLSLYYHMHLLRSHGHFASFDNREDAID  182

Query  724  YVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQ  903
            Y+PGV  I   DL SY+Q T+  TV H+IIYK+F D + ADF++CNTV+ELE  T++A+ 
Sbjct  183  YIPGVPEIKPTDLTSYLQATDITTVVHRIIYKAFDDVKRADFIICNTVEELESNTISAIH  242

Query  904  EKTSFFTVGPIFPPVFAQSAVATSL*SESDC  996
            +K  ++ +GP+FP  F +S V  ++ SESDC
Sbjct  243  QKQPYYAIGPLFPTGFTKSPVPMNMWSESDC  273



>gb|AFJ53012.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=486

 Score =   327 bits (838),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 152/278 (55%), Positives = 212/278 (76%), Gaps = 9/278 (3%)
 Frame = +1

Query  187   QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSN--PRDDDIFSG  360
             +KPHAI+I +PLQGH+IP+VHLA +LA +GFT+T++NT  +H+  + S+  P  DD F+G
Sbjct  14    RKPHAIVIPFPLQGHVIPAVHLAFKLASQGFTITYVNTEYIHHKTSSSSTAPTGDDFFAG  73

Query  361   IRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPP  540
             +RK GLDIRY TISDGLP  +DR++NHDQF+AS+ H++SAHVEE +  ++ +        
Sbjct  74    VRKSGLDIRYKTISDGLPLRFDRSLNHDQFIASMFHVFSAHVEELVAGMVAAGKEE---K  130

Query  541   VNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAI  720
             V+CL+ADTFFV+P K+AKK+ L+++S WT+PALVFTLY+H+HLLR N HFGC D REDAI
Sbjct  131   VSCLVADTFFVWPSKVAKKFGLVFVSIWTQPALVFTLYHHVHLLRRNCHFGCQDRREDAI  190

Query  721   EYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAAL  900
             EY+PGV+ I+ KD+ S +QE +      +  + +F+D R ADF+L NTVQELEH+T++ L
Sbjct  191   EYIPGVKRIEPKDMPSILQEVDENV--EKTAFVAFRDVRYADFILANTVQELEHDTISGL  248

Query  901   QE--KTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             ++  K  F+++GPIFPP F  S+++TSL SESDC   L
Sbjct  249   KQAHKAQFYSIGPIFPPEFTTSSISTSLWSESDCTEWL  286



>gb|EMT03715.1| Cytokinin-O-glucosyltransferase 2 [Aegilops tauschii]
Length=440

 Score =   325 bits (832),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/272 (55%), Positives = 201/272 (74%), Gaps = 9/272 (3%)
 Frame = +1

Query  190  KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKS---NPRDDDIFSG  360
            KPHA+++ YPLQGH+IP  HLA RLA +GF VT +NT +VH    ++   +P   D F+G
Sbjct  17   KPHAVVVVYPLQGHVIPVTHLALRLAARGFAVTLVNTEAVHDQTARALGVDPAGHDFFAG  76

Query  361  IRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPP  540
             R  G+D+RY  +SDGLP  +DR+++HD+ M+SLLH  S HVEE L +++        P 
Sbjct  77   TRASGMDVRYELVSDGLPVGFDRSLHHDELMSSLLHALSGHVEEVLGRVVVD------PA  130

Query  541  VNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAI  720
              CL+ADTFFV+P  LA K+ + Y+SFWTEPAL+F LYYH+HLL  NGHFGC + R+D I
Sbjct  131  ATCLVADTFFVWPATLASKFGIAYVSFWTEPALIFNLYYHVHLLTNNGHFGCNEPRKDTI  190

Query  721  EYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAAL  900
             Y+PGV +I+  +LMSY+QET+T +V H+II+K+F +AR AD+VLCNTV+ELE  T+AAL
Sbjct  191  TYIPGVPAIEPHELMSYLQETDTTSVVHRIIFKAFDEARGADYVLCNTVEELEPSTIAAL  250

Query  901  QEKTSFFTVGPIFPPVFAQSAVATSL*SESDC  996
            + +  F+ VGPIFP  FA+SAVATS+ +ESDC
Sbjct  251  RAEKPFYAVGPIFPAGFARSAVATSMWAESDC  282



>ref|XP_007205117.1| hypothetical protein PRUPE_ppa004829mg [Prunus persica]
 gb|EMJ06316.1| hypothetical protein PRUPE_ppa004829mg [Prunus persica]
Length=490

 Score =   326 bits (836),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/277 (56%), Positives = 211/277 (76%), Gaps = 9/277 (3%)
 Frame = +1

Query  178  DSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNP-RDDDIF  354
            ++ + PHA++  YPLQGH+IP+VHLA +LA KG TVTF+NT +VH+ + KS+   DD+IF
Sbjct  4    NTSKHPHAVIFPYPLQGHVIPAVHLAIKLASKGITVTFVNTQAVHHQIVKSHAMEDDNIF  63

Query  355  SGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGG  534
            +G+R+ GLDI YVTI+DG P ++DR++NHDQF  S+LH + AHV+E L K++ S+     
Sbjct  64   NGVRQSGLDIHYVTINDGFPVDFDRSLNHDQFWESVLHDFPAHVDELLAKLVLSN-----  118

Query  535  PPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGH---FGCIDV  705
            PPVNCLI+DTFFV+P  +AKKY L+ +SFWTEPAL+F LYYH+ LL  NGH       + 
Sbjct  119  PPVNCLISDTFFVWPTIIAKKYNLVTVSFWTEPALIFNLYYHVDLLNKNGHGHFTSHANP  178

Query  706  REDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHE  885
            R+D I+Y+PGVR+I+ KDL SY+Q ++  +  H+II K+F+  + ADF+LCNTVQELE E
Sbjct  179  RQDTIDYIPGVRAIEPKDLSSYLQPSDYTSPVHRIIVKAFEKIKTADFILCNTVQELESE  238

Query  886  TVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDC  996
            TV+ALQEK   +++GPIFP  F +S VATSL SESDC
Sbjct  239  TVSALQEKQQIYSIGPIFPTGFTKSRVATSLWSESDC  275



>ref|XP_008243980.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Prunus mume]
Length=490

 Score =   323 bits (829),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/277 (56%), Positives = 206/277 (74%), Gaps = 9/277 (3%)
 Frame = +1

Query  178  DSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNP-RDDDIF  354
            ++ + PH +L +YPLQGH+IP+VHLA +LA KG TVTF+NT +VH+   KS+   DD+IF
Sbjct  4    NTSKHPHVVLFAYPLQGHVIPAVHLAIKLASKGITVTFVNTEAVHHQTVKSHAMEDDNIF  63

Query  355  SGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGG  534
             G+ + GLDIRYVTI+DG P E+DR++NHDQF  S++H + A V+E L K++ S+     
Sbjct  64   KGVLQSGLDIRYVTINDGFPVEFDRSLNHDQFWESVIHDFPAQVDELLAKLVLSN-----  118

Query  535  PPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGH---FGCIDV  705
            PPVNCLI+DTFF +   +AKKY L+ +SFWTEPALVF LYYHL LL  NGH       + 
Sbjct  119  PPVNCLISDTFFEWTTNIAKKYNLVTVSFWTEPALVFNLYYHLDLLNKNGHGHFTSHANP  178

Query  706  REDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHE  885
            R+D I Y+PGVR+I+ KDL SY+Q  +  +  H+II K+F+  +NADF+LCNTVQELE E
Sbjct  179  RQDTINYIPGVRAIEPKDLSSYLQPNDYTSPIHRIIVKAFEKIKNADFILCNTVQELESE  238

Query  886  TVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDC  996
            T++ALQE+   +++GPIFPP F +S VATSL SESDC
Sbjct  239  TISALQERQQIYSIGPIFPPGFTKSRVATSLWSESDC  275



>ref|XP_004304452.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Fragaria vesca 
subsp. vesca]
Length=490

 Score =   323 bits (829),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/281 (56%), Positives = 208/281 (74%), Gaps = 11/281 (4%)
 Frame = +1

Query  172  MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSN----PR  339
            M ++  KPHA+L SYPLQGH+IP+VHLA +LA  GFTVTF+NT +VH+ + KS     P 
Sbjct  1    MENNHSKPHAVLFSYPLQGHVIPAVHLAIKLASNGFTVTFVNTRAVHHQIIKSQSLDTPS  60

Query  340  DD-DIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTS  516
            +D +IF G+ K  LDIRYVTISDG P  +DR++NHDQF   +LH + AHV+E + +++ S
Sbjct  61   EDVNIFDGVCKSSLDIRYVTISDGFPIGFDRSLNHDQFWEGVLHDFPAHVDELVAELVRS  120

Query  517  SANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGC  696
                  PPV CLIADTFFV+P  +A KY L+ +SFWTEP LV TLYYH++LLR NGHF  
Sbjct  121  D-----PPVTCLIADTFFVWPTMIAAKYNLVNVSFWTEPVLVLTLYYHIYLLRENGHFAS  175

Query  697  I-DVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQE  873
              + R+D I+Y+PGV++I+ KDLMSY+Q T+  +V H+II+K+F++ + ADF+LCNT+QE
Sbjct  176  PGNHRQDTIDYIPGVKAIEPKDLMSYLQATDVTSVVHRIIFKAFEEVKRADFILCNTIQE  235

Query  874  LEHETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDC  996
            LE  T++A QEK   + +GPIFP  F +S VATSL SE DC
Sbjct  236  LESGTISAFQEKQPTYAIGPIFPNGFTKSTVATSLWSEFDC  276



>ref|XP_004983013.1| PREDICTED: UDP-glycosyltransferase 86A1-like isoform X2 [Setaria 
italica]
Length=493

 Score =   322 bits (825),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 152/287 (53%), Positives = 207/287 (72%), Gaps = 15/287 (5%)
 Frame = +1

Query  175   ADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDD---  345
               +G KPHA+++ YPLQGH+IP+VHLA RLAE+GF VTF+NT SVH+  T++        
Sbjct  14    GSAGTKPHAVVVPYPLQGHVIPAVHLALRLAERGFAVTFVNTESVHHQTTRALAVLGGGA  73

Query  346   ---DIFSGIRKPG---LDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKI  507
                DIF+G+R      LD+RY  +SDG P  +DR++NHDQFM  +LH+  AHVEE L+++
Sbjct  74    GGGDIFAGVRASSAEQLDLRYEVVSDGFPLGFDRSLNHDQFMEGVLHVLPAHVEELLRRV  133

Query  508   LTSSANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGH  687
             +        PP  CL+ DTFFV+P  LA+K  + Y+SFWTEPAL+F+LYYH+ LL  +GH
Sbjct  134   VVD------PPSTCLVVDTFFVWPATLARKLGVPYVSFWTEPALIFSLYYHMDLLTKHGH  187

Query  688   FGCIDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTV  867
             F C + R+D I Y+PGV SI+  +LMSY+QET+T +V H+II+K+F +AR AD+VLCNTV
Sbjct  188   FNCKEPRKDTITYIPGVPSIEPTELMSYLQETDTTSVVHRIIFKAFDEARRADYVLCNTV  247

Query  868   QELEHETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             +ELE  T+AAL+ +  F+ VGP+ P  FA+SAVATS+ +ESDC   L
Sbjct  248   EELEPSTIAALRAEKPFYAVGPVLPAGFARSAVATSMWAESDCSRWL  294



>dbj|BAJ89293.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=487

 Score =   322 bits (824),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 152/285 (53%), Positives = 205/285 (72%), Gaps = 11/285 (4%)
 Frame = +1

Query  169   AMADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKS---NPR  339
             A +    KPHA+++ YPLQGH+IP  HLA RLA +GF VT +NT +VH+   ++   +P 
Sbjct  11    ATSGGKAKPHAVVVVYPLQGHVIPVTHLALRLAVRGFAVTVVNTEAVHHQTARALGVDPA  70

Query  340   DDDIFSGIRK--PGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILT  513
               D F G R   P +D+RY  +SDGLP  +DR+++HD+FM SLLH  S HVEE L +++ 
Sbjct  71    GHDFFDGARASAPEMDVRYELVSDGLPVGFDRSLHHDEFMGSLLHALSGHVEELLGRVVV  130

Query  514   SSANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFG  693
                    P   CL+ADTFFV+P  LA+K+ + Y+SFWTEPAL+F LYYH+HLL  NGHFG
Sbjct  131   D------PAATCLVADTFFVWPATLARKFGIAYVSFWTEPALIFNLYYHVHLLTNNGHFG  184

Query  694   CIDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQE  873
             C + R+D I Y+PGV +I+  +LMSY+QET+T +V H+II+K+F +AR AD+VLCNTV+E
Sbjct  185   CNEPRKDTIMYIPGVPAIEPHELMSYLQETDTTSVVHRIIFKAFDEARGADYVLCNTVEE  244

Query  874   LEHETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             LE  T+AAL+ +  F+ VGPIFP  FA+SAVATS+ +ESDC   L
Sbjct  245   LEPSTIAALRAEKPFYAVGPIFPAGFARSAVATSMWAESDCSQWL  289



>dbj|BAJ89423.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=486

 Score =   322 bits (824),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 148/272 (54%), Positives = 200/272 (74%), Gaps = 9/272 (3%)
 Frame = +1

Query  190  KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKS---NPRDDDIFSG  360
            KPHA+++ YPLQGHIIP  HLA RLA +GF VT + T +VH    ++   +P   D F+G
Sbjct  19   KPHAVVVVYPLQGHIIPETHLALRLAARGFAVTVVTTEAVHDQTARALGVDPAGHDAFAG  78

Query  361  IRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPP  540
             R  G+D+RY  +SDGLP  +DR+++HD+F  SLLH  S HVEE L +++        P 
Sbjct  79   ARSAGMDVRYELVSDGLPVGFDRSLHHDEFHESLLHALSGHVEEVLGRVVLD------PA  132

Query  541  VNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAI  720
              CL+ADTFFV+P  LA+K+ + Y+SFWTEPAL+F LYYH+HLL  NGHFGC + R+D I
Sbjct  133  TTCLVADTFFVWPATLARKFGIAYVSFWTEPALIFNLYYHVHLLTQNGHFGCNEPRKDTI  192

Query  721  EYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAAL  900
             Y+PGV +I+  +LMSY+QET+  +V H++I+K+FQ+AR AD+VLCNTV+ELE  T+AAL
Sbjct  193  TYIPGVPAIEPHELMSYLQETDATSVVHRVIFKAFQEARGADYVLCNTVEELEPSTIAAL  252

Query  901  QEKTSFFTVGPIFPPVFAQSAVATSL*SESDC  996
            + +  F+ VGPIFP  FA+SAVATS+ +ESDC
Sbjct  253  RAEKPFYAVGPIFPAGFARSAVATSMWAESDC  284



>ref|XP_009785232.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Nicotiana sylvestris]
 ref|XP_009785233.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Nicotiana sylvestris]
Length=487

 Score =   322 bits (824),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/274 (56%), Positives = 199/274 (73%), Gaps = 8/274 (3%)
 Frame = +1

Query  190  KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKS-----NPRDDDIF  354
            KPHAI+I  PLQGHI+P  HLA  LA KG T+TF+NT S H  L K+     +  D DIF
Sbjct  8    KPHAIMIPAPLQGHIVPFTHLAINLASKGLTITFVNTQSTHQRLMKAQSVSGSSLDYDIF  67

Query  355  SGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGG  534
            +  RK GLDIRY TI DG P  +DRA NH+QFM  LLH++SAHV++ +  ++ S+ N   
Sbjct  68   TEARKSGLDIRYTTICDGFPLNFDRARNHNQFMEGLLHVFSAHVDDLVGNLVDSNHN---  124

Query  535  PPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVRED  714
            PPV+CLIAD+F+V+P ++AKKY L+ ISFWTEPAL FT YYH+ LLR NGHFG  D RED
Sbjct  125  PPVSCLIADSFYVWPSEIAKKYNLVNISFWTEPALAFTSYYHMDLLRSNGHFGSQDNRED  184

Query  715  AIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVA  894
             I Y+PGV++I+ +DL SYIQ+ E  ++ H+ I+KS +DA+ AD ++CNTVQELE  T++
Sbjct  185  MIHYIPGVQAIEPRDLPSYIQDPEPWSIMHRYIFKSLEDAKKADMIICNTVQELESSTIS  244

Query  895  ALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDC  996
            ALQEK  F+ +GPIFP  F +S   T+L  ESDC
Sbjct  245  ALQEKKPFYAIGPIFPNGFTKSVAPTNLWVESDC  278



>emb|CDP18343.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   321 bits (823),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/281 (54%), Positives = 202/281 (72%), Gaps = 5/281 (2%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTK--SNPRDD  345
             MA + +KPHAI+I YP QGHI P VHLA +LA KGF +TF+NT SV + ++K  +  R D
Sbjct  1     MAGTYRKPHAIMIPYPYQGHINPFVHLAIKLASKGFIITFVNTQSVQHQISKAQTGSRRD  60

Query  346   DIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSAN  525
             DIF+  R+ GLDIRY T+SDG P  +DR++N DQF+  L+H++SAH++E +  ++ S   
Sbjct  61    DIFAKARQSGLDIRYATVSDGFPLSFDRSLNEDQFVEGLIHVFSAHIDELVGNLVNSETE  120

Query  526   SGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDV  705
                PP  CLI+DTFFV+   +A+K+ L+++SFWTEPALV TLYYHL LLR NGHF     
Sbjct  121   ---PPATCLISDTFFVWGSVIARKHNLVHVSFWTEPALVLTLYYHLDLLRQNGHFASPVN  177

Query  706   REDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHE  885
             R D I+Y+PGV++I+  DLMSY+Q T+  T  HQ+IYK+F D + AD ++CNTVQELE E
Sbjct  178   RRDNIDYIPGVKAIEPGDLMSYLQATDIWTAVHQVIYKAFDDVKRADIIICNTVQELEPE  237

Query  886   TVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             T++AL  K   + +GP+FP  F +S VATSL SESDC   L
Sbjct  238   TISALNRKQPTYAIGPVFPAGFTKSNVATSLWSESDCTQWL  278



>ref|XP_009610181.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Nicotiana tomentosiformis]
Length=498

 Score =   320 bits (821),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 149/285 (52%), Positives = 205/285 (72%), Gaps = 11/285 (4%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD---  342
             MA   QKPHAI+I YP QGHI P V+LA +LA  GFT+TF+NTH +H  ++ S  +    
Sbjct  1     MASHYQKPHAIMIPYPYQGHITPFVYLAIKLASHGFTITFVNTHYIHSKISNSQTQQNYQ  60

Query  343   ---DDIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILT  513
                DD+F+  R+ GLDIRY T++DG P  +DR++NHDQF+  LLH++SAH +E +  ++ 
Sbjct  61    HNKDDLFAKARENGLDIRYATVNDGFPLGFDRSLNHDQFVEGLLHVFSAHFDEVVGNLVK  120

Query  514   SSANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFG  693
             S      PPV CLIADTF+V+P  +A+KY L+Y+SFWTEPALV TLYYH+ LL+ NGHF 
Sbjct  121   SD-----PPVTCLIADTFYVWPLMIAEKYNLVYVSFWTEPALVLTLYYHMELLKKNGHFA  175

Query  694   CIDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQE  873
             C D R+D+I+Y+PGV +I+ +DLMSY+Q T+  TV H++IYK+F D + AD ++CNTVQE
Sbjct  176   CQDNRKDSIDYIPGVEAIEPRDLMSYLQATDIWTVVHRVIYKAFTDIKKADMIICNTVQE  235

Query  874   LEHETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             LE +T++AL +K   + +GPIFP    ++  + SL SESDC   L
Sbjct  236   LEFDTLSALNKKQPTYAIGPIFPSGLTKAPFSISLWSESDCSQWL  280



>ref|XP_007205115.1| hypothetical protein PRUPE_ppa004816mg [Prunus persica]
 gb|EMJ06314.1| hypothetical protein PRUPE_ppa004816mg [Prunus persica]
Length=490

 Score =   319 bits (817),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/277 (56%), Positives = 205/277 (74%), Gaps = 9/277 (3%)
 Frame = +1

Query  178  DSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNP-RDDDIF  354
            ++ + PH +L +YPLQGH+IP+VHLA +LA KG TVTF+NT +VH+   KS+   DD+IF
Sbjct  4    NTSKHPHVVLFAYPLQGHVIPAVHLAIKLASKGITVTFVNTEAVHHQTVKSHAMEDDNIF  63

Query  355  SGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGG  534
             G+ + GLDIRYVTI+DG P E+DR++NHDQF  S++H + A V+E L K++ S+     
Sbjct  64   KGVLQSGLDIRYVTINDGFPVEFDRSLNHDQFWESVIHDFPAQVDELLAKLVLSN-----  118

Query  535  PPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGH---FGCIDV  705
            PPVNCLI+DTFF +   +AKKY L+ +SFWTEPALVF LYYHL LL  NGH       + 
Sbjct  119  PPVNCLISDTFFEWTTNIAKKYNLVTVSFWTEPALVFNLYYHLDLLNKNGHGHFTSHANP  178

Query  706  REDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHE  885
            R+D I Y+PGVR+I+ KDL SY+Q ++  +  H+II K+F+  + ADF+LCNTVQELE E
Sbjct  179  RQDTINYIPGVRAIEPKDLSSYLQPSDYTSPIHRIIVKAFEKIKTADFILCNTVQELESE  238

Query  886  TVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDC  996
            T++ALQEK   +++GPIFP  F +S VATSL SESDC
Sbjct  239  TISALQEKQQIYSIGPIFPTGFTKSRVATSLWSESDC  275



>ref|XP_004246641.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Solanum lycopersicum]
Length=500

 Score =   319 bits (818),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/287 (52%), Positives = 206/287 (72%), Gaps = 13/287 (5%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD---  342
             MA+  QKPHAI+I YP QGHI P V+LA +LA  GFT+TF+NTH +H  ++ S  R+   
Sbjct  1     MANHHQKPHAIMIPYPYQGHITPFVYLAIKLASHGFTITFVNTHYIHSKISNSQSRENSQ  60

Query  343   ----DDIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKIL  510
                 DD+F+  R+ GLDIRY T++DG P  +DR++NHDQF+  LLH++SAH +E +  ++
Sbjct  61    IKNKDDLFARARESGLDIRYATVNDGFPLGFDRSLNHDQFVEGLLHVFSAHFDELVGDLV  120

Query  511   TSSANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHF  690
              S      PPV CLIADTF+V+P  +A+KY L+Y+SFWTEPALVF LYYH+ LL+ NGHF
Sbjct  121   KSD-----PPVTCLIADTFYVWPAMIAEKYNLVYVSFWTEPALVFNLYYHMELLKKNGHF  175

Query  691   GCIDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQ  870
                D R+D I+Y+PGV++I+ +DLMSY+Q TE  TV H++IYK+F D + AD ++CNTVQ
Sbjct  176   ASQDNRKDTIDYIPGVKAIEPRDLMSYLQATEIWTVVHRVIYKAFTDIKKADIIICNTVQ  235

Query  871   ELEHETVAALQEKTSFFTVGPIFPP-VFAQSAVATSL*SESDCEPLL  1008
             ELE +T++AL +    + +GPIFP   F ++  + SL SESDC   L
Sbjct  236   ELEFDTLSALNKNQPTYAIGPIFPSGNFTKAPFSISLWSESDCSQWL  282



>ref|XP_003573976.1| PREDICTED: UDP-glycosyltransferase 86A1 isoform X1 [Brachypodium 
distachyon]
Length=488

 Score =   318 bits (814),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/275 (54%), Positives = 205/275 (75%), Gaps = 12/275 (4%)
 Frame = +1

Query  190  KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKS---NPRDDDIFSG  360
            KPHA+++ YPLQGHIIP  HLA RLA +GF VTF+NT +VH    ++   +P   D+F+G
Sbjct  18   KPHAVVVVYPLQGHIIPVTHLALRLASRGFAVTFVNTEAVHDQTARALGVDPAGYDVFAG  77

Query  361  IR---KPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSG  531
             R      +D+RY  +SDGLP  +DR+++HD+FM +L    S HVE  L++++   A++ 
Sbjct  78   ARGEWSSEMDVRYELVSDGLPVGFDRSLHHDEFMEALFSALSGHVEALLRRVVVDPAST-  136

Query  532  GPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVRE  711
                 CL+ADTFFV+P  LA+K+ + Y+SFWTEPAL+F LYYH+HLL  NGHFGC + R+
Sbjct  137  -----CLVADTFFVWPATLARKFGIAYVSFWTEPALIFNLYYHVHLLTNNGHFGCDEPRK  191

Query  712  DAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETV  891
            D I Y+PGV +I+ ++LMSY+QET+T TV H+II+K+F++AR AD+VLCNTV+ELE  T+
Sbjct  192  DTITYIPGVPAIEPRELMSYLQETDTTTVVHRIIFKAFEEARGADYVLCNTVEELEPSTI  251

Query  892  AALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDC  996
            AAL+ +  F+ VGPIFP  FA+SAVATS+ +ESDC
Sbjct  252  AALRAEKPFYAVGPIFPAGFARSAVATSMWAESDC  286



>ref|XP_009401822.1| PREDICTED: UDP-glycosyltransferase 86A1 [Musa acuminata subsp. 
malaccensis]
Length=508

 Score =   318 bits (814),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 163/311 (52%), Positives = 210/311 (68%), Gaps = 36/311 (12%)
 Frame = +1

Query  172   MADSGQKP-HAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDD-  345
             MA S +KP HA+L+ YPLQGHIIP+VHLA +LA +GF +TF+NT +VH+    +  R   
Sbjct  1     MAASHRKPPHALLVPYPLQGHIIPAVHLAIKLASRGFAITFVNTEAVHHQTCCAARRSGS  60

Query  346   ----DIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILT  513
                 DIF   R  GLDIRY  +SDGLP  +DR++NHDQFM ++LH+ SAHVEE ++K+  
Sbjct  61    DLGHDIFPAARASGLDIRYELVSDGLPVAFDRSLNHDQFMFAVLHVLSAHVEELIRKL--  118

Query  514   SSANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFG  693
               +    PP+ CLIADTFFV+P  LAKK+ + Y+SFWTEPAL+F+LYYH+ LL  NGHF 
Sbjct  119   --SLRADPPLTCLIADTFFVWPSTLAKKFGIPYVSFWTEPALIFSLYYHMDLLIRNGHFA  176

Query  694   --------------------------CIDVREDAIEYVPGVRSIDVKDLMSYIQETETET  795
                                        +D  +D I YVPGV +I+  DLMSY+QET+  T
Sbjct  177   SHGDRHISIPTRLLFLFFPHDSFMCLVVDNSKDTITYVPGVAAIEPADLMSYLQETDVST  236

Query  796   VCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQEKTSFFTVGPIFPPVFAQSAVATS  975
             V HQII+K+F +A+ ADFVLCNTVQELE +T++ALQ +  F+ VGPIFP  F +SAVATS
Sbjct  237   VVHQIIFKAFDEAKAADFVLCNTVQELESDTISALQREKPFYAVGPIFPAGFTRSAVATS  296

Query  976   L*SESDCEPLL  1008
             L +ESDC   L
Sbjct  297   LWAESDCSQWL  307



>ref|XP_009802698.1| PREDICTED: UDP-glycosyltransferase 86A1 [Nicotiana sylvestris]
Length=496

 Score =   317 bits (812),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 149/283 (53%), Positives = 203/283 (72%), Gaps = 9/283 (3%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPR----  339
             MA   QKPHAILI YP QGHI P V+LA +LA  GFT+TF+NTH +H  ++ S  +    
Sbjct  1     MASHYQKPHAILIPYPYQGHITPFVYLAIKLASHGFTITFVNTHYIHSKISNSQTQRHSN  60

Query  340   DDDIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSS  519
              DD+F+  R+ GLDIRY T++DG P  +DR++NHDQF+  LLH++SAH +E +  ++ S 
Sbjct  61    KDDLFAKARENGLDIRYATVNDGFPLGFDRSLNHDQFVEGLLHVFSAHFDEVVGNLVKSD  120

Query  520   ANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCI  699
                  PPV CLIADTF+V+P  +A+KY L+Y+SFWTEPALV TLYYH+ LL+ NGHF   
Sbjct  121   -----PPVTCLIADTFYVWPLMIAEKYNLVYVSFWTEPALVLTLYYHMELLKKNGHFASQ  175

Query  700   DVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELE  879
             D R+D I+Y+PGV +I+ +DLMSY+Q T+  TV H++IYK+F D + AD ++CNTVQELE
Sbjct  176   DNRKDTIDYIPGVEAIEPRDLMSYLQATDIWTVVHRVIYKAFTDIKKADIIICNTVQELE  235

Query  880   HETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
              +T++AL +K   + +GPIFP    ++  + SL SESDC   L
Sbjct  236   FDTLSALNKKQPTYAIGPIFPSGLTKAPFSISLWSESDCSQWL  278



>ref|XP_006354353.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Solanum tuberosum]
Length=500

 Score =   317 bits (812),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 149/287 (52%), Positives = 205/287 (71%), Gaps = 13/287 (5%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD---  342
             MA+  QKPHAI+I YP QGHI P V+LA +LA  GFT+TF+NTH +H  ++ S  R+   
Sbjct  1     MANHHQKPHAIMIPYPYQGHITPFVYLAIKLASHGFTITFVNTHYIHSKISNSQSRENSQ  60

Query  343   ----DDIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKIL  510
                 DD+F+  R+ GLDIRY T++DG P  +DR++NHDQF+  LLH++SAH +E +  ++
Sbjct  61    IKNKDDLFARARESGLDIRYATVNDGFPLGFDRSLNHDQFVEGLLHVFSAHFDELVGDLV  120

Query  511   TSSANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHF  690
              S      PPV CLIADTF+V+P  +A KY L+Y+SFWTEPALVF LYYH+ LL+ NGHF
Sbjct  121   KSD-----PPVTCLIADTFYVWPAMIADKYNLVYVSFWTEPALVFNLYYHMELLKKNGHF  175

Query  691   GCIDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQ  870
                D R+D I+Y+PGV++I+ +DLMSY+Q T+  TV H++IYK+F D + AD ++CNTVQ
Sbjct  176   ASQDNRKDTIDYIPGVKAIEPRDLMSYLQATDIWTVVHRVIYKAFTDIKKADIIICNTVQ  235

Query  871   ELEHETVAALQEKTSFFTVGPIFPP-VFAQSAVATSL*SESDCEPLL  1008
             ELE +T++AL +    + +GPIFP   F ++  + SL SESDC   L
Sbjct  236   ELEFDTLSALNKNQPTYAIGPIFPSGNFTKAPFSISLWSESDCSQWL  282



>gb|EYU38553.1| hypothetical protein MIMGU_mgv1a005283mg [Erythranthe guttata]
Length=490

 Score =   316 bits (810),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/279 (54%), Positives = 203/279 (73%), Gaps = 11/279 (4%)
 Frame = +1

Query  190   KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPR----DDDIFS  357
             KPHAIL  YPLQGH+IP V+LA +LA  GF +TFINT S+H+ +TK+        DDIF+
Sbjct  11    KPHAILFPYPLQGHVIPFVNLAVKLASNGFKITFINTESIHHQITKAKDGPALGQDDIFA  70

Query  358   GIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGP  537
               RK GL+I+Y T+SDG P  +DR++NHDQF   +LH++ AHV+E + K++ +      P
Sbjct  71    QARKSGLEIQYATVSDGFPLGFDRSMNHDQFFEGILHVFPAHVDELVGKLVEAD-----P  125

Query  538   PVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDA  717
              +N LI DTF+V+P  +A+KY L+ ISF+TEPALVFTLYYHL LLR NGHF   + R DA
Sbjct  126   TINALIVDTFYVWPSFIAEKYNLVNISFFTEPALVFTLYYHLELLRKNGHFASKENRRDA  185

Query  718   IEYVPGVRSIDVKDLMSYIQETE--TETVCHQIIYKSFQDARNADFVLCNTVQELEHETV  891
             I+Y+PGV+SI   DLMSY+Q  E  + T  H IIYK+F D + +DF++CNT+QELE ET+
Sbjct  186   IDYIPGVKSIMPTDLMSYLQANEDASTTTVHGIIYKAFVDVKKSDFIICNTIQELEEETI  245

Query  892   AALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             +AL  +  F+++GPIFPP FA+S ++TSL SESDC   L
Sbjct  246   SALNREQPFYSIGPIFPPGFAKSCISTSLWSESDCNQWL  284



>ref|XP_006662391.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Oryza brachyantha]
Length=476

 Score =   315 bits (808),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/273 (52%), Positives = 199/273 (73%), Gaps = 6/273 (2%)
 Frame = +1

Query  190   KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIRK  369
             +PHA+++ YPLQGH+IP+VHLA RLA +GF VTF+NT SVH  +       DDIF+G   
Sbjct  15    RPHAVVVPYPLQGHVIPAVHLALRLAARGFAVTFVNTESVHQQIASGGGGGDDIFAGA--  72

Query  370   PGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPVNC  549
                 +RY  + DG P  +DR++NHDQ+M  +LH+  AHV+E L++++    ++      C
Sbjct  73    -AAGVRYELVGDGFPLGFDRSLNHDQYMEGVLHVLPAHVDELLRRLI---GDADAAAATC  128

Query  550   LIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIEYV  729
             L+ DTFFV+P   A+K+ + Y+SFWTEPAL+FTLYYH+ LL  NGHF C + R+D I YV
Sbjct  129   LVVDTFFVWPATFARKFGVPYVSFWTEPALIFTLYYHMDLLTKNGHFNCKEPRKDTITYV  188

Query  730   PGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQEK  909
             PGV +I+ ++LMSY+QET+T TV H+II+K+F++AR AD+V+CNTV+ELE  T+AAL+ +
Sbjct  189   PGVAAIEPRELMSYLQETDTTTVVHRIIFKAFEEARAADYVVCNTVEELEPSTIAALRAE  248

Query  910   TSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
               F+ VGPI P  FA+SAVATS+ +ESDC   L
Sbjct  249   KPFYAVGPILPAGFARSAVATSMWAESDCSQWL  281



>ref|XP_009413144.1| PREDICTED: UDP-glycosyltransferase 86A1 [Musa acuminata subsp. 
malaccensis]
Length=484

 Score =   315 bits (807),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/275 (55%), Positives = 205/275 (75%), Gaps = 5/275 (2%)
 Frame = +1

Query  187   QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKS-NPRDDDIFSGI  363
             + PHA+L+ YPLQGHIIP+VHLA +LA +GFT+TF+ T ++H+  +++ +  D DIF+  
Sbjct  7     KPPHALLVPYPLQGHIIPAVHLATKLASRGFTITFVYTEAIHHQTSRAASGVDRDIFAAA  66

Query  364   RKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPV  543
             R  GLD+R   ++DGLP  +DR++NHD+FM SLLH+  AHVEE ++K+    +    PP+
Sbjct  67    RARGLDVRCELVNDGLPVAFDRSLNHDRFMGSLLHVLPAHVEELMRKL----SLYADPPI  122

Query  544   NCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIE  723
               LIADTFFV+P  LAKK+ L Y+SFWTEPALVFTLYYHL LL  +GHF   D  +D I 
Sbjct  123   TYLIADTFFVWPSTLAKKFGLPYVSFWTEPALVFTLYYHLDLLIKHGHFASHDNSKDTIT  182

Query  724   YVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQ  903
             YVPGV +I+  DLMSY+QE +  +V HQII+++F++A+ AD VLCNT+QELE ET++ALQ
Sbjct  183   YVPGVAAIEPADLMSYLQERDVSSVVHQIIFRAFEEAKGADLVLCNTLQELEPETISALQ  242

Query  904   EKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
              +  F+ +GPIFP  F +SAVATSL +ESDC   L
Sbjct  243   LEKPFYAIGPIFPAGFTKSAVATSLWAESDCSRWL  277



>ref|XP_009616388.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Nicotiana tomentosiformis]
Length=491

 Score =   313 bits (803),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/284 (51%), Positives = 209/284 (74%), Gaps = 10/284 (4%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD---  342
             M    QKPHAIL  YPLQGH+IP V+LA +LA  GFT+TF+NT SVHY ++K+   +   
Sbjct  1     MNQIDQKPHAILFPYPLQGHVIPFVNLAIKLASNGFTITFVNTQSVHYQISKARLENGVE  60

Query  343   -DDIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSS  519
              DD+FS  RK GLDIR VTI DG P ++DR++NHD++  ++L+ + +HV+E ++ ++ S+
Sbjct  61    GDDLFSSARKLGLDIRDVTIYDGFPIDFDRSLNHDKYFEAILNDFGSHVDELVENLVLSN  120

Query  520   ANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCI  699
                  PP N L+ADTF+++P  +AKKY L+ +S+WTEPALV ++YYHL LLR NGH+ CI
Sbjct  121   -----PPPNILVADTFYIWPSTIAKKYNLVNVSYWTEPALVLSVYYHLDLLRQNGHYDCI  175

Query  700   DVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKS-FQDARNADFVLCNTVQEL  876
             D R+D I+Y+PGV++I   DL SY+Q  +T+ V ++II+++ F D + A++++CNTVQ+L
Sbjct  176   DKRQDVIDYIPGVKAIKPTDLASYLQSNDTKMVANRIIHRAIFTDVKKAEYIICNTVQQL  235

Query  877   EHETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             E ET+AALQEK   + +GP+F P F +S+V TSL SESDC   L
Sbjct  236   ESETIAALQEKQPVYAIGPLFSPGFTKSSVKTSLWSESDCTNWL  279



>ref|XP_002464565.1| hypothetical protein SORBIDRAFT_01g020920 [Sorghum bicolor]
 gb|EER91563.1| hypothetical protein SORBIDRAFT_01g020920 [Sorghum bicolor]
Length=490

 Score =   311 bits (796),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/282 (54%), Positives = 203/282 (72%), Gaps = 19/282 (7%)
 Frame = +1

Query  190   KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIRK  369
             +PHA+++ YPLQGH+IP+VHLA RLAE+GF VTF+NT SVH+ +        DIF+ +R 
Sbjct  20    RPHAVVMPYPLQGHVIPAVHLALRLAERGFAVTFVNTESVHHQIGAGG----DIFAAVRA  75

Query  370   PG---------LDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSA  522
              G         LD+RY  +SDG P  +DR++NHDQFM  +LH+  AHVEE L++++    
Sbjct  76    GGGGATTTTTELDVRYELVSDGFPLGFDRSLNHDQFMEGILHVLPAHVEELLRRVVVD--  133

Query  523   NSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCID  702
                 PP  CL+ DTFFV+P  LA+K  + Y+SFWTEPAL+F LYYH+ LL  +GHF C +
Sbjct  134   ----PPTTCLVIDTFFVWPATLARKLGVPYVSFWTEPALIFNLYYHMDLLTKHGHFKCKE  189

Query  703   VREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEH  882
              R+D I Y+PGV SI+  +LMSY+QET+T +V H+II+K+F +AR+AD+VLCNTV+ELE 
Sbjct  190   PRKDTITYIPGVASIEPSELMSYLQETDTTSVVHRIIFKAFDEARDADYVLCNTVEELEP  249

Query  883   ETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
              T+AAL+    F+ VGPIFP  FA+SAVATS+ +ESDC   L
Sbjct  250   STIAALRADRPFYAVGPIFPAGFARSAVATSMWAESDCSRWL  291



>ref|XP_011077327.1| PREDICTED: UDP-glycosyltransferase 86A1 [Sesamum indicum]
Length=477

 Score =   310 bits (795),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/277 (52%), Positives = 201/277 (73%), Gaps = 8/277 (3%)
 Frame = +1

Query  187   QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSN--PRDDDIFSG  360
             QKPHAI+  YPLQGH+IP  +LA +LA  GFT+TFINT S+H+ ++K+   P D D+FS 
Sbjct  7     QKPHAIMFPYPLQGHVIPFTNLAIKLASNGFTITFINTESIHHQISKAKGRPVDHDLFSE  66

Query  361   IRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPP  540
              RK GLDIRY T+ DG P  +DR++NHD+F   +LH++SAHV+E ++ ++   +      
Sbjct  67    ARKSGLDIRYATVPDGFPVGFDRSLNHDEFFEGILHVFSAHVDEIVRNLVREDST-----  121

Query  541   VNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAI  720
             +N +I DTF+V+   +A KY L+ ISF+TEPALV TLYYH+ LLR NGHF   + R DAI
Sbjct  122   INSIIVDTFYVWGSVIADKYDLVNISFFTEPALVLTLYYHVDLLRKNGHFASSENRTDAI  181

Query  721   EYVPGVRSIDVKDLMSYIQET-ETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAA  897
             +Y+PGV+SI  +DLMSY Q+  +  T+ HQIIYK F+D + ADF++CNT+QE E +T++A
Sbjct  182   DYIPGVKSIMPRDLMSYFQDKDDISTIAHQIIYKCFEDVKKADFIICNTIQEFEEDTISA  241

Query  898   LQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             LQ+   F+++GPIF P F +S ++TSL SESDC   L
Sbjct  242   LQQYQPFYSIGPIFAPGFTKSCISTSLWSESDCTQWL  278



>gb|AFJ53013.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=487

 Score =   310 bits (794),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 147/283 (52%), Positives = 206/283 (73%), Gaps = 6/283 (2%)
 Frame = +1

Query  169   AMADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPR-DD  345
             A  +  +KPHAI+I +PLQGH+IP V LA +LA +GFT+TF+NT  +H+  + S    D+
Sbjct  8     AGGNHHRKPHAIVIPFPLQGHVIPPVPLAVKLAPQGFTITFVNTEYIHHKTSSSAGGCDE  67

Query  346   DIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSAN  525
             D F+G+RK GLDIRY TISDGLP  +DR++NHDQFMAS+ H++ AHVEE +  ++ +   
Sbjct  68    DFFAGVRKSGLDIRYKTISDGLPLRFDRSLNHDQFMASMSHVFPAHVEELVAGMVAAGEE  127

Query  526   SGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDV  705
                  V+CLI DTFF +P K+ KK+ L+++S WT+PALVFTLY+H+HLLR NGH+GC D 
Sbjct  128   E---KVSCLITDTFFAWPSKVVKKFGLVFVSIWTQPALVFTLYHHVHLLRQNGHYGCQDR  184

Query  706   REDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHE  885
             RED+I+Y+PGV+ I+ KDL S +QE +  ++  Q  +   QD ++ADF+L NTVQELEH+
Sbjct  185   REDSIDYIPGVKKIEPKDLPSILQEIDETSLFIQATFHVLQDVKSADFILANTVQELEHD  244

Query  886   TVAALQE--KTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             T+++L++     F+ +GP+FPP F  S V+TSL  ESDC   L
Sbjct  245   TISSLKQAYNDQFYAIGPVFPPGFTISPVSTSLWPESDCTQWL  287



>ref|NP_001169578.1| uncharacterized protein LOC100383459 [Zea mays]
 gb|ACN34169.1| unknown [Zea mays]
Length=481

 Score =   310 bits (793),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 148/274 (54%), Positives = 197/274 (72%), Gaps = 16/274 (6%)
 Frame = +1

Query  193  PHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIRKP  372
            PHA+++ YPLQGH+IP+VHLA RLAE+GF VTFINT SVH+ +        DIF+G+R  
Sbjct  21   PHAVVMPYPLQGHVIPAVHLALRLAERGFAVTFINTESVHHQIGAGG----DIFAGVRAR  76

Query  373  G-------LDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSG  531
            G       LD+RY  +SDG P  +DR++NHDQFM  +LH+  AHVE+ L++ +       
Sbjct  77   GGGTTTEELDVRYELVSDGFPLGFDRSLNHDQFMEGVLHVLPAHVEDLLRRRVVVD----  132

Query  532  GPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVRE  711
             P   CL+ DTFFV+P  LA+K  + Y+SFWTEPAL+F LYYH+ LL  +GHF C D R+
Sbjct  133  -PATTCLVVDTFFVWPATLARKLGVPYVSFWTEPALIFNLYYHMDLLTKHGHFKCKDPRK  191

Query  712  DAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETV  891
            D I Y+PGV SI+  +LMSY+Q+T+T +V H+II+++F +AR AD+VLCNTV+ELE  T+
Sbjct  192  DTITYIPGVASIEPSELMSYLQDTDTTSVVHRIIFRAFDEARRADYVLCNTVEELEPSTI  251

Query  892  AALQEKTSFFTVGPIFPPVFAQSAVATSL*SESD  993
            AAL+    F+ VGPIFP  FA+SAVATS+  ESD
Sbjct  252  AALRADRPFYAVGPIFPAGFARSAVATSMWPESD  285



>dbj|BAG80551.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=482

 Score =   309 bits (792),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 149/273 (55%), Positives = 195/273 (71%), Gaps = 8/273 (3%)
 Frame = +1

Query  190  KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDD-----DIF  354
            K HAI+I  PLQGHI+P ++LA +LA KG T+TF+NT   H  L K+    D     DIF
Sbjct  8    KLHAIMIPAPLQGHIVPFINLAIKLASKGLTITFVNTQFTHQRLMKAQSISDSSLDYDIF  67

Query  355  SGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGG  534
            S  R  GLD+RY TISDG P  + RA NHDQFM  L H++SAHV++ +  ++ S+ N   
Sbjct  68   SEARNSGLDVRYTTISDGFPLNFYRAGNHDQFMEGLFHVFSAHVDDLVGNLVNSNHN---  124

Query  535  PPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVRED  714
            PPV+CLIAD+F+V+P ++AKKY L+ IS WTEPAL FT YYH+ LLR+NGHFG  D RED
Sbjct  125  PPVSCLIADSFYVWPSEIAKKYNLVNISVWTEPALAFTSYYHMDLLRINGHFGSQDNRED  184

Query  715  AIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVA  894
             I Y+PGV +I+  DL SYIQ+ E   + H+ ++KS +DAR AD ++CNTVQELE  T++
Sbjct  185  TIHYIPGVEAIEPGDLPSYIQDPEPWGIMHRYMFKSLEDARKADIIICNTVQELESSTIS  244

Query  895  ALQEKTSFFTVGPIFPPVFAQSAVATSL*SESD  993
            ALQEKT F+ +GPIFP  F +S + T+L +ESD
Sbjct  245  ALQEKTPFYALGPIFPNGFTKSTIPTNLWTESD  277



>ref|XP_008645070.1| PREDICTED: uncharacterized protein LOC100383459 isoform X1 [Zea 
mays]
 tpg|DAA49848.1| TPA: hypothetical protein ZEAMMB73_668920 [Zea mays]
Length=492

 Score =   309 bits (792),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/274 (54%), Positives = 197/274 (72%), Gaps = 16/274 (6%)
 Frame = +1

Query  193  PHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIRKP  372
            PHA+++ YPLQGH+IP+VHLA RLAE+GF VTFINT SVH+ +        DIF+G+R  
Sbjct  21   PHAVVMPYPLQGHVIPAVHLALRLAERGFAVTFINTESVHHQIGAGG----DIFAGVRAR  76

Query  373  G-------LDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSG  531
            G       LD+RY  +SDG P  +DR++NHDQFM  +LH+  AHVE+ L++ +       
Sbjct  77   GGGTTTEELDVRYELVSDGFPLGFDRSLNHDQFMEGVLHVLPAHVEDLLRRRVVVD----  132

Query  532  GPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVRE  711
             P   CL+ DTFFV+P  LA+K  + Y+SFWTEPAL+F LYYH+ LL  +GHF C D R+
Sbjct  133  -PATTCLVVDTFFVWPATLARKLGVPYVSFWTEPALIFNLYYHMDLLTKHGHFKCKDPRK  191

Query  712  DAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETV  891
            D I Y+PGV SI+  +LMSY+Q+T+T +V H+II+++F +AR AD+VLCNTV+ELE  T+
Sbjct  192  DTITYIPGVASIEPSELMSYLQDTDTTSVVHRIIFRAFDEARRADYVLCNTVEELEPSTI  251

Query  892  AALQEKTSFFTVGPIFPPVFAQSAVATSL*SESD  993
            AAL+    F+ VGPIFP  FA+SAVATS+  ESD
Sbjct  252  AALRADRPFYAVGPIFPAGFARSAVATSMWPESD  285



>gb|AFJ53014.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=492

 Score =   309 bits (792),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 143/282 (51%), Positives = 204/282 (72%), Gaps = 3/282 (1%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNP-RDDD  348
             + D   KPHAI++ +PLQGH+IP+V+LA +LA +GFT+T++NTH +H+  + S     DD
Sbjct  15    LQDHTPKPHAIVVPFPLQGHVIPAVYLAIKLASQGFTITYVNTHYIHHKTSSSAAATGDD  74

Query  349   IFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANS  528
              F+G+R+ GLDIRY TISDG P  +DR++NHD+F+AS++H++ A+VEE +  ++ +    
Sbjct  75    FFAGVRESGLDIRYKTISDGKPLGFDRSLNHDEFLASIMHVFPANVEELVAGMVAAGEKE  134

Query  529   GGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVR  708
                 V+CL+ADTFFV+P K+AKK+ L+Y+S WT+PALVFTLY+H+HLLR NGHFGC D R
Sbjct  135   EEGKVSCLVADTFFVWPSKVAKKFGLVYVSVWTQPALVFTLYHHVHLLRQNGHFGCRDRR  194

Query  709   EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHET  888
             +D I+YVPGV+ I+ KD  S +QE +  T+ HQ    +F D R+ADFVL NT+QELE +T
Sbjct  195   KDTIDYVPGVKRIEPKDTPSPLQEDDETTIVHQTTLGAFHDVRSADFVLINTIQELEQDT  254

Query  889   VAALQ--EKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             ++ L+   +   + +GPIFP  F    ++ SL SESDC   L
Sbjct  255   ISGLEHVHEAQVYAIGPIFPRGFTTKPISMSLWSESDCTQWL  296



>gb|AFJ53015.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=494

 Score =   309 bits (791),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 152/297 (51%), Positives = 215/297 (72%), Gaps = 11/297 (4%)
 Frame = +1

Query  187   QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD---DDIFS  357
             +KPHAI+I +PLQGH+IP+VHLA +LA +GFT+TFINTH +H+ +T S+      DD F+
Sbjct  13    RKPHAIVIPFPLQGHVIPAVHLAIKLASEGFTITFINTHYIHHKITSSSAAGGAGDDFFA  72

Query  358   GIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGP  537
             G+R+ GLDIRY T+SDG P  +DR++NH++FMAS++ +   HVEE L   + ++      
Sbjct  73    GVRETGLDIRYKTVSDGKPLGFDRSLNHNEFMASVMQVLPVHVEE-LVAGMVAAGEEEEE  131

Query  538   PVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDA  717
              V+CL+ADTFFV+  K+AKK+ L+Y+S WTEPALVFTLY+H+HLLR NGHFGC   R+D 
Sbjct  132   KVSCLVADTFFVWSSKVAKKFGLVYVSVWTEPALVFTLYHHVHLLRQNGHFGCQGRRDDP  191

Query  718   IEYVPGVRSIDVKDLMSYIQETETETVC-HQIIYKSFQDARNADFVLCNTVQELEHETVA  894
             I+Y+PGV+ I+ KD  S +Q  + ETV  HQ+++ + QDA++ADF+L NT+QELE +T+A
Sbjct  192   IDYIPGVKIIEPKDTPSSLQGDDDETVIDHQVVFGAIQDAKSADFILANTIQELEQDTLA  251

Query  895   ALQ--EKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL----ILPLLHCSYRWFA  1047
              L+   +   + +GPIFP  F +S V+TSL SESDC   L    +  +L+ S+  FA
Sbjct  252   GLKLAHEAQVYAIGPIFPTEFTKSLVSTSLWSESDCTRWLNSKPLGSVLYVSFGTFA  308



>dbj|BAF75888.1| glucosyltransferase [Dianthus caryophyllus]
Length=476

 Score =   308 bits (788),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/277 (54%), Positives = 204/277 (74%), Gaps = 8/277 (3%)
 Frame = +1

Query  190   KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPR-DDDIFSGIR  366
             KPHAILI YPLQGH+IP+VHLA +LA  GFT+TFINT  +H+ +TKSNP    DIFS  R
Sbjct  10    KPHAILIPYPLQGHVIPAVHLATKLASNGFTITFINTEFIHHEITKSNPNHQTDIFSETR  69

Query  367   KPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPVN  546
             + GLDIRY T+SDG P  +DR++NHDQFM  +LH+ SAHV+E + K+++SS     P ++
Sbjct  70    ESGLDIRYATVSDGFPVGFDRSLNHDQFMEGVLHVLSAHVDELVGKLVSSSE----PKIS  125

Query  547   CLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIEY  726
              +IADTFFV+   +A KYKL+ +SFWTEPALV  +YYHL LL  +GHFG  + R+DAI+Y
Sbjct  126   IMIADTFFVWTSVIANKYKLVNVSFWTEPALVLNIYYHLELLVSHGHFGSQENRKDAIDY  185

Query  727   VPGVRSIDVKDLMSYIQET--ETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAAL  900
             +PG+ +I   DLMSY+Q T  +T TV H+IIYK+F+D ++AD++L N+VQELE+ET++ L
Sbjct  186   IPGISTIIPDDLMSYLQPTIEDTSTVLHRIIYKAFKDVKHADYILINSVQELENETISTL  245

Query  901   QEKTSFFTVGPIFPPVFAQSA-VATSL*SESDCEPLL  1008
               K   F +GP+FP    ++  V+TS+  + DC   L
Sbjct  246   NRKQPTFAIGPLFPIGDTKNKEVSTSMWEQCDCTKWL  282



>ref|XP_010107481.1| UDP-glycosyltransferase 86A1 [Morus notabilis]
 gb|EXC16163.1| UDP-glycosyltransferase 86A1 [Morus notabilis]
Length=489

 Score =   308 bits (788),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/282 (53%), Positives = 197/282 (70%), Gaps = 13/282 (5%)
 Frame = +1

Query  187   QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNP--------RD  342
             +KPHAI+I    QGH+ PSV+LA +LA KGF +TF+NT  VH+ +TKS          +D
Sbjct  7     KKPHAIMIPLHYQGHVTPSVNLAIKLASKGFIITFVNTEIVHHQITKSKSFNTTELEEKD  66

Query  343   DDIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSA  522
              DIF+G RK GLDIRY T+SDG P  +DR +N  QF    LH++ AHV+E +  ++    
Sbjct  67    RDIFAGARKSGLDIRYKTVSDGFPLSFDRFLNAKQFGEGSLHVFPAHVDELVGNLVRED-  125

Query  523   NSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCID  702
                 P V+CLIADTFF +   +AKKYKL+ +SFWTEPALVFTLYYH+ LL  NGHF   D
Sbjct  126   ----PSVSCLIADTFFTWTSWIAKKYKLINVSFWTEPALVFTLYYHVDLLIQNGHFASND  181

Query  703   VREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEH  882
              RED IEY+PGV++I+ KDL S+ Q T+T T+ H+IIYKSF+D + ADF+LCNTVQELE 
Sbjct  182   NREDTIEYIPGVKAIEPKDLPSFFQSTDTNTLRHRIIYKSFEDVKAADFILCNTVQELES  241

Query  883   ETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             +T++A+Q+K   + +GP+ P  F +S V TSL +E DC   L
Sbjct  242   DTISAIQDKQPIYAIGPVLPSEFTKSIVPTSLKAEFDCSQWL  283



>gb|EYU34478.1| hypothetical protein MIMGU_mgv1a020724mg [Erythranthe guttata]
Length=490

 Score =   308 bits (788),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/281 (51%), Positives = 199/281 (71%), Gaps = 8/281 (3%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDD--  345
             MAD+ +KPHAI+I YP QGHI P V LA +LA +GFT+TF+NT SVH  ++++    D  
Sbjct  1     MADTARKPHAIMIPYPYQGHINPFVSLAMKLASQGFTITFVNTQSVHSRISRAQSGTDAA  60

Query  346   DIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSAN  525
             DIF+G R  GLDIRY T+SDG P  +DR+ NHDQF+  L+H++SAHV+E     L ++ +
Sbjct  61    DIFAGARNSGLDIRYATVSDGFPLGFDRSANHDQFVEGLIHVFSAHVDE-----LVATLS  115

Query  526   SGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDV  705
             +  PPV CLIADTF+V+   +A K+ L+ +SFWTEPALV +LYYHL LL+ N HFG  + 
Sbjct  116   ASDPPVTCLIADTFYVWSSAIAAKHNLVSVSFWTEPALVLSLYYHLDLLKKNSHFGSKEK  175

Query  706   REDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHE  885
             R+D I+Y+PGV +++  DL SY+Q  +T TV H++IY++F D + AD ++CN VQELE +
Sbjct  176   RKDTIDYIPGVETVNPTDLPSYLQSDDTSTVVHRVIYRAFTDVKKADIIICNAVQELESK  235

Query  886   TVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             T++AL  K   + +GPI    F    +ATSL SE+DC P L
Sbjct  236   TLSALHTKQPTYAIGPIV-SCFTNQTIATSLWSETDCTPWL  275



>ref|XP_010907030.1| PREDICTED: UDP-glycosyltransferase 86A1-like isoform X2 [Elaeis 
guineensis]
Length=482

 Score =   307 bits (787),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 155/284 (55%), Positives = 206/284 (73%), Gaps = 9/284 (3%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPR----  339
             MA+  QKPHA+LI  PLQGHI P+  LA +LA +GFT+T++NT +VH+  +++       
Sbjct  1     MAEPPQKPHAVLIPVPLQGHINPATRLAIKLATRGFTITYVNTEAVHHQSSRARRSASSI  60

Query  340   DDDIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSS  519
             D  IF+     GLDIRY  ISDGLP  +DR  N  QF+ SLL+++SAHVEE ++K LT +
Sbjct  61    DHHIFADACASGLDIRYELISDGLPVSFDRTANPIQFLHSLLYVFSAHVEEFMRK-LTRA  119

Query  520   ANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCI  699
             A+   PP+ CLIADTFFV+P  +AKK+ + Y+SFWTEPA+VFTLYYH+ LL  NGHF   
Sbjct  120   AS---PPITCLIADTFFVWPSTIAKKFDIPYVSFWTEPAVVFTLYYHMDLLIKNGHFASC  176

Query  700   DVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELE  879
             + R+D I Y+PGV +I+  DLMSY+QET T +V HQII+K+F++AR ADFVLCNTVQELE
Sbjct  177   ENRKDTIAYIPGVPAIEPTDLMSYLQETNTTSVLHQIIFKAFEEARGADFVLCNTVQELE  236

Query  880   HETVAALQEKTSFFTVGPIFPPVFAQS-AVATSL*SESDCEPLL  1008
              ET++A+Q++  F+ VGP+ PP F    +V T+L  ESDC   L
Sbjct  237   PETISAIQQEKPFYAVGPLIPPGFIPGISVQTTLQVESDCSQWL  280



>dbj|BAJ86664.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=484

 Score =   306 bits (785),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 156/292 (53%), Positives = 212/292 (73%), Gaps = 19/292 (7%)
 Frame = +1

Query  172   MADSG----QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKS---  330
             MA++G    +KPHA++I YPLQGH+IP+ HLA RLA +GF VTF+NT SVH    ++   
Sbjct  1     MAENGTGGRKKPHAVVIPYPLQGHVIPAAHLALRLAARGFAVTFVNTESVHQQTARALGA  60

Query  331   NPRDDDIFSGIRKPG------LDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEE  492
             + R  DIF+G R PG      LD+RY  +SDG P  +DR++NHDQFM  +LH+  AHVEE
Sbjct  61    DRRSYDIFAGARAPGKEEEERLDVRYELVSDGFPLGFDRSLNHDQFMEGVLHVLPAHVEE  120

Query  493   ALKKILTSSANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLL  672
              L++++   A++      CL+ADTFFV+P  LA K  + Y+SFWTEPAL+F LYYH+ LL
Sbjct  121   LLRRLVVDPAST------CLVADTFFVWPATLAGKLGVPYVSFWTEPALIFNLYYHMDLL  174

Query  673   RLNGHFGCIDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFV  852
              ++GHF C + R+D I Y+PGV +I+  +LMSY+QET+T +V H+II+K+F +AR AD+V
Sbjct  175   AMHGHFKCKEPRKDTIMYIPGVPAIEPHELMSYLQETDTTSVVHRIIFKAFDEARGADYV  234

Query  853   LCNTVQELEHETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             LCNTV+ELE  T+AAL+ +  F+ VGPIFP  FA+SAVATS+ +ESDC   L
Sbjct  235   LCNTVEELEPSTIAALRAEKPFYAVGPIFPAGFARSAVATSMWAESDCSQWL  286



>ref|XP_010907029.1| PREDICTED: UDP-glycosyltransferase 86A1-like isoform X1 [Elaeis 
guineensis]
Length=483

 Score =   306 bits (785),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 156/285 (55%), Positives = 207/285 (73%), Gaps = 10/285 (4%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPR----  339
             MA+  QKPHA+LI  PLQGHI P+  LA +LA +GFT+T++NT +VH+  +++       
Sbjct  1     MAEPPQKPHAVLIPVPLQGHINPATRLAIKLATRGFTITYVNTEAVHHQSSRARRSASSI  60

Query  340   DDDIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSS  519
             D  IF+     GLDIRY  ISDGLP  +DR  N  QF+ SLL+++SAHVEE ++K LT +
Sbjct  61    DHHIFADACASGLDIRYELISDGLPVSFDRTANPIQFLHSLLYVFSAHVEEFMRK-LTRA  119

Query  520   ANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFG-C  696
             A+   PP+ CLIADTFFV+P  +AKK+ + Y+SFWTEPA+VFTLYYH+ LL  NGHF  C
Sbjct  120   AS---PPITCLIADTFFVWPSTIAKKFDIPYVSFWTEPAVVFTLYYHMDLLIKNGHFASC  176

Query  697   IDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQEL  876
              + R+D I Y+PGV +I+  DLMSY+QET T +V HQII+K+F++AR ADFVLCNTVQEL
Sbjct  177   AENRKDTIAYIPGVPAIEPTDLMSYLQETNTTSVLHQIIFKAFEEARGADFVLCNTVQEL  236

Query  877   EHETVAALQEKTSFFTVGPIFPPVFAQS-AVATSL*SESDCEPLL  1008
             E ET++A+Q++  F+ VGP+ PP F    +V T+L  ESDC   L
Sbjct  237   EPETISAIQQEKPFYAVGPLIPPGFIPGISVQTTLQVESDCSQWL  281



>ref|XP_010557349.1| PREDICTED: UDP-glycosyltransferase 86A2 [Tarenaya hassleriana]
Length=485

 Score =   306 bits (783),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 150/276 (54%), Positives = 198/276 (72%), Gaps = 10/276 (4%)
 Frame = +1

Query  196   HAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNP----RDDDIFSGI  363
             HA+LI YP QGH+ P VHLA +LA +G TVTF+NT  +H+ +T SNP       DIF+G 
Sbjct  12    HALLIPYPFQGHVNPCVHLAIKLASQGITVTFVNTDYIHHQIT-SNPINGSSSGDIFAGF  70

Query  364   R-KPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPP  540
             R + GLDIRY T+SDGLP  +DR++NHDQ+ ASLLH++SAHVEE + ++    A  G   
Sbjct  71    RSESGLDIRYATVSDGLPIGFDRSLNHDQYQASLLHVFSAHVEELVARL----AGDGDGG  126

Query  541   VNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAI  720
             VN LIADTFFV+P  +A+K+ L+Y+SFWTE ALVF+LYYH+ LLRL+GHF     R+D I
Sbjct  127   VNVLIADTFFVWPSAIARKFGLVYVSFWTEAALVFSLYYHMDLLRLHGHFCSQGRRKDLI  186

Query  721   EYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAAL  900
             +Y+PGV++I+ KD  SY+Q+T+T +V HQII+K+F+D + ADFVLCNT+ E E  T+ AL
Sbjct  187   DYIPGVKAIEPKDTASYLQDTDTSSVVHQIIFKAFEDVKKADFVLCNTIYEFEDRTIQAL  246

Query  901   QEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
               K  F+ +GPI P       V TSL SE+DC   L
Sbjct  247   NSKIPFYAIGPIIPFGIKNKTVTTSLWSEADCTQWL  282



>ref|XP_010414605.1| PREDICTED: UDP-glycosyltransferase 86A2-like [Camelina sativa]
Length=481

 Score =   305 bits (782),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 150/273 (55%), Positives = 201/273 (74%), Gaps = 9/273 (3%)
 Frame = +1

Query  196   HAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIR-KP  372
             HA+LI YP QGH+ P V LA +LA +G TVTF+NTH +H+ +T  N  D DIF+G+R + 
Sbjct  16    HALLIPYPFQGHVNPFVQLAIKLASQGITVTFVNTHYIHHQIT--NGSDGDIFAGVRSES  73

Query  373   GLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPVNCL  552
             GLDIRY T+SDGLP  +DR++NHD + +SLL+++ AHVEE     L +S   G   VN +
Sbjct  74    GLDIRYATVSDGLPVGFDRSLNHDTYQSSLLYVFYAHVEE-----LVASLVGGDSGVNVM  128

Query  553   IADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIEYVP  732
             IADTFFV+P  +A+K+ L+ +SFWTE ALVF+LYYHL LLR++GHFG  + RED I+Y+P
Sbjct  129   IADTFFVWPSVVARKFGLVCVSFWTEAALVFSLYYHLDLLRVHGHFGAQETREDLIDYIP  188

Query  733   GVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQEKT  912
             GV +I+ KD  SY+QET+T +V HQII+K+F+D +  DFVLCNT+Q+ E +T+ AL  K 
Sbjct  189   GVAAINPKDTASYLQETDTSSVVHQIIFKAFEDVKKVDFVLCNTIQQFEDKTIKALNSKI  248

Query  913   SFFTVGPIFP-PVFAQSAVATSL*SESDCEPLL  1008
              F+ VGPI P  + + S+VATSL SESDC   L
Sbjct  249   PFYAVGPIIPFNLQSGSSVATSLWSESDCTQWL  281



>ref|XP_008243982.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Prunus mume]
Length=479

 Score =   305 bits (781),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 146/284 (51%), Positives = 197/284 (69%), Gaps = 10/284 (4%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPR----  339
             M D   KPHAI++  P QGH+IP  HLA +LA  GFT+TF+NT  +H+ +TKS       
Sbjct  1     MEDKHSKPHAIMVPLPRQGHVIPFTHLALKLASNGFTITFVNTQIIHHQITKSESNGSEG  60

Query  340   DDDIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSS  519
              +DIF+  RK GLDIRY T+SDG P  ++R+ N DQ++  LLH++ AHV+E + K++ S 
Sbjct  61    QEDIFAAARKSGLDIRYRTVSDGFPLAFNRSQNLDQYLEGLLHVFPAHVDELVGKLVQSD  120

Query  520   ANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCI  699
                  P ++CLIADTF  +P  +A KY L+YISFWTE A V  +YYH+ LLR NGHFG  
Sbjct  121   -----PSISCLIADTFHTWPATIANKYNLVYISFWTETAFVLCIYYHMDLLRKNGHFGSH  175

Query  700   DVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELE  879
             D RED I+Y+PGV++I+ KDL+S++Q T T T  H+I+YK+FQ   NA+F+LCNTVQELE
Sbjct  176   DNREDTIDYIPGVQAIEPKDLVSHLQATNTSTAAHRILYKAFQQVTNANFILCNTVQELE  235

Query  880   HETVAALQEKTSFFTVGPIFPPVFAQS-AVATSL*SESDCEPLL  1008
              +++ ALQEK   + +GP+FP    +S  VAT+L SE DC   L
Sbjct  236   SQSLLALQEKQPTYAIGPVFPSKATKSVVVATNLISEFDCTEWL  279



>ref|XP_011094626.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Sesamum indicum]
Length=502

 Score =   305 bits (782),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 147/281 (52%), Positives = 199/281 (71%), Gaps = 8/281 (3%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDD--  345
             MA + +KPHAI+I YP QGHI P V LA +LA +GFT+TF+NT SVH  ++++    D  
Sbjct  1     MAGTPRKPHAIMIPYPYQGHINPFVSLAMKLAAQGFTITFVNTQSVHCRISRAQKWIDGS  60

Query  346   DIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSAN  525
             DIF+G R  GLDIRY T+SDG P  +DR++NHDQF+  L+H++SAHV+E +  +  S   
Sbjct  61    DIFAGARDSGLDIRYATVSDGFPLGFDRSLNHDQFVEGLIHVFSAHVDELVANLADSD--  118

Query  526   SGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDV  705
                PPV CLIADTF+V+   +A+K+ L+ +SFWTEPALV +LYYHL LL+ NGHFG  + 
Sbjct  119   ---PPVTCLIADTFYVWASAIAEKHNLVSVSFWTEPALVLSLYYHLDLLKENGHFGSQEK  175

Query  706   REDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHE  885
             R+D I+Y+PGV +I   DL SY+Q  E  TV H++IY++F+D + AD ++CNTV+ELE+ 
Sbjct  176   RQDIIDYIPGVGTIKPTDLTSYLQADEIWTVVHRVIYRAFEDVKKADIIICNTVRELEYN  235

Query  886   TVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             T+AAL  K   + +GPI    F    VATSL SE+DC P L
Sbjct  236   TLAALHRKQPTYAIGPIVSD-FTNQTVATSLWSETDCTPWL  275



>emb|CDP12501.1| unnamed protein product [Coffea canephora]
Length=479

 Score =   305 bits (780),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 145/286 (51%), Positives = 200/286 (70%), Gaps = 13/286 (5%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDD--  345
             M +   +PHA+L+ YPLQGH+IP +HLA +LA  GF +TF+ T S+H+ +T S  + +  
Sbjct  1     MGEIHPRPHALLLPYPLQGHVIPFIHLATKLASNGFIITFVITESIHHQITTSKNQTNHY  60

Query  346   -----DIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKIL  510
                  +IF+  RK GLDIRY T+SDG P  +DR++NHDQF   ++H++SAHV+E + K++
Sbjct  61    KEGGINIFAEARKSGLDIRYATVSDGFPLGFDRSLNHDQFFEGIVHVFSAHVDEIVGKLV  120

Query  511   TSSANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHF  690
              S      PPVNCL+ DTF+VF   +A+KY L+ ISFWTEPALVF+LYYH+ LLR+NGH+
Sbjct  121   QSE-----PPVNCLVIDTFYVFASPIARKYNLVNISFWTEPALVFSLYYHMDLLRINGHY  175

Query  691   GCIDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQ  870
                D RED I Y+PGV SI   DL SY+Q T+  TV H++I K+F D RN+DFV+ NT+ 
Sbjct  176   DNYDKREDIITYIPGVESIKPTDLTSYLQ-TDPTTVVHRLITKAFVDIRNSDFVISNTID  234

Query  871   ELEHETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             ELE + ++ LQE   F+++GPI P    +S+V  S+ SESDC P L
Sbjct  235   ELEPQIISVLQENQPFYSIGPILPTGLTKSSVPVSMWSESDCGPWL  280



>ref|XP_010107482.1| UDP-glycosyltransferase 86A1 [Morus notabilis]
 gb|EXC16164.1| UDP-glycosyltransferase 86A1 [Morus notabilis]
Length=489

 Score =   305 bits (781),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 150/284 (53%), Positives = 196/284 (69%), Gaps = 13/284 (5%)
 Frame = +1

Query  181   SGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSN--------P  336
             S  KPHAI+I +  QGHI P V+LA +LA +GFT+TF+NT  +H+ +TKS          
Sbjct  5     STTKPHAIMIPFYFQGHITPFVNLAIKLASEGFTLTFVNTEIIHHQITKSKDSNTTELEE  64

Query  337   RDDDIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTS  516
              D DIF+G RK GLDIRY T+SDG P  ++R +N DQF    LH++ AHV+E +  ++  
Sbjct  65    NDHDIFAGARKSGLDIRYKTVSDGFPLSFNRLLNIDQFCEGGLHVFPAHVDELVGNLVRE  124

Query  517   SANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGC  696
                   P V+CLIADTFF +   +AKKYKL+ +SFWTEPALVFTL YH  LL  NGHF  
Sbjct  125   D-----PSVSCLIADTFFSWTSWIAKKYKLINVSFWTEPALVFTLNYHWDLLVKNGHFAS  179

Query  697   IDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQEL  876
              D RED I+Y+PGV++I+ KDL S++Q T T T+ H+ IYKSF+DA+NADF+LCNTVQEL
Sbjct  180   NDNREDTIDYIPGVKAIEPKDLTSFLQSTNTNTIQHRSIYKSFEDAKNADFILCNTVQEL  239

Query  877   EHETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             E +T+ A+QEK   + +GP+FP  F +S V TSL +  DC   L
Sbjct  240   ESDTILAIQEKQPMYAIGPVFPSEFTESIVPTSLKAGFDCSQWL  283



>ref|XP_003573977.1| PREDICTED: UDP-glycosyltransferase 86A1 isoform X2 [Brachypodium 
distachyon]
Length=488

 Score =   304 bits (778),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 148/278 (53%), Positives = 201/278 (72%), Gaps = 12/278 (4%)
 Frame = +1

Query  190  KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKS---NPRDDDIFSG  360
            KPHA++I YPLQGH+IP+ HLA RLA +GF VTF+NT SVH    ++   +    DIF+ 
Sbjct  12   KPHAVVIPYPLQGHVIPAAHLALRLATRGFAVTFVNTESVHQQTARALGVSAAGYDIFAA  71

Query  361  IRKP------GLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSA  522
             R         LD+RY  +SDG P  +DR++NHDQ+M  +LH+  AHVEE L +++    
Sbjct  72   ARAEDEEEENKLDVRYELVSDGFPLGFDRSLNHDQYMEGVLHVLPAHVEELLCRLVCDVD  131

Query  523  NSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCID  702
             +      CL+ADTFFV+P  LA+K  + Y+SFWTEPAL+FTLYYH+ LL  +GHF C +
Sbjct  132  QAAS---TCLVADTFFVWPATLARKLGVPYVSFWTEPALIFTLYYHMDLLAKHGHFKCQE  188

Query  703  VREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEH  882
             R+D I Y+PGV +I+ ++LMSY+QET+T TV H+II+K+F++AR AD+VLCNTV+ELE 
Sbjct  189  PRKDTITYIPGVPAIEPRELMSYLQETDTTTVVHRIIFKAFEEARGADYVLCNTVEELEP  248

Query  883  ETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDC  996
             T+AAL+ +  F+ VGPIFP  FA+SAVATS+ +ESDC
Sbjct  249  STIAALRAEKPFYAVGPIFPAGFARSAVATSMWAESDC  286



>ref|XP_006345817.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Solanum tuberosum]
Length=488

 Score =   303 bits (777),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/273 (54%), Positives = 194/273 (71%), Gaps = 7/273 (3%)
 Frame = +1

Query  190  KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNP-----RDDDIF  354
            K HAI+I  PLQGHI+  ++LA +LA KG T+TF+NTH  H  L K+ P      D +IF
Sbjct  8    KLHAIMIPVPLQGHIVQFINLAIKLASKGLTITFVNTHITHQRLMKAQPVSENSSDYNIF  67

Query  355  SGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGG  534
            S  +K GLDIRY TISDG P  +DR  NHDQFM  L H++S HV++ +  ++ S  N+  
Sbjct  68   SEAQKSGLDIRYTTISDGFPLNFDRMGNHDQFMEGLFHVFSTHVDDLIGNLVNS--NNQN  125

Query  535  PPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVRED  714
            PPV+ LIADTFFV+P  +AKKY L+ ISF+TE AL FT YYH+ LL++NGHFG  D RED
Sbjct  126  PPVSFLIADTFFVWPSAIAKKYDLVNISFFTEAALAFTSYYHMDLLKINGHFGSQDNRED  185

Query  715  AIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVA  894
             I+Y+PGV++I++ DL SYIQ++E     H+ I+KS +DA  AD ++CNTVQELE  T+A
Sbjct  186  TIDYIPGVQAIELGDLPSYIQDSEPWGTMHRYIFKSLEDAGKADMIICNTVQELESSTIA  245

Query  895  ALQEKTSFFTVGPIFPPVFAQSAVATSL*SESD  993
            ALQEK  F+ +GPIFP  F +S + T+L  ESD
Sbjct  246  ALQEKKPFYALGPIFPNGFTKSTIPTNLRMESD  278



>ref|XP_004239693.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Solanum lycopersicum]
Length=483

 Score =   303 bits (776),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 151/280 (54%), Positives = 195/280 (70%), Gaps = 10/280 (4%)
 Frame = +1

Query  190   KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKS-----NPRDDDIF  354
             KPHAI+I  PLQGHI+  ++LA +LA KG T+TF+NTH  H  L K+     +  D +IF
Sbjct  8     KPHAIMIPVPLQGHIVQFINLAIKLASKGLTITFVNTHITHQRLMKAQSVSESSSDYNIF  67

Query  355   SGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGG  534
             S  +K GLDIRY TISDG P  +DR  NHDQFM  L H++S HV++ +  ++ S+ N   
Sbjct  68    SEAQKSGLDIRYTTISDGFPLNFDRMGNHDQFMEGLFHVFSTHVDDLIGNLVNSNHN---  124

Query  535   PPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVRED  714
             PPV+CLIADTFFV+P  +AKKY LL ISF+TE AL FT YYH+ LL LNGHFG  D RED
Sbjct  125   PPVSCLIADTFFVWPSVIAKKYDLLNISFFTEAALAFTSYYHMDLLTLNGHFGSQDNRED  184

Query  715   AIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVA  894
              I+Y+PGV++I+  DL SYIQ++E     H+ I+KS +DARNAD ++CNTVQELE  T++
Sbjct  185   TIDYIPGVQAIEPGDLPSYIQDSEPWDTMHRYIFKSLEDARNADMIICNTVQELESSTIS  244

Query  895   ALQEKTSFFTVGPIFPPVFAQSAVAT--SL*SESDCEPLL  1008
             ALQEK  F+ +GP+FP  F  +   T  +L  ESD    L
Sbjct  245   ALQEKKPFYALGPVFPNGFTNNTTPTKSNLWMESDTTEWL  284



>ref|XP_009376819.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Pyrus x bretschneideri]
Length=479

 Score =   301 bits (772),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 144/284 (51%), Positives = 199/284 (70%), Gaps = 10/284 (4%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD---  342
             M ++  KPHAI++  P+QGH+IP  +LA +LA  GFT+TF+NT  VH+ L KS P +   
Sbjct  1     MEENHSKPHAIMVPLPIQGHVIPFTNLAMKLASNGFTITFVNTKCVHHQLHKSQPNNNSG  60

Query  343   --DDIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTS  516
               DDIFS +R+ GLDIRY T+SDGLP  ++R  N DQF+   LH++ AHV+E +  ++ S
Sbjct  61    DQDDIFSKVRESGLDIRYTTVSDGLPLAFNRFQNLDQFLECSLHVFPAHVDELVGDLVQS  120

Query  517   SANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGC  696
                   P + CLIADT+  +P  +A KY L++ISFWT+PALVF +YYHL LL  NGHFG 
Sbjct  121   D-----PSITCLIADTYHCWPATIANKYNLVHISFWTQPALVFNIYYHLDLLIKNGHFGS  175

Query  697   IDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQEL  876
              D RE  I+Y+PGV++I+ KDLMS  QET+  T+ H++IYK++++ + ADF+LCNTVQEL
Sbjct  176   QDNREGTIDYIPGVKAIEPKDLMSNFQETDISTLMHRVIYKAYEEVKGADFILCNTVQEL  235

Query  877   EHETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             E E+++ALQEK   + +GP+     A+  VAT+L SE DC   L
Sbjct  236   ESESLSALQEKQPTYAIGPVLSNKPAKGMVATNLMSEFDCTQWL  279



>ref|XP_004983012.1| PREDICTED: UDP-glycosyltransferase 86A1-like isoform X1 [Setaria 
italica]
Length=495

 Score =   301 bits (771),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 147/293 (50%), Positives = 200/293 (68%), Gaps = 19/293 (6%)
 Frame = +1

Query  169   AMADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDD-  345
             A    G KPHA++++YPLQGHIIP  HLA RLA +GF VTF++T +VH    ++   DD 
Sbjct  10    APGGGGNKPHAVVVAYPLQGHIIPVAHLALRLAARGFAVTFVSTEAVHDQTARAMGVDDP  69

Query  346   ---DIFSGIR---------KPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVE  489
                D+F+  R         +  LD+ Y  +SDGLP  +DR+++HD FM +LLH   AHVE
Sbjct  70    DGYDVFAAARASVASGGEGEEELDVAYELVSDGLPVGFDRSLHHDDFMGALLHALPAHVE  129

Query  490   EALKKILTSSANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHL  669
             E L++++        P    L+ADTFFV+P  LA +  + Y+SFWTEPAL+F LYYH+ L
Sbjct  130   ELLRRVVVD------PAATFLVADTFFVWPATLATRLGVAYVSFWTEPALIFNLYYHMDL  183

Query  670   LRLNGHFGCIDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADF  849
             L  NGHF C + R+D I Y+PGV SI+  +LMSY+QET+T +V H+II+K+F +AR AD+
Sbjct  184   LTHNGHFRCNEPRKDTITYIPGVPSIEPTELMSYLQETDTTSVVHRIIFKAFDEARRADY  243

Query  850   VLCNTVQELEHETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             VLCNTV+ELE  T+AAL+ +  F+ VGP+ P  FA+SAVATS+ +ESDC   L
Sbjct  244   VLCNTVEELEPSTIAALRAEKPFYAVGPVLPAGFARSAVATSMWAESDCSRWL  296



>gb|KFK32346.1| udp-glycosyltransferase-like protein [Arabis alpina]
Length=480

 Score =   300 bits (769),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 152/307 (50%), Positives = 210/307 (68%), Gaps = 16/307 (5%)
 Frame = +1

Query  187   QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIR  366
             +K HA+LI YP QGH+ P VHLA +LA +G TVTF+NTH + + +        DIFSG+R
Sbjct  16    KKLHALLIPYPFQGHVNPFVHLAIKLASEGITVTFVNTHYIDHQIGSG-----DIFSGVR  70

Query  367   -KPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPV  543
              + GLDIRY T+SDGLP  +DR++NHDQ+ +SLLH++SAHVEE +  ++      GG  V
Sbjct  71    SESGLDIRYATVSDGLPIGFDRSLNHDQYQSSLLHVFSAHVEELVASLV---GEKGG--V  125

Query  544   NCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIE  723
             N +IADTFFV+P  +A K+ L+ +SFWTE ALVF+LYYH+ LLR++GHFG  + RED I+
Sbjct  126   NVMIADTFFVWPSVVASKFGLVCVSFWTEAALVFSLYYHMDLLRIHGHFGAQETREDLID  185

Query  724   YVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQ  903
             Y+PGV++I  KD  SY+QET+T +V HQII+K+F+D +  DFVLCNT+   E  T+ AL 
Sbjct  186   YIPGVKAIKPKDTASYLQETDTSSVVHQIIFKAFEDVKKVDFVLCNTIHSFEDRTIQALN  245

Query  904   EKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLLILP----LLHCSYRWFAGGVAGRTV  1071
              K  F+ +GPI P      ++ TSL SESDC   L       +L+ S+  +A  V  + +
Sbjct  246   SKIPFYAIGPIIPFSLQSGSITTSLWSESDCTQWLDTKPAGSVLYISFGSYA-HVTKKDL  304

Query  1072  VSLLDGV  1092
             V + +GV
Sbjct  305   VEIANGV  311



>ref|XP_007206586.1| hypothetical protein PRUPE_ppa020358mg [Prunus persica]
 gb|EMJ07785.1| hypothetical protein PRUPE_ppa020358mg [Prunus persica]
Length=481

 Score =   300 bits (768),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/284 (51%), Positives = 195/284 (69%), Gaps = 10/284 (4%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPR----  339
             M D   KPHAI++  P QGH+IP  HLA +LA  GFT+TF+NT  +H+ +TKS       
Sbjct  1     MEDKHSKPHAIMVPLPRQGHVIPFTHLALKLASNGFTITFVNTQIIHHQITKSESNGSEG  60

Query  340   DDDIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSS  519
              +DIF+  RK GLDIRY T+SDG P  ++R+ N DQ++  LLH++ AHV+E +  ++ S 
Sbjct  61    QEDIFAAARKSGLDIRYRTVSDGFPLAFNRSQNLDQYLEGLLHVFPAHVDELVGNLVQSD  120

Query  520   ANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCI  699
                  P + CLIADTF  +P  +A KY L++ISFWTE A V  +YYH+ LLR NGHFG  
Sbjct  121   -----PSITCLIADTFHTWPATIANKYNLVHISFWTETAFVLCIYYHMDLLRKNGHFGSH  175

Query  700   DVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELE  879
             D RED I+Y+PGV++I+ KDL+S++Q T T T  H+I+YK+FQ   NA+F+LCNTVQELE
Sbjct  176   DNREDTIDYIPGVQAIEPKDLVSHLQATNTSTAAHRILYKAFQQVINANFILCNTVQELE  235

Query  880   HETVAALQEKTSFFTVGPIFPPVFAQS-AVATSL*SESDCEPLL  1008
              +++ ALQEK   + +GP+FP    +S  VAT+L SE DC   L
Sbjct  236   SQSLLALQEKQPAYAIGPVFPSKATKSVVVATNLISEFDCTEWL  279



>gb|EAY78678.1| hypothetical protein OsI_33780 [Oryza sativa Indica Group]
Length=505

 Score =   300 bits (769),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 146/294 (50%), Positives = 205/294 (70%), Gaps = 23/294 (8%)
 Frame = +1

Query  178   DSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKS----NPRDD  345
             D G KPHA++++YPLQGH+ P+VHLA RLA +GF VTF++T SVH    ++    +P   
Sbjct  14    DGGSKPHAVVVTYPLQGHVNPAVHLALRLAARGFAVTFVSTESVHEQTARALGVVDPSGY  73

Query  346   DIFSGIR-------------KPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHV  486
             D+F+  R                +D+RY  +SDGLP  +DR++NHD FM SLLH + AHV
Sbjct  74    DVFAAARAAAAKGGGGGETVAAAMDVRYEVVSDGLPVGFDRSLNHDDFMGSLLHAFGAHV  133

Query  487   EEALKKILTSSANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLH  666
             E  L +++  +A +       L+ADTFFV+P  L+KK  + Y+SFWTEPAL+F LYYH++
Sbjct  134   EALLCRVVVDAAAT------FLVADTFFVWPATLSKKLGIPYVSFWTEPALIFNLYYHIN  187

Query  667   LLRLNGHFGCIDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNAD  846
             LL  +GHF C + R+D I YVPGV +I+  +LMSY+Q+T+T TV H+II+++F++AR AD
Sbjct  188   LLTEHGHFRCNEPRKDTITYVPGVEAIEPGELMSYLQDTDTTTVVHRIIFRAFEEARGAD  247

Query  847   FVLCNTVQELEHETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             +V+CNTV+ELE  T+AAL+ +  F+ VGPI P  FA+SAVATS+ +ESDC   L
Sbjct  248   YVVCNTVEELEPSTIAALRRERPFYAVGPILPAGFARSAVATSMWAESDCSRWL  301



>emb|CDX74999.1| BnaA05g07450D [Brassica napus]
Length=484

 Score =   299 bits (766),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 145/280 (52%), Positives = 199/280 (71%), Gaps = 12/280 (4%)
 Frame = +1

Query  187   QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD-DDIFSGI  363
             +KPHA++I YPLQGH+IP VHLA +LA  GFT+TF+NT S+H+H++ +   D  DIFS  
Sbjct  7     RKPHAMMIPYPLQGHVIPFVHLAIKLASHGFTITFVNTDSIHHHISTARQGDAGDIFSEA  66

Query  364   RKPG-LDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPP  540
             R  G LDIRY T+SDG P E+DR++NHDQF   ++H++ AHV++ + KI   S     PP
Sbjct  67    RSSGNLDIRYTTVSDGFPLEFDRSLNHDQFFEGIIHVFPAHVDDLITKI---SRRGDDPP  123

Query  541   VNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAI  720
             V CLI DTF+V+   + +K+ L+ +SFWTEPALV  LYYH+HLL  NGHF  +D RED I
Sbjct  124   VTCLINDTFYVWSSMICEKHNLVNVSFWTEPALVLNLYYHMHLLISNGHFKSLDNREDVI  183

Query  721   EYVPGVRSIDVKDLMSYIQ----ETETETVCHQIIYKSFQDARNADFVLCNTVQELEHET  888
             +Y+PGV +I+ KDLMSY+Q    + +T TV ++II+K+F D + ADFVLCNT+QELE ++
Sbjct  184   DYIPGVNAIEPKDLMSYLQVSDKDVDTTTVVYRIIFKAFTDVKKADFVLCNTIQELEPDS  243

Query  889   VAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             ++ LQ     + +GP+F     +S V TSL +ESDC   L
Sbjct  244   LSVLQANQPVYAIGPVFS---TESVVPTSLWTESDCTEWL  280



>emb|CDY33211.1| BnaC04g08280D [Brassica napus]
Length=477

 Score =   299 bits (765),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 147/280 (53%), Positives = 198/280 (71%), Gaps = 12/280 (4%)
 Frame = +1

Query  187   QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD-DDIFSGI  363
             +KPHA++I +PLQGH+IP VHLA +LA  GFT+TF+NT S+H+H++ +   D  DIFS  
Sbjct  7     RKPHAMMIPFPLQGHVIPFVHLAIKLASHGFTITFVNTDSIHHHISTARQGDAGDIFSAA  66

Query  364   RKPG-LDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPP  540
             R  G LDIRY T+SDG P E+DR++NHDQF   L+H++ AHV++ + KI   S     PP
Sbjct  67    RTSGNLDIRYTTVSDGFPLEFDRSLNHDQFFEGLIHVFPAHVDDLITKI---SRRGDDPP  123

Query  541   VNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAI  720
             V CLIADTF+V+   +  K+ L+ +SFWT+PALV  +YYHLHLL  NGHF  +D RED I
Sbjct  124   VTCLIADTFYVWSSMICNKHNLVNVSFWTQPALVLNIYYHLHLLISNGHFNSLDNREDVI  183

Query  721   EYVPGVRSIDVKDLMSYIQET----ETETVCHQIIYKSFQDARNADFVLCNTVQELEHET  888
             +YVPGV++ID KDLMSY+Q T    +T  V ++II+++F D + ADFVLCNTVQELE  +
Sbjct  184   DYVPGVKAIDPKDLMSYLQVTDKDVDTNRVVYRIIFEAFTDVKKADFVLCNTVQELEPGS  243

Query  889   VAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             ++ALQ     + +GP+F     +  V TSL +ESDC   L
Sbjct  244   LSALQANQPVYAIGPVFS---TELVVPTSLWAESDCTEWL  280



>ref|XP_002879117.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55376.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=481

 Score =   299 bits (765),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 144/268 (54%), Positives = 193/268 (72%), Gaps = 8/268 (3%)
 Frame = +1

Query  208   ISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIR-KPGLDI  384
             I YP QGH+ P VHLA +LA +G TVTF+NTH +H+ +T  N  D DIF+G+R + GLDI
Sbjct  22    IPYPFQGHVNPFVHLAIKLASQGITVTFVNTHYIHHQIT--NGSDGDIFAGVRSESGLDI  79

Query  385   RYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPVNCLIADT  564
             RY T+SDGLP  +DR++NHD + +SLLH++ AHVEE     L +S   G   VN +IADT
Sbjct  80    RYATVSDGLPVGFDRSLNHDTYQSSLLHVFYAHVEE-----LVASLVGGDGGVNVMIADT  134

Query  565   FFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIEYVPGVRS  744
             FFV+P  +A+K+ L+ +SFWTE ALVF+LYYH+ LLR++GHFG  + R D I+Y+PGV +
Sbjct  135   FFVWPSVVARKFGLVCVSFWTEAALVFSLYYHMDLLRIHGHFGAQETRRDLIDYIPGVAA  194

Query  745   IDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQEKTSFFT  924
             I+ KD  SY+QET+T +V HQII+K+F+D +  DFVLCNT+Q+ E +T+ AL  K  F+ 
Sbjct  195   INPKDTASYLQETDTSSVVHQIIFKAFEDVKKVDFVLCNTIQQFEDKTIKALNTKIPFYA  254

Query  925   VGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             +GPI P      +V TSL SESDC   L
Sbjct  255   IGPIIPFNNQTGSVTTSLWSESDCTQWL  282



>ref|NP_180375.1| UDP-glycosyltransferase 86A2 [Arabidopsis thaliana]
 sp|Q9ZUV0.1|U86A2_ARATH RecName: Full=UDP-glycosyltransferase 86A2 [Arabidopsis thaliana]
 gb|AAC98458.1| putative glucosyltransferase [Arabidopsis thaliana]
 dbj|BAD95413.1| putative glucosyltransferase [Arabidopsis thaliana]
 gb|AEC08076.1| UDP-glycosyltransferase 86A2 [Arabidopsis thaliana]
 gb|AHL38835.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=482

 Score =   299 bits (765),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 144/268 (54%), Positives = 193/268 (72%), Gaps = 8/268 (3%)
 Frame = +1

Query  208   ISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIR-KPGLDI  384
             I YP QGH+ P VHLA +LA +G TVTF+NTH +H+ +T  N  D DIF+G+R + GLDI
Sbjct  22    IPYPFQGHVNPFVHLAIKLASQGITVTFVNTHYIHHQIT--NGSDGDIFAGVRSESGLDI  79

Query  385   RYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPVNCLIADT  564
             RY T+SDGLP  +DR++NHD + +SLLH++ AHVEE     L +S   G   VN +IADT
Sbjct  80    RYATVSDGLPVGFDRSLNHDTYQSSLLHVFYAHVEE-----LVASLVGGDGGVNVMIADT  134

Query  565   FFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIEYVPGVRS  744
             FFV+P  +A+K+ L+ +SFWTE ALVF+LYYH+ LLR++GHFG  + R D I+Y+PGV +
Sbjct  135   FFVWPSVVARKFGLVCVSFWTEAALVFSLYYHMDLLRIHGHFGAQETRSDLIDYIPGVAA  194

Query  745   IDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQEKTSFFT  924
             I+ KD  SY+QET+T +V HQII+K+F+D +  DFVLCNT+Q+ E +T+ AL  K  F+ 
Sbjct  195   INPKDTASYLQETDTSSVVHQIIFKAFEDVKKVDFVLCNTIQQFEDKTIKALNTKIPFYA  254

Query  925   VGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             +GPI P      +V TSL SESDC   L
Sbjct  255   IGPIIPFNNQTGSVTTSLWSESDCTQWL  282



>ref|XP_002879636.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH55895.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=487

 Score =   299 bits (765),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 145/280 (52%), Positives = 204/280 (73%), Gaps = 13/280 (5%)
 Frame = +1

Query  187   QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD-DDIFSGI  363
             +KPH ++I YPLQGH+IP VHLA +LA  GFT+TF+NT S+H+H++ ++  D  DIFS  
Sbjct  7     RKPHIMMIPYPLQGHVIPFVHLAIKLASHGFTITFVNTDSIHHHISTAHHGDAGDIFSSA  66

Query  364   RKPG-LDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPP  540
             R  G LDIRY T++DG P ++DR++NHDQF   +LH++SAHV++    ++ + ++   PP
Sbjct  67    RSSGKLDIRYTTVTDGFPLDFDRSLNHDQFFEGILHVFSAHVDD----LIATLSHRDDPP  122

Query  541   VNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAI  720
             V CLIADTF+V+   +  K+ L+ +SFWTEPALV  LYYH+ LL  NGHF  +D R+D I
Sbjct  123   VTCLIADTFYVWSSMICDKHNLVNVSFWTEPALVLNLYYHMDLLISNGHFKSLDNRKDVI  182

Query  721   EYVPGVRSIDVKDLMSYIQ----ETETETVCHQIIYKSFQDARNADFVLCNTVQELEHET  888
             +YVPGV++ID KDLMSY+Q    + +T TV ++I++K+F+D + ADFVLCNTVQELE E+
Sbjct  183   DYVPGVKAIDPKDLMSYLQVSDKDVDTNTVVYRILFKAFKDVKRADFVLCNTVQELEPES  242

Query  889   VAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             ++ALQ K   + +GP+F     +S V TSL +ESDC   L
Sbjct  243   LSALQAKQPVYAIGPVFS---TESVVPTSLWAESDCTEWL  279



>gb|AAM61749.1| putative glucosyltransferase [Arabidopsis thaliana]
Length=482

 Score =   298 bits (763),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 144/268 (54%), Positives = 193/268 (72%), Gaps = 8/268 (3%)
 Frame = +1

Query  208   ISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIR-KPGLDI  384
             I YP QGH+ P VHLA +LA +G TVTF+NTH +H+ +T  N  D DIF+G+R + GLDI
Sbjct  22    IPYPFQGHVNPFVHLAIKLASQGITVTFVNTHYIHHQIT--NGSDGDIFAGVRSESGLDI  79

Query  385   RYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPVNCLIADT  564
             RY T+SDGLP  +DR++NHD + +SLLH++ AHVEE     L +S   G   VN +IADT
Sbjct  80    RYATVSDGLPVGFDRSLNHDTYQSSLLHVFYAHVEE-----LVASLVGGDDGVNVMIADT  134

Query  565   FFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIEYVPGVRS  744
             FFV+P  +A+K+ L+ +SFWTE ALVF+LYYH+ LLR++GHFG  + R D I+Y+PGV +
Sbjct  135   FFVWPSVVARKFGLVCVSFWTEAALVFSLYYHMDLLRIHGHFGAQETRGDLIDYIPGVAA  194

Query  745   IDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQEKTSFFT  924
             I+ KD  SY+QET+T +V HQII+K+F+D +  DFVLCNT+Q+ E +T+ AL  K  F+ 
Sbjct  195   INPKDTASYLQETDTSSVVHQIIFKAFEDVKKVDFVLCNTIQQFEDKTIKALNTKIPFYA  254

Query  925   VGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             +GPI P      +V TSL SESDC   L
Sbjct  255   IGPIIPFNNQTGSVTTSLWSESDCTQWL  282



>gb|KFK36574.1| hypothetical protein AALP_AA4G141300 [Arabis alpina]
Length=488

 Score =   298 bits (764),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 146/280 (52%), Positives = 201/280 (72%), Gaps = 13/280 (5%)
 Frame = +1

Query  187   QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD-DDIFSGI  363
             +KPHA++I YPLQGH+IP VHLA +LA  GFT+TF+NT S+H+H++ +   D  +IFS  
Sbjct  7     RKPHAMMIPYPLQGHVIPFVHLAIKLASHGFTITFVNTDSIHHHISTARHGDAGNIFSAA  66

Query  364   RKPG-LDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPP  540
                G LDIRY+T+SDG P  +DR++NHDQF   +LH++SAHV++ + KI    +N   PP
Sbjct  67    CSSGHLDIRYITVSDGFPLAFDRSLNHDQFFEGILHVFSAHVDDLITKI----SNRDDPP  122

Query  541   VNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAI  720
             V C+IADTF+V+   +  K+ L+ +SFWTEPALV  LYYH+ LL  NGHF  +D RED I
Sbjct  123   VTCMIADTFYVWSSMICDKHNLVNVSFWTEPALVLNLYYHMDLLIANGHFKSLDNREDVI  182

Query  721   EYVPGVRSIDVKDLMSYIQ----ETETETVCHQIIYKSFQDARNADFVLCNTVQELEHET  888
             +Y+PGV++ID KDLMSY+Q    + +T TV ++I+ K+F+D + ADFVLCNTVQELE  +
Sbjct  183   DYIPGVKAIDPKDLMSYLQVRNKDVDTNTVVYRILDKAFKDVKRADFVLCNTVQELEPGS  242

Query  889   VAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             ++ALQ K   + +GP+F     +S V TSL +ESDC   L
Sbjct  243   LSALQAKQPVYAIGPVFS---TESVVPTSLWAESDCTEWL  279



>emb|CDX75000.1| BnaA05g07460D [Brassica napus]
Length=479

 Score =   298 bits (762),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 145/280 (52%), Positives = 196/280 (70%), Gaps = 12/280 (4%)
 Frame = +1

Query  187   QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD-DDIFSGI  363
             +KPHA++I +PLQGH+IP VHLA +LA  GFT+TF+NT S+H+H++ +   D  DIFS  
Sbjct  7     RKPHAMMIPFPLQGHVIPFVHLAIKLASHGFTITFVNTDSIHHHISTARQGDAGDIFSAA  66

Query  364   RKPG-LDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPP  540
             R  G LDIRY T+SDG P E+DR++NHDQF   L H++ AHV++ + KI   S     PP
Sbjct  67    RTSGNLDIRYTTVSDGFPLEFDRSLNHDQFFEGLFHVFPAHVDDLITKI---SRRGDDPP  123

Query  541   VNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAI  720
             V C IADTF+V+   +  K+ L+ +SFWT+PAL   +YYHLHLL  NGHF  +D RED I
Sbjct  124   VTCFIADTFYVWSSMICNKHNLVNVSFWTQPALALNIYYHLHLLISNGHFNSLDNREDVI  183

Query  721   EYVPGVRSIDVKDLMSYIQ----ETETETVCHQIIYKSFQDARNADFVLCNTVQELEHET  888
             +Y+PGV++ID KDLMSY+Q    + +T  V ++II+++F D + ADFVLCNTVQELE  +
Sbjct  184   DYIPGVKAIDPKDLMSYLQVSDKDVDTNRVVYRIIFEAFTDVKKADFVLCNTVQELEPGS  243

Query  889   VAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             ++ALQ     + +GPIF     +S V TSL +ESDC   L
Sbjct  244   LSALQANQPVYAIGPIFS---TESVVPTSLWAESDCTEWL  280



>ref|XP_010516934.1| PREDICTED: UDP-glycosyltransferase 86A1 [Camelina sativa]
Length=497

 Score =   298 bits (763),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 145/280 (52%), Positives = 200/280 (71%), Gaps = 13/280 (5%)
 Frame = +1

Query  187   QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDD-DIFSGI  363
             +KPH ++I YPLQGH+IP VHLA +LA  GFT+TF+NT S+H+H++ +   D+ DIFS  
Sbjct  7     RKPHIMMIPYPLQGHVIPFVHLAIKLASHGFTITFVNTDSIHHHISTARQGDEGDIFSAA  66

Query  364   RKPG-LDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPP  540
             R  G LDIRY T++DG P  +DR++NHDQF   +LH++SAHV++ + K+    +     P
Sbjct  67    RSSGQLDIRYTTVTDGFPLGFDRSLNHDQFFEGILHVFSAHVDDLIAKL----SRQDDHP  122

Query  541   VNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAI  720
             V CLIADTF+V+   +  K+ L+ +SFWTEPALV  LYYH+ LL  NGHF C++ RED I
Sbjct  123   VTCLIADTFYVWSSMICDKHNLVNVSFWTEPALVLNLYYHMDLLISNGHFKCLENREDVI  182

Query  721   EYVPGVRSIDVKDLMSYIQ----ETETETVCHQIIYKSFQDARNADFVLCNTVQELEHET  888
             +YVPGV++I+ KDLMSY+Q    + +T TV +QI+ K+F+D + ADFVLCNTVQELE ++
Sbjct  183   DYVPGVKAIEPKDLMSYLQVSDKDVDTNTVVYQILSKAFKDVKRADFVLCNTVQELEPDS  242

Query  889   VAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             ++ALQ K   + +GP+F      S V TSL +ESDC   L
Sbjct  243   LSALQAKQPVYAIGPVFS---TDSVVPTSLWTESDCTEWL  279



>ref|XP_010510698.1| PREDICTED: UDP-glycosyltransferase 86A2 [Camelina sativa]
Length=481

 Score =   297 bits (761),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/269 (54%), Positives = 195/269 (72%), Gaps = 9/269 (3%)
 Frame = +1

Query  208   ISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIR-KPGLDI  384
             I YP QGH+ P V LA +LA +G TVTF+NTH +H+ +T  N  D DIF+G+R + GLDI
Sbjct  20    IPYPFQGHVNPFVQLAIKLASQGITVTFVNTHYIHHQIT--NGSDGDIFAGVRSESGLDI  77

Query  385   RYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPVNCLIADT  564
             RY T+SDGLP  +DR++NHD + +SLLH++ AHVEE     L +S   G   VN +IADT
Sbjct  78    RYATVSDGLPVGFDRSLNHDTYQSSLLHVFYAHVEE-----LVASLVGGDGGVNVMIADT  132

Query  565   FFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIEYVPGVRS  744
             FFV+P  +A+K+ L+ +SFWTE ALVF+LYYHL LLR++GHFG  + R+D I Y+PGV +
Sbjct  133   FFVWPSVVARKFGLVCVSFWTEAALVFSLYYHLDLLRIHGHFGAQETRDDLINYIPGVAA  192

Query  745   IDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQEKTSFFT  924
             I+ KD  SY+QET+T +V HQII+K+F+D +  DFVLCNT+Q+ E +T+ AL  K  F+ 
Sbjct  193   INPKDTASYLQETDTSSVVHQIIFKAFEDVKKVDFVLCNTIQQFEDKTIKALNSKIPFYA  252

Query  925   VGPIFP-PVFAQSAVATSL*SESDCEPLL  1008
             VGPI P  + + S+V TSL SESDC   L
Sbjct  253   VGPIIPFNLQSGSSVTTSLWSESDCTQWL  281



>gb|AAP53972.1| UDP-glucoronosyl and UDP-glucosyl transferase family protein, 
expressed [Oryza sativa Japonica Group]
Length=503

 Score =   298 bits (763),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/292 (49%), Positives = 205/292 (70%), Gaps = 23/292 (8%)
 Frame = +1

Query  184   GQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKS----NPRDDDI  351
             G KPHA++++YPLQGH+ P+VHLA +LA +GF VTF++T SVH    ++    +P   D+
Sbjct  14    GGKPHAVVVTYPLQGHVNPAVHLALQLAARGFAVTFVSTESVHEQTARALGVADPSGYDV  73

Query  352   FSGIR-------------KPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEE  492
             F+  R                +D+RY  +SDGLP  +DR++NHD FM SLLH + AHVE 
Sbjct  74    FAAARAAAAKGGGGGETVAAAMDVRYEVVSDGLPVGFDRSLNHDDFMGSLLHAFGAHVEA  133

Query  493   ALKKILTSSANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLL  672
              L++++  +A +       L+ADTFFV+P  L+KK  + Y+SFWTEPAL+F LYYH++LL
Sbjct  134   LLRRVVVDAAAT------FLVADTFFVWPATLSKKLGIPYVSFWTEPALIFNLYYHINLL  187

Query  673   RLNGHFGCIDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFV  852
               +GHF C + R+D I YVPGV +I+  +LMSY+Q+T+T TV H+II+++F++AR AD+V
Sbjct  188   TEHGHFRCNEPRKDTITYVPGVEAIEPGELMSYLQDTDTTTVVHRIIFRAFEEARGADYV  247

Query  853   LCNTVQELEHETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             +CNTV+ELE  T+AAL+ +  F+ VGPI P  FA+SAVATS+ +ESDC   L
Sbjct  248   VCNTVEELEPSTIAALRRERPFYAVGPILPAGFARSAVATSMWAESDCSRWL  299



>ref|XP_009334655.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Pyrus x bretschneideri]
Length=477

 Score =   297 bits (761),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/278 (51%), Positives = 190/278 (68%), Gaps = 8/278 (3%)
 Frame = +1

Query  172  MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD---  342
            M D    PHAI++  PLQGH+IP  HLA +LA +GFT+TF+NTH +H+H+ KS P D   
Sbjct  1    MEDKASNPHAIMVPLPLQGHVIPFTHLATKLASQGFTITFVNTHYIHHHILKSQPNDKTE  60

Query  343  DDIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSA  522
            DDIF+  RK GLDIRY T+SDG P  ++R  N DQF+   LH++ AHV+E +  ++ S  
Sbjct  61   DDIFAISRKSGLDIRYTTVSDGFPLAFNRFQNLDQFLEGALHVFPAHVDELVGDLVQSD-  119

Query  523  NSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCID  702
                P + CLI DTF  +   +A KY L++ISFWTEPALV  +YYHL LLR NGHFG  D
Sbjct  120  ----PSITCLIVDTFQSWSATIANKYNLIHISFWTEPALVLNIYYHLDLLRKNGHFGAHD  175

Query  703  VREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEH  882
             RED I+Y+P V++I+ KDLMSY+Q T+      +I YK+F++ + ADF+LCNTVQELE 
Sbjct  176  NREDIIDYIPSVKAIEPKDLMSYLQTTDIFCPMLRIYYKAFREVKRADFILCNTVQELEF  235

Query  883  ETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDC  996
            E+++ALQ K   + +GP+ P     + VAT+L  E DC
Sbjct  236  ESLSALQAKQPTYAIGPVLPDSLTNNIVATNLMPEFDC  273



>ref|XP_006410874.1| hypothetical protein EUTSA_v10016577mg [Eutrema salsugineum]
 gb|ESQ52327.1| hypothetical protein EUTSA_v10016577mg [Eutrema salsugineum]
Length=488

 Score =   297 bits (760),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 148/280 (53%), Positives = 200/280 (71%), Gaps = 12/280 (4%)
 Frame = +1

Query  187   QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD-DDIFSGI  363
             +KPHA++I YPLQGH+IP VHLA +LA  GFT+TF+NT S+H+H++ +   D  DIFS  
Sbjct  7     KKPHAMMIPYPLQGHVIPFVHLAIKLASHGFTITFVNTDSIHHHISTALHGDAGDIFSTA  66

Query  364   RKPG-LDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPP  540
                G LDIRY T+SDG P  +DR++NHDQF   +LH++SAHV++ + KI   +     PP
Sbjct  67    CSSGHLDIRYTTVSDGFPLGFDRSLNHDQFFEGILHVFSAHVDDLIAKI---ARQDDDPP  123

Query  541   VNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAI  720
             V CLIADTF+V+   +  K+ L+ +SFWTEPALV  LYYH+ LL  NGHF  +D RED I
Sbjct  124   VTCLIADTFYVWSSVICDKHNLVNVSFWTEPALVLNLYYHMDLLISNGHFKSLDNREDVI  183

Query  721   EYVPGVRSIDVKDLMSYIQ----ETETETVCHQIIYKSFQDARNADFVLCNTVQELEHET  888
             +YVPGV++I+ KDLMSY+Q    + +T TV ++I++K+F+D + ADFVLCNTVQELE  +
Sbjct  184   DYVPGVKAIEPKDLMSYLQVSDKDIDTNTVVYRILFKAFKDVKRADFVLCNTVQELEPGS  243

Query  889   VAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             ++ALQ K   + +GP+F     QS V TSL +ESDC   L
Sbjct  244   LSALQAKQPVYAIGPVFS---TQSVVPTSLWAESDCTEWL  280



>ref|XP_010470154.1| PREDICTED: UDP-glycosyltransferase 86A2-like [Camelina sativa]
Length=482

 Score =   295 bits (756),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 145/270 (54%), Positives = 195/270 (72%), Gaps = 10/270 (4%)
 Frame = +1

Query  208   ISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIR-KPGLDI  384
             I YP QGH+ P V LA +LA +G TVTF+NTH +H+ +T  N  D DIF+G+R + GLDI
Sbjct  20    IPYPFQGHVNPFVQLAIKLASQGITVTFVNTHYIHHQIT--NGSDGDIFAGVRSESGLDI  77

Query  385   RYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPVNCLIADT  564
             RY T+SDGLP  +DR++NHD + +SLLH++ AHVEE +  ++      GG  VN +IADT
Sbjct  78    RYATVSDGLPVGFDRSLNHDTYQSSLLHVFYAHVEELVASLV---GRDGG--VNVMIADT  132

Query  565   FFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIEYVPGVRS  744
             FFV+P  +A+K+ L+ +SFWTE ALVF+LYYHL LLR++GHFG  + R+D I+Y+PGV +
Sbjct  133   FFVWPSVVARKFGLVCVSFWTEAALVFSLYYHLDLLRVHGHFGAQETRDDLIDYIPGVAA  192

Query  745   IDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQEKTSFFT  924
             I+ KD  SY+QET+T +V HQII+K+F+D +  DFVLCNT+Q+ E +T+ AL  K  F+ 
Sbjct  193   INPKDTASYLQETDTSSVVHQIIFKAFEDVKKVDFVLCNTIQQFEDKTIKALNSKIPFYA  252

Query  925   VGPIFPPVF--AQSAVATSL*SESDCEPLL  1008
             VGPI P       S+V TSL SESDC   L
Sbjct  253   VGPIIPFNLQSGSSSVTTSLWSESDCTQWL  282



>ref|NP_181234.1| UDP-glycosyltransferase 86A1 [Arabidopsis thaliana]
 sp|Q9SJL0.1|U86A1_ARATH RecName: Full=UDP-glycosyltransferase 86A1 [Arabidopsis thaliana]
 gb|AAD31582.1| putative glucosyltransferase [Arabidopsis thaliana]
 gb|AAL06924.1| At2g36970/T1J8.15 [Arabidopsis thaliana]
 gb|AAM91353.1| At2g36970/T1J8.15 [Arabidopsis thaliana]
 gb|AEC09329.1| UDP-glycosyltransferase 86A1 [Arabidopsis thaliana]
 gb|AHL38804.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=490

 Score =   296 bits (757),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 143/280 (51%), Positives = 201/280 (72%), Gaps = 13/280 (5%)
 Frame = +1

Query  187   QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD-DDIFSGI  363
             +KPH ++I YPLQGH+IP VHLA +LA  GFT+TF+NT S+H+H++ ++  D  DIFS  
Sbjct  7     RKPHIMMIPYPLQGHVIPFVHLAIKLASHGFTITFVNTDSIHHHISTAHQDDAGDIFSAA  66

Query  364   RKPGL-DIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPP  540
             R  G  DIRY T+SDG P ++DR++NHDQF   +LH++SAHV++ + K+    +    PP
Sbjct  67    RSSGQHDIRYTTVSDGFPLDFDRSLNHDQFFEGILHVFSAHVDDLIAKL----SRRDDPP  122

Query  541   VNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAI  720
             V CLIADTF+V+   +  K+ L+ +SFWTEPALV  LYYH+ LL  NGHF  +D R+D I
Sbjct  123   VTCLIADTFYVWSSMICDKHNLVNVSFWTEPALVLNLYYHMDLLISNGHFKSLDNRKDVI  182

Query  721   EYVPGVRSIDVKDLMSYIQ----ETETETVCHQIIYKSFQDARNADFVLCNTVQELEHET  888
             +YVPGV++I+ KDLMSY+Q    + +T TV ++I++K+F+D + ADFV+CNTVQELE ++
Sbjct  183   DYVPGVKAIEPKDLMSYLQVSDKDVDTNTVVYRILFKAFKDVKRADFVVCNTVQELEPDS  242

Query  889   VAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             ++ALQ K   + +GP+F      S V TSL +ESDC   L
Sbjct  243   LSALQAKQPVYAIGPVFS---TDSVVPTSLWAESDCTEWL  279



>ref|XP_008359642.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Malus domestica]
Length=522

 Score =   296 bits (759),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/278 (51%), Positives = 190/278 (68%), Gaps = 8/278 (3%)
 Frame = +1

Query  172  MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD---  342
            M D    PHAI++  PLQGH+IP  HLA +LA +GFT+TF+NT  +H+H+ KS P D   
Sbjct  46   MEDKASNPHAIMVPLPLQGHVIPFTHLATKLASQGFTLTFVNTQYIHHHILKSQPNDKTE  105

Query  343  DDIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSA  522
            DDIF+  RK GLDIRY T+SDG P  +DR  N DQF+   LH++ AHV+E +  ++ S  
Sbjct  106  DDIFATARKSGLDIRYTTVSDGFPLAFDRFQNLDQFLEGTLHVFPAHVDELVGDLVQSX-  164

Query  523  NSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCID  702
                P + CLI DTF  +   +A KY L++ISFWTEPALV  +YYHL LLR NGHFG  D
Sbjct  165  ----PSITCLIVDTFQSWSATIANKYNLIHISFWTEPALVLNIYYHLDLLRKNGHFGAHD  220

Query  703  VREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEH  882
             RED I+Y+P V++I+ +DLMS +Q T+      +I YK+F++ + ADF+LCNTVQELE 
Sbjct  221  NREDIIDYIPSVKAIEPRDLMSXLQTTDLFCPMLRIFYKAFREVKRADFILCNTVQELEF  280

Query  883  ETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDC  996
            E+++ALQ K   + +GP+FP    ++ VAT+L  E DC
Sbjct  281  ESLSALQAKQPTYAIGPVFPDSLTKNIVATNLMPEFDC  318



>ref|XP_009143540.1| PREDICTED: UDP-glycosyltransferase 86A1 [Brassica rapa]
Length=484

 Score =   295 bits (756),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 144/280 (51%), Positives = 199/280 (71%), Gaps = 12/280 (4%)
 Frame = +1

Query  187   QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD-DDIFSGI  363
             +KPHA++I YPLQGH+IP VHLA +LA  GFT+TF+NT S+H+ ++ +   D  DIFS  
Sbjct  7     RKPHAMMIPYPLQGHVIPFVHLAIKLASHGFTITFVNTDSIHHQISTARQGDAGDIFSEA  66

Query  364   RKP-GLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPP  540
             R    LDIRY T+SDG P E+DR++NHDQF   ++H++ AHV++ + KI   S     PP
Sbjct  67    RSSENLDIRYTTVSDGFPLEFDRSLNHDQFFEGIIHVFPAHVDDLITKI---SRRGDDPP  123

Query  541   VNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAI  720
             V CLI DTF+V+   + +K+ L+ +SFWTEPALV  LYYH+HLL  NGHF  +D RED I
Sbjct  124   VTCLINDTFYVWSSMICEKHNLVNVSFWTEPALVLNLYYHMHLLISNGHFKSLDNREDVI  183

Query  721   EYVPGVRSIDVKDLMSYIQ----ETETETVCHQIIYKSFQDARNADFVLCNTVQELEHET  888
             +Y+PGV +I+ KDLMSY+Q    + +T TV ++II+K+F D + ADFVLCNTVQELE ++
Sbjct  184   DYIPGVNAIEPKDLMSYLQVSDKDVDTNTVVYRIIFKAFTDVKKADFVLCNTVQELEPDS  243

Query  889   VAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             ++ALQ     + +GP+   + ++S V TSL +ESDC   L
Sbjct  244   LSALQANQPVYAIGPV---ISSESVVPTSLWTESDCTEWL  280



>ref|XP_008350360.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Malus domestica]
Length=477

 Score =   295 bits (754),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/278 (51%), Positives = 190/278 (68%), Gaps = 8/278 (3%)
 Frame = +1

Query  172  MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD---  342
            M D    PHAI++  PLQGH+ P  HLA +LA +GFT+TF+NT  +H+H+ KS P D   
Sbjct  1    MEDKASNPHAIMVPLPLQGHVTPLTHLATKLASQGFTITFVNTQYIHHHILKSQPNDNTE  60

Query  343  DDIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSA  522
            DDIF+  RK GLDIRY T+SDG P  ++R  N DQ +   LH++ AHV+E +  ++ S  
Sbjct  61   DDIFATARKSGLDIRYTTVSDGFPLAFNRIQNLDQSLEGALHVFPAHVDELVGBLVQSD-  119

Query  523  NSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCID  702
                P + CLI DTF  +   +A KY L++ISFWTEPALVF +YYHL LL+ NGHFG  D
Sbjct  120  ----PSITCLIVDTFQSWSATIANKYNLIHISFWTEPALVFNIYYHLDLLQKNGHFGSHD  175

Query  703  VREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEH  882
             RED I+Y+PGV++I+ KDLMS+IQ T+      +  YKSF++ + ADF+LCNTVQELE 
Sbjct  176  NREDIIDYIPGVKAIEPKDLMSHIQSTDLFCPMLRTFYKSFREVKKADFILCNTVQELEF  235

Query  883  ETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDC  996
            E+++ALQ K   + +GP+FP    ++ VAT+L  E DC
Sbjct  236  ESLSALQAKQPTYPIGPVFPDNLTKNIVATNLMPEFDC  273



>ref|XP_006352303.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 86A2-like 
[Solanum tuberosum]
Length=478

 Score =   295 bits (754),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 157/254 (62%), Positives = 196/254 (77%), Gaps = 8/254 (3%)
 Frame = +1

Query  241  SVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIRKPGLDIRYVTISDGLPPE  420
            ++HLA +LA+KGFT+TFINT S HY +T+ N   D  +S      LDIRY+T+SDGLP  
Sbjct  33   TIHLAVKLAQKGFTITFINTESTHYQITQKNSNIDIFYSVQGHQELDIRYMTVSDGLPVN  92

Query  421  WDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPVNCLIADTFFVFPGKLAKKY  600
            +DR++NH QFMASLLH++SAHVEEAL K+  S  +   PPV CLIAD+FFVFPGKL KKY
Sbjct  93   FDRSLNHHQFMASLLHVFSAHVEEALVKLEESKLD---PPVTCLIADSFFVFPGKLTKKY  149

Query  601  KLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIEYVPGVRSIDVKD--LMSYI  774
             LLY+ FWTEPALVFTLYYHLHLL L+GHFGCID+RED I+Y+PGV+SI  KD  LMSY+
Sbjct  150  GLLYLYFWTEPALVFTLYYHLHLLMLHGHFGCIDMREDPIDYIPGVQSIKPKDLILMSYL  209

Query  775  QETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQEKTSFFTVGPIFPPVFA  954
            QET+T  +CHQII+ +F D RN DF+LC    EL++E ++ALQ +  F+ +GPIFPP F 
Sbjct  210  QETDTTXMCHQIIFNAFNDVRNTDFILC---XELKYEIISALQIEKPFYAIGPIFPPEFT  266

Query  955  QSAVATSL*SESDC  996
            +S V TS+  ESDC
Sbjct  267  KSCVTTSMWFESDC  280



>ref|XP_010907028.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Elaeis guineensis]
Length=469

 Score =   294 bits (753),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/281 (51%), Positives = 197/281 (70%), Gaps = 8/281 (3%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKS--NPRDD  345
             M D  +KPHA+LI  P QGHI P+V LA +LA KGFT+TF+NT + +Y ++++  +P + 
Sbjct  1     MVDPDRKPHAVLIPMPFQGHIFPAVQLAIKLASKGFTITFVNTEATNYQISQAHHSPINH  60

Query  346   DIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSAN  525
             DIFS  R  GLDIRY  ISDGLP  +DR+ N +Q   + L+++S HVE  ++K+L +S  
Sbjct  61    DIFSDARASGLDIRYELISDGLPTSYDRSRNDEQLWYAYLYLFSTHVEALMQKLLLTS--  118

Query  526   SGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDV  705
                PPV CLIADTFFV+P  +AKK  L Y+SFWTEPA VFTL+YH+ LL  +GH  C + 
Sbjct  119   ---PPVTCLIADTFFVWPSTMAKKLGLTYVSFWTEPATVFTLFYHMDLLIAHGHHACQEN  175

Query  706   REDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHE  885
             R+D I Y+PGV +I+  DLMSY+Q  +   +  Q+++K+ ++ + ADFVLCNT +ELE E
Sbjct  176   RKDTITYIPGVPAIEPTDLMSYLQ-LDIPPMPRQMLFKAMEETKGADFVLCNTAEELELE  234

Query  886   TVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             T++ALQ +  F+ VGPIFP  F +S VA +L +ESDC   L
Sbjct  235   TISALQREKPFYAVGPIFPVDFTRSTVAATLWTESDCSQWL  275



>ref|XP_007207842.1| hypothetical protein PRUPE_ppa023014mg [Prunus persica]
 gb|EMJ09041.1| hypothetical protein PRUPE_ppa023014mg [Prunus persica]
Length=486

 Score =   295 bits (754),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/285 (49%), Positives = 196/285 (69%), Gaps = 9/285 (3%)
 Frame = +1

Query  166   KAMADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD-  342
             +A+ D   +PHAI++  PLQGH++P  HLA +LA  GFT+TF+NT  +H+ ++KS P D 
Sbjct  7     RAVEDKHSQPHAIMVPMPLQGHLLPHTHLAMKLASNGFTITFVNTQHIHHQISKSQPNDT  66

Query  343   ---DDIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILT  513
                DDIF+  RK GLDIRY T+SDG P  ++R  NH+Q +  LL+++ AHV+E +  ++ 
Sbjct  67    EDQDDIFATARKSGLDIRYKTVSDGFPLAFNRFQNHNQAVEGLLYVFPAHVDELVGNLVQ  126

Query  514   SSANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFG  693
             S      P V CLI DTF  +   +A KY L+ ISFWTEPALV ++YYHL LLR  GH+G
Sbjct  127   SD-----PSVTCLIVDTFHPWSATIANKYNLVNISFWTEPALVLSIYYHLDLLRERGHYG  181

Query  694   CIDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQE  873
               D RED ++Y+PGV++I+ KDLMS++QE +  T  H+ ++K+F + + ADF+LCNTVQE
Sbjct  182   SHDNREDTVDYIPGVQAIEPKDLMSHLQEADISTPMHRALHKAFHEVQRADFILCNTVQE  241

Query  874   LEHETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             LE  T++ALQEK   + +GP+ P    +S VAT+L SE DC   L
Sbjct  242   LESNTLSALQEKQHTYAIGPVSPNNPTKSIVATNLMSEFDCTEWL  286



>ref|XP_008243981.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Prunus mume]
Length=480

 Score =   294 bits (753),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 143/277 (52%), Positives = 192/277 (69%), Gaps = 9/277 (3%)
 Frame = +1

Query  190   KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNP----RDDDIFS  357
             KPHAIL+  PLQGH+IP  +LA +LA  GFT+TF+NT  +H+ +TKS P    + DDIF+
Sbjct  9     KPHAILVPLPLQGHVIPFTNLAVKLASNGFTITFVNTQYIHHQITKSQPNNKTKQDDIFA  68

Query  358   GIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGP  537
               RK GLDIRY T+SDG P  ++R  N DQF+   LH+Y AHV+E +  ++ S      P
Sbjct  69    AARKAGLDIRYKTVSDGFPLAFNRFQNLDQFLEGHLHVYPAHVDELVGDLVQSD-----P  123

Query  538   PVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDA  717
              + C IADTF  +P  +A KY L+ +SFWT+PALV ++YYHL LLR NGHFG  D RED 
Sbjct  124   SITCFIADTFHTWPETIANKYNLVNVSFWTQPALVLSIYYHLDLLRQNGHFGFHDKREDI  183

Query  718   IEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAA  897
             I+Y+PGV++I+ KDLMS++Q T+  +   +IIYK+F + + ADF+L N VQELE ET++A
Sbjct  184   IDYIPGVQAIEPKDLMSHLQTTDLLSPMLRIIYKAFHEVKRADFILINAVQELESETLSA  243

Query  898   LQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             L EK   + +GP+FP    +S VAT+L SE DC   L
Sbjct  244   LHEKQPTYAIGPVFPSKTTKSIVATNLMSEFDCTQWL  280



>ref|XP_006294108.1| hypothetical protein CARUB_v10023101mg [Capsella rubella]
 gb|EOA27006.1| hypothetical protein CARUB_v10023101mg [Capsella rubella]
Length=486

 Score =   295 bits (754),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 194/269 (72%), Gaps = 9/269 (3%)
 Frame = +1

Query  208   ISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIR-KPGLDI  384
             I YP QGH+ P V LA +LA +G TVTF+NTH +H+ +T  N  D DIF+G+R + GLDI
Sbjct  23    IPYPFQGHVNPFVQLAIKLASQGITVTFVNTHYIHHQIT--NGSDGDIFAGVRSESGLDI  80

Query  385   RYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPVNCLIADT  564
             RY T+SDGLP  +DR++NHD + +SLLH++ AHVEE     L +S   G   VN +IADT
Sbjct  81    RYATVSDGLPVGFDRSLNHDTYQSSLLHVFYAHVEE-----LVASLVGGDDGVNVMIADT  135

Query  565   FFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIEYVPGVRS  744
             FFV+P  +A+K+ L+ +SFWTE ALVF+LYYH+ LLR +GHFG  + R D I+Y+PGV +
Sbjct  136   FFVWPSVVARKFGLVCVSFWTEAALVFSLYYHMDLLRSHGHFGSQETRRDLIDYIPGVAA  195

Query  745   IDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQEKTSFFT  924
             I+ KD  SY+QET+T +V HQII+K+F+D +  DFVLCNT+Q+ E +T+ AL  K  F+ 
Sbjct  196   INPKDTASYLQETDTSSVVHQIIFKAFEDVKKVDFVLCNTIQQFEDKTIKALNSKIPFYA  255

Query  925   VGPIFP-PVFAQSAVATSL*SESDCEPLL  1008
             VGPI P  + + S+V TSL SESDC   L
Sbjct  256   VGPIIPLHLQSGSSVTTSLWSESDCTQWL  284



>gb|KDP29154.1| hypothetical protein JCGZ_16543 [Jatropha curcas]
Length=482

 Score =   294 bits (753),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 148/286 (52%), Positives = 203/286 (71%), Gaps = 12/286 (4%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKS-----NP  336
             M D+ +KPHAIL+  PLQGHIIP VHLA  LA KGFT+TFINT   HY +TK+     N 
Sbjct  1     MEDNQEKPHAILMPCPLQGHIIPFVHLAINLASKGFTITFINTEFTHYRITKATTSANNQ  60

Query  337   RDDDIFSGIRKP-GLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILT  513
                DIF+  R   G DIRY  +SDG P  +DRAVN +QF+  +L+I+SAHV++ + K+  
Sbjct  61    EYYDIFTEARTQFGFDIRYRIVSDGFPLVFDRAVNREQFLKGMLYIFSAHVDDLVGKLEQ  120

Query  514   SSANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFG  693
             ++     P + CL+ADTF+V+P  +AKKY L+ ISFWTEPAL F+LYYH  LL++NGHFG
Sbjct  121   NTK----PKITCLLADTFYVWPSMVAKKYNLVNISFWTEPALDFSLYYHWDLLKINGHFG  176

Query  694   CIDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQE  873
               D RED  +Y+PGV +I+ KDL SY+Q+T+T T+ +++IYK +++ + ADF++CNT+QE
Sbjct  177   YYDNREDTRKYIPGVEAIEPKDLPSYLQDTQTTTM-NKMIYKGYENVKEADFIICNTIQE  235

Query  874   LEHETVAALQEKTSFFTVGPIF-PPVFAQSAVATSL*SESDCEPLL  1008
             LE + ++AL EK  F+++GPIF    F   ++ TSL SESDC   L
Sbjct  236   LEPKPISALNEKQPFYSIGPIFLLNGFTNISIPTSLWSESDCTQWL  281



>ref|XP_007206708.1| hypothetical protein PRUPE_ppa024090mg [Prunus persica]
 gb|EMJ07907.1| hypothetical protein PRUPE_ppa024090mg [Prunus persica]
Length=480

 Score =   294 bits (752),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 145/277 (52%), Positives = 192/277 (69%), Gaps = 9/277 (3%)
 Frame = +1

Query  190   KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNP----RDDDIFS  357
             KPHAIL+  PLQGH+IP  +LA +LA  GFT+TF+NT  +H+ +TKS P    + DDIF+
Sbjct  9     KPHAILVPLPLQGHVIPFTNLAMKLASNGFTITFVNTQYIHHQITKSQPNNKTKQDDIFA  68

Query  358   GIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGP  537
               RK GLDIRY T+SDG P  ++R  N DQF+   LH+Y AHV+E +  ++ S      P
Sbjct  69    AARKSGLDIRYKTVSDGFPLAFNRFQNLDQFLEGHLHVYPAHVDELVGDLVQSD-----P  123

Query  538   PVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDA  717
              + C IADTF  +P  +A KY L+ ISFWTEPALV ++YYHL LLR NGHFG  D  ED 
Sbjct  124   SITCFIADTFHTWPETIANKYNLVNISFWTEPALVLSIYYHLDLLRQNGHFGSHDKCEDI  183

Query  718   IEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAA  897
             I+Y+PGV++I+ KDLMS++Q T+  +   +IIYK+F + + ADF+L NTVQELE ET++A
Sbjct  184   IDYIPGVQAIEPKDLMSHLQATDLLSPMLRIIYKAFHEIKRADFILINTVQELESETLSA  243

Query  898   LQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             L EK   + +GP+FP    +S VAT+L SE DC   L
Sbjct  244   LHEKQPTYAIGPVFPSKTTKSIVATNLMSEFDCTQWL  280



>ref|XP_010505248.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Camelina sativa]
Length=497

 Score =   294 bits (753),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 144/280 (51%), Positives = 197/280 (70%), Gaps = 13/280 (5%)
 Frame = +1

Query  187   QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD-DDIFSGI  363
             +KPH ++I YPLQGH+IP VHLA +LA  GFT+TF+NT S+H+H++ +   D  DIFS  
Sbjct  7     RKPHIMMIPYPLQGHVIPFVHLAIKLASHGFTITFVNTDSIHHHISTARQGDAGDIFSAA  66

Query  364   RKPG-LDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPP  540
             R  G LDIRY T++DG P  +DR++NHDQF   +LH++SAHV++ + K+     +    P
Sbjct  67    RNSGKLDIRYTTVTDGFPLGFDRSLNHDQFFEGILHVFSAHVDDLIAKLSLQDDH----P  122

Query  541   VNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAI  720
             V CLIAD F+V+   +  K+ L+ +SFWTEPALV  LYYH+ LL  NGHF C++ RED I
Sbjct  123   VTCLIADAFYVWSSMICDKHNLVNVSFWTEPALVLNLYYHMDLLISNGHFKCLENREDVI  182

Query  721   EYVPGVRSIDVKDLMSYIQ----ETETETVCHQIIYKSFQDARNADFVLCNTVQELEHET  888
             +YVPGV+ I+ KDLMSY+Q    + +T TV +QI+ K+F+D + ADFVLCNTVQELE ++
Sbjct  183   DYVPGVKEIEPKDLMSYLQASDKDVDTNTVVYQILSKAFKDVKRADFVLCNTVQELEPDS  242

Query  889   VAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             ++ALQ K   + +GP+F      S V TSL +ESDC   L
Sbjct  243   LSALQAKQPVYAIGPVFS---TDSVVPTSLWAESDCTEWL  279



>ref|XP_009376816.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Pyrus x bretschneideri]
Length=477

 Score =   294 bits (752),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 141/278 (51%), Positives = 188/278 (68%), Gaps = 8/278 (3%)
 Frame = +1

Query  172  MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD---  342
            M D    PHAI++   LQGH+IP  HLA +LA +GFT+TF+NTH +H+H+ KS P D   
Sbjct  1    MEDKASNPHAIMVPLSLQGHVIPFTHLAMKLASQGFTITFVNTHYIHHHILKSQPNDNTE  60

Query  343  DDIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSA  522
            DDIF+  RK GLDIRY T+SDG P  +DR  N DQF+   LH++ AHV+E +  ++ S  
Sbjct  61   DDIFATARKSGLDIRYTTVSDGFPLAFDRFQNLDQFLEGALHVFPAHVDELVGDLVQSD-  119

Query  523  NSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCID  702
                P + CLI DTF  +   +A KY L++ISFWTEPALV  +YYHL LLR NGHFG  D
Sbjct  120  ----PSITCLIVDTFQSWSATIANKYNLIHISFWTEPALVLNIYYHLDLLRKNGHFGAHD  175

Query  703  VREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEH  882
              ED I+Y+P V++I+ KDLMSY+Q T+      +I YK+F++ + ADF+LCNTVQELE 
Sbjct  176  NCEDIIDYIPSVKAIEPKDLMSYLQTTDIFCPMLRIYYKAFREVKRADFILCNTVQELEF  235

Query  883  ETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDC  996
            E+++ALQ K   + +GP+ P     + VAT+L  E DC
Sbjct  236  ESLSALQAKQPTYAIGPVLPDSLTNNIVATNLMPEFDC  273



>emb|CDX77151.1| BnaC04g39460D [Brassica napus]
Length=480

 Score =   294 bits (752),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 142/273 (52%), Positives = 196/273 (72%), Gaps = 14/273 (5%)
 Frame = +1

Query  196   HAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIR-KP  372
             HA+LI YP QGH+ P VHLA +LA +G TVTF+NTH  H+ +        DIF+G+R + 
Sbjct  17    HALLIPYPFQGHVNPFVHLAIKLASQGITVTFVNTHYNHHQINSG-----DIFAGVRSES  71

Query  373   GLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPVNCL  552
             GLDIRY T+SDGLP  ++R++NHDQ+ +SLLH++SAHVEE ++ ++       G  VN +
Sbjct  72    GLDIRYATVSDGLPLGFNRSLNHDQYQSSLLHVFSAHVEELVESLV-------GEGVNVM  124

Query  553   IADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIEYVP  732
             IADTFFV+P  +A+K+ L+ +SFWTE ALVF+LYYH+ LLR++GHFG  + R D I+Y+P
Sbjct  125   IADTFFVWPSVVARKFGLVCVSFWTEAALVFSLYYHMDLLRIHGHFGAQETRRDLIDYIP  184

Query  733   GVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQEKT  912
             GV +I+ KD  SY+QET+  +V HQII+K+F+D +  DFVLCNT+ + E +T+ AL  K 
Sbjct  185   GVEAINPKDTASYLQETDISSVVHQIIFKAFEDVKKVDFVLCNTIHQFESKTIRALNSKI  244

Query  913   SFFTVGPIFP-PVFAQSAVATSL*SESDCEPLL  1008
              F+ +GPI P  +   S+V TSL SESDC   L
Sbjct  245   PFYAIGPIIPFNLKTGSSVTTSLWSESDCTQWL  277



>emb|CDY30510.1| BnaA04g16230D [Brassica napus]
Length=480

 Score =   294 bits (752),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 142/276 (51%), Positives = 197/276 (71%), Gaps = 14/276 (5%)
 Frame = +1

Query  187   QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIR  366
              + HA+LI YP QGH+ P VHLA +LA +G TVTF+NTH  H+ +        DIF+G+R
Sbjct  14    HRLHALLIPYPFQGHVNPFVHLAIKLASQGITVTFVNTHYNHHQINSG-----DIFAGVR  68

Query  367   -KPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPV  543
              + GLDIRY T+SDGLP  +DR++NHDQ+ ++LLH++SAHVEE ++ ++       G  V
Sbjct  69    SESGLDIRYATVSDGLPLGFDRSLNHDQYQSALLHVFSAHVEELVESLV-------GEGV  121

Query  544   NCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIE  723
             N +IADTFFV+P  +A+K+ L+ +SFWTE ALVF+LYYH+ LLR++GHFG  + R D I+
Sbjct  122   NVMIADTFFVWPSVVARKFGLVCVSFWTEAALVFSLYYHMDLLRIHGHFGAQETRRDLID  181

Query  724   YVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQ  903
             Y+PGV +I+ KD  SY+QET+  +V HQII+K+F+D +  DFVLCNT+ + E +T+ AL 
Sbjct  182   YIPGVEAINPKDTASYLQETDISSVVHQIIFKAFEDVKKVDFVLCNTIHQFESKTIHALN  241

Query  904   EKTSFFTVGPIFP-PVFAQSAVATSL*SESDCEPLL  1008
              K  F+ +GPI P  +   S+V TSL SESDC   L
Sbjct  242   SKIPFYAIGPIIPFNLKTGSSVTTSLWSESDCTQWL  277



>ref|XP_009140842.1| PREDICTED: UDP-glycosyltransferase 86A2 [Brassica rapa]
Length=480

 Score =   293 bits (751),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 142/276 (51%), Positives = 197/276 (71%), Gaps = 14/276 (5%)
 Frame = +1

Query  187   QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIR  366
              + HA+LI YP QGH+ P VHLA +LA +G TVTF+NTH  H+ +        DIF+G+R
Sbjct  14    HRLHALLIPYPFQGHVNPFVHLAIKLASQGITVTFVNTHYNHHQINSG-----DIFAGVR  68

Query  367   -KPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPV  543
              + GLDIRY T+SDGLP  +DR++NHDQ+ ++LLH++SAHVEE ++ ++       G  V
Sbjct  69    SESGLDIRYATVSDGLPLGFDRSLNHDQYQSALLHVFSAHVEELVESLV-------GEGV  121

Query  544   NCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIE  723
             N +IADTFFV+P  +A+K+ L+ +SFWTE ALVF+LYYH+ LLR++GHFG  + R D I+
Sbjct  122   NVMIADTFFVWPSVVARKFGLVCVSFWTEAALVFSLYYHMDLLRIHGHFGAQETRRDLID  181

Query  724   YVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQ  903
             Y+PGV +I+ KD  SY+QET+  +V HQII+K+F+D +  DFVLCNT+ + E +T+ AL 
Sbjct  182   YIPGVEAINPKDTASYLQETDISSVVHQIIFKAFEDVKKVDFVLCNTIHQFESKTIHALN  241

Query  904   EKTSFFTVGPIFP-PVFAQSAVATSL*SESDCEPLL  1008
              K  F+ +GPI P  +   S+V TSL SESDC   L
Sbjct  242   SKIPFYAIGPIIPFNLKTGSSVTTSLWSESDCTQWL  277



>ref|XP_006367686.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Solanum tuberosum]
Length=485

 Score =   293 bits (751),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 143/281 (51%), Positives = 202/281 (72%), Gaps = 12/281 (4%)
 Frame = +1

Query  187   QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTK---SNPRDD---D  348
             QKPHAIL  YPLQGH+IP V+LA +LA  GFT+TFINT S+H  ++K   SN  D+   D
Sbjct  8     QKPHAILFPYPLQGHVIPFVNLAIKLASNGFTITFINTQSIHQQISKAGRSNINDNESND  67

Query  349   IFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANS  528
             +FSG RK GLDIR V+I DG   ++DR++NHD+F  ++L+ +  HV+E +  ++ S+   
Sbjct  68    LFSGARKSGLDIRDVSIYDGFSVDFDRSLNHDEFFEAILNDFVFHVDEVVGTLMLSN---  124

Query  529   GGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCI-DV  705
               P  N LIADTF+V+   +AKKY L+ +S+WTEPALVF++YYH+ LL+ NGH+ CI + 
Sbjct  125   --PSPNILIADTFYVWSSTIAKKYNLVNVSYWTEPALVFSVYYHMDLLKQNGHYDCIENK  182

Query  706   REDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHE  885
             RED I+Y+PGV++I   DL SY+Q  +T  V ++II ++F++ +N DF++CNTVQELE E
Sbjct  183   REDIIDYIPGVKAIKPTDLPSYLQSDDTNMVVNRIIKRAFKEVKNVDFIICNTVQELEPE  242

Query  886   TVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             T+ +LQ+  S + +GPIF P F  + V+TSL SES+C   L
Sbjct  243   TITSLQKYHSIYAIGPIFSPGFTNTFVSTSLWSESNCTDWL  283



>ref|XP_008644820.1| PREDICTED: UDP-glycosyltransferase 86A1 [Zea mays]
 gb|AFW68687.1| hypothetical protein ZEAMMB73_327986 [Zea mays]
Length=494

 Score =   293 bits (750),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 143/288 (50%), Positives = 196/288 (68%), Gaps = 19/288 (7%)
 Frame = +1

Query  184   GQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIF---  354
             G KPHA++++YPLQGH+IP VHLA RLA +GF VTF++T +VH    ++   D D +   
Sbjct  15    GGKPHAVVVAYPLQGHVIPVVHLALRLAARGFAVTFVSTEAVHDQTARALGVDPDGYDPF  74

Query  355   ---------SGIRKPGL-DIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKK  504
                       G   P L D+ Y  +SDGLP  +DR++NHD FM +L H   AHVE+ L++
Sbjct  75    AAARARAQEEGPPPPPLGDVSYALVSDGLPVGFDRSLNHDDFMGALFHALPAHVEQLLRR  134

Query  505   ILTSSANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNG  684
             ++        P    L+ADTFFV+P  LA++  + Y+SFWTEPAL+F LYYH+ LL  NG
Sbjct  135   VVVE------PRATFLVADTFFVWPATLARRLGIAYVSFWTEPALIFNLYYHIDLLTQNG  188

Query  685   HFGCIDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNT  864
             HF C + R+D I Y+PGV +I+  +LMSY+QET+T ++ H+II+K+F +AR AD+VLCNT
Sbjct  189   HFRCNEPRKDTITYIPGVAAIEPSELMSYLQETDTTSIVHRIIFKAFDEARGADYVLCNT  248

Query  865   VQELEHETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             V+ELE  T+AAL+    F+ VGPI P  FA+SAVATS+ +ESDC   L
Sbjct  249   VEELEPSTIAALRAYRPFYAVGPILPAGFARSAVATSMWAESDCSRWL  296



>ref|XP_009376817.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Pyrus x bretschneideri]
Length=477

 Score =   292 bits (748),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/278 (50%), Positives = 189/278 (68%), Gaps = 8/278 (3%)
 Frame = +1

Query  172  MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD---  342
            M D    PHAI++  PLQGH+ P  HLA +LA +GFT+TF+NT  +H+H+ KS P D   
Sbjct  1    MEDKASTPHAIMVPLPLQGHVNPLTHLATKLASQGFTITFVNTQYIHHHILKSQPNDNTE  60

Query  343  DDIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSA  522
            DDIF+  RK GLDIRY T+SDG P  +DR  N DQ +   LH++ AHV+E +  ++ S  
Sbjct  61   DDIFAMARKSGLDIRYTTVSDGFPLVFDRIQNLDQSLEGALHVFPAHVDELVGNLVQSD-  119

Query  523  NSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCID  702
                P + CLI DTF  +   +A KY L++ISFWT+PALVF +YYHL LL+ NGHFG  D
Sbjct  120  ----PSITCLIVDTFQSWSATIANKYNLIHISFWTQPALVFNIYYHLDLLKKNGHFGSHD  175

Query  703  VREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEH  882
             RED I+Y+PGV++I+ KDLMS++Q T+  +   +  YKSF++ + ADF+LCNTVQELE 
Sbjct  176  NREDIIDYIPGVKAIEPKDLMSHLQSTDLFSPMLRTFYKSFREVKRADFILCNTVQELEF  235

Query  883  ETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDC  996
            E+++ALQ K   + +GP+ P     + VAT+L  E DC
Sbjct  236  ESLSALQAKQPTYAIGPVLPDSLTNNIVATNLMPEFDC  273



>ref|XP_006409826.1| hypothetical protein EUTSA_v10016590mg [Eutrema salsugineum]
 gb|ESQ51279.1| hypothetical protein EUTSA_v10016590mg [Eutrema salsugineum]
Length=478

 Score =   291 bits (744),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 139/268 (52%), Positives = 189/268 (71%), Gaps = 13/268 (5%)
 Frame = +1

Query  208   ISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIR-KPGLDI  384
             I YP QGH+ P VHLA +LA +G TVTF+NTH  H+ +        DIF+G+R + GLDI
Sbjct  20    IPYPFQGHVNPFVHLAIKLASQGITVTFVNTHYNHHQINSG-----DIFAGVRSESGLDI  74

Query  385   RYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPVNCLIADT  564
             RY T+SDGLP  +DR++NHDQ+ +SLLH++SAHVEE +  ++       G  VN +IADT
Sbjct  75    RYATVSDGLPIGFDRSLNHDQYQSSLLHVFSAHVEELVASLV-------GEGVNVMIADT  127

Query  565   FFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIEYVPGVRS  744
             FFV+P  +A+K+ L+ +SFWTE ALVF+LYYH+ LLR++GHFG  + R D I+Y+PGV +
Sbjct  128   FFVWPSVVARKFGLVCVSFWTEAALVFSLYYHMDLLRIHGHFGAQETRGDLIDYIPGVEA  187

Query  745   IDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQEKTSFFT  924
             I+ KD  SY+QET+  +V HQII+K+F+D +  DFVLCNT+ + E +T+ AL  K  F+ 
Sbjct  188   INPKDTASYLQETDISSVVHQIIFKAFEDVKKVDFVLCNTIHQFESKTIQALNSKIPFYA  247

Query  925   VGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             +GPI P      +V TSL SESDC   L
Sbjct  248   IGPIIPFNLQTGSVTTSLWSESDCTQWL  275



>ref|XP_009143541.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Brassica rapa]
Length=479

 Score =   291 bits (744),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 141/280 (50%), Positives = 194/280 (69%), Gaps = 12/280 (4%)
 Frame = +1

Query  187   QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD-DDIFSGI  363
             +KPHA++I +PLQGH+IP VHLA +LA  GFT+TF+NT S+H+ ++ +   D  DIFS  
Sbjct  7     RKPHAMMIPFPLQGHVIPFVHLAIKLASHGFTITFVNTDSIHHQISTARQGDAGDIFSEA  66

Query  364   RKP-GLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPP  540
             R    LDIRY T+SDG P E+DR++NHDQF   L H++ AHV++ + KI   S     PP
Sbjct  67    RSSENLDIRYTTVSDGFPLEFDRSLNHDQFFEGLFHVFPAHVDDLITKI---SRRGDDPP  123

Query  541   VNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAI  720
             V C IADTF+V+   +  K+ L+ +SFWT+PAL   +YYHLHLL  NGHF  +D RED I
Sbjct  124   VTCFIADTFYVWSSMICNKHNLVNVSFWTQPALALNIYYHLHLLISNGHFNSLDNREDVI  183

Query  721   EYVPGVRSIDVKDLMSYIQ----ETETETVCHQIIYKSFQDARNADFVLCNTVQELEHET  888
             +Y+PGV++ID KDLMSY+Q    + +T  V ++II+++F D + ADFVLCNTVQELE ++
Sbjct  184   DYIPGVKAIDPKDLMSYLQVSDKDVDTNRVVYRIIFEAFTDVKKADFVLCNTVQELEPDS  243

Query  889   VAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             ++ALQ     + +GP+F     +  V TSL +ESDC   L
Sbjct  244   LSALQANQPVYAIGPVFS---TELVVPTSLWAESDCTEWL  280



>ref|XP_010509409.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Camelina sativa]
Length=490

 Score =   291 bits (744),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 142/280 (51%), Positives = 199/280 (71%), Gaps = 13/280 (5%)
 Frame = +1

Query  187   QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDD-DIFSGI  363
             +K H ++I YPLQGH+IP VHLA +LA  GFT+TF+NT SVH++++ ++  D+ DIFS  
Sbjct  7     RKSHIMMIPYPLQGHVIPFVHLAIKLASHGFTITFVNTESVHHNISTAHQGDEGDIFSAA  66

Query  364   RKPG-LDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPP  540
             R  G LDIRY T++DG P  +DR++NHDQF   +LH++SAHV++ + K+    +     P
Sbjct  67    RSSGQLDIRYTTVTDGFPLGFDRSLNHDQFFEGILHVFSAHVDDLIAKL----SRQDDHP  122

Query  541   VNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAI  720
             V CLIADTF+V+   +  K+ L+ +SFWTEPALV  LYYH+ LL  NGHF C++ RED I
Sbjct  123   VTCLIADTFYVWSSMICDKHNLVNVSFWTEPALVLNLYYHMDLLISNGHFKCLENREDVI  182

Query  721   EYVPGVRSIDVKDLMSYIQ----ETETETVCHQIIYKSFQDARNADFVLCNTVQELEHET  888
             +YVPGV++I+ KDLMSY+Q    + +T T  +QI+ K+F+D + AD+VLCNTVQELE ++
Sbjct  183   DYVPGVKAIEPKDLMSYLQVSDKDVDTNTTVYQILSKAFKDVKRADYVLCNTVQELEPDS  242

Query  889   VAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             ++ALQ K   + +GP+F      S V TSL +ESDC   L
Sbjct  243   LSALQAKQPVYAIGPVFS---TDSVVPTSLWAESDCTEWL  279



>ref|XP_004249621.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Solanum lycopersicum]
Length=498

 Score =   284 bits (727),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 136/281 (48%), Positives = 200/281 (71%), Gaps = 12/281 (4%)
 Frame = +1

Query  187   QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKS------NPRDDD  348
             QKPHAIL  YPLQGH+IP V+LA +LA  GFT+TFINT S+H  ++K+      +  ++D
Sbjct  8     QKPHAILFPYPLQGHVIPFVNLAIKLASNGFTITFINTQSIHQQISKAGRSNVIDNENND  67

Query  349   IFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANS  528
             +FS   K GLDIR V+I DG P ++DR++NHD+F  ++++ +  HV+E + K++ S+   
Sbjct  68    LFSCACKSGLDIRDVSIYDGFPVDYDRSLNHDKFFEAIMNDFVFHVDEVVGKLMLSN---  124

Query  529   GGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCI-DV  705
               P  N LI DTF+V+   +AKKY L+ +S+WTEPALVF++YYH+ LL+ NGH+ CI + 
Sbjct  125   --PSPNILIGDTFYVWSSTIAKKYSLVNVSYWTEPALVFSVYYHMDLLKQNGHYDCIENK  182

Query  706   REDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHE  885
             RED I+Y+PGV++I   DL SY+Q  +T  V ++II ++F++ +  DF++CNTV ELE E
Sbjct  183   REDIIDYIPGVKAIKPTDLPSYLQSDDTNMVVNRIIKRAFKEVQIVDFIICNTVHELEPE  242

Query  886   TVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
              + ALQ+  S +++GPIF P F  ++V+TSL SES+C   L
Sbjct  243   IITALQKYLSIYSIGPIFSPGFTNTSVSTSLWSESNCTDWL  283



>ref|XP_011094625.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Sesamum indicum]
Length=487

 Score =   282 bits (721),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/280 (49%), Positives = 191/280 (68%), Gaps = 11/280 (4%)
 Frame = +1

Query  187   QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPR------DDD  348
             ++PH I+I  P QGHI PSV L  +LA +GFTVTF+NT   H  + KS         DDD
Sbjct  11    KRPHFIIIPPPFQGHINPSVQLTLKLASRGFTVTFVNTEFSHDQIKKSRKHLSNGEDDDD  70

Query  349   IFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANS  528
             IF+G R+ GLDIRY T+SDG P  +DR+++ DQF+   +H+  AHV++ + K++ S    
Sbjct  71    IFAGSRESGLDIRYRTVSDGFPLSFDRSLHRDQFVEGRIHVSPAHVDDLVGKLMASD---  127

Query  529   GGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVR  708
               PP  CL+AD+F  +   +A KY L+ +SFWT+PA+VF LYYHL LL+ NGH+G   +R
Sbjct  128   --PPPTCLVADSFSTWGSSIAWKYGLVNVSFWTQPAVVFMLYYHLDLLKKNGHYGSKVLR  185

Query  709   EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHET  888
             +D ++Y+PGV SI+ +DL S++QET+T TV H++I K+FQDA+NAD ++ NT +ELE   
Sbjct  186   KDTVDYIPGVASIEPRDLTSFLQETDTSTVMHRLIEKAFQDAKNADLIIINTAEELEPGP  245

Query  889   VAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             ++AL+EK   + +GPIFP  F   AV  +L SESDC   L
Sbjct  246   ISALKEKHPTYAIGPIFPSHFTNRAVEMNLWSESDCTRWL  285



>emb|CDY33212.1| BnaC04g08270D [Brassica napus]
Length=484

 Score =   282 bits (721),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 149/280 (53%), Positives = 201/280 (72%), Gaps = 12/280 (4%)
 Frame = +1

Query  187   QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD-DDIFSGI  363
             +KPHA++I YPLQGH+IP VHLA +LA  GFT+TF+NT S+H+H++ +   D  DIFS +
Sbjct  7     RKPHAMMIPYPLQGHVIPFVHLAIKLASHGFTITFVNTDSIHHHISTARQGDAGDIFSEV  66

Query  364   RKPG-LDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPP  540
             R  G LDIRY T+SDG P E+DR++NHDQF   +LH++ AHV++ + KI   S     PP
Sbjct  67    RSYGNLDIRYTTVSDGFPLEFDRSLNHDQFFEGILHVFPAHVDDLITKI---SRRGDDPP  123

Query  541   VNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAI  720
             V CLI DTF+V+   + +K+ L+ +SFWTEPALV  LYYHLHLL  N HF  +D RED I
Sbjct  124   VTCLINDTFYVWSSMICEKHNLVNVSFWTEPALVLNLYYHLHLLISNCHFKSLDNREDVI  183

Query  721   EYVPGVRSIDVKDLMSYIQ----ETETETVCHQIIYKSFQDARNADFVLCNTVQELEHET  888
             +Y+PGV++ID KDLMSY+Q    + +T TV ++II+K+F D + ADFVLCNTVQELE ++
Sbjct  184   DYIPGVKAIDPKDLMSYLQVSDKDVDTNTVVYRIIFKAFTDVKKADFVLCNTVQELEPDS  243

Query  889   VAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             ++ALQ     + +GP+F     +S V TSL +ESDC   L
Sbjct  244   LSALQANQPVYAIGPVFS---TESVVPTSLWAESDCTEWL  280



>gb|EYU34479.1| hypothetical protein MIMGU_mgv1a005298mg [Erythranthe guttata]
Length=490

 Score =   280 bits (716),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/272 (48%), Positives = 188/272 (69%), Gaps = 6/272 (2%)
 Frame = +1

Query  196   HAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPR-DDDIFSGIRKP  372
             H I+I  P QGHI PS+ LA +LA KGFT+TF+NTHS H  +TKS P+  DDIF   R  
Sbjct  14    HVIIIPPPFQGHINPSIQLALKLASKGFTITFVNTHSTHDQITKSRPKISDDIFGPARDS  73

Query  373   GLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPVNCL  552
             G DIRY+TISDG P  +DR++N +QFM   +H+Y AHV+E + ++  S      P  +CL
Sbjct  74    GRDIRYITISDGFPLSFDRSLNREQFMEGRMHVYPAHVDELVGQLAGSD-----PRPDCL  128

Query  553   IADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIEYVP  732
             ++DT   +   +A KY L+Y+SFWT+PALVF++Y H HLL++NGH+G ID R+D I+Y+P
Sbjct  129   VSDTISTWGYGIAAKYGLVYVSFWTQPALVFSMYSHTHLLKINGHYGSIDNRKDTIDYIP  188

Query  733   GVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQEKT  912
             GV +I+ KDL S++ ET+T    H++I K+F +A+ ADF++ N ++ELE E ++ L++  
Sbjct  189   GVEAIEPKDLSSFLHETDTSKAIHRVIPKAFAEAKKADFIIFNAMEELEPEPISTLKKTL  248

Query  913   SFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
               + VGP+FP  FA  ++  +L SESDC   L
Sbjct  249   PVYPVGPLFPHHFANPSIQMNLWSESDCSKWL  280



>ref|XP_009623615.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Nicotiana tomentosiformis]
Length=477

 Score =   280 bits (715),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/271 (48%), Positives = 185/271 (68%), Gaps = 6/271 (2%)
 Frame = +1

Query  190  KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNP---RDDDIFSG  360
            K HA++I  PLQGHI P  HLA +LA KGFT+TF+NT S H H+T++       D+ FS 
Sbjct  8    KLHAVMIPLPLQGHINPFTHLAMKLASKGFTITFVNTESTHQHITRAQSLKDEHDNPFSH  67

Query  361  IRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPP  540
             +K GLDIRY  ISDG P  ++R    DQF+  L+H++ AHV++ ++K++ S  +   PP
Sbjct  68   AQKSGLDIRYAKISDGFPLSFERRAKADQFVEGLIHVFEAHVDDFIEKLILSKPD---PP  124

Query  541  VNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAI  720
            V+C+IAD+F V+   +AKKY L  +SFWTEPA V T+YYH+ LL+  GHFGC    ED I
Sbjct  125  VSCIIADSFHVWASTIAKKYNLFNVSFWTEPATVLTIYYHMDLLKSKGHFGCHGKCEDTI  184

Query  721  EYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAAL  900
             Y+PGV++I+  DL SY Q+ ++ TV  + ++K  +DA+ ADFV+CNTVQELE   ++ +
Sbjct  185  RYIPGVQAIEPADLPSYCQDPDSSTVMPRFVFKCLEDAQKADFVICNTVQELESSAISVI  244

Query  901  QEKTSFFTVGPIFPPVFAQSAVATSL*SESD  993
            QEK  F+ +GP+FP  F +  ++T L  ESD
Sbjct  245  QEKQPFYAIGPVFPASFTKRTISTGLLPESD  275



>ref|XP_010107502.1| UDP-glycosyltransferase 86A1 [Morus notabilis]
 gb|EXC16184.1| UDP-glycosyltransferase 86A1 [Morus notabilis]
Length=544

 Score =   281 bits (719),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/274 (49%), Positives = 192/274 (70%), Gaps = 10/274 (4%)
 Frame = +1

Query  196  HAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNP------RDDDIFS  357
            HAI++  PLQGH+IP+V+LA +LA  GFT+TFIN   + + +T S+P       ++DIF 
Sbjct  11   HAIVMPVPLQGHVIPAVNLALKLASNGFTITFINNEIIRHKITTSHPPANFDGSENDIFC  70

Query  358  GIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMA-SLLHIYSAHVEEALKKILTSSANSGG  534
            G R+ GLDIR+ T+ DG P  +DR  N ++++    LH     ++E +  I+  + +   
Sbjct  71   GARECGLDIRHRTVGDGFPLSFDRLANDERYLEEGQLHAVPVLMDELVGDIVKEARD---  127

Query  535  PPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVRED  714
            PPV+CLIAD FF +P  +A+KY L+++SFWTEPALVFTLYYHL LL+ NGH+   D RED
Sbjct  128  PPVSCLIADGFFTWPSMIAEKYDLVFVSFWTEPALVFTLYYHLDLLKTNGHYASHDNRED  187

Query  715  AIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVA  894
             I+Y+PGV++I+ KDL SY+QET+  TV H++I  +F+D + ADFVLCNTV+ELE + ++
Sbjct  188  TIDYIPGVKAIEPKDLPSYLQETDVSTVMHRLIDVAFKDVKRADFVLCNTVEELESKPIS  247

Query  895  ALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDC  996
            ALQEK  F+ +GP+FP    +  V TSL  ES+C
Sbjct  248  ALQEKQPFYAIGPLFPSGLTKGVVPTSLRPESNC  281


 Score =   111 bits (278),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 74/107 (69%), Gaps = 1/107 (1%)
 Frame = +1

Query  676  LNGHFGCIDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVL  855
             NG     D R D I+Y+PGV++I+ KDL SY+QET+  T+ H++I ++F+D   ADF+L
Sbjct  425  FNGKHWPTDNRHDIIDYIPGVKAIESKDLPSYLQETDVSTIMHRLIDEAFKDVEKADFIL  484

Query  856  CNTVQELEHETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDC  996
            CNT++ELE E + ALQEK  F+ +GP+ P  F +  V TSL  ES+C
Sbjct  485  CNTIEELELEAILALQEKQPFYAIGPL-PSGFTKGIVPTSLRPESNC  530



>ref|XP_009784463.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Nicotiana sylvestris]
Length=503

 Score =   277 bits (708),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/279 (47%), Positives = 186/279 (67%), Gaps = 5/279 (2%)
 Frame = +1

Query  163  SKAMADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD  342
            +K   +   K HA++I  PLQGHI P  HLA +LA KGFT+TF+NT S H H+ ++    
Sbjct  26   TKMGVEEHPKLHAVMIPLPLQGHINPFTHLAMKLASKGFTITFVNTESTHQHIVRAQSLK  85

Query  343  DD--IFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTS  516
            DD   FS  +K GLDIRY  ISDG P  ++R     QF+  L+H++ AHV++ ++ ++ S
Sbjct  86   DDENPFSHAQKSGLDIRYAKISDGFPLSFERRAKAGQFVEGLIHVFEAHVDDFIENLILS  145

Query  517  SANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGC  696
              +   PP++C+IAD+F V+   +AKKY L+ +S WTEPA V T+YYH+ LL+  GHFGC
Sbjct  146  KPD---PPISCIIADSFHVWASTIAKKYNLVNVSLWTEPATVLTIYYHMDLLKSKGHFGC  202

Query  697  IDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQEL  876
             D  ED I Y+PGV++I+  DL SY Q+ ++ TV  + ++K  +DA+ ADFV+CNTVQEL
Sbjct  203  HDKCEDTIRYIPGVQAIEPADLPSYCQDPDSSTVMPRFVFKCLEDAQKADFVICNTVQEL  262

Query  877  EHETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESD  993
            E   + A+QEK  F+ +GP+FP  F +  +AT L  ESD
Sbjct  263  EPSAILAIQEKQPFYAIGPVFPASFTKRTIATGLLPESD  301



>ref|XP_010686253.1| PREDICTED: UDP-glycosyltransferase 86A1-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=496

 Score =   275 bits (703),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 134/278 (48%), Positives = 191/278 (69%), Gaps = 13/278 (5%)
 Frame = +1

Query  187  QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPR------DDD  348
            +KP AI+I++PLQGH+IP++ LA +LA KG ++TFINT ++H+ +T SNP         D
Sbjct  18   KKPRAIIIAHPLQGHLIPTIQLAIKLASKGISITFINTENIHHQITTSNPTAIDTDGGGD  77

Query  349  IFSGIRKP-GLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSAN  525
            IF   R   GLDI Y+T+SDGLP E+DR++ HDQ++ + +H + AHVE A+ KI+ S   
Sbjct  78   IFIEARNSSGLDIDYMTVSDGLPLEFDRSLYHDQWVGATIHCFPAHVEVAVAKIVRSK--  135

Query  526  SGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFG-CID  702
               P   CLI D++ V+  K+AKK+ L ++SFWTE A+V   Y+HLHLL+ NGH G   +
Sbjct  136  ---PLTCCLIVDSYSVWASKVAKKFGLFHVSFWTEAAMVLDFYFHLHLLKENGHVGPGSN  192

Query  703  VREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEH  882
             R+D I+Y+PG+ SI   DL SY+QE +  T+ HQ I  S +D + ADF+L N V ELE 
Sbjct  193  ARDDTIDYIPGISSIKRSDLTSYLQEEDLTTMSHQCILPSMEDTKQADFILGNNVHELEA  252

Query  883  ETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDC  996
            +T+ A+Q  T F+ +GP+FPP F +S VA+SL +ES+C
Sbjct  253  QTIEAIQTTTPFYAIGPLFPPGFTKSPVASSLWAESNC  290



>ref|XP_006350954.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Solanum tuberosum]
Length=473

 Score =   274 bits (701),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/270 (48%), Positives = 185/270 (69%), Gaps = 5/270 (2%)
 Frame = +1

Query  190  KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSN--PRDDDIFSGI  363
            +PHA+L+  PLQGHI P  HLA +LA KGFT+TF+NT S H  + K+     DD+ FS  
Sbjct  5    QPHAVLVPLPLQGHITPFTHLAMKLASKGFTITFVNTESTHQQIAKAQSLKDDDNPFSHG  64

Query  364  RKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPV  543
            +K GLDIRY  ISDG P  +  + N +QF+  L+H++ AHV++ ++ ++ S  N   PP+
Sbjct  65   QKCGLDIRYAKISDGFPLSFYWSANANQFVEGLIHVFQAHVDDFIENLVLSKPN---PPI  121

Query  544  NCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIE  723
            +C+IAD+F V+   ++KKY L+ +SFWTEPA V T YYH+ LL+ NGHFGC D  ED I 
Sbjct  122  SCIIADSFHVWGSTISKKYNLVNVSFWTEPATVLTAYYHMDLLKSNGHFGCHDKCEDTIR  181

Query  724  YVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQ  903
            Y+PGV++I+  DL SY Q+ +  TV H+ ++K  +DA+ A+FV+ NTVQELE   ++ALQ
Sbjct  182  YLPGVQAIEPTDLPSYFQDADPNTVMHRFVFKCLEDAQKANFVIGNTVQELESSPISALQ  241

Query  904  EKTSFFTVGPIFPPVFAQSAVATSL*SESD  993
            EK  F+ +GP+FP  F +  ++ +L   SD
Sbjct  242  EKQPFYAIGPLFPTSFTKRTISMNLLPASD  271



>ref|XP_010107499.1| UDP-glycosyltransferase 86A1 [Morus notabilis]
 gb|EXC16181.1| UDP-glycosyltransferase 86A1 [Morus notabilis]
Length=940

 Score =   284 bits (727),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 140/289 (48%), Positives = 204/289 (71%), Gaps = 14/289 (5%)
 Frame = +1

Query  169   AMADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNP----  336
             AM D+  +PHAI+ S   QGH+ PS+HLA +LA KGFT+TF+NT  VH+ LTKS P    
Sbjct  457   AMEDNHPRPHAIMFSLDYQGHVTPSIHLAMKLASKGFTITFVNTQIVHHQLTKSQPDCTN  516

Query  337   -RDDDIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILT  513
               D DIF+G R+ GLDIRY T+SDGL  ++++ +NHD+F+ S L++  +  +E +  ++ 
Sbjct  517   TDDYDIFAGARELGLDIRYKTMSDGLSLDFNKILNHDEFLKSNLYVLPSLADELIGNLVK  576

Query  514   SSANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFG  693
                    P ++CLIADTF  +  +LAKKY L+ +SFWT+PA+VFTL YHL LL++NGH+ 
Sbjct  577   ED-----PSISCLIADTFQPWALRLAKKYNLISVSFWTQPAIVFTLDYHLDLLKINGHYL  631

Query  694   CID-VREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQ--IIYKSFQDARNADFVLCNT  864
              ++  RED I+Y+PGV+SI+ KDLM Y++ET+  TV H   ++YKSF+D +N DF+LCNT
Sbjct  632   SLNGNREDTIDYIPGVKSIEPKDLMPYLRETKGSTVTHGHLLLYKSFEDVKNVDFILCNT  691

Query  865   VQELEHETVAALQEKTSFFTVGPIFPPV-FAQSAVATSL*SESDCEPLL  1008
             ++ELE++ + A+++K   + +GPI  P  F +S V+TSL +E DC   L
Sbjct  692   LEELEYDAIWAIRQKQPMYAIGPIISPFGFTKSPVSTSLRTEFDCSQWL  740


 Score =   223 bits (567),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/242 (44%), Positives = 169/242 (70%), Gaps = 10/242 (4%)
 Frame = +1

Query  259  RLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIRKPGLDIRYVTISDGLPPEWDRAVN  438
             + +KG  VT+ N   V  H    +  D DIF+G R+ GLD+RY T+SDG P +++R +N
Sbjct  46   EVKDKGLIVTWTNQIEVISH---PSIDDYDIFAGARELGLDVRYKTMSDGFPLDYNRMLN  102

Query  439  HDQFMASLLHIYSAHVEEALKKILTSSANSGGPPVNCLIADTFFVFPGKLAKKYKLLYIS  618
            H++F  + L  +  HV+E +  ++   ++     ++CLIADTF  +  ++AKKY L+ +S
Sbjct  103  HEEFFENTLFSFPFHVDELVGNLVKEDSS-----ISCLIADTFQPWTSQIAKKYNLISVS  157

Query  619  FWTEPALVFTLYYHLHLLRLNGHFGCID-VREDAIEYVPGVRSIDVKDLMSYIQETETET  795
            FWT+PA+VFTL YHL LL++NGH+  ++  RED I+Y+PGV+SI+ K+LM+Y++ET   T
Sbjct  158  FWTQPAIVFTLGYHLDLLKMNGHYLSLNGNREDTIDYIPGVKSIEPKNLMTYLRETNEST  217

Query  796  VCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQEKTSFFTVGPIFPPV-FAQSAVAT  972
            V H++++KSF+D +N DF+LCNTV+ELEH+ + A+++K   + +GP+  P  F +S V+T
Sbjct  218  VMHKLLHKSFEDVKNVDFILCNTVEELEHDAIWAVRQKQPMYGIGPLMSPFGFDKSPVST  277

Query  973  SL  978
            SL
Sbjct  278  SL  279



>ref|XP_006833161.1| hypothetical protein AMTR_s00072p00130550 [Amborella trichopoda]
 gb|ERM98439.1| hypothetical protein AMTR_s00072p00130550 [Amborella trichopoda]
Length=607

 Score =   277 bits (708),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 140/276 (51%), Positives = 190/276 (69%), Gaps = 21/276 (8%)
 Frame = +1

Query  229   HIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKS---------------NPRDDDIFSGI  363
             HIIPSV LA +LA KG T+TF+NT +VH    K+               +   DDIF G 
Sbjct  129   HIIPSVQLALKLASKGLTITFVNTEAVHAQTVKAYNNSLSKTLNDSIDCSNSTDDIFFGA  188

Query  364   RKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPV  543
             R+ GLDIRY  +SDGLP E+DR++NH+QFM SLLH++SAHVE+ ++++        GPP+
Sbjct  189   REAGLDIRYRVVSDGLPLEFDRSLNHNQFMFSLLHVFSAHVEKIIREVALD-----GPPI  243

Query  544   NCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDV-REDAI  720
             +C+IADTFFV+   +A+K+ + +ISFWTEPALVF+LY+H HLLR +GHF      R+D I
Sbjct  244   SCIIADTFFVWVAPMAEKFGVPHISFWTEPALVFSLYHHAHLLRQHGHFDSEGKNRKDPI  303

Query  721   EYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAAL  900
             +Y+PG+ SID KD+ SY+Q ++T TV HQII  +F  A+ AD+VL NTV+ELE  T+ AL
Sbjct  304   DYIPGIPSIDPKDIPSYLQVSDTSTVVHQIILAAFNGAKRADWVLSNTVEELELHTIEAL  363

Query  901   QEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
                  F+ VGPI PP F +++++TSL  ESDC   L
Sbjct  364   NNYFPFYAVGPILPPKFTENSISTSLWPESDCSSWL  399



>dbj|BAJ85107.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ94593.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=494

 Score =   273 bits (698),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 144/281 (51%), Positives = 195/281 (69%), Gaps = 14/281 (5%)
 Frame = +1

Query  190   KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDD---DIFSG  360
             KPHA++I+YP QGH+IP+ HLA RLA +GF VTF+NT SVH    ++   D    DIF+G
Sbjct  19    KPHAVVIAYPYQGHVIPAAHLALRLAARGFAVTFVNTESVHEQTARALGVDRHRYDIFAG  78

Query  361   IRKPG--LDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGG  534
              R     LD+RY  +SDG P  +DR++NHDQF    LH+ +AHVEE L++++   A++  
Sbjct  79    ARASADALDVRYELVSDGFPLAFDRSLNHDQFKEGELHVLAAHVEELLRRVVVDPAST--  136

Query  535   PPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDV--R  708
                 CL+ADTFFV+P  LA+K  + Y+SFWTEPAL+F LYYH+ LL  +GHF       R
Sbjct  137   ----CLVADTFFVWPATLARKLGIPYVSFWTEPALIFNLYYHMDLLAAHGHFNSSKGPPR  192

Query  709   EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHET  888
             +D I YVPGV +I+  +LMSY+Q+T+  +V H+II+K+F +AR AD+VLCNTV+ELE  T
Sbjct  193   KDTITYVPGVPAIEPHELMSYLQDTDVTSVVHRIIFKAFDEARRADYVLCNTVEELEPST  252

Query  889   VAALQEKTSFFTVGPI-FPPVFAQSAVATSL*SESDCEPLL  1008
             VAAL+ +  F+ VGPI FP     + VATS+ +ESDC   L
Sbjct  253   VAALRAEKPFYAVGPIGFPRAGGDAGVATSMWAESDCSQWL  293



>ref|XP_008778580.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Phoenix dactylifera]
Length=454

 Score =   272 bits (695),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 130/242 (54%), Positives = 177/242 (73%), Gaps = 8/242 (3%)
 Frame = +1

Query  172  MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPR----  339
            MA+   KPHA+LI  PLQGHI P+  LA +LA +GF +T++NT +VH+  +++       
Sbjct  1    MAELPPKPHAVLIPLPLQGHINPAACLAIKLATRGFAITYVNTEAVHHQSSRARRSASSI  60

Query  340  DDDIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSS  519
            D DIF+  R  GLDIRY  ISDGLP  +DRA N  QF+ SLL+++SAHVEE ++K+    
Sbjct  61   DHDIFADARASGLDIRYELISDGLPISFDRAANPIQFLHSLLYVFSAHVEELMRKL----  116

Query  520  ANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCI  699
              + GPP+ CLIADTFFV+P  +A K+ + Y+SFWTEPA+VF LYYH+ LL  NGHF   
Sbjct  117  TRAAGPPITCLIADTFFVWPDTIANKFGIPYVSFWTEPAVVFALYYHIDLLIKNGHFASR  176

Query  700  DVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELE  879
            + R+D I Y+PGV +++  DLMSY+QET+T ++ HQII+K+F++A+ ADFVLCN+VQELE
Sbjct  177  ENRKDTITYIPGVPAVEPTDLMSYLQETDTTSLLHQIIFKAFEEAKGADFVLCNSVQELE  236

Query  880  HE  885
             E
Sbjct  237  PE  238



>gb|EYU34477.1| hypothetical protein MIMGU_mgv1a005487mg [Erythranthe guttata]
Length=482

 Score =   271 bits (694),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/276 (51%), Positives = 190/276 (69%), Gaps = 12/276 (4%)
 Frame = +1

Query  187   QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIR  366
             QKPHAI+IS+ LQGHIIP V+L  +LA KGF+VTF +   +H+ +++S P   DIF+G R
Sbjct  8     QKPHAIMISFHLQGHIIPFVNLTLKLASKGFSVTFAHLDFIHHQISQSQPAQTDIFAGAR  67

Query  367   KPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPVN  546
               GL+I Y T SDG P ++DR+ + D ++   LH +   V+E + KI++SS     PP +
Sbjct  68    ASGLNISYTTFSDGFPLDFDRSADFDAYLKFFLHRFPDKVDELVGKIISSS-----PPGS  122

Query  547   --CLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAI  720
                LIADTF V+P K+++KY L+ +SFWTEPALVF+LYYHL LLR+NGH      RED +
Sbjct  123   EHFLIADTFSVWPEKISEKYGLVNVSFWTEPALVFSLYYHLPLLRVNGHVPVNGRRED-V  181

Query  721   EYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAAL  900
              YVPGV SI+ KD MSY   +E E + H +I+ +F   + ADFVLCNTVQELE E ++AL
Sbjct  182   GYVPGVESINTKDFMSYFDYSEMEMI-HTVIFGAFDAVKKADFVLCNTVQELEEEAISAL  240

Query  901   QEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             Q+K  F+ VGP+FP   A+ +VA SL  ESDC   L
Sbjct  241   QQKQRFYAVGPLFP---AKFSVAGSLLPESDCTEWL  273



>ref|XP_004304453.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Fragaria vesca 
subsp. vesca]
Length=482

 Score =   270 bits (691),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 134/286 (47%), Positives = 187/286 (65%), Gaps = 12/286 (4%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSN------  333
             M  +  KPHAI++   LQGH+ P  HLA +LA  GFT+TF+NT   H+ +TKS       
Sbjct  1     METNHPKPHAIMVPLSLQGHVNPFTHLAMKLASNGFTITFVNTEYFHHQITKSKLNNTAQ  60

Query  334   -PRDDDIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKIL  510
                 DDIF+  R+ GLDIRY T+SDG P  ++R  N DQ +   +H++ AH++E +  ++
Sbjct  61    EQEQDDIFAAARETGLDIRYRTVSDGFPLSFNRFQNLDQSLEGAIHVFPAHIDELVGDLV  120

Query  511   TSSANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHF  690
              S      P +NCLIADTF  +   +A K+ L+ ISFWTEPALV  +YYHL LL  +GHF
Sbjct  121   QSD-----PSINCLIADTFHTWTAMIANKHNLINISFWTEPALVLNIYYHLDLLVKHGHF  175

Query  691   GCIDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQ  870
             GC D  ED I+Y+PGV++I+ KDL S++  T T     +I+ K+F++A+ ADF+LCNTVQ
Sbjct  176   GCHDNCEDTIDYIPGVQAIEPKDLTSHLHITNTSDPMLRIVKKAFREAKRADFILCNTVQ  235

Query  871   ELEHETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             ELE E+++ LQ+K   + +GP+FP    +S VAT+L SE DC   L
Sbjct  236   ELEAESLSTLQDKQPTYAIGPVFPTEPTKSVVATNLMSEIDCTQWL  281



>ref|XP_009770479.1| PREDICTED: UDP-glycosyltransferase 86A1-like, partial [Nicotiana 
sylvestris]
Length=172

 Score =   259 bits (663),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 147/175 (84%), Gaps = 4/175 (2%)
 Frame = +1

Query  172  MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDI  351
            M DS  KPHAIL+ YPLQGH+IP+++L  +LA+KGFT+TFINT S+HY +T+ N +DD I
Sbjct  1    MVDSRSKPHAILVCYPLQGHVIPTINLTIKLAQKGFTITFINTQSIHYQITQKNDQDD-I  59

Query  352  FSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSG  531
            FS  +   LDIRY+T+SDGLP  +DR++NHDQFM++LLH++SAHVEEAL KI+ S  +  
Sbjct  60   FSTYQGLELDIRYMTVSDGLPLNFDRSLNHDQFMSALLHVFSAHVEEALLKIMESKID--  117

Query  532  GPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGC  696
             PPVNCLIAD+FFVFPGKLAKKY LLYISFWTE ALVFT+YYHLHLL LNGHFGC
Sbjct  118  -PPVNCLIADSFFVFPGKLAKKYGLLYISFWTETALVFTIYYHLHLLELNGHFGC  171



>gb|EPS66574.1| hypothetical protein M569_08200, partial [Genlisea aurea]
Length=462

 Score =   267 bits (682),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 139/305 (46%), Positives = 190/305 (62%), Gaps = 21/305 (7%)
 Frame = +1

Query  187   QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIR  366
             +KPHAI++ YP QGHI P   LA  LA +GFTVTF+NT SV   ++++     DIF G R
Sbjct  1     RKPHAIMLPYPYQGHINPFARLAVNLAAEGFTVTFVNTRSVDGRISRARGDGGDIFGGAR  60

Query  367   KPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPVN  546
               GLDIRY T+ DG P  +DR +NHD+F+  L+H++ AHV+E    +         PP  
Sbjct  61    DSGLDIRYATVCDGFPLSFDRVLNHDRFVEGLIHVFPAHVDEFFDNLAGDD-----PPAT  115

Query  547   CLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHF------GCIDVR  708
             CLI+DTF+V+   +A+K+ L+Y+SFWTEPALVF+LYYHL LL  NG F           +
Sbjct  116   CLISDTFYVWGSAIARKHNLVYVSFWTEPALVFSLYYHLELLINNGDFDSSGQNNLKKKK  175

Query  709   EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHET  888
             E  I Y+PGV +I+  DL SY+Q ++T TV H++I+K+F D + AD ++CNTVQ+LE ET
Sbjct  176   ETMIHYIPGVEAINPTDLPSYLQ-SQTTTVVHRVIFKAFDDVKKADMIICNTVQKLEEET  234

Query  889   VAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLLILP----LLHCSYRWFAGGV  1056
             ++AL  K   + VGPI   VF       SL SESDC   L       +L+ S+   AG  
Sbjct  235   LSALHRKQPTYAVGPIISDVF-----TASLWSESDCSDWLSAKPKGSVLYVSFGSHAGTT  289

Query  1057  AGRTV  1071
             +  T+
Sbjct  290   SRNTI  294



>ref|XP_010686252.1| PREDICTED: UDP-glycosyltransferase 86A1-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=499

 Score =   264 bits (675),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 134/278 (48%), Positives = 188/278 (68%), Gaps = 13/278 (5%)
 Frame = +1

Query  187  QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPR----DDDIF  354
            +K HAIL+  PLQGH+IP V LA +LA KGF++TFINT  +H+ +T SN       +DIF
Sbjct  21   KKIHAILVGLPLQGHVIPFVQLAIKLASKGFSITFINTKHIHHQITSSNASAFDGGEDIF  80

Query  355  SGIRK--PGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANS  528
               R+   GLDI Y+TI+DGLP E+DR++NHDQ++ + ++   AH+E A+ KI+TS    
Sbjct  81   VEARRGSTGLDIEYMTITDGLPLEFDRSLNHDQWVGANIYCLQAHLEVAVCKIVTSR---  137

Query  529  GGPPVNC-LIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGC-ID  702
              P + C L+AD++FV+  KLA K+ L+++SFWTEPA+V  +Y+H HLL+ NGH G    
Sbjct  138  --PSIRCCLVADSYFVWASKLASKFGLVHVSFWTEPAVVLDIYFHRHLLKENGHIGLGSS  195

Query  703  VREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEH  882
             R+D I Y+PG+ S+   DL SY+QE +  T+  Q  + S  D R A F+L NTVQELE 
Sbjct  196  ARKDIINYIPGISSLKRTDLTSYLQEEDLTTMHPQYNFASLDDTRKAQFILSNTVQELEA  255

Query  883  ETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDC  996
             T++A+Q    F+ +GP+F P F +S V TSL +ESDC
Sbjct  256  HTISAVQAHVPFYAIGPLFSPEFTKSPVTTSLWAESDC  293



>ref|XP_004246642.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Solanum lycopersicum]
Length=476

 Score =   261 bits (668),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 135/279 (48%), Positives = 187/279 (67%), Gaps = 14/279 (5%)
 Frame = +1

Query  193   PHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTK------SNPRD-DDI  351
             PHA++I  P QGHI P++HLA +LA KGF +TFINT  +H  +TK      S P   ++I
Sbjct  7     PHALVIPCPYQGHINPTIHLALKLASKGFIITFINTQFIHSQITKAHSPSSSEPSGLENI  66

Query  352   FSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSG  531
             FS   + GLDIRY+TISDG P E+DR +N   F+  L++ +S +V++ +  +        
Sbjct  67    FSKPCESGLDIRYLTISDGFPLEFDRNMNSLPFLEGLINGFSNYVDKLVGDLAKEDCVD-  125

Query  532   GPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVRE  711
               P+NCLIADTFFV+P  +AKKY+++++SF+TEPALVF LYYHL LL  NGH G  + R+
Sbjct  126   --PINCLIADTFFVWPSIIAKKYEIVHVSFFTEPALVFALYYHLDLLEENGHSGSHENRK  183

Query  712   DAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETV  891
             D ++Y+PGV+SI   DL S  Q     +V HQ+IYK+FQD R AD ++ NTVQELE ET+
Sbjct  184   DIVDYIPGVKSIKSSDLPSLYQ----NSVVHQLIYKAFQDVRKADIIIANTVQELEPETI  239

Query  892   AALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
              ++QEK  F+ +GPI    F +  +++SL SE DC   L
Sbjct  240   TSIQEKHKFYAIGPIVSANFTELTISSSLWSEHDCTQWL  278



>ref|XP_011094737.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Sesamum indicum]
Length=479

 Score =   261 bits (666),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/280 (48%), Positives = 196/280 (70%), Gaps = 8/280 (3%)
 Frame = +1

Query  175   ADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKS--NPRDDD  348
             ++  +KPHAI+IS  LQGHIIP V+LA +LA KGF+VTF +   VH+ ++KS  N  D D
Sbjct  3     SNKNRKPHAIMISLHLQGHIIPFVNLAIKLASKGFSVTFAHLEFVHHQISKSQFNSTDID  62

Query  349   IFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANS  528
             IF+  R  GLDI Y TISDG   E+DR+   D ++ + L  +   V+E + KI+ S +++
Sbjct  63    IFAQARSSGLDINYTTISDGFAVEFDRST--DLYVEAFLCRFPEKVDELVGKIMQSHSSA  120

Query  529   GGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVR  708
             G      L++DTF V+P K+A+KY L+ +SFWTEPALVF+LYYHL LLR NGH   ++ R
Sbjct  121   GSNFF--LVSDTFSVWPAKIAEKYGLVDVSFWTEPALVFSLYYHLQLLRENGHVP-VNGR  177

Query  709   EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHET  888
              + ++Y+PG++SI+ KD MSY+Q++E  T+ H++I+++F   ++ADF+LCNTVQELE E 
Sbjct  178   RENVDYLPGIQSINTKDFMSYLQDSEL-TLLHKLIFQAFDTVKSADFILCNTVQELETEA  236

Query  889   VAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             ++AL+EK  F+ +GP+F     ++ VA SL  ES+C   L
Sbjct  237   ISALKEKQPFYAIGPLFLGDLKKNPVARSLLPESNCTEWL  276



>ref|XP_010107479.1| UDP-glycosyltransferase 86A1 [Morus notabilis]
 gb|EXC16161.1| UDP-glycosyltransferase 86A1 [Morus notabilis]
Length=487

 Score =   261 bits (666),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/283 (48%), Positives = 187/283 (66%), Gaps = 18/283 (6%)
 Frame = +1

Query  190   KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPR-------DDD  348
             KPHAI+     QGH+ PS+HLA +LA KGF +TF+NT  +H+ LTKS P        +DD
Sbjct  9     KPHAIMFPLTYQGHVTPSIHLAMKLASKGFAITFVNTEFIHHQLTKSQPNSTSAAAIEDD  68

Query  349   IFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANS  528
             IF+G R+ GLDIRY T++DG P +++R +N  QF+A        HV+E +  ++ S    
Sbjct  69    IFTGARESGLDIRYKTMTDGFPLDFNRILN-PQFVALNFLSLPVHVDELVGNLVNSD---  124

Query  529   GGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVR  708
               P ++CLIADTF+ +   +A KYKL+ ISFWT+PALVF +YYH+ LL  N HF   D +
Sbjct  125   --PSISCLIADTFYTWASHIAHKYKLVNISFWTQPALVFNIYYHMELLITNSHFPPQDEQ  182

Query  709   EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHET  888
             +D IEY+PGVR I+ KDL SY+Q+T TE    Q + K+F++ + ADF+LCNTVQELE  +
Sbjct  183   KDTIEYIPGVRVIEQKDLPSYLQQTNTEG--QQFLDKAFKEVKKADFILCNTVQELESHS  240

Query  889   VAALQEKTSFFTVGPI--FPPVFAQ-SAVATSL*SESDCEPLL  1008
             +  LQEK S + +GP+  FP  F + + V TS+ +E DC   L
Sbjct  241   IFVLQEKKSIYAIGPLLNFPNGFTKRNIVPTSMRTEFDCSQWL  283



>ref|XP_006354352.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Solanum tuberosum]
Length=473

 Score =   258 bits (658),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 130/278 (47%), Positives = 184/278 (66%), Gaps = 13/278 (5%)
 Frame = +1

Query  193   PHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTK------SNPRDDDIF  354
             PHA++I  P QGHI P++HL+ +LA KGF +TFINT  +H  +TK      S P  ++IF
Sbjct  7     PHALVIPCPYQGHINPAIHLSLKLASKGFIITFINTQFIHSQITKAHSPSSSEPGLENIF  66

Query  355   SGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGG  534
             S   + GLDIRY+TISDG P E+DR +N   F+  L++ +S HV++ + +++        
Sbjct  67    SKACESGLDIRYLTISDGFPLEFDRNMNSLPFLEGLINGFSNHVDKLVGELVKEDCID--  124

Query  535   PPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVRED  714
              P+NCLIADTF V+P  +AKKY+++++SF+TEPALVF LYYH  LL  NGH G  + R+D
Sbjct  125   -PINCLIADTFLVWPSIIAKKYEIVHVSFFTEPALVFALYYHFDLLEENGHSGSHENRQD  183

Query  715   AIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVA  894
              ++Y+PGV+SI   DL S  Q     +V HQ+I K+FQD R AD ++ NTVQELE ET+ 
Sbjct  184   IVDYIPGVKSIKSSDLPSLFQ----NSVVHQLINKAFQDVRKADIIIANTVQELELETIT  239

Query  895   ALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             ++QE   F+ +GPI    F +  +++SL  E DC   L
Sbjct  240   SIQENHKFYAIGPIVSANFTKLTISSSLWFEHDCTQWL  277



>ref|XP_009400676.1| PREDICTED: UDP-glycosyltransferase 86A2-like [Musa acuminata 
subsp. malaccensis]
Length=550

 Score =   259 bits (662),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 130/281 (46%), Positives = 179/281 (64%), Gaps = 8/281 (3%)
 Frame = +1

Query  175   ADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD---D  345
             + S   PHA+ ++ P QGH  P+V LA  LA +GF VTF  T +  +  T S        
Sbjct  66    SGSATGPHALFVTAPYQGHFAPAVDLAINLAARGFVVTFACTEAFQHQRTASGASSADHR  125

Query  346   DIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSAN  525
             D+F+G R  GLDIRY  +SDGLP  +DR  + +QF ++LLH+  +HV+E ++K+L S   
Sbjct  126   DVFAGARSRGLDIRYELVSDGLPVSFDRHSHPEQFYSALLHLLPSHVDELIRKLLLSEV-  184

Query  526   SGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDV  705
                 PV+ ++ DTFF +   LAK + L  +SFWT+PALVFTLYYH+ LL  NGHF   + 
Sbjct  185   ----PVDFILTDTFFSWASTLAKNHGLPCVSFWTKPALVFTLYYHMDLLIANGHFASPEN  240

Query  706   REDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHE  885
             R+D I Y+PG+ +I+  DL SY++ET+T T   Q+I +SF++ +  D VL NTVQELE E
Sbjct  241   RKDTITYIPGIPAIETTDLASYLRETDTTTPLQQMIARSFEEVKRCDIVLANTVQELEEE  300

Query  886   TVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             T+A LQ++  F+ VGP+FP  F    V TSL  ESDC   L
Sbjct  301   TIAVLQQEQPFYAVGPVFPDGFTGGTVMTSLWPESDCSSWL  341



>ref|XP_011094627.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Sesamum indicum]
Length=481

 Score =   257 bits (657),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 129/280 (46%), Positives = 191/280 (68%), Gaps = 10/280 (4%)
 Frame = +1

Query  187   QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPR-----DDDI  351
             +K HAI+I++  QGHI P ++LA +LA  GFTVTF++T  +H+ L+K++       D+D 
Sbjct  4     RKLHAIMIAFSFQGHITPFINLALKLASNGFTVTFVHTEFIHHMLSKAHHNITHVDDEDF  63

Query  352   FSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSG  531
             FSG R+ GLDIRY+TISDG P ++DR +N +++  ++L  + + V E + +I+ S+ +  
Sbjct  64    FSGARQSGLDIRYMTISDGFPLDYDRILNFNEYWEAILRDFPSRVHELVGRIIQSNES--  121

Query  532   GPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVRE  711
                V  L+ADTF+ +P  +A+++ +L +SFWTEPALVF++ YHL LLR NG F     +E
Sbjct  122   --LVPFLVADTFYSWPASIAEEFNILNVSFWTEPALVFSIDYHLDLLRENGFFPSKGNQE  179

Query  712   DAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETV  891
             D I++VPGV+SI  KDLMSY+Q+    TV HQI++K+F   ++ADF+L NTV ELEHET+
Sbjct  180   DLIDFVPGVQSIKTKDLMSYLQDAHITTVIHQIVFKAFDQVKHADFILINTVNELEHETL  239

Query  892   AALQEKTSFFTVGPI-FPPVFAQSAVATSL*SESDCEPLL  1008
              AL +K   + +G I F   F ++ V  SL SE+DC   L
Sbjct  240   LALNKKQPSYAIGSINFSTDFTKTVVPKSLWSETDCTEWL  279



>ref|XP_004249916.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Solanum lycopersicum]
Length=474

 Score =   254 bits (650),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/270 (46%), Positives = 179/270 (66%), Gaps = 7/270 (3%)
 Frame = +1

Query  190  KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTK--SNPRDDDIFSGI  363
            +PHA+LI  P QGHI P  HLA +LA +GFT+TF+NT S H  + K  S+  DD+ FS  
Sbjct  8    QPHAVLIPVPFQGHINPFTHLAMKLASRGFTITFVNTESTHERIAKAHSHKDDDNPFSHA  67

Query  364  RKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPV  543
             + GLDIRY  ISDG P  +DR  N  QFM  L H++ AHV++ ++ ++ S  N   PPV
Sbjct  68   EESGLDIRYARISDGFPLSFDRRANASQFMIGLTHVFQAHVDDFIENLVLSKPN---PPV  124

Query  544  NCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIE  723
            +C+IAD+F V+   +AKKY L+ +SFWTEPA   T++Y+  LL+ NGHFG  D  +D I 
Sbjct  125  SCIIADSFHVWGSMIAKKYNLINVSFWTEPATALTVFYNADLLKRNGHFGRHDKYDDTIS  184

Query  724  YVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQ  903
            Y+PG+++I  +DL SY Q+ +   +  + ++K  +DA+ AD V+ NTVQELE  T++ALQ
Sbjct  185  YIPGIQAIKPEDLPSYCQDADPNDI--KYVFKCIEDAQKADIVIGNTVQELESSTISALQ  242

Query  904  EKTSFFTVGPIFPPVFAQSAVATSL*SESD  993
            E+  F+ +GP+ P  F +  ++T+L   +D
Sbjct  243  EQQPFYAIGPLCPTNFTKKTISTNLLPTTD  272



>ref|XP_006350953.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Solanum tuberosum]
Length=474

 Score =   254 bits (650),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 124/270 (46%), Positives = 177/270 (66%), Gaps = 7/270 (3%)
 Frame = +1

Query  190  KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSN--PRDDDIFSGI  363
            +PHA+LI  PLQGHI P  HLA +LA KGFT+TF+NT S H  + K+     DD+ FS  
Sbjct  8    QPHAVLIPVPLQGHINPFTHLAMKLASKGFTITFVNTESTHQRIAKAQSLKDDDNPFSHA  67

Query  364  RKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPV  543
             + GLDIRY  ISDG P  +DR  N  QFM  L H++ AHV++ ++ ++ S  N   PPV
Sbjct  68   EESGLDIRYARISDGFPLSFDRRANASQFMIGLTHVFQAHVDDFIENLVLSKPN---PPV  124

Query  544  NCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIE  723
            +C+I D+F V+   +A+KY L+ +SFWTEPA V T++Y+  LL+ NGHFG  D  +D I 
Sbjct  125  SCIITDSFHVWGSTIARKYNLVNVSFWTEPATVLTVFYNTDLLKRNGHFGRHDKYDDTIS  184

Query  724  YVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQ  903
            Y+PG+++I  +DL SY Q+ +      + ++K  +DA+ AD V+ NTVQELE  T+ ALQ
Sbjct  185  YIPGIQAIKPEDLPSYCQDADPNET--KYVFKCIEDAQKADIVIGNTVQELESSTILALQ  242

Query  904  EKTSFFTVGPIFPPVFAQSAVATSL*SESD  993
            E+  F+ +GPI P  F +  ++T+L   +D
Sbjct  243  EQQPFYAIGPICPTNFTKKTISTNLLPATD  272



>ref|XP_010669654.1| PREDICTED: UDP-glycosyltransferase 86A2-like [Beta vulgaris subsp. 
vulgaris]
Length=490

 Score =   251 bits (642),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/278 (47%), Positives = 185/278 (67%), Gaps = 13/278 (5%)
 Frame = +1

Query  187  QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPR----DDDIF  354
            QK HAIL+  P QGH+IP VHLA +LA KGF++TFINT  +H+ +T SN        DIF
Sbjct  16   QKLHAILVVLPQQGHVIPFVHLAIKLASKGFSITFINTDHIHHKITLSNATVLEDGGDIF  75

Query  355  SGIRKP--GLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANS  528
               RK   GLDI YVTI+DGLP E+DR++ HDQ+  +  + + AH+E A+ KI+ S    
Sbjct  76   VEARKKYSGLDIEYVTITDGLPLEFDRSLYHDQWRGATTYCFPAHLELAVSKIVRSR---  132

Query  529  GGPPVNC-LIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFG-CID  702
              P V C L+AD++FV+  KLA K+ L ++SFWTE A+V  +Y+H HLL+ NGH G    
Sbjct  133  --PLVPCCLVADSYFVWASKLASKFGLFHVSFWTENAMVLDIYFHRHLLKENGHIGPGSS  190

Query  703  VREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEH  882
            VR+ +I+Y+PG++S++  DL SY+QE +      Q  +++  D R A F+L NTVQELE 
Sbjct  191  VRKGSIDYIPGIKSLNRTDLTSYLQEEDLTAFHPQYNFQALDDTRRAHFILGNTVQELEA  250

Query  883  ETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDC  996
            +T+ A++    F+ +GP+FPP F +  VATSL +E DC
Sbjct  251  DTITAVEAHVPFYAIGPLFPPGFTKMPVATSLWAEFDC  288



>ref|XP_011074004.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Sesamum indicum]
Length=479

 Score =   249 bits (636),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 125/272 (46%), Positives = 177/272 (65%), Gaps = 6/272 (2%)
 Frame = +1

Query  190  KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPR--DDDIFSGI  363
            KPHAIL++YP QGHI P V+LA  LA +GFT+T++    +H+ L+K + R  D D+F   
Sbjct  8    KPHAILLAYPFQGHITPMVNLAVNLASRGFTITYVQLEFIHHTLSKGHDRAGDVDVFVEA  67

Query  364  RKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPV  543
            RK GLDIRY T+SDG   E+DR +N  ++   ++  + A V+E +  I TS +++     
Sbjct  68   RKSGLDIRYTTMSDGFSLEFDRKLNMSEYWEGMIRDFPALVDELIGSITTSDSSA---TA  124

Query  544  NCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIE  723
            + L+ADT + +P  +AKK+ L+++S WTEPA VF + YHL LLR NGH  C    ++ I 
Sbjct  125  SILVADTLYSWPAAIAKKHNLVHVSLWTEPATVFAIDYHLDLLRENGHLPCSGNGDNCIN  184

Query  724  YVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQ  903
            Y+PGV+SI  KDLMSYIQ  +   V  +I+ K+F+  +NADF+LCNTVQELE E ++AL 
Sbjct  185  YIPGVKSISSKDLMSYIQAPDVVPVLMKIVAKAFEQVKNADFILCNTVQELEAECLSALN  244

Query  904  EKTSFFTVGPI-FPPVFAQSAVATSL*SESDC  996
             K   + +GP+ F   F  + V  SL  ESDC
Sbjct  245  LKQPTYAIGPMNFFSDFTNTVVEKSLWPESDC  276



>ref|XP_009398946.1| PREDICTED: UDP-glycosyltransferase 86A2-like [Musa acuminata 
subsp. malaccensis]
Length=482

 Score =   248 bits (633),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/277 (46%), Positives = 175/277 (63%), Gaps = 10/277 (4%)
 Frame = +1

Query  190   KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDD---IFSG  360
             K HAI ++ P QGH  P+ + A ++A +GF VTF+ T + H+  T S     D   +F+ 
Sbjct  9     KHHAIFVAAPFQGHFTPAANFAVKIAARGFIVTFVTTEAFHHQRTASGAVSVDGHEVFAD  68

Query  361   IRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPP  540
              R  GLDIRY  +SDGLP  +DR ++ DQF  +  H+  AHVEE ++K+L +       P
Sbjct  69    ARSMGLDIRYELVSDGLPVTFDRYMHRDQFSDAFYHLLPAHVEELMRKLLLAEN-----P  123

Query  541   VNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGC-IDVREDA  717
             ++ LI+DTF V+P  LAKK+ L Y+SFWTEPALVF +YYH+HLL  NGHFG   + R+D 
Sbjct  124   IDVLISDTFAVWPSTLAKKFGLPYVSFWTEPALVFAIYYHMHLLVENGHFGSPTETRKDT  183

Query  718   IEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAA  897
             I Y+PGV SI+  DL+S+    E      + + K+F++ + ADFVLCNTVQELE E + A
Sbjct  184   ITYIPGVPSIEPTDLVSFFHAPEASWRLLRNVGKAFEEVKGADFVLCNTVQELEVEVIGA  243

Query  898   LQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             LQ++  F+ VGPI P    +   ATSL  E DC   L
Sbjct  244   LQQEWPFYAVGPIGPDS-GEGGAATSLWPELDCSQWL  279



>gb|KHG24976.1| hypothetical protein F383_10689 [Gossypium arboreum]
Length=179

 Score =   238 bits (606),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 143/176 (81%), Gaps = 7/176 (4%)
 Frame = +1

Query  172  MAD-SGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPR-DD  345
            MAD S QK HAI I YPLQGH+IPSV+LA +LA KGFT+TFINTH+VH+   K++P    
Sbjct  1    MADESSQKSHAIFIPYPLQGHVIPSVNLAIKLASKGFTITFINTHAVHHQTAKAHPDIGS  60

Query  346  DIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSAN  525
            DIF+ +R+ GLDIRY T+SDGLP E+DR++NHDQFMASLLH +SAHV+E + +I+ S   
Sbjct  61   DIFAKVRESGLDIRYATVSDGLPVEFDRSLNHDQFMASLLHEFSAHVDEVVSRIVGS---  117

Query  526  SGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFG  693
              G  V+CLIADTFFV+P K+AKK+ LLY+S+WTEPALVFTLY+HL LLR NGHFG
Sbjct  118  --GEKVHCLIADTFFVWPSKIAKKFGLLYVSYWTEPALVFTLYHHLDLLRENGHFG  171



>ref|XP_011094621.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Sesamum indicum]
Length=476

 Score =   247 bits (631),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 129/280 (46%), Positives = 184/280 (66%), Gaps = 4/280 (1%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDI  351
             M++S  KPHAI+++ P QGHI P V+LA +LA KG  VTF++   +H+ L++S     D+
Sbjct  1     MSESCPKPHAIMLALPYQGHITPFVNLALKLASKGIVVTFVHLEFIHHTLSQSQQSSSDL  60

Query  352   FSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSG  531
             FS  R+ GL++RY TI DG   E+DR V+ D++  S+L  +   VEE + K + S   S 
Sbjct  61    FSEARECGLEVRYTTIDDGFSLEFDRVVHSDEYWESMLRDFPGRVEEFVVKTIQSDDPSF  120

Query  532   GPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVRE  711
                 + LIADTF+ +P  +AKK+ LL +SFWTEPAL+F+L YH++LL+ NGHF C D  E
Sbjct  121   A---HFLIADTFYTWPAAIAKKHNLLNVSFWTEPALMFSLAYHMNLLKENGHFPCKDHVE  177

Query  712   DAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETV  891
             + I Y+PGV  I  KDLMSY++ T+T T+  +++ K+F++ + ADF+L NTV ELE ET+
Sbjct  178   EEINYLPGVEEISTKDLMSYLKATDTATIVDKVVPKAFEEVKKADFILHNTVHELESETL  237

Query  892   AALQEKTSFFTVGPI-FPPVFAQSAVATSL*SESDCEPLL  1008
             +AL +    + VGPI F    A   V+ SL SE DC   L
Sbjct  238   SALNKYQPNYAVGPINFSKTLATITVSKSLRSELDCTNWL  277



>ref|XP_004172588.1| PREDICTED: UDP-glycosyltransferase 86A2-like, partial [Cucumis 
sativus]
Length=173

 Score =   237 bits (605),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 138/172 (80%), Gaps = 7/172 (4%)
 Frame = +1

Query  184  GQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPR-DDDIFSG  360
             QKPHAI I+YPLQGH+IPSVHLA  LA +GF VTFINTH++H      +    DD+FS 
Sbjct  7    NQKPHAIFIAYPLQGHVIPSVHLAIHLAARGFIVTFINTHAIHQQTCNGHSSAGDDLFSA  66

Query  361  IRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPP  540
            +RK GLDIRY T+SDGLP  +DR++NHDQFM SLLH++SAHVEEA+++I+ + A      
Sbjct  67   VRKSGLDIRYKTVSDGLPVGFDRSLNHDQFMGSLLHVFSAHVEEAVERIVKTEA------  120

Query  541  VNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGC  696
            V+CLIADTFFV+P K+AKK+ LLY+SFWTEPALVFTLYYH++LLR+N HF C
Sbjct  121  VSCLIADTFFVWPSKVAKKFDLLYVSFWTEPALVFTLYYHMNLLRINRHFDC  172



>ref|XP_009405745.1| PREDICTED: UDP-glycosyltransferase 86A2-like [Musa acuminata 
subsp. malaccensis]
Length=479

 Score =   246 bits (627),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 129/285 (45%), Positives = 177/285 (62%), Gaps = 12/285 (4%)
 Frame = +1

Query  172   MADSG--QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDD  345
             MADS    K HA+ ++ P QGH  P+ + A +LA +GF VTF+ T   H+    S     
Sbjct  1     MADSEGITKHHALFVTVPFQGHFTPAANFAVKLAARGFIVTFVTTEGFHHQRAASGAVSV  60

Query  346   D---IFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTS  516
             D   +F+  R  G+DIR   +SDGLP  +DR ++ DQF  +  H+  +HVEE ++K+L +
Sbjct  61    DGHEVFADARSMGMDIRSELVSDGLPVSFDRTLHRDQFSDAFYHLLPSHVEELMRKLLLA  120

Query  517   SANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGC  696
                   PP++ LI+DTF V+P  LAKK+ L Y+SFWTE ALVF +YYH+HLL   GHFG 
Sbjct  121   E-----PPIDVLISDTFNVWPSTLAKKFGLPYVSFWTEAALVFAIYYHVHLLVEYGHFGS  175

Query  697   -IDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQE  873
               + R+DAI Y+PGV SI+  DL+S+    E      + + K+F++A+ ADFVLCNTVQE
Sbjct  176   PTETRKDAIMYIPGVPSIEPTDLVSFFHSPEASWRVLRNVGKAFEEAKGADFVLCNTVQE  235

Query  874   LEHETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             LE E + ALQ++  F+ VGPI  P   +   ATSL  E DC   L
Sbjct  236   LEAEVIGALQQERPFYAVGPIV-PASGEGGAATSLWPELDCSQWL  279



>ref|XP_011091584.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Sesamum indicum]
Length=484

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/279 (45%), Positives = 179/279 (64%), Gaps = 7/279 (3%)
 Frame = +1

Query  190   KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSN---PRDDDIFSG  360
             KPHAILI YP QGH+ P ++LA RLA +GFT+TF+ T  +H  + K+        D+F+ 
Sbjct  7     KPHAILIPYPYQGHVTPMINLAIRLASRGFTITFVQTEFIHQFMCKAQNLPAASFDLFAE  66

Query  361   IRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPP  540
              RK GLDIRY TISDG P ++DR +N +++  S+   +   V+E + K +        PP
Sbjct  67    ARKSGLDIRYTTISDGFPLDFDRHLNFNEYWESMFRNFPDRVDEIVVKTMEDDVLPETPP  126

Query  541   VNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCID--VRED  714
                L+ADTF+ +P  +AKK+ ++ ISFWTEPA+VF+L YHL LLR NG          E+
Sbjct  127   F-LLVADTFYTWPATIAKKHNMVNISFWTEPAIVFSLNYHLELLRQNGFSDKTQHGNAEN  185

Query  715   AIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVA  894
              I Y+PG++SI  +DLM+Y+Q+ E   +  +I+ K F+  + ADF+LCNTV+ELE ET+A
Sbjct  186   YINYIPGIQSISTRDLMTYLQDPEAIPMLIKIVEKGFEQVKKADFILCNTVEELELETLA  245

Query  895   ALQEKTSFFTVGPI-FPPVFAQSAVATSL*SESDCEPLL  1008
             AL +K   + +GPI F     Q+++A SL SESDC   L
Sbjct  246   ALNQKHPTYAIGPINFYTDLTQTSIAKSLWSESDCTQWL  284



>gb|EYU34484.1| hypothetical protein MIMGU_mgv1a005271mg [Erythranthe guttata]
 gb|EYU34485.1| hypothetical protein MIMGU_mgv1a017916mg [Erythranthe guttata]
Length=490

 Score =   243 bits (620),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 134/289 (46%), Positives = 187/289 (65%), Gaps = 16/289 (6%)
 Frame = +1

Query  169   AMADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKS---NPR  339
             A   + +K HAI+IS P QGHI P V LA +LA  GF++TF++   +H+ L+K+   NP 
Sbjct  2     AAESACKKSHAIMISVPYQGHINPFVGLALKLASNGFSITFVHLEFIHHKLSKAHHKNPE  61

Query  340   DDDIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSS  519
             + D+FS  R+ GLDIRY T+SDG P E+DR ++  ++  SLL  +   VEE + KI+ S 
Sbjct  62    EFDLFSEARESGLDIRYTTMSDGFPLEFDRDLHIMEYWESLLRDFPTIVEEFVGKIIRSD  121

Query  520   ANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCI  699
               S    V  L+ADT + +P  +AKKY L+ +S WTEPALVF+L YHL LLR  GHF C 
Sbjct  122   QVS----VYFLVADTNYFWPATIAKKYNLVNVSLWTEPALVFSLIYHLDLLREKGHFPCK  177

Query  700   DVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELE  879
             D  E+ I+YVPGV  I  +DLM Y++E E+++V  +I+  SF++ + ADF+L NTVQELE
Sbjct  178   DNIEEEIDYVPGVGKISTRDLMPYLKEAESQSVLTRILSASFKEVKKADFILHNTVQELE  237

Query  880   HETVAALQEKTSFFTVGPIFPPVFAQS------AVATSL*SESDCEPLL  1008
              ET+++L +    + VGPI    F++S       V+ SL SESDC   L
Sbjct  238   SETLSSLNKYQPNYAVGPI---NFSKSNLPTNTTVSKSLWSESDCTKWL  283



>ref|XP_010678487.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Beta vulgaris subsp. 
vulgaris]
Length=476

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 130/282 (46%), Positives = 183/282 (65%), Gaps = 10/282 (4%)
 Frame = +1

Query  181   SGQKPHAILISYPLQGHIIPSVHLACRLAE-KGFTVTFINTHSVHYHLTKSNPR--DDDI  351
             + Q  HAI +   LQGHI P+VH + +LA  K FT+TF+    +H  LT++ P     DI
Sbjct  7     NNQNHHAIFLPLSLQGHINPAVHFSHKLASSKNFTITFLTFEFLHQQLTQARPDGCSTDI  66

Query  352   FSGIRK--PGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHI-YSAHVEEALKKILTSSA  522
             FS  R    GLDIRY  +SDGLP E+DR    ++F+   L       V + +++I+  S 
Sbjct  67    FSRARDGPDGLDIRYRAVSDGLPMEFDRTGQLEEFLMWYLDGGMFDQVAKGVEEIVLDSR  126

Query  523   NSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCID  702
                 P V+ LI DTF+ +  K+AK + L   SFWTEPALVF +YYH+HLL+ +GHF C D
Sbjct  127   ----PKVDVLIIDTFYPWASKIAKMFGLRLASFWTEPALVFNMYYHVHLLKQHGHFDCPD  182

Query  703   VREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEH  882
              R+D I+Y+PGV+SI+  +L SYIQ+ +  T  H++I++++QD R+ADFVLCNTVQELE 
Sbjct  183   TRKDPIDYIPGVQSIEPHNLPSYIQDKDISTNMHKLIFQAYQDVRSADFVLCNTVQELES  242

Query  883   ETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             +T++ALQ    F+TVGPI P    ++ ++TSL  ES+C   L
Sbjct  243   DTISALQAVMPFYTVGPIIPSRSLENVMSTSLWVESNCSEWL  284



>ref|XP_008779947.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Phoenix dactylifera]
Length=180

 Score =   231 bits (589),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 142/185 (77%), Gaps = 6/185 (3%)
 Frame = +1

Query  172  MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDI  351
            MA+ G KPHA++I+YPLQGHIIP VHLA +LA KGFT+TF NT +VH+  T+++   DDI
Sbjct  1    MAEQGHKPHALIIAYPLQGHIIPVVHLAIKLASKGFTITFANTEAVHHQTTQAH-SSDDI  59

Query  352  FSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSG  531
            F+G R  GLDIRY  +SDGLP  +DR++NHDQFMASLLH+ SAHVEE ++K+L +S    
Sbjct  60   FAGARASGLDIRYELVSDGLPVSFDRSLNHDQFMASLLHVLSAHVEELVQKLLHAS----  115

Query  532  GPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVRE  711
             PP+ CLI DTFFV+P  +AKK+ + Y+SFWTE A++FTLYYH++LL+ NGHF  +  + 
Sbjct  116  -PPITCLITDTFFVWPSTIAKKFGIPYVSFWTEAAIIFTLYYHMNLLKKNGHFASLGNKS  174

Query  712  DAIEY  726
            +   Y
Sbjct  175  NFFIY  179



>ref|XP_011091585.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Sesamum indicum]
Length=484

 Score =   238 bits (608),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 121/279 (43%), Positives = 179/279 (64%), Gaps = 7/279 (3%)
 Frame = +1

Query  190   KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSN---PRDDDIFSG  360
             KPHAI+I YP QGH+ P ++LA RLA +GFT+TF+ T  +H  + K+        D+F+ 
Sbjct  7     KPHAIVIPYPYQGHVTPMINLAIRLASRGFTITFVQTEFIHQFMCKAQNLPAASFDLFAE  66

Query  361   IRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPP  540
              RK  LDIRY TISDG P ++DR +N +++  S+   +   V+E + K + +      PP
Sbjct  67    ARKSDLDIRYTTISDGFPLDFDRDLNFNEYWESMFRDFPDRVDEIVVKTMEADVLPETPP  126

Query  541   VNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCID--VRED  714
                L+ADTF+ +P  +AKK+ ++ +SFWTEPA+VF+L YHL LLR NG          E+
Sbjct  127   F-LLVADTFYTWPATIAKKHNMVNVSFWTEPAIVFSLNYHLELLRQNGFSDKTQHGNAEN  185

Query  715   AIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVA  894
              I Y+PG++SI  +DLM+Y+Q+ E   +  +I+ K F+  + ADF+LCNTV+ELE ET++
Sbjct  186   YINYIPGIQSISTRDLMTYLQDPEAIPMLIKIVEKGFEQVKKADFILCNTVEELELETLS  245

Query  895   ALQEKTSFFTVGPI-FPPVFAQSAVATSL*SESDCEPLL  1008
             AL +K   + +GPI F     ++++A SL SESDC   L
Sbjct  246   ALNQKHPTYAIGPINFYTDLTKTSIAKSLWSESDCTQWL  284



>gb|EYU34489.1| hypothetical protein MIMGU_mgv1a005852mg [Erythranthe guttata]
Length=468

 Score =   236 bits (602),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 123/277 (44%), Positives = 180/277 (65%), Gaps = 11/277 (4%)
 Frame = +1

Query  184  GQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDD----DI  351
              K HAI+I+ P QGHI P ++LA +LA KGF +TF++   +H  +  S  RD+    D+
Sbjct  2    ASKAHAIMIALPYQGHITPLINLATKLASKGFVITFVHLEFIH-QMMLSQSRDNTIQPDL  60

Query  352  FSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSG  531
            FSG R+ GLDIRY TISDG P E+DRA++ D++  S+L  +   V+E + +I+ ++  S 
Sbjct  61   FSGARESGLDIRYETISDGFPLEFDRALHTDEYWESMLSDFPHRVDELVTEIIRANPCSA  120

Query  532  GPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVRE  711
                + L+ DT + +P ++AKK+ L+ +SFWTEPALVF+L YH+ LL  NGHF C D  E
Sbjct  121  ----HFLVTDTLYTWPAEIAKKHNLVNVSFWTEPALVFSLAYHIDLLTENGHFPCKDHVE  176

Query  712  DAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETV  891
            + I+Y+PG+ SI  KDLM Y++E+   T  H+I  ++FQ  + ADF+L NTVQE E  T+
Sbjct  177  EEIKYLPGIESISTKDLMPYLKESAIGTTVHKIETRAFQQVKKADFILHNTVQEFESSTL  236

Query  892  AALQEKTSFFTVGPI-FPPVFAQS-AVATSL*SESDC  996
            +AL +    + +GP+ F      + AV+ SL SE DC
Sbjct  237  SALNKHQPNYAIGPVNFSKNLGTNYAVSNSLWSEHDC  273



>gb|EEE51029.1| hypothetical protein OsJ_31675 [Oryza sativa Japonica Group]
Length=1032

 Score =   244 bits (624),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 158/211 (75%), Gaps = 6/211 (3%)
 Frame = +1

Query  376   LDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPVNCLI  555
             +D+RY  +SDGLP  +DR++NHD FM SLLH + AHVE  L++++  +A         L+
Sbjct  1     MDVRYEVVSDGLPVGFDRSLNHDDFMGSLLHAFGAHVEALLRRVVVDAA------ATFLV  54

Query  556   ADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIEYVPG  735
             ADTFFV+P  L+KK  + Y+SFWTEPAL+F LYYH++LL  +GHF C + R+D I YVPG
Sbjct  55    ADTFFVWPATLSKKLGIPYVSFWTEPALIFNLYYHINLLTEHGHFRCNEPRKDTITYVPG  114

Query  736   VRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQEKTS  915
             V +I+  +LMSY+Q+T+T TV H+II+++F++AR AD+V+CNTV+ELE  T+AAL+ +  
Sbjct  115   VEAIEPGELMSYLQDTDTTTVVHRIIFRAFEEARGADYVVCNTVEELEPSTIAALRRERP  174

Query  916   FFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             F+ VGPI P  FA+SAVATS+ +ESDC   L
Sbjct  175   FYAVGPILPAGFARSAVATSMWAESDCSRWL  205



>ref|XP_011094622.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Sesamum indicum]
Length=485

 Score =   234 bits (597),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 132/288 (46%), Positives = 184/288 (64%), Gaps = 15/288 (5%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKS-----NP  336
             MA+  +KPHAI+IS P QGHI P V+LA ++A KGF++TF++  SVH+ ++K+     N 
Sbjct  1     MAECHRKPHAIMISIPYQGHINPFVNLALKIASKGFSITFVHFESVHHRVSKAHHLHCNK  60

Query  337   RDDDIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTS  516
                DIFS  R+ GLDIRY TISDGLP E+DR  N +++   +L  + A V+E + KI+ S
Sbjct  61    TQVDIFSEARESGLDIRYTTISDGLPVEFDRYSNFEEYWGRILRDFPARVDEFVGKIIQS  120

Query  517   SANSGGPPVN-CLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFG  693
                   P V+   +ADTFF +P  +A+KY L+ +S WT+PALVFTL YHL LLR NGHF 
Sbjct  121   D-----PYVDYFFVADTFFPYPATIAEKYNLVNVSLWTQPALVFTLAYHLDLLRENGHFP  175

Query  694   CIDVREDAIEYVPGVRSIDVKDLMSYIQETET--ETVCHQIIYKSFQDARNADFVLCNTV  867
             C D   + + Y+PGV+ I  +DL+S ++E+E    T+   +   S Q A+ ADF+L NTV
Sbjct  176   CKDNIHEEVNYIPGVKPISTRDLVSVMKESEQGYHTMLTSLFMASDQ-AKKADFILHNTV  234

Query  868   QELEHETVAALQEKTSFFTVGPI-FPPVFAQSAVATSL*SESDCEPLL  1008
              ELE +T++AL +    + +GPI F        V+ SL SESDC   L
Sbjct  235   HELEADTLSALNKYQPNYAIGPINFFKNLPTYTVSKSLWSESDCSEWL  282



>ref|XP_011074246.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Sesamum indicum]
Length=478

 Score =   233 bits (595),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 119/278 (43%), Positives = 176/278 (63%), Gaps = 6/278 (2%)
 Frame = +1

Query  172  MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNP--RDD  345
            M ++  +PHAI+ SYP QGHI P+++LA  LA +GFT+T++    VH+ ++K++    D 
Sbjct  1    MGETHPRPHAIVFSYPFQGHITPTLNLATNLASRGFTITYVQLEFVHHTISKAHDGVEDV  60

Query  346  DIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSAN  525
            D F   R+ GLD+RY TISDG P E+DR +N ++    ++  +   V+E +  I  S A+
Sbjct  61   DFFVQARRSGLDMRYTTISDGFPLEFDRNLNFNEHWEGMVRDFPDRVDELVGSITRSDAS  120

Query  526  SGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDV  705
            +       L+ADT + +P  +AKK+ L+ +S WT  A VF++  HL+LLR NGH  C   
Sbjct  121  AAA---FFLVADTLYTWPAAIAKKHNLVNVSLWTGAATVFSINSHLNLLRENGHLPCRGN  177

Query  706  REDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHE  885
             E+ I Y+PGV+SI  KDLM YIQ+ +   V  +I+ K+F+  +NADF+LCNTVQELE E
Sbjct  178  DEEHISYIPGVQSIRTKDLMPYIQDPDVVPVLMKIVVKAFEQVKNADFILCNTVQELEAE  237

Query  886  TVAALQEKTSFFTVGPI-FPPVFAQSAVATSL*SESDC  996
             ++AL  K   + +GP+ F   F ++ V  SL  ESDC
Sbjct  238  CLSALNLKQPTYAIGPMNFFSDFTKTVVEKSLWPESDC  275



>ref|XP_011069428.1| PREDICTED: UDP-glycosyltransferase 86A1-like, partial [Sesamum 
indicum]
Length=281

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 124/284 (44%), Positives = 179/284 (63%), Gaps = 13/284 (5%)
 Frame = +1

Query  172  MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKS-----NP  336
            MA++  KPHAI+IS P QGHI P V+LA ++A KGF++TF++   VH+ L+K+     N 
Sbjct  1    MAENRGKPHAIMISVPYQGHINPFVNLALKIASKGFSITFVHFEFVHHRLSKAHHLHCNK  60

Query  337  RDDDIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTS  516
               DIFS  R+ GLDIRY TISDG P E+DR  N+++F   +LH + + V+E ++K + S
Sbjct  61   TQVDIFSEARESGLDIRYTTISDGFPLEFDRDANYEEFWGRVLHEFPSRVDEFVRKTIKS  120

Query  517  SANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGC  696
                    ++ L+ADT F +P  +A+KY L+ +S WTEPALVFTL YH+ LL  NGHF C
Sbjct  121  DPYL----LHFLVADTVFSWPATIAEKYNLVNVSLWTEPALVFTLAYHVDLLIENGHFPC  176

Query  697  -IDVREDAIEYVPGVRSIDVKDLMSYIQETET--ETVCHQIIYKSFQDARNADFVLCNTV  867
             ++   + + YVPGV+SI  +DL+S   E+         + ++ +F+  + ADF+L NTV
Sbjct  177  KVNNIHEEVNYVPGVKSISTRDLISVSMESAQGYNYTMLESVFMAFEQVKKADFILHNTV  236

Query  868  QELEHETVAALQEKTSFFTVGPI-FPPVFAQSAVATSL*SESDC  996
             ELE ET++ L +    + +GPI F        V+ SL SESDC
Sbjct  237  HELEAETLSVLNKYQPNYAIGPINFFKNLPTYTVSKSLWSESDC  280



>ref|XP_011094624.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Sesamum indicum]
Length=482

 Score =   230 bits (586),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 125/285 (44%), Positives = 179/285 (63%), Gaps = 12/285 (4%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTK-----SNP  336
             M +S  KPHAI+IS P QGHI P V+LA ++A KGF++TF++   VH+ L+K     +  
Sbjct  1     MGESHGKPHAIMISVPYQGHINPFVNLALKIASKGFSITFVHLEFVHHKLSKVHDHTTTA  60

Query  337   RDDDIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTS  516
                D F   R+ GLDIRY TISDG P E+DR ++  ++  +L H + A V+E +  I+ S
Sbjct  61    DQVDFFFVARESGLDIRYTTISDGYPLEFDRDLHQLEYFNTLFHDFPARVDEFVGNIIQS  120

Query  517   SANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGC  696
                S    V+ L+ DT + +P  +A KY L+ +SFWTE ALVF+L YH  LLR  GH  C
Sbjct  121   DPFS----VHFLVTDTIYHWPATIAHKYNLVNVSFWTELALVFSLGYHWDLLREKGHVPC  176

Query  697   IDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQEL  876
              D +E  I Y+PG+ SI  +D+MSY++  E E V  ++++ +FQ+ + ADFVL NTVQEL
Sbjct  177   KDNKEVEINYLPGIESISTRDVMSYLR--EEEIVLSEVLFVAFQEVKKADFVLHNTVQEL  234

Query  877   EHETVAALQEKTSFFTVGPI-FPPVFAQSAVATSL*SESDCEPLL  1008
             E ET++AL +    + +GPI F  +   + ++ SL  ESDC   L
Sbjct  235   ESETLSALNKYLPNYAIGPINFSKILDTNTISKSLWPESDCTEWL  279



>ref|XP_011094740.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Sesamum indicum]
Length=486

 Score =   228 bits (581),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 126/283 (45%), Positives = 175/283 (62%), Gaps = 13/283 (5%)
 Frame = +1

Query  190   KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKS--------NPRDD  345
             K HAI+I+ P QGH  P  HLA +LA KGFT+TF++T   H+ ++KS        N  + 
Sbjct  8     KLHAIMIAVPYQGHANPFTHLAIKLASKGFTITFVHTEDAHHRISKSYQKRNSTSNSNEV  67

Query  346   DIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSAN  525
             DIFS  R  GLDIRY TISDG P E+DR  N D++  S+ H + + V+E +  ++ SS  
Sbjct  68    DIFSEARDSGLDIRYTTISDGFPLEFDRIHNIDEYWESMFHDFPSRVDEFIGNLIESSDP  127

Query  526   SGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTL-YYHLHLLRLNGHFGCID  702
             S  P    L+ADT + +P  +AKKY L+ +SFWTEPALVF +  Y+  LL  NGHF   D
Sbjct  128   SLVP---FLVADTVYSWPATIAKKYNLVNVSFWTEPALVFAISNYYFDLLSTNGHFPRTD  184

Query  703   VREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEH  882
                 +I+Y+PGV  I  KDLM Y+ E +T TV H+I+ K+F++ + ADF+L NTVQELE 
Sbjct  185   DPLYSIDYIPGVELISNKDLMPYLHEVDTTTVTHKILIKAFEEVKKADFILHNTVQELEL  244

Query  883   ETVAALQEKTSFFTVGPI-FPPVFAQSAVATSL*SESDCEPLL  1008
              T++ L +K   + +GP+       ++ V+ SL  E DC   L
Sbjct  245   YTLSILNQKQPTYAIGPVNLSSECIKTRVSKSLFFEIDCSKWL  287



>ref|XP_011094623.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Sesamum indicum]
Length=482

 Score =   228 bits (580),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 124/285 (44%), Positives = 180/285 (63%), Gaps = 12/285 (4%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDD--  345
             M +S  KPHAI+IS P QGHI P V+LA ++A KGF++TF++   VH+ L+K++      
Sbjct  1     MGESHGKPHAIMISVPYQGHINPFVNLALKIASKGFSITFVHLEFVHHKLSKAHDHTTTT  60

Query  346   ---DIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTS  516
                D FS  R+  LDIRY TI DG P E+DR ++  ++  SL H + A V+E +  I+ S
Sbjct  61    DQVDFFSVARESCLDIRYTTICDGYPLEFDRDLHFLEYFNSLYHDFPARVDEFVGNIIQS  120

Query  517   SANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGC  696
                S    ++ L+ADT + +P  +A KY L+ +SFWTEPALVF+L YH  LLR  GH  C
Sbjct  121   DPYS----LHFLVADTIYHWPATIAHKYNLVNVSFWTEPALVFSLGYHWDLLREKGHVPC  176

Query  697   IDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQEL  876
              D +E  I Y+PGV SI  +D+MSY+  +  E +   +++ +FQ+ + ADF+L NTVQEL
Sbjct  177   KDNKEVEINYLPGVESISTRDVMSYL--SGEEIILSDVLFLAFQEVKKADFILHNTVQEL  234

Query  877   EHETVAALQEKTSFFTVGPI-FPPVFAQSAVATSL*SESDCEPLL  1008
             E ET++AL +    + +GPI F  +   + ++ SL +ESDC   L
Sbjct  235   ECETLSALNKYLPNYAIGPINFSKILDTNTISKSLWAESDCTEWL  279



>gb|EYU36650.1| hypothetical protein MIMGU_mgv1a004868mg [Erythranthe guttata]
Length=506

 Score =   227 bits (579),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 121/296 (41%), Positives = 177/296 (60%), Gaps = 20/296 (7%)
 Frame = +1

Query  181   SGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDD----  348
             +  + HA+++S+  QGHI P +HLA +LA KG TVTF+ T  +H+ ++ ++   DD    
Sbjct  2     AANRGHAVMVSFLFQGHITPFIHLAIKLASKGCTVTFVQTEFLHHRISTASAAGDDEERE  61

Query  349   ---IFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSS  519
                IF G R+ GLDIRY TISDG P E+DR  N ++F  S+L  +   V+E L +I  + 
Sbjct  62    IPEIFLGARESGLDIRYATISDGFPLEFDREANFEEFWGSILRDFPGRVDEFLGRITAAE  121

Query  520   ANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCI  699
                GG P + L+ADT +++  ++A KY +  +SFWTE AL F++ YHL LL+LN HF  +
Sbjct  122   NCDGGVPPSFLVADTTYLWGSEIAHKYNMFSVSFWTEAALAFSIGYHLDLLKLNAHFPLV  181

Query  700   DVREDA----IEYVPGVRSIDVKDLMSYIQETET----ETVCHQIIYKSFQDARNADFVL  855
             +  +      I YVPG+ SI  +DLMSY++         TV +Q I  +++  + ADF+L
Sbjct  182   NNDDGGDGVVISYVPGIESISTRDLMSYLEGDNDPFNIPTVLYQNIIDAYEQVKKADFIL  241

Query  856   CNTVQELEHETVAALQEKTSFFTVGPI----FPPVFAQS-AVATSL*SESDCEPLL  1008
             CNTVQELE  T++AL ++   + VGP      PP+   S    TSL  E DC+  L
Sbjct  242   CNTVQELEPHTLSALNQEQPTYAVGPSNFSGTPPIITVSNTTTTSLWPEVDCQKWL  297



>ref|XP_010107480.1| UDP-glycosyltransferase 86A1 [Morus notabilis]
 gb|EXC16162.1| UDP-glycosyltransferase 86A1 [Morus notabilis]
Length=467

 Score =   226 bits (576),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 126/293 (43%), Positives = 181/293 (62%), Gaps = 42/293 (14%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHL-TKSNPR---  339
             M ++  KPHAI+   P QG++ PS+ LA +LA KGFT+TF+NT  +H+ + T S P    
Sbjct  1     MENNNSKPHAIMFPLPYQGYVTPSIQLAMKLASKGFTITFVNTEFIHHQIITSSQPDYST  60

Query  340   ------DDDIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALK  501
                   DDDIF   R  GLDIRY T++DG P                     AHV+E + 
Sbjct  61    VDGGSGDDDIFDKARDLGLDIRYKTMTDGFP---------------------AHVDELVG  99

Query  502   KILTSSANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLN  681
              ++ S      P V+CLIADTF+ +   +++KYKL+ ISFWT+PALVF +YYH+  L  +
Sbjct  100   NLVKSD-----PSVSCLIADTFYTWAPLISQKYKLVNISFWTQPALVFNIYYHMDFLITD  154

Query  682   GHF-GCIDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLC  858
             GHF    ++++ AI+Y+PGV++I+ KDL SY+QET+     H+   K F++ ++ADF+LC
Sbjct  155   GHFPPQYNLKDTAIDYIPGVKAIEPKDLSSYLQETDKGP--HEFFDKVFKEVKSADFILC  212

Query  859   NTVQELEHETVAALQEKTSFFTVGP--IFPPVFAQSA-VATSL*SESDCEPLL  1008
             NT+QELE +T+ ALQEK   F + P  + P  FA+S+ V TSL ++ DC   L
Sbjct  213   NTIQELESDTIFALQEKKPIFAISPQVLSPFGFAKSSTVPTSLRAKFDCSQWL  265



>ref|XP_011094738.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Sesamum indicum]
Length=495

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 120/283 (42%), Positives = 174/283 (61%), Gaps = 13/283 (5%)
 Frame = +1

Query  190   KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPR--------DD  345
             KPHAI+IS P QGH  P  HLA +LA KGFT+TF++T   H+ ++KS  +        + 
Sbjct  8     KPHAIMISVPYQGHANPFTHLAIKLASKGFTITFVHTQDAHHRISKSYQKLNSTSSSDEV  67

Query  346   DIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSAN  525
             DIFS  R  GLDIRY TI+DG P E+DR  N +++  S+LH + + V+E +  ++ S   
Sbjct  68    DIFSEARDSGLDIRYTTIADGFPLEFDRDQNVNEYWESILHDFPSRVDEFIGNLIESFDP  127

Query  526   SGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTL-YYHLHLLRLNGHFGCID  702
                P    L+AD  + +P  +AKKY L+ +SFWT PA V  + YY    LR NGHF   D
Sbjct  128   ELLP---FLVADAIYPWPATIAKKYNLVNVSFWTGPAAVLAINYYFFDHLRANGHFPPTD  184

Query  703   VREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEH  882
                 +I+Y+PGV SI  KDLM Y++E +T T+ H+++ + F++ + ADF+L NT+QELE 
Sbjct  185   DPLYSIDYIPGVESISSKDLMPYLREADTTTIVHKVLLRVFEEVKKADFILHNTLQELEQ  244

Query  883   ETVAALQEKTSFFTVGPI-FPPVFAQSAVATSL*SESDCEPLL  1008
              T++ L +K   + +GP+ F P   ++ V+ SL  E DC   L
Sbjct  245   HTLSTLNQKQPTYAIGPVSFSPDCIKTRVSKSLLFEIDCSKWL  287



>gb|EYU34480.1| hypothetical protein MIMGU_mgv1a004928mg [Erythranthe guttata]
Length=504

 Score =   220 bits (561),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/290 (42%), Positives = 182/290 (63%), Gaps = 16/290 (6%)
 Frame = +1

Query  172   MADSGQ--KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKS---NP  336
             M D  +  KPHAI+IS P QGHI P V+LA +LA +G +VTF++   VH+ L+K+   NP
Sbjct  1     MEDESECTKPHAIMISLPYQGHINPFVNLALKLASEGVSVTFVHLEFVHHKLSKARRQNP  60

Query  337   RDDDIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTS  516
              + D+F   R+ GLDI+Y TI DG P E+DR ++  ++  S +  + A V+E + + + S
Sbjct  61    NEFDLFDQARESGLDIQYTTIGDGFPLEFDRDLHLMEYWESFMRDFPAIVDEFIAEKIRS  120

Query  517   SANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGC  696
                   P    L++DT + +   +A+KYKL+ +S WTEPALVF+L YH  LL  NGHF C
Sbjct  121   H-----PVRYFLVSDTIYWWSSIVAEKYKLVNVSLWTEPALVFSLMYHSRLLSENGHFPC  175

Query  697   IDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQEL  876
              D   + I+YVPGV  I  +DLM Y++E E++++  +++  +F++ +NADF+L NTVQ+L
Sbjct  176   KDGIVEEIDYVPGVGKISTQDLMPYLKEAESQSIITKLLSVAFENVKNADFLLHNTVQQL  235

Query  877   EHETVAALQEKTSFFTVGPI----FPPVFAQSAVA--TSL*SESDCEPLL  1008
             E ET+  L ++   + +GPI     P +    +V   TSL SESDC   L
Sbjct  236   ESETLLYLNKQLPNYAIGPINFSESPAITNNKSVVSKTSLWSESDCTKWL  285



>gb|ABR17327.1| unknown [Picea sitchensis]
Length=491

 Score =   219 bits (557),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 116/274 (42%), Positives = 167/274 (61%), Gaps = 13/274 (5%)
 Frame = +1

Query  196  HAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIRKPG  375
            H + +  P+QGHI P  + A +LA KG TVTF+NT + + ++TK+    +D FS  +  G
Sbjct  15   HVVAVPLPVQGHITPMFNFAKKLAAKGVTVTFVNTEACYANITKAR-NGEDPFSHAQSLG  73

Query  376  LDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPVNCLI  555
            LDIR   ISDGLP E+DR++N ++F+ S       HVEE     L S      PPV C+I
Sbjct  74   LDIRSAQISDGLPLEFDRSLNAEEFIESFETNMIPHVEE-----LISHLKEEEPPVLCII  128

Query  556  ADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCI---DVREDAIEY  726
            AD+FFV+  ++AKKY + + SFWTE A+VF++YYH  LL  NGH   +   D  E+ I Y
Sbjct  129  ADSFFVWLDRVAKKYGISHASFWTEAAMVFSIYYHWDLLVENGHSPFVNKEDDHENLINY  188

Query  727  VPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQE  906
            +PG+  +   DL SY QE +  +  H I+Y++FQ  R AD+++ NTV++LE  T+A LQ 
Sbjct  189  IPGLSDLKTTDLPSYFQELDLSSRTHDILYEAFQSVRGADWIISNTVEDLESRTIAELQS  248

Query  907  KTSFFTVGPIFPPVFAQ----SAVATSL*SESDC  996
               F++VGP+ P  F +        T++  ESDC
Sbjct  249  IKPFWSVGPLLPSAFQEDLNKETSRTNMWPESDC  282



>gb|EYU34487.1| hypothetical protein MIMGU_mgv1a005354mg [Erythranthe guttata]
Length=487

 Score =   218 bits (555),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 117/277 (42%), Positives = 174/277 (63%), Gaps = 8/277 (3%)
 Frame = +1

Query  190   KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTK---SNPRDDDIFSG  360
             K HAI+IS P QGHI P V LA +LA  GF++TF++   VH  L+K   SN  + D+FS 
Sbjct  9     KSHAIMISAPYQGHINPFVSLALKLASNGFSITFVHFEFVHDKLSKALHSNNNEVDLFSE  68

Query  361   IRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPP  540
              R+ GLDIRY TI+DG P E+DR ++ +++  S+   + + ++E + K + S   S    
Sbjct  69    ARESGLDIRYTTIADGFPSEFDRELHFEEYWESITFDFQSIIDEFVGKTIESDPYS----  124

Query  541   VNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAI  720
             V+ L+ADT +V+PGK++ KY L+ +S WT+PALVF+L YH+ LLR  GHF      ++ I
Sbjct  125   VHFLVADTIYVWPGKISDKYNLINVSLWTQPALVFSLGYHIELLREKGHFPWGGNIDEEI  184

Query  721   EYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAAL  900
              Y+PGV SI   DLM Y+ + E++ +  +I   +F+  + ADF+L N V ELE +T++AL
Sbjct  185   NYIPGVESISTSDLMPYLIKAESQILRTRICSVAFEQVKKADFILHNNVYELESQTLSAL  244

Query  901   QEKTSFFTVGPI-FPPVFAQSAVATSL*SESDCEPLL  1008
              +    +T+GP+ F      + V+ S  SESDC   L
Sbjct  245   SKYQPNYTIGPVKFSKNIPTNDVSKSFWSESDCTNWL  281



>gb|EMS64309.1| UDP-glycosyltransferase 86A1 [Triticum urartu]
Length=374

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 137/182 (75%), Gaps = 6/182 (3%)
 Frame = +1

Query  451  MASLLHIYSAHVEEALKKILTSSANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTE  630
            M  +LH+  AHVEE L++++   A++      CL+ADTFFV+P  LA+   + Y+SFWTE
Sbjct  1    MEGVLHVLPAHVEELLRRVVLDPAST------CLVADTFFVWPATLARALGVPYVSFWTE  54

Query  631  PALVFTLYYHLHLLRLNGHFGCIDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQI  810
            PAL+F LYYH+ LL  +GHF C + R+D I Y+PGV +I+  +LMSY+QET+T +V H+I
Sbjct  55   PALIFALYYHMDLLAEHGHFKCKEPRKDTITYIPGVPAIEPHELMSYLQETDTTSVVHRI  114

Query  811  IYKSFQDARNADFVLCNTVQELEHETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SES  990
            I+K+F++AR AD+VLCNTV+ELE  T+AAL+ +  F+ VGPIFP  FA+S VATS+ +ES
Sbjct  115  IFKAFEEARGADYVLCNTVEELEPSTIAALRAEKPFYAVGPIFPAGFARSTVATSMWAES  174

Query  991  DC  996
            DC
Sbjct  175  DC  176



>emb|CDP21275.1| unnamed protein product [Coffea canephora]
Length=186

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 130/180 (72%), Gaps = 12/180 (7%)
 Frame = +1

Query  172  MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDD--  345
            M +   +PHA+L+ YPLQGH+IP +HLA +LA  GF +TF+ T S+H+ +T S  + +  
Sbjct  1    MGEIHPRPHALLLPYPLQGHVIPFIHLATKLASNGFIITFVITESIHHQITTSKNQTNHY  60

Query  346  -----DIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKIL  510
                 +IF+  RK GLDIRY T+SDG P  +DR++NHDQF   ++H++SAHV+E + K++
Sbjct  61   KEGGINIFAEARKSGLDIRYATVSDGFPLGFDRSLNHDQFFEGIVHVFSAHVDEIVGKLV  120

Query  511  TSSANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHF  690
             S      PPVNCL+ DTF+VF   +A+KY L+ ISFWTEPALVF+LYYH+ LLR+NGH+
Sbjct  121  QSE-----PPVNCLVIDTFYVFASPIARKYNLVNISFWTEPALVFSLYYHMDLLRINGHY  175



>gb|EYU34488.1| hypothetical protein MIMGU_mgv1a005552mg [Erythranthe guttata]
Length=479

 Score =   207 bits (526),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 108/273 (40%), Positives = 166/273 (61%), Gaps = 10/273 (4%)
 Frame = +1

Query  190  KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDD------DI  351
            K H I+IS P QGHI P V LA +LA  GF++TF++   VH+ L+K+   ++      D+
Sbjct  9    KSHVIMISVPYQGHINPFVSLALKLASNGFSITFVHFEFVHHKLSKALNSNNTSSTEVDL  68

Query  352  FSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSG  531
            FS  R+ GLD+RY TI DG   E+DR ++ +++  S+       +++ + K + S  NS 
Sbjct  69   FSEARESGLDVRYTTIEDGFSSEFDRELHFEKYWESITFDLLGMIDKFVGKTIQSDPNS-  127

Query  532  GPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVRE  711
               V+ L+AD  + +PG +A KY L+ +SFWTEPALVF+L YH+ LLR  GHF C    +
Sbjct  128  ---VHFLVADCVYAWPGAIADKYNLVNVSFWTEPALVFSLQYHMELLREKGHFPCKGNID  184

Query  712  DAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETV  891
            + I Y+PGV SI  +D M Y+++ E+E V  +    +F+  + ADF+L NTV ELE +T+
Sbjct  185  EEINYIPGVESISTRDFMPYLKKAESEYVPTRAASVAFERVKKADFILHNTVYELESQTL  244

Query  892  AALQEKTSFFTVGPIFPPVFAQSAVATSL*SES  990
            +AL      + +GPI    ++++     L S+S
Sbjct  245  SALSTYQPNYAIGPINKSFWSETDCTNWLDSKS  277



>gb|EYU34486.1| hypothetical protein MIMGU_mgv1a023861mg [Erythranthe guttata]
Length=477

 Score =   204 bits (518),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 115/277 (42%), Positives = 167/277 (60%), Gaps = 18/277 (6%)
 Frame = +1

Query  190   KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTK---SNPRDDDIFSG  360
             K HAI+IS P QGHI P V LA +LA  GF+VTF++   VH  L+K   SN  + D+FS 
Sbjct  9     KSHAIMISLPYQGHINPFVSLALKLASNGFSVTFVHFEFVHQKLSKAIHSNNTEVDLFSE  68

Query  361   IRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPP  540
              R+ GLDIRY TI+DG P E+DR ++ ++++ S+     + ++E + K + S   S    
Sbjct  69    ARESGLDIRYTTITDGFPSEFDRELHFEEYLESITFDLPSIIDEFVGKTIESDPYS----  124

Query  541   VNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAI  720
             V+ L++DT + + GK++ KY L+ +S WT+PAL+F+L YH+ LLR  GHF       + I
Sbjct  125   VHFLVSDTIYAWSGKISDKYNLINVSLWTQPALLFSLGYHMELLREKGHFPWKGNIAEEI  184

Query  721   EYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAAL  900
              YVPGV+SI  +DLM Y  + E+E +            + ADF+L NTV ELE +T++AL
Sbjct  185   NYVPGVQSISTRDLMPYFTKAESEYI----------PTKKADFILHNTVYELESQTLSAL  234

Query  901   QEKTSFFTVGPI-FPPVFAQSAVATSL*SESDCEPLL  1008
              +    + +GPI F      + V+ S  SESDC   L
Sbjct  235   SKYQPNYAIGPIRFSKNVPTNDVSKSFWSESDCTNWL  271



>gb|EAY78680.1| hypothetical protein OsI_33782 [Oryza sativa Indica Group]
Length=250

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 124/176 (70%), Gaps = 9/176 (5%)
 Frame = +1

Query  181  SGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD----DD  348
             G++PHA++I YPLQGH+IP+VHLA RLA +GF VTF+NT SVH  +T S        DD
Sbjct  16   GGKRPHAVVIPYPLQGHVIPAVHLALRLAARGFAVTFVNTESVHRQITSSGGGHGGGGDD  75

Query  349  IFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANS  528
            IF+G    G  IRY  +SDG P  +DR++NHDQ+M  +LH+  AHV+E L++++    ++
Sbjct  76   IFAG--AGGGAIRYELVSDGFPLGFDRSLNHDQYMEGVLHVLPAHVDELLRRVVGDGDDA  133

Query  529  GGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGC  696
                  CL+ADTFFV+P  LA+K  + Y+SFWTEPA++F+LYYH+ LL  NGHF C
Sbjct  134  A---ATCLVADTFFVWPATLARKLGVPYVSFWTEPAIIFSLYYHMDLLTKNGHFNC  186



>gb|AAP53973.1| Cytokinin-O-glucosyltransferase 2, putative, expressed [Oryza 
sativa Japonica Group]
 gb|EAZ16224.1| hypothetical protein OsJ_31676 [Oryza sativa Japonica Group]
Length=253

 Score =   196 bits (498),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 122/177 (69%), Gaps = 9/177 (5%)
 Frame = +1

Query  181  SGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRD-----D  345
             G++PHA++I YPLQGH+IP+VHLA RLA +GF VTF+NT SVH  +T S         D
Sbjct  17   GGKRPHAVVIPYPLQGHVIPAVHLALRLAARGFAVTFVNTESVHRQITSSGGGHGVGGGD  76

Query  346  DIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSAN  525
            DIF+G    G  IRY  +SDG P  +DR+ NHDQ+M  +LH+  AHV+E L++++    +
Sbjct  77   DIFAGA-GGGAMIRYELVSDGFPLGFDRSRNHDQYMEGVLHVLPAHVDELLRRVV---GD  132

Query  526  SGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGC  696
                   CL+ADTFFV+P  LA+K  + Y+SFWTEPA++F+LYYH+ LL  NGHF C
Sbjct  133  GDAAAATCLVADTFFVWPATLARKLGVPYVSFWTEPAIIFSLYYHMDLLTKNGHFNC  189



>gb|EPS68563.1| hypothetical protein M569_06205, partial [Genlisea aurea]
Length=463

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 120/274 (44%), Positives = 168/274 (61%), Gaps = 8/274 (3%)
 Frame = +1

Query  190  KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDI--FSGI  363
            K HAI+ S P QGHI P V+LA +LA KG T TF+N   VH+H T +    DD   FS  
Sbjct  1    KLHAIVFSPPYQGHINPIVNLALKLASKGITTTFVNFRHVHHHQTHAAAAADDHDPFSRA  60

Query  364  RKPGLDIRYVTISDGLPPEWDRAVNHDQFMASL-LHIYSAHVEEALKKILTSSANSGGPP  540
            R  GLD+RY T+SDG P E+DR +  D+++  L LH   A  +E + +I   +A  G P 
Sbjct  61   RASGLDVRYATMSDGFPLEFDRRLRLDEYLTRLYLHELPARADELVGRI---AAEFGAPW  117

Query  541  VNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAI  720
            +N L+ADT F     +A+K+ ++ +SFW +PALVF+L YHL LL+ N HF   D  E+ I
Sbjct  118  INFLVADTAFFPVVDVARKFGIVAVSFWPQPALVFSLMYHLELLKANPHFPFKDEAEEEI  177

Query  721  EYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAAL  900
             ++PG+ SI+ KDLM  ++E+    V   I+ K+F++ + ADFVL NTV+E+E E +AAL
Sbjct  178  TFIPGISSINTKDLMQNLKESGARGVIPDIVSKAFEEVKKADFVLHNTVEEVEPEILAAL  237

Query  901  QEKTSFFTVGPI--FPPVFAQSAVATSL*SESDC  996
              +   + VGP+  F      S V+ SL  E DC
Sbjct  238  NRRQPNYAVGPVNFFEQSPTISPVSKSLLPEIDC  271



>gb|KFK36575.1| hypothetical protein AALP_AA4G141400 [Arabis alpina]
Length=205

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 122/167 (73%), Gaps = 8/167 (5%)
 Frame = +1

Query  388  YVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPVNCLIADTF  567
            Y T+SDG P  +DR++NHDQF   +LH++SAHV++ L KI    ++    PV CLIADTF
Sbjct  43   YTTVSDGFPLAFDRSLNHDQFFEGILHVFSAHVDDLLTKI----SSRDDSPVTCLIADTF  98

Query  568  FVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIEYVPGVRSI  747
            +V+   +  K+ L+ +SFWT+PALV  LYYH+ LL  NGHF  +D RED I+Y+PGV++I
Sbjct  99   YVWSSMICDKHNLVNVSFWTQPALVLNLYYHVDLLISNGHFKSLDNREDVIDYIPGVKAI  158

Query  748  DVKDLMSYIQ----ETETETVCHQIIYKSFQDARNADFVLCNTVQEL  876
              KDLMSY+Q    + +T TV ++I++K+F+D + ADFVLCNTVQEL
Sbjct  159  VPKDLMSYLQVSDKDVDTNTVVYRILFKAFKDVKRADFVLCNTVQEL  205



>ref|XP_002519499.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF42913.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=333

 Score =   193 bits (490),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 107/259 (41%), Positives = 148/259 (57%), Gaps = 62/259 (24%)
 Frame = +1

Query  277   FTVTFINTHSVHYHLTKS---------------NPRDDDIFSGIRKPGLDIRYVTISDGL  411
              T+TFINT S+H+ +TK+               N  + DIF   R+ GLDI Y T+SDG 
Sbjct  24    LTITFINTESIHHQITKAAHDNQDEAHQLPRTMNTTEHDIFFEARQSGLDICYATVSDGF  83

Query  412   PPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPVNCLIADTFFVFPGKLA  591
             P  +D ++NHDQFM  LLH++SAHV++ + KI+ ++     P VNCLIADTF+V+   +A
Sbjct  84    PLGFDGSLNHDQFMEGLLHVFSAHVDDIVGKIVQTN-----PTVNCLIADTFYVWSSMIA  138

Query  592   KKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIEYVPGVRSIDVKDLMSY  771
             +KY L+ ISFWT PAL++TLYYHL LL +NGHF   D REDA++Y+             Y
Sbjct  139   QKYNLVNISFWTGPALIYTLYYHLDLLNINGHFASGDKREDALDYI-------------Y  185

Query  772   IQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQEKTSFFTVGPIFPPVF  951
             ++                              +ELE +T++ LQ+K  F+ +GP+FP  F
Sbjct  186   LE-----------------------------WKELESKTISGLQQKQPFYPIGPLFPTGF  216

Query  952   AQSAVATSL*SESDCEPLL  1008
              +  VATSL SESDC   L
Sbjct  217   TKITVATSLWSESDCTQWL  235



>gb|EYU34483.1| hypothetical protein MIMGU_mgv1a005954mg [Erythranthe guttata]
Length=463

 Score =   192 bits (489),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/233 (44%), Positives = 147/233 (63%), Gaps = 9/233 (4%)
 Frame = +1

Query  166  KAMADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDD  345
            ++MA+S  KPHAI+IS P QGHI P   LA +LA  GF+VTF++   +H  L K      
Sbjct  15   ESMAESKYKPHAIMISVPYQGHINPFASLALKLASSGFSVTFVHYEFLHQKLPKL-----  69

Query  346  DIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSAN  525
            D+FS  R+ GLDIRY TI DG P E+DR ++ ++   S+    S  ++E + K + S  +
Sbjct  70   DLFSEARESGLDIRYTTIKDGFPSEFDRGLHLEEHWESISLDRSGTIDEFVGKTIQSDPD  129

Query  526  SGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDV  705
            S    V+ LIADT   +P  +A KY L+ +SFWT+PALVF++ YHL LLR  GHF     
Sbjct  130  S----VHFLIADTITAWPAIIANKYNLINVSFWTQPALVFSMNYHLDLLREKGHFPWKGN  185

Query  706  REDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNT  864
              + I+Y+PGV S+  +DL+ Y+ +TE+E+V  +I   +F+  + ADF+L NT
Sbjct  186  TAEEIDYIPGVESLSTRDLIHYLTKTESESVITRISSLAFERVKKADFILHNT  238



>gb|EPS73117.1| hypothetical protein M569_01639, partial [Genlisea aurea]
Length=474

 Score =   192 bits (489),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/278 (38%), Positives = 162/278 (58%), Gaps = 10/278 (4%)
 Frame = +1

Query  190   KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIRK  369
             K HA+++S   QGH+ P  +LA  +A KG TVT +    + + L++++    D F+  R 
Sbjct  6     KLHAVMLSLGFQGHMTPFFNLAITVASKGITVTLVQLEHIRHQLSQAHGPLVDPFAAARD  65

Query  370   PGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPVNC  549
              GLDIR  T+SDG   ++DR +   ++   LL  +  H+ E L ++L    +     VN 
Sbjct  66    SGLDIRCTTMSDGFDVDFDRQLRFVEYGEKLLDGFEEHLYEFLGELLVGFQSPDW--VNF  123

Query  550   LIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIEYV  729
             L+ADT +      A+K  +  +SFWTEPALVF + YH+ LLR NGH+ C D  ++ I Y+
Sbjct  124   LVADTLYASATNAARKCGIPSVSFWTEPALVFHMVYHVELLRENGHYPCKDDLKEEITYL  183

Query  730   PGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQEK  909
             PG+ SI+ +DL++ ++E+E   +  + + KSFQD RNADF+L NTVQELE   ++ L   
Sbjct  184   PGISSINTEDLLTALRESEASGIISRFLIKSFQDVRNADFILYNTVQELEESVLSVLNRH  243

Query  910   TSFFTVGPIFPPVFAQSAVA-----TSL*SESDCEPLL  1008
                + +GPI    F++ A++      SL S SDC   L
Sbjct  244   QPGYAIGPI---NFSEKALSLNIEGKSLWSVSDCTGWL  278



>ref|XP_008350374.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Malus domestica]
Length=398

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 127/190 (67%), Gaps = 5/190 (3%)
 Frame = +1

Query  427  RAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPVNCLIADTFFVFPGKLAKKYKL  606
            R  N DQ +   LH++ AHV+E +  ++ S      P + CLI DTF  +   +A KY L
Sbjct  10   RIQNLDQSLEGALHVFPAHVDELVGNLVQSD-----PSITCLIVDTFQSWSATIANKYNL  64

Query  607  LYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIEYVPGVRSIDVKDLMSYIQETE  786
            ++ISFWTEPALVF +YYHL LL+ NGHFG  D RED I+Y+P V++I+ KDLMS+IQ T+
Sbjct  65   IHISFWTEPALVFNIYYHLDLLQKNGHFGSHDNREDIIDYIPXVKAIEPKDLMSHIQSTD  124

Query  787  TETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQEKTSFFTVGPIFPPVFAQSAV  966
                  +  YKSF++ + ADF+LCNTVQELE E+++ALQ K   + +GP+ P    ++ V
Sbjct  125  LFCPMLRXFYKSFREVKKADFILCNTVQELEFESLSALQAKQPTYPIGPVXPDNLTKNIV  184

Query  967  ATSL*SESDC  996
            AT+L  E DC
Sbjct  185  ATNLMPEFDC  194



>ref|XP_011094735.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Sesamum indicum]
Length=394

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 136/203 (67%), Gaps = 10/203 (5%)
 Frame = +1

Query  172  MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKS-----NP  336
            MA++  KPHAI+IS P QGHI P V+LA ++A KGF++TF++   VH+ L+K+     N 
Sbjct  1    MAENRGKPHAIMISVPYQGHINPFVNLALKIASKGFSITFVHFEFVHHRLSKAHHLHCNK  60

Query  337  RDDDIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTS  516
               DIFS  R+ GLDIRY TISDG P E+DR  N+++F   +LH + + V+E ++K + S
Sbjct  61   TQVDIFSEARESGLDIRYTTISDGFPLEFDRDANYEEFWGRVLHEFPSRVDEFVRKTIKS  120

Query  517  SANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGC  696
                    ++ L+ADT F +P  +A+KY L+ +S WTEPALVFTL YH+ LL  NGHF C
Sbjct  121  DPYL----LHFLVADTVFSWPATIAEKYNLVNVSLWTEPALVFTLAYHVDLLIENGHFPC  176

Query  697  -IDVREDAIEYVPGVRSIDVKDL  762
             ++   + + YVPGV+SI  +DL
Sbjct  177  KVNNIHEEVNYVPGVKSISTRDL  199



>gb|ABK24777.1| unknown [Picea sitchensis]
 gb|ACN40444.1| unknown [Picea sitchensis]
Length=487

 Score =   181 bits (459),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 109/293 (37%), Positives = 166/293 (57%), Gaps = 23/293 (8%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTK----SNPR  339
             MA + +  HA++  YP QGHI P +  A +LA KG  VTF+ TH  H  +TK    S  +
Sbjct  1     MARNPEHLHALVFPYPTQGHITPMMQFAKKLASKGVIVTFLTTHHRHQQITKAHTLSAEQ  60

Query  340   DDDIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSS  519
             DD I    RK GLDIR   ISDGLP ++DR+   + FM S+ ++    +E+ L  +    
Sbjct  61    DDPIEQEARKLGLDIRSAQISDGLPLDFDRSARFNDFMRSVDNM-GGELEQLLHNL----  115

Query  520   ANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCI  699
              N  GP V+C+IADT   +  ++AKK  + +ISFWT+P +++++YYH HLL    H  C 
Sbjct  116   -NKTGPAVSCVIADTILPWSFEIAKKLGIPWISFWTQPTVLYSIYYHAHLLEDLRHSLCE  174

Query  700   DVRED---AIEYVPGVRSIDVKDLMSYIQETETET-VCHQIIYKSFQDARNADFVLCNTV  867
                ++   +I+Y+PGV ++  +DL S+I+E + ++     ++ KSFQ +R AD+VL N+ 
Sbjct  175   GTADEGSISIDYIPGVPTLKTRDLPSFIREGDADSQYILNVLRKSFQLSREADWVLGNSF  234

Query  868   QELEHETVAALQEKTSFFTVGPIFPPVFAQS------AVATSL*SESDCEPLL  1008
              +LE ++V     K     VGP+ P  F  S       V TS+ ++ D    L
Sbjct  235   DDLESKSV---HLKPPVLQVGPLLPSSFLNSEHSKDIGVGTSIWTQYDASEWL  284



>ref|XP_011091588.1| PREDICTED: UDP-glycosyltransferase 86A1-like isoform X2 [Sesamum 
indicum]
Length=495

 Score =   179 bits (455),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 112/295 (38%), Positives = 164/295 (56%), Gaps = 21/295 (7%)
 Frame = +1

Query  169   AMADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHL--TKSNPRD  342
             A AD+  K HAI++ +  QGHI P  HLA  LA KG TVT++ T   HY +  T ++ R 
Sbjct  2     AEADAA-KLHAIMVQFLFQGHITPFSHLALALASKGCTVTYVQTEFQHYQMKSTAASARH  60

Query  343   DDI---------FSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEA  495
             D +         F G R+ GLDIRY TISDG P ++DR +N  +F  S+L  + A V+E 
Sbjct  61    DQLSNEEAVDLFFPGARESGLDIRYTTISDGFPLDFDRDLNFLEFYESILRDFPARVDEL  120

Query  496   LKKILTSSANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLR  675
             + KI+ S   S  P    L+AD  +++P  +A KY ++ ++FWT  AL  +L YH  LL+
Sbjct  121   VGKIVESD-RSLTP---FLVADATYLWPPAIANKYNMVQVAFWTSTALHLSLGYHFELLK  176

Query  676   LNGHFGCIDVREDAIEYVPGVRSIDVKDLMSYIQETETETV---CHQIIYKSFQDARNAD  846
              NG         D I+ VPGVR  +++D + Y    E   V    ++ I K+ ++ R AD
Sbjct  177   ENGQLLLGGQDMDHID-VPGVRRSNIEDFIKYDTTDEDPQVPIPVYENIMKARREIRKAD  235

Query  847   FVLCNTVQELEHETVAALQEKTSFFTVGPI-FPPVFAQSAVATSL*SESDCEPLL  1008
             F+LCNTV+ELE E +  +++    + +GP  F   F +    +SL  E+DC   L
Sbjct  236   FILCNTVEELEPEAILGIKQSLQTYAIGPTNFFANFNKVTSVSSLQFETDCTKWL  290



>ref|XP_011091587.1| PREDICTED: UDP-glycosyltransferase 86A1-like isoform X1 [Sesamum 
indicum]
Length=537

 Score =   180 bits (457),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 112/296 (38%), Positives = 165/296 (56%), Gaps = 21/296 (7%)
 Frame = +1

Query  169   AMADS-GQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHL--TKSNPR  339
             AMA++   K HAI++ +  QGHI P  HLA  LA KG TVT++ T   HY +  T ++ R
Sbjct  42    AMAEADAAKLHAIMVQFLFQGHITPFSHLALALASKGCTVTYVQTEFQHYQMKSTAASAR  101

Query  340   DDDI---------FSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEE  492
              D +         F G R+ GLDIRY TISDG P ++DR +N  +F  S+L  + A V+E
Sbjct  102   HDQLSNEEAVDLFFPGARESGLDIRYTTISDGFPLDFDRDLNFLEFYESILRDFPARVDE  161

Query  493   ALKKILTSSANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLL  672
              + KI+ S   S  P    L+AD  +++P  +A KY ++ ++FWT  AL  +L YH  LL
Sbjct  162   LVGKIVESD-RSLTP---FLVADATYLWPPAIANKYNMVQVAFWTSTALHLSLGYHFELL  217

Query  673   RLNGHFGCIDVREDAIEYVPGVRSIDVKDLMSYIQETETETV---CHQIIYKSFQDARNA  843
             + NG         D I+ VPGVR  +++D + Y    E   V    ++ I K+ ++ R A
Sbjct  218   KENGQLLLGGQDMDHID-VPGVRRSNIEDFIKYDTTDEDPQVPIPVYENIMKARREIRKA  276

Query  844   DFVLCNTVQELEHETVAALQEKTSFFTVGPI-FPPVFAQSAVATSL*SESDCEPLL  1008
             DF+LCNTV+ELE E +  +++    + +GP  F   F +    +SL  E+DC   L
Sbjct  277   DFILCNTVEELEPEAILGIKQSLQTYAIGPTNFFANFNKVTSVSSLQFETDCTKWL  332



>gb|AGA84057.1| UDP-glucosyltransferase isoform 1 [Picrorhiza kurrooa]
Length=473

 Score =   179 bits (453),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 108/275 (39%), Positives = 158/275 (57%), Gaps = 11/275 (4%)
 Frame = +1

Query  196   HAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTK---SNPRDDDIFSGIR  366
             HAI+I  P     +P   L      KG TVTF+N   + + ++K   SN  D  +FS  +
Sbjct  4     HAIMI--PTSLGPLPFFDLCIEACFKGITVTFVNFDFIQHMISKAGNSNSGDVVLFSKAQ  61

Query  367   KPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPVN  546
             + GLDIRY TISDGLP E+DR +N ++++  LL  + A V+E ++K +    +     ++
Sbjct  62    QSGLDIRYATISDGLPLEFDRNLNFEEWVQVLLTEFPARVDEFIEKTIKRDPSL----IS  117

Query  547   CLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIEY  726
              ++ADT+  +   +A KY L+ + FWTEPALVF+L YH  LL+ + H+ C D  E+ I Y
Sbjct  118   FIVADTY-AWQATIANKYNLVSVYFWTEPALVFSLNYHTDLLKEHAHYPCKDDIEEDINY  176

Query  727   VPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQE  906
             +PGV SI  +D+M Y++E        Q      +  +N DFVL NTVQELE ET++AL E
Sbjct  177   LPGVDSISTRDIMPYLKEIGINNYGVQSYVNGIEAIKNVDFVLHNTVQELEPETLSALNE  236

Query  907   KTSFFTVGPI-FPPVFAQSAVATSL*SESDCEPLL  1008
               S   + P+ F     ++ +  SL SESDC   L
Sbjct  237   IQSITPLVPLNFSKNLEKTTITNSLWSESDCTQWL  271



>gb|ACN39829.1| unknown [Picea sitchensis]
Length=487

 Score =   178 bits (452),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 108/293 (37%), Positives = 165/293 (56%), Gaps = 23/293 (8%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTK----SNPR  339
             MA + +  HA++  YP QGHI P +  A +LA KG  VTF+ TH  H  +TK    S  +
Sbjct  1     MARNPEHLHALVFPYPTQGHITPMMQFAKKLASKGVIVTFLTTHHRHQQITKAHTLSAEQ  60

Query  340   DDDIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSS  519
             DD I    RK GLDI    ISDGLP ++DR+   + FM S+ ++    +E+ L  +    
Sbjct  61    DDPIEQEARKLGLDISSAQISDGLPLDFDRSARFNDFMRSVDNM-GGELEQLLHNL----  115

Query  520   ANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCI  699
              N  GP V+C+IADT   +  ++AKK  + +ISFWT+P +++++YYH HLL    H  C 
Sbjct  116   -NKTGPAVSCVIADTILPWSFEIAKKLGIPWISFWTQPTVLYSIYYHAHLLEDLHHSLCE  174

Query  700   DVRED---AIEYVPGVRSIDVKDLMSYIQETETET-VCHQIIYKSFQDARNADFVLCNTV  867
                ++   +I+Y+PGV ++  +DL S+I+E + ++     ++ KSFQ +R AD+VL N+ 
Sbjct  175   GTADEGSISIDYIPGVPTLKTRDLPSFIREGDADSKYILNVLRKSFQLSREADWVLGNSF  234

Query  868   QELEHETVAALQEKTSFFTVGPIFPPVFAQS------AVATSL*SESDCEPLL  1008
              +LE ++V     K     VGP+ P  F  S       V TS+ ++ D    L
Sbjct  235   DDLESKSV---HLKPPVLQVGPLLPSSFLNSEHSKDIGVGTSIWTQYDASEWL  284



>gb|ABR17061.1| unknown [Picea sitchensis]
Length=472

 Score =   166 bits (421),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 105/293 (36%), Positives = 156/293 (53%), Gaps = 38/293 (13%)
 Frame = +1

Query  172   MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTK----SNPR  339
             MA + +  HA++  YP QGHI P +  A +LA KG  VTF+ TH  H  +TK    S  +
Sbjct  1     MARNPEHLHALVFPYPTQGHITPMMQFAKKLASKGVIVTFLTTHHRHQQITKAHTLSAEQ  60

Query  340   DDDIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSS  519
             DD I    RK GLDIR   ISDGLP +     N    +  LLH                +
Sbjct  61    DDPIEQEARKLGLDIRSAQISDGLPLD-----NMGGELEQLLH----------------N  99

Query  520   ANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCI  699
              N  GP V+C+IADT   +  ++AKK  + +ISFWT+P +++++YYH HLL    H  C 
Sbjct  100   LNKTGPAVSCVIADTILPWSFEIAKKLGIPWISFWTQPTVLYSIYYHAHLLEDLRHSLCK  159

Query  700   DVRED---AIEYVPGVRSIDVKDLMSYIQETETET-VCHQIIYKSFQDARNADFVLCNTV  867
                ++   +I+Y+PGV ++  +DL S+I+E + ++     ++ +SFQ +R AD+VL N+ 
Sbjct  160   GTADEGSISIDYIPGVPTLKTRDLPSFIREGDADSQYIFNVLRRSFQLSREADWVLGNSF  219

Query  868   QELEHETVAALQEKTSFFTVGPIFPPVFAQS------AVATSL*SESDCEPLL  1008
              +LE ++V     K     VGP+ P  F  S       V TS+ ++ D    L
Sbjct  220   DDLESKSV---HLKPPVLQVGPLLPSSFLNSEHSKDIGVGTSIWTQYDASEWL  269



>gb|EMT04157.1| Cyanohydrin beta-glucosyltransferase [Aegilops tauschii]
Length=286

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 126/211 (60%), Gaps = 39/211 (18%)
 Frame = +1

Query  376   LDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPVNCLI  555
             +D RY  ISDGLP  +DR+++HD+FM SL    S HV+     ++   A        CL+
Sbjct  1     MDERYELISDGLPVGFDRSLHHDEFMGSLFQALSGHVDVVPGHVVVDPA------ATCLV  54

Query  556   ADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIEYVPG  735
             ADTFFV+P  LA+K+         EP                        R+D I ++PG
Sbjct  55    ADTFFVWPATLARKF---------EP------------------------RKDMITHIPG  81

Query  736   VRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQEKTS  915
             V +I+  +LMSY+QET+T  V H I++K+F++AR AD+VLCNTV+ELE  T+ AL+ +  
Sbjct  82    VTAIEPHELMSYLQETDTTKVVHCILFKAFEEARGADYVLCNTVEELEPSTIVALRAEKP  141

Query  916   FFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             F+ VGPIFP  FA SAVATS+ +ES+C  LL
Sbjct  142   FYAVGPIFPAGFAHSAVATSMRAESNCSHLL  172



>gb|EMT33068.1| Cytokinin-N-glucosyltransferase 1 [Aegilops tauschii]
Length=330

 Score =   160 bits (405),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 117/170 (69%), Gaps = 14/170 (8%)
 Frame = +1

Query  190  KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDD---DIFSG  360
            KPHA++I+YP QGH+IP+  LA RLA +GF VTF+NT SVH    ++   D    DIF+G
Sbjct  17   KPHAVVIAYPYQGHVIPAAPLALRLAARGFAVTFVNTESVHEQTARALGVDRHRYDIFAG  76

Query  361  IR-----KPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSAN  525
             R     K  LD+RY  +SDG P  +DR++NHDQF    LH+ +AHVE+ L++++   A+
Sbjct  77   ARASSDHKEPLDVRYELVSDGFPLGFDRSLNHDQFKEGELHVLAAHVEDLLRRLVVDPAS  136

Query  526  SGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLR  675
            +      CL+ADTFFV+P  LAKK+ + Y+SFWTEPAL+F LYYH+ L R
Sbjct  137  T------CLVADTFFVWPATLAKKFGVPYVSFWTEPALIFNLYYHMDLSR  180



>gb|EPS60356.1| hypothetical protein M569_14447, partial [Genlisea aurea]
Length=404

 Score =   160 bits (404),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 93/275 (34%), Positives = 160/275 (58%), Gaps = 12/275 (4%)
 Frame = +1

Query  187  QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLT---KSNPRDDDIFS  357
            +K  A+L   P QGH+ P+V+LA +LA +GF++TF+    +H  L+   K    + D+FS
Sbjct  3    KKLQALLFPAPHQGHLTPAVNLALKLASEGFSITFVVFEYLHRKLSAIHKQGTSEFDLFS  62

Query  358  GI-RKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGG  534
                K GL I Y TI+DGLP ++DR     +F   L++ +   V+E + + + S  ++  
Sbjct  63   EAHNKSGLKIDYTTIADGLPDDFDREARLVEFYEYLMNEFQPLVDEFVGEKIRSDPDT--  120

Query  535  PPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVRED  714
                 +++DT  ++    A+KY LL++SFWT+P++V++L +H  LLR +GH+   D  E+
Sbjct  121  --TYFIVSDTILLWQAAAAEKYNLLHVSFWTQPSMVYSLGWHSELLREHGHYPLKDNIEE  178

Query  715  AIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVA  894
             ++YVPG++S++ +D M Y++ +      + +  ++F  ++ ADFVL NTVQELE   ++
Sbjct  179  DVDYVPGIQSVNTRDFMPYLRPSHP---FYDLGARAFDLSKKADFVLHNTVQELESSILS  235

Query  895  ALQEKTSFFTVGPIFP-PVFAQSAVATSL*SESDC  996
            AL +    + +G         +     SL +ESDC
Sbjct  236  ALNKYKPNYAIGLTNTYGDLVKIPTKKSLWAESDC  270



>gb|EYU36656.1| hypothetical protein MIMGU_mgv11b024665mg [Erythranthe guttata]
Length=471

 Score =   158 bits (399),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 88/259 (34%), Positives = 132/259 (51%), Gaps = 36/259 (14%)
 Frame = +1

Query  199  AILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDD------IFSG  360
             + I Y   G     +    R    G TVTF+ T  +H+ ++ +   DD+      I  G
Sbjct  32   CVFIPYKYFGRKSIWLGTTTRWGSMGCTVTFVQTEFLHHRISTAAAGDDEEREIPEIILG  91

Query  361  IRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPP  540
             R+ GLDIRY TISDG P ++DR  N ++F  S+L  +   V+E L +I  +    GG P
Sbjct  92   ARESGLDIRYATISDGFPLKFDREANFEEFWGSILRDFPGRVDEFLGRITAAENCDGGVP  151

Query  541  VNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAI  720
             + L+ADT +++  ++A KY +  +SFWTE AL F++ YHL LL+LN HF  ++      
Sbjct  152  PSFLVADTTYLWASEIAHKYNMFSVSFWTEAALAFSVGYHLDLLKLNAHFPIVN------  205

Query  721  EYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAAL  900
                                     V +Q I  +++  + ADF+LCNTVQELE + ++AL
Sbjct  206  ------------------------NVLYQNIIDAYEQVKKADFILCNTVQELEPQALSAL  241

Query  901  QEKTSFFTVGPIFPPVFAQ  957
             +K   + V P   PV  Q
Sbjct  242  NQKQPTYAVAPPISPVDCQ  260



>gb|ADE76226.1| unknown [Picea sitchensis]
 gb|ADE76673.1| unknown [Picea sitchensis]
Length=474

 Score =   156 bits (394),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 99/279 (35%), Positives = 151/279 (54%), Gaps = 24/279 (9%)
 Frame = +1

Query  196   HAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDD-DIFSGIRKP  372
             HAI++  P QGHI P++ LA +LA KG  +TF+ T S H  +T ++     + F+  R  
Sbjct  10    HAIIVPMPGQGHINPAMQLAKKLASKGIAITFVLTQSWHNIITHAHSSAGVNAFAHARNL  69

Query  373   GLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGP-PVNC  549
             GLDIR V I D LP E++R     +F  SL ++ S HVEE +K +     N   P PV+C
Sbjct  70    GLDIRLVAIPDCLPGEFERWNKLHEFFQSLDNMES-HVEELIKNL-----NQSNPTPVSC  123

Query  550   LIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIEYV  729
             ++ADT   +   LAKK +LL +SFWT+   VF++ YH +L          + +  ++ ++
Sbjct  124   IVADTMLGWAVPLAKKLRLLSVSFWTQNVSVFSITYHSYL---------AERQAGSVIHI  174

Query  730   PGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQEK  909
             PGV  +   DL  +++ +  + +  +++ + FQ  R AD+V+ N+ Q LE   V AL EK
Sbjct  175   PGVTHLQPADLPLWLKLSPDDVIA-RVVARCFQTVREADWVVANSFQGLEGHVVEALWEK  233

Query  910   TSFFTVGPIFPPVF------AQSAVATSL*SESDCEPLL  1008
                + VGP+ P  +        S V TS   E DC   L
Sbjct  234   MRVYCVGPLLPSAYLDLSDPRDSVVGTSYRVEMDCTQWL  272



>gb|ABK24601.1| unknown [Picea sitchensis]
Length=288

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 99/278 (36%), Positives = 148/278 (53%), Gaps = 21/278 (8%)
 Frame = +1

Query  196   HAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDD-DIFSGIRKP  372
             HAI+++ P QGHI P + LA +LA  G ++TF+ T S H  +T+++     D F+  R  
Sbjct  10    HAIVVAMPGQGHINPMMQLAKKLASMGISITFVLTQSWHRIITEAHLGTGLDAFAHARNL  69

Query  373   GLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPVNCL  552
             GL+IR V I D +P E++R  N  QF  SL  +    VEE +  +      S   PV+C+
Sbjct  70    GLNIRLVAIPDCVPGEFERWNNIQQFYRSLGKM-EGLVEELINNL---QQQSNVAPVSCI  125

Query  553   IADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIEYVP  732
             +ADTF  +   LAKK  LL +SFWT    +F+++YHL           +  +E +I ++P
Sbjct  126   VADTFLGWAVPLAKKLNLLSVSFWTPSVSMFSIFYHLK---------SVQHQEGSIIHIP  176

Query  733   GVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQEKT  912
             GV SI+  DL S+ + +  + V  + I    + AR AD+V+ N+ + LE   V AL EK 
Sbjct  177   GVISIESADLPSFFKPS-ADPVNARAIVLCLERAREADWVVANSFEALEGHLVEALSEKL  235

Query  913   SFFTVGPIFPPVF------AQSAVATSL*SESDCEPLL  1008
               + VGP+ P  +        S V TS   E +C   L
Sbjct  236   QVYCVGPLLPSAYLDCSDPRDSVVGTSSRVEVNCTKWL  273



>gb|ADE76691.1| unknown [Picea sitchensis]
Length=474

 Score =   153 bits (387),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 99/279 (35%), Positives = 151/279 (54%), Gaps = 24/279 (9%)
 Frame = +1

Query  196   HAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDD-DIFSGIRKP  372
             HAI++  P QGHI P++ LA +LA KG  +TF+ T S H  +T ++     + FS  R  
Sbjct  10    HAIIVPLPGQGHINPAMQLAKKLASKGIAITFVLTQSWHNTITDAHSSTGVNAFSHARNL  69

Query  373   GLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGP-PVNC  549
             GL+I  V I D +P E++R     +F  SL ++ S HVEE +K +     N   P PV+C
Sbjct  70    GLEIELVAIPDCVPGEFERGNKLYKFSQSLDNMES-HVEELIKNL-----NQSNPTPVSC  123

Query  550   LIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIEYV  729
             +++DTF  +   LAKK +LL +SFWT+  LVF++ YH +L          + +  ++ ++
Sbjct  124   IVSDTFLGWAVPLAKKLRLLSVSFWTQNVLVFSITYHSYL---------AERQAGSVIHI  174

Query  730   PGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQEK  909
             PGV  +   DL  +++ +  + V  ++I + FQ  R AD+V+ N+   LE   V AL EK
Sbjct  175   PGVTPLQPADLPLWLKLSPDDVVV-RVISRCFQTVREADWVVANSFLGLEGHVVEALWEK  233

Query  910   TSFFTVGPIFPPVF------AQSAVATSL*SESDCEPLL  1008
                + VGP+ P  +        S V TS   E DC   L
Sbjct  234   MRVYCVGPLLPSAYLDLSEPRDSVVGTSYRVEMDCTQFL  272



>gb|EEC67042.1| hypothetical protein OsI_33784 [Oryza sativa Indica Group]
Length=184

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 99/155 (64%), Gaps = 9/155 (6%)
 Frame = +1

Query  181  SGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKS-----NPRDD  345
             G++PHA++I YPLQGH+IP+VHLA RLA +GF VTF+NT SVH  +T S         D
Sbjct  17   GGKRPHAVVIPYPLQGHVIPAVHLALRLAARGFAVTFVNTESVHRQITSSGGGHGVGGGD  76

Query  346  DIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSAN  525
            DIF+G    G  IRY  +SD  P  +DR+ NHDQ+M  +LH+  AHV+E L++++    +
Sbjct  77   DIFAGAGG-GAMIRYELVSDAFPLGFDRSRNHDQYMEGVLHVLPAHVDELLRRVV---GD  132

Query  526  SGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTE  630
                   CL+ADT FV+P  LA+K  +  +S  TE
Sbjct  133  GDAAAATCLVADTLFVWPATLARKLGVPVVSCTTE  167



>gb|ACN39827.1| unknown [Picea sitchensis]
Length=496

 Score =   145 bits (367),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 92/257 (36%), Positives = 144/257 (56%), Gaps = 14/257 (5%)
 Frame = +1

Query  196  HAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDD---IFSGIR  366
            HA+L  YP QGH+ P +  A  LA KG TVTF+ TH  H  + K+  + D    I     
Sbjct  9    HALLFPYPTQGHMTPMMQFAKNLASKGLTVTFVTTHHTHRQIIKARSQSDQVDPIHQDAH  68

Query  367  KPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPVN  546
               LDIR   ISDGLP ++DR+     F+ ++ ++    +E  +  +     N  GPP++
Sbjct  69   NLDLDIRSAQISDGLPLDFDRSAGFSDFIQAVDNM-GGELERLIHNL-----NKTGPPIS  122

Query  547  CLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLL---RLNGHFGCIDVREDA  717
            C+I DT   +  +++KK  + +ISFWT+P  V+++YY+ HL+   R + + G  +     
Sbjct  123  CVIVDTMLFWSLEVSKKLGIPWISFWTQPTFVYSIYYYAHLVEAQRRSHYKGSGNEGNIL  182

Query  718  IEYVPGVRSIDVKDLMSYIQETETET-VCHQIIYKSFQDARNADFVLCNTVQELEHETVA  894
            I+Y+PGV ++   DL S+  ET+ ++     +  KSFQ +R AD+VLCN+  +LE   V 
Sbjct  183  IDYIPGVPTLHPSDLPSFFNETDFDSQYILDLFRKSFQSSRRADWVLCNSFDDLESAEVN  242

Query  895  ALQE-KTSFFTVGPIFP  942
            AL E +    +VGP+ P
Sbjct  243  ALMELQPPVLSVGPLLP  259



>ref|XP_009334676.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Pyrus x bretschneideri]
Length=559

 Score =   143 bits (360),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = +1

Query  625  TEPALVFTLYYHLHLLRLNGHFGCIDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCH  804
            TEPALVF +YYHL LL+ NGHFG  D RED I+Y+PGV++I+ KDLMS++Q T+  +   
Sbjct  232  TEPALVFNIYYHLDLLKKNGHFGSHDNREDIIDYIPGVKAIEPKDLMSHLQSTDLFSPML  291

Query  805  QIIYKSFQDARNADFVLCNTVQELEHETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*S  984
            +  YKSF++ + ADF+LCNTVQELE E+++ALQ K   + +GP+ P     + VAT+L  
Sbjct  292  RTFYKSFREVKRADFILCNTVQELEFESLSALQAKQPTYAIGPVLPDSLTNNIVATNLMP  351

Query  985  ESDC  996
            E DC
Sbjct  352  EFDC  355



>ref|XP_004173864.1| PREDICTED: UDP-glycosyltransferase 86A2-like, partial [Cucumis 
sativus]
Length=308

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +1

Query  703   VREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEH  882
             +REDAI+Y+PGV +I+ +D+ SY+QE++T +VCHQII  +FQD R ADFVLCNT+Q+LE+
Sbjct  1     IREDAIDYIPGVPTINPQDMTSYLQESDTTSVCHQIISAAFQDVRKADFVLCNTIQDLEN  60

Query  883   ETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             +T++ALQ +T F+ +GP+FPP F +S+V TSL  ESDC   L
Sbjct  61    DTISALQAQTQFYAIGPVFPPGFTKSSVPTSLWPESDCTNWL  102



>ref|XP_009794965.1| PREDICTED: UDP-glycosyltransferase 86A2-like, partial [Nicotiana 
sylvestris]
Length=350

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +1

Query  700  DVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELE  879
            D  ED I+Y+PGV+SI  KDLMSY+QET+T ++CHQII  +F+D R+ADF+LCNT+QELE
Sbjct  36   DKSEDVIDYIPGVQSIRPKDLMSYLQETDTTSICHQIISNAFEDVRSADFILCNTIQELE  95

Query  880  HETVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDC  996
             ET++ALQ + SFF +GP+FPP F +  VATS+ SE DC
Sbjct  96   PETISALQVEKSFFAIGPVFPPEFNKIDVATSMWSEFDC  134



>ref|XP_002452527.1| hypothetical protein SORBIDRAFT_04g027460 [Sorghum bicolor]
 gb|EES05503.1| hypothetical protein SORBIDRAFT_04g027460 [Sorghum bicolor]
Length=484

 Score =   135 bits (340),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 92/279 (33%), Positives = 139/279 (50%), Gaps = 31/279 (11%)
 Frame = +1

Query  187  QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIR  366
            Q+PHA+LI  P QGH+ P +HLA  L  +GF VT++N+   H  L +S  R  D  +G  
Sbjct  8    QRPHAVLIPQPAQGHVTPMLHLAKALHARGFRVTYVNSEYNHRRLLRS--RGQDSLAGTD  65

Query  367  KPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTS-SANSGGPPV  543
                  R+  + DGLP   +  V  D  +A+L    + H     + +L   +A  G PPV
Sbjct  66   G----FRFEAVPDGLPQSDNDDVTQD--IAALCLSTTEHSAAPFRDLLARLNATPGSPPV  119

Query  544  NCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHL-HLLRL------------NG  684
            +C+IAD    F  ++A++  +L + FWT  A  F  Y H   L+R             NG
Sbjct  120  SCVIADGVMSFAQRVAEEMGILALVFWTTSACGFMGYLHFAELIRRAYVPLKDESDLSNG  179

Query  685  HFGCIDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNT  864
            +       + AI+++PG+  I +KD+ S+I+ T+ + V         Q+AR A  V+ NT
Sbjct  180  YL------DTAIDWIPGMPGIRLKDIPSFIRTTDPDDVMLNFDGGEAQNARKARGVILNT  233

Query  865  VQELEHETVAAL-QEKTSFFTVGPIFPPVFAQSAVATSL  978
               LE + V AL +E    +TVGP+    FA +A    L
Sbjct  234  YDALEQDVVDALRREFPRVYTVGPL--ATFANAAAGGGL  270



>ref|XP_006647925.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Oryza brachyantha]
Length=484

 Score =   134 bits (338),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 98/314 (31%), Positives = 149/314 (47%), Gaps = 37/314 (12%)
 Frame = +1

Query  181   SGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSG  360
             S +KPHA+ I YP QGHI P +++A  L  +GF VTF+NT   H  L ++  R +   +G
Sbjct  6     SAEKPHAVCIPYPAQGHITPMLNVAKLLHARGFDVTFVNTEYNHARLVRT--RGEAAVAG  63

Query  361   IRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILT--SSANSGG  534
             I  PG   R+ TI DGLPP  D  V  D  + SL            +++L   +   +G 
Sbjct  64    I--PGF--RFATIPDGLPPSDDDDVTQD--IPSLCRSTKETCLGPFRRLLAQLNDPATGH  117

Query  535   PPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVRE-  711
             PPV C+++D    F    AK+  L Y+  WT  ++ +  Y H  LL   G     D ++ 
Sbjct  118   PPVTCVVSDVVMGFSMDAAKELGLPYVQLWTASSISYLAYRHYRLLMERGLAPLKDAKQL  177

Query  712   ------DAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQE  873
                     +E VPG+R++ ++D  S+I  T  E      + +  +  + A  V+ NT  +
Sbjct  178   TNGYLDTPVENVPGLRNMRIRDFPSFILTTNPEEYMVGYVIEETERCKGASAVIVNTFGD  237

Query  874   LEHETVAALQ--EKTSFFTVGPIF------PPVFAQSAVATSL*SESDCEPLLILPLLHC  1029
             LE E VAA++       +T+GP+       PP  A+S++  SL  E +           C
Sbjct  238   LEGEAVAAMEVLGLPKVYTLGPLQLVAREDPPT-ARSSIRLSLWKEQE----------EC  286

Query  1030  SYRWFAGGVAGRTV  1071
               +W  G  AG  V
Sbjct  287   -LQWLDGKAAGSVV  299



>ref|XP_006649062.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Oryza brachyantha]
Length=484

 Score =   134 bits (337),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 87/270 (32%), Positives = 141/270 (52%), Gaps = 19/270 (7%)
 Frame = +1

Query  187  QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIR  366
            ++PHA+LI  P+QGHI P +HLA  L  +GF VT++N+      L +S  R     +G  
Sbjct  8    RQPHAVLIPQPVQGHITPMLHLAKALHARGFRVTYVNSEYNRRRLLRS--RGPGALAG--  63

Query  367  KPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTS-SANSGGPPV  543
             PG   R+  + DGLP   +  V  D  +A+L    + H  E  +++L   ++  G PPV
Sbjct  64   APGF--RFEAVPDGLPESGNDDVTQD--IAALCVSTTKHSAEPFRELLVRLNSTPGSPPV  119

Query  544  NCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCID-------  702
            +C+IAD    F  ++A++  +L + FWT  A  F  Y H   L   G+    D       
Sbjct  120  SCVIADGVMSFAQRVAEEMGILAVVFWTTSACGFMGYLHFAELIRRGYVPLKDQCDLTNG  179

Query  703  VREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEH  882
              + +I+++PG++ I ++D+ S+I+ T+ + V         Q+AR A  ++ NT   LE 
Sbjct  180  YLDTSIDWIPGMQGIRLRDVPSFIRTTDPDDVMLNFDGGEAQNARKARGLILNTYDALEQ  239

Query  883  ETVAALQ-EKTSFFTVGPIFPPVFAQSAVA  969
            + V AL+ E    +TVGP+  P FA++   
Sbjct  240  DVVDALRSEFPRVYTVGPL--PAFAKAVAG  267



>ref|XP_010107491.1| UDP-glycosyltransferase 86A1 [Morus notabilis]
 gb|EXC16173.1| UDP-glycosyltransferase 86A1 [Morus notabilis]
Length=160

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 94/146 (64%), Gaps = 12/146 (8%)
 Frame = +1

Query  190  KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTK-------SNPRDDD  348
            KPHAI+I++ LQGH+IP+VHLA +LA KG T+TF+NT  +H+ +TK       S+   +D
Sbjct  11   KPHAIIIAFGLQGHVIPAVHLAIKLASKGLTITFVNTEVIHHEITKSKRHEVGSDDHQND  70

Query  349  IFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANS  528
            IF+G R  GLDIRY T+ +G P E++R  N ++F    L+    +++E +  IL    + 
Sbjct  71   IFAGARNSGLDIRYRTVCNGFPIEFNRPANLEKFHEGYLNNLPNYMDELVGDILRDVTS-  129

Query  529  GGPPVNCLIADTFFVFPGKLAKKYKL  606
                V+CLI DTF+ +  ++AKKY L
Sbjct  130  ----VSCLIVDTFYTWTSQIAKKYNL  151



>ref|XP_003570607.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Brachypodium 
distachyon]
Length=491

 Score =   131 bits (330),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 87/270 (32%), Positives = 137/270 (51%), Gaps = 32/270 (12%)
 Frame = +1

Query  187  QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIR  366
            Q+PHA+L+  P QGH+ P +HLA  L  +GF VTF+N+   H  + +S           R
Sbjct  9    QQPHAVLVPQPAQGHVTPMLHLAKALHARGFHVTFVNSEYNHRRVLRS-----------R  57

Query  367  KPG-LD----IRYVTISDGLPPEWDRAVNHD--QFMASLLHIYSAHVEEALKKILT--SS  519
             PG LD     R+  I DGLPP  D   N D  Q +A+L    + +     + +L+    
Sbjct  58   GPGSLDGVDGFRFEAIPDGLPPPSDSGHNDDVTQDIAALCLSTTKNSAAPFRALLSRLKE  117

Query  520  ANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCI  699
             + G PPV+C+IAD    F  ++A++  +  + FWT  A  F  Y H   L   G+    
Sbjct  118  NDDGTPPVSCVIADGVMSFAQRVAEEVGVPALLFWTTSACGFVGYLHFAELVRRGYVPLK  177

Query  700  DVR-------EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLC  858
            D         +  I+++PG+  + ++D+ S+I+ T+ + +         Q+AR A  ++ 
Sbjct  178  DESDLTNGYLDTEIDWIPGMEGVRLRDMPSFIRTTDPDDIMLNFDGGEAQNARGARGLIL  237

Query  859  NTVQELEHETVAALQEKTSFF----TVGPI  936
            NT   LEH+ + AL+ +TSFF    TVGP+
Sbjct  238  NTYDALEHDVLRALR-RTSFFPRLYTVGPL  266



>ref|XP_008679293.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Zea mays]
 gb|AFW64427.1| hypothetical protein ZEAMMB73_376341 [Zea mays]
Length=484

 Score =   131 bits (330),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 86/259 (33%), Positives = 132/259 (51%), Gaps = 17/259 (7%)
 Frame = +1

Query  187  QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIR  366
            ++PHA+LI  P QGH+ P +HLA  L  +GF VT++N+   H  L +S  R  D  +G  
Sbjct  8    RRPHAVLIPQPAQGHVTPMLHLAKALHARGFRVTYVNSEYNHRRLLRS--RGQDSLAGTD  65

Query  367  KPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTS-SANSGGPPV  543
                   +  + DGLP   +  V  D  +A+L    +AH     + +L   +A  G PPV
Sbjct  66   G----FHFEAVPDGLPQSDNDDVTQD--IAALCLSTTAHSAAPFRDLLARLNAMPGSPPV  119

Query  544  NCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVR-----  708
            +C+IAD    F  ++A++  +L + FWT  A  F  Y H   L   G+    D       
Sbjct  120  SCVIADGVMSFAQRVAEEMGILALVFWTTSACGFMGYLHFAELIRRGYVPLKDESDLTNG  179

Query  709  --EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEH  882
              + AI+++PG+  I +KD+ S+I+ T+ + V         Q+AR A  V+ NT   LE 
Sbjct  180  YLDTAIDWIPGMPDIRLKDIPSFIRTTDRDDVMLNFDGGEAQNARRARGVILNTYDALEQ  239

Query  883  ETVAAL-QEKTSFFTVGPI  936
            + V AL +E    +TVGP+
Sbjct  240  DVVDALRREFPRVYTVGPL  258



>gb|ABR16264.1| unknown [Picea sitchensis]
Length=490

 Score =   130 bits (326),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 78/256 (30%), Positives = 135/256 (53%), Gaps = 15/256 (6%)
 Frame = +1

Query  190  KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIRK  369
            KPH +++ YP QGHI P +  A RLA K   VTF+ T +    + K+     D   G   
Sbjct  11   KPHVLVMPYPAQGHINPMLLFAKRLASKQIMVTFVTTEASRERMLKAQ----DAVPGASN  66

Query  370  PGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPVNC  549
               ++++ TISDGLP ++DR+ + D  +  L  I    +   ++++     N+ G  ++C
Sbjct  67   SSTEVQFETISDGLPLDFDRSKDVDLTLDMLCRIGGLTLANLIERL-----NAQGNNISC  121

Query  550  LIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLH--LLRLNGHFGCIDVREDAIE  723
            ++ D+F  +  ++AKK+K+    FWT+   V+++YY+ +  L  L    G +    DAIE
Sbjct  122  IVYDSFLHWVPEVAKKFKIPVAFFWTQSCAVYSIYYNFNRGLANLRDETGKL---VDAIE  178

Query  724  YVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQ  903
             +PG+  + V DL S++Q +       +++   F+    A +VL N+  ELE E + +++
Sbjct  179  -IPGLPLLKVSDLPSFLQPSNAYESLLRLVMDQFKPLPEATWVLGNSFSELESEEINSMK  237

Query  904  EKTSFFTVGPIFPPVF  951
                  TVGP+ P  F
Sbjct  238  SIAPLRTVGPLIPSAF  253



>ref|NP_001048165.1| Os02g0755900 [Oryza sativa Japonica Group]
 dbj|BAD17253.1| putative UDP-glucose glucosyltransferase1 [Oryza sativa Japonica 
Group]
 dbj|BAF10079.1| Os02g0755900 [Oryza sativa Japonica Group]
 gb|EAZ24674.1| hypothetical protein OsJ_08442 [Oryza sativa Japonica Group]
 dbj|BAG93535.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97062.1| unnamed protein product [Oryza sativa Japonica Group]
Length=485

 Score =   129 bits (324),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 94/311 (30%), Positives = 146/311 (47%), Gaps = 36/311 (12%)
 Frame = +1

Query  190   KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIRK  369
             KPHA+ + YP QGHI P +++A  L  +GF VTF+NT   H  L ++  R +   +G   
Sbjct  9     KPHAVCMPYPAQGHITPMLNVAKLLHARGFDVTFVNTEYNHARLVRT--RGEAAVAG--A  64

Query  370   PGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILT--SSANSGGPPV  543
             PG   R+ TI DGLPP  D  V  D  + SL            +++L   +   +G PPV
Sbjct  65    PGF--RFATIPDGLPPSDDDDVTQD--IPSLCRSTKETCLAPFRRLLAQLNDPATGHPPV  120

Query  544   NCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVRE----  711
              C+++D    F    AK+  L Y+  WT  ++ +  Y H  LL   G     DV +    
Sbjct  121   TCVVSDVVMGFSMAAAKELGLPYVQLWTASSISYLGYRHYRLLMERGLAPLKDVDQLTNG  180

Query  712   ---DAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEH  882
                  +E VPG+R++ +KD  S+I  T  E      + +  +  ++A  ++ N+  +LE 
Sbjct  181   YLDTPVEDVPGLRNMRIKDFPSFIHTTNPEEYMVGYVIEETERCKDASAIIVNSFGDLEG  240

Query  883   ETVAALQEKT--SFFTVGPI------FPPVFAQSAVATSL*SESDCEPLLILPLLHCSYR  1038
             E VAA++       +T+GP+       PP   +S++  SL  E +           C  +
Sbjct  241   EAVAAMEALGLPKVYTLGPLPLVARKDPPSPRRSSIRLSLWKEQE----------EC-LQ  289

Query  1039  WFAGGVAGRTV  1071
             W  G  AG  V
Sbjct  290   WLDGKEAGSVV  300



>gb|AFW64428.1| hypothetical protein ZEAMMB73_964153, partial [Zea mays]
Length=490

 Score =   129 bits (324),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 88/277 (32%), Positives = 135/277 (49%), Gaps = 22/277 (8%)
 Frame = +1

Query  169  AMADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDD  348
            +M  S  +PHA+LI YP QGH+ P + LA  L  +GF VT++N+   H  L +S  R  D
Sbjct  6    SMMGSNARPHAVLIPYPAQGHVTPLLQLAKVLHSRGFFVTYVNSEYNHRRLLRS--RGAD  63

Query  349  IFSGIRKPGLDIRYVTISDGLPPEW-DRAVNHD--QFMASLLHIYSAHVEEALKKILTSS  519
              +G+     D R+ TI DGLPP   D  V  D      SL    +A   + L ++   +
Sbjct  64   SLAGLD----DFRFETIPDGLPPSGSDDDVTQDIPALCESLSRSGAAPFRDLLARL---N  116

Query  520  ANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCI  699
               G PPV C++ D F  F  ++A +  +L + F T  A  F  Y H   L   G+    
Sbjct  117  GMPGRPPVTCVVLDNFMSFAQRVASEMGILAVVFCTMSACGFMGYLHFKELMDRGYVPLK  176

Query  700  DVR-------EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLC  858
            D         +  +++VPG+R I ++D+ S+I+ T+ +           Q+AR A  ++ 
Sbjct  177  DESYLTNGYLDTVLDWVPGMRGIRLRDMPSFIRTTDPDEFMVHFDSGEAQNARRAQGIIV  236

Query  859  NTVQELEHETVAALQEK-TSFFTVGPIFPPVFAQSAV  966
            NT   LE + V AL+      +T+GP+    FA+  V
Sbjct  237  NTFDALEQDVVGALRGVFPRVYTIGPLL--TFARDMV  271



>ref|XP_008679294.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Zea mays]
 ref|XP_008679295.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Zea mays]
Length=491

 Score =   129 bits (324),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 88/277 (32%), Positives = 135/277 (49%), Gaps = 22/277 (8%)
 Frame = +1

Query  169  AMADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDD  348
            +M  S  +PHA+LI YP QGH+ P + LA  L  +GF VT++N+   H  L +S  R  D
Sbjct  6    SMMGSNARPHAVLIPYPAQGHVTPLLQLAKVLHSRGFFVTYVNSEYNHRRLLRS--RGAD  63

Query  349  IFSGIRKPGLDIRYVTISDGLPPEW-DRAVNHD--QFMASLLHIYSAHVEEALKKILTSS  519
              +G+     D R+ TI DGLPP   D  V  D      SL    +A   + L ++   +
Sbjct  64   SLAGLD----DFRFETIPDGLPPSGSDDDVTQDIPALCESLSRSGAAPFRDLLARL---N  116

Query  520  ANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCI  699
               G PPV C++ D F  F  ++A +  +L + F T  A  F  Y H   L   G+    
Sbjct  117  GMPGRPPVTCVVLDNFMSFAQRVASEMGILAVVFCTMSACGFMGYLHFKELMDRGYVPLK  176

Query  700  DVR-------EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLC  858
            D         +  +++VPG+R I ++D+ S+I+ T+ +           Q+AR A  ++ 
Sbjct  177  DESYLTNGYLDTVLDWVPGMRGIRLRDMPSFIRTTDPDEFMVHFDSGEAQNARRAQGIIV  236

Query  859  NTVQELEHETVAALQEK-TSFFTVGPIFPPVFAQSAV  966
            NT   LE + V AL+      +T+GP+    FA+  V
Sbjct  237  NTFDALEQDVVGALRGVFPRVYTIGPLL--TFARDMV  271



>gb|EAY87581.1| hypothetical protein OsI_08991 [Oryza sativa Indica Group]
Length=485

 Score =   129 bits (324),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 94/311 (30%), Positives = 146/311 (47%), Gaps = 36/311 (12%)
 Frame = +1

Query  190   KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIRK  369
             KPHA+ + YP QGHI P +++A  L  +GF VTF+NT   H  L ++  R +   +G   
Sbjct  9     KPHAVCMPYPAQGHITPMLNVAKLLHARGFDVTFVNTEYNHARLVRT--RGEAAVAG--A  64

Query  370   PGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILT--SSANSGGPPV  543
             PG   R+ TI DGLPP  D  V  D  + SL            +++L   +   +G PPV
Sbjct  65    PGF--RFATIPDGLPPSDDDDVTQD--IPSLCRSTKETCLAPFRRLLAQLNDPATGHPPV  120

Query  544   NCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVRE----  711
              C+++D    F    AK+  L Y+  WT  ++ +  Y H  LL   G     DV +    
Sbjct  121   TCVVSDVVMGFSMAAAKELGLPYVQLWTASSISYLGYRHYRLLMERGLAPLKDVDQLTNG  180

Query  712   ---DAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEH  882
                  +E VPG+R++ +KD  S+I  T  E      + +  +  ++A  ++ N+  +LE 
Sbjct  181   YLDTPVEDVPGLRNMRIKDFPSFIHTTNPEEYMVGYVIEETERCKDASAIIVNSFGDLEG  240

Query  883   ETVAALQEKT--SFFTVGPI------FPPVFAQSAVATSL*SESDCEPLLILPLLHCSYR  1038
             E VAA++       +T+GP+       PP   +S++  SL  E +           C  +
Sbjct  241   EAVAAMEALGLPKVYTLGPLPLVARKDPPSPRRSSIRLSLWKEQE----------EC-LQ  289

Query  1039  WFAGGVAGRTV  1071
             W  G  AG  V
Sbjct  290   WLDGKEAGSVV  300



>ref|NP_001048164.1| Os02g0755600 [Oryza sativa Japonica Group]
 dbj|BAD17249.1| putative UDP-glucose glucosyltransferase [Oryza sativa Japonica 
Group]
 dbj|BAF10078.1| Os02g0755600 [Oryza sativa Japonica Group]
 gb|EEE57832.1| hypothetical protein OsJ_08435 [Oryza sativa Japonica Group]
Length=482

 Score =   129 bits (324),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 84/270 (31%), Positives = 137/270 (51%), Gaps = 19/270 (7%)
 Frame = +1

Query  187  QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIR  366
            ++ HA+LI  P QGH+ P +HLA  L  +GF VT++N+   H  L +S+       +   
Sbjct  7    RRAHAVLIPQPAQGHVTPMLHLAKALHARGFFVTYVNSEYNHRRLLRSSGPGALAGA---  63

Query  367  KPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTS-SANSGGPPV  543
                  R+  + DG+P   +  V  D  +A+L    + H  E  +++L   ++  G PPV
Sbjct  64   ---AGFRFEAVPDGMPESGNDDVTQD--IAALCVSTTRHSAEPFRELLVRLNSTPGTPPV  118

Query  544  NCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVR-----  708
            +C+IAD    F  ++A++  +L + FWT  A  F  Y H   L   G+    D       
Sbjct  119  SCVIADGVMSFAQRVAEEMGILALVFWTTSACGFMGYLHFAELIRRGYVPLKDESDLTNG  178

Query  709  --EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEH  882
              +  I+++PG+R I +KD+ S+I+ T+ + V         Q+AR A  ++ NT   LE 
Sbjct  179  YLDTPIDWIPGMRGIRLKDVPSFIRTTDPDDVMLNFDGGEAQNARKARGLILNTYDALEQ  238

Query  883  ETVAAL-QEKTSFFTVGPIFPPVFAQSAVA  969
            + V AL +E    +TVGP+  P FA++A  
Sbjct  239  DVVDALRREFPRVYTVGPL--PAFAKAAAG  266



>gb|EEC74033.1| hypothetical protein OsI_08990 [Oryza sativa Indica Group]
Length=581

 Score =   129 bits (325),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 85/270 (31%), Positives = 137/270 (51%), Gaps = 19/270 (7%)
 Frame = +1

Query  187  QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIR  366
            ++ HA+LI  P QGH+ P +HLA  L  +GF VT+IN+   H  L +S+       +   
Sbjct  106  RRAHAVLIPQPAQGHVTPMLHLAKALHARGFFVTYINSEYNHRRLLRSSGPGALAGA---  162

Query  367  KPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTS-SANSGGPPV  543
                  R+  + DG+P   +  V  D  +A+L    + H  E  +++L   ++  G PPV
Sbjct  163  ---AGFRFEAVPDGMPESGNDDVTQD--IAALCVSTTRHSAEPFRELLVRLNSTPGTPPV  217

Query  544  NCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVR-----  708
            +C+IAD    F  ++A++  +L + FWT  A  F  Y H   L   G+    D       
Sbjct  218  SCVIADGVMSFAQRVAEEMGILALVFWTTSACGFMGYLHFAELIRRGYVPLKDESDLTNG  277

Query  709  --EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEH  882
              +  I+++PG+R I +KD+ S+I+ T+ + V         Q+AR A  ++ NT   LE 
Sbjct  278  YLDTPIDWIPGMRGIRLKDVPSFIRTTDPDDVMLNFDGGEAQNARKARGLILNTYDALEQ  337

Query  883  ETVAAL-QEKTSFFTVGPIFPPVFAQSAVA  969
            + V AL +E    +TVGP+  P FA++A  
Sbjct  338  DVVDALRREFPRVYTVGPL--PAFAKAAAG  365



>dbj|BAK01910.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=490

 Score =   128 bits (322),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 86/266 (32%), Positives = 130/266 (49%), Gaps = 27/266 (10%)
 Frame = +1

Query  187  QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIR  366
            ++PHA+LI  P QGH+ P +HLA  L  +GF +TF+N+      L +S           R
Sbjct  8    RQPHAVLIPQPAQGHVTPMLHLAKALHARGFRITFVNSEYNRRRLLRS-----------R  56

Query  367  KPG-LD----IRYVTISDGLPPEW-DRAVNHDQFMASLLHIYSAHVEEALKKILTSSANS  528
             PG LD     R+  + DGLPP   D   +  Q +A+L    + H     K++L    N 
Sbjct  57   GPGSLDGADGFRFEAVPDGLPPPSDDHGDDVTQDIAALCLSTTKHSAAPFKELLVRLNNG  116

Query  529  --GGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCID  702
              G PPV+C+IAD    F  ++A +  +  + FWT  A  F  Y H   L   G+    D
Sbjct  117  MPGAPPVSCVIADGVMSFAQRVAGEMGIPALVFWTTSACGFMGYLHFAELVRRGYVPLKD  176

Query  703  VR-------EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCN  861
                     +  I+++PG+  I +KD+ S+I+ T+ + V         Q+AR A  ++ N
Sbjct  177  ESDLTNGYLDTVIDWIPGMEGIRLKDIPSFIRTTDPDDVMLNFDGGEAQNARGARGLILN  236

Query  862  TVQELEHETVAALQEK-TSFFTVGPI  936
            T  ELE + V AL+      +TVGP+
Sbjct  237  TYDELEQDVVDALRRTFPRLYTVGPL  262



>ref|XP_004953968.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Setaria italica]
Length=486

 Score =   128 bits (321),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 86/268 (32%), Positives = 132/268 (49%), Gaps = 22/268 (8%)
 Frame = +1

Query  190  KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIRK  369
            KPHA+ + YP QGHI P +++A  L  +GF VTF+NT      L ++  R     +G+  
Sbjct  11   KPHAVCLPYPAQGHITPMLNVAKLLHARGFDVTFVNTEYNQARLVRT--RGAAAVAGV--  66

Query  370  PGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSAN--SGGPPV  543
            PG   R+ TI DGLPP  D  V  D  + SL    +       +++L +  +  +G PPV
Sbjct  67   PGF--RFATIPDGLPPSEDDDVTQD--IPSLCKSTTETCLGPFRRLLAALNDPATGHPPV  122

Query  544  NCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVRE----  711
             C+++D    F    AK+  L Y+  WT   + F  Y H  LL   G     DV +    
Sbjct  123  TCVVSDVVMGFSIDAAKELGLPYVQLWTASTISFLGYQHYRLLMTRGLAPLKDVEQLTNG  182

Query  712  ---DAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEH  882
                 +E VPG+R++  +D  S+I+ T+ +      + K    +  A  V+ NT  ELE 
Sbjct  183  FLDTPVEDVPGLRNMRFRDFPSFIRTTDPDEFMVHYVLKETGRSAGASAVIFNTFDELEG  242

Query  883  ETVAALQE---KTSFFTVGPIFPPVFAQ  957
            E VAA++        +T+GP+  P+ A+
Sbjct  243  EAVAAMESLGLARKVYTLGPL--PLLAR  268



>ref|NP_001064696.2| Os10g0442300 [Oryza sativa Japonica Group]
 dbj|BAF26610.2| Os10g0442300, partial [Oryza sativa Japonica Group]
Length=319

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = +1

Query  706   REDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHE  885
             R+D I YVPGV +I+  +LMSY+Q+T+T TV H+II+++F++AR AD+V+CNTV+ELE  
Sbjct  15    RKDTITYVPGVEAIEPGELMSYLQDTDTTTVVHRIIFRAFEEARGADYVVCNTVEELEPS  74

Query  886   TVAALQEKTSFFTVGPIFPPVFAQSAVATSL*SESDCEPLL  1008
             T+AAL+ +  F+ VGPI P  FA+SAVATS+ +ESDC   L
Sbjct  75    TIAALRRERPFYAVGPILPAGFARSAVATSMWAESDCSRWL  115



>ref|XP_002454243.1| hypothetical protein SORBIDRAFT_04g027420 [Sorghum bicolor]
 gb|EES07219.1| hypothetical protein SORBIDRAFT_04g027420 [Sorghum bicolor]
Length=487

 Score =   127 bits (319),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 86/277 (31%), Positives = 136/277 (49%), Gaps = 24/277 (9%)
 Frame = +1

Query  169  AMADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDD  348
            ++  + Q+PHA+ + YP QGHI P +++A  L  +GF VTF+NT      L ++  R   
Sbjct  3    SLGSAAQQPHAVCLPYPAQGHITPMLNVAKLLHARGFHVTFVNTEYNQARLVRT--RGAA  60

Query  349  IFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILT----S  516
              +G+  PG   R+ TI DGLPP  D  V  D  + SL    +    E  +++L     S
Sbjct  61   AVAGL--PGF--RFATIPDGLPPSDDDDVTQD--IPSLCKSTTETCLEPFRRLLADLNDS  114

Query  517  SANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGC  696
            +A    PPV C+++D    F    AK+  L Y+  WT  A+ F  Y H   L   G    
Sbjct  115  AATGCHPPVTCVVSDVVMGFSIDAAKELGLPYVQLWTASAISFLGYQHYRRLMSRGLAPL  174

Query  697  IDVRE-------DAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVL  855
              V +         +E VPG+R++  +D  S+I+ T+ +      + +    +  A  V+
Sbjct  175  KSVEQLTNGFLDTPVEDVPGLRNMRFRDFPSFIRTTDPDEYMVGYVLQETGRSAGASAVI  234

Query  856  CNTVQELEHETVAALQE---KTSFFTVGPIFPPVFAQ  957
             NT+ ELE E VAA++        +T+GP+  P+ A+
Sbjct  235  VNTLDELEGEAVAAMESLGLARKVYTLGPL--PLLAR  269



>ref|XP_008219313.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   127 bits (318),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 86/266 (32%), Positives = 130/266 (49%), Gaps = 20/266 (8%)
 Frame = +1

Query  172  MADSG--QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDD  345
            M  +G  +KPHA+ I +P QGHI P + LA  L  KGF +TF+NT   H  L KS  R  
Sbjct  1    MGSNGLIEKPHAVCIPFPAQGHINPMLKLAKLLHYKGFYITFVNTEFNHKRLLKS--RGP  58

Query  346  DIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTS-SA  522
            +   G+       R+ TI DGLPP      N  Q + SL      H     + +L+  ++
Sbjct  59   NSLDGLPS----FRFETIPDGLPP---TDANATQDIPSLCESTRKHSLPYFRDLLSKLNS  111

Query  523  NSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCID  702
            ++G PPV+C+++D    F    A +  +  + FWT  A     Y H H L   G     D
Sbjct  112  STGCPPVSCIVSDGVMSFTLDAAHELGIPEVLFWTTSACGLLAYVHYHRLIEKGLTPLKD  171

Query  703  VR-------EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCN  861
                     E  I+++PG+R I +KD+ S+I+ T+ + +    +    +  R A  VL N
Sbjct  172  ASYLTNGYLETEIDWIPGMRGIRLKDIPSFIRTTDPDDIMLDFVVHETERTRKASAVLLN  231

Query  862  TVQELEHETVAALQE-KTSFFTVGPI  936
            T  +LEHE + AL       +++GP+
Sbjct  232  TFHDLEHEALDALSTLLPPIYSIGPL  257



>ref|XP_008219317.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   127 bits (318),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 86/266 (32%), Positives = 131/266 (49%), Gaps = 20/266 (8%)
 Frame = +1

Query  172  MADSG--QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDD  345
            M  +G  +KPHA+ I +P QGHI P + LA  L  KGF +TF+NT   H  L KS  R  
Sbjct  1    MGSNGLIEKPHAVCIPFPAQGHINPMLKLAKLLHYKGFHITFVNTEFNHKRLLKS--RGP  58

Query  346  DIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTS-SA  522
            +   G+       R+ TI DGLPP      N  Q + SL      H     + +L+  ++
Sbjct  59   NSLDGLPS----FRFETIPDGLPP---TDANATQDIPSLCESTRKHSLPYFRDLLSKLNS  111

Query  523  NSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCID  702
            ++G PPV+C+++D    F    A +  +  + FWT  A  F  Y H H L   G     D
Sbjct  112  STGCPPVSCIVSDGVMSFTLDAAHELGIPEVLFWTTSACGFLAYVHYHRLIEKGLTPLKD  171

Query  703  VR-------EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCN  861
                     E  I+++PG+R I +KD+ S+I+ T+ + +    +    +  R A  V+ N
Sbjct  172  ANYLTNGYLETQIDWIPGMRGIRLKDIPSFIRTTDPDDLMLDFLVHETERTRKASAVVLN  231

Query  862  TVQELEHETVAALQE-KTSFFTVGPI  936
            T  +LEHE + AL       +++GP+
Sbjct  232  TFHDLEHEALDALSTLLPPIYSIGPL  257



>gb|KEH35117.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=479

 Score =   127 bits (318),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 83/260 (32%), Positives = 131/260 (50%), Gaps = 20/260 (8%)
 Frame = +1

Query  187  QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIR  366
            QK HA+L+ YP QGH+ P + LA  L   GF +TF+NT   H  L   N    D  +G+ 
Sbjct  3    QKLHAVLVPYPAQGHVNPLMQLAKLLRCNGFHITFVNTEFNHKRLV--NSLGQDYMNGLP  60

Query  367  KPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGP--P  540
                D ++ TI DGLP  +  A    Q + +L      +     K++L +  N+  P  P
Sbjct  61   ----DFQFETIPDGLPFFYKDAT---QDIPTLCDATRKNCYAPFKELL-NKLNTSSPHIP  112

Query  541  VNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNG-------HFGCI  699
            V C+IAD  F F G++A+   +  I FWT  A  F  Y H   L   G       HF C 
Sbjct  113  VTCIIADGLFGFAGRVARDLGIQEIQFWTASACGFVGYLHYDELVKRGILPFQDEHFVCD  172

Query  700  DVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELE  879
               E +I+++ G++ I +KDL S+++ T+   +    +    Q+   +  ++ NT +ELE
Sbjct  173  GTLETSIDWISGMKDIKLKDLPSFMRVTDLNDIMFDFMGSESQNCLRSSTIIINTFEELE  232

Query  880  HETVAALQEKT-SFFTVGPI  936
             E +A L+ K  + +++GP+
Sbjct  233  DEVIATLKTKNPNIYSIGPL  252



>emb|CBI38429.3| unnamed protein product [Vitis vinifera]
Length=336

 Score =   125 bits (314),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 88/304 (29%), Positives = 141/304 (46%), Gaps = 39/304 (13%)
 Frame = +1

Query  61   LRKQRESPSFCAYILVALSSLVKTKSNSLIC***SKAMADSGQKPHAILISYPLQGHIIP  240
            L+  R+  ++C+++ VAL  +                  ++ +KPH + + +P QGH+IP
Sbjct  2    LKIFRQPWNYCSFVPVALLKMDP---------------KNTTRKPHIVCVPFPAQGHVIP  46

Query  241  SVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIRKPGLDIRYVTISDGLPPE  420
             + LA  L  KGF +TF+NT   H  L +S  + +D   G      D  + TISDGLPP 
Sbjct  47   MMQLAKLLHSKGFCITFVNTEFNHRRLVRS--KGEDWAKGFD----DFWFETISDGLPPS  100

Query  421  WDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGG-PPVNCLIADTFFVFPGKLAKK  597
               A  +      L +    H     + +L    +S   PPV C+I+D    F  K A++
Sbjct  101  NPDATQNPTM---LCYHVPKHCLAPFRHLLAKLNSSPEVPPVTCIISDGIMSFALKAAEE  157

Query  598  YKLLYISFWTEPALVFTLYYHLHLLRLNGHF----------GCIDVREDAIEYVPGVRSI  747
              +  + FWT  A  F  Y H   L   G F          G +D R   ++++PG+R+I
Sbjct  158  LGIPEVQFWTASACGFMAYLHHAELIQKGIFPFKDENFMSDGTLDTR---VDWIPGMRNI  214

Query  748  DVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQEK-TSFFT  924
             +KDL S+I+ T+   +         Q+   A  ++ NT    EHE + A+  K    +T
Sbjct  215  RLKDLPSFIRTTDPNHIMFHFARTETQNCLKASAIIFNTFDAFEHEVLEAIASKFPHIYT  274

Query  925  VGPI  936
            +GP+
Sbjct  275  IGPL  278



>ref|XP_010039907.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW45644.1| hypothetical protein EUGRSUZ_L00599 [Eucalyptus grandis]
Length=487

 Score =   126 bits (317),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 88/265 (33%), Positives = 128/265 (48%), Gaps = 19/265 (7%)
 Frame = +1

Query  178  DSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFS  357
            D  QKPHA+ I YP QGHI P ++LA  L  +GF VTF+NT   H  L +S  R      
Sbjct  5    DMIQKPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRS--RGPSSLD  62

Query  358  GIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSA----HVEEALKKILTSSAN  525
            G+  P    R  TI DGLPP  D A +  Q   +L    S     +  + L ++   SA 
Sbjct  63   GL--PSFQFR--TIPDGLPPS-DAAADTTQDTLALCQSTSKFCLPYFRDLLHRLNEESAT  117

Query  526  SGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDV  705
            SG PPV+C+++D    F    A+   +  +  WT  A  F  Y     L   G     D 
Sbjct  118  SGSPPVSCVVSDGAMTFTLDAAEAIGVPEVLLWTASACSFMGYVQYRSLIDKGLAPLKDA  177

Query  706  R-------EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNT  864
                    +  I+++PG+R+I ++DL S+IQ T+   +      +  + A+ A  ++ NT
Sbjct  178  SYLTNGYLDTTIDWIPGMRNIRLRDLPSFIQTTDPNDLMIPFCLREIERAKRASAIVFNT  237

Query  865  VQELEHETVAALQEK-TSFFTVGPI  936
               LEHE + AL+      +TVGP+
Sbjct  238  FDRLEHEVLDALKAMFPPIYTVGPL  262



>ref|NP_001048163.1| Os02g0755500 [Oryza sativa Japonica Group]
 dbj|BAD17248.1| putative UDP-glycosyltransferase 85A8 [Oryza sativa Japonica 
Group]
 dbj|BAF10077.1| Os02g0755500 [Oryza sativa Japonica Group]
 gb|EAZ24666.1| hypothetical protein OsJ_08434 [Oryza sativa Japonica Group]
 dbj|BAG89900.1| unnamed protein product [Oryza sativa Japonica Group]
Length=486

 Score =   126 bits (317),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 88/274 (32%), Positives = 137/274 (50%), Gaps = 20/274 (7%)
 Frame = +1

Query  181  SGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSG  360
            S  + HA+LI YP QGH+ P +HLA  L  +GF VTF+N+   H+ L +S  R     +G
Sbjct  3    SNSRLHAVLIPYPAQGHVTPLLHLAKVLHSRGFHVTFVNSEYNHHRLLRS--RGTGALAG  60

Query  361  IRKPGLDIRYVTISDGLPPEWDRAVNHD--QFMASLLHIYSAHVEEALKKILTS-SANSG  531
            +     D R+ TI DGLPP    + N D  Q + ++   +  H   A   +L   ++  G
Sbjct  61   LD----DFRFETIPDGLPPP-SESDNDDVTQDIPTVCTSFLTHGPAAFGALLARLNSEPG  115

Query  532  GPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVR-  708
             PPV+C+I D    F  ++A    +L  +FWT  A  F  Y H   L   G+    D   
Sbjct  116  TPPVSCVIPDGVMSFAQRVASDMGILAPAFWTTSACGFMGYLHYAELIDRGYVPLKDESY  175

Query  709  ------EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQ  870
                  +  +++VPG+  I ++D+ S+I+ T+ +           Q+AR+A  ++ NT  
Sbjct  176  LTNGYLDTVLDWVPGMPGIRLRDMPSFIRTTDRDEFMLNFDSGEAQNARHAQGLILNTFD  235

Query  871  ELEHETVAALQEK-TSFFTVGPIFPPVFAQSAVA  969
             +EH+ V AL+      +TVGP+    FA +A A
Sbjct  236  AVEHDVVDALRRIFPRVYTVGPLL--TFAGAAAA  267



>ref|XP_008219318.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=480

 Score =   126 bits (316),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 83/259 (32%), Positives = 127/259 (49%), Gaps = 18/259 (7%)
 Frame = +1

Query  187  QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIR  366
            +KPHA+ I +P QGHI P + LA  L  KGF +TF+NT   H  L KS  R  +   G+ 
Sbjct  8    EKPHAVCIPFPAQGHINPMLELAKLLHYKGFHITFVNTEFNHKRLLKS--RGPNSLDGLP  65

Query  367  KPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTS-SANSGGPPV  543
                  R+ TI DGLPP      N  Q + SL      H     + +L+  ++++G PPV
Sbjct  66   S----FRFETIPDGLPP---TDANATQDIPSLCESTRKHSLPYFRDLLSKLNSSTGCPPV  118

Query  544  NCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVR-----  708
            +C+++D    F    A +  +  + FWT  A  F  Y H H L   G     D       
Sbjct  119  SCIVSDGVMSFTLDAAHELGIPEVLFWTTSACGFLAYVHYHRLIEKGLTPLKDASYLTNG  178

Query  709  --EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEH  882
              E  I+++PG+R I +KD+ S+I+ T+ + +    +    +  R A  V+ NT  + EH
Sbjct  179  YLETEIDWIPGMRGIRLKDIPSFIRTTDPDDIMLDFVVHETERTRKASAVILNTFHDFEH  238

Query  883  ETVAALQE-KTSFFTVGPI  936
            E + AL       +++GP+
Sbjct  239  EVLDALSTLLPPIYSIGPL  257



>ref|XP_004953967.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Setaria italica]
Length=490

 Score =   126 bits (316),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 88/278 (32%), Positives = 136/278 (49%), Gaps = 21/278 (8%)
 Frame = +1

Query  178  DSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFS  357
            D+ ++PHA+LI  P QGH+ P +HLA  L  KGF +T++N+   H  L +S  R  D  +
Sbjct  5    DAPRRPHAVLIPQPAQGHVTPMLHLAKALHAKGFHITYVNSEYNHRRLLRS--RGPDSLA  62

Query  358  GIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKI---LTSSANS  528
            G         +  + DGLPP  +  V  D  +A+L    + H     + +   L +   S
Sbjct  63   GADG----FCFEAVPDGLPPSDNDDVTQD--IAALCLSTTEHSAAPFRDLLARLNARPGS  116

Query  529  GGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVR  708
              P V+C+IAD    F  ++A++  +L + FWT  A  F  Y H   L   G+    D  
Sbjct  117  RAPAVSCVIADGVMSFAQRVAEEMGILALVFWTTSACGFMGYLHFAELIRRGYVPLKDES  176

Query  709  -------EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTV  867
                   + AI+++PG+  + +KD+ S+I+ T+ + V         Q+AR A  V+ NT 
Sbjct  177  DLTNGYLDTAIDWIPGMPGMRLKDIPSFIRTTDRDDVMLNFDGGEAQNARKARGVILNTY  236

Query  868  QELEHETVAAL-QEKTSFFTVGPIFPPVFAQSAVATSL  978
              LE   V AL +E    +TVGP+    FA +A    L
Sbjct  237  DALEQGVVDALRREFPRVYTVGPL--AAFANAARGGEL  272



>ref|XP_007042920.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
 gb|EOX98751.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
Length=519

 Score =   126 bits (316),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 80/258 (31%), Positives = 127/258 (49%), Gaps = 17/258 (7%)
 Frame = +1

Query  187  QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIR  366
             KPHA+ + YP QGH+ P + +A  L  KGF +TF+NT   H  L KS  R  +   G+ 
Sbjct  8    NKPHAVCLPYPAQGHVNPMLKVAKLLHFKGFHITFVNTEYNHKRLLKS--RGPNALDGVP  65

Query  367  KPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPVN  546
                D R+ TI DGLPP     ++  Q + +L    S +     +++L    +SG PPV 
Sbjct  66   ----DFRFETIPDGLPPP---DIDATQDIPALCDSTSKNCLAPFRQLLAKLNSSGVPPVT  118

Query  547  CLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVR------  708
            C+++D    F  K A++  +  + FWT  A  F  Y H   L   G     D        
Sbjct  119  CIVSDGVMSFTLKAAEELGIPEVLFWTTSACGFLGYMHYPRLIERGFTPLKDETYLTNGY  178

Query  709  -EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHE  885
             +  I+++PG+++I ++DL S+++ T+   +    +    + A  A  V+ NT  E EH+
Sbjct  179  LDTVIDWIPGMKNIRIRDLPSFVRTTDRNDIMLNFLAVESERAAKASAVIVNTFDEFEHD  238

Query  886  TVAALQEK-TSFFTVGPI  936
             V AL       +T+GP+
Sbjct  239  VVKALSSMLPRIYTIGPL  256



>ref|XP_002310553.1| hypothetical protein POPTR_0007s05230g [Populus trichocarpa]
 gb|EEE91003.1| hypothetical protein POPTR_0007s05230g [Populus trichocarpa]
Length=481

 Score =   125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 87/281 (31%), Positives = 138/281 (49%), Gaps = 30/281 (11%)
 Frame = +1

Query  172  MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDI  351
            M     KPHA+L+ YP QGH+ P + LA  L  KGF VTF+NT   H  L +SN    + 
Sbjct  1    MGSLNNKPHAVLLPYPAQGHVNPLMQLARLLHSKGFHVTFVNTEFNHRRLVRSN--GPEF  58

Query  352  FSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSG  531
            F G+    LD R+ TI DGLPP  DR    D  + +L      +  +  +++L    +S 
Sbjct  59   FKGL----LDFRFETIPDGLPPS-DRDATQD--IWALSDSVRKNCLDPFRELLAKLNSSP  111

Query  532  G-PPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNG--------  684
              PPV C+I+D    F  + A++  +  I FWT  A+    +     L   G        
Sbjct  112  ELPPVTCIISDGLMSFAIEAAEELDIPEIQFWTASAIGLMGFLQFEELVKRGIVPFKDEN  171

Query  685  --HFGCIDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLC  858
              + G +D+    + ++PGV++I +KD+ S I+ T+ + +  + +    Q+   A  ++ 
Sbjct  172  FINDGTLDM---PLGWIPGVKNIRLKDMPSLIRTTDPDDIMLKFMSDEAQNCLKASAIIF  228

Query  859  NTVQELEHETVAALQEK-TSFFTVGPI------FPPVFAQS  960
            NT  E+EH  + A+  K    +T+GP+       PP  A+S
Sbjct  229  NTFDEIEHVVLEAIVTKFPRIYTIGPLSLLGRNMPPTQAKS  269



>gb|EPS62953.1| hypothetical protein M569_11835 [Genlisea aurea]
Length=466

 Score =   125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 88/281 (31%), Positives = 136/281 (48%), Gaps = 24/281 (9%)
 Frame = +1

Query  190  KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIRK  369
            KPHA+ I YP QGH+ P + LA  L  KGF +TF+NTH  H  L KS+        GI+ 
Sbjct  4    KPHALCIPYPAQGHVNPMLKLAKLLHHKGFCITFVNTHFNHRRLIKSH--------GIQA  55

Query  370  PGL--DIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPV  543
                 D R+ +I DGLPP      +  Q + SL         E L +++    +S  PPV
Sbjct  56   LSALPDFRFASIPDGLPPS---EADATQDVPSLCLSIPNTCLEPLCELIREVNSSNSPPV  112

Query  544  NCLIADTFFVFPGKLAKKYKLLYISFWTEPA---LVFTLYYHLHLLRLNGHFGCIDVRED  714
            NCL+ D    F  K A+ ++L  ++ WT  A   L   L+  L  L +          E 
Sbjct  113  NCLVVDGVMTFALKAAEAFRLPAVALWTSSACGLLTCMLFQRLVDLGITPSKEEDGYLER  172

Query  715  AIEYVPGVR-SIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETV  891
             +++VPGV+  + ++D  S+++ T+ + +    + +  +  + A  +L NT   LE E +
Sbjct  173  VMDWVPGVKDGLRLRDFPSFVRTTDPDDIMLNYMLREMEAIKGAKAILLNTFDALEEEVI  232

Query  892  AALQE--KTSFFTVGPI-----FPPVFAQSAVATSL*SESD  993
             AL+E      +TVGP+       P  +  A+ +SL  E D
Sbjct  233  GALEEMLPPPLYTVGPLNLSLDRLPDSSVKAIGSSLWKEED  273



>gb|EMT15333.1| Cytokinin-O-glucosyltransferase 2 [Aegilops tauschii]
Length=520

 Score =   125 bits (314),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 85/268 (32%), Positives = 135/268 (50%), Gaps = 19/268 (7%)
 Frame = +1

Query  187  QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIR  366
             +PHA+LI YP QGH+ P +HLA  L  +GF VTF+N+   H  L +S  R +D  +G+ 
Sbjct  2    SRPHAVLIPYPAQGHVTPLLHLAKVLHSRGFYVTFVNSEYNHRRLLRS--RGEDSLAGLD  59

Query  367  KPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPVN  546
                D ++ TI DGLPP  +  V  D  + +L   ++ H   AL + L +  + G PPV+
Sbjct  60   ----DFQFETIPDGLPPIENEDVTQD--VPALCTSFATH-GAALFRDLLARVDDGRPPVS  112

Query  547  CLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVR------  708
            C++ D    F  ++A +  +  + FWT  A  F  Y H   L   G+    D        
Sbjct  113  CVVTDGVMSFALEVAGERGVPALVFWTTSACGFMGYLHFFELIERGYVPLKDESCLTNGY  172

Query  709  -EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHE  885
             + A+++V G+  I ++D  S+++ T+   V         Q+A  A  ++ NT   +E +
Sbjct  173  LDTALDWVAGMPGIRLRDFPSFVRTTDRNDVMLNFDGGEAQNAHRAQGIILNTFDAVEQD  232

Query  886  TVAALQEK-TSFFTVGPIFPPVFAQSAV  966
             V AL+      +TVGP+  P FA +A 
Sbjct  233  VVDALRRIFPRVYTVGPL--PAFAVTAA  258



>ref|XP_007224069.1| hypothetical protein PRUPE_ppa015357mg [Prunus persica]
 gb|EMJ25268.1| hypothetical protein PRUPE_ppa015357mg [Prunus persica]
Length=482

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 86/266 (32%), Positives = 131/266 (49%), Gaps = 20/266 (8%)
 Frame = +1

Query  172  MADSG--QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDD  345
            M  +G  +KPHA+ I +P QGHI P + LA  L  KGF +TF+NT   H  L KS  R  
Sbjct  1    MGSNGLIEKPHAVCIPFPAQGHINPMLKLAKLLHYKGFHITFVNTEFNHKRLLKS--RGP  58

Query  346  DIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTS-SA  522
            +   G+       R+ TI DGLP       N  Q + SL      H     + +L+  ++
Sbjct  59   NSLDGLPS----FRFETIPDGLPL---TDANATQDIPSLCESTRKHSLPYFRDLLSKLNS  111

Query  523  NSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCID  702
            ++G PPV+C+++D    F    A +  +  + FWT  A  F  Y H H L  NG     D
Sbjct  112  STGCPPVSCIVSDGVMSFTLDAAHELGIPEVLFWTTSACGFLAYVHYHRLIENGLTPLKD  171

Query  703  VR-------EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCN  861
                     E  I+++PG+R I +KD+ S+I+ T+ + +    +    +  R A  V+ N
Sbjct  172  ASYLTNGYLETQIDWIPGMRGIRLKDIPSFIRTTDRDDLMLDFLVHETERTRKASAVVLN  231

Query  862  TVQELEHETVAALQE-KTSFFTVGPI  936
            T  +LEHE + AL       +++GP+
Sbjct  232  TFHDLEHEALDALSTLLPPIYSIGPL  257



>ref|XP_006366324.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Solanum tuberosum]
Length=479

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 79/264 (30%), Positives = 128/264 (48%), Gaps = 25/264 (9%)
 Frame = +1

Query  190  KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIRK  369
            KPHA+L+ YP QGH+ P + LA  L  +GF +TF+NT   H  L +S   D        K
Sbjct  9    KPHAVLLPYPSQGHVTPMMSLAKLLHSRGFHITFVNTEFNHSRLIQSKGVDS------VK  62

Query  370  PGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGPPVNC  549
              LD ++ TI DG+PP  + A    Q +  L  +         KK+LT   +   PPV+C
Sbjct  63   GLLDFKFATIPDGMPPSDENAT---QDITLLCDMTRKTCLVPFKKLLTKLNSGEVPPVSC  119

Query  550  LIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHF----------GCI  699
            +I+D    F  K A+   +  ++FWT     F  Y H   L   G F          G +
Sbjct  120  VISDGVMTFGIKAAQDLGIPDVTFWTASVCAFVGYLHYRQLIKRGIFPFKNDNYLIDGTL  179

Query  700  DVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELE  879
            D     I+++PG++ + +KDL S+++ T+   +    + +  Q+   A  ++ NT +  E
Sbjct  180  DT---PIDWIPGMKDVKLKDLPSFLRTTDPNDIMFDFMGEEAQNCLKASAIMFNTFEVFE  236

Query  880  HETVAALQEKTSF---FTVGPIFP  942
            HE +  +    +F   +++GP+ P
Sbjct  237  HELLQTIVSNFNFSNIYSIGPLGP  260



>gb|EYU19971.1| hypothetical protein MIMGU_mgv1a024760mg [Erythranthe guttata]
Length=483

 Score =   124 bits (312),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 88/269 (33%), Positives = 133/269 (49%), Gaps = 24/269 (9%)
 Frame = +1

Query  172  MADSGQ-KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDD  348
            MA +G+ KPHA+ I +P QGHI P + LA  L   GF +TF+NT   H+ L KS  R  D
Sbjct  1    MASAGKVKPHAVCIPFPAQGHINPMLKLAKLLHNNGFHITFVNTEYNHHRLLKS--RGPD  58

Query  349  IFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYS----AHVEEALKKILTS  516
              +G+       R+ TI DGLPP  +   +  Q + SL    +    A   + L K L  
Sbjct  59   SLTGLPS----FRFETIPDGLPPPSEDDADATQDIPSLCESTTNTCLAPFRDLLAK-LND  113

Query  517  SANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGC  696
            +A+S  PPV+C+++D    F    A++  +  I FWT  A  F  Y     +   G+   
Sbjct  114  TASSEVPPVSCIVSDGVMSFTADAAEELGIPEILFWTTSACGFYAYTQYEYVFQKGYAPL  173

Query  697  IDVR-------EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVL  855
             D         E  IE +P +  I +KD+ S+++ T  +    Q I+   + A+    ++
Sbjct  174  ADTSCFTNGYLETVIEGIPSMEGIRMKDMPSFVRTTNEDDFMIQFIFAETKRAKRVSAIV  233

Query  856  CNTVQELEHETVAALQEKTSFFTVGPIFP  942
             NT +ELE +T+ AL   +SF    PI+P
Sbjct  234  LNTFEELERDTIDAL---SSFLP--PIYP  257



>ref|XP_010937418.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Elaeis 
guineensis]
Length=485

 Score =   124 bits (312),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 82/259 (32%), Positives = 128/259 (49%), Gaps = 17/259 (7%)
 Frame = +1

Query  190  KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIRK  369
            +PHA+LI  P QGH+ P + L+  L  KGF +T++N+   H  L +S  R  D  +G+  
Sbjct  6    RPHAVLIPQPAQGHVTPMLQLSKVLHSKGFYITYVNSEYNHRRLLRS--RGPDSLNGLE-  62

Query  370  PGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGG-PPVN  546
               D R+  I DGLP   +  V  D  +A L    + +     + ++    NS G PPV+
Sbjct  63   ---DFRFEAIPDGLPLSDNDDVTQD--IAELCISTTKNSLAPFRDLIIRLNNSPGVPPVS  117

Query  547  CLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVR------  708
            C+IAD    F  ++A+K  +L + FWT  A  F  Y H   L   G+    D        
Sbjct  118  CVIADGVMSFAQRVAEKMGILALVFWTTSACGFMGYLHFSELIRRGYTPLKDESHLSNGY  177

Query  709  -EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHE  885
             +  I+++PG+  I +KD+ S+I+ T+             Q+A  A  V+ NT  ELEHE
Sbjct  178  LDTPIDWIPGMTGIRLKDIPSFIRTTDPNDTMLNFDGGEAQNAFKAWGVILNTFDELEHE  237

Query  886  TVAALQEK-TSFFTVGPIF  939
             + A++      +T+GP+ 
Sbjct  238  VIDAMKSMFPRLYTIGPLL  256



>gb|EYU34482.1| hypothetical protein MIMGU_mgv1a026087mg [Erythranthe guttata]
Length=364

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 86/131 (66%), Gaps = 1/131 (1%)
 Frame = +1

Query  580  GKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVREDAIEYVPGVRSIDVKD  759
            G +AKK+ L+ +SFWT PALVF+L YH  LL  NGHF C D   + I+YVPGV+ I  KD
Sbjct  15   GLVAKKHNLVNVSFWTGPALVFSLIYHSRLLAKNGHFPCKDNTVEEIDYVPGVQKISTKD  74

Query  760  LMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHETVAALQEKTSFFTVGPI-  936
            LM ++ E++ +++  +I+  +F+  + ADF+L NTVQELE ET++AL      + +GP+ 
Sbjct  75   LMPFMMESDDQSIITRILSVAFEQVKKADFILHNTVQELESETISALSNYQPNYAIGPVN  134

Query  937  FPPVFAQSAVA  969
            F      SA A
Sbjct  135  FSKNLPTSATA  145



>ref|XP_010040274.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   124 bits (312),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 85/265 (32%), Positives = 130/265 (49%), Gaps = 20/265 (8%)
 Frame = +1

Query  178  DSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFS  357
            D  QKPHA+ I YP QGHI P ++LA  L  +GF VTF+NT   H  L +S  R      
Sbjct  5    DMIQKPHALCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRS--RGPSSLD  62

Query  358  GIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSA----HVEEALKKILTSSAN  525
            G+       R+ TI DGLPP      +  Q + +L    S     +  + L+++   S  
Sbjct  63   GLPS----FRFRTIPDGLPPS--DVADATQDIPALCQSTSKFCLPYFRDLLERLNEESTT  116

Query  526  SGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDV  705
            SG PPV+C+++D    F    A+   +  + FWT  A  F  Y     L   G     D 
Sbjct  117  SGSPPVSCVVSDGVMSFTLDAAEAIGVPEVLFWTTSACGFMGYVQYRNLIDKGLTPLKDA  176

Query  706  R-------EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNT  864
                    +  I+++PG+R+I ++DL S+IQ T+ + +    + +  + A+ A  ++ NT
Sbjct  177  SYLTNAYLDTIIDWIPGMRNIRLRDLPSFIQTTDPDDLMIHFVLRETERAKRASAIVFNT  236

Query  865  VQELEHETVAALQEK-TSFFTVGPI  936
               LEHE + AL+    S  T+GP+
Sbjct  237  FDRLEHEVLDALKAMFPSICTLGPL  261



>gb|EYU18463.1| hypothetical protein MIMGU_mgv1a005662mg [Erythranthe guttata]
Length=475

 Score =   124 bits (311),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 86/269 (32%), Positives = 124/269 (46%), Gaps = 20/269 (7%)
 Frame = +1

Query  172  MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDI  351
            MA    KPHA+ + +P QGH+ P + LA  L  +GF +TF+NT   H  L KS       
Sbjct  1    MAAESYKPHAVFVPFPAQGHVNPMLKLAKLLHNRGFFITFVNTEYNHRRLLKSG-GGPAA  59

Query  352  FSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILT---SSA  522
             +G+     D R+ TI DGLPP      +  Q + SL    S    E L  +LT   SS 
Sbjct  60   LAGLP----DFRFATIPDGLPPS--ELEDSTQDIPSLCDYCSKTCLEPLCNLLTEINSSG  113

Query  523  NSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCID  702
             +G PPV C++ D F  F  K A+ + L    FWT  A  F  Y H   L   G     D
Sbjct  114  EAGVPPVTCIVTDGFMCFALKAAEAFSLPAAVFWTTSACGFLAYTHYKYLVEEGFAPLKD  173

Query  703  VR-------EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCN  861
            +        E  ++ V G++ I +KD  S+I+ T+ E +      +       A  ++ N
Sbjct  174  MNQISDGYLETTLDEVRGMKQIRLKDFPSFIRTTDPEDIMLNFCIQETDATHTAKAIIIN  233

Query  862  TVQELEHETVAALQEKTS---FFTVGPIF  939
            T   LE +T+ AL    +    +T+GP+ 
Sbjct  234  TFDALEQDTLHALSATYAPLPIYTIGPLL  262



>ref|XP_010060020.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   124 bits (310),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 85/265 (32%), Positives = 129/265 (49%), Gaps = 20/265 (8%)
 Frame = +1

Query  178  DSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFS  357
            D  QKPHA+ I YP QGHI P ++LA  L  +GF VTF+NT   H  L +S  R      
Sbjct  5    DMIQKPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRS--RGPSSLD  62

Query  358  GIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSA----HVEEALKKILTSSAN  525
            G+       R+ TI DGLPP      +  Q + +L    S     +  + L+++   S  
Sbjct  63   GLPS----FRFRTIPDGLPPS--DVADATQDIPALCQSTSKFCLPYFRDLLERLNEESTT  116

Query  526  SGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDV  705
            SG PPV+C+++D    F    A+   +  + FWT  A  F  Y     L   G     D 
Sbjct  117  SGSPPVSCVVSDGAMSFTLDAAEAIGVPEVLFWTTSACGFMGYVQYRNLVDKGLTPLKDA  176

Query  706  R-------EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNT  864
                    +  I+++PG+R+I ++DL S+IQ T  + +    + +  + A+ A  ++ NT
Sbjct  177  SYLTNGYLDTIIDWIPGMRNIRLRDLPSFIQTTNPDDLMIHFVLRETERAKRASAIVFNT  236

Query  865  VQELEHETVAALQEK-TSFFTVGPI  936
               LEHE + AL+    S  T+GP+
Sbjct  237  FDRLEHEVLDALKATFPSICTLGPL  261



>gb|KCW66541.1| hypothetical protein EUGRSUZ_F00338, partial [Eucalyptus grandis]
Length=478

 Score =   124 bits (310),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 82/264 (31%), Positives = 126/264 (48%), Gaps = 24/264 (9%)
 Frame = +1

Query  187  QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIR  366
            QKPHA+ I  P QGHI P ++LA  L  +GF VTF+NT   H  L +S  R      G+ 
Sbjct  8    QKPHAVCIPAPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRS--RGPSSLDGLP  65

Query  367  KPGLDIRYVTISDGLPPEWDRAVNHD--QFMASLLHIYSAHVEEALKKILTSSANSGGPP  540
                  R+ TI DGLPP     V  D      S   +   +  + L+++   SA SG PP
Sbjct  66   S----FRFRTIPDGLPPSDAADVTQDIPALCQSTSKLCLPYFRDLLQRLNEESAASGSPP  121

Query  541  VNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVR----  708
            V+C+++D    F    A+   +  + FWT  A  F  Y     L   G     D      
Sbjct  122  VSCVVSDGMMTFTLDAAEAIGVPEVLFWTASACGFMGYVQYRSLVDKGLTPLKDASYLTN  181

Query  709  ---EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELE  879
               +  I+++PG+R+I ++DL S+++ T+ + +      +  + A+ A  ++ NT   LE
Sbjct  182  GYLDTTIDWIPGMRNIRLRDLPSFLRTTDKDDLMIDFCLRETKRAKRASAIVFNTFDRLE  241

Query  880  HETVAALQEKTSFFTVGPIFPPVF  951
            HE + AL+          IFPP++
Sbjct  242  HEVLDALKA---------IFPPIY  256



>gb|AIL51400.1| glycosyltransferase [Actinidia deliciosa]
Length=484

 Score =   124 bits (310),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 80/268 (30%), Positives = 132/268 (49%), Gaps = 22/268 (8%)
 Frame = +1

Query  172  MADSG--QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDD  345
            M  +G  +KPHA+ + YP QGHI P + LA  L  KGF VTF+NT   H  L KS  R  
Sbjct  1    MGSAGMPEKPHAVCLPYPAQGHITPMLKLAKLLHSKGFHVTFVNTEFNHKRLLKS--RGP  58

Query  346  DIFSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKI---LTS  516
            D  +G+       R+ TI DGLP   +  ++  QF+ SL      +     +++   L +
Sbjct  59   DSLTGLS----SFRFETIPDGLP---ESDLDATQFIPSLCESTRKNCLGPFRQLLGKLNN  111

Query  517  SANSGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGC  696
            + +SG PPV+C+++D    F    A++  +  + FWT     F  Y H   L   G+   
Sbjct  112  TVSSGVPPVSCVVSDGVMSFSLDAAEELGIPQVLFWTTSVCGFMAYVHYRNLIEKGYTPL  171

Query  697  IDVR-------EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVL  855
             DV        +  I+++PG+  I +KDL S+++ T+   +    +    ++   +  ++
Sbjct  172  KDVSYVTNGYLDTVIDWIPGMEGIRLKDLPSFLRTTDPNDIMLDFVLSETKNTHRSSAII  231

Query  856  CNTVQELEHETVAALQEK-TSFFTVGPI  936
             NT  +LEH+ +  L       +T+GP+
Sbjct  232  FNTFDKLEHQVLEPLASMFPPIYTIGPL  259



>ref|XP_010060017.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   124 bits (310),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 82/264 (31%), Positives = 126/264 (48%), Gaps = 24/264 (9%)
 Frame = +1

Query  187  QKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIR  366
            QKPHA+ I  P QGHI P ++LA  L  +GF VTF+NT   H  L +S  R      G+ 
Sbjct  8    QKPHAVCIPAPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRS--RGPSSLDGLP  65

Query  367  KPGLDIRYVTISDGLPPEWDRAVNHD--QFMASLLHIYSAHVEEALKKILTSSANSGGPP  540
                  R+ TI DGLPP     V  D      S   +   +  + L+++   SA SG PP
Sbjct  66   S----FRFRTIPDGLPPSDAADVTQDIPALCQSTSKLCLPYFRDLLQRLNEESAASGSPP  121

Query  541  VNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVR----  708
            V+C+++D    F    A+   +  + FWT  A  F  Y     L   G     D      
Sbjct  122  VSCVVSDGMMTFTLDAAEAIGVPEVLFWTASACGFMGYVQYRSLVDKGLTPLKDASYLTN  181

Query  709  ---EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELE  879
               +  I+++PG+R+I ++DL S+++ T+ + +      +  + A+ A  ++ NT   LE
Sbjct  182  GYLDTTIDWIPGMRNIRLRDLPSFLRTTDKDDLMIDFCLRETKRAKRASAIVFNTFDRLE  241

Query  880  HETVAALQEKTSFFTVGPIFPPVF  951
            HE + AL+          IFPP++
Sbjct  242  HEVLDALKA---------IFPPIY  256



>gb|EMT18349.1| Cytokinin-O-glucosyltransferase 2 [Aegilops tauschii]
Length=596

 Score =   124 bits (312),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 84/278 (30%), Positives = 135/278 (49%), Gaps = 21/278 (8%)
 Frame = +1

Query  172  MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDI  351
            M  + +KPHA+ + YP QGHI P +++A  L  +GF VTF+NT   H  L +S  R    
Sbjct  1    MGPAAEKPHAVCLPYPAQGHITPMLNVAKLLHARGFDVTFVNTEYNHARLVRS--RGLAA  58

Query  352  FSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILT--SSAN  525
             +G+  PG   R+ TI DGLPP  D  V  D  + +L    +       + +L   +   
Sbjct  59   VAGL--PGF--RFATIPDGLPPSDDDDVTQD--IPALCKSTTETCLGPFRSLLARLNDPA  112

Query  526  SGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDV  705
            +G PPV C+++D    F  + A +  L Y+  WT  A+ +  Y H  LL   G     D 
Sbjct  113  AGHPPVTCVVSDVVMGFSMEAANELGLTYVQLWTASAISYLGYRHYRLLIGRGIVPLKDA  172

Query  706  RE-------DAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNT  864
             +         +E VPG+RS+ ++D  S+I+ T+ +      + +  +    A  V+ N+
Sbjct  173  EQLTNGYLDTPVEDVPGLRSMRLRDFPSFIRTTDPDEYIVHYVLRETERTAGASAVILNS  232

Query  865  VQELEHETVAALQE--KTSFFTVGPIFPPVFAQSAVAT  972
              +LE E V A++       +T+GP+  P+ A+    T
Sbjct  233  FADLEGEAVDAMEALGLAKVYTLGPL--PLLAREEPPT  268



>ref|XP_002268637.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
 emb|CAN71907.1| hypothetical protein VITISV_038672 [Vitis vinifera]
Length=482

 Score =   123 bits (309),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 82/265 (31%), Positives = 127/265 (48%), Gaps = 24/265 (9%)
 Frame = +1

Query  178  DSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFS  357
            ++ +KPH + + +P QGH+IP + LA  L  KGF +TF+NT   H  L +S  + +D   
Sbjct  5    NTTRKPHIVCVPFPAQGHVIPMMQLAKLLHSKGFCITFVNTEFNHRRLVRS--KGEDWAK  62

Query  358  GIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGG-  534
            G      D  + TISDGLPP    A  +      L +    H     + +L    +S   
Sbjct  63   GFD----DFWFETISDGLPPSNPDATQNPTM---LCYHVPKHCLAPFRHLLAKLNSSPEV  115

Query  535  PPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHF--------  690
            PPV C+I+D    F  K A++  +  + FWT  A  F  Y H   L   G F        
Sbjct  116  PPVTCIISDGIMSFALKAAEELGIPEVQFWTASACGFMAYLHHAELIQKGIFPFKDENFM  175

Query  691  --GCIDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNT  864
              G +D R   ++++PG+R+I +KDL S+I+ T+   +         Q+   A  ++ NT
Sbjct  176  SDGTLDTR---VDWIPGMRNIRLKDLPSFIRTTDPNHIMFHFARTETQNCLKASAIIFNT  232

Query  865  VQELEHETVAALQEK-TSFFTVGPI  936
                EHE + A+  K    +T+GP+
Sbjct  233  FDAFEHEVLEAIASKFPHIYTIGPL  257



>ref|XP_010060023.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW66547.1| hypothetical protein EUGRSUZ_F00343 [Eucalyptus grandis]
Length=486

 Score =   123 bits (308),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 84/265 (32%), Positives = 129/265 (49%), Gaps = 20/265 (8%)
 Frame = +1

Query  178  DSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFS  357
            D  QKPHA+ I YP QGHI P ++LA  L  +GF VTF+NT   H  L +S  R      
Sbjct  5    DKIQKPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRS--RGPSSLD  62

Query  358  GIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSA----HVEEALKKILTSSAN  525
            G+       R+ TI DGLPP      +  Q + +L    S     +  + L+++   S  
Sbjct  63   GLPS----FRFRTIPDGLPPS--DVADATQDIPALCQSTSKFCLPYFRDLLERLNEESTT  116

Query  526  SGGPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDV  705
             G PPV+C+++D    F    A+   +  + FWT  A  F  Y     L   G     D 
Sbjct  117  LGSPPVSCVVSDGVMSFTLDAAEAIGVPEVLFWTTSACGFMGYVQYRNLIDKGLTPLKDA  176

Query  706  R-------EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNT  864
                    +  I+++PG+R+I ++DL S+IQ T+ + +    + +  + A+ A  ++ NT
Sbjct  177  SYLTNGYLDTIIDWIPGMRNIQLRDLPSFIQTTDPDDLMIHFVLRETERAKRASAIVFNT  236

Query  865  VQELEHETVAALQEK-TSFFTVGPI  936
               LEHE + AL+    S  T+GP+
Sbjct  237  FDRLEHEVLDALKAMFPSICTLGPL  261



>gb|ABR16342.1| unknown [Picea sitchensis]
Length=476

 Score =   123 bits (308),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 81/264 (31%), Positives = 131/264 (50%), Gaps = 21/264 (8%)
 Frame = +1

Query  172  MADSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDI  351
            MA   ++PHA+++ +P QG I   + LA  L  +GF +TF+NT  V   +++S       
Sbjct  1    MALLNKRPHAVMLPFPAQGPINAMMQLAQILYARGFYITFVNTQYVQERISRSGS-----  55

Query  352  FSGIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSG  531
               ++ P  D R+ T+ DGLPPE  R     +   S       + ++ + K L  S   G
Sbjct  56   VESVKSPP-DFRFETLPDGLPPEHGRTSKLAELSRSFTDNGPPYFDKLMDK-LKHSQPDG  113

Query  532  GPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVR-  708
             PPV C+++D    FP K+A+K  +  +SFWT  A  F+ Y+   LL   G+    D R 
Sbjct  114  VPPVTCIVSDGLVSFPQKIARKLGVPRVSFWTHSACGFSTYFFAPLLVEKGYIPLKDERC  173

Query  709  ------EDAIEYVPGVRSIDVKDL-MSYIQETETETVCHQIIYKSFQDARNADFVLCNTV  867
                  E  I  +PG+  + +KDL  S ++    E V  +      Q A  AD +L NT 
Sbjct  174  LTNGYMEQIIPSIPGLPHLRIKDLSFSLLRMNMLEFVKSE-----GQAALEADLILLNTF  228

Query  868  QELEHETVAALQEK-TSFFTVGPI  936
            ++L+   + AL+++    +T+GP+
Sbjct  229  EDLDRPVIDALRDRLPPLYTIGPL  252



>gb|EAY87578.1| hypothetical protein OsI_08989 [Oryza sativa Indica Group]
Length=486

 Score =   123 bits (308),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 87/274 (32%), Positives = 135/274 (49%), Gaps = 20/274 (7%)
 Frame = +1

Query  181  SGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSG  360
            S  + HA+LI YP QGH+ P +HLA  L  +GF VTF+N+   H  L +S  R     +G
Sbjct  3    SNSRLHAVLIPYPAQGHVTPLLHLAKVLHSRGFHVTFVNSEYNHRRLLRS--RGTGALAG  60

Query  361  IRKPGLDIRYVTISDGLPPEWDRAVNHD--QFMASLLHIYSAHVEEALKKILTS-SANSG  531
            +     D R+ TI DGLPP    + N D  Q + ++   +  H   A   +L   ++  G
Sbjct  61   LD----DFRFETIPDGLPPP-SESDNDDVTQDIPTVCTSFLTHGPAAFGALLARLNSEPG  115

Query  532  GPPVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVR-  708
             PPV+C+I D    F  ++A    +L  +FWT  A  F  Y H   L   G+    D   
Sbjct  116  TPPVSCVIPDGVMSFAQRVASDMGILAPAFWTTSACGFMGYLHYAELIDRGYVPLKDESY  175

Query  709  ------EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQ  870
                  +  +++VPG+  I ++D+ S+I+ T+ +           Q+AR+A  ++ NT  
Sbjct  176  LTNGYLDTVLDWVPGMPGIRLRDMPSFIRTTDRDEFMLNFDSGEAQNARHAQGLILNTFD  235

Query  871  ELEHETVAALQEK-TSFFTVGPIFPPVFAQSAVA  969
             +E + V AL+      +TVGP+    FA +A A
Sbjct  236  AVEDDVVDALRRIFPRVYTVGPLL--TFAGAAAA  267



>ref|XP_008811180.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Phoenix dactylifera]
Length=484

 Score =   122 bits (307),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 84/259 (32%), Positives = 126/259 (49%), Gaps = 18/259 (7%)
 Frame = +1

Query  190  KPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFSGIRK  369
            +PHA+LI  P QGH+ P + LA  L  KGF +T++N+   H  L +S  R  D   G+  
Sbjct  6    RPHAVLIPQPAQGHVTPMLQLAKVLHSKGFYITYVNSEYNHKRLLRS--RGPDSLDGLE-  62

Query  370  PGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGG-PPVN  546
               D R+  I DGLP   D  V  D  +A L    + +     + +L     S G PPV+
Sbjct  63   ---DFRFEAIPDGLPQS-DDDVTQD--IAELCISTTKNSLVPFRDLLVRLNRSPGVPPVS  116

Query  547  CLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHFGCIDVR------  708
            C+IAD    F  ++A+K  +L + FWT  A  F  Y H   L   G+    D        
Sbjct  117  CVIADGVMSFAQRVAEKMGILALVFWTTSACGFMGYLHFSELIRRGYTPLEDESYLTNGY  176

Query  709  -EDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTVQELEHE  885
             +  IE++PG+  I +KD+ S+I+ T+             Q+A  A  V+ NT  ELE+E
Sbjct  177  LDTPIEWIPGMTGIRLKDIPSFIRTTDRNDTMLNFDGGEAQNALKAWGVILNTFDELEYE  236

Query  886  TVAALQEK-TSFFTVGPIF  939
             + A++      +T+GP+ 
Sbjct  237  VIDAMKRMFPRLYTIGPLL  255



>ref|XP_004235064.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=479

 Score =   122 bits (307),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 78/268 (29%), Positives = 130/268 (49%), Gaps = 25/268 (9%)
 Frame = +1

Query  178  DSGQKPHAILISYPLQGHIIPSVHLACRLAEKGFTVTFINTHSVHYHLTKSNPRDDDIFS  357
            +  +KPHA+L+ YP QGH+ P + LA  L  +GF +TF+NT   H  L +S   D     
Sbjct  5    NEARKPHAVLLPYPSQGHVTPMMSLAKLLHSRGFHITFVNTEFNHKRLIQSKGVDS----  60

Query  358  GIRKPGLDIRYVTISDGLPPEWDRAVNHDQFMASLLHIYSAHVEEALKKILTSSANSGGP  537
               K  LD ++ TI+DG+P   + A    Q +  L            KK+LT   +   P
Sbjct  61   --VKGLLDFKFATITDGMPASDENAT---QDITLLCDTTRKTCLVPFKKLLTKLNSGEVP  115

Query  538  PVNCLIADTFFVFPGKLAKKYKLLYISFWTEPALVFTLYYHLHLLRLNGHF---------  690
            PV+C+I+D    F  + A+   +  ++FWT     F  Y H   L   G F         
Sbjct  116  PVSCVISDGVMTFGIRAAQDLGIPDVTFWTASVCAFVGYLHYRQLIKRGIFPFKNDNYLI  175

Query  691  -GCIDVREDAIEYVPGVRSIDVKDLMSYIQETETETVCHQIIYKSFQDARNADFVLCNTV  867
             G +D     I+++PG++ + +KDL S+++ T+   +    + +  Q+   A  ++ NT 
Sbjct  176  DGTLDT---PIDWIPGMKDVKLKDLPSFLRTTDPNDIMFDFMGEEAQNCLKASAIMFNTF  232

Query  868  QELEHETVAALQEKTSF---FTVGPIFP  942
            +ELE E +  +    +F   +++GP+ P
Sbjct  233  EELEPELLQTIVSNFNFYNIYSIGPLGP  260



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2761034754820