BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13354_g1_i2 len=1524 path=[3210:0-80 @145@!:81-786 851:787-1523]

Length=1524
                                                                      Score     E

ref|XP_009783889.1|  PREDICTED: hexose carrier protein HEX6-like        720   0.0      
emb|CDO96746.1|  unnamed protein product                                688   0.0      
ref|XP_006358234.1|  PREDICTED: hexose carrier protein HEX6-like        687   0.0      
ref|XP_011076399.1|  PREDICTED: hexose carrier protein HEX6-like        674   0.0      
gb|KDP22452.1|  hypothetical protein JCGZ_26283                         671   0.0      
ref|XP_002510991.1|  sugar transporter, putative                        670   0.0      Ricinus communis
sp|Q07423.1|HEX6_RICCO  RecName: Full=Hexose carrier protein HEX6       669   0.0      Ricinus communis
ref|XP_007219546.1|  hypothetical protein PRUPE_ppa004465mg             669   0.0      
ref|XP_008234428.1|  PREDICTED: hexose carrier protein HEX6-like        667   0.0      
ref|XP_007038321.1|  Major facilitator superfamily protein              664   0.0      
gb|KDP22450.1|  hypothetical protein JCGZ_26281                         663   0.0      
ref|XP_008367298.1|  PREDICTED: LOW QUALITY PROTEIN: hexose carri...    662   0.0      
emb|CDP05363.1|  unnamed protein product                                660   0.0      
ref|XP_009362698.1|  PREDICTED: hexose carrier protein HEX6-like        658   0.0      
ref|XP_010275368.1|  PREDICTED: hexose carrier protein HEX6             656   0.0      
ref|XP_011046852.1|  PREDICTED: hexose carrier protein HEX6             654   0.0      
ref|XP_006421607.1|  hypothetical protein CICLE_v10004775mg             654   0.0      
ref|XP_007038318.1|  Major facilitator superfamily protein              652   0.0      
gb|AFO84095.1|  hexose transport protein                                652   0.0      
ref|XP_006490155.1|  PREDICTED: hexose carrier protein HEX6-like        652   0.0      
ref|XP_003598178.1|  Hexose carrier                                     647   0.0      
gb|KCW46315.1|  hypothetical protein EUGRSUZ_K00178                     647   0.0      
ref|XP_004309029.1|  PREDICTED: hexose carrier protein HEX6-like        645   0.0      
ref|NP_001268206.1|  hexose transporter-like                            644   0.0      
gb|ADP37128.1|  hexose transporter                                      644   0.0      
ref|XP_010035050.1|  PREDICTED: hexose carrier protein HEX6-like ...    647   0.0      
ref|XP_006385129.1|  hypothetical protein POPTR_0004s24170g             643   0.0      
emb|CAN72462.1|  hypothetical protein VITISV_025873                     643   0.0      Vitis vinifera
ref|XP_011028472.1|  PREDICTED: hexose carrier protein HEX6-like ...    642   0.0      
ref|XP_010035048.1|  PREDICTED: hexose carrier protein HEX6-like ...    647   0.0      
ref|XP_007038317.1|  Major facilitator superfamily protein, putative    641   0.0      
gb|EYU20201.1|  hypothetical protein MIMGU_mgv1a005029mg                640   0.0      
gb|KDP22453.1|  hypothetical protein JCGZ_26284                         640   0.0      
gb|KEH32841.1|  sugar porter (SP) family MFS transporter                638   0.0      
ref|XP_009370442.1|  PREDICTED: hexose carrier protein HEX6-like        640   0.0      
ref|XP_002323002.1|  hypothetical protein POPTR_0016s12820g             639   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006421592.1|  hypothetical protein CICLE_v10004779mg             639   0.0      
ref|XP_009372848.1|  PREDICTED: hexose carrier protein HEX6-like        637   0.0      
ref|XP_007148729.1|  hypothetical protein PHAVU_005G009500g             637   0.0      
gb|KCW46317.1|  hypothetical protein EUGRSUZ_K00179                     637   0.0      
ref|XP_010035051.1|  PREDICTED: hexose carrier protein HEX6-like        636   0.0      
ref|XP_004309027.1|  PREDICTED: hexose carrier protein HEX6-like        635   0.0      
gb|KCW90864.1|  hypothetical protein EUGRSUZ_A02911                     635   0.0      
ref|XP_011028473.1|  PREDICTED: hexose carrier protein HEX6-like ...    632   0.0      
ref|XP_010062447.1|  PREDICTED: hexose carrier protein HEX6-like        634   0.0      
ref|XP_008453891.1|  PREDICTED: hexose carrier protein HEX6 isofo...    634   0.0      
ref|XP_004287421.1|  PREDICTED: hexose carrier protein HEX6-like        632   0.0      
ref|XP_007219184.1|  hypothetical protein PRUPE_ppa016853mg             632   0.0      
ref|XP_006490161.1|  PREDICTED: hexose carrier protein HEX6-like        632   0.0      
ref|XP_008376389.1|  PREDICTED: LOW QUALITY PROTEIN: hexose carri...    631   0.0      
ref|XP_004146943.1|  PREDICTED: hexose carrier protein HEX6-like        630   0.0      
ref|XP_008234427.1|  PREDICTED: hexose carrier protein HEX6-like        629   0.0      
ref|XP_004171208.1|  PREDICTED: LOW QUALITY PROTEIN: hexose carri...    629   0.0      
ref|XP_008234426.1|  PREDICTED: hexose carrier protein HEX6-like        627   0.0      
ref|XP_006358233.1|  PREDICTED: hexose carrier protein HEX6-like        627   0.0      
ref|XP_010934655.1|  PREDICTED: hexose carrier protein HEX6-like        627   0.0      
emb|CDP05360.1|  unnamed protein product                                625   0.0      
ref|XP_007219614.1|  hypothetical protein PRUPE_ppa023229mg             626   0.0      
ref|XP_006490159.1|  PREDICTED: hexose carrier protein HEX6-like        626   0.0      
ref|XP_003598179.1|  Hexose carrier protein HEX6                        625   0.0      
ref|XP_006490156.1|  PREDICTED: hexose carrier protein HEX6-like        625   0.0      
ref|XP_004235176.1|  PREDICTED: hexose carrier protein HEX6             625   0.0      
ref|XP_006421591.1|  hypothetical protein CICLE_v10006672mg             624   0.0      
ref|XP_006421606.1|  hypothetical protein CICLE_v10004781mg             624   0.0      
ref|XP_006837317.1|  hypothetical protein AMTR_s00111p00066720          624   0.0      
gb|KDO49971.1|  hypothetical protein CISIN_1g010323mg                   622   0.0      
gb|EYU20200.1|  hypothetical protein MIMGU_mgv1a004758mg                621   0.0      
ref|XP_006490163.1|  PREDICTED: hexose carrier protein HEX6-like ...    621   0.0      
ref|XP_006490160.1|  PREDICTED: hexose carrier protein HEX6-like        620   0.0      
ref|XP_003526372.1|  PREDICTED: hexose carrier protein HEX6-like        620   0.0      
ref|XP_006421598.1|  hypothetical protein CICLE_v10006632mg             619   0.0      
ref|XP_004499623.1|  PREDICTED: LOW QUALITY PROTEIN: hexose carri...    619   0.0      
ref|XP_008775188.1|  PREDICTED: hexose carrier protein HEX6-like        618   0.0      
ref|XP_006490162.1|  PREDICTED: hexose carrier protein HEX6-like ...    618   0.0      
ref|XP_006421597.1|  hypothetical protein CICLE_v10006871mg             618   0.0      
ref|XP_006421604.1|  hypothetical protein CICLE_v10004764mg             617   0.0      
ref|XP_006490157.1|  PREDICTED: hexose carrier protein HEX6-like ...    616   0.0      
ref|XP_009783890.1|  PREDICTED: hexose carrier protein HEX6-like        616   0.0      
ref|XP_009628001.1|  PREDICTED: hexose carrier protein HEX6-like        615   0.0      
ref|XP_003527549.1|  PREDICTED: hexose carrier protein HEX6-like ...    613   0.0      
ref|XP_006421603.1|  hypothetical protein CICLE_v10004798mg             613   0.0      
ref|XP_007148727.1|  hypothetical protein PHAVU_005G009300g             612   0.0      
ref|XP_006490158.1|  PREDICTED: hexose carrier protein HEX6-like ...    607   0.0      
gb|KDO49972.1|  hypothetical protein CISIN_1g012438mg                   606   0.0      
ref|XP_006421601.1|  hypothetical protein CICLE_v10004936mg             604   0.0      
ref|XP_011076401.1|  PREDICTED: hexose carrier protein HEX6-like        605   0.0      
ref|XP_006582411.1|  PREDICTED: hexose carrier protein HEX6-like ...    603   0.0      
gb|KDO45292.1|  hypothetical protein CISIN_1g048207mg                   600   0.0      
emb|CDP05362.1|  unnamed protein product                                602   0.0      
gb|EYU20198.1|  hypothetical protein MIMGU_mgv1a004584mg                601   0.0      
ref|XP_006421594.1|  hypothetical protein CICLE_v10006533mg             599   0.0      
ref|XP_011076415.1|  PREDICTED: hexose carrier protein HEX6-like        600   0.0      
ref|XP_007148728.1|  hypothetical protein PHAVU_005G009400g             600   0.0      
ref|XP_011076414.1|  PREDICTED: hexose carrier protein HEX6-like        599   0.0      
ref|XP_010678286.1|  PREDICTED: hexose carrier protein HEX6 isofo...    597   0.0      
ref|XP_010678285.1|  PREDICTED: hexose carrier protein HEX6 isofo...    598   0.0      
ref|XP_004146944.1|  PREDICTED: hexose carrier protein HEX6-like        597   0.0      
ref|XP_008803828.1|  PREDICTED: hexose carrier protein HEX6-like        596   0.0      
ref|XP_011076405.1|  PREDICTED: hexose carrier protein HEX6-like        594   0.0      
ref|XP_004171207.1|  PREDICTED: LOW QUALITY PROTEIN: hexose carri...    591   0.0      
ref|XP_011076417.1|  PREDICTED: hexose carrier protein HEX6-like        589   0.0      
ref|XP_006421596.1|  hypothetical protein CICLE_v10006610mg             585   0.0      
ref|XP_004986088.1|  PREDICTED: hexose carrier protein HEX6-like        585   0.0      
ref|XP_011076406.1|  PREDICTED: hexose carrier protein HEX6-like        583   0.0      
gb|KHN26456.1|  Hexose carrier protein HEX6                             580   0.0      
ref|XP_011076520.1|  PREDICTED: hexose carrier protein HEX6-like        576   0.0      
ref|XP_011076404.1|  PREDICTED: hexose carrier protein HEX6-like        575   0.0      
ref|XP_010919657.1|  PREDICTED: hexose carrier protein HEX6-like ...    574   0.0      
ref|XP_009407139.1|  PREDICTED: hexose carrier protein HEX6 isofo...    574   0.0      
ref|XP_011076407.1|  PREDICTED: hexose carrier protein HEX6-like ...    573   0.0      
ref|XP_009407138.1|  PREDICTED: hexose carrier protein HEX6 isofo...    574   0.0      
ref|XP_008454476.1|  PREDICTED: hexose carrier protein HEX6-like        568   0.0      
ref|XP_011076410.1|  PREDICTED: hexose carrier protein HEX6-like        566   0.0      
ref|XP_009417127.1|  PREDICTED: hexose carrier protein HEX6-like        566   0.0      
ref|XP_009374462.1|  PREDICTED: hexose carrier protein HEX6-like        564   0.0      
emb|CDP05361.1|  unnamed protein product                                564   0.0      
ref|XP_010679174.1|  PREDICTED: hexose carrier protein HEX6-like        565   0.0      
ref|XP_010546155.1|  PREDICTED: sugar transport protein 3               563   0.0      
ref|NP_001149551.1|  hexose carrier protein HEX6                        560   0.0      Zea mays [maize]
ref|NP_001065385.1|  Os10g0561300                                       556   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_011076412.1|  PREDICTED: hexose carrier protein HEX6-like        554   0.0      
ref|XP_008453892.1|  PREDICTED: hexose carrier protein HEX6 isofo...    552   0.0      
ref|XP_006650945.1|  PREDICTED: hexose carrier protein HEX6-like        556   0.0      
gb|KCW46316.1|  hypothetical protein EUGRSUZ_K00178                     551   0.0      
ref|XP_009412437.1|  PREDICTED: sugar carrier protein C-like            553   0.0      
ref|XP_011076411.1|  PREDICTED: hexose carrier protein HEX6-like        551   0.0      
ref|XP_009418748.1|  PREDICTED: sugar carrier protein C-like            552   0.0      
ref|XP_009388857.1|  PREDICTED: sugar carrier protein C-like            552   0.0      
ref|XP_009407859.1|  PREDICTED: hexose carrier protein HEX6-like        551   0.0      
ref|XP_008812644.1|  PREDICTED: sugar carrier protein C-like            551   0.0      
gb|ABG66260.1|  Hexose carrier protein HEX6, putative, expressed        547   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006662062.1|  PREDICTED: hexose carrier protein HEX6-like        546   0.0      
gb|AFW85928.1|  hexose carrier protein HEX6                             546   0.0      
gb|ACL36483.1|  hexose carrier                                          545   0.0      Aegilops tauschii
ref|XP_010905889.1|  PREDICTED: sugar carrier protein C-like            545   0.0      
gb|EPS64704.1|  hypothetical protein M569_10076                         540   0.0      
gb|ADK62367.1|  hexose carrier                                          543   0.0      
ref|XP_009416065.1|  PREDICTED: sugar carrier protein C-like            543   0.0      
ref|XP_010936607.1|  PREDICTED: sugar carrier protein C-like            541   0.0      
gb|ACL36477.1|  hexose transporter                                      541   0.0      Triticum aestivum [Canadian hard winter wheat]
ref|XP_009402797.1|  PREDICTED: sugar carrier protein C-like            540   0.0      
gb|EMS51881.1|  Hexose carrier protein HEX6                             539   0.0      
ref|NP_001062724.1|  Os09g0268300                                       538   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_009385295.1|  PREDICTED: sugar carrier protein C-like            538   0.0      
ref|XP_003559033.1|  PREDICTED: hexose carrier protein HEX6             538   0.0      
gb|ACN35012.1|  unknown                                                 537   0.0      Zea mays [maize]
ref|XP_010904882.1|  PREDICTED: sugar carrier protein C-like            538   0.0      
ref|XP_010905564.1|  PREDICTED: sugar carrier protein C-like            537   0.0      
gb|EEC84216.1|  hypothetical protein OsI_30627                          536   0.0      Oryza sativa Indica Group [Indian rice]
gb|EPS60332.1|  hypothetical protein M569_14469                         534   0.0      
gb|ACF85014.1|  unknown                                                 531   0.0      Zea mays [maize]
ref|NP_001105681.1|  monosaccharide transporter1                        533   0.0      Zea mays [maize]
gb|ACN34678.1|  unknown                                                 533   0.0      Zea mays [maize]
ref|NP_001048652.1|  Os03g0101300                                       533   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|ADK62370.1|  hexose carrier                                          532   0.0      
ref|NP_001058832.1|  Os07g0131600                                       533   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EAZ02666.1|  hypothetical protein OsI_24778                          532   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_007038316.1|  Major facilitator superfamily protein, putative    529   0.0      
dbj|BAJ90307.1|  predicted protein                                      531   0.0      
ref|XP_009385289.1|  PREDICTED: sugar carrier protein C-like            530   0.0      
dbj|BAJ85833.1|  predicted protein                                      530   0.0      
ref|XP_004983651.1|  PREDICTED: hexose carrier protein HEX6-like        528   3e-180   
ref|XP_008800390.1|  PREDICTED: sugar carrier protein C-like            528   3e-180   
ref|XP_010268857.1|  PREDICTED: sugar carrier protein C-like            528   4e-180   
ref|XP_002437798.1|  hypothetical protein SORBIDRAFT_10g002770          526   2e-179   Sorghum bicolor [broomcorn]
ref|XP_008351458.1|  PREDICTED: LOW QUALITY PROTEIN: hexose carri...    520   5e-179   
ref|XP_004955303.1|  PREDICTED: sugar carrier protein C-like isof...    525   9e-179   
gb|EMS50017.1|  Hexose carrier protein HEX6                             523   1e-178   
ref|NP_001058704.1|  Os07g0106200                                       525   1e-178   Oryza sativa Japonica Group [Japonica rice]
gb|EMT31642.1|  Sugar carrier protein C                                 524   2e-178   
ref|XP_008797206.1|  PREDICTED: sugar transport protein 4-like          523   2e-178   
ref|XP_006661064.1|  PREDICTED: hexose carrier protein HEX6-like        524   2e-178   
gb|EMS66971.1|  Sugar carrier protein C                                 524   3e-178   
ref|XP_008441746.1|  PREDICTED: sugar transport protein 10-like         523   3e-178   
gb|ABK24644.1|  unknown                                                 523   5e-178   Picea sitchensis
ref|XP_008793638.1|  PREDICTED: sugar carrier protein C-like            522   9e-178   
ref|XP_003574336.1|  PREDICTED: hexose carrier protein HEX6-like        522   1e-177   
gb|EMT12033.1|  Hexose carrier protein HEX6                             525   7e-177   
ref|XP_007013711.1|  Sugar transporter protein 7 isoform 1              520   8e-177   
ref|XP_003563688.1|  PREDICTED: hexose carrier protein HEX6-like        520   9e-177   
ref|XP_002452988.1|  hypothetical protein SORBIDRAFT_04g036140          520   2e-176   Sorghum bicolor [broomcorn]
ref|XP_010277922.1|  PREDICTED: sugar carrier protein C                 519   2e-176   
gb|EMT33361.1|  Hexose carrier protein HEX6                             520   3e-176   
dbj|BAK07271.1|  predicted protein                                      518   4e-176   
ref|XP_010483824.1|  PREDICTED: sugar transport protein 3               518   5e-176   
ref|XP_002969912.1|  hypothetical protein SELMODRAFT_170916             518   5e-176   
dbj|BAJ89694.1|  predicted protein                                      518   6e-176   
gb|EMT27396.1|  Sugar transport protein 1                               517   7e-176   
ref|XP_006658204.1|  PREDICTED: sugar carrier protein C-like            518   7e-176   
gb|AAQ24872.1|  monosaccharide transporter 6                            518   7e-176   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002467490.1|  hypothetical protein SORBIDRAFT_01g029030          517   8e-176   Sorghum bicolor [broomcorn]
dbj|BAJ94378.1|  predicted protein                                      517   9e-176   
gb|KHG17738.1|  Sugar transport 7 -like protein                         517   1e-175   
ref|XP_003557694.1|  PREDICTED: LOW QUALITY PROTEIN: sugar carrie...    516   1e-175   
ref|XP_004955304.1|  PREDICTED: sugar carrier protein C-like isof...    514   3e-175   
ref|XP_002981389.1|  hypothetical protein SELMODRAFT_154400             516   3e-175   
ref|XP_010112199.1|  Sugar transport protein 7                          515   4e-175   
ref|XP_006396402.1|  hypothetical protein EUTSA_v10028576mg             515   6e-175   
ref|NP_192114.1|  sugar transport protein 7                             514   7e-175   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010106347.1|  Sugar transport protein 7                          514   9e-175   
ref|XP_008441745.1|  PREDICTED: sugar transport protein 10-like         514   9e-175   
ref|XP_008336926.1|  PREDICTED: sugar transport protein 7 isoform X2    514   1e-174   
ref|NP_001145934.1|  monosaccharide transport protein 2                 514   1e-174   Zea mays [maize]
ref|XP_010422647.1|  PREDICTED: sugar transport protein 7               514   1e-174   
ref|XP_008670623.1|  PREDICTED: sugar transport protein 1-like          514   2e-174   
ref|NP_001141959.1|  uncharacterized protein LOC100274108               514   2e-174   Zea mays [maize]
ref|XP_008811880.1|  PREDICTED: sugar transport protein 1-like          514   2e-174   
ref|XP_010457418.1|  PREDICTED: sugar transport protein 3-like          513   2e-174   
ref|XP_009338427.1|  PREDICTED: sugar carrier protein A-like            514   2e-174   
ref|XP_010456090.1|  PREDICTED: sugar transport protein 7-like          513   2e-174   
gb|EMS67764.1|  Sugar carrier protein C                                 513   2e-174   
gb|ACG38482.1|  sugar carrier protein A                                 514   2e-174   Zea mays [maize]
gb|ABK24474.1|  unknown                                                 513   2e-174   Picea sitchensis
ref|XP_004146734.1|  PREDICTED: sugar transport protein 7-like          513   2e-174   
ref|XP_002443949.1|  hypothetical protein SORBIDRAFT_07g004950          513   3e-174   Sorghum bicolor [broomcorn]
ref|XP_009358503.1|  PREDICTED: sugar carrier protein A-like            513   3e-174   
ref|XP_002872859.1|  hypothetical protein ARALYDRAFT_327595             513   3e-174   
gb|EAZ05797.1|  hypothetical protein OsI_28032                          513   4e-174   Oryza sativa Indica Group [Indian rice]
ref|NP_001061127.1|  Os08g0178200                                       513   4e-174   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008336925.1|  PREDICTED: sugar transport protein 7 isoform X1    515   5e-174   
ref|NP_001043369.1|  Os01g0567500                                       513   5e-174   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008675375.1|  PREDICTED: sugar transport protein 1-like          512   5e-174   
ref|XP_009397582.1|  PREDICTED: sugar transport protein 10-like         515   5e-174   
emb|CDY07098.1|  BnaCnng01130D                                          512   5e-174   
tpg|DAA61441.1|  TPA: sugar carrier protein A                           511   7e-174   
ref|XP_010687752.1|  PREDICTED: sugar transport protein 7               512   9e-174   
ref|XP_008443895.1|  PREDICTED: sugar transport protein 7               512   1e-173   
ref|XP_009134451.1|  PREDICTED: sugar transport protein 7               512   1e-173   
ref|XP_008798484.1|  PREDICTED: sugar transport protein 10-like         511   1e-173   
ref|XP_010918337.1|  PREDICTED: sugar carrier protein C-like            511   1e-173   
ref|XP_010429078.1|  PREDICTED: sugar transport protein 7-like          511   2e-173   
ref|XP_006366202.1|  PREDICTED: sugar carrier protein A-like            511   3e-173   
emb|CDX90958.1|  BnaA03g26380D                                          511   3e-173   
ref|XP_006281983.1|  hypothetical protein CARUB_v10028207mg             511   3e-173   
ref|XP_006394496.1|  hypothetical protein EUTSA_v10003990mg             511   4e-173   
gb|KDO36125.1|  hypothetical protein CISIN_1g017485mg                   505   4e-173   
gb|EEC70918.1|  hypothetical protein OsI_02481                          510   4e-173   Oryza sativa Indica Group [Indian rice]
emb|CDY22024.1|  BnaA09g00530D                                          509   6e-173   
gb|AHC98497.1|  putative hexose transporter                             509   1e-172   
gb|KFK30778.1|  hexose transporter                                      509   1e-172   
ref|XP_006644257.1|  PREDICTED: sugar carrier protein C-like            509   1e-172   
ref|XP_010253802.1|  PREDICTED: sugar transport protein 4               509   1e-172   
dbj|BAA83554.1|  putative hexose transport protein HEX6                 509   1e-172   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006663022.1|  PREDICTED: hexose carrier protein HEX6-like        509   2e-172   
ref|XP_009417436.1|  PREDICTED: sugar transport protein 7               509   2e-172   
ref|XP_006287526.1|  hypothetical protein CARUB_v10000732mg             509   2e-172   
ref|XP_006343267.1|  PREDICTED: sugar carrier protein C-like            509   2e-172   
emb|CDO99641.1|  unnamed protein product                                509   2e-172   
ref|XP_009136482.1|  PREDICTED: sugar transport protein 3 isoform X1    508   3e-172   
ref|XP_007043258.1|  Major facilitator superfamily protein              508   3e-172   
ref|XP_004982025.1|  PREDICTED: sugar transport protein 7-like          508   3e-172   
ref|XP_003577397.1|  PREDICTED: hexose carrier protein HEX6-like        508   3e-172   
emb|CDX87052.1|  BnaC09g03670D                                          508   5e-172   
ref|XP_004956822.1|  PREDICTED: sugar transport protein 7-like          508   5e-172   
ref|XP_010443972.1|  PREDICTED: sugar transport protein 3-like          507   5e-172   
ref|XP_008242891.1|  PREDICTED: sugar transport protein 7               507   6e-172   
ref|XP_008343915.1|  PREDICTED: sugar transport protein 7-like is...    505   7e-172   
ref|XP_008787055.1|  PREDICTED: sugar transport protein 4-like          507   7e-172   
ref|XP_010942230.1|  PREDICTED: sugar carrier protein C-like            507   8e-172   
ref|XP_008343914.1|  PREDICTED: sugar transport protein 7-like is...    507   8e-172   
ref|XP_002458021.1|  hypothetical protein SORBIDRAFT_03g025600          507   8e-172   Sorghum bicolor [broomcorn]
emb|CDY19352.1|  BnaC05g08610D                                          507   9e-172   
ref|XP_009111324.1|  PREDICTED: sugar transport protein 7               506   1e-171   
ref|XP_006657831.1|  PREDICTED: sugar transport protein 1-like          507   1e-171   
dbj|BAJ98302.1|  predicted protein                                      507   1e-171   
emb|CDY19773.1|  BnaA09g04260D                                          507   1e-171   
emb|CDP10521.1|  unnamed protein product                                506   1e-171   
ref|XP_009412674.1|  PREDICTED: sugar carrier protein C-like            506   1e-171   
ref|XP_009111698.1|  PREDICTED: sugar transport protein 13              507   2e-171   
emb|CDY45759.1|  BnaC02g42230D                                          506   2e-171   
ref|XP_010533083.1|  PREDICTED: sugar transport protein 7               506   2e-171   
ref|NP_001056756.2|  Os06g0141000                                       505   2e-171   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003566793.2|  PREDICTED: sugar transport protein 1-like          505   2e-171   
gb|KEH16382.1|  sugar porter (SP) family MFS transporter                505   2e-171   
ref|NP_001059981.1|  Os07g0559700                                       506   3e-171   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008651124.1|  PREDICTED: uncharacterized protein LOC100274...    504   3e-171   
ref|XP_002449779.1|  hypothetical protein SORBIDRAFT_05g023140          506   3e-171   Sorghum bicolor [broomcorn]
ref|XP_009389223.1|  PREDICTED: sugar transport protein 10-like         506   3e-171   
ref|XP_008659944.1|  PREDICTED: hexose carrier protein HEX6-like        506   3e-171   
ref|XP_009148457.1|  PREDICTED: sugar transport protein 1-like          506   3e-171   
gb|AAY89231.1|  hexose transporter 1                                    506   3e-171   
emb|CDX91815.1|  BnaC03g31170D                                          516   4e-171   
ref|XP_003617723.1|  Hexose transporter                                 505   4e-171   
ref|XP_002866441.1|  hypothetical protein ARALYDRAFT_919396             504   5e-171   
ref|XP_009136370.1|  PREDICTED: sugar transport protein 11              505   5e-171   
ref|NP_188628.1|  sugar transport protein 10                            505   5e-171   
ref|XP_009366131.1|  PREDICTED: sugar transport protein 7-like is...    503   7e-171   
gb|AFO84087.1|  hexose transport protein                                505   7e-171   
ref|XP_008362876.1|  PREDICTED: sugar transport protein 7-like is...    503   9e-171   
ref|XP_009366130.1|  PREDICTED: sugar transport protein 7-like is...    504   9e-171   
ref|XP_001753236.1|  predicted protein                                  504   1e-170   
gb|KEH16381.1|  sugar porter (SP) family MFS transporter                503   1e-170   
ref|XP_008362875.1|  PREDICTED: sugar transport protein 7-like is...    504   1e-170   
ref|XP_009341808.1|  PREDICTED: sugar transport protein 7-like is...    502   1e-170   
ref|XP_004964498.1|  PREDICTED: hexose carrier protein HEX6-like        503   1e-170   
ref|XP_001753303.1|  predicted protein                                  504   1e-170   
ref|XP_010096785.1|  Sugar transport protein 10                         504   2e-170   
ref|XP_004968998.1|  PREDICTED: sugar transport protein 1-like          503   2e-170   
ref|XP_009341807.1|  PREDICTED: sugar transport protein 7-like is...    503   2e-170   
gb|EPS67473.1|  monosaccharide transporter 2                            503   2e-170   
gb|EMT27399.1|  Sugar transport protein 1                               503   3e-170   
ref|XP_006394595.1|  hypothetical protein EUTSA_v10005579mg             503   3e-170   
ref|XP_009614842.1|  PREDICTED: sugar transport protein 12-like         503   3e-170   
ref|NP_001234855.1|  hexose transporter 3                               503   3e-170   
ref|NP_001234849.1|  hexose transporter 1                               503   5e-170   
gb|KEH23649.1|  sugar porter (SP) family MFS transporter                502   5e-170   
ref|XP_006394875.1|  hypothetical protein EUTSA_v10003980mg             503   5e-170   
ref|XP_002463019.1|  hypothetical protein SORBIDRAFT_02g036310          503   5e-170   
gb|KFK26411.1|  hypothetical protein AALP_AA8G245100                    503   6e-170   
ref|XP_009623349.1|  PREDICTED: sugar carrier protein A                 502   7e-170   
ref|NP_001148007.1|  sugar carrier protein C                            502   8e-170   
dbj|BAO96218.1|  sugar transporter 3                                    501   1e-169   
gb|EPS66044.1|  hypothetical protein M569_08731                         501   1e-169   
ref|NP_200960.2|  sugar transport protein 3                             501   1e-169   
ref|XP_010918404.1|  PREDICTED: sugar transport protein 4-like          501   2e-169   
tpg|DAA63119.1|  TPA: sugar carrier protein                             501   2e-169   
ref|XP_004234261.1|  PREDICTED: sugar carrier protein C-like            501   2e-169   
ref|XP_006453688.1|  hypothetical protein CICLE_v10008037mg             501   2e-169   
ref|XP_009761332.1|  PREDICTED: sugar transport protein 12-like         501   3e-169   
ref|XP_003533697.1|  PREDICTED: sugar transport protein 10-like         500   3e-169   
ref|XP_009771478.1|  PREDICTED: sugar carrier protein A                 500   3e-169   
gb|KDP40155.1|  hypothetical protein JCGZ_02153                         501   3e-169   
ref|XP_002306376.1|  hypothetical protein POPTR_0005s09290g             500   3e-169   
ref|XP_010521842.1|  PREDICTED: sugar transport protein 11-like         500   3e-169   
ref|XP_003576390.1|  PREDICTED: sugar carrier protein C-like            501   3e-169   
ref|XP_003573411.1|  PREDICTED: sugar carrier protein C-like            500   4e-169   
gb|KHN23099.1|  Sugar transport protein 10                              499   5e-169   
ref|XP_010522016.1|  PREDICTED: sugar transport protein 11-like         500   5e-169   
ref|XP_007157147.1|  hypothetical protein PHAVU_002G046800g             500   5e-169   
ref|NP_198006.1|  sugar transport protein 13                            500   5e-169   
gb|AFO84096.1|  hexose transport protein                                499   6e-169   
dbj|BAO45901.1|  hexose transporter                                     500   6e-169   
ref|XP_010508245.1|  PREDICTED: sugar transport protein 10-like         499   6e-169   
ref|XP_003609532.1|  Transmembrane 9 superfamily protein member         498   6e-169   
gb|KDO59359.1|  hypothetical protein CISIN_1g010375mg                   499   7e-169   
ref|XP_003555844.1|  PREDICTED: sugar transport protein 11              499   8e-169   
ref|XP_002889859.1|  hypothetical protein ARALYDRAFT_888424             499   9e-169   
ref|XP_006473953.1|  PREDICTED: sugar carrier protein A-like            499   1e-168   
emb|CDO99036.1|  unnamed protein product                                499   1e-168   
ref|XP_010049878.1|  PREDICTED: sugar transport protein 7               499   1e-168   
ref|NP_172592.1|  sugar transporter 1                                   499   1e-168   
ref|XP_009398213.1|  PREDICTED: sugar carrier protein C-like isof...    499   1e-168   
ref|XP_010521988.1|  PREDICTED: sugar transport protein 11-like         499   1e-168   
ref|XP_007043259.1|  Major facilitator superfamily protein              498   1e-168   
emb|CAA39037.1|  glucose transporter                                    499   2e-168   
ref|XP_008390869.1|  PREDICTED: sugar transport protein 13-like         499   2e-168   
ref|XP_003546610.1|  PREDICTED: sugar transport protein 7-like          498   2e-168   
ref|XP_004287225.1|  PREDICTED: sugar transport protein 7-like          498   2e-168   
ref|XP_006287497.1|  hypothetical protein CARUB_v10000707mg             499   2e-168   
ref|XP_006359910.1|  PREDICTED: sugar transport protein 13-like         498   2e-168   
ref|XP_003533699.1|  PREDICTED: sugar transport protein 10-like         498   2e-168   
ref|XP_003565750.1|  PREDICTED: sugar transport protein 1-like          499   2e-168   
ref|XP_003535765.1|  PREDICTED: sugar transport protein 10-like         498   2e-168   
gb|KHN35184.1|  Sugar transport protein 13                              498   3e-168   
ref|XP_009763608.1|  PREDICTED: sugar transport protein 13              498   3e-168   
ref|XP_004515049.1|  PREDICTED: sugar transport protein 10-like         498   3e-168   
ref|XP_003517581.1|  PREDICTED: sugar transport protein 13              498   3e-168   
gb|EPS73973.1|  hypothetical protein M569_00781                         498   3e-168   
ref|NP_001119473.1|  sugar transport protein 3                          496   3e-168   
ref|XP_004958016.1|  PREDICTED: sugar carrier protein C-like            498   3e-168   
ref|NP_001268207.1|  hexose transporter                                 498   3e-168   
ref|XP_003539275.1|  PREDICTED: sugar transport protein 13-like         498   4e-168   
ref|XP_002517216.1|  sugar transporter, putative                        498   4e-168   
ref|XP_010454987.1|  PREDICTED: sugar transport protein 13 isofor...    498   4e-168   
gb|EMS57942.1|  Sugar carrier protein C                                 496   4e-168   
emb|CDY34842.1|  BnaA09g47680D                                          498   4e-168   
ref|XP_011002259.1|  PREDICTED: sugar transport protein 10-like         497   5e-168   
ref|XP_002960062.1|  hypothetical protein SELMODRAFT_402034             498   5e-168   
ref|XP_010421503.1|  PREDICTED: sugar transport protein 13-like         497   6e-168   
ref|XP_007221814.1|  hypothetical protein PRUPE_ppa004132mg             498   6e-168   
gb|EYU25295.1|  hypothetical protein MIMGU_mgv1a005014mg                496   7e-168   
ref|NP_001141004.1|  hypothetical protein                               496   8e-168   
ref|NP_001147591.1|  sugar carrier protein C                            498   8e-168   
ref|XP_011017956.1|  PREDICTED: sugar carrier protein A-like            497   8e-168   
gb|AAM67326.1|  glucose transporter                                     497   1e-167   
ref|XP_004511353.1|  PREDICTED: sugar transport protein 13-like         497   1e-167   
emb|CAN61766.1|  hypothetical protein VITISV_025413                     497   1e-167   
ref|XP_011033480.1|  PREDICTED: sugar carrier protein A-like            496   1e-167   
ref|XP_010489959.1|  PREDICTED: LOW QUALITY PROTEIN: sugar transp...    496   1e-167   
emb|CDY67102.1|  BnaA06g39540D                                          495   2e-167   
ref|XP_008797565.1|  PREDICTED: sugar carrier protein C-like            494   2e-167   
ref|XP_009118196.1|  PREDICTED: sugar transport protein 1               496   2e-167   
gb|KFK39319.1|  hypothetical protein AALP_AA3G229200                    495   2e-167   
ref|XP_010244794.1|  PREDICTED: sugar transport protein 7-like          496   2e-167   
ref|XP_008784806.1|  PREDICTED: sugar transport protein 7               496   2e-167   
ref|NP_001267837.1|  hexose transporter 7                               496   2e-167   
ref|XP_003610701.1|  Hexose transporter                                 496   3e-167   
ref|XP_002883212.1|  hypothetical protein ARALYDRAFT_318745             495   3e-167   
ref|XP_004134452.1|  PREDICTED: sugar transport protein 13-like         495   4e-167   
ref|XP_006347143.1|  PREDICTED: sugar carrier protein C-like            495   4e-167   
ref|XP_006482187.1|  PREDICTED: sugar carrier protein C-like            495   4e-167   
ref|XP_006286434.1|  hypothetical protein CARUB_v10003693mg             495   4e-167   
ref|XP_008380303.1|  PREDICTED: sugar transport protein 13-like         495   4e-167   
ref|XP_008438691.1|  PREDICTED: sugar transport protein 13-like         495   5e-167   
ref|XP_009151136.1|  PREDICTED: sugar transport protein 13-like         494   6e-167   
ref|XP_002308382.1|  Sugar carrier protein A                            494   6e-167   
ref|XP_002524690.1|  sugar transporter, putative                        494   7e-167   
sp|Q41144.1|STC_RICCO  RecName: Full=Sugar carrier protein C            494   7e-167   
emb|CBI25604.3|  unnamed protein product                                494   7e-167   
ref|XP_010108002.1|  Sugar transport protein 13                         495   8e-167   
ref|XP_003562874.1|  PREDICTED: sugar carrier protein C-like            494   9e-167   
ref|XP_011096193.1|  PREDICTED: sugar carrier protein C-like            493   1e-166   
ref|XP_011084034.1|  PREDICTED: sugar transport protein 7-like          493   1e-166   
gb|EYU39411.1|  hypothetical protein MIMGU_mgv1a004703mg                494   1e-166   
gb|KDP38625.1|  hypothetical protein JCGZ_03978                         494   1e-166   
emb|CAN83402.1|  hypothetical protein VITISV_009589                     494   1e-166   
ref|XP_006660626.1|  PREDICTED: sugar transport protein 7-like          494   1e-166   
emb|CAB07812.1|  monosaccharid transport protein                        494   1e-166   
ref|NP_001274389.1|  sugar transport protein 10-like                    494   1e-166   
gb|KGN61348.1|  hypothetical protein Csa_2G094390                       493   2e-166   
ref|XP_006380505.1|  hypothetical protein POPTR_0007s07530g             493   2e-166   
ref|XP_010942152.1|  PREDICTED: sugar transport protein 7               493   2e-166   
gb|KFK43420.1|  hypothetical protein AALP_AA1G123500                    493   2e-166   
ref|XP_006853128.1|  hypothetical protein AMTR_s00038p00156510          494   3e-166   
ref|XP_004504960.1|  PREDICTED: sugar transport protein 1-like          493   3e-166   
gb|EPS73041.1|  hexose transporter 1                                    491   3e-166   
dbj|BAO96217.1|  sugar transporter 2                                    493   4e-166   
ref|XP_003578119.1|  PREDICTED: sugar transport protein 7               493   4e-166   
emb|CAB52689.1|  hexose transporter                                     493   4e-166   
gb|KDO59361.1|  hypothetical protein CISIN_1g010375mg                   490   5e-166   
ref|XP_004972717.1|  PREDICTED: sugar carrier protein C-like            492   5e-166   
emb|CDP10520.1|  unnamed protein product                                493   5e-166   
gb|EYU41503.1|  hypothetical protein MIMGU_mgv1a004471mg                492   6e-166   
ref|XP_006300082.1|  hypothetical protein CARUB_v10016310mg             492   6e-166   
ref|XP_004170560.1|  PREDICTED: sugar transport protein 10-like         492   6e-166   
ref|XP_011002256.1|  PREDICTED: LOW QUALITY PROTEIN: sugar transp...    492   7e-166   
ref|XP_008438690.1|  PREDICTED: sugar transport protein 13-like         491   8e-166   
ref|NP_001234785.1|  hexose transporter protein                         492   9e-166   
ref|XP_008364130.1|  PREDICTED: sugar carrier protein C                 491   1e-165   
gb|AAT09977.1|  putative hexose transporter                             491   1e-165   
ref|XP_010434176.1|  PREDICTED: sugar transport protein 12-like         490   2e-165   
gb|EEC84574.1|  hypothetical protein OsI_31368                          491   2e-165   
ref|XP_002961014.1|  hypothetical protein SELMODRAFT_437470             491   2e-165   
ref|NP_001063176.1|  Os09g0416200                                       490   2e-165   
ref|XP_002966995.1|  hypothetical protein SELMODRAFT_144534             491   2e-165   
ref|XP_006430696.1|  hypothetical protein CICLE_v10013580mg             490   3e-165   
ref|XP_006419892.1|  hypothetical protein CICLE_v10004729mg             490   3e-165   
ref|XP_002891565.1|  monosaccharide transporter                         490   4e-165   
ref|XP_004134962.1|  PREDICTED: sugar carrier protein C-like            491   4e-165   
ref|XP_011002255.1|  PREDICTED: sugar transport protein 10-like         490   4e-165   
ref|XP_010035273.1|  PREDICTED: sugar transport protein 13-like         490   4e-165   
ref|XP_010052390.1|  PREDICTED: sugar carrier protein C                 490   4e-165   
ref|XP_009374920.1|  PREDICTED: sugar carrier protein C                 490   4e-165   
ref|XP_002960063.1|  hypothetical protein SELMODRAFT_402035             490   4e-165   
ref|XP_004134451.1|  PREDICTED: sugar transport protein 13-like         489   4e-165   
gb|EAY74592.1|  hypothetical protein OsI_02482                          489   6e-165   
ref|XP_010265716.1|  PREDICTED: sugar transport protein 7-like          489   1e-164   
ref|XP_004171066.1|  PREDICTED: sugar carrier protein C-like            489   1e-164   
ref|XP_009771361.1|  PREDICTED: sugar transport protein 12-like         489   1e-164   
ref|XP_010493897.1|  PREDICTED: sugar transport protein 13-like         489   1e-164   
ref|XP_009804570.1|  PREDICTED: sugar transport protein 12-like         489   1e-164   
ref|XP_010918295.1|  PREDICTED: sugar transport protein 1-like          489   1e-164   
ref|XP_010255992.1|  PREDICTED: sugar transport protein 13              488   1e-164   
ref|XP_010413061.1|  PREDICTED: sugar transport protein 7-like          488   1e-164   
emb|CAD30830.1|  monosaccharide-H+ symporter                            488   2e-164   
gb|KFK39191.1|  hypothetical protein AALP_AA3G211700                    488   2e-164   
ref|NP_001043370.1|  Os01g0567600                                       488   2e-164   
ref|XP_010467141.1|  PREDICTED: sugar transport protein 7-like          488   2e-164   
ref|XP_010521999.1|  PREDICTED: sugar transport protein 11-like i...    488   2e-164   
gb|EPS70218.1|  hexose transporter 1                                    487   3e-164   
ref|XP_010522006.1|  PREDICTED: sugar transport protein 11-like i...    488   3e-164   
ref|XP_008439909.1|  PREDICTED: sugar carrier protein C-like            488   4e-164   
ref|NP_175449.1|  sugar transporter 9                                   488   4e-164   
ref|XP_004296903.1|  PREDICTED: sugar transport protein 13-like         488   4e-164   
gb|KDP20877.1|  hypothetical protein JCGZ_21348                         488   4e-164   
gb|KEH27346.1|  sugar porter (SP) family MFS transporter                486   4e-164   
ref|XP_002310647.2|  hypothetical protein POPTR_0007s07640g             487   5e-164   
emb|CDP20258.1|  unnamed protein product                                487   6e-164   
ref|XP_010667424.1|  PREDICTED: sugar transport protein 13              488   6e-164   
ref|XP_004167176.1|  PREDICTED: sugar transport protein 13-like         488   6e-164   
emb|CAN87006.1|  hexose transporter 1                                   487   6e-164   
ref|XP_009603909.1|  PREDICTED: sugar carrier protein C-like            487   7e-164   
ref|XP_011078589.1|  PREDICTED: sugar transport protein 7-like          486   7e-164   
ref|XP_004168644.1|  PREDICTED: LOW QUALITY PROTEIN: sugar transp...    486   7e-164   
ref|XP_003616628.1|  Sugar transport protein                            486   7e-164   
ref|XP_007034709.1|  Major facilitator superfamily protein              487   7e-164   
gb|EMS63665.1|  Sugar transport protein 13                              486   7e-164   
ref|XP_011090738.1|  PREDICTED: sugar transport protein 13              487   7e-164   
ref|XP_011026237.1|  PREDICTED: sugar transport protein 13-like         487   8e-164   
gb|KCW76349.1|  hypothetical protein EUGRSUZ_D00720                     490   9e-164   
ref|XP_010277661.1|  PREDICTED: sugar transport protein 13-like         487   9e-164   
gb|EMT20071.1|  Sugar transport protein 13                              486   9e-164   
ref|XP_011002247.1|  PREDICTED: sugar transport protein 10-like         486   9e-164   
emb|CAA47324.1|  monosaccharid transporter                              486   1e-163   
ref|XP_010694810.1|  PREDICTED: sugar carrier protein C-like            486   1e-163   
ref|XP_008222939.1|  PREDICTED: sugar transport protein 13-like         486   1e-163   
ref|XP_004134731.1|  PREDICTED: sugar carrier protein C-like            487   1e-163   
ref|XP_006406438.1|  hypothetical protein EUTSA_v10020528mg             486   1e-163   
gb|KDO74663.1|  hypothetical protein CISIN_1g009833mg                   484   2e-163   
ref|XP_004296074.1|  PREDICTED: sugar transport protein 10-like         486   2e-163   
ref|XP_002460212.1|  hypothetical protein SORBIDRAFT_02g024690          486   2e-163   
ref|XP_009398212.1|  PREDICTED: sugar carrier protein C-like isof...    487   2e-163   
ref|XP_006393163.1|  hypothetical protein EUTSA_v10011372mg             486   3e-163   
dbj|BAK07965.1|  predicted protein                                      485   3e-163   
gb|AES59985.2|  sugar porter (SP) family MFS transporter                485   3e-163   
ref|XP_002325158.2|  hypothetical protein POPTR_0018s12130g             485   3e-163   
gb|AAA18534.1|  glucose transporter                                     485   3e-163   
gb|KFK27906.1|  hypothetical protein AALP_AA8G445500                    485   3e-163   
emb|CDX80558.1|  BnaC07g28860D                                          484   4e-163   
gb|KDO59360.1|  hypothetical protein CISIN_1g010375mg                   483   4e-163   



>ref|XP_009783889.1| PREDICTED: hexose carrier protein HEX6-like [Nicotiana sylvestris]
Length=510

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/454 (83%), Positives = 411/454 (91%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FFHDVYTKMKED  +VSNYCKFDS+LLTSFTSSLY+AGLFA+ +ASSV
Sbjct  45    GGVTSMEPFLKKFFHDVYTKMKEDK-EVSNYCKFDSQLLTSFTSSLYVAGLFATFIASSV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  SIL+GG  FLAGAALGGAA N+YMLIFGRVLLG+GVGFANQAVPLYLSEMAP
Sbjct  104   TRTFGRKASILLGGANFLAGAALGGAAFNIYMLIFGRVLLGVGVGFANQAVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             +KYRGG+N SFQL VGIGVLIANLINYGTEK++ GWGWRVSL +AAVPA +LT+GA+ LP
Sbjct  164   SKYRGGINNSFQLSVGIGVLIANLINYGTEKVKGGWGWRVSLAMAAVPAFILTLGALFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR ND +  KR LQR+RGTDDVQAELDDL+ ASE S+TI+ PFKNIL R+YRP
Sbjct  224   ETPNSLIQRTNDREKVKRMLQRIRGTDDVQAELDDLIVASETSKTIKHPFKNILQRKYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVM+ A+PFFQQVTGINVIAFYAP+LFRTIGLGESAAL+SAVVTGAVGI TT  SML+V
Sbjct  284   QLVMSVAIPFFQQVTGINVIAFYAPILFRTIGLGESAALLSAVVTGAVGIATTAMSMLIV  343

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DKVGRR LLI GGI MFVTQM VGG+MGAKLGD GG+SK WA ++L+LI  YVAGFGLSW
Sbjct  344   DKVGRRGLLIFGGIQMFVTQMIVGGLMGAKLGDHGGVSKAWAFVILVLICIYVAGFGLSW  403

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCH KYGIFFFFGGWVA+
Sbjct  404   GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHFKYGIFFFFGGWVAI  463

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY  LPETKNLPIEKMD VWREHWFWKKIV
Sbjct  464   MTAFVYWFLPETKNLPIEKMDKVWREHWFWKKIV  497



>emb|CDO96746.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/454 (80%), Positives = 403/454 (89%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF DVY KMKED+ K SNYCKFDS+LLT FTSSLY+AGL AS  ASS+
Sbjct  44    GGVTSMEPFLKKFFPDVYAKMKEDT-KTSNYCKFDSQLLTLFTSSLYLAGLVASFCASSL  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR  SIL GG AFL+GAALGGAA NVYM+IFGR+LLGIGVGFANQAVPLYLSEMAP
Sbjct  103   TRAFGRKASILTGGAAFLSGAALGGAAYNVYMIIFGRILLGIGVGFANQAVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             AK+RG +N SFQL +GIG+LIANLINYGTEKI+DG GWR+SL LAAVPA +LT+GA+ LP
Sbjct  163   AKFRGAINNSFQLSIGIGILIANLINYGTEKIKDGRGWRISLALAAVPAFILTLGALFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNS++Q  N+H+ AKR LQRVRGT+DVQAE DDL+ A EIS+TI+ PFKNI+ RRYRP
Sbjct  223   ETPNSILQHSNNHEKAKRILQRVRGTEDVQAEFDDLIKAGEISKTIKHPFKNIIQRRYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVM+ A+PFFQQVTGINVIAFYAP+LFRTIGL ESA+LMSA VTG+VGI TTF SML+V
Sbjct  283   QLVMSVAIPFFQQVTGINVIAFYAPILFRTIGLKESASLMSAAVTGSVGICTTFISMLVV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DKVGRR LLI GGI MFV Q+ VGGVM AKLGD GGLSKG A LVL+LI  YVAGFGLSW
Sbjct  343   DKVGRRFLLINGGICMFVMQILVGGVMAAKLGDHGGLSKGHAFLVLVLICLYVAGFGLSW  402

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWLIPSEIFPLEIRSAGQSI VAVNFLFTF+VGQTFL+MLCH KYG+FFFFGGWVA+
Sbjct  403   GPLGWLIPSEIFPLEIRSAGQSINVAVNFLFTFIVGQTFLSMLCHFKYGLFFFFGGWVAL  462

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVYLLLPETKN+PIE+M+ VWR+HWFW KIV
Sbjct  463   MTAFVYLLLPETKNVPIEQMERVWRKHWFWNKIV  496



>ref|XP_006358234.1| PREDICTED: hexose carrier protein HEX6-like [Solanum tuberosum]
Length=509

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/454 (82%), Positives = 412/454 (91%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FFHDVY KMKED  ++SNYCKFDSELLTSFTSSLY+AGLFA+ +ASSV
Sbjct  44    GGVTSMEPFLKKFFHDVYIKMKEDK-ELSNYCKFDSELLTSFTSSLYVAGLFATFVASSV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR  SIL+GG  FLAGAALGGAA N+YMLI GRVLLG+GVGFANQAVPLYLSEMAP
Sbjct  103   TRAYGRKASILLGGANFLAGAALGGAASNIYMLIIGRVLLGVGVGFANQAVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              KYRGG N SFQL VGIGVLIANLINYGTEK++ GWGWRVSL +AAVPA++LT+GA+ LP
Sbjct  163   TKYRGGFNNSFQLSVGIGVLIANLINYGTEKVKGGWGWRVSLAMAAVPASILTLGALFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSLIQR +DH+  KR LQRVRGTDDVQAELDDL+ ASEIS+T++ PFKNIL R+YRP
Sbjct  223   DTPNSLIQRTDDHEKVKRLLQRVRGTDDVQAELDDLILASEISKTMKHPFKNILQRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVM+ A+PFFQQVTGINVIAFYAP+LFRTIGLG SA+L+SAV+TGAVGIVTT  SML+V
Sbjct  283   QLVMSVAIPFFQQVTGINVIAFYAPILFRTIGLGVSASLLSAVITGAVGIVTTGLSMLIV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DKVGRR LLI GGI MFVTQM VGG+MGAKLGD GGLSKGWA ++L+LI +YVAGFGLSW
Sbjct  343   DKVGRRGLLIFGGIQMFVTQMIVGGLMGAKLGDHGGLSKGWAFVILVLICTYVAGFGLSW  402

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWLIPSEIFPLEIRSAGQSI+V+VNFLFTFLVGQTFLAMLCH K+GIFFFFG WVA+
Sbjct  403   GPLGWLIPSEIFPLEIRSAGQSISVSVNFLFTFLVGQTFLAMLCHFKFGIFFFFGVWVAI  462

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY  LPETKNLPIEKMD VWREHWFWK+IV
Sbjct  463   MTAFVYFFLPETKNLPIEKMDRVWREHWFWKRIV  496



>ref|XP_011076399.1| PREDICTED: hexose carrier protein HEX6-like [Sesamum indicum]
 ref|XP_011076400.1| PREDICTED: hexose carrier protein HEX6-like [Sesamum indicum]
Length=504

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/454 (78%), Positives = 401/454 (88%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF +VYT+MKED+ K+SNYCKFDS+LLT FTSSLY+AGL AS  ASSV
Sbjct  44    GGVTSMEPFLKKFFPEVYTRMKEDT-KISNYCKFDSQLLTLFTSSLYLAGLIASFFASSV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR P+IL GG AFLAGAAL GAAI+ YMLIFGRVLLG+GVGFANQAVPLYLSEMAP
Sbjct  103   TRAYGREPTILFGGAAFLAGAALNGAAISTYMLIFGRVLLGVGVGFANQAVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             AKYRG  N  FQ  VGIG L ANLINYGTEKI+ GWGWR+SL LAAVPA+ LT+GA+ L 
Sbjct  163   AKYRGAFNNGFQFSVGIGALSANLINYGTEKIKGGWGWRISLALAAVPASALTLGAIFLQ  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNS+IQR N +D AK  LQR+RGT+DV+AEL+DL+ ASE SRTI+ P+KNIL R YRP
Sbjct  223   ETPNSVIQRTNKYDKAKAMLQRIRGTNDVEAELNDLIKASENSRTIKSPYKNILQRSYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVM+ A+PFFQQVTGINVIAFY+P++FRTIG GESA+LMS+V+TG VGIVTTF SM++V
Sbjct  283   QLVMSIAIPFFQQVTGINVIAFYSPIVFRTIGFGESASLMSSVMTGVVGIVTTFLSMMIV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             D+ GRR LLIVGGI+MFV+QM VG +M AKLGD GGLSKG+A +VL+LI  YVAGFG+SW
Sbjct  343   DRAGRRFLLIVGGIIMFVSQMLVGAIMAAKLGDHGGLSKGYADVVLVLIGVYVAGFGVSW  402

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWLIPSEIFPLEIRSAGQSI+VAVNFLFTFLVGQTFL+MLCH K GIFFFFGGWVAV
Sbjct  403   GPLGWLIPSEIFPLEIRSAGQSISVAVNFLFTFLVGQTFLSMLCHFKSGIFFFFGGWVAV  462

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY+LLPETKN+PIE+M+ VWR HWFWKKIV
Sbjct  463   MTGFVYVLLPETKNVPIEQMERVWRGHWFWKKIV  496



>gb|KDP22452.1| hypothetical protein JCGZ_26283 [Jatropha curcas]
Length=509

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/454 (75%), Positives = 393/454 (87%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF DVY KMKED+ K+SNYCKFDS+LLTSFTSSLY+AGL AS  AS V
Sbjct  44    GGVTSMEPFLKKFFPDVYKKMKEDT-KISNYCKFDSQLLTSFTSSLYVAGLVASFFASWV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR  SIL+ G AFLAG+ALGGAA NVYMLIFGR+LLGIG+GFANQ+VPLYLSEMAP
Sbjct  103   TRAFGRKSSILLAGAAFLAGSALGGAAFNVYMLIFGRILLGIGLGFANQSVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              +YRG +N  FQ CVGIG+L ANL+NYGTEKI  GWGWR+SL LAAVPAT+LTIGA+ LP
Sbjct  163   PRYRGAINNGFQFCVGIGILSANLVNYGTEKIEGGWGWRISLALAAVPATILTIGALFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR NDH+ AK  LQRVRGT+DVQAELDDL+ AS IS+TIE PFKNI+ R+YRP
Sbjct  223   ETPNSLIQRTNDHERAKLMLQRVRGTNDVQAELDDLIKASSISKTIEHPFKNIMQRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA  +PFFQQVTGINV+AFYAPVLFRTIGLGESA+LMS+V TG VG ++TF SML+V
Sbjct  283   QLVMAITIPFFQQVTGINVVAFYAPVLFRTIGLGESASLMSSVATGGVGSLSTFISMLVV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR L + GG+ MF +Q+ VGG+M A+LGD+GG+ KG+A +VL+LI  YVAGF  SW
Sbjct  343   DKLGRRALFLFGGVQMFASQIIVGGIMAAELGDRGGIGKGYAYIVLILICIYVAGFAFSW  402

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIFPLEIRSAGQSI VAVNFL  F+  QTFL++LCH K G FFFFGGWV V
Sbjct  403   GPLGWLVPSEIFPLEIRSAGQSIVVAVNFLLIFITAQTFLSVLCHFKSGTFFFFGGWVVV  462

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FV+L LPETKN+P+EKM++VWREHWFWK+IV
Sbjct  463   MTIFVHLFLPETKNIPLEKMEIVWREHWFWKRIV  496



>ref|XP_002510991.1| sugar transporter, putative [Ricinus communis]
 gb|EEF51593.1| sugar transporter, putative [Ricinus communis]
Length=510

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/454 (76%), Positives = 393/454 (87%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+PFLK+FF DVY KMKED+ ++SNYCKFDS+LLTSFTSSLY+AGL AS  ASSV
Sbjct  44    GGVTSMDPFLKKFFPDVYRKMKEDT-EISNYCKFDSQLLTSFTSSLYVAGLVASFFASSV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR PSIL+GG  FLAGAALGGAA+NVYMLIFGRVLLG+GVGFANQAVPLYLSEMAP
Sbjct  103   TRAFGRKPSILLGGAVFLAGAALGGAAVNVYMLIFGRVLLGVGVGFANQAVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              +YRG +N  FQ  VGIG L ANLINYGTEKI  GWGWR+SL +AAVPA +LT GA+ LP
Sbjct  163   PRYRGAINNGFQFSVGIGALSANLINYGTEKIEGGWGWRISLAMAAVPAAILTFGALFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR NDH+ AK  LQRVRGT DVQAELDDL+ AS ISRTI+ PFKNI+ R+YRP
Sbjct  223   ETPNSLIQRSNDHERAKLMLQRVRGTTDVQAELDDLIKASIISRTIQHPFKNIMRRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA A+PFFQQVTGINVIAFYAP+LFRTIGL ESA+L+S++VTG VG  +TF SML+V
Sbjct  283   QLVMAVAIPFFQQVTGINVIAFYAPILFRTIGLEESASLLSSIVTGLVGSASTFISMLIV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR L I GG+ MFV Q+ VG +M A+LGD GG+ KG+A +VL+LI  YVAGFG SW
Sbjct  343   DKLGRRALFIFGGVQMFVAQIMVGSIMAAELGDHGGIGKGYAYIVLILICIYVAGFGWSW  402

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIFPLEIRSAGQSI VAV+FLFTF+V QTFL+MLCH K GIFFFFGGWV V
Sbjct  403   GPLGWLVPSEIFPLEIRSAGQSIVVAVSFLFTFVVAQTFLSMLCHFKSGIFFFFGGWVVV  462

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FV+ LLPETK +PIEKMD+VWR+HWFWKKI+
Sbjct  463   MTAFVHFLLPETKKVPIEKMDIVWRDHWFWKKII  496



>sp|Q07423.1|HEX6_RICCO RecName: Full=Hexose carrier protein HEX6 [Ricinus communis]
 gb|AAA79857.1| hexose carrier protein [Ricinus communis]
Length=510

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/454 (76%), Positives = 392/454 (86%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+PFLK+FF DVY KMKED+ ++SNYCKFDS+LLTSFTSSLY+AGL AS  ASSV
Sbjct  44    GGVTSMDPFLKKFFPDVYRKMKEDT-EISNYCKFDSQLLTSFTSSLYVAGLVASFFASSV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR PSIL+GG  FLA AALGGAA+NVYMLIFGRVLLG+GVGFANQAVPLYLSEMAP
Sbjct  103   TRAFGRKPSILLGGXVFLAXAALGGAAVNVYMLIFGRVLLGVGVGFANQAVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              +YRG +N  FQ  VGIG L ANLINYGTEKI  GWGWR+SL +AAVPA +LT GA+ LP
Sbjct  163   PRYRGAINNGFQFSVGIGALSANLINYGTEKIEGGWGWRISLAMAAVPAAILTFGALFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR NDH+ AK  LQRVRGT DVQAELDDL+ AS ISRTI+ PFKNI+ R+YRP
Sbjct  223   ETPNSLIQRSNDHERAKLMLQRVRGTTDVQAELDDLIKASIISRTIQHPFKNIMRRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA A+PFFQQVTGINVIAFYAP+LFRTIGL ESA+L+S++VTG VG  +TF SML+V
Sbjct  283   QLVMAVAIPFFQQVTGINVIAFYAPILFRTIGLEESASLLSSIVTGLVGSASTFISMLIV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR L I GG+ MFV Q+ VG +M A+LGD GG+ KG+A +VL+LI  YVAGFG SW
Sbjct  343   DKLGRRALFIFGGVQMFVAQIMVGSIMAAELGDHGGIGKGYAYIVLILICIYVAGFGWSW  402

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIFPLEIRSAGQSI VAV+FLFTF+V QTFL+MLCH K GIFFFFGGWV V
Sbjct  403   GPLGWLVPSEIFPLEIRSAGQSIVVAVSFLFTFVVAQTFLSMLCHFKSGIFFFFGGWVVV  462

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FV+ LLPETK +PIEKMD+VWR+HWFWKKI+
Sbjct  463   MTAFVHFLLPETKKVPIEKMDIVWRDHWFWKKII  496



>ref|XP_007219546.1| hypothetical protein PRUPE_ppa004465mg [Prunus persica]
 gb|EMJ20745.1| hypothetical protein PRUPE_ppa004465mg [Prunus persica]
Length=508

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/454 (76%), Positives = 393/454 (87%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF +VY++MK D  K+SNYCKFDSELLTSFTSSLYIAGL ASL AS V
Sbjct  44    GGVTSMEPFLKKFFPEVYSRMKSDK-KISNYCKFDSELLTSFTSSLYIAGLLASLFASLV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR PSIL GG AFLAG+AL GAA N+YMLI GR+LLG+GVGFANQAVPLYLSEMAP
Sbjct  103   TRAYGRKPSILAGGAAFLAGSALNGAAFNIYMLILGRILLGVGVGFANQAVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             AK+RG +N  FQ  VGIG L ANLINYGTEKI+ GWGWR+SL +AAVPA++LT+GA  LP
Sbjct  163   AKHRGAINNGFQFSVGIGALSANLINYGTEKIKAGWGWRISLAMAAVPASMLTLGAFFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR  DH  AK+ LQ +RG DDV+AELDDL+ A+ +S+TI+ PFK IL R+YRP
Sbjct  223   ETPNSLIQRSTDHQRAKQMLQHIRGVDDVEAELDDLIKANNVSKTIKHPFKKILERKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA A+PFFQQVTGINVIAFYAP+LFRTIGLGESA+L+SAV+TG VG ++TF SML+V
Sbjct  283   QLVMAIAIPFFQQVTGINVIAFYAPILFRTIGLGESASLLSAVMTGVVGTISTFISMLIV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK GRR L +VGGI M V+Q+ +GGVM A+LGD GG+SKG+A LVL+LI  YVAGFG SW
Sbjct  343   DKFGRRALFMVGGIQMLVSQIMIGGVMAAQLGDHGGVSKGYAYLVLVLICIYVAGFGWSW  402

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIFPLEIRSAGQSI V VNFLFTF+V QTFLAMLCH K GIFFFFGGWV+V
Sbjct  403   GPLGWLVPSEIFPLEIRSAGQSINVVVNFLFTFIVAQTFLAMLCHFKSGIFFFFGGWVSV  462

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVYL LPETKN+PIEKM++VW EHWFW++IV
Sbjct  463   MTVFVYLFLPETKNVPIEKMEMVWVEHWFWRRIV  496



>ref|XP_008234428.1| PREDICTED: hexose carrier protein HEX6-like [Prunus mume]
Length=508

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/454 (76%), Positives = 394/454 (87%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF +VYT+MK D  K+SNYCKFDSELLTSFTSSLYIAGL ASL AS V
Sbjct  44    GGVTSMEPFLKKFFPEVYTRMKSDK-KISNYCKFDSELLTSFTSSLYIAGLLASLFASLV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR PSIL GG AFLAG+AL GAA+N+YMLI GR+LLG+GVGFANQAVPLYLSEMAP
Sbjct  103   TRAYGRKPSILAGGAAFLAGSALNGAALNIYMLILGRILLGVGVGFANQAVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             AK+RG +N  FQ  VGIG L ANLINYGTEKI+ GWGWR+SL +AAVPA++LT+GA  LP
Sbjct  163   AKHRGAINNGFQFSVGIGALSANLINYGTEKIKAGWGWRISLAMAAVPASMLTLGAFFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR  DH  AK+ LQR+RG +DV+AEL+DL+ A+ +S+TI+ PFK IL R YRP
Sbjct  223   ETPNSLIQRSTDHQRAKQMLQRIRGVNDVEAELEDLIKANNVSKTIKHPFKKILERMYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA A+PFFQQVTGINVIAFYAP+LFRTIGLGESA+L+SAV+TG VG ++TF SML+V
Sbjct  283   QLVMAIAIPFFQQVTGINVIAFYAPILFRTIGLGESASLLSAVMTGVVGTISTFISMLIV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK GRR L +VGGI M V+Q+ +GGVM A+LGD GG+SKG+A LVL+LI  YVAGFG SW
Sbjct  343   DKFGRRALFMVGGIQMLVSQIMIGGVMAAQLGDHGGVSKGYAYLVLVLICIYVAGFGWSW  402

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIFPLEIRSAGQSI V VNFLFTF+V QTFLAMLCH K GIFFFFGGWV+V
Sbjct  403   GPLGWLVPSEIFPLEIRSAGQSINVVVNFLFTFIVAQTFLAMLCHFKSGIFFFFGGWVSV  462

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVYL LPETKN+PIEKM++VW EHWFW++IV
Sbjct  463   MTVFVYLFLPETKNVPIEKMEMVWVEHWFWRRIV  496



>ref|XP_007038321.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY22822.1| Major facilitator superfamily protein [Theobroma cacao]
Length=507

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/454 (74%), Positives = 396/454 (87%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF DVY KMKED+ K+SNYCKFDS+LLTSFTSSLY+AGLFA+ LASSV
Sbjct  44    GGVTSMEPFLKKFFPDVYRKMKEDT-KISNYCKFDSQLLTSFTSSLYVAGLFATFLASSV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T+A GR PSIL GG AFLAG+ALGGAA+NVYMLIFGR+LLGIGVGFANQ+VPLYLSEMAP
Sbjct  103   TKAFGRKPSILAGGAAFLAGSALGGAALNVYMLIFGRILLGIGVGFANQSVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              +YRG +N  FQ  +GIG L+ANLIN+GTEKI  GWGWR+SL +AAVPA++LT+GA+ LP
Sbjct  163   PRYRGAINNGFQFSIGIGALVANLINFGTEKIEGGWGWRISLAMAAVPASILTLGAIFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQ  +DHD AK  LQR+RGT DVQAELDDL+ AS ++++I  P K I+ R+YRP
Sbjct  223   ETPNSLIQNSSDHDKAKTLLQRIRGTSDVQAELDDLIKASLVAKSINHPIKKIIQRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA A+PFFQQVTGINVIAFYAP+LFRTIG+GESA+L+S+VVTG VG  +TF SML+V
Sbjct  283   QLVMAIAIPFFQQVTGINVIAFYAPILFRTIGIGESASLLSSVVTGVVGAGSTFISMLIV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK GRR L +VGGI MFV+QM VGG+M A+LGD G +SKG+A LV+ LI  YVAGFG SW
Sbjct  343   DKFGRRALFMVGGIQMFVSQMLVGGIMAAQLGDHGTVSKGYAYLVIFLICIYVAGFGWSW  402

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEI+ LEIRSAGQSITVAV+F+FTF+V QTFL+MLCH K GIFFFFGGWV V
Sbjct  403   GPLGWLVPSEIYQLEIRSAGQSITVAVSFVFTFVVAQTFLSMLCHFKAGIFFFFGGWVVV  462

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY LLPETKN+PIE+M+ VW+EHWFWK+I+
Sbjct  463   MTAFVYFLLPETKNVPIEQMEKVWKEHWFWKRIL  496



>gb|KDP22450.1| hypothetical protein JCGZ_26281 [Jatropha curcas]
Length=509

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/454 (76%), Positives = 392/454 (86%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF +VY KMKED+ K+SNYCKFDS+LLTSFTSSLYIAGL AS  AS V
Sbjct  44    GGVTSMEPFLKKFFPEVYRKMKEDT-KISNYCKFDSQLLTSFTSSLYIAGLVASFFASLV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T A GR PSIL+GG AFLAGAALGGAA NVYMLIFGRVLLG+GVGFANQ+VPLYLSEMAP
Sbjct  103   TGAFGRKPSILLGGAAFLAGAALGGAAFNVYMLIFGRVLLGVGVGFANQSVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              +YRG +N  FQ  VGIG L ANLINYGTEKI  GWGWR+SL +AAVPA++LTIGA+ LP
Sbjct  163   PRYRGAINNGFQFSVGIGALSANLINYGTEKIEGGWGWRISLAMAAVPASILTIGAIFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR NDH+ AK  LQRVRGT DVQAELDDL+ AS IS+T++ PFK I+ R YRP
Sbjct  223   ETPNSLIQRTNDHERAKLMLQRVRGTSDVQAELDDLIKASSISKTMKHPFKKIMQRNYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA A+PF QQVTGIN IAFYAP+LFRTIG GESA+LMS+VVTG VG ++TF SML+V
Sbjct  283   QLVMAIAIPFLQQVTGINAIAFYAPILFRTIGFGESASLMSSVVTGVVGTLSTFISMLVV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR L + GG+ MFV+Q+ VGG+M A+LGD G + KG+A +VL+LI  YVAGFG SW
Sbjct  343   DKLGRRTLFLFGGVQMFVSQIMVGGIMAAELGDHGTIGKGYAYIVLILICIYVAGFGWSW  402

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIFPLEIRSAGQSI VAV+FLFT ++ QTFL+MLCH K GIFFFFGGWV V
Sbjct  403   GPLGWLVPSEIFPLEIRSAGQSIVVAVSFLFTLIIAQTFLSMLCHFKSGIFFFFGGWVVV  462

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FV+LLLPETKN+PIEKM++VWREHWFWK+IV
Sbjct  463   MTVFVHLLLPETKNMPIEKMEIVWREHWFWKRIV  496



>ref|XP_008367298.1| PREDICTED: LOW QUALITY PROTEIN: hexose carrier protein HEX6-like 
[Malus domestica]
Length=508

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/454 (75%), Positives = 390/454 (86%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF +V TKMK D+ K+SNYCKFDSELLTSFTSSLYIAGL ASL AS V
Sbjct  44    GGVTSMEPFLKKFFPEVNTKMKSDT-KISNYCKFDSELLTSFTSSLYIAGLVASLFASLV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR PSIL GG AFLAG+AL GAA+N+YMLI GR+LLG+G+GF NQAVPLYLSEMAP
Sbjct  103   TRAYGRKPSILAGGAAFLAGSALNGAAMNIYMLILGRLLLGVGIGFGNQAVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              KYRG +N  FQ  VGIGVL ANLINYG+EKI+ GWGWR+SL +AAVPA++LT+GA  LP
Sbjct  163   PKYRGAINNGFQFSVGIGVLSANLINYGSEKIKGGWGWRISLAMAAVPASMLTLGAFFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR  DH  AK+ LQR+RG DDVQAELDDL+ A+ IS+ I+ PFK IL R+YRP
Sbjct  223   ETPNSLIQRSTDHQTAKKMLQRIRGVDDVQAELDDLIKANNISKNIKHPFKKILERKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA A+PFFQQVTGINVI+FY+ VLFRTIGLGESA+L+S V+TG VG  +TF SML+V
Sbjct  283   QLVMAIAIPFFQQVTGINVISFYSAVLFRTIGLGESASLLSVVLTGVVGTSSTFVSMLIV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK GRR L + GGI M V+Q+ VGGVM A+LGD+GG+SKG+A LVL+LI  YVAGFG SW
Sbjct  343   DKFGRRVLFLAGGIQMLVSQIMVGGVMAAQLGDRGGVSKGYACLVLVLICIYVAGFGWSW  402

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSE+FPLEIRSAGQSI V VNFLFTF+V QTFLAMLCH K GIFFFFGGWVAV
Sbjct  403   GPLGWLVPSEVFPLEIRSAGQSINVVVNFLFTFIVAQTFLAMLCHFKAGIFFFFGGWVAV  462

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVYL LPETKN+PIEKM+ VW+EHWFW++IV
Sbjct  463   MTVFVYLFLPETKNVPIEKMESVWQEHWFWRRIV  496



>emb|CDP05363.1| unnamed protein product [Coffea canephora]
Length=510

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/454 (75%), Positives = 390/454 (86%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFL++FF +VYTKMK+DS K+SNYC+FDS+LLTSFTSSLY+AGL AS  AS V
Sbjct  44    GGVTSMEPFLRKFFPEVYTKMKQDS-KISNYCRFDSQLLTSFTSSLYVAGLVASFFASPV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR PSILIGG AFL GAALGGAA N+YMLIFGRVLLG+GVGFA Q+VPLYLSEMAP
Sbjct  103   TRTFGRKPSILIGGAAFLTGAALGGAAYNIYMLIFGRVLLGVGVGFATQSVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              K RG  N+ FQLCVGIGVL+ANLINYGTEKI+DGWGWR+SL +AA PAT+LT+GA+ LP
Sbjct  163   PKSRGAFNIGFQLCVGIGVLVANLINYGTEKIKDGWGWRISLAMAAAPATILTLGALFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR NDH+ A + LQR+RGT DV+AEL DL+ ASEIS+T++ PFKN+  R+YRP
Sbjct  223   ETPNSLIQRGNDHEKAMKMLQRIRGTTDVKAELVDLIKASEISKTVKHPFKNLAQRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVM+ A PFFQQVTGINVI+FYAPVLFRTIGLGESA+LMSAVV G VG   TF S+L+V
Sbjct  283   QLVMSIAFPFFQQVTGINVISFYAPVLFRTIGLGESASLMSAVVIGLVGTSWTFISLLIV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR +L  GG+ MFV+QM +G ++  KLGD GG+SK + VLVL+LI  YVAGF LSW
Sbjct  343   DKLGRRTVLKTGGVQMFVSQMMIGAILAVKLGDHGGMSKAYGVLVLILICIYVAGFSLSW  402

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+ SEIFPLEIRSA QSITVAV FLFTFLV QTFLAMLCH +  IF FFGGWVA+
Sbjct  403   GPLGWLVTSEIFPLEIRSAAQSITVAVGFLFTFLVAQTFLAMLCHFRSWIFVFFGGWVAI  462

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FV LLLPETKN+PIEKMD +WREHW+WKKIV
Sbjct  463   MTVFVCLLLPETKNVPIEKMDEIWREHWYWKKIV  496



>ref|XP_009362698.1| PREDICTED: hexose carrier protein HEX6-like [Pyrus x bretschneideri]
Length=509

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/455 (74%), Positives = 388/455 (85%), Gaps = 2/455 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF +V TKMK D+ K+SNYCKFDSELLTSFTSSLYIAGL ASL AS V
Sbjct  44    GGVTSMEPFLKKFFPEVNTKMKSDT-KISNYCKFDSELLTSFTSSLYIAGLVASLFASLV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR PSIL GG AFLAG+AL GAA+N+YMLI GR+LLG+G+GF NQAVPLYLSEMAP
Sbjct  103   TRAYGRKPSILAGGAAFLAGSALNGAAMNIYMLILGRLLLGVGIGFGNQAVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              KYRG +N  FQ  VGIGVL ANLINYG+EKI+ GWGWR+SL +AAVPA++LT+GA  LP
Sbjct  163   PKYRGAINNGFQFSVGIGVLSANLINYGSEKIKGGWGWRISLAMAAVPASMLTLGAFFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR  DH  AK+ LQR+RG DDVQAELDDL+ A+ IS+ I+ PFK IL R+YRP
Sbjct  223   ETPNSLIQRSTDHQTAKQMLQRIRGVDDVQAELDDLIKANSISKNIKHPFKKILERKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtg-avgivttFASMLL  979
             QLVMA A+PFFQQVTGINVI+FY+ +LFRTIGLGESA+L+S  +T   VG  +TF SML+
Sbjct  283   QLVMAIAIPFFQQVTGINVISFYSAILFRTIGLGESASLLSVAMTTGVVGTSSTFVSMLI  342

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
             VDK GRR L + GGI M V+Q+ VGGVM A+LGD+G +SKG+A LVL+LI  YVAGFG S
Sbjct  343   VDKFGRRALFLAGGIQMLVSQIMVGGVMAAQLGDRGRVSKGYAYLVLVLICIYVAGFGWS  402

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPLGWL+PSEIFPLEIRSAGQSI V VNFLFTF+V QTFLAMLCH K GIFFFFGGWVA
Sbjct  403   WGPLGWLVPSEIFPLEIRSAGQSINVVVNFLFTFIVAQTFLAMLCHFKAGIFFFFGGWVA  462

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             VMT FVYL LPETKN+PIEKM++VW+EHWFW++IV
Sbjct  463   VMTVFVYLFLPETKNVPIEKMEIVWQEHWFWRRIV  497



>ref|XP_010275368.1| PREDICTED: hexose carrier protein HEX6 [Nelumbo nucifera]
 ref|XP_010275369.1| PREDICTED: hexose carrier protein HEX6 [Nelumbo nucifera]
Length=509

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/456 (76%), Positives = 394/456 (86%), Gaps = 4/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGV+SMEPFLK+FF +VYTKMK+D+ K+SNYCKFDS+LLTSFTSSLYIAGL AS  ASSV
Sbjct  44    GGVSSMEPFLKKFFPEVYTKMKDDT-KISNYCKFDSQLLTSFTSSLYIAGLVASFFASSV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR PSIL GG  FLAGAALGGAA NVYMLI GR+LLG+GVGFANQ+VPLYLSEMAP
Sbjct  103   TRAFGRKPSILAGGATFLAGAALGGAAFNVYMLILGRILLGVGVGFANQSVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              +YRG  N  FQ  VGIG L ANLIN+ TEKIR GWGWR+SL LAAVPA++LT+GA+ LP
Sbjct  163   PQYRGAFNNGFQFSVGIGALSANLINFTTEKIRGGWGWRLSLALAAVPASILTLGAIFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTI--ERPFKNILHRRY  796
             +TPNSLIQR N+ + AKR LQRVRGT DVQAELDDL+ A +IS     + PF+ IL  RY
Sbjct  223   DTPNSLIQR-NNQEKAKRMLQRVRGTTDVQAELDDLIQAGDISTEAIGDHPFRKILRSRY  281

Query  797   RPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASML  976
             RPQLVM+ A+PFFQQVTGINVIAFYAP+LFRTIGLGESA+LMSAV+TG VG V+TF SML
Sbjct  282   RPQLVMSMAIPFFQQVTGINVIAFYAPILFRTIGLGESASLMSAVMTGVVGTVSTFISML  341

Query  977   LVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGL  1156
             +VD++GRR L  +GG+ MFV+Q+ VGG+M AKLGD GGLSKG A LVL+LI  YVAGFG 
Sbjct  342   IVDRLGRRVLFAIGGVQMFVSQLMVGGIMAAKLGDHGGLSKGDAYLVLVLIGIYVAGFGW  401

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSEIFPLEIRSAGQSITVAV+FLFTF+V QTFL+MLCH K GIFFFFGGWV
Sbjct  402   SWGPLGWLVPSEIFPLEIRSAGQSITVAVSFLFTFIVAQTFLSMLCHFKSGIFFFFGGWV  461

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             AVMT FVYLLLPETKN+PIE+MD VWREHWFWK+IV
Sbjct  462   AVMTGFVYLLLPETKNVPIEQMDRVWREHWFWKRIV  497



>ref|XP_011046852.1| PREDICTED: hexose carrier protein HEX6 [Populus euphratica]
Length=509

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/454 (75%), Positives = 388/454 (85%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFL++FF  VY KMKED+ ++SNYCKFDS LLTSFTSS+Y+AG  AS  ASS+
Sbjct  45    GGVTSMEPFLEKFFPKVYRKMKEDT-EISNYCKFDSPLLTSFTSSMYVAGFIASFFASSI  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T+A GR PSIL+GG AFLAGAALGGAA NVYMLIFGRVLLG+GVGFANQAVPLYLSEMAP
Sbjct  104   TKAFGRKPSILLGGAAFLAGAALGGAAFNVYMLIFGRVLLGVGVGFANQAVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              +YRG +N  FQ  +GIG L ANLINYGTEKI+  WGWR+SL LAAVPAT+LT+GAV LP
Sbjct  164   PRYRGAINNGFQFSIGIGALSANLINYGTEKIKGSWGWRISLALAAVPATILTLGAVFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQ  +D + AK  LQRVRGT+DVQAELDDL+ AS IS+T+E PFKNI+ R+YRP
Sbjct  224   ETPNSLIQLTDDTERAKLMLQRVRGTEDVQAELDDLIKASSISKTVEHPFKNIIKRKYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA A+PFFQQVTGINVIAFYAP+LFRTIGLGESA+LMS+VVTG VG  +TF SML+V
Sbjct  284   QLVMAIAIPFFQQVTGINVIAFYAPILFRTIGLGESASLMSSVVTGIVGTGSTFISMLVV  343

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR L I G + M V+Q+ VGG+M A+LGD GG+ +G+A +VL+LI  YVAGFG SW
Sbjct  344   DKLGRRALFIFGAVQMLVSQIMVGGIMAAQLGDHGGIGEGYAYVVLILICIYVAGFGWSW  403

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIFPLEIRSAGQSI VAV+FLFTF+V QTFLAMLCH K GIFF FGGWV V
Sbjct  404   GPLGWLVPSEIFPLEIRSAGQSIVVAVSFLFTFIVAQTFLAMLCHFKSGIFFLFGGWVVV  463

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY LLPETKN PIEKMD VWREH FW KIV
Sbjct  464   MTAFVYYLLPETKNTPIEKMDRVWREHGFWNKIV  497



>ref|XP_006421607.1| hypothetical protein CICLE_v10004775mg [Citrus clementina]
 gb|ESR34847.1| hypothetical protein CICLE_v10004775mg [Citrus clementina]
Length=511

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/454 (73%), Positives = 396/454 (87%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFL++FF +V+ KMKED+ K+SNYCKFDS+LLTSFTSSLY+AGL AS +ASSV
Sbjct  47    GGVTSMEPFLEKFFPEVHRKMKEDT-KISNYCKFDSQLLTSFTSSLYVAGLVASFVASSV  105

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR PS+L+GG AFLAG+ALGGAA+NVYMLIFGR+LLG+GVGFANQ+VPLYLSEMAP
Sbjct  106   TRAFGRKPSVLMGGAAFLAGSALGGAAVNVYMLIFGRLLLGVGVGFANQSVPLYLSEMAP  165

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A+YRG +N  FQ  +GIG L AN INYGTE+I+ GWGWRVSL LAAVPA++LT+GA+ LP
Sbjct  166   ARYRGAINNGFQFSIGIGALAANFINYGTEQIKGGWGWRVSLALAAVPASILTLGALFLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR++DH  AK  LQRVRGT+DVQAE DDL+ AS  ++TI  PFK I+ R+YRP
Sbjct  226   ETPNSLIQRKSDHQKAKLMLQRVRGTNDVQAEFDDLLKASSTAKTINHPFKKIIQRKYRP  285

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA A+PFFQQVTGINVIAFYAP+LFRTIGLG SA+L+S+V +G VG  +T  SM +V
Sbjct  286   QLVMATAIPFFQQVTGINVIAFYAPLLFRTIGLGVSASLLSSVFSGIVGAGSTLISMFIV  345

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             D++GR++L ++GGI MFV+Q+ +GGVM  +LGDQG +SKG++++VL+LI  YVAGFG SW
Sbjct  346   DRLGRKKLFLIGGIQMFVSQVIIGGVMAVQLGDQGTVSKGYSIVVLILICVYVAGFGWSW  405

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIF LEIRSAGQSITVAV+F+FTF+V QTFLAMLCH K GIFFFFGGWV V
Sbjct  406   GPLGWLVPSEIFQLEIRSAGQSITVAVSFVFTFIVAQTFLAMLCHFKAGIFFFFGGWVVV  465

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT F+ LLLPETKN+PIE+MD VWREHWFWKK V
Sbjct  466   MTAFMQLLLPETKNVPIEQMDGVWREHWFWKKYV  499



>ref|XP_007038318.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY22819.1| Major facilitator superfamily protein [Theobroma cacao]
Length=510

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/454 (75%), Positives = 385/454 (85%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF  V TKMKED+ K+SNYCKFDS+LLTSFTSSLYIAGL +S  AS V
Sbjct  44    GGVTSMEPFLKKFFPKVNTKMKEDT-KISNYCKFDSQLLTSFTSSLYIAGLISSFFASPV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR PSILIGG AFLAG+ALGGAA NVYMLIFGRVLLG+GVGFANQ+VPLY+SEMA 
Sbjct  103   TRAFGRKPSILIGGAAFLAGSALGGAAFNVYMLIFGRVLLGVGVGFANQSVPLYISEMAL  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              ++RG MN+ FQ  VGIGVL AN+IN+GTEKI  GWGWR+SL LAA+PA+ LTIGA++LP
Sbjct  163   PRHRGAMNIGFQCGVGIGVLSANIINFGTEKIEGGWGWRISLALAALPASFLTIGALLLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQ  N+H  AK  LQR+RGT DVQAELDDL+ AS IS+T   PF+ I+ R+YRP
Sbjct  223   ETPNSLIQNSNNHQKAKSVLQRIRGTADVQAELDDLIKASSISKTTNHPFQKIIQRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             Q VMA A+PFFQQVTGINVI FYAP+LFRTIG GESA+LMSAVVTG VG   TF SML V
Sbjct  283   QFVMAIALPFFQQVTGINVITFYAPILFRTIGQGESASLMSAVVTGLVGTTATFVSMLAV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DKVGRR LL++GGI M VTQ+ +GG+M A LGD GGLSKG+A LVL LI  YVAGF  SW
Sbjct  343   DKVGRRALLMIGGIQMLVTQIIIGGIMAALLGDHGGLSKGYAYLVLALICVYVAGFAWSW  402

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIFPLEIRSAGQSITVAV FLFTF++ QTFLAMLCH K GIFFFFGGWV +
Sbjct  403   GPLGWLVPSEIFPLEIRSAGQSITVAVGFLFTFIIAQTFLAMLCHFKSGIFFFFGGWVVL  462

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY  LPETKN+PIE+M+ VWREHWFWK+IV
Sbjct  463   MTAFVYFFLPETKNVPIEQMEKVWREHWFWKRIV  496



>gb|AFO84095.1| hexose transport protein [Actinidia polygama]
Length=508

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/454 (74%), Positives = 393/454 (87%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSME FLK+FF +VYTKMKED+ K+SNYCKFDS+LLTSFTSSLYIAGL AS  ASSV
Sbjct  44    GGVTSMESFLKKFFPEVYTKMKEDT-KISNYCKFDSQLLTSFTSSLYIAGLIASFFASSV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T+A GR PSI+IGG AFLAGAALGGAA+NVYMLIFGRVLLG GVGFANQ+VPLYLSEMAP
Sbjct  103   TKAYGRKPSIVIGGAAFLAGAALGGAALNVYMLIFGRVLLGTGVGFANQSVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A+YRG +N  FQ  +GIG LIANLINYGTEKI  GWGWR+SLG+AA+PA++LT+GA+ LP
Sbjct  163   ARYRGAINNGFQFSIGIGSLIANLINYGTEKIEGGWGWRISLGMAALPASILTLGAIFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLI+R   H  AK  LQ+VRGT+DVQ EL+DL+ AS+IS+T    F+ I  R+YRP
Sbjct  223   ETPNSLIERSKHHQKAKSMLQKVRGTEDVQEELEDLIKASDISKTTTNQFRKICLRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMAFA+PFFQQVTGINVIAFYAPV FRTIGLGESA+LMSA VTG +G+ +TF SML+V
Sbjct  283   QLVMAFALPFFQQVTGINVIAFYAPVFFRTIGLGESASLMSAGVTGLLGMASTFVSMLIV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR+LL+VGG +M V+Q+ VGG++ A+LGD GGLSK +AV VL++I +Y+ G+ +SW
Sbjct  343   DKLGRRKLLMVGGAIMLVSQVMVGGLLAAELGDHGGLSKWYAVTVLIVICTYIMGYAVSW  402

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWLIPSEIFPLEIRSAGQSI VAVNFL TF+V QT L MLCH KYGIFFF+GGWVA+
Sbjct  403   GPLGWLIPSEIFPLEIRSAGQSINVAVNFLCTFIVAQTSLVMLCHFKYGIFFFYGGWVAL  462

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVYL LPETK +PIE+MD VWR HWFWK+IV
Sbjct  463   MTVFVYLFLPETKGIPIEQMDKVWRGHWFWKRIV  496



>ref|XP_006490155.1| PREDICTED: hexose carrier protein HEX6-like [Citrus sinensis]
Length=511

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/454 (73%), Positives = 396/454 (87%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFL++FF +V+ KMKED+ K+SNYCKFDS+LLTSFTSSLY+AGL AS +ASSV
Sbjct  47    GGVTSMEPFLEKFFPEVHRKMKEDT-KISNYCKFDSQLLTSFTSSLYVAGLVASFVASSV  105

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR PS+L+GG AFLAG+ALGGAA+NVYMLIFGR+LLG+GVGFANQ+VPLYLSEMAP
Sbjct  106   TRAFGRKPSVLMGGAAFLAGSALGGAAVNVYMLIFGRLLLGVGVGFANQSVPLYLSEMAP  165

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A+YRG +N  FQ  +GIG L AN INYGTE+I+ GWGWRVSL LAAVPA++LT+GA+ LP
Sbjct  166   ARYRGAINNGFQFSIGIGALAANFINYGTEQIKGGWGWRVSLALAAVPASILTLGALFLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR++DH  AK  LQRVRGT+DV+AE DDL+ AS  ++TI  PFK I+ R+YRP
Sbjct  226   ETPNSLIQRKSDHQKAKLMLQRVRGTNDVEAEFDDLLKASSTAKTINHPFKKIIQRKYRP  285

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QL+MA A+PFFQQVTGINVIAFYAP+LFRTIGLG SA+L+S+V +G VG  +T  SM +V
Sbjct  286   QLLMAMAIPFFQQVTGINVIAFYAPLLFRTIGLGVSASLLSSVFSGIVGAGSTLISMFIV  345

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             D++GR++L ++GGI MFV+Q+ +GGVM  +LGDQG +SKG+++LVL+LI  YVAGFG SW
Sbjct  346   DRLGRKKLFLIGGIQMFVSQVIIGGVMAVQLGDQGTVSKGYSILVLILICVYVAGFGWSW  405

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIF LEIRSAGQSITVAV+F+FTF+V QTFLAMLCH K GIFFFFGGWV V
Sbjct  406   GPLGWLVPSEIFQLEIRSAGQSITVAVSFVFTFIVAQTFLAMLCHFKAGIFFFFGGWVVV  465

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT F+ LLLPETK++PIE+MD VWREHWFWKK V
Sbjct  466   MTAFMQLLLPETKSVPIEQMDRVWREHWFWKKYV  499



>ref|XP_003598178.1| Hexose carrier [Medicago truncatula]
 gb|AES68429.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=509

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/454 (73%), Positives = 387/454 (85%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM PFL++FF DVYTKMK+D+ K+SNYCKFDS+LLT+FTSSLYIAGL AS  ASS+
Sbjct  45    GGVTSMVPFLEKFFPDVYTKMKQDN-KISNYCKFDSQLLTTFTSSLYIAGLLASFFASSI  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR PSIL+GG AFL GAALGGAA+N+YMLI GRVLLG+G+GFANQAVPLYLSEMA 
Sbjct  104   TRAFGRKPSILVGGAAFLIGAALGGAALNIYMLILGRVLLGVGIGFANQAVPLYLSEMAL  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              +YRG +N+ FQLCVGIGVL ANLIN+GTEKI+DGWGWR+SL +AAVPAT+LT+GA  LP
Sbjct  164   PRYRGAINIGFQLCVGIGVLSANLINFGTEKIKDGWGWRISLAMAAVPATILTLGAFFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNS+IQ   +H  AK  LQ +RGT DVQ E +DL+ AS +S +I+ PFKNIL R+YRP
Sbjct  224   ETPNSIIQNSKNHQKAKLMLQSIRGTHDVQQEFEDLIEASIMSNSIKHPFKNILQRKYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA A+PFFQQ TGINVI+FYAP+LF TIGLGESA+L+SAV+ G VG  +TF SML+V
Sbjct  284   QLVMAIAIPFFQQFTGINVISFYAPILFLTIGLGESASLLSAVMVGIVGTTSTFISMLIV  343

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR L I GGI MF +Q+ +G +M A+LGD G +SK +A L+L+LI  YVAGF  SW
Sbjct  344   DKLGRRVLFISGGIQMFFSQILIGSIMAAQLGDHGEISKKYAYLILVLICIYVAGFAWSW  403

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIFPLEIRSA QSITVAVNFLFTF+V QTFL+MLCH KYG FFFFGGWV +
Sbjct  404   GPLGWLVPSEIFPLEIRSAAQSITVAVNFLFTFIVAQTFLSMLCHFKYGTFFFFGGWVVI  463

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY LLPETKN+PIE+MD VWREH+FWK+IV
Sbjct  464   MTVFVYFLLPETKNVPIEQMDRVWREHFFWKRIV  497



>gb|KCW46315.1| hypothetical protein EUGRSUZ_K00178 [Eucalyptus grandis]
Length=509

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/454 (72%), Positives = 390/454 (86%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF DVY KM ED+ K+SNYCK+D++LLT FTSSLYI+GL AS  ASSV
Sbjct  45    GGVTSMEPFLKKFFRDVYDKMNEDT-KISNYCKYDNQLLTLFTSSLYISGLVASFFASSV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR PSIL+GG +FLAG+ALGGAA NVYMLIFGR+LLG+GVGFANQ+VPLY+SEMAP
Sbjct  104   TRAFGRKPSILVGGASFLAGSALGGAASNVYMLIFGRILLGVGVGFANQSVPLYISEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              ++RG  N  FQ CVGIGVL ANLINYGTEKI  GWGWR+SL +AAVPA++LT+GA+ LP
Sbjct  164   PRHRGLFNNGFQFCVGIGVLSANLINYGTEKIEGGWGWRISLAMAAVPASILTVGALFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ET NSLIQR +DH+  +  L+R+RG +DVQAEL+DLV AS IS+T++ PF+NI+ R YRP
Sbjct  224   ETANSLIQRSDDHEKVETMLRRIRGVNDVQAELNDLVKASSISKTVDHPFRNIIQREYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVM+ A+PFFQQVTGINVI+FYAPVLFRTIGLGESA+L+SAVVTG VG ++TF SML+V
Sbjct  284   QLVMSIAIPFFQQVTGINVISFYAPVLFRTIGLGESASLLSAVVTGVVGTISTFISMLVV  343

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR+L ++GG  M  +Q  VGG+M +KLGD GG+S+ +  LVL+LI  YVAGF  SW
Sbjct  344   DKLGRRKLFMIGGFQMLASQAMVGGIMASKLGDHGGISQAYGYLVLVLICIYVAGFAWSW  403

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEI+PLEIRSAGQSITVAV FLFTFLV QTFL MLCH K GIFFFFGGWV +
Sbjct  404   GPLGWLVPSEIYPLEIRSAGQSITVAVGFLFTFLVAQTFLLMLCHFKSGIFFFFGGWVVI  463

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVYLLLPETKN+PIE+M+ +WREHWFWK ++
Sbjct  464   MTAFVYLLLPETKNVPIEQMNKIWREHWFWKNVM  497



>ref|XP_004309029.1| PREDICTED: hexose carrier protein HEX6-like [Fragaria vesca subsp. 
vesca]
Length=507

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/454 (74%), Positives = 386/454 (85%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFL++FF +VYT+MK D+ K+SNYCKFDSELLTSFTSSLYIAGL AS+ ASSV
Sbjct  44    GGVTSMEPFLEKFFPEVYTRMKSDA-KISNYCKFDSELLTSFTSSLYIAGLVASVFASSV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR PSIL GG AFLAGAAL GAA+N+YMLI GR+LLG+GVGFANQ+VPLYLSEMAP
Sbjct  103   TRAYGRKPSILAGGAAFLAGAALNGAAVNIYMLILGRILLGVGVGFANQSVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             +KYRG ++  FQ  VGIG L ANLINYGT+KI  GWGWR+SL LAAVPA+VLT+GA  LP
Sbjct  163   SKYRGAISNGFQFSVGIGALSANLINYGTQKIEGGWGWRISLALAAVPASVLTLGAFFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR  DH  A   L+R+RG +DVQ EL+DL+ A+ IS+TI+ PF+ IL R+YRP
Sbjct  223   ETPNSLIQRSVDHQTAMLMLRRIRGVEDVQLELEDLIKANNISKTIQHPFRKILERKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA A+PFFQQVTGINVIAFYAP+LFRTIGLGESA+L+SAV+TG VG ++TF SML+V
Sbjct  283   QLVMAIAIPFFQQVTGINVIAFYAPILFRTIGLGESASLLSAVMTGVVGTISTFISMLIV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK GRR L I GG+ M V+QM VGGVM  +LGD GG+S G+A LVL+LI  YVAGFG SW
Sbjct  343   DKFGRRALFIGGGLQMLVSQMMVGGVMATQLGDHGGVSTGYAYLVLVLIGIYVAGFGWSW  402

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIFPLEIRSAGQSI V VNFLFTF+V QTFLAMLCH K GIFFFFGGWV V
Sbjct  403   GPLGWLVPSEIFPLEIRSAGQSINVVVNFLFTFIVAQTFLAMLCHFKAGIFFFFGGWVMV  462

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY  LPETKN+P+E M+ VW EHWFW++IV
Sbjct  463   MTLFVYFFLPETKNVPMETMESVWVEHWFWRRIV  496



>ref|NP_001268206.1| hexose transporter-like [Vitis vinifera]
 gb|AAT09978.1| putative hexose transporter [Vitis vinifera]
Length=508

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/455 (73%), Positives = 392/455 (86%), Gaps = 1/455 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FLK+FF +VY +MKED+ K+SNYCKFDS+LLTSFTSSLYIAGL AS +AS +
Sbjct  44    GGVTSMDSFLKKFFPEVYKRMKEDT-KISNYCKFDSQLLTSFTSSLYIAGLVASFVASWI  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T+  GR P+IL GG AFL G+ALGGAA NVYM+I GR+LLG+GVGFANQAVPLYLSEMAP
Sbjct  103   TKKFGRKPTILAGGAAFLIGSALGGAAFNVYMVILGRILLGVGVGFANQAVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              +YRG +N  FQ  +G+G L ANLIN+GTEKI+ GWGWRVSL LAAVPA++LT+GA+ LP
Sbjct  163   PRYRGAINNGFQFSIGVGALSANLINFGTEKIKGGWGWRVSLALAAVPASILTLGALFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR  D+  A+  LQRVRGT+DVQAELDDLV AS +++TI  PFK IL R+YRP
Sbjct  223   ETPNSLIQRSKDYGKAELMLQRVRGTNDVQAELDDLVKASSLAKTINDPFKKILQRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA A+PFFQQVTGINVIAFYAPVLFR IGLG SA+L+SAVVTG VG+ +TF SML+V
Sbjct  283   QLVMAIAIPFFQQVTGINVIAFYAPVLFRAIGLGVSASLLSAVVTGVVGMASTFISMLIV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR L +VGGI M V+Q+ VGG++ A+LGD GG+SK +A LVLLLI  YVAGFG SW
Sbjct  343   DKLGRRVLFLVGGIQMLVSQIMVGGILAAELGDHGGVSKVYAFLVLLLICVYVAGFGWSW  402

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIFPLEIRSAGQSITVAV+F+FTF+V QTFL+MLCH K GIFFFFGGWV +
Sbjct  403   GPLGWLVPSEIFPLEIRSAGQSITVAVSFIFTFIVAQTFLSMLCHFKSGIFFFFGGWVVL  462

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIVV  1447
             MT FVY LLPETK++PIE+MD VW+EHWFWK+IVV
Sbjct  463   MTAFVYYLLPETKSIPIEQMDRVWKEHWFWKRIVV  497



>gb|ADP37128.1| hexose transporter [Vitis vinifera]
Length=508

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/455 (73%), Positives = 392/455 (86%), Gaps = 1/455 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FLK+FF +VY +MKED+ K+SNYCKFDS+LLTSFTSSLYIAGL AS +AS +
Sbjct  44    GGVTSMDSFLKKFFPEVYKRMKEDT-KISNYCKFDSQLLTSFTSSLYIAGLVASFVASWI  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T+  GR P+IL GG AFL G+ALGGAA NVYM+I GR+LLG+GVGFANQAVPLYLSEMAP
Sbjct  103   TKKFGRKPTILAGGAAFLIGSALGGAAFNVYMVILGRILLGVGVGFANQAVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              +YRG +N  FQ  +G+G L ANLIN+GTEKI+ GWGWRVSL LAAVPA++LT+GA+ LP
Sbjct  163   PRYRGAINNGFQFSIGVGALSANLINFGTEKIKGGWGWRVSLALAAVPASILTLGALFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR  D+  A+  LQRVRGT+DVQAELDDLV AS +++TI  PFK IL R+YRP
Sbjct  223   ETPNSLIQRSKDYGKAELMLQRVRGTNDVQAELDDLVKASSLAKTINDPFKKILQRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA A+PFFQQVTGINVIAFYAPVLFR IGLG SA+L+SAVVTG VG+ +TF SML+V
Sbjct  283   QLVMAIAIPFFQQVTGINVIAFYAPVLFRAIGLGVSASLLSAVVTGVVGMASTFISMLIV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR L +VGGI M V+Q+ VGG++ A+LGD GG+SK +A LVLLLI  YVAGFG SW
Sbjct  343   DKLGRRVLFLVGGIQMLVSQIMVGGILAAELGDHGGVSKVYAFLVLLLICVYVAGFGWSW  402

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIFPLEIRSAGQSITVAV+F+FTF+V QTFL+MLCH K GIFFFFGGWV +
Sbjct  403   GPLGWLVPSEIFPLEIRSAGQSITVAVSFIFTFIVAQTFLSMLCHFKSGIFFFFGGWVVL  462

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIVV  1447
             MT FVY LLPETK++PIE+MD VW+EHWFWK+IVV
Sbjct  463   MTAFVYYLLPETKSIPIEQMDRVWKEHWFWKRIVV  497



>ref|XP_010035050.1| PREDICTED: hexose carrier protein HEX6-like isoform X2 [Eucalyptus 
grandis]
Length=595

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/454 (72%), Positives = 390/454 (86%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF DVY KM ED+ K+SNYCK+D++LLT FTSSLYI+GL AS  ASSV
Sbjct  131   GGVTSMEPFLKKFFRDVYDKMNEDT-KISNYCKYDNQLLTLFTSSLYISGLVASFFASSV  189

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR PSIL+GG +FLAG+ALGGAA NVYMLIFGR+LLG+GVGFANQ+VPLY+SEMAP
Sbjct  190   TRAFGRKPSILVGGASFLAGSALGGAASNVYMLIFGRILLGVGVGFANQSVPLYISEMAP  249

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              ++RG  N  FQ CVGIGVL ANLINYGTEKI  GWGWR+SL +AAVPA++LT+GA+ LP
Sbjct  250   PRHRGLFNNGFQFCVGIGVLSANLINYGTEKIEGGWGWRISLAMAAVPASILTVGALFLP  309

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ET NSLIQR +DH+  +  L+R+RG +DVQAEL+DLV AS IS+T++ PF+NI+ R YRP
Sbjct  310   ETANSLIQRSDDHEKVETMLRRIRGVNDVQAELNDLVKASSISKTVDHPFRNIIQREYRP  369

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVM+ A+PFFQQVTGINVI+FYAPVLFRTIGLGESA+L+SAVVTG VG ++TF SML+V
Sbjct  370   QLVMSIAIPFFQQVTGINVISFYAPVLFRTIGLGESASLLSAVVTGVVGTISTFISMLVV  429

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR+L ++GG  M  +Q  VGG+M +KLGD GG+S+ +  LVL+LI  YVAGF  SW
Sbjct  430   DKLGRRKLFMIGGFQMLASQAMVGGIMASKLGDHGGISQAYGYLVLVLICIYVAGFAWSW  489

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEI+PLEIRSAGQSITVAV FLFTFLV QTFL MLCH K GIFFFFGGWV +
Sbjct  490   GPLGWLVPSEIYPLEIRSAGQSITVAVGFLFTFLVAQTFLLMLCHFKSGIFFFFGGWVVI  549

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVYLLLPETKN+PIE+M+ +WREHWFWK ++
Sbjct  550   MTAFVYLLLPETKNVPIEQMNKIWREHWFWKNVM  583



>ref|XP_006385129.1| hypothetical protein POPTR_0004s24170g [Populus trichocarpa]
 gb|ERP62926.1| hypothetical protein POPTR_0004s24170g [Populus trichocarpa]
Length=509

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/455 (72%), Positives = 383/455 (84%), Gaps = 2/455 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF +VY +MKED+ K+SNYCKFDS+LLTSFTSSLY+AGL AS  ASS+
Sbjct  44    GGVTSMEPFLKKFFPEVYARMKEDT-KISNYCKFDSQLLTSFTSSLYVAGLVASFFASSI  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR PSIL GG AFL+G+AL GAA N+YMLIFGRVLLG+GVGFANQAVPLYLSEMAP
Sbjct  103   TRYFGRKPSILAGGAAFLSGSALNGAATNLYMLIFGRVLLGVGVGFANQAVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              +YRG +N  FQLC+ IGVL AN IN+GTEKI  GWGWR+SL + A+PAT LTIG++ LP
Sbjct  163   PRYRGAINNGFQLCIAIGVLSANFINFGTEKIEGGWGWRISLAMGAIPATFLTIGSLFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR ND   AK  LQR+RGT DV+AE +DL+ AS +S++IE P K I+ ++YRP
Sbjct  223   ETPNSLIQRFNDEQKAKTMLQRIRGTTDVEAEFNDLIKASLVSKSIEHPIKKIIQKKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAAL-MSavvtgavgivttFASMLL  979
             QLVMA A+PFFQQVTGINVI+FYAP+LFRTIGL ES +L MSA++ G VG  +TF SML+
Sbjct  283   QLVMAIAIPFFQQVTGINVISFYAPILFRTIGLSESVSLIMSALIAGVVGTASTFLSMLV  342

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
             VDK+GRR +LI GG+ MFV+Q+ +G +M A+LGD G ++KG+A  VL +IS YV+GF  S
Sbjct  343   VDKLGRRVMLICGGVQMFVSQIMIGSIMAAQLGDHGSINKGYAYFVLTMISIYVSGFAWS  402

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPLGWL+PSEIFPLEIRS GQSI VAVNF+FTF+V QTFLAMLCH K GIFFFFGGWVA
Sbjct  403   WGPLGWLVPSEIFPLEIRSVGQSIVVAVNFVFTFIVAQTFLAMLCHFKSGIFFFFGGWVA  462

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             VMT FVYLLLPETK +PIE MD VWREHWFWK+IV
Sbjct  463   VMTAFVYLLLPETKKVPIEVMDRVWREHWFWKRIV  497



>emb|CAN72462.1| hypothetical protein VITISV_025873 [Vitis vinifera]
Length=508

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/455 (73%), Positives = 391/455 (86%), Gaps = 1/455 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FLK+FF  VY +MKED+ K+SNYCKFDS+LLTSFTSSLYIAGL AS +AS +
Sbjct  44    GGVTSMDSFLKKFFPXVYKRMKEDT-KISNYCKFDSQLLTSFTSSLYIAGLVASFVASWI  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T+  GR P+IL GG AFL G+ALGGAA NVYM+I GR+LLG+GVGFANQAVPLYLSEMAP
Sbjct  103   TKKFGRKPTILAGGAAFLIGSALGGAAFNVYMVILGRILLGVGVGFANQAVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              +YRG +N  FQ  +G+G L ANLIN+GTEKI+ GWGWRVSL LAAVPA++LT+GA+ LP
Sbjct  163   PRYRGAINNGFQFSIGVGALSANLINFGTEKIKGGWGWRVSLALAAVPASILTLGALFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR  D+  A+  LQRVRGT+DVQAELDDLV AS +++TI  PFK IL R+YRP
Sbjct  223   ETPNSLIQRSKDYGKAELMLQRVRGTNDVQAELDDLVKASSLAKTINDPFKKILQRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA A+PFFQQVTGINVIAFYAPVLFR IGLG SA+L+SAVVTG VG+ +TF SML+V
Sbjct  283   QLVMAIAIPFFQQVTGINVIAFYAPVLFRAIGLGVSASLLSAVVTGVVGMASTFISMLIV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR L +VGGI M V+Q+ VGG++ A+LGD GG+SK +A LVLLLI  YVAGFG SW
Sbjct  343   DKLGRRVLFLVGGIQMLVSQIMVGGILAAELGDHGGVSKVYAFLVLLLICVYVAGFGWSW  402

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIFPLEIRSAGQSITVAV+F+FTF+V QTFL+MLCH K GIFFFFGGWV +
Sbjct  403   GPLGWLVPSEIFPLEIRSAGQSITVAVSFIFTFIVAQTFLSMLCHFKSGIFFFFGGWVVL  462

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIVV  1447
             MT FVY LLPETK++PIE+MD VW+EHWFWK+IVV
Sbjct  463   MTAFVYYLLPETKSIPIEQMDRVWKEHWFWKRIVV  497



>ref|XP_011028472.1| PREDICTED: hexose carrier protein HEX6-like isoform X1 [Populus 
euphratica]
Length=502

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/455 (72%), Positives = 383/455 (84%), Gaps = 2/455 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF +VYT+MKED+ K+SNYCKFDS++LTSFTSSLY+AGL AS  ASS+
Sbjct  44    GGVTSMEPFLKKFFPEVYTRMKEDT-KISNYCKFDSQILTSFTSSLYVAGLVASFFASSI  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR PSIL GG AFL+G+AL GAA N+YMLIFGRVLLG+GVGFANQ+VPLYLSEMAP
Sbjct  103   TRHFGRKPSILAGGSAFLSGSALNGAANNLYMLIFGRVLLGVGVGFANQSVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              +YRG +N  FQLCVGIGVL AN IN+GTEKI  GWGWR+SL  AA+PAT LTIG++ LP
Sbjct  163   PRYRGAINNGFQLCVGIGVLSANFINFGTEKIEGGWGWRISLAAAAIPATFLTIGSLFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR ND    K  LQR+RGT DV+AE +DL+ AS +S++IE P K I+ ++YRP
Sbjct  223   ETPNSLIQRFNDEQKVKTILQRIRGTTDVEAEFNDLIKASFVSKSIEHPIKKIIQKKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAAL-MSavvtgavgivttFASMLL  979
             QLVMA A+PFFQQVTGINVI+FYAP+LFRTIGL ES +L MSA++ G VG  +TF SML+
Sbjct  283   QLVMAIAIPFFQQVTGINVISFYAPILFRTIGLNESVSLIMSALIAGVVGTASTFLSMLV  342

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
             VDK+GRR +LI GG+ MFV+Q+ +G +M A+LGD G + KG+A  VL +IS YV+GF  S
Sbjct  343   VDKLGRRAMLICGGVQMFVSQIMIGSIMAAQLGDHGSIDKGYAYFVLAMISIYVSGFAWS  402

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPLGWL+PSEIFPLEIRS GQSI VAVNF+FTF+V QTFLAMLCH K GIFFFFGGWVA
Sbjct  403   WGPLGWLVPSEIFPLEIRSVGQSIVVAVNFVFTFVVAQTFLAMLCHFKSGIFFFFGGWVA  462

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             VMT FVYLLLPETK +P+E MD VWREHWFWK+IV
Sbjct  463   VMTAFVYLLLPETKKVPMEVMDRVWREHWFWKRIV  497



>ref|XP_010035048.1| PREDICTED: hexose carrier protein HEX6-like isoform X1 [Eucalyptus 
grandis]
Length=662

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/454 (72%), Positives = 390/454 (86%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF DVY KM ED+ K+SNYCK+D++LLT FTSSLYI+GL AS  ASSV
Sbjct  198   GGVTSMEPFLKKFFRDVYDKMNEDT-KISNYCKYDNQLLTLFTSSLYISGLVASFFASSV  256

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR PSIL+GG +FLAG+ALGGAA NVYMLIFGR+LLG+GVGFANQ+VPLY+SEMAP
Sbjct  257   TRAFGRKPSILVGGASFLAGSALGGAASNVYMLIFGRILLGVGVGFANQSVPLYISEMAP  316

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              ++RG  N  FQ CVGIGVL ANLINYGTEKI  GWGWR+SL +AAVPA++LT+GA+ LP
Sbjct  317   PRHRGLFNNGFQFCVGIGVLSANLINYGTEKIEGGWGWRISLAMAAVPASILTVGALFLP  376

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ET NSLIQR +DH+  +  L+R+RG +DVQAEL+DLV AS IS+T++ PF+NI+ R YRP
Sbjct  377   ETANSLIQRSDDHEKVETMLRRIRGVNDVQAELNDLVKASSISKTVDHPFRNIIQREYRP  436

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVM+ A+PFFQQVTGINVI+FYAPVLFRTIGLGESA+L+SAVVTG VG ++TF SML+V
Sbjct  437   QLVMSIAIPFFQQVTGINVISFYAPVLFRTIGLGESASLLSAVVTGVVGTISTFISMLVV  496

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR+L ++GG  M  +Q  VGG+M +KLGD GG+S+ +  LVL+LI  YVAGF  SW
Sbjct  497   DKLGRRKLFMIGGFQMLASQAMVGGIMASKLGDHGGISQAYGYLVLVLICIYVAGFAWSW  556

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEI+PLEIRSAGQSITVAV FLFTFLV QTFL MLCH K GIFFFFGGWV +
Sbjct  557   GPLGWLVPSEIYPLEIRSAGQSITVAVGFLFTFLVAQTFLLMLCHFKSGIFFFFGGWVVI  616

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVYLLLPETKN+PIE+M+ +WREHWFWK ++
Sbjct  617   MTAFVYLLLPETKNVPIEQMNKIWREHWFWKNVM  650


 Score = 90.5 bits (223),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = +2

Query  131  VYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSVTRACGRTPSiliggva  310
            +Y KMKED+ K+SN CK+DS LLTSFTSSLY +GL AS   SSVT A  R PS L GG +
Sbjct  1    MYDKMKEDT-KISNCCKYDSRLLTSFTSSLYRSGLVASFFPSSVTGAFERKPSTLAGGAS  59

Query  311  flagaalggaaiNVYMLIFGRVLLGIGVGFANQ  409
            FLAG   GGAA NV+ML FGR+LLG GV FANQ
Sbjct  60   FLAGLPPGGAACNVHMLTFGRILLGAGVSFANQ  92



>ref|XP_007038317.1| Major facilitator superfamily protein, putative [Theobroma cacao]
 gb|EOY22818.1| Major facilitator superfamily protein, putative [Theobroma cacao]
Length=507

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/454 (72%), Positives = 381/454 (84%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+PFLK+FF +VY +MK ++ K+SNYCKFDS+LLT FTSSLYIAGL AS  AS V
Sbjct  44    GGVTSMDPFLKKFFPNVYRRMKANT-KISNYCKFDSQLLTLFTSSLYIAGLIASFFASPV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR  S+L+ GVA LAG+ALGGAA NVYML+FGRV LGIG+GFANQ++PLY+SEMA 
Sbjct  103   TRAFGRKASMLVAGVAVLAGSALGGAASNVYMLVFGRVFLGIGLGFANQSIPLYISEMAL  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              K RG MN+ F+  +G GVLIAN+INYGTEKI  GWGWR+SL LAAVPA++LT+GA++LP
Sbjct  163   PKQRGAMNIIFECGIGFGVLIANIINYGTEKIEGGWGWRISLSLAAVPASILTLGALILP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSLIQ  NDH+ AKR LQR+RGT +VQAELDDL+ AS IS+TI  PFK I+ R+YRP
Sbjct  223   DTPNSLIQTTNDHEKAKRVLQRIRGTINVQAELDDLIQASSISKTINNPFKKIIQRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA A+PFF Q+TGINVI FYAP+LFRTIGL ES++L+SAVV   V     F SM  V
Sbjct  283   QLVMAAAIPFFAQMTGINVITFYAPILFRTIGLHESSSLLSAVVIRLVSTSCIFISMFAV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK GRR L ++GGILM  TQ+ +GG+M A LGD GGLSK    LVL+L+  YV+GFGLSW
Sbjct  343   DKHGRRVLFMIGGILMLATQITIGGLMTALLGDHGGLSKASGYLVLVLVCIYVSGFGLSW  402

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEI+PLEIRSAGQSITVAV+F F FLVGQTFLAMLCH+K GIFFFFGGWVAV
Sbjct  403   GPLGWLVPSEIYPLEIRSAGQSITVAVSFFFCFLVGQTFLAMLCHMKSGIFFFFGGWVAV  462

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MTTFVYLLLPETKN+PIEKM+ VWREHW WK+IV
Sbjct  463   MTTFVYLLLPETKNVPIEKMEKVWREHWLWKRIV  496



>gb|EYU20201.1| hypothetical protein MIMGU_mgv1a005029mg [Erythranthe guttata]
Length=500

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/456 (74%), Positives = 390/456 (86%), Gaps = 2/456 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF  VYT+MK+D   +SNYCKFDSELLT FTSSLY+AGL AS  AS V
Sbjct  44    GGVTSMEPFLKKFFPQVYTRMKDDK-NISNYCKFDSELLTLFTSSLYLAGLVASFFASFV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T A GR PSI+ GG AFLAGAAL GAA+++YMLI GRVLLG+GVGFANQA PLYLSEMAP
Sbjct  103   TGAYGRKPSIVAGGAAFLAGAALNGAAVSIYMLILGRVLLGVGVGFANQAFPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             AKYRG  N  FQL VGIG L ANLINYGTEKI  G+GWR+SL +AAVPA+ LT+GA+ LP
Sbjct  163   AKYRGAFNNGFQLSVGIGALSANLINYGTEKIDGGFGWRISLAMAAVPASALTLGALFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQ  N+H+ AK+ LQ++RGT++V+ ELDDL+ ASE S+  + P+  I  R YRP
Sbjct  223   ETPNSLIQLNNNHEKAKKMLQKIRGTENVEMELDDLIKASENSKIAKNPYGKIAGRNYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             Q VM+ A+PFFQQVTGINVIAFYAP+LFRTIG GESA+L+SAV+TG VGI TTFASM++V
Sbjct  283   QFVMSIAIPFFQQVTGINVIAFYAPILFRTIGFGESASLLSAVMTGVVGIATTFASMVIV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQ-GGLSKGWAVLVLLLISSYVAGFGLS  1159
             D+ GRR LLI+GGI+MF +QM VG VM A+L D+ GGLS+G+A LVL+LI  YVAGFG+S
Sbjct  343   DRFGRRFLLIIGGIVMFASQMIVGSVMAAELDDRGGGLSRGYADLVLVLIGVYVAGFGVS  402

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPLGWLIPSEIFP+EIRSAGQSI+VAVNFLFTFLVGQTFL MLC LK GIFFFFGGWVA
Sbjct  403   WGPLGWLIPSEIFPMEIRSAGQSISVAVNFLFTFLVGQTFLTMLCRLKSGIFFFFGGWVA  462

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIVV  1447
             VMT FVYLLLPETKN+PIE+M++VWREHWFWKK VV
Sbjct  463   VMTVFVYLLLPETKNIPIEQMEMVWREHWFWKKFVV  498



>gb|KDP22453.1| hypothetical protein JCGZ_26284 [Jatropha curcas]
Length=508

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/455 (72%), Positives = 383/455 (84%), Gaps = 4/455 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSME FL++FF +VY KMKED+ ++SNYCKFDS+LLTSFTSSLY+AGL AS +ASSV
Sbjct  44    GGVTSMESFLRKFFPEVYNKMKEDT-EISNYCKFDSQLLTSFTSSLYLAGLIASFVASSV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR PSIL GG AFL+G+AL GAA N+YMLIFGRVLLG+GVGFANQ+VPLYLSEMAP
Sbjct  103   TRYFGRKPSILAGGAAFLSGSALNGAASNLYMLIFGRVLLGVGVGFANQSVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A+YRG +N  FQLCVGIGVL AN IN+GTEKI  GWGWR+SL +AAVPA +LT+GA+ LP
Sbjct  163   AQYRGAINNGFQLCVGIGVLSANFINFGTEKIEGGWGWRISLAMAAVPALILTLGAIFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR NDH  AK  LQR+RGT +VQAELDDL+ AS IS  I+ PFK I+ R+YRP
Sbjct  223   ETPNSLIQRSNDHQKAKAMLQRIRGTANVQAELDDLIRASSIS--IKHPFKKIIQRKYRP  280

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAAL-MSavvtgavgivttFASMLL  979
             QLVMA A+PFFQQVTGINVI+FYAP+LFRTIGL ES +L MSA++ G  G   TF SML+
Sbjct  281   QLVMAIAIPFFQQVTGINVISFYAPILFRTIGLSESLSLIMSALIAGVAGTTATFISMLV  340

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
             VD++GRR + I GG  MF++Q+A+GG+M A+LGD G + KG+A LVL++I  YV GF  S
Sbjct  341   VDRLGRRAMFIFGGAQMFLSQIAIGGIMAAELGDHGSIGKGYASLVLIMICVYVTGFAWS  400

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPLGWL+PSEIF LEIRSAGQ I VAVNFLFTF+V QTFL MLC+ K GIFFFFGGWVA
Sbjct  401   WGPLGWLVPSEIFQLEIRSAGQGIVVAVNFLFTFVVAQTFLTMLCYFKSGIFFFFGGWVA  460

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             VMT FV+ LLPETKN+PIE MD+VW+EHWFWK+IV
Sbjct  461   VMTAFVFFLLPETKNMPIELMDIVWKEHWFWKRIV  495



>gb|KEH32841.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=460

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/449 (72%), Positives = 382/449 (85%), Gaps = 1/449 (0%)
 Frame = +2

Query  98    MEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSVTRACG  277
             M PFL++FF DVYTKMK+D+ K+SNYCKFDS+LLT+FTSSLYIAGL AS  ASS+TRA G
Sbjct  1     MVPFLEKFFPDVYTKMKQDN-KISNYCKFDSQLLTTFTSSLYIAGLLASFFASSITRAFG  59

Query  278   RTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAPAKYRG  457
             R PSIL+GG AFL GAALGGAA+N+YMLI GRVLLG+G+GFANQAVPLYLSEMA  +YRG
Sbjct  60    RKPSILVGGAAFLIGAALGGAALNIYMLILGRVLLGVGIGFANQAVPLYLSEMALPRYRG  119

Query  458   GMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLPETPNS  637
              +N+ FQLCVGIGVL ANLIN+GTEKI+DGWGWR+SL +AAVPAT+LT+GA  LPETPNS
Sbjct  120   AINIGFQLCVGIGVLSANLINFGTEKIKDGWGWRISLAMAAVPATILTLGAFFLPETPNS  179

Query  638   LIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRPQLVMA  817
             +IQ   +H  AK  LQ +RGT DVQ E +DL+ AS +S +I+ PFKNIL R+YRPQLVMA
Sbjct  180   IIQNSKNHQKAKLMLQSIRGTHDVQQEFEDLIEASIMSNSIKHPFKNILQRKYRPQLVMA  239

Query  818   FAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLVDKVGR  997
              A+PFFQQ TGINVI+FYAP+LF TIGLGESA+L+SAV+ G VG  +TF SML+VDK+GR
Sbjct  240   IAIPFFQQFTGINVISFYAPILFLTIGLGESASLLSAVMVGIVGTTSTFISMLIVDKLGR  299

Query  998   RRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSWGPLGW  1177
             R L I GGI MF +Q+ +G +M A+LGD G +SK +A L+L+LI  YVAGF  SWGPLGW
Sbjct  300   RVLFISGGIQMFFSQILIGSIMAAQLGDHGEISKKYAYLILVLICIYVAGFAWSWGPLGW  359

Query  1178  LIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAVMTTFV  1357
             L+PSEIFPLEIRSA QSITVAVNFLFTF+V QTFL+MLCH KYG FFFFGGWV +MT FV
Sbjct  360   LVPSEIFPLEIRSAAQSITVAVNFLFTFIVAQTFLSMLCHFKYGTFFFFGGWVVIMTVFV  419

Query  1358  YLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             Y LLPETKN+PIE+MD VWREH+FWK+IV
Sbjct  420   YFLLPETKNVPIEQMDRVWREHFFWKRIV  448



>ref|XP_009370442.1| PREDICTED: hexose carrier protein HEX6-like [Pyrus x bretschneideri]
Length=508

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/454 (76%), Positives = 388/454 (85%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF +V TKMK D+ K+SNYCKFDSELLTSFTSSLYIAGL ASL AS V
Sbjct  44    GGVTSMEPFLKKFFPEVNTKMKSDT-KISNYCKFDSELLTSFTSSLYIAGLVASLFASLV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR PSIL GG AFLAG+AL GAA+N+YMLI GRVLLG+GVGF NQAVPLYLSEMAP
Sbjct  103   TRAYGRKPSILAGGAAFLAGSALNGAAMNIYMLILGRVLLGVGVGFGNQAVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              KYRG +N  FQ  VGIG L ANLINYGTEKI+ GWGWR+SL LAAVPA+VLT+GA  LP
Sbjct  163   PKYRGAINNGFQFSVGIGALSANLINYGTEKIKGGWGWRISLALAAVPASVLTLGAFFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR  DH  AK  LQR+RG DDVQ ELDDL+ A+ IS+ ++ PFK IL R+YRP
Sbjct  223   ETPNSLIQRSADHQTAKLMLQRIRGVDDVQVELDDLIKANNISKNMKHPFKKILERKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA A+PFFQQVTGINVIAFYAP+LFRTIGLGESA+L+S+V+TG VG ++TF SML+V
Sbjct  283   QLVMAMAIPFFQQVTGINVIAFYAPILFRTIGLGESASLLSSVMTGVVGTISTFVSMLIV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK GRR L + GGI M V+Q+ VGGVM A+LGD GG+SKG+A LVL+LI  YVAGFG SW
Sbjct  343   DKFGRRALFLAGGIQMLVSQIMVGGVMAAQLGDHGGVSKGYAYLVLVLICIYVAGFGWSW  402

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIFPLEIRSAGQSI V VNFLFTF+V QTFLAMLCH K GIFFFFGGW  V
Sbjct  403   GPLGWLVPSEIFPLEIRSAGQSINVVVNFLFTFIVAQTFLAMLCHFKAGIFFFFGGWGVV  462

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVYL LPETKN+PIEKM++VW+EHWFW++IV
Sbjct  463   MTLFVYLFLPETKNVPIEKMEIVWQEHWFWRRIV  496



>ref|XP_002323002.1| hypothetical protein POPTR_0016s12820g [Populus trichocarpa]
 gb|EEF04763.1| hypothetical protein POPTR_0016s12820g [Populus trichocarpa]
Length=509

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/454 (75%), Positives = 388/454 (85%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFL++FF  VY KMKED+ ++SNYCKFDS+LLTSFTSS+Y+AG  AS  ASS+
Sbjct  45    GGVTSMEPFLEKFFPKVYRKMKEDT-EISNYCKFDSQLLTSFTSSMYVAGFIASFFASSI  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T+A GR PSIL+GG AFLAGAALGGAA NVYMLIFGRVLLG+GVGFANQAVPLYLSEMAP
Sbjct  104   TKAFGRKPSILLGGAAFLAGAALGGAAFNVYMLIFGRVLLGVGVGFANQAVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              +YRG +N  FQ  +GIG L ANLINYGTEKI+ GWGWR+SL LAAVPAT+LT+GAV LP
Sbjct  164   PRYRGAINNGFQFSIGIGALSANLINYGTEKIKGGWGWRISLALAAVPATILTLGAVFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQ  +D + AK  LQRVRGT+DVQAELDDL+ AS IS+T+E PFK I+ R+YRP
Sbjct  224   ETPNSLIQLTDDTERAKLMLQRVRGTEDVQAELDDLIKASSISKTVEHPFKKIIKRKYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA A+PFFQQVTGINVIAFYAP+LFRTIGLGESA+LMS+VVTG VG  +TF SML+V
Sbjct  284   QLVMAIAIPFFQQVTGINVIAFYAPILFRTIGLGESASLMSSVVTGIVGTGSTFISMLVV  343

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR L I GG+ M V+Q+ VGG+M A+LGD GG+  G+A +VL+LI  YVAGF  SW
Sbjct  344   DKLGRRALFIFGGVQMLVSQIMVGGIMAAQLGDHGGIGGGYAYVVLILICIYVAGFSWSW  403

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIFPLEIRSAGQSI VAV+FLFTF+V QTFLAMLCH K GIFFFFGGWV V
Sbjct  404   GPLGWLVPSEIFPLEIRSAGQSIVVAVSFLFTFIVAQTFLAMLCHFKSGIFFFFGGWVVV  463

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY  LPETKN PIEKMD VWREH FW KIV
Sbjct  464   MTAFVYYFLPETKNTPIEKMDRVWREHGFWNKIV  497



>ref|XP_006421592.1| hypothetical protein CICLE_v10004779mg [Citrus clementina]
 gb|ESR34832.1| hypothetical protein CICLE_v10004779mg [Citrus clementina]
Length=511

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/455 (72%), Positives = 383/455 (84%), Gaps = 2/455 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF +VY KMKED+  +SNYCKFDS+LLT+FTSSLYIAGL ASL ASSV
Sbjct  45    GGVTSMEPFLKKFFPEVYRKMKEDT-NISNYCKFDSQLLTTFTSSLYIAGLIASLFASSV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR  SIL+GG AFLAG+ALGGAA N+YMLIFGRVLLG+G+GFANQ+VPLYLSEMAP
Sbjct  104   TRAFGRKASILVGGTAFLAGSALGGAAFNIYMLIFGRVLLGVGIGFANQSVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              K RG  N+ FQ+CV IGVL ANL+NYGT+KI+ GWGWR+SL +AA PA++LTIGA+ LP
Sbjct  164   PKNRGAFNIGFQVCVAIGVLSANLLNYGTQKIKGGWGWRISLAMAAAPASILTIGALFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNS+IQR NDH  A+R LQRVRGT DVQAELDDL+ A  IS+TI  PFK I+ R+YRP
Sbjct  224   ETPNSIIQRSNDHQKAERMLQRVRGTADVQAELDDLIRAGSISKTINHPFKKIIERKYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAA-LMSavvtgavgivttFASMLL  979
             QLVMA  +PFFQQVTGINVI+FYAPVLFRTI L ES + LMSA+VTG VG ++T  SM+L
Sbjct  284   QLVMAILIPFFQQVTGINVISFYAPVLFRTIKLSESTSLLMSAIVTGGVGTISTILSMIL  343

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
              D++GR+ L +VGGI M V+Q+ +G +M A+LGD GG S G+A L+L+L+  Y  GF  S
Sbjct  344   ADRLGRKVLFLVGGIQMLVSQVMIGSIMAAQLGDHGGFSSGYAYLILVLVCVYTTGFAYS  403

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPLGWL+PSEIFPLEIRSAGQSITVAV  LFTFLV QTFLAMLCH K GIFFFFGGWVA
Sbjct  404   WGPLGWLVPSEIFPLEIRSAGQSITVAVGLLFTFLVAQTFLAMLCHFKAGIFFFFGGWVA  463

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              MTTFV+  LPETKNLPIE+MD +W EHWFW++IV
Sbjct  464   FMTTFVHFFLPETKNLPIEQMDKLWAEHWFWRRIV  498



>ref|XP_009372848.1| PREDICTED: hexose carrier protein HEX6-like [Pyrus x bretschneideri]
Length=508

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/454 (76%), Positives = 388/454 (85%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF +V TKMK D+ K+SNYCKFDSELLTSFTSSLYIAGL ASL AS V
Sbjct  44    GGVTSMEPFLKKFFPEVNTKMKLDT-KISNYCKFDSELLTSFTSSLYIAGLVASLFASLV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR PSIL GG AFLAG+AL GAA+N+YMLI GRVLLG+GVGF NQAVPLYLSEMAP
Sbjct  103   TRAYGRKPSILAGGAAFLAGSALNGAAMNIYMLILGRVLLGVGVGFGNQAVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              KYRG +N  FQ  VGIG L ANLINYGTEKI+ GWGWR+SL LAAVPA+VLT+GA  LP
Sbjct  163   PKYRGAINNGFQFSVGIGALSANLINYGTEKIKGGWGWRISLALAAVPASVLTLGAFFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR  DH  AK  LQR+RG DDVQ ELDDL+ A+ IS+ ++ PFK IL R+YRP
Sbjct  223   ETPNSLIQRSADHQTAKLMLQRIRGVDDVQVELDDLIKANNISKNMKHPFKKILERKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA A+PFFQQVTGINVIAFYAP+LFRTIGLGESA+L+S+V+TG VG ++TF SML+V
Sbjct  283   QLVMAMAIPFFQQVTGINVIAFYAPILFRTIGLGESASLLSSVMTGVVGTISTFVSMLIV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK GRR L + GGI M V+Q+ VGGVM A+LGD GG+SKG+A LVL+LI  YVAGFG SW
Sbjct  343   DKFGRRALFLAGGIQMLVSQIMVGGVMAAQLGDHGGVSKGYAYLVLVLICIYVAGFGWSW  402

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIFPLEIRSAGQSI V VNFLFTF+V QTFLAMLCH K GIFFFFGGW  V
Sbjct  403   GPLGWLVPSEIFPLEIRSAGQSINVVVNFLFTFIVAQTFLAMLCHFKAGIFFFFGGWGVV  462

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVYL LPETKN+PIEKM++VW+EHWFW++IV
Sbjct  463   MTLFVYLFLPETKNVPIEKMEIVWQEHWFWRRIV  496



>ref|XP_007148729.1| hypothetical protein PHAVU_005G009500g [Phaseolus vulgaris]
 gb|ESW20723.1| hypothetical protein PHAVU_005G009500g [Phaseolus vulgaris]
Length=522

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/455 (73%), Positives = 390/455 (86%), Gaps = 2/455 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM PFL++FF +VY KMK+D+ K+SNYCKFDS+LLT+FTSSLYIAGL AS  ASSV
Sbjct  65    GGVTSMVPFLEKFFPEVYIKMKQDT-KISNYCKFDSQLLTTFTSSLYIAGLIASFFASSV  123

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR PSILIGG AFL GAALGGAA+N+YMLI GRV+LG+G+GFANQ+VPLYLSEMAP
Sbjct  124   TRAFGRKPSILIGGAAFLIGAALGGAALNIYMLILGRVMLGVGIGFANQSVPLYLSEMAP  183

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              +YRG +N+ FQLCVGIGVL ANLIN+GTEKI+DGWGWR+SL +AAVPA++L++G++ LP
Sbjct  184   PRYRGAINIGFQLCVGIGVLSANLINFGTEKIKDGWGWRISLVMAAVPASMLSLGSLFLP  243

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNS+IQ   D   AK  LQR+RGT+DVQ EL+DL  AS+IS +I+ PFKNILHR+YRP
Sbjct  244   ETPNSIIQHSKDRHKAKLMLQRIRGTNDVQQELEDLFEASDISNSIKHPFKNILHRKYRP  303

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAA-LMSavvtgavgivttFASMLL  979
             QLVMA A+PFFQQ TGINVI+FYAP+LF TIGLGESA+ L+SA+VTG VG  +TF SML+
Sbjct  304   QLVMAIAIPFFQQFTGINVISFYAPILFLTIGLGESASLLLSAIVTGVVGTTSTFISMLM  363

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
             VDK+GRR L I GGI MF++Q+ VG +M  +LGD G +SK +A L+LLLI  YVAGF  S
Sbjct  364   VDKLGRRVLFISGGIQMFLSQVIVGSIMATQLGDHGEISKIYAYLILLLICIYVAGFAWS  423

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPLGWL+PSEIF LEIRSA QSITVAVNFLFTF+V QTFL+MLCH K G FFFFGGWV 
Sbjct  424   WGPLGWLVPSEIFQLEIRSAAQSITVAVNFLFTFIVAQTFLSMLCHFKSGTFFFFGGWVV  483

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             VMT FVYLLLPET+N+PIE+MD VWREH+FWK IV
Sbjct  484   VMTVFVYLLLPETRNVPIEQMDRVWREHFFWKTIV  518



>gb|KCW46317.1| hypothetical protein EUGRSUZ_K00179 [Eucalyptus grandis]
Length=525

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/454 (73%), Positives = 382/454 (84%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF  VY KM+ED+ K+SNYCKFDS+LLT FTSSLYIAGL AS  ASSV
Sbjct  61    GGVTSMEPFLKKFFPKVYDKMREDT-KLSNYCKFDSQLLTLFTSSLYIAGLVASFFASSV  119

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR PSIL GG AFLAG+ALGGAA NV MLIFGRVLLGIGVGFANQ+VPLY+SEMAP
Sbjct  120   TRYFGRRPSILAGGAAFLAGSALGGAASNVAMLIFGRVLLGIGVGFANQSVPLYISEMAP  179

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              ++RG  N  F+LC+GIGVL ANLINYGTEKI  GWGWR+SL +AAVPAT L  GA  LP
Sbjct  180   PRHRGFFNNGFELCIGIGVLFANLINYGTEKIEGGWGWRISLAMAAVPATTLIFGAFFLP  239

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR +D D AK  L+R+RGTDDVQAELDDLV AS IS+T+  PF+NI+ R+YRP
Sbjct  240   ETPNSLIQRSSDIDKAKSMLRRIRGTDDVQAELDDLVKASLISKTVRHPFRNIIKRKYRP  299

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVM+ A+PFFQ VTGINVI+FYAPVLFRTIGLGESA+L+SAV+TG VG V+ F  MLLV
Sbjct  300   QLVMSIAIPFFQIVTGINVISFYAPVLFRTIGLGESASLLSAVITGIVGAVSIFICMLLV  359

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR+L ++GG+ M   Q+  GG+M AKLGD   +SK +A  V++L+  YVAGF  SW
Sbjct  360   DKLGRRKLFMIGGLQMLAAQLMAGGIMAAKLGDHSEISKPYAYSVIVLVCIYVAGFCWSW  419

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIFPLEIRSAGQSITVAV FLFT+LV QTFL+MLCH K G+FFFFGGW A+
Sbjct  420   GPLGWLVPSEIFPLEIRSAGQSITVAVGFLFTYLVAQTFLSMLCHFKSGLFFFFGGWAAI  479

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FV+L LPETKN+PIE+MD +WREHWFWKKIV
Sbjct  480   MTVFVHLFLPETKNVPIEQMDKIWREHWFWKKIV  513



>ref|XP_010035051.1| PREDICTED: hexose carrier protein HEX6-like [Eucalyptus grandis]
Length=509

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/454 (73%), Positives = 382/454 (84%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF  VY KM+ED+ K+SNYCKFDS+LLT FTSSLYIAGL AS  ASSV
Sbjct  45    GGVTSMEPFLKKFFPKVYDKMREDT-KLSNYCKFDSQLLTLFTSSLYIAGLVASFFASSV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR PSIL GG AFLAG+ALGGAA NV MLIFGRVLLGIGVGFANQ+VPLY+SEMAP
Sbjct  104   TRYFGRRPSILAGGAAFLAGSALGGAASNVAMLIFGRVLLGIGVGFANQSVPLYISEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              ++RG  N  F+LC+GIGVL ANLINYGTEKI  GWGWR+SL +AAVPAT L  GA  LP
Sbjct  164   PRHRGFFNNGFELCIGIGVLFANLINYGTEKIEGGWGWRISLAMAAVPATTLIFGAFFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR +D D AK  L+R+RGTDDVQAELDDLV AS IS+T+  PF+NI+ R+YRP
Sbjct  224   ETPNSLIQRSSDIDKAKSMLRRIRGTDDVQAELDDLVKASLISKTVRHPFRNIIKRKYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVM+ A+PFFQ VTGINVI+FYAPVLFRTIGLGESA+L+SAV+TG VG V+ F  MLLV
Sbjct  284   QLVMSIAIPFFQIVTGINVISFYAPVLFRTIGLGESASLLSAVITGIVGAVSIFICMLLV  343

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR+L ++GG+ M   Q+  GG+M AKLGD   +SK +A  V++L+  YVAGF  SW
Sbjct  344   DKLGRRKLFMIGGLQMLAAQLMAGGIMAAKLGDHSEISKPYAYSVIVLVCIYVAGFCWSW  403

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIFPLEIRSAGQSITVAV FLFT+LV QTFL+MLCH K G+FFFFGGW A+
Sbjct  404   GPLGWLVPSEIFPLEIRSAGQSITVAVGFLFTYLVAQTFLSMLCHFKSGLFFFFGGWAAI  463

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FV+L LPETKN+PIE+MD +WREHWFWKKIV
Sbjct  464   MTVFVHLFLPETKNVPIEQMDKIWREHWFWKKIV  497



>ref|XP_004309027.1| PREDICTED: hexose carrier protein HEX6-like [Fragaria vesca subsp. 
vesca]
Length=507

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/454 (72%), Positives = 380/454 (84%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFL++FF +VYT+MK D+ K+SNYCKFDSELLTSFTSSL IAGL AS+ ASSV
Sbjct  44    GGVTSMEPFLEKFFPEVYTRMKSDT-KISNYCKFDSELLTSFTSSLCIAGLVASVFASSV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR PSIL G  AFLAGAAL GAA+N+YMLI GR+LLG+GVGFANQ+VPLYLSEMAP
Sbjct  103   TRVYGRKPSILAGSAAFLAGAALNGAAVNIYMLILGRILLGVGVGFANQSVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             +KYRG ++  FQ  VGI  L ANLINYGT+KI+ GWGWR+SL LAAVPA++LTIGA  LP
Sbjct  163   SKYRGAISNGFQFSVGIDALSANLINYGTQKIKGGWGWRISLALAAVPASILTIGAFFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR  DH  A   L+R+RG +DVQ EL+DL+ A+ IS+TI+ PF+ IL R+YRP
Sbjct  223   ETPNSLIQRSVDHQTANVMLRRIRGVEDVQLELEDLIKANNISKTIQHPFRKILERKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA A+PFFQ VTGINVIAFYAP+LFRTIGLGESA+L+SAV+TG V  + TF SM++V
Sbjct  283   QLVMAIAIPFFQIVTGINVIAFYAPILFRTIGLGESASLLSAVMTGVVATIATFISMIIV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK GRR L I GG+ M V+QM VGGVM  +LGD GG+S G+A LVL+LI  YVAG+G SW
Sbjct  343   DKFGRRALFIGGGLQMLVSQMMVGGVMATQLGDHGGVSTGYAYLVLVLIGIYVAGYGWSW  402

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIFPLEIRSAGQSI V VNFLFTF+V QTFLAMLCH K GIFFFFGGWV V
Sbjct  403   GPLGWLVPSEIFPLEIRSAGQSINVMVNFLFTFIVAQTFLAMLCHFKAGIFFFFGGWVMV  462

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY  LPETKN+P+E M+ VW EHWFW++IV
Sbjct  463   MTLFVYFFLPETKNVPMETMESVWVEHWFWRRIV  496



>gb|KCW90864.1| hypothetical protein EUGRSUZ_A02911 [Eucalyptus grandis]
Length=507

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/454 (74%), Positives = 381/454 (84%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FLKRFFH+VY KM ED+ K+SNYCKFDS+LLTSFTSSLYIAGLFAS  AS V
Sbjct  45    GGVTSMDSFLKRFFHEVYIKMNEDT-KISNYCKFDSQLLTSFTSSLYIAGLFASFCASFV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR PS+LIGG AFLAG+ALGGAA NV+MLI GR LLG+GVGFANQ+VPLYLSEMAP
Sbjct  104   TRVFGRKPSMLIGGAAFLAGSALGGAAANVFMLILGRALLGVGVGFANQSVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              +YRG  N  FQ  +GIG L ANLINYGT+KI+ GWGWRVSL + AVPA++LT+GA+ LP
Sbjct  164   PRYRGAFNNGFQFSLGIGALSANLINYGTQKIKGGWGWRVSLAMGAVPASILTLGALFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQ  N  + AK  LQ VRGT  +QAELDDLV A+   + I +PF+ I   +YRP
Sbjct  224   ETPNSLIQSHNGPEKAKSMLQLVRGTPSIQAELDDLVKANLNIQAIRQPFRTITQEKYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA A+PFFQQVTGINVI FYAPVLFR IGLGESA+LMSAVVTG +G  +TF SML+V
Sbjct  284   QLVMAIAIPFFQQVTGINVIGFYAPVLFRAIGLGESASLMSAVVTGVIGCSSTFISMLIV  343

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR L +VGGI M V+Q+ VGG+M AKLGD GGLSKG+A +VLL I  YVAGFG SW
Sbjct  344   DKLGRRTLFLVGGIQMLVSQVMVGGIMAAKLGDHGGLSKGYAYVVLLSICIYVAGFGWSW  403

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEI+PLEIRSAGQSITVAV+F+FT  V QT LAMLCHLK GIFFFFGGWVAV
Sbjct  404   GPLGWLVPSEIYPLEIRSAGQSITVAVSFVFTIAVAQTSLAMLCHLKSGIFFFFGGWVAV  463

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVYLLLPETKN+PIE+MD VWREHWFWK+IV
Sbjct  464   MTAFVYLLLPETKNIPIEQMDRVWREHWFWKRIV  497



>ref|XP_011028473.1| PREDICTED: hexose carrier protein HEX6-like isoform X2 [Populus 
euphratica]
Length=454

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/450 (71%), Positives = 378/450 (84%), Gaps = 2/450 (0%)
 Frame = +2

Query  98    MEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSVTRACG  277
             MEPFLK+FF +VYT+MKED+ K+SNYCKFDS++LTSFTSSLY+AGL AS  ASS+TR  G
Sbjct  1     MEPFLKKFFPEVYTRMKEDT-KISNYCKFDSQILTSFTSSLYVAGLVASFFASSITRHFG  59

Query  278   RTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAPAKYRG  457
             R PSIL GG AFL+G+AL GAA N+YMLIFGRVLLG+GVGFANQ+VPLYLSEMAP +YRG
Sbjct  60    RKPSILAGGSAFLSGSALNGAANNLYMLIFGRVLLGVGVGFANQSVPLYLSEMAPPRYRG  119

Query  458   GMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLPETPNS  637
              +N  FQLCVGIGVL AN IN+GTEKI  GWGWR+SL  AA+PAT LTIG++ LPETPNS
Sbjct  120   AINNGFQLCVGIGVLSANFINFGTEKIEGGWGWRISLAAAAIPATFLTIGSLFLPETPNS  179

Query  638   LIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRPQLVMA  817
             LIQR ND    K  LQR+RGT DV+AE +DL+ AS +S++IE P K I+ ++YRPQLVMA
Sbjct  180   LIQRFNDEQKVKTILQRIRGTTDVEAEFNDLIKASFVSKSIEHPIKKIIQKKYRPQLVMA  239

Query  818   FAVPFFQQVTGINVIAFYAPVLFRTIGLGESAAL-MSavvtgavgivttFASMLLVDKVG  994
              A+PFFQQVTGINVI+FYAP+LFRTIGL ES +L MSA++ G VG  +TF SML+VDK+G
Sbjct  240   IAIPFFQQVTGINVISFYAPILFRTIGLNESVSLIMSALIAGVVGTASTFLSMLVVDKLG  299

Query  995   RRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSWGPLG  1174
             RR +LI GG+ MFV+Q+ +G +M A+LGD G + KG+A  VL +IS YV+GF  SWGPLG
Sbjct  300   RRAMLICGGVQMFVSQIMIGSIMAAQLGDHGSIDKGYAYFVLAMISIYVSGFAWSWGPLG  359

Query  1175  WLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAVMTTF  1354
             WL+PSEIFPLEIRS GQSI VAVNF+FTF+V QTFLAMLCH K GIFFFFGGWVAVMT F
Sbjct  360   WLVPSEIFPLEIRSVGQSIVVAVNFVFTFVVAQTFLAMLCHFKSGIFFFFGGWVAVMTAF  419

Query  1355  VYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             VYLLLPETK +P+E MD VWREHWFWK+IV
Sbjct  420   VYLLLPETKKVPMEVMDRVWREHWFWKRIV  449



>ref|XP_010062447.1| PREDICTED: hexose carrier protein HEX6-like [Eucalyptus grandis]
Length=514

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/454 (74%), Positives = 381/454 (84%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FLKRFFH+VY KM ED+ K+SNYCKFDS+LLTSFTSSLYIAGLFAS  AS V
Sbjct  45    GGVTSMDSFLKRFFHEVYIKMNEDT-KISNYCKFDSQLLTSFTSSLYIAGLFASFCASFV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR PS+LIGG AFLAG+ALGGAA NV+MLI GR LLG+GVGFANQ+VPLYLSEMAP
Sbjct  104   TRVFGRKPSMLIGGAAFLAGSALGGAAANVFMLILGRALLGVGVGFANQSVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              +YRG  N  FQ  +GIG L ANLINYGT+KI+ GWGWRVSL + AVPA++LT+GA+ LP
Sbjct  164   PRYRGAFNNGFQFSLGIGALSANLINYGTQKIKGGWGWRVSLAMGAVPASILTLGALFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQ  N  + AK  LQ VRGT  +QAELDDLV A+   + I +PF+ I   +YRP
Sbjct  224   ETPNSLIQSHNGPEKAKSMLQLVRGTPSIQAELDDLVKANLNIQAIRQPFRTITQEKYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA A+PFFQQVTGINVI FYAPVLFR IGLGESA+LMSAVVTG +G  +TF SML+V
Sbjct  284   QLVMAIAIPFFQQVTGINVIGFYAPVLFRAIGLGESASLMSAVVTGVIGCSSTFISMLIV  343

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR L +VGGI M V+Q+ VGG+M AKLGD GGLSKG+A +VLL I  YVAGFG SW
Sbjct  344   DKLGRRTLFLVGGIQMLVSQVMVGGIMAAKLGDHGGLSKGYAYVVLLSICIYVAGFGWSW  403

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEI+PLEIRSAGQSITVAV+F+FT  V QT LAMLCHLK GIFFFFGGWVAV
Sbjct  404   GPLGWLVPSEIYPLEIRSAGQSITVAVSFVFTIAVAQTSLAMLCHLKSGIFFFFGGWVAV  463

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVYLLLPETKN+PIE+MD VWREHWFWK+IV
Sbjct  464   MTAFVYLLLPETKNIPIEQMDRVWREHWFWKRIV  497



>ref|XP_008453891.1| PREDICTED: hexose carrier protein HEX6 isoform X1 [Cucumis melo]
Length=514

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/454 (72%), Positives = 386/454 (85%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSME FLK+FF +V  KMKED   +SNYCKFDS+LLTSFTSSLY+AGL ASL ASS+
Sbjct  44    GGVTSMESFLKKFFPEVDRKMKEDK-DISNYCKFDSQLLTSFTSSLYLAGLVASLFASSM  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T++ GR PSIL  G+ F+ GA LGGAA+NVYMLI GRVLLG+GVGFANQAVPLYLSEMAP
Sbjct  103   TKSLGRRPSILFSGLVFIVGATLGGAAMNVYMLILGRVLLGVGVGFANQAVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             + YRG +N  FQ  VGIG L ANLIN+GT+KI+ G GWR+SL +A  PA++LT+GA  LP
Sbjct  163   SNYRGAINNGFQFSVGIGGLTANLINFGTQKIKSGNGWRISLAMAGFPASILTLGAFFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR N H      LQR+RGT +VQ+EL DL+ ASEI+++I+ PFKNI+ R+YRP
Sbjct  223   ETPNSLIQRGNSHQLVDEMLQRIRGTPNVQSELADLIKASEIAKSIDNPFKNIMRRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA A+PFFQQVTGINVIAFYAPVLFRTIGLGESA+L SA++TGAVG+VTTF SML+V
Sbjct  283   QLVMAIAIPFFQQVTGINVIAFYAPVLFRTIGLGESASLFSAIMTGAVGLVTTFISMLVV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR L I GG+ MFV+Q+ VGG++ A LGDQG +SKG++ L+L+LI  YVAGFG SW
Sbjct  343   DKLGRRVLFIAGGLQMFVSQVIVGGLLAALLGDQGTVSKGYSYLLLVLICVYVAGFGWSW  402

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIFPLEIRSAGQSITVA NF+FTF++ QTFLAMLCHLK GIFFFFGGWV V
Sbjct  403   GPLGWLVPSEIFPLEIRSAGQSITVATNFVFTFIIAQTFLAMLCHLKAGIFFFFGGWVVV  462

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY  LPETKNLPIEK++ VWREHWFWK++V
Sbjct  463   MTVFVYYFLPETKNLPIEKVERVWREHWFWKRVV  496



>ref|XP_004287421.1| PREDICTED: hexose carrier protein HEX6-like [Fragaria vesca subsp. 
vesca]
Length=506

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/455 (72%), Positives = 381/455 (84%), Gaps = 2/455 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF +VYTKMK+D+ KVSNYCKFDS LLT+FTSSLYIAGL AS  ASSV
Sbjct  44    GGVTSMEPFLKKFFPEVYTKMKQDA-KVSNYCKFDSPLLTTFTSSLYIAGLVASFFASSV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T A GR PSIL+ G +FLAG+ALGGAA+N++MLI GR+LLGIGVGF NQAVPLYLSEMAP
Sbjct  103   TGAFGRKPSILVAGASFLAGSALGGAAVNLFMLITGRILLGIGVGFGNQAVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
               +RG +N+ FQLCVGIGVL ANLIN+GTEKI+ GWGWR+SL +AAVPA++LT+GA+ LP
Sbjct  163   PTFRGAINIGFQLCVGIGVLSANLINFGTEKIKSGWGWRISLAMAAVPASLLTLGALFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR NDH  AK  LQR RG +DV+AELDDL+ AS  S+TI+ PF+ I+ R+YRP
Sbjct  223   ETPNSLIQRTNDHQRAKLLLQRTRGMEDVEAELDDLIEASNRSKTIDHPFRKIVQRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtg-avgivttFASMLL  979
             QLVMA A+PFF Q+TGINVI+FYAP+LFRTIGL ES +L+ AV++   VG   TF SML+
Sbjct  283   QLVMAVAMPFFTQLTGINVISFYAPILFRTIGLSESMSLLCAVISTGVVGTAATFISMLM  342

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
             VDK+GRR L  +GGI MFV+Q+ VG +M AKLGD GGLSK  A LVL  +  YVAGF  S
Sbjct  343   VDKLGRRALFQIGGIQMFVSQIIVGCIMAAKLGDVGGLSKVHAYLVLFFVCIYVAGFAWS  402

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTF + QTFL MLC  K G+FFFFGGWV 
Sbjct  403   WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFAIAQTFLPMLCCFKSGMFFFFGGWVM  462

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             VMT FVY LLPET N+PIEKMD VW+EHWFWK+I+
Sbjct  463   VMTAFVYFLLPETTNIPIEKMDEVWKEHWFWKRIL  497



>ref|XP_007219184.1| hypothetical protein PRUPE_ppa016853mg [Prunus persica]
 gb|EMJ20383.1| hypothetical protein PRUPE_ppa016853mg [Prunus persica]
Length=507

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/455 (72%), Positives = 381/455 (84%), Gaps = 2/455 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF +V+TKMKED+ K SNYCKFDS+LLT+FTSSLYIAGL AS  ASSV
Sbjct  46    GGVTSMEPFLKKFFPEVHTKMKEDT-KTSNYCKFDSQLLTAFTSSLYIAGLVASFFASSV  104

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR PSIL+ G +FLAG+ALGGAA NV MLI GR+LLG+GVGFANQ+VPLYLSEMA 
Sbjct  105   TRTFGRKPSILVAGASFLAGSALGGAATNVLMLISGRILLGVGVGFANQSVPLYLSEMAL  164

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              ++RG  N+ FQLCV IGVL ANLIN+G EKI+ GWGWR+SL LAAVPA++LT+GA++LP
Sbjct  165   PRHRGAFNIGFQLCVAIGVLSANLINFGAEKIKGGWGWRISLSLAAVPASILTLGALLLP  224

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR NDH  AK  LQR RG +DVQAELDDL+ ASE S+TI+ PFK ++ R+YRP
Sbjct  225   ETPNSLIQRSNDHQKAKSMLQRTRGCEDVQAELDDLIKASENSKTIKHPFKKLMQRKYRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtg-avgivttFASMLL  979
             QLVMA A+PFF QVTGINVI+FYAPVLFRTIGL ES +L+SAV++   VG   TF SML+
Sbjct  285   QLVMAIAMPFFTQVTGINVISFYAPVLFRTIGLSESMSLLSAVMSAGMVGTCATFVSMLM  344

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
             VDK+GRR L  +GGI MFV+Q+ VG +M A+LGD GG+ KG+A L+++ +S YVAGF  S
Sbjct  345   VDKLGRRTLFAIGGIQMFVSQVIVGSIMAAELGDIGGIRKGYAYLLIIFVSVYVAGFAWS  404

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPLGWLIPSEIFPLEIRSAGQS+TVAVNFL TF + Q+FL MLCH K GIFFFFGGWVA
Sbjct  405   WGPLGWLIPSEIFPLEIRSAGQSVTVAVNFLSTFGIAQSFLFMLCHFKSGIFFFFGGWVA  464

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             VMT FVYLLLPET N+PIEKMD VW  HWFW + V
Sbjct  465   VMTGFVYLLLPETANIPIEKMDGVWMGHWFWNRYV  499



>ref|XP_006490161.1| PREDICTED: hexose carrier protein HEX6-like [Citrus sinensis]
Length=512

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/455 (71%), Positives = 386/455 (85%), Gaps = 2/455 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF +VY  M+ED+  VSNYCKF+S+LLT+FTSS +IAGL ASL AS V
Sbjct  46    GGVTSMEPFLKKFFPEVYKNMREDT-NVSNYCKFNSQLLTTFTSSPFIAGLIASLFASKV  104

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR  SIL+GGVAFLAG+ALGGAA NVYMLI GRVLLG+G+GF+NQ+VPLYLSEMAP
Sbjct  105   TRALGRKASILVGGVAFLAGSALGGAAFNVYMLILGRVLLGVGIGFSNQSVPLYLSEMAP  164

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              K+RG  N+ FQ+C  IGVL ANL+NYGT+KI+ GWGWR+SL +AA PA++LT+GA++LP
Sbjct  165   PKHRGAFNIGFQVCTAIGVLGANLLNYGTQKIKGGWGWRISLSMAAAPASILTLGALILP  224

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNS+IQR N H+ AK+ LQRVRGT DVQAELDDL+ AS +SRT++ PFK I+ R+YRP
Sbjct  225   DTPNSIIQRSNGHEKAKKMLQRVRGTADVQAELDDLIRASIVSRTVKHPFKTIIQRKYRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAA-LMSavvtgavgivttFASMLL  979
             QLVMA  +PFFQQVTGINVI+FYAPVLFRTI L ES + LMSAVVTG V  + T  SM+L
Sbjct  285   QLVMAILIPFFQQVTGINVISFYAPVLFRTIKLSESTSLLMSAVVTGGVSTIATITSMIL  344

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
              DK+GR+ L +VGGILMFV+Q+ +G +M A+LGD GG+S+G+A LVL L+  Y+AGF  S
Sbjct  345   TDKLGRKVLFLVGGILMFVSQVMIGSIMAAELGDHGGISEGYAYLVLALVCVYIAGFASS  404

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPLGWL+PSEIFPLEIRSAGQSITVAV FLF FLV Q+FLAMLCHLK GIFFFFGGW  
Sbjct  405   WGPLGWLVPSEIFPLEIRSAGQSITVAVGFLFFFLVAQSFLAMLCHLKAGIFFFFGGWEV  464

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             VMT FV+  LPETKN+PIE+MD VWREHWFWK+IV
Sbjct  465   VMTVFVHFFLPETKNVPIERMDKVWREHWFWKRIV  499



>ref|XP_008376389.1| PREDICTED: LOW QUALITY PROTEIN: hexose carrier protein HEX6 [Malus 
domestica]
Length=508

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/454 (74%), Positives = 384/454 (85%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF +V TKMK D+ K+SNYCKFDSELLTSFTSSLYIAGL ASL AS V
Sbjct  44    GGVTSMEPFLKKFFPEVNTKMKSDT-KISNYCKFDSELLTSFTSSLYIAGLVASLFASLV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR PSIL GG AFLAG+AL GAA+N+YMLI GRVLLG+GVGF NQAVPLYLSEMAP
Sbjct  103   TRAYGRKPSILAGGAAFLAGSALNGAAMNIYMLILGRVLLGVGVGFGNQAVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              K RG +N  FQ  VGIG L ANLINYGTEKI+ GWGWR+SL LAAVPA+VLT+GA  LP
Sbjct  163   PKXRGAINNGFQFSVGIGALSANLINYGTEKIKGGWGWRISLALAAVPASVLTLGAFFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR  DH  AK  LQR+RG DDVQ ELDDL+ A+ IS+ ++ PFK IL R+YRP
Sbjct  223   ETPNSLIQRSADHQTAKLMLQRIRGVDDVQVELDDLIKANNISKNMKHPFKKILERKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA A+PFFQQVTGINVIAFYAP+LFRTIGLGESA+L+S+V+TG    ++TF SML+V
Sbjct  283   QLVMAIAIPFFQQVTGINVIAFYAPILFRTIGLGESASLLSSVMTGVXXTISTFISMLIV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             +K GR  L + GGI M V+Q+ VGGVM A+LGD GG+SKG+A LVL+LI  YVAGFG SW
Sbjct  343   BKFGRXALFLAGGIQMLVSQIMVGGVMVAQLGDHGGVSKGYAYLVLVLICIYVAGFGWSW  402

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIFPLEIRSAGQSI V VNFLFTF+V QTFLAMLCH K GIFFFFGGW  V
Sbjct  403   GPLGWLVPSEIFPLEIRSAGQSINVVVNFLFTFIVAQTFLAMLCHFKAGIFFFFGGWGVV  462

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVYL LPETKN+PIEKM++VW+EHWFW+++V
Sbjct  463   MTVFVYLFLPETKNVPIEKMEIVWQEHWFWRRVV  496



>ref|XP_004146943.1| PREDICTED: hexose carrier protein HEX6-like [Cucumis sativus]
 gb|KGN53156.1| hypothetical protein Csa_4G022920 [Cucumis sativus]
Length=513

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/454 (73%), Positives = 387/454 (85%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSME FLK+FF +V  KMKED   +SNYCKFDS+LLTSFTSSLY+AGL AS  ASS+
Sbjct  44    GGVTSMESFLKKFFPEVDRKMKEDK-DISNYCKFDSQLLTSFTSSLYLAGLIASFFASSM  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T++ GR PSIL  GV F+AGAALGGAA+NVYMLI GRVLLG+GVGFANQAVPLYLSEMAP
Sbjct  103   TKSLGRKPSILFSGVVFIAGAALGGAAMNVYMLILGRVLLGVGVGFANQAVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             + YRG +N  FQ  VGIG L ANLIN+GT+KI+ G GWR+SL +AA PA++LT+GA  LP
Sbjct  163   SNYRGAINNGFQFSVGIGALTANLINFGTQKIKSGNGWRISLAMAAFPASILTLGAFFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR + H      LQR+RGT +VQ+EL DL+ ASEI+++I+ PFKNI+ R+YRP
Sbjct  223   ETPNSLIQRGSSHQLVDEMLQRIRGTPNVQSELADLIKASEIAKSIDSPFKNIMRRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA A+PFFQQVTGINVIAFYAPVLFRTIGLGESAAL SA++TGAVG+VTTF SML+V
Sbjct  283   QLVMAIAIPFFQQVTGINVIAFYAPVLFRTIGLGESAALFSAIMTGAVGLVTTFLSMLVV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR L I GG+ MFV+Q+ VG ++ A LGDQG +SKG++ L+L+LI  YVAGFG SW
Sbjct  343   DKLGRRVLFIAGGLQMFVSQVIVGVLLAALLGDQGTVSKGYSYLLLVLICVYVAGFGWSW  402

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIFPLEIRSAGQSITVA NF+FTF++ QTFLAMLCHLK GIFFFFGGWV V
Sbjct  403   GPLGWLVPSEIFPLEIRSAGQSITVATNFVFTFIIAQTFLAMLCHLKAGIFFFFGGWVVV  462

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY  LPETKNLPIEK++ VWREHWFW+++V
Sbjct  463   MTVFVYYFLPETKNLPIEKVERVWREHWFWRRVV  496



>ref|XP_008234427.1| PREDICTED: hexose carrier protein HEX6-like [Prunus mume]
Length=498

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/455 (71%), Positives = 378/455 (83%), Gaps = 2/455 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGV SMEPFLK+FF +VYTKMKED+ K SNYCKFDS+LLT+FTSSLYIAGL AS  ASSV
Sbjct  44    GGVISMEPFLKKFFPEVYTKMKEDT-KTSNYCKFDSQLLTTFTSSLYIAGLVASFFASSV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR PS+L+ G +FLAG ALGGAA N+ MLI GR+LLG+GVGFANQ+VPLYLSEMA 
Sbjct  103   TRAFGRKPSVLVAGASFLAGLALGGAATNIVMLISGRILLGVGVGFANQSVPLYLSEMAL  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              ++RG  N+ FQLCVGIGVL ANLIN+GTEKI  G GWR+SL LAAVPA++LT+GA+ LP
Sbjct  163   PRHRGAFNIGFQLCVGIGVLSANLINFGTEKITGGSGWRISLSLAAVPASILTLGALFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNS IQ  NDH  AK  LQR RG +DVQAELDDL+ ASE S+TI+ PFK ++ R+YRP
Sbjct  223   ETPNSFIQSTNDHQKAKSMLQRTRGCEDVQAELDDLIKASENSKTIKYPFKKLMQRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtg-avgivttFASMLL  979
             QLVMA A+PFF QVTGINV +FYAP+LFRT+GL ES +L+SAV++  A G   TF SML+
Sbjct  283   QLVMAIAMPFFTQVTGINVFSFYAPILFRTLGLSESMSLLSAVMSTGAAGTSATFISMLM  342

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
             VDK+GRR L  +GGI MFV+Q+ VG +M A+LGD GG++KG+A LVL+ +  YVA F  S
Sbjct  343   VDKLGRRALFAIGGIQMFVSQVIVGSIMAAELGDIGGMNKGYAYLVLIFVCVYVAAFAWS  402

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPLGWLIPSEIFPLEIRSAGQS+TVAVNF+ TF++ Q+FL+MLCH K GIFFFFGGWV 
Sbjct  403   WGPLGWLIPSEIFPLEIRSAGQSVTVAVNFVSTFVIAQSFLSMLCHFKSGIFFFFGGWVM  462

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             VMT FVYLLLPET N+PIEKMD VWREHWFW + V
Sbjct  463   VMTGFVYLLLPETANIPIEKMDRVWREHWFWNRFV  497



>ref|XP_004171208.1| PREDICTED: LOW QUALITY PROTEIN: hexose carrier protein HEX6-like 
[Cucumis sativus]
Length=513

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/454 (72%), Positives = 387/454 (85%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSME FLK+FF +V  KMKED   +SNYCKFDS+LLTSFTSSLY+AGL AS  ASS+
Sbjct  44    GGVTSMESFLKKFFPEVDRKMKEDK-DISNYCKFDSQLLTSFTSSLYLAGLIASFFASSM  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T++ GR PSIL  GV F+AGAALGGAA+NVYMLI GRVLLG+GVGFANQAVPLYLSEMAP
Sbjct  103   TKSLGRKPSILFSGVVFIAGAALGGAAMNVYMLILGRVLLGVGVGFANQAVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             + YRG +N  FQ  VGIG L ANLIN+GT+KI+ G GWR+SL +AA PA++LT+G + LP
Sbjct  163   SNYRGAINNGFQFSVGIGALTANLINFGTQKIKSGNGWRISLAMAAFPASILTLGXLFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR + H      LQR+RGT +VQ+EL DL+ ASEI+++I+ PFKNI+ R+YRP
Sbjct  223   ETPNSLIQRGSSHQLVDEMLQRIRGTPNVQSELADLIKASEIAKSIDSPFKNIMRRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA A+PFFQQVTGINVIAFYAPVLFRTIGLGESAAL SA++TGAVG+VTTF SML+V
Sbjct  283   QLVMAIAIPFFQQVTGINVIAFYAPVLFRTIGLGESAALFSAIMTGAVGLVTTFLSMLVV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR L I GG+ MFV+Q+ VG ++ A LGDQG +SKG++ L+L+LI  YVAGFG SW
Sbjct  343   DKLGRRVLFIAGGLQMFVSQVIVGVLLAALLGDQGTVSKGYSYLLLVLICVYVAGFGWSW  402

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIFPLEIRSAGQSITVA NF+FTF++ QTFLAMLCHLK GIFFFFGGWV V
Sbjct  403   GPLGWLVPSEIFPLEIRSAGQSITVATNFVFTFIIAQTFLAMLCHLKAGIFFFFGGWVVV  462

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY  LPETKNLPIEK++ VWREHWFW+++V
Sbjct  463   MTVFVYYFLPETKNLPIEKVERVWREHWFWRRVV  496



>ref|XP_008234426.1| PREDICTED: hexose carrier protein HEX6-like [Prunus mume]
Length=507

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/455 (71%), Positives = 379/455 (83%), Gaps = 2/455 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF +V TKMKED+ K SNYCKFDS+LLT+FTSSLYIAGL AS  ASSV
Sbjct  46    GGVTSMEPFLKKFFPEVRTKMKEDT-KTSNYCKFDSQLLTAFTSSLYIAGLVASFFASSV  104

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR PSIL+ G +FLAG+ALGGAA NV+MLI GR+LLG+GVGFANQ+VPLYLSEMA 
Sbjct  105   TRTFGRKPSILVAGASFLAGSALGGAATNVFMLISGRILLGVGVGFANQSVPLYLSEMAL  164

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              ++RG  N+ FQLCV IGVL ANLIN+G EKI  GWGWR+SL LAAVPA++LT+GA++LP
Sbjct  165   PRHRGAFNIGFQLCVAIGVLSANLINFGAEKITGGWGWRISLSLAAVPASILTLGALLLP  224

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR NDH  A+  LQR RG +DVQAEL DL+ ASE S+TI+ PFK ++ R+YRP
Sbjct  225   ETPNSLIQRSNDHQKAESMLQRTRGCEDVQAELHDLIKASENSKTIKHPFKKLMQRKYRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtg-avgivttFASMLL  979
             QLVMA A+PFF QVTGINVI+FYAPVLFRT+GL ES +L+SAV++   VG   TF SML+
Sbjct  285   QLVMAIAMPFFTQVTGINVISFYAPVLFRTLGLSESMSLLSAVMSTGMVGTGATFVSMLM  344

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
             VDK+GRR L  +GG+ MFV+Q+ VG +M A+LGD GG+SKG+A LVL+ +  YVAGF  S
Sbjct  345   VDKLGRRTLFAIGGVQMFVSQVIVGSIMAAELGDIGGISKGYAYLVLIFVCVYVAGFAWS  404

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPLGWLIPSEIFPLEIRSAGQS+TVAVNF+ TF + Q+FL+MLCH K GIFFFFGGWV 
Sbjct  405   WGPLGWLIPSEIFPLEIRSAGQSVTVAVNFVSTFGIAQSFLSMLCHFKSGIFFFFGGWVM  464

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             VMT FVYLLLPET N+PIEKMD VW  HWFW + V
Sbjct  465   VMTGFVYLLLPETANIPIEKMDRVWMGHWFWNRYV  499



>ref|XP_006358233.1| PREDICTED: hexose carrier protein HEX6-like [Solanum tuberosum]
Length=509

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/454 (71%), Positives = 379/454 (83%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGV SM PFLK+FF +V+TKM   + ++SNYC FDS+LLTSFTSSLYIAGL AS LAS V
Sbjct  45    GGVISMAPFLKKFFPEVFTKMTHVA-EISNYCVFDSQLLTSFTSSLYIAGLIASFLASPV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR P+I+IGG+AFL G+ALGGAA N+YML+ GR+LLG+GVGFANQAVPLYLSEMAP
Sbjct  104   TRTYGRKPTIIIGGIAFLIGSALGGAASNIYMLLLGRILLGVGVGFANQAVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             AKYRG  N++FQLCVGIGVL A+L+NYG  KI+ GWGWR+SL +AA PAT LTIGA  LP
Sbjct  164   AKYRGSFNIAFQLCVGIGVLFASLLNYGVLKIKGGWGWRISLAMAAAPATFLTIGAFFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ET NSLIQ  NDH  AK+ LQRVRGT DVQAELDDL+ AS+ S+ ++ PFK I+ R+YRP
Sbjct  224   ETANSLIQHGNDHQKAKKILQRVRGTTDVQAELDDLIKASDKSKAVKHPFKQIIKRKYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVM+  +PFFQQVTGINVI+FYAP+LF+TIGLG SA+LMSAVVTG VG   TF ++L+V
Sbjct  284   QLVMSILIPFFQQVTGINVISFYAPILFQTIGLGASASLMSAVVTGVVGTSATFLALLIV  343

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             D+VGRR +   GGI MFV+QM +G +M  KLGD G LSKG+ +LVL+LI  YVAGF LSW
Sbjct  344   DRVGRRAMFSFGGIQMFVSQMLIGIIMAVKLGDHGVLSKGYGLLVLVLICIYVAGFSLSW  403

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIFPLEIRSAGQSITVAV  +FTF++ QTFLAMLCHLK GIFFFFG WVA+
Sbjct  404   GPLGWLVPSEIFPLEIRSAGQSITVAVGLIFTFIIAQTFLAMLCHLKSGIFFFFGAWVAI  463

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY  LPET+NLPIE M+ +WR+HWFWK+ V
Sbjct  464   MTVFVYFFLPETRNLPIENMESIWRDHWFWKRFV  497



>ref|XP_010934655.1| PREDICTED: hexose carrier protein HEX6-like [Elaeis guineensis]
Length=510

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/456 (71%), Positives = 384/456 (84%), Gaps = 1/456 (0%)
 Frame = +2

Query  77    SVGGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLAS  256
             S GGVTSM+ FLK+FF +VY +MKED+  +SNYCKFDS+LLT+FTSSLY+AGLFA+  AS
Sbjct  42    SAGGVTSMDSFLKKFFPEVYRRMKEDT-HISNYCKFDSQLLTAFTSSLYVAGLFATFFAS  100

Query  257   SVTRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEM  436
             SVTRA GR PS+L+GG AFLAG  LGGAA+NV M+I GRVLLG+G+GFANQ+VPLYLSEM
Sbjct  101   SVTRAFGRRPSMLLGGAAFLAGTVLGGAAVNVSMVILGRVLLGVGLGFANQSVPLYLSEM  160

Query  437   APAKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVV  616
             AP +YRG  N  FQ  VG+G L ANLINYGTEKI+ GWGWRVSL LAAVPA++LT+GA  
Sbjct  161   APPQYRGAFNNGFQFSVGVGALCANLINYGTEKIKAGWGWRVSLALAAVPASLLTLGAFF  220

Query  617   LPETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRY  796
             LPETPNSLIQ+ ND   AK  LQ++RGT DV  EL DL+AAS  ++ +  PF+ I+  +Y
Sbjct  221   LPETPNSLIQQGNDLKKAKELLQKIRGTIDVDEELHDLIAASSAAKAVNHPFRRIIRPKY  280

Query  797   RPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASML  976
             RPQLVMA  +PFFQQVTGINVIAFYAPVLFRTIGL ESA+LMSAVVTG VG  +TF SM+
Sbjct  281   RPQLVMAITIPFFQQVTGINVIAFYAPVLFRTIGLAESASLMSAVVTGVVGTGSTFISMI  340

Query  977   LVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGL  1156
             +VDK+GRR L ++GG+ MFV+Q+ +G ++  +LGD GGLSKG+A +VL+LIS YVAGFG 
Sbjct  341   IVDKLGRRALFLIGGVQMFVSQVIIGVIIATQLGDHGGLSKGYAYIVLVLISVYVAGFGW  400

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSEIFPLEIRSAGQSITVAV+F+FTF+V QTFLAMLCHLK GIFFFFGGW+
Sbjct  401   SWGPLGWLVPSEIFPLEIRSAGQSITVAVSFIFTFIVAQTFLAMLCHLKSGIFFFFGGWL  460

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
               MT F+YL LPETKN+PIE+M  VWREHWFW++IV
Sbjct  461   VFMTVFIYLFLPETKNIPIEQMVGVWREHWFWRRIV  496



>emb|CDP05360.1| unnamed protein product [Coffea canephora]
Length=484

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/455 (69%), Positives = 388/455 (85%), Gaps = 1/455 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSME FLK+FF DVY KM+E + +VSNYC+FDS+LLT+FTSSLY+AGL AS  ASS 
Sbjct  12    GGVTSMESFLKKFFPDVYAKMEETT-EVSNYCRFDSQLLTAFTSSLYVAGLVASFFASSF  70

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR PSIL+GG +F  GA LG AA NVY+L+ GRVLLG+GVGFANQ++PLYLSE+AP
Sbjct  71    TRNFGRKPSILVGGASFFIGAVLGAAAFNVYILVLGRVLLGVGVGFANQSIPLYLSEIAP  130

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              KYRG  +  FQL V +G+L+ANLIN+GTEKI+ GWGWRVSLG+AA+PA ++T+G V LP
Sbjct  131   PKYRGAFSNGFQLSVSLGILVANLINFGTEKIKGGWGWRVSLGMAAIPALIMTLGEVFLP  190

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNS+IQR  D++ AK+ LQ++RG DDV+AELDDLV AS+ SR+I+ PFK I+ R YRP
Sbjct  191   ETPNSIIQRSGDYEKAKQLLQKLRGADDVEAELDDLVKASDFSRSIKHPFKKIMQREYRP  250

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVM+ A+PFFQQVTGINVIAFYAP+LFR IGL ES++L+SAVVTGAVG++TT  S+L+V
Sbjct  251   QLVMSIAIPFFQQVTGINVIAFYAPILFRIIGLKESSSLLSAVVTGAVGMLTTMVSVLVV  310

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR +  VGGILMFV+Q+ +G +M  KLGD G +++G+A ++LL+I  YVA +GLSW
Sbjct  311   DKLGRRVMFAVGGILMFVSQIVIGTIMAIKLGDYGEINRGYAFVLLLMICLYVAAYGLSW  370

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIFPLEIRSAGQS+TVAVNFLFTF++ QTFLAMLCH K GIFFFFGGWVAV
Sbjct  371   GPLGWLVPSEIFPLEIRSAGQSVTVAVNFLFTFVIAQTFLAMLCHFKAGIFFFFGGWVAV  430

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIVV  1447
             MT FVY LLPETK LP+E+MD VWR HWFW+++V+
Sbjct  431   MTLFVYALLPETKGLPLEQMDRVWRSHWFWRRMVI  465



>ref|XP_007219614.1| hypothetical protein PRUPE_ppa023229mg [Prunus persica]
 gb|EMJ20813.1| hypothetical protein PRUPE_ppa023229mg [Prunus persica]
Length=506

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/455 (70%), Positives = 378/455 (83%), Gaps = 2/455 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+PFLK+FF +VYTKMK+D+ K SNYCKFDS+LLT+FTSSLYIAGL AS  ASSV
Sbjct  45    GGVTSMDPFLKKFFPEVYTKMKDDT-KTSNYCKFDSQLLTTFTSSLYIAGLVASFFASSV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR PSIL+ G  FL+G ALGGAA N+ MLI GR+LLG+GVGFANQ+VPLYLSEMA 
Sbjct  104   TRAFGRKPSILVAGALFLSGLALGGAATNIVMLISGRILLGVGVGFANQSVPLYLSEMAL  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              ++RG  N+ FQLCVGIGVL ANLIN+GTEKI  G GWR+SL LAAVPA++LT+GA+ LP
Sbjct  164   PRHRGAFNIGFQLCVGIGVLSANLINFGTEKITGGSGWRISLSLAAVPASILTLGALFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNS IQ  NDH  AK  LQR RG +DVQAELDDL+ AS+ S+TI+ PFK ++ R+YRP
Sbjct  224   ETPNSFIQSTNDHQIAKSMLQRTRGCEDVQAELDDLIKASDNSKTIKYPFKKLMQRKYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtg-avgivttFASMLL  979
             QLVMA A+PFF QVTGINV +FYAP+LFRT+GL ES +L+SAV++  A G   TF SML+
Sbjct  284   QLVMAIAMPFFTQVTGINVFSFYAPILFRTLGLSESMSLLSAVMSTGAAGTSATFISMLM  343

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
             VDK+GRR L  +GGI MFV+Q+ VG +M A+LGD GG++KG+A LVL+ +  YVA F  S
Sbjct  344   VDKLGRRALFAIGGIQMFVSQVIVGSIMAAELGDIGGMNKGYAYLVLIFVCVYVAAFAWS  403

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPLGWLIPSEIFPLEIRSAGQS+TVAVNF+ TF++ Q+FL+MLCH K GIFFFFGGWV 
Sbjct  404   WGPLGWLIPSEIFPLEIRSAGQSVTVAVNFVSTFVIAQSFLSMLCHFKSGIFFFFGGWVM  463

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             VMT FVYLLLPET N+PIEKMD VWREHWFW + V
Sbjct  464   VMTGFVYLLLPETANIPIEKMDRVWREHWFWNRYV  498



>ref|XP_006490159.1| PREDICTED: hexose carrier protein HEX6-like [Citrus sinensis]
Length=511

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/455 (71%), Positives = 383/455 (84%), Gaps = 2/455 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFL++FF +VY KMKED+  +SNYCKFDS+LLTSFTSSLYIAGL ASL ASSV
Sbjct  45    GGVTSMEPFLEKFFPEVYRKMKEDT-HISNYCKFDSQLLTSFTSSLYIAGLIASLFASSV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR  SIL+GG AFLAG+ALGGAA+N+YMLIFGRVLLG+G+GFANQ+VPLYLSEMAP
Sbjct  104   TRAFGRRASILVGGAAFLAGSALGGAALNIYMLIFGRVLLGVGIGFANQSVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              ++RG  N+ ++LC  IG+L A+LINYGT+KI+ GWGWR+SL +AA PA +LT+GA+ LP
Sbjct  164   PRHRGAFNIGYELCTAIGILGASLINYGTQKIKGGWGWRISLAMAAAPALILTLGALFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNS+IQR ND   AK+ LQR+RGTDDV+AE DDL+ AS I++T+  PFK I+ R+YRP
Sbjct  224   ETPNSIIQRSNDLQKAKQMLQRIRGTDDVEAEFDDLIKASSIAKTVNHPFKKIIQRKYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAA-LMSavvtgavgivttFASMLL  979
             QLVMA  +PFF QVTGINVI FYAPVLFRTI L ES + LMSAVVTG +G ++T  SM+L
Sbjct  284   QLVMAILIPFFLQVTGINVIGFYAPVLFRTIKLSESTSLLMSAVVTGGIGTLSTIISMIL  343

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
             VDK+GR+ L +VGGI M   Q+ +G +M  +LGDQGG SKG A L+L+LI  YVAGF +S
Sbjct  344   VDKLGRKVLFLVGGIQMLAAQVMIGSIMENQLGDQGGFSKGNAYLILVLICVYVAGFAVS  403

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPLG+L+PSEIFPLEIRSAGQSI VAV FLFTFL+ QTFLAMLCH K GIFFFFGGWV 
Sbjct  404   WGPLGFLVPSEIFPLEIRSAGQSINVAVGFLFTFLIAQTFLAMLCHFKAGIFFFFGGWVV  463

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             VMTTFV+  LPETKN+PIE+MD VW EHWFWKKIV
Sbjct  464   VMTTFVHFFLPETKNVPIEQMDEVWGEHWFWKKIV  498



>ref|XP_003598179.1| Hexose carrier protein HEX6 [Medicago truncatula]
 gb|AES68430.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=510

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/455 (73%), Positives = 379/455 (83%), Gaps = 2/455 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFL +FFH++Y KMK D  KVSNYC FDS+LLTSFTSSLY+AG   S  AS V
Sbjct  45    GGVTSMEPFLNKFFHNIYLKMKSDD-KVSNYCMFDSQLLTSFTSSLYVAGFVTSFFASYV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR PSI+ GG AFLAG ALGGAA NVYMLI GR+LLG+GVGFANQAVPLYLSEMA 
Sbjct  104   TRVFGRKPSIVAGGAAFLAGTALGGAAFNVYMLIVGRLLLGVGVGFANQAVPLYLSEMAL  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              ++RG +N  FQL +GIG L ANLINYGTEKI  GWGWRVSL +AAVPA+ LT+GA+ LP
Sbjct  164   PRFRGAINNGFQLSIGIGALSANLINYGTEKIEGGWGWRVSLAMAAVPASFLTLGALFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTI-ERPFKNILHRRYR  799
             ETPNSLIQ   DH  AKR LQR+RG +DV+AELDDL  AS  S+T  ++PFK I+ RRYR
Sbjct  224   ETPNSLIQTTQDHQKAKRILQRIRGIEDVEAELDDLTKASSTSKTSSQQPFKIIMKRRYR  283

Query  800   PQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLL  979
             PQLVMA A+PFFQQVTGINVIAFYAP+LFRTIGLGESA+L+S+V+TG VG  +TF SM +
Sbjct  284   PQLVMAIAIPFFQQVTGINVIAFYAPLLFRTIGLGESASLLSSVMTGIVGTGSTFISMFI  343

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
             VDK+GRR L IVGGI MFV+Q  VGG+M   L D GGLSKG+A +VL++I  YVAGFG S
Sbjct  344   VDKLGRRTLFIVGGIQMFVSQCIVGGIMAVHLKDHGGLSKGYAYMVLIMICIYVAGFGWS  403

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPLGWL+PSEIFPLEIRSAGQSITVAV+FLFTF+V QTFL+MLCH K GIFFFFGGWV 
Sbjct  404   WGPLGWLVPSEIFPLEIRSAGQSITVAVSFLFTFIVAQTFLSMLCHFKSGIFFFFGGWVV  463

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             VMT FVY  LPETKN+P+E+M+ VW+EHWFWKKIV
Sbjct  464   VMTVFVYCFLPETKNVPLEQMEKVWQEHWFWKKIV  498



>ref|XP_006490156.1| PREDICTED: hexose carrier protein HEX6-like [Citrus sinensis]
Length=505

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/455 (71%), Positives = 380/455 (84%), Gaps = 2/455 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF  VYTKM+ED+  VSNYCKFDS+LLT+FTSSLYIAGL ASL ASSV
Sbjct  45    GGVTSMEPFLKKFFPGVYTKMREDT-NVSNYCKFDSQLLTTFTSSLYIAGLIASLFASSV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR  SIL+GG AFLAG+ LGGAA N+YMLIFGRVLLGIG+GFANQ+VPLYLSEMAP
Sbjct  104   TRAFGRKASILVGGTAFLAGSVLGGAAFNIYMLIFGRVLLGIGIGFANQSVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              K+RG  N+ FQ+C+ IGVL ANL+NYGT+KI+ GWGWR+SL +AA PA++LT+GA+ +P
Sbjct  164   PKHRGAFNIGFQVCLAIGVLSANLLNYGTQKIKGGWGWRISLAMAAAPASILTVGALFMP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNS+IQR NDH  AKR LQRVRGT DV+AEL+DL+ AS IS+TI  PFK I+ R+YRP
Sbjct  224   ETPNSIIQRSNDHQKAKRMLQRVRGTADVEAELNDLIRASSISKTINHPFKKIIQRKYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAA-LMSavvtgavgivttFASMLL  979
             QLVMA  +PFFQQVTGIN+I  YAPVL RT+ LGESA+ L+SAVVTG +G V T  SM+L
Sbjct  284   QLVMAILIPFFQQVTGINIIGLYAPVLLRTLKLGESASLLLSAVVTGGIGTVLTIISMIL  343

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
             VDK+GR+ L +VGGI M V+Q+ +G +M  +LGD GG S+G+A L+L+L+  Y AGF  S
Sbjct  344   VDKLGRKILFLVGGIQMLVSQVIIGSIMAVELGDHGGFSEGYAYLILVLVCVYSAGFSYS  403

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPL WL+PSEIFPLEIRSAGQSITVAV  +F F   QTFLAMLCH K GIFFFFGG V 
Sbjct  404   WGPLAWLVPSEIFPLEIRSAGQSITVAVCLVFIFFTAQTFLAMLCHFKAGIFFFFGGLVM  463

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             VMTTF++L LPETKN+PIE+MD VWR+HWFWKK V
Sbjct  464   VMTTFMHLFLPETKNVPIEQMDKVWRQHWFWKKYV  498



>ref|XP_004235176.1| PREDICTED: hexose carrier protein HEX6 [Solanum lycopersicum]
 ref|XP_010318171.1| PREDICTED: hexose carrier protein HEX6 [Solanum lycopersicum]
Length=514

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/454 (71%), Positives = 377/454 (83%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGV SM PFLK+FF +V+TKM   + + SNYC FDS+LLTSFTSSLYIAGL AS  AS V
Sbjct  45    GGVISMAPFLKKFFPEVFTKMTNVT-ETSNYCVFDSQLLTSFTSSLYIAGLIASFFASPV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR PSI+IGG+AFL G+ALGGAA N+YML+ GR+LLG+GVGFANQAVPLYLSEMAP
Sbjct  104   TRTYGRRPSIIIGGIAFLIGSALGGAASNIYMLLLGRILLGVGVGFANQAVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             AKYRG  N++FQLCVGIGVL A+L+NYG +KI+ GWGWR+SL +AA PAT LT+GA  LP
Sbjct  164   AKYRGSFNIAFQLCVGIGVLFASLLNYGVQKIKGGWGWRISLAMAAAPATFLTVGAFFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ET NSLIQ  NDH  AK+ LQRVRGT DVQAELDDL+ AS+ S+ ++ PFK I+ R+YRP
Sbjct  224   ETANSLIQHGNDHQKAKKILQRVRGTTDVQAELDDLIKASDNSKAVKHPFKQIIKRKYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVM+  +PFFQQVTGINVI+FYAP+LF+TIGLG SA+LMSAVVTG VG   TF ++L+V
Sbjct  284   QLVMSVVIPFFQQVTGINVISFYAPILFQTIGLGASASLMSAVVTGVVGTSATFLALLIV  343

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             D+VGRR +   GGI MFV+QM +G +M  KLGD G LSKG+ +LVL+LI  YVAGF  SW
Sbjct  344   DRVGRRAMFSFGGIQMFVSQMLIGIIMAVKLGDHGVLSKGYGLLVLVLICIYVAGFSFSW  403

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIFPLEIRSAGQSITVAV   FTF++ QTFLAMLCHLK GIFFFFG WVA+
Sbjct  404   GPLGWLVPSEIFPLEIRSAGQSITVAVGLTFTFIIAQTFLAMLCHLKSGIFFFFGAWVAI  463

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVYL LPET+NLPIE M+ +WR+HWFWK+ V
Sbjct  464   MTAFVYLFLPETRNLPIENMESIWRDHWFWKRFV  497



>ref|XP_006421591.1| hypothetical protein CICLE_v10006672mg [Citrus clementina]
 gb|ESR34831.1| hypothetical protein CICLE_v10006672mg [Citrus clementina]
Length=512

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/455 (71%), Positives = 385/455 (85%), Gaps = 2/455 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF +VY  M+ED+ KVSNYCKF+S+LLT+FTSS +IAGL ASL AS V
Sbjct  46    GGVTSMEPFLKKFFPEVYKNMREDT-KVSNYCKFNSQLLTTFTSSPFIAGLIASLFASKV  104

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR  SIL+GGVAFLAG+ALGGAA NVYMLI GRVLLG+G+GF+NQ+VPLYLSEMAP
Sbjct  105   TRALGRKASILVGGVAFLAGSALGGAAFNVYMLILGRVLLGVGIGFSNQSVPLYLSEMAP  164

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
               +RG  N+ FQ+C  IGVL ANL+NYGT+KI+ GWGWR+SL +AA PA++LT+GA++LP
Sbjct  165   PNHRGAFNIGFQVCTAIGVLGANLLNYGTQKIKGGWGWRISLSMAAAPASILTLGALILP  224

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNS+IQR N  + AK+ LQRVRGT DVQAELDDL+ AS +SRT++ PF+ I+ R+YRP
Sbjct  225   DTPNSIIQRSNGPEKAKKMLQRVRGTADVQAELDDLLRASIVSRTVKHPFQTIIQRKYRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAA-LMSavvtgavgivttFASMLL  979
             QLVMA  +PFFQQVTGINVI+FYAPVLFRTI L ES + LMSAVVTG V  + T  SM+L
Sbjct  285   QLVMAILIPFFQQVTGINVISFYAPVLFRTIKLSESTSLLMSAVVTGGVSTIATITSMIL  344

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
              DK+GR+ L +VGGILMFV+Q+ +G +M A+LGD GG+S+G+A LVL L+  Y+AGF  S
Sbjct  345   TDKLGRKVLFLVGGILMFVSQVMIGSIMAAELGDHGGISEGYAYLVLALVCVYIAGFASS  404

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPLGWL+PSEIFPLEIRSAGQSITVAV FLF FLV Q+FLAMLCHLK GIFFFFGGW  
Sbjct  405   WGPLGWLVPSEIFPLEIRSAGQSITVAVGFLFIFLVAQSFLAMLCHLKAGIFFFFGGWEV  464

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             VMT FV+  LPETKN+PIE+MD VW+EHWFW++IV
Sbjct  465   VMTVFVHFFLPETKNVPIERMDKVWKEHWFWQRIV  499



>ref|XP_006421606.1| hypothetical protein CICLE_v10004781mg [Citrus clementina]
 gb|ESR34846.1| hypothetical protein CICLE_v10004781mg [Citrus clementina]
Length=511

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/455 (71%), Positives = 382/455 (84%), Gaps = 2/455 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFL++FF  VY KMKED+  +SNYCKFDS+LLTSFTSSLYIAGL ASL AS+V
Sbjct  45    GGVTSMEPFLEKFFPKVYRKMKEDT-HISNYCKFDSQLLTSFTSSLYIAGLIASLFASTV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T+A GR  SIL+GG AFLAG+ALGGAA+N+YMLIFGRVLLG+G+GFANQ+VPLYLSEMAP
Sbjct  104   TKAFGRRASILVGGTAFLAGSALGGAALNIYMLIFGRVLLGVGIGFANQSVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              ++RG  N+ ++LC  IG+L A+LINYGT+KI+ GWGWR+SL +AA PA +LT+GA+ LP
Sbjct  164   PRHRGAFNIGYELCTAIGILAASLINYGTQKIKGGWGWRISLAMAAAPALILTLGALFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNS+IQR ND   AK+ LQR+RGTDDV+AE DDL+ AS I++T+  PFK I+ R+YRP
Sbjct  224   ETPNSIIQRSNDLQRAKQMLQRIRGTDDVEAEFDDLIKASSIAKTVNHPFKKIIQRKYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAA-LMSavvtgavgivttFASMLL  979
             QLVMA  +PFF QVTGINVI FYAPVLFRTI L ES + LMSAVVTG +G ++T  SM+L
Sbjct  284   QLVMAILIPFFLQVTGINVIGFYAPVLFRTIKLSESTSLLMSAVVTGGIGTLSTIISMIL  343

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
             VDK+GR+ L +VGGI M   Q+ +G +M  +LGDQGG SKG A L+L+LI  YVAGF +S
Sbjct  344   VDKLGRKVLFLVGGIQMLAAQVMIGSIMENQLGDQGGFSKGNAYLILVLICVYVAGFAVS  403

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPLG+L+PSEIFPLEIRSAGQSI VAV FLFTFL+ QTFLAMLCH K GIFFFFGGWV 
Sbjct  404   WGPLGFLVPSEIFPLEIRSAGQSINVAVGFLFTFLIAQTFLAMLCHFKSGIFFFFGGWVV  463

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             VMTTFV+  LPETKN+PIE+MD VW EHWFWKKIV
Sbjct  464   VMTTFVHFFLPETKNVPIEQMDKVWGEHWFWKKIV  498



>ref|XP_006837317.1| hypothetical protein AMTR_s00111p00066720 [Amborella trichopoda]
 gb|ERN00171.1| hypothetical protein AMTR_s00111p00066720 [Amborella trichopoda]
Length=508

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/455 (75%), Positives = 389/455 (85%), Gaps = 2/455 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM PFL++FF +VY KM+EDS   SNYCKFDSELLTSFTSSLYIAGL +S  ASSV
Sbjct  44    GGVTSMGPFLEKFFPEVYKKMQEDS-ISSNYCKFDSELLTSFTSSLYIAGLISSFFASSV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR PSILIGG AFLAG+ALGGAA+N+YMLIFGRVLLGIGVGFANQAVPLYLSEMAP
Sbjct  103   TRAYGRRPSILIGGAAFLAGSALGGAAMNIYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              +YRG ++  FQ  VGIG L ANLINYGTEKI  GWGWRVSL LAAVPA++LT+G+++LP
Sbjct  163   PRYRGAISNGFQFSVGIGALAANLINYGTEKISGGWGWRVSLALAAVPASLLTVGSLILP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSLI+R   HD AK  LQR+RGT ++  E +DL+ AS+IS++I  PFKNIL +RYRP
Sbjct  223   DTPNSLIEREASHDKAKMMLQRIRGTTNINNEFEDLIQASKISKSISHPFKNILKKRYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVM+ A+PFFQQVTGINVIAFYAP+LFRTIG GESA+LMSAVVTG VG ++TF SML V
Sbjct  283   QLVMSIAIPFFQQVTGINVIAFYAPLLFRTIGFGESASLMSAVVTGLVGTISTFISMLTV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG-GLSKGWAVLVLLLISSYVAGFGLS  1159
             D+ GRR LL+VGG  M V QM VGG++GAKLGD G GL K W+  VL++I  YVAGFG S
Sbjct  343   DRFGRRTLLLVGGAQMLVAQMIVGGLIGAKLGDHGEGLGKAWSYFVLVMIGFYVAGFGWS  402

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPLGWLIPSEIFPLEIRSAGQSI VAVNFLFTF+V QTFLAMLC LK+GIFFFFGGWVA
Sbjct  403   WGPLGWLIPSEIFPLEIRSAGQSINVAVNFLFTFIVAQTFLAMLCRLKFGIFFFFGGWVA  462

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             VMT+FVYL LPETKN+PIE+M  VWREHWFW K+V
Sbjct  463   VMTSFVYLFLPETKNVPIEQMGSVWREHWFWGKMV  497



>gb|KDO49971.1| hypothetical protein CISIN_1g010323mg [Citrus sinensis]
Length=513

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/457 (71%), Positives = 382/457 (84%), Gaps = 4/457 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFL++FF  VY KMKED+  +SNYCKFDS+LLTSFTSSLYIAGL ASL ASSV
Sbjct  45    GGVTSMEPFLEKFFPKVYRKMKEDT-HISNYCKFDSQLLTSFTSSLYIAGLIASLFASSV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQA--VPLYLSEM  436
             TRA GR  SIL+GG AFLAG+ALGGAA+N+YMLIFGRVLLG+G+GFANQA  VPLYLSEM
Sbjct  104   TRAFGRRASILVGGAAFLAGSALGGAALNIYMLIFGRVLLGVGIGFANQASSVPLYLSEM  163

Query  437   APAKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVV  616
             AP ++RG  N+ ++LC  IG+L A+LINYGT+KI+ GWGWR+SL +AA PA +LT+GA+ 
Sbjct  164   APPRHRGAFNIGYELCTAIGILAASLINYGTQKIKGGWGWRISLAMAAAPALILTLGALF  223

Query  617   LPETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRY  796
             LPETPNS+IQR ND   AK+ LQR+RGTDDV+AE DDL+ AS I++T+  PFK I+ R+Y
Sbjct  224   LPETPNSIIQRSNDLQRAKQMLQRIRGTDDVEAEFDDLIKASSIAKTVNHPFKKIIQRKY  283

Query  797   RPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAA-LMSavvtgavgivttFASM  973
             RPQLVMA  +PFF QVTGINVI FYAPVLFRTI L ES + LMSAVVTG +G ++T  SM
Sbjct  284   RPQLVMAILIPFFLQVTGINVIGFYAPVLFRTIKLSESTSLLMSAVVTGGIGTLSTIISM  343

Query  974   LLVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFG  1153
             +LVDK+GR+ L +VGGI M   Q+ +G +M  +LGDQGG SKG A L+L+LI  YVAGF 
Sbjct  344   ILVDKLGRKVLFLVGGIQMLAAQVMIGSIMENQLGDQGGFSKGNAYLILVLICVYVAGFA  403

Query  1154  LSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGW  1333
             +SWGPLG+L+PSEIFPLEIRSAGQSI VAV FLFTFL+ QTFLAMLCH K GIFFFFGGW
Sbjct  404   VSWGPLGFLVPSEIFPLEIRSAGQSINVAVGFLFTFLIAQTFLAMLCHFKAGIFFFFGGW  463

Query  1334  VAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             V VMTTFV+  LPETKN+PIE+MD VW EHWFWKKIV
Sbjct  464   VVVMTTFVHFFLPETKNVPIEQMDEVWGEHWFWKKIV  500



>gb|EYU20200.1| hypothetical protein MIMGU_mgv1a004758mg [Erythranthe guttata]
Length=511

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/454 (69%), Positives = 383/454 (84%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSME FL++FF  V ++MK+D+ ++SNYCKFDS+LLT FTSSLY+AGL  S  AS +
Sbjct  45    GGVTSMEAFLEKFFPGVQSRMKQDT-RISNYCKFDSQLLTLFTSSLYLAGLVTSFFASWI  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T A GR PS+L GG AFLAGAAL GAA N+YMLI GR+ LGIGVGF NQAVPLYLSE+A 
Sbjct  104   TDAFGRKPSMLAGGSAFLAGAALNGAAFNIYMLILGRIFLGIGVGFTNQAVPLYLSELAL  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              K+RG ++  FQ  +GIG   AN++NYGTEKI  GWGWRVSL +AAVPA+ LT+GA+ LP
Sbjct  164   PKHRGAISNGFQFSLGIGFFAANIVNYGTEKITGGWGWRVSLAMAAVPASALTLGAIFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNS IQR NDH+ A+R LQ++RGT+DVQ+EL+DL+ AS+ S+ I+ P+KNIL R YRP
Sbjct  224   ETPNSFIQRSNDHETARRMLQKIRGTNDVQSELEDLIEASDASKKIKNPYKNILRRNYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVM+ A+PFFQ +TGINV+ FYAP+LFRTIGLGESA+L+S+V+TG VG  TTF +M++V
Sbjct  284   QLVMSVAIPFFQIMTGINVVGFYAPILFRTIGLGESASLLSSVITGVVGSSTTFIAMVVV  343

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             D+VGRR LL++GG+LMF  Q+ VGG+M  KLGDQGGLSK ++  VL LIS Y+AGFG+SW
Sbjct  344   DRVGRRFLLLLGGVLMFFPQILVGGIMAVKLGDQGGLSKEYSYAVLALISLYIAGFGVSW  403

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWLIPSEIFP+EIRSAGQS+TVAVNFLFTF+VGQTFL+MLCH K G+FFFFGGW AV
Sbjct  404   GPLGWLIPSEIFPMEIRSAGQSVTVAVNFLFTFVVGQTFLSMLCHFKAGLFFFFGGWAAV  463

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY LLPETKN+PIE+MD +WREHWFWK+ V
Sbjct  464   MTVFVYFLLPETKNIPIEQMDGIWREHWFWKRFV  497



>ref|XP_006490163.1| PREDICTED: hexose carrier protein HEX6-like isoform X2 [Citrus 
sinensis]
Length=511

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/455 (69%), Positives = 379/455 (83%), Gaps = 2/455 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF +VY KMKED+ K+SNYCKFDS+LL +FTSSLYI+GL ASL AS+V
Sbjct  45    GGVTSMEPFLKKFFPEVYRKMKEDT-KISNYCKFDSQLLAAFTSSLYISGLIASLFASTV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR  SIL+GG AFLAG+A+GGAA+N+YMLIFGRVLLG+G+GF NQ+VPLYLSEMAP
Sbjct  104   TRAFGRKASILVGGTAFLAGSAIGGAALNIYMLIFGRVLLGVGIGFTNQSVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              K+RG   + FQ+CV IGVL ANL+NYGT+KI+ GWGWR+SL +AA PA++LTIG + LP
Sbjct  164   PKHRGAFTIGFQVCVAIGVLSANLLNYGTQKIKGGWGWRISLAMAAAPASILTIGGLFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNS+IQR ND+  A++ LQRVRGT DVQAELDDL+ A  +S+ I  PFK I+ R+YRP
Sbjct  224   ETPNSIIQRTNDYQKAEKMLQRVRGTADVQAELDDLIRAGSVSKNINHPFKKIIQRKYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAA-LMSavvtgavgivttFASMLL  979
             QLVMA  +PFFQQVTG+N+I+FYAPVLFRTI L E+ + LMSA+VTG +G V+    M+L
Sbjct  284   QLVMAILIPFFQQVTGVNIISFYAPVLFRTIKLSENTSLLMSALVTGGIGTVSAILPMIL  343

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
              DK+GR+ L ++GGI M V+Q+ +G +M A+LGD GG S G+A L+L+L+  Y  GF  S
Sbjct  344   ADKLGRKVLFLLGGIQMLVSQVMIGSIMAAQLGDHGGFSSGYAYLILVLVCVYTTGFAYS  403

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPLGWL+PSEIFPLEIRSAGQSITVAV  LFTFLV QTFLAMLCH K GIFFFFGGWVA
Sbjct  404   WGPLGWLVPSEIFPLEIRSAGQSITVAVGLLFTFLVAQTFLAMLCHFKAGIFFFFGGWVA  463

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              MTTFV+  LPETKNLPIE+MD +W EHWFW++IV
Sbjct  464   FMTTFVHFFLPETKNLPIEQMDKLWVEHWFWRRIV  498



>ref|XP_006490160.1| PREDICTED: hexose carrier protein HEX6-like [Citrus sinensis]
Length=505

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/455 (70%), Positives = 379/455 (83%), Gaps = 2/455 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF  VY KM+ED+ KVSNYCKFDS+LLT+FTSSLYIAGL ASL ASSV
Sbjct  45    GGVTSMEPFLKKFFPGVYLKMREDT-KVSNYCKFDSQLLTTFTSSLYIAGLIASLFASSV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR  SIL+GG AFLAG+ALGGAA N+YMLIFGRVLLG+G+GFANQ+VPLYLSEMAP
Sbjct  104   TRAFGRKASILVGGTAFLAGSALGGAAFNIYMLIFGRVLLGVGIGFANQSVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              K+RG  N+ FQ+C+ IGVL ANL+NYGT+KI+  WGWR+SL +AA PA++LT+GA+ +P
Sbjct  164   PKHRGAFNIGFQVCIAIGVLSANLLNYGTQKIKGDWGWRISLAMAAAPASILTLGALFMP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNS+IQR NDH  AKR LQRVRGT DV+AEL+DL+ AS IS+TI  PF  I+ R+YRP
Sbjct  224   ETPNSIIQRSNDHQEAKRMLQRVRGTADVEAELNDLIRASSISKTINHPFNKIIQRKYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAA-LMSavvtgavgivttFASMLL  979
             QLVMA  +PFFQQVTGIN+I  YAPVL RT+ LGES + L+SAVVTG +G V T  SM+L
Sbjct  284   QLVMAILIPFFQQVTGINIIGLYAPVLLRTLKLGESTSLLLSAVVTGGIGTVLTITSMIL  343

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
             VDK+GR+ L +VGGI + V+Q+ +G +M A+LGD GGLS+ +A L+L+L+  Y AGF  S
Sbjct  344   VDKLGRKILFLVGGIQILVSQVIIGSIMAAELGDHGGLSQSYAYLILVLVCVYSAGFSYS  403

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPL WL+PSEIFPLEIRSAGQSITVAV  +F F   QT LAMLCH K GIFFFFGGWV 
Sbjct  404   WGPLAWLVPSEIFPLEIRSAGQSITVAVTLVFIFFSAQTLLAMLCHFKAGIFFFFGGWVI  463

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             VMTTF++L LPETKN+PIE+MD VWR+HWFWKK V
Sbjct  464   VMTTFMHLFLPETKNVPIEQMDKVWRQHWFWKKYV  498



>ref|XP_003526372.1| PREDICTED: hexose carrier protein HEX6-like [Glycine max]
 gb|KHN26457.1| Hexose carrier protein HEX6 [Glycine soja]
Length=510

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/455 (71%), Positives = 378/455 (83%), Gaps = 1/455 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FFH VY KMK    KVSNYC FDS+LLTSFTSSLY+AGL  S  AS +
Sbjct  44    GGVTSMEPFLKKFFHKVYLKMKLADDKVSNYCVFDSQLLTSFTSSLYVAGLVTSFFASYI  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T+A GR PSI++GG AFLAG  LGGAA NVYMLI GR+LLG+GVGFANQAVPLYLSEMA 
Sbjct  104   TKAFGRKPSIVVGGAAFLAGTGLGGAAFNVYMLIVGRLLLGVGVGFANQAVPLYLSEMAL  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              + RG +N  FQL +GIG L ANLINYGTEKI  GWGWR+SL +AAVPA+VLT+GA+ LP
Sbjct  164   PRLRGAINNGFQLSIGIGALSANLINYGTEKIEGGWGWRMSLAMAAVPASVLTLGALFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIER-PFKNILHRRYR  799
             ETPNS+IQR +D   AK  LQR+RG +DVQAELDDL+ AS  S+T  +   K IL  RYR
Sbjct  224   ETPNSVIQRSHDKQKAKLMLQRIRGMEDVQAELDDLIKASSPSKTNNKQSLKLILKGRYR  283

Query  800   PQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLL  979
             PQLVMA A+PFFQQVTGINVIAFYAP+LFRTIGLGESA+L+SAV+TG VG  +TF SM +
Sbjct  284   PQLVMALAIPFFQQVTGINVIAFYAPLLFRTIGLGESASLLSAVMTGVVGTGSTFISMFV  343

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
             VDK+GRR L ++GGI MFV+Q  VGG+M   L D GGLSKG+A +VL++I  YVAGFG S
Sbjct  344   VDKLGRRTLFMIGGIQMFVSQCIVGGIMALHLKDHGGLSKGYAFVVLVMICIYVAGFGWS  403

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPLGWL+PSEIFPLEIRSAGQSITVAV+F+FTF+V QTFL+MLCH + GIFFFFGGWV 
Sbjct  404   WGPLGWLVPSEIFPLEIRSAGQSITVAVSFIFTFIVAQTFLSMLCHFRSGIFFFFGGWVV  463

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             VMTTFVY  LPETK++P+E+M+ VW+EHWFWK+IV
Sbjct  464   VMTTFVYYFLPETKSVPLEQMEKVWQEHWFWKRIV  498



>ref|XP_006421598.1| hypothetical protein CICLE_v10006632mg, partial [Citrus clementina]
 gb|ESR34838.1| hypothetical protein CICLE_v10006632mg, partial [Citrus clementina]
Length=504

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/454 (68%), Positives = 372/454 (82%), Gaps = 11/454 (2%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF  VY KM+ED+ KVSNYCKFDS+LLT+FTSSLYIAGL AS  ASSV
Sbjct  53    GGVTSMEPFLKKFFPGVYIKMREDT-KVSNYCKFDSQLLTTFTSSLYIAGLIASFFASSV  111

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR  SIL+GG AFLAG+ALGGAA N+YMLIFGRVLLG+G+GFANQ+VPLYLSEMAP
Sbjct  112   TRAFGRKASILVGGTAFLAGSALGGAAFNIYMLIFGRVLLGVGIGFANQSVPLYLSEMAP  171

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              K+RG  N+ FQ+C+ IGVL ANL+NYGT+KI+ GWGWRVSL +AA PA++LT+GA+ +P
Sbjct  172   PKHRGAFNIGFQVCIAIGVLSANLLNYGTQKIKGGWGWRVSLAMAAAPASILTVGALFMP  231

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNS+IQR NDH  A+R LQRVRGT DV+AEL+DL+ AS IS+T++ PFK I+ R+YRP
Sbjct  232   ETPNSIIQRSNDHQRARRMLQRVRGTADVEAELNDLIKASSISKTVDHPFKKIIQRKYRP  291

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA  +PFFQQVTGIN+I  YAPVL RT+ LGESA+L+ + V              +V
Sbjct  292   QLVMAILIPFFQQVTGINIIGLYAPVLLRTLKLGESASLLLSAVVTGG----------IV  341

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GR+ L +VGGI M V+Q+ +G +M A+LGD GGLS+G+A L+L+L+  Y AGF  SW
Sbjct  342   DKLGRKILFLVGGIQMLVSQVIIGSIMAAELGDHGGLSQGYAYLILVLVCVYSAGFSYSW  401

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPL WL+PSEIFPLEIRSAGQSITVAV  +F F   QT LAMLCH K GIFFFFGGWV V
Sbjct  402   GPLAWLVPSEIFPLEIRSAGQSITVAVTLVFIFFSAQTLLAMLCHFKAGIFFFFGGWVMV  461

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MTTF++L LPETKN+PIE+MD +WR+HWFWKK V
Sbjct  462   MTTFMHLFLPETKNVPIEQMDKIWRQHWFWKKYV  495



>ref|XP_004499623.1| PREDICTED: LOW QUALITY PROTEIN: hexose carrier protein HEX6-like 
[Cicer arietinum]
Length=537

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/457 (71%), Positives = 377/457 (82%), Gaps = 4/457 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFL +FFH++Y KMKED   VSNYC FDS+LLTSFTSSLY+AG F S LAS V
Sbjct  45    GGVTSMEPFLNKFFHNIYLKMKEDV-TVSNYCLFDSQLLTSFTSSLYVAGFFTSFLASYV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T   GR PSI+ GG AFLAG ALGGAA NVYMLI GR++LG+GVGFANQAVPLYLSEMA 
Sbjct  104   TSVFGRKPSIIAGGTAFLAGTALGGAAFNVYMLIVGRLMLGVGVGFANQAVPLYLSEMAL  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              ++RG +N  FQL +GIG L ANLINYGTEKI+  +GWRVSL +AAVPA+ LT+GA+ LP
Sbjct  164   PRFRGAINNGFQLSIGIGALSANLINYGTEKIKGSYGWRVSLAMAAVPASFLTLGALFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTI---ERPFKNILHRR  793
             ETPNSLIQ   DH  AKR LQR+RG +DVQ+ELDDL  A+  + T    ++PFK IL RR
Sbjct  224   ETPNSLIQTSQDHQKAKRILQRIRGVEDVQSELDDLTKANSSTSTKTSPQQPFKLILKRR  283

Query  794   YRPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASM  973
             YRPQLV A A+PFFQQVTGINVIAFYAP+LFRTIGLGESA+L+S+V+TG  G  +TF SM
Sbjct  284   YRPQLVTAIAIPFFQQVTGINVIAFYAPLLFRTIGLGESASLLSSVMTGITGTCSTFISM  343

Query  974   LLVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFG  1153
             L+VDK+GRR L IVGGI MFV+Q  VGG+M   L D GGL+KG+A +VL++I  YVAGFG
Sbjct  344   LVVDKLGRRTLFIVGGIQMFVSQCIVGGIMAFHLKDHGGLTKGYAYMVLVMICIYVAGFG  403

Query  1154  LSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGW  1333
              SWGPLGWL+PSEIFPLEIRS GQSITVAV+F+FTF+V Q+FL+MLCH K GIFFFFGGW
Sbjct  404   WSWGPLGWLVPSEIFPLEIRSVGQSITVAVSFVFTFVVAQSFLSMLCHFKSGIFFFFGGW  463

Query  1334  VAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             V VMT FVY  LPETKN+P+E+M+ VW+EHWFWK+IV
Sbjct  464   VVVMTVFVYFFLPETKNVPLEQMEKVWQEHWFWKRIV  500



>ref|XP_008775188.1| PREDICTED: hexose carrier protein HEX6-like [Phoenix dactylifera]
Length=510

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/456 (71%), Positives = 385/456 (84%), Gaps = 1/456 (0%)
 Frame = +2

Query  77    SVGGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLAS  256
             S GGVTSM+ FLK+FF +VY +MKED+  +SNYCKFDS+LLTSFTSSLY+AGL A+  AS
Sbjct  42    SAGGVTSMDSFLKKFFPEVYRRMKEDT-HISNYCKFDSQLLTSFTSSLYVAGLIATFFAS  100

Query  257   SVTRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEM  436
             SVTRA GR PS+L+GG AFLAGAALGGAA+NV M+I GRVLLG+GVGFANQ+VPLYLSEM
Sbjct  101   SVTRAFGRRPSMLLGGAAFLAGAALGGAAVNVSMVILGRVLLGVGVGFANQSVPLYLSEM  160

Query  437   APAKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVV  616
             AP +YRG  +  FQ  +G+G L ANLINYGTEKI+ GWGWRVSL LAAVPA++LT+GA+ 
Sbjct  161   APPQYRGAFSNGFQFSLGVGALSANLINYGTEKIKAGWGWRVSLALAAVPASLLTLGALF  220

Query  617   LPETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRY  796
             LPETPNSLIQR ND    +  L+++RGT DV  EL DL+AAS  ++ +  PF+ I+  +Y
Sbjct  221   LPETPNSLIQRGNDLKKTRELLEKIRGTVDVDKELHDLIAASSAAKAVNHPFRRIIRPKY  280

Query  797   RPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASML  976
             RPQLVMA  +PFFQQVTGINVIAFYAPVL RTIGLGESAALMSAVVTG VG  +TF SM+
Sbjct  281   RPQLVMAITIPFFQQVTGINVIAFYAPVLLRTIGLGESAALMSAVVTGVVGTGSTFISMI  340

Query  977   LVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGL  1156
             +VDK+GRR L I+GG+ MFV+Q+ +G ++  +LGD GG+SKG+A +VL+LI  YVAGFG 
Sbjct  341   MVDKLGRRALFIIGGVQMFVSQIIIGVIIATQLGDHGGVSKGYAYIVLVLIGVYVAGFGW  400

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSEIFPLEIRSAGQSITVAV+F+FTF+V Q FLAMLCHLK GIFFFFGGW+
Sbjct  401   SWGPLGWLVPSEIFPLEIRSAGQSITVAVSFVFTFIVAQAFLAMLCHLKSGIFFFFGGWL  460

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              +MT F+YLLLPETKN+PIE+M  VWRE+WFWK+IV
Sbjct  461   VLMTLFIYLLLPETKNVPIEQMVGVWRENWFWKRIV  496



>ref|XP_006490162.1| PREDICTED: hexose carrier protein HEX6-like isoform X1 [Citrus 
sinensis]
 ref|XP_006490164.1| PREDICTED: hexose carrier protein HEX6-like isoform X3 [Citrus 
sinensis]
Length=511

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/453 (69%), Positives = 378/453 (83%), Gaps = 2/453 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF +VY KMKED+ K+SNYCKFDS+LL +FTSSLYI+GL ASL AS+V
Sbjct  45    GGVTSMEPFLKKFFPEVYRKMKEDT-KISNYCKFDSQLLAAFTSSLYISGLIASLFASTV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR  SIL+GG AFLAG+A+GGAA+N+YMLIFGRVLLG+G+GF NQ+VPLYLSEMAP
Sbjct  104   TRAFGRKASILVGGTAFLAGSAIGGAALNIYMLIFGRVLLGVGIGFTNQSVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              K+RG   + FQ+CV IGVL ANL+NYGT+KI+ GWGWR+SL +AA PA++LTIG + LP
Sbjct  164   PKHRGAFTIGFQVCVAIGVLSANLLNYGTQKIKGGWGWRISLAMAAAPASILTIGGLFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNS+IQR ND+  A++ LQRVRGT DVQAELDDL+ A  +S+ I  PFK I+ R+YRP
Sbjct  224   ETPNSIIQRTNDYQKAEKMLQRVRGTADVQAELDDLIRAGSVSKNINHPFKKIIQRKYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAA-LMSavvtgavgivttFASMLL  979
             QLVMA  +PFFQQVTG+N+I+FYAPVLFRTI L E+ + LMSA+VTG +G V+    M+L
Sbjct  284   QLVMAILIPFFQQVTGVNIISFYAPVLFRTIKLSENTSLLMSALVTGGIGTVSAILPMIL  343

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
              DK+GR+ L ++GGI M V+Q+ +G +M A+LGD GG S G+A L+L+LI  Y AGFG S
Sbjct  344   ADKLGRKVLFLLGGIQMLVSQVMIGSIMAAQLGDHGGFSIGYAYLILVLICVYKAGFGFS  403

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPLGWL+PSEIFPLEIRSAGQSITVAV  LFT LV QTFLAMLCH K G+FFFFGGW+ 
Sbjct  404   WGPLGWLVPSEIFPLEIRSAGQSITVAVGLLFTSLVAQTFLAMLCHFKAGVFFFFGGWLT  463

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKK  1438
             VMTTFV+  LPETKN+PIE MD VWREHWFW+K
Sbjct  464   VMTTFVHFFLPETKNVPIELMDKVWREHWFWRK  496



>ref|XP_006421597.1| hypothetical protein CICLE_v10006871mg [Citrus clementina]
 gb|ESR34837.1| hypothetical protein CICLE_v10006871mg [Citrus clementina]
Length=521

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/453 (70%), Positives = 378/453 (83%), Gaps = 2/453 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF +VY KMKED+ K+SNYCKFDS+LL +FTSSLYI+GL ASL AS+V
Sbjct  55    GGVTSMEPFLKKFFPEVYRKMKEDT-KISNYCKFDSQLLAAFTSSLYISGLIASLFASTV  113

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR  SIL+GG AFLAG+A+GGAA+N+YMLIFGRVLLG+G+GF NQ+VPLYLSEMAP
Sbjct  114   TRAFGRKASILVGGTAFLAGSAIGGAALNIYMLIFGRVLLGVGIGFTNQSVPLYLSEMAP  173

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              K+RG   + FQ+CV IGVL ANL+NYGT+KI+ GWGWRVSL +AA PA++LTIG + LP
Sbjct  174   PKHRGAFTIGFQVCVAIGVLSANLLNYGTQKIKGGWGWRVSLAMAAAPASILTIGGLFLP  233

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNS+IQR ND+  A++ LQRVRGT DVQAELDDL+ A  +S+ I  PFK I+ R+YRP
Sbjct  234   ETPNSIIQRTNDYQKAEKMLQRVRGTADVQAELDDLIRAGSVSKNINHPFKKIIQRKYRP  293

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAA-LMSavvtgavgivttFASMLL  979
             QLVMA  +PFFQQVTG+N+I+FYAPVLFRTI L E+ + LMSA+VTG +G V+    M+L
Sbjct  294   QLVMAILIPFFQQVTGVNIISFYAPVLFRTIKLSENTSLLMSALVTGGIGTVSAILPMIL  353

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
              DK+GR+ L ++GGI M V+Q+ +G +M A+LGD GG S G+A L+L+LI  Y AGFG S
Sbjct  354   ADKLGRKVLFLLGGIQMLVSQVMIGSIMSAQLGDHGGFSIGYAYLILVLICVYKAGFGFS  413

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPLGWL+PSEIFPLEIRSAGQSITVAV  LFT LV QTFLAMLCH K G+FFFFGGW+ 
Sbjct  414   WGPLGWLVPSEIFPLEIRSAGQSITVAVGLLFTSLVAQTFLAMLCHFKAGVFFFFGGWLT  473

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKK  1438
             VMTTFV+  LPETKN+PIE MD VWREHWFW+K
Sbjct  474   VMTTFVHFFLPETKNVPIELMDEVWREHWFWRK  506



>ref|XP_006421604.1| hypothetical protein CICLE_v10004764mg [Citrus clementina]
 gb|ESR34844.1| hypothetical protein CICLE_v10004764mg [Citrus clementina]
Length=512

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/455 (69%), Positives = 379/455 (83%), Gaps = 2/455 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF +VY  M+ED+ KVSNYCKFDS+LLT+FTSSLYI G+  SL+ASSV
Sbjct  45    GGVTSMEPFLKKFFPEVYKNMREDT-KVSNYCKFDSQLLTTFTSSLYITGILGSLIASSV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR  SILIGGVAFLAG+ALGG+A N+YMLIFGR+LLG+G+GF NQ+VPLYLSEMAP
Sbjct  104   TRALGRKVSILIGGVAFLAGSALGGSAFNIYMLIFGRLLLGVGIGFGNQSVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              KYRG  N+ FQLC  IGVL ANL+NYGT+KI+ GWGWR+SL +AA PA++LTIGA+ LP
Sbjct  164   PKYRGTFNIGFQLCGAIGVLSANLLNYGTQKIKGGWGWRISLAMAAAPASILTIGAIFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNS+IQR NDH  A++ LQRVRG  DV+AEL+DL+ AS IS++I  PFKNI+ R+YRP
Sbjct  224   ETPNSIIQRSNDHQKAQKMLQRVRGIADVEAELNDLIRASSISKSITHPFKNIVQRKYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAA-LMSavvtgavgivttFASMLL  979
             QLVMA  +PFFQQVTGIN++  Y+PVLFRT+ LGES + L+SA+V G +G V    SM+L
Sbjct  284   QLVMAILIPFFQQVTGINIVGLYSPVLFRTLKLGESTSLLLSALVAGGMGTVFAIVSMIL  343

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
              DK GR+ L +VGGI M V+Q+ +G +M A+LGD+GG S+G+A L+L+++  Y +G+  S
Sbjct  344   ADKFGRKVLFLVGGIQMLVSQVMIGSIMAAQLGDRGGFSEGYAYLILVMVCLYSSGYCYS  403

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPL WL+PSEIFPLEIRSAGQSITVAVNFLFTFL  QTFL MLCH K GIFFFFGG V 
Sbjct  404   WGPLAWLVPSEIFPLEIRSAGQSITVAVNFLFTFLTAQTFLPMLCHFKAGIFFFFGGLVL  463

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             +MTTF++  LPETKN+PIE+MD VWREHWFW KIV
Sbjct  464   IMTTFMHFFLPETKNVPIEQMDKVWREHWFWMKIV  498



>ref|XP_006490157.1| PREDICTED: hexose carrier protein HEX6-like isoform X1 [Citrus 
sinensis]
Length=512

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/455 (69%), Positives = 376/455 (83%), Gaps = 2/455 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF DVY  M+ED+ KV NYCKFDS+LLT+FTSSLYI G+  SL+ASSV
Sbjct  45    GGVTSMEPFLKKFFPDVYKNMREDT-KVGNYCKFDSQLLTTFTSSLYITGILGSLIASSV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR  SILIGGVAFLAG+ALGG+A N+YMLIFGR+LLG+G+GF NQ+VPLYLSEMAP
Sbjct  104   TRALGRKVSILIGGVAFLAGSALGGSAFNIYMLIFGRLLLGVGIGFGNQSVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              KYRG  N+ FQLC  IGVL ANL+NYGT+KI+ GWGWR+SL +AA PA++LTIGA+ LP
Sbjct  164   PKYRGTFNIGFQLCGAIGVLSANLLNYGTQKIKGGWGWRISLAMAAAPASILTIGAIFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNS+IQR NDH  A++ LQRVRG  DV+AEL+DL+ AS IS++I  PFKNI  R+YRP
Sbjct  224   ETPNSIIQRSNDHQKAQKMLQRVRGIADVEAELNDLIRASSISKSITHPFKNIAQRKYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAA-LMSavvtgavgivttFASMLL  979
             QLVMA  +PFFQQVTGIN++  Y+PVLFRT+ LGES + L+SA+V G +G V    SM+L
Sbjct  284   QLVMAILIPFFQQVTGINIVGLYSPVLFRTLKLGESTSLLLSALVAGGMGTVFAIVSMIL  343

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
              DK GR+ L +VGGI M V+Q+ VG +M A+LGD GG S+G+A L+L+++  Y +G+  S
Sbjct  344   ADKFGRKVLFLVGGIQMLVSQVMVGSIMAAQLGDHGGFSEGYAYLILVMVCLYSSGYCYS  403

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPL WL+PSEIFPLEIRSAGQSITVAVNFLFTFL  QTFL MLCH K GIFFFFGG V 
Sbjct  404   WGPLAWLVPSEIFPLEIRSAGQSITVAVNFLFTFLTAQTFLPMLCHFKAGIFFFFGGLVL  463

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             +MTTF++  LPETKN+PIE+MD VWREHWFW KIV
Sbjct  464   IMTTFMHFFLPETKNVPIEQMDKVWREHWFWMKIV  498



>ref|XP_009783890.1| PREDICTED: hexose carrier protein HEX6-like [Nicotiana sylvestris]
Length=509

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/454 (72%), Positives = 385/454 (85%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGV SMEPFLK+FF DVY KMK+ S K+SNYC FDS+LLTSFTSSLYIAGL AS  AS +
Sbjct  46    GGVISMEPFLKKFFPDVYNKMKQVS-KISNYCIFDSQLLTSFTSSLYIAGLIASFFASPI  104

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR PSILIGGVAFL G++LGGAA N+YML+ GRVLLG+GVGFANQAVPLYLSEMAP
Sbjct  105   TRTFGRRPSILIGGVAFLIGSSLGGAASNIYMLLLGRVLLGVGVGFANQAVPLYLSEMAP  164

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              KYRG  N++FQLCVGIGVL A+L+NYG EKI+ GWGWR+SL +AA PA+ LT+GA+ LP
Sbjct  165   PKYRGSFNIAFQLCVGIGVLSASLLNYGVEKIKGGWGWRISLAMAAAPASFLTLGALFLP  224

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ET NSLIQ   DH  AK+ LQRVRGT DVQ ELDDL+ AS+ S+T++ PFK I+ R+YRP
Sbjct  225   ETANSLIQHGKDHQKAKQILQRVRGTLDVQTELDDLIKASDKSKTVKHPFKQIIKRKYRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVM+ A+PFFQQVTGINVI+FYAP+LF+TIGLG SA+L+SAVVTG VG   TF ++L+V
Sbjct  285   QLVMSIAIPFFQQVTGINVISFYAPILFQTIGLGASASLLSAVVTGVVGTSATFLALLIV  344

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DKVGRR +   GGI MF++QM +GG+M AKLGDQG LSKG+ +LVL+L+  YVAGF LSW
Sbjct  345   DKVGRRAMFSSGGITMFISQMLIGGIMAAKLGDQGALSKGYGLLVLILVCIYVAGFSLSW  404

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIFPLEIRSA QSITVAV  +FTF++ QTFL MLCHLK GIFFFFGGWVA+
Sbjct  405   GPLGWLVPSEIFPLEIRSAAQSITVAVGLIFTFIIAQTFLVMLCHLKSGIFFFFGGWVAI  464

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVYLLLPET+NLPIE M+ +WR+HWFWK+ V
Sbjct  465   MTAFVYLLLPETRNLPIENMEQIWRDHWFWKRFV  498



>ref|XP_009628001.1| PREDICTED: hexose carrier protein HEX6-like [Nicotiana tomentosiformis]
Length=508

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/454 (72%), Positives = 384/454 (85%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGV SMEPFLK+FF DVY KMK+ S K+SNYC FDS+LLTSFTSSLYIAGL AS  AS +
Sbjct  45    GGVISMEPFLKKFFPDVYNKMKQVS-KISNYCIFDSQLLTSFTSSLYIAGLIASFFASPI  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR PSILIGG+AFL G+ALGGAA N+YML+ GRVLLG+GVGFANQAVPLYLSEMAP
Sbjct  104   TRTFGRRPSILIGGIAFLIGSALGGAATNIYMLLLGRVLLGVGVGFANQAVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              KYRG  N++FQLCVGIGVL A+L+NYG EKI+ GWGWR+SL +AA PA+ LT+GA+ LP
Sbjct  164   PKYRGSFNIAFQLCVGIGVLSASLLNYGVEKIKGGWGWRISLAMAAAPASFLTVGALFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ET NSLIQ   DH  AK+ LQRVRGT DVQ ELDDL+ AS+ S+T++ PFK I+ R+YRP
Sbjct  224   ETANSLIQHGKDHQKAKQILQRVRGTLDVQTELDDLIKASDKSKTVKHPFKQIIKRKYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVM+ A+PFFQQVTGINVI+FYAP+LF+TIGLG SA+L+SAVVTG VG   TF ++L+V
Sbjct  284   QLVMSIAIPFFQQVTGINVISFYAPILFQTIGLGASASLLSAVVTGVVGTSATFLALLIV  343

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DKVGRR +   GGI MF++QM +GG+M AKLGDQG LSKG+ +LVL+LI  YVAGF LSW
Sbjct  344   DKVGRRAMFSSGGITMFISQMLIGGIMAAKLGDQGALSKGYGLLVLILICIYVAGFSLSW  403

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIFPLEIRSA QSITVAV  +FTF++ QTFL MLCHLK GIFFFFGGWVA+
Sbjct  404   GPLGWLVPSEIFPLEIRSAAQSITVAVGLIFTFIIAQTFLVMLCHLKSGIFFFFGGWVAI  463

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVYLLLPET+NLPIE M+ +WR+HWFW + V
Sbjct  464   MTAFVYLLLPETRNLPIENMEKIWRDHWFWNRFV  497



>ref|XP_003527549.1| PREDICTED: hexose carrier protein HEX6-like isoform X1 [Glycine 
max]
Length=501

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/455 (72%), Positives = 387/455 (85%), Gaps = 2/455 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM PFL++FF DVYTKMK+D+ KVSNYCKFDS+LLT+FTSSLYIAGL AS  ASSV
Sbjct  44    GGVTSMVPFLEKFFPDVYTKMKQDT-KVSNYCKFDSQLLTAFTSSLYIAGLIASFFASSV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR PSILIGG AFL GAALGGAA+N+YMLI GRV+LG+G+GFANQ+ PLYLSEMAP
Sbjct  103   TRAFGRKPSILIGGAAFLIGAALGGAALNIYMLILGRVMLGVGIGFANQSAPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              +YRG +N  FQLCVGIGVL ANL+N+GTEKI+ GWGWR+SL +AAVPA++LT G++ LP
Sbjct  163   PRYRGAINTGFQLCVGIGVLSANLVNFGTEKIKAGWGWRISLVMAAVPASMLTFGSLFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNS+IQ   +H  AK  LQR+RGTDDVQ EL+DL+ ASE+S +I+ PFKNILHR+YRP
Sbjct  223   ETPNSIIQHDKNHQKAKLMLQRIRGTDDVQQELEDLIEASEMSNSIKHPFKNILHRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAA-LMSavvtgavgivttFASMLL  979
             QLVMA A+PFFQQ TGINVI+FYAP+LF TIGLGESA+ L+SAVVTG VG  +TF SML+
Sbjct  283   QLVMAIAIPFFQQFTGINVISFYAPILFLTIGLGESASLLLSAVVTGFVGTASTFISMLM  342

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
             VD++GRR L I GGI MF +Q+ +G +M  +LGD G + K +A L+L+LI  YVAGF  S
Sbjct  343   VDRLGRRVLFISGGIQMFFSQVLIGSIMATQLGDHGEIDKKYAYLILVLICIYVAGFAWS  402

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPLGWL+PSEIF LEIRSA QSITVAVNF FTF+V QTFL MLCH K+G FFFFGGWV 
Sbjct  403   WGPLGWLVPSEIFQLEIRSAAQSITVAVNFFFTFIVAQTFLIMLCHFKFGTFFFFGGWVV  462

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             VMT FVYLLLPET+N+PIE+MD VWREH+FWK+IV
Sbjct  463   VMTAFVYLLLPETRNVPIEQMDRVWREHFFWKRIV  497



>ref|XP_006421603.1| hypothetical protein CICLE_v10004798mg [Citrus clementina]
 gb|ESR34843.1| hypothetical protein CICLE_v10004798mg [Citrus clementina]
Length=505

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/455 (70%), Positives = 379/455 (83%), Gaps = 2/455 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF  VYTKM+ED+ KVSNYCKFDS+LLT+FTSSLYIAGL ASL ASSV
Sbjct  45    GGVTSMEPFLKKFFPGVYTKMREDT-KVSNYCKFDSQLLTTFTSSLYIAGLIASLFASSV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR  SIL+GG AFLAG+ALGGAA N+YMLIFGRVLLGIG+GFANQ+VPLYLSEMAP
Sbjct  104   TRAFGRKASILVGGTAFLAGSALGGAAFNIYMLIFGRVLLGIGIGFANQSVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              K+RG  N+ FQ+C+ IGVL ANL+NYGT+KI+ GWGWR+SL +AA PA++LT+GA+ +P
Sbjct  164   PKHRGAFNIGFQVCLAIGVLSANLLNYGTQKIKGGWGWRISLAMAAAPASILTVGALFMP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNS+IQR ND   AKR LQRVRGT DV+AEL+DL+ AS IS+TI  PFK I+ R+YRP
Sbjct  224   ETPNSIIQRSNDPQKAKRMLQRVRGTADVEAELNDLIRASSISKTINHPFKKIIQRKYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtg-avgivttFASMLL  979
             QLVMA  +PFFQQVTGIN+I  YAPVL RT+ L ESA+L+ + V    +G V T  SM+L
Sbjct  284   QLVMAILIPFFQQVTGINIIGLYAPVLLRTLKLSESASLLLSAVVTGGIGTVLTIISMIL  343

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
             VDK+GR+ L +VGGI MFV+Q+ +G +M A+LGD GG S+G+A L+L+L+  Y AGF  S
Sbjct  344   VDKLGRKILFLVGGIQMFVSQVIIGSIMAAELGDHGGFSEGYAYLILVLVCVYSAGFSYS  403

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPL WL+PSEIFPLEIRSAGQSITVAV  +F F   QTFLAMLCH K GIFFFFGGWV 
Sbjct  404   WGPLAWLVPSEIFPLEIRSAGQSITVAVCLVFIFFTAQTFLAMLCHFKAGIFFFFGGWVM  463

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             VMTTF++L LPETKN+PIE+MD VWR+HWFWKK V
Sbjct  464   VMTTFMHLFLPETKNVPIEQMDKVWRQHWFWKKYV  498



>ref|XP_007148727.1| hypothetical protein PHAVU_005G009300g [Phaseolus vulgaris]
 gb|ESW20721.1| hypothetical protein PHAVU_005G009300g [Phaseolus vulgaris]
Length=516

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/456 (71%), Positives = 376/456 (82%), Gaps = 2/456 (0%)
 Frame = +2

Query  77    SVGGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLAS  256
             + GGVTSM+ FLK+FFH VY K KED+ KVSNYC FDS+LLTSFTSSLYIAGL  S  AS
Sbjct  42    TAGGVTSMDSFLKKFFHKVYLK-KEDA-KVSNYCVFDSQLLTSFTSSLYIAGLVTSFFAS  99

Query  257   SVTRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEM  436
              +T+A GR PS++ GG AFLAG ALGGAA NVYMLI GR+LLG+GVGFANQAVPLYLSEM
Sbjct  100   YITKAFGRKPSMVAGGAAFLAGTALGGAAFNVYMLIVGRLLLGVGVGFANQAVPLYLSEM  159

Query  437   APAKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVV  616
             A  + RG  +  FQL +GIG L ANLINYGTEKI  GWGWRVSL +AAVPA+VLT+GA+ 
Sbjct  160   ALPRLRGATSNGFQLSIGIGALSANLINYGTEKIEGGWGWRVSLAMAAVPASVLTLGALF  219

Query  617   LPETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRY  796
             LPETPNSLIQR +DH  AK  LQR+RG +DV+AELDDL+ AS      ++ FK IL RRY
Sbjct  220   LPETPNSLIQRNHDHQKAKLLLQRIRGIEDVEAELDDLIKASSSKTNNKQSFKIILKRRY  279

Query  797   RPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASML  976
             RPQLVMA A+PFFQQVTGINVIAFYAP+LFRTIGLGESAAL+SAV+TG VG  +TF SM 
Sbjct  280   RPQLVMAVAIPFFQQVTGINVIAFYAPLLFRTIGLGESAALLSAVMTGVVGTGSTFISMF  339

Query  977   LVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGL  1156
             +VDK+GRR L ++GGI MF +Q  VGG+M   L D GGLSK ++ +VL++I  YVAGFG 
Sbjct  340   MVDKLGRRTLFMIGGIQMFASQCIVGGIMAFHLRDHGGLSKVYSCVVLVMILIYVAGFGW  399

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSEIFPLEIRS GQSITVAV+F+FTF+V QTFL+MLCH + GIFFFFGGWV
Sbjct  400   SWGPLGWLVPSEIFPLEIRSVGQSITVAVSFIFTFIVAQTFLSMLCHFRSGIFFFFGGWV  459

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              VMT FVY LLPETK++P+E+M+ VW EHWFWK+IV
Sbjct  460   VVMTIFVYYLLPETKSVPLEQMEKVWHEHWFWKRIV  495



>ref|XP_006490158.1| PREDICTED: hexose carrier protein HEX6-like isoform X2 [Citrus 
sinensis]
Length=463

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/450 (69%), Positives = 371/450 (82%), Gaps = 2/450 (0%)
 Frame = +2

Query  98    MEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSVTRACG  277
             MEPFLK+FF DVY  M+ED+ KV NYCKFDS+LLT+FTSSLYI G+  SL+ASSVTRA G
Sbjct  1     MEPFLKKFFPDVYKNMREDT-KVGNYCKFDSQLLTTFTSSLYITGILGSLIASSVTRALG  59

Query  278   RTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAPAKYRG  457
             R  SILIGGVAFLAG+ALGG+A N+YMLIFGR+LLG+G+GF NQ+VPLYLSEMAP KYRG
Sbjct  60    RKVSILIGGVAFLAGSALGGSAFNIYMLIFGRLLLGVGIGFGNQSVPLYLSEMAPPKYRG  119

Query  458   GMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLPETPNS  637
               N+ FQLC  IGVL ANL+NYGT+KI+ GWGWR+SL +AA PA++LTIGA+ LPETPNS
Sbjct  120   TFNIGFQLCGAIGVLSANLLNYGTQKIKGGWGWRISLAMAAAPASILTIGAIFLPETPNS  179

Query  638   LIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRPQLVMA  817
             +IQR NDH  A++ LQRVRG  DV+AEL+DL+ AS IS++I  PFKNI  R+YRPQLVMA
Sbjct  180   IIQRSNDHQKAQKMLQRVRGIADVEAELNDLIRASSISKSITHPFKNIAQRKYRPQLVMA  239

Query  818   FAVPFFQQVTGINVIAFYAPVLFRTIGLGESAA-LMSavvtgavgivttFASMLLVDKVG  994
               +PFFQQVTGIN++  Y+PVLFRT+ LGES + L+SA+V G +G V    SM+L DK G
Sbjct  240   ILIPFFQQVTGINIVGLYSPVLFRTLKLGESTSLLLSALVAGGMGTVFAIVSMILADKFG  299

Query  995   RRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSWGPLG  1174
             R+ L +VGGI M V+Q+ VG +M A+LGD GG S+G+A L+L+++  Y +G+  SWGPL 
Sbjct  300   RKVLFLVGGIQMLVSQVMVGSIMAAQLGDHGGFSEGYAYLILVMVCLYSSGYCYSWGPLA  359

Query  1175  WLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAVMTTF  1354
             WL+PSEIFPLEIRSAGQSITVAVNFLFTFL  QTFL MLCH K GIFFFFGG V +MTTF
Sbjct  360   WLVPSEIFPLEIRSAGQSITVAVNFLFTFLTAQTFLPMLCHFKAGIFFFFGGLVLIMTTF  419

Query  1355  VYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             ++  LPETKN+PIE+MD VWREHWFW KIV
Sbjct  420   MHFFLPETKNVPIEQMDKVWREHWFWMKIV  449



>gb|KDO49972.1| hypothetical protein CISIN_1g012438mg [Citrus sinensis]
 gb|KDO49973.1| hypothetical protein CISIN_1g012438mg [Citrus sinensis]
Length=463

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/450 (68%), Positives = 371/450 (82%), Gaps = 2/450 (0%)
 Frame = +2

Query  98    MEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSVTRACG  277
             MEPFLK+FF DVY  M+ED+ KV NYCKFDS+LLT+FTSSLYI G+  SL+ASSVTRA G
Sbjct  1     MEPFLKKFFPDVYKNMREDT-KVGNYCKFDSQLLTTFTSSLYITGILGSLIASSVTRALG  59

Query  278   RTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAPAKYRG  457
             R  SILIGGVAFLAG+ALGG+A N+YMLIFGR+LLG+G+GF NQ+VPLYLSEMAP KYRG
Sbjct  60    RKVSILIGGVAFLAGSALGGSAFNIYMLIFGRLLLGVGIGFGNQSVPLYLSEMAPPKYRG  119

Query  458   GMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLPETPNS  637
               N+ FQLC  IGVL ANL+NYGT+KI+ GWGWR+SL +AA PA++LTIGA+ LPETPNS
Sbjct  120   TFNIGFQLCGAIGVLSANLLNYGTQKIKGGWGWRISLAMAAAPASILTIGAIFLPETPNS  179

Query  638   LIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRPQLVMA  817
             +IQR NDH  A++ LQRVRG  DV+AEL+DL+ AS IS++I  PFKNI  R+YRPQLVMA
Sbjct  180   IIQRSNDHQKAQKMLQRVRGIADVEAELNDLIRASSISKSITHPFKNIAQRKYRPQLVMA  239

Query  818   FAVPFFQQVTGINVIAFYAPVLFRTIGLGESAA-LMSavvtgavgivttFASMLLVDKVG  994
               +PFFQQVTGIN++  Y+PVLFRT+ LGES + L+SA+V G +G V    SM+L DK G
Sbjct  240   ILIPFFQQVTGINIVGLYSPVLFRTLKLGESTSLLLSALVAGGMGTVFAIVSMILADKFG  299

Query  995   RRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSWGPLG  1174
             R+ L +VGGI M V+Q+ +G +M A+LGD GG S+G+A L+L+++  Y +G+  SWGPL 
Sbjct  300   RKVLFLVGGIQMLVSQVMIGSIMAAQLGDHGGFSEGYAYLILVMVCLYSSGYCYSWGPLA  359

Query  1175  WLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAVMTTF  1354
             WL+PSEIFPLEIRSAGQSITVAVNFLFTFL  QTFL MLCH K GIFFFFGG V +MTTF
Sbjct  360   WLVPSEIFPLEIRSAGQSITVAVNFLFTFLTAQTFLPMLCHFKAGIFFFFGGLVLIMTTF  419

Query  1355  VYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             ++  LPETKN+PIE+MD VWREHWFW KIV
Sbjct  420   MHFFLPETKNVPIEQMDKVWREHWFWMKIV  449



>ref|XP_006421601.1| hypothetical protein CICLE_v10004936mg [Citrus clementina]
 gb|ESR34841.1| hypothetical protein CICLE_v10004936mg [Citrus clementina]
Length=458

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/450 (69%), Positives = 376/450 (84%), Gaps = 2/450 (0%)
 Frame = +2

Query  98    MEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSVTRACG  277
             M+PFLK+FF  VY KM+ED+ KVSNYCKFDS+LLT+FTSSLYIAGL ASL ASSVTRA G
Sbjct  1     MDPFLKKFFPGVYIKMREDT-KVSNYCKFDSQLLTTFTSSLYIAGLIASLFASSVTRAFG  59

Query  278   RTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAPAKYRG  457
             R  SIL+GG AFLAG+ALGGAA N+YMLIFGRVLLG+G+GFANQ+VPLYLSEMAP ++RG
Sbjct  60    RKASILVGGTAFLAGSALGGAAFNIYMLIFGRVLLGVGIGFANQSVPLYLSEMAPPRHRG  119

Query  458   GMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLPETPNS  637
               N+ F  C+ IGVL ANL+NYGT+KI+ GWGWRVSL +AA PA++LT+GA+ +PETPNS
Sbjct  120   AFNLGFHECIAIGVLSANLLNYGTQKIKGGWGWRVSLAMAAAPASILTVGALFIPETPNS  179

Query  638   LIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRPQLVMA  817
             +IQR NDH  A+R LQRVRGT DV+AEL+DL+ AS IS+T++ PFK I+ R+YRPQL+MA
Sbjct  180   IIQRSNDHQRARRMLQRVRGTADVEAELNDLIKASSISKTVDHPFKKIIQRKYRPQLLMA  239

Query  818   FAVPFFQQVTGINVIAFYAPVLFRTIGLGESAA-LMSavvtgavgivttFASMLLVDKVG  994
               +PFFQQVTGIN+I  YAPVL RT+ LGESA+ L+SAVVTG +G V T  SM+LVDK+G
Sbjct  240   ILIPFFQQVTGINIIGLYAPVLLRTLKLGESASLLLSAVVTGGIGTVLTIISMILVDKLG  299

Query  995   RRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSWGPLG  1174
             R+ L +VGGI M V+Q+ +G +M A+LGD GG S+G+A L+L+L+  Y AGF  SWGPL 
Sbjct  300   RKILFLVGGIQMLVSQVIIGSIMAAELGDHGGFSEGYAYLILVLLCVYSAGFSYSWGPLT  359

Query  1175  WLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAVMTTF  1354
             WL+PSEIFPLEIRSAGQSITVAV+ +F F   QTFLAMLCH K G FFFFGG V VMTTF
Sbjct  360   WLVPSEIFPLEIRSAGQSITVAVSLVFIFFTAQTFLAMLCHFKAGSFFFFGGLVMVMTTF  419

Query  1355  VYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             ++L LPETKN+PIE+MD +WR+HWFWKK V
Sbjct  420   MHLFLPETKNVPIEEMDKIWRQHWFWKKYV  449



>ref|XP_011076401.1| PREDICTED: hexose carrier protein HEX6-like [Sesamum indicum]
 ref|XP_011076403.1| PREDICTED: hexose carrier protein HEX6-like [Sesamum indicum]
Length=510

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/454 (66%), Positives = 373/454 (82%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGV+SM+PFLK+FF  VY KMKED   VSNYCKFDS+LLT FTSSLYIAGLF+S  A+ V
Sbjct  44    GGVSSMDPFLKKFFLGVYKKMKEDK-DVSNYCKFDSQLLTCFTSSLYIAGLFSSFFAAIV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR PSI+IGG++++ GAA+GGAA N+Y+LI GRVLLG+G+GF NQ+VPLYLSEMAP
Sbjct  103   TRNYGRKPSIVIGGLSYMVGAAIGGAAYNIYVLILGRVLLGVGLGFTNQSVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             +KYRG  NV+FQ+C+GIG   A LINYGT +I+ GWGWR+S+ +A VPA VL IGA+ LP
Sbjct  163   SKYRGAFNVAFQICIGIGQNSATLINYGTVRIKGGWGWRISIAMAGVPAAVLAIGALFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQ  NDH  AK+ LQ++RGTDDVQAELDDL+ AS  S+ I+ PFKN++ R+YRP
Sbjct  223   ETPNSLIQHTNDHGKAKKMLQKIRGTDDVQAELDDLIEASNASKAIKHPFKNLMQRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA A+PFFQQ+TGINVI+FYAP+LF TIG GE+A+L+SA V G +G +    +++LV
Sbjct  283   QLVMAIAMPFFQQITGINVISFYAPLLFLTIGSGENASLLSATVIGLIGSIFVLITLVLV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DKVGRR L  +GG+ M ++Q+ VGG++ AKLGD G + KG+A+ VL+LI  Y++GFGLSW
Sbjct  343   DKVGRRPLFHIGGLQMLISQLLVGGIIAAKLGDHGTMDKGYALGVLILICIYISGFGLSW  402

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGW++ SEIFPLE+RSA QSITVAVN   TF++ Q FLAMLCHLK GIFFFF  WV V
Sbjct  403   GPLGWVVTSEIFPLEVRSAAQSITVAVNLSMTFIIAQIFLAMLCHLKSGIFFFFAAWVVV  462

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             M+ FVY LLPETKN+PIEKM+ +W EH+FWK+ V
Sbjct  463   MSGFVYFLLPETKNIPIEKMEKIWGEHFFWKRFV  496



>ref|XP_006582411.1| PREDICTED: hexose carrier protein HEX6-like isoform X2 [Glycine 
max]
Length=453

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/450 (72%), Positives = 382/450 (85%), Gaps = 2/450 (0%)
 Frame = +2

Query  98    MEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSVTRACG  277
             M PFL++FF DVYTKMK+D+ KVSNYCKFDS+LLT+FTSSLYIAGL AS  ASSVTRA G
Sbjct  1     MVPFLEKFFPDVYTKMKQDT-KVSNYCKFDSQLLTAFTSSLYIAGLIASFFASSVTRAFG  59

Query  278   RTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAPAKYRG  457
             R PSILIGG AFL GAALGGAA+N+YMLI GRV+LG+G+GFANQ+ PLYLSEMAP +YRG
Sbjct  60    RKPSILIGGAAFLIGAALGGAALNIYMLILGRVMLGVGIGFANQSAPLYLSEMAPPRYRG  119

Query  458   GMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLPETPNS  637
              +N  FQLCVGIGVL ANL+N+GTEKI+ GWGWR+SL +AAVPA++LT G++ LPETPNS
Sbjct  120   AINTGFQLCVGIGVLSANLVNFGTEKIKAGWGWRISLVMAAVPASMLTFGSLFLPETPNS  179

Query  638   LIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRPQLVMA  817
             +IQ   +H  AK  LQR+RGTDDVQ EL+DL+ ASE+S +I+ PFKNILHR+YRPQLVMA
Sbjct  180   IIQHDKNHQKAKLMLQRIRGTDDVQQELEDLIEASEMSNSIKHPFKNILHRKYRPQLVMA  239

Query  818   FAVPFFQQVTGINVIAFYAPVLFRTIGLGESAA-LMSavvtgavgivttFASMLLVDKVG  994
              A+PFFQQ TGINVI+FYAP+LF TIGLGESA+ L+SAVVTG VG  +TF SML+VD++G
Sbjct  240   IAIPFFQQFTGINVISFYAPILFLTIGLGESASLLLSAVVTGFVGTASTFISMLMVDRLG  299

Query  995   RRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSWGPLG  1174
             RR L I GGI MF +Q+ +G +M  +LGD G + K +A L+L+LI  YVAGF  SWGPLG
Sbjct  300   RRVLFISGGIQMFFSQVLIGSIMATQLGDHGEIDKKYAYLILVLICIYVAGFAWSWGPLG  359

Query  1175  WLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAVMTTF  1354
             WL+PSEIF LEIRSA QSITVAVNF FTF+V QTFL MLCH K+G FFFFGGWV VMT F
Sbjct  360   WLVPSEIFQLEIRSAAQSITVAVNFFFTFIVAQTFLIMLCHFKFGTFFFFGGWVVVMTAF  419

Query  1355  VYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             VYLLLPET+N+PIE+MD VWREH+FWK+IV
Sbjct  420   VYLLLPETRNVPIEQMDRVWREHFFWKRIV  449



>gb|KDO45292.1| hypothetical protein CISIN_1g048207mg, partial [Citrus sinensis]
Length=466

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/452 (68%), Positives = 373/452 (83%), Gaps = 2/452 (0%)
 Frame = +2

Query  86    GVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSVT  265
             GVTSMEPFLK+FF +V  KM+ED+ KVS+YCKFDS+LLTS TSSLYI G+ ASL+ASSVT
Sbjct  1     GVTSMEPFLKKFFPEVNRKMREDT-KVSDYCKFDSQLLTSLTSSLYITGILASLIASSVT  59

Query  266   RACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAPA  445
             RA G   SILIGGVAFLAG+ALGG+A N+YMLIFGR+LLG+G+ F NQ+VPLYLSEMAP 
Sbjct  60    RALGGKVSILIGGVAFLAGSALGGSAFNIYMLIFGRLLLGVGIDFGNQSVPLYLSEMAPP  119

Query  446   KYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLPE  625
             K RG  N+ FQ+CV  G+L ANL+NYGT+KI+ GWGW++SL +AA PA++LTIG++ LPE
Sbjct  120   KCRGAFNIGFQVCVATGILSANLLNYGTQKIKGGWGWKISLAMAAAPASILTIGSLFLPE  179

Query  626   TPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRPQ  805
             TPNS+IQR NDH  A++ LQRV GT DVQAEL+DL+ AS  S+ I  PFK I+ R+YRPQ
Sbjct  180   TPNSIIQRTNDHQKAEKMLQRVHGTADVQAELEDLIRASSDSKNINHPFKKIIQRKYRPQ  239

Query  806   LVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAA-LMSavvtgavgivttFASMLLV  982
             LVMA  +PFFQQVTG+N+I+FYAPVLFRTI L E+ + LMSA+VTG +G V+    M+L 
Sbjct  240   LVMAILIPFFQQVTGVNIISFYAPVLFRTIKLSENTSLLMSALVTGGIGTVSAILPMILA  299

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GR+ L ++GGI M V+Q+ +G +M A+LGD GG S G+A L+L+LI  Y AGFG SW
Sbjct  300   DKLGRKVLFLLGGIQMLVSQVMIGSIMAAQLGDHGGFSIGYAYLILVLICVYKAGFGFSW  359

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIFPLEIRSAGQSITVAV  LFT LV QTFLAMLCH K G+FFFFGGW+ V
Sbjct  360   GPLGWLVPSEIFPLEIRSAGQSITVAVGLLFTSLVAQTFLAMLCHFKAGVFFFFGGWLTV  419

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKK  1438
             MTTFV+  LPETKN+PIE MD VWREHWFW+K
Sbjct  420   MTTFVHFFLPETKNVPIELMDKVWREHWFWRK  451



>emb|CDP05362.1| unnamed protein product [Coffea canephora]
Length=510

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/455 (67%), Positives = 365/455 (80%), Gaps = 1/455 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FLK+FF +V+ KMKED    SNYCKFDS+LLT FTSSLYIA L AS  AS V
Sbjct  44    GGVTSMDHFLKKFFPEVFKKMKEDK-TTSNYCKFDSQLLTFFTSSLYIAALVASFFASQV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR  SIL+GG AF+ G+A+GGAA NV MLIFGR+ LG+G+GFANQ+VPLYL+EMAP
Sbjct  103   TRAFGRKSSILLGGAAFIIGSAIGGAAYNVVMLIFGRIFLGVGIGFANQSVPLYLAEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              K RG     F  CVGIG+LIANLINYG  KIR GWGWR+SL +AA PA++LT+GA+ LP
Sbjct  163   PKKRGAFTSGFNFCVGIGILIANLINYGAAKIRGGWGWRISLAMAAAPASILTLGALFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNS+IQ   +++ AKR LQ++RG DDVQ ELDDL+ AS+I++  + PFK+I  RRYRP
Sbjct  223   DTPNSIIQHGKNYEKAKRVLQQIRGVDDVQIELDDLIQASDIAKATKHPFKDIRRRRYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVM+ A+PFFQQ+TGIN I FYAPVLFRTIG GESA+L+SA+V G VG      + L+V
Sbjct  283   QLVMSMAIPFFQQLTGINTITFYAPVLFRTIGRGESASLLSAIVVGVVGSSAVILTSLIV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DKVGR+ L  VGG +M   Q+ +GG+M  KLGD G LS  +A LVL+L+  YVAGFGLSW
Sbjct  343   DKVGRKVLFFVGGAVMLFCQLTIGGIMAVKLGDHGQLSTTYAYLVLILVCMYVAGFGLSW  402

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWLIPSEIFPLEIRSA Q I VAV+F+F FL  QTFLAMLCHLK GIFFFFGGWV V
Sbjct  403   GPLGWLIPSEIFPLEIRSAAQGIRVAVDFVFIFLGAQTFLAMLCHLKAGIFFFFGGWVTV  462

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIVV  1447
             MT FVYLLLPETKN+PIE+M+ +WREHWFWK+ V+
Sbjct  463   MTAFVYLLLPETKNVPIERMEKIWREHWFWKRFVL  497



>gb|EYU20198.1| hypothetical protein MIMGU_mgv1a004584mg [Erythranthe guttata]
Length=519

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/454 (70%), Positives = 372/454 (82%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK FF  VY KMK DS  +SNYCKFDS+LLT+FTSSLYIAGL AS  AS V
Sbjct  46    GGVTSMEPFLKEFFPGVYRKMKRDS-DISNYCKFDSQLLTTFTSSLYIAGLIASFFASPV  104

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR  SILIGGV+F+ GAALGG A N+YMLI GR+LLGIGVGF NQ+VPLYLSEMAP
Sbjct  105   TRALGRRASILIGGVSFIGGAALGGTARNIYMLIVGRILLGIGVGFTNQSVPLYLSEMAP  164

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              KYRG  N+ FQLCV IG L A LINYGTEKI  GWGWR+SL +AAVPA++LT+G + LP
Sbjct  165   PKYRGAFNIGFQLCVSIGGLSAFLINYGTEKIAGGWGWRISLSMAAVPASILTVGGIFLP  224

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQ  +D   AK  L+R+RGTDDV+AE  DL+ ASE SR +ERPF+ IL R+YRP
Sbjct  225   ETPNSLIQHGHDIQTAKTMLKRIRGTDDVEAEFTDLLTASEASRKVERPFRKILERKYRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVM+ A+PFFQQVTGINVIAFYAP+LFRTIG G S +L+S+V+   VG +TT  SM +V
Sbjct  285   QLVMSIAIPFFQQVTGINVIAFYAPILFRTIGSGVSDSLLSSVIIAVVGTITTVLSMAIV  344

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR L  +GG+LMFV Q+ +GGVM AKLGD+GGLS+G++VLVL+LI  YVAGF +SW
Sbjct  345   DKLGRRALFHIGGVLMFVPQVMIGGVMAAKLGDRGGLSEGYSVLVLILICVYVAGFSVSW  404

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+ SEIFPLEIRSA QSI VAV F F F V QTFLAMLC +K  IFFFF  WVAV
Sbjct  405   GPLGWLVTSEIFPLEIRSAAQSINVAVGFFFIFAVAQTFLAMLCRMKAAIFFFFAAWVAV  464

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             M+ FVY+LLPETK++PIEKMD +WR+HWFWK+ V
Sbjct  465   MSGFVYVLLPETKDIPIEKMDAIWRKHWFWKRYV  498



>ref|XP_006421594.1| hypothetical protein CICLE_v10006533mg, partial [Citrus clementina]
 gb|ESR34834.1| hypothetical protein CICLE_v10006533mg, partial [Citrus clementina]
Length=466

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/452 (68%), Positives = 372/452 (82%), Gaps = 2/452 (0%)
 Frame = +2

Query  86    GVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSVT  265
             GVTSMEPFLK+FF  V  KM+ED+ KVS+YCKFDS+LLTS TSSLYI G+ ASL+ASSVT
Sbjct  1     GVTSMEPFLKKFFPKVNRKMREDT-KVSDYCKFDSQLLTSLTSSLYITGILASLIASSVT  59

Query  266   RACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAPA  445
             RA G   SILIGGVAFLAG+ALGG+A N+YMLIFGR+LLG+G+ F NQ+VPLYLSEMAP 
Sbjct  60    RALGGKVSILIGGVAFLAGSALGGSAFNIYMLIFGRLLLGVGIDFGNQSVPLYLSEMAPP  119

Query  446   KYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLPE  625
             K RG  N+ FQ+CV  G+L ANL+NYGT+KI+ GWGW++SL +AA PA++LTIG++ LPE
Sbjct  120   KCRGAFNIGFQVCVATGILSANLLNYGTQKIKGGWGWKISLAMAAAPASILTIGSLFLPE  179

Query  626   TPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRPQ  805
             TPNS+IQR NDH  A++ LQRV GT DVQAEL+DL+ AS  S+ I  PFK I+ R+YRPQ
Sbjct  180   TPNSIIQRTNDHQKAEKMLQRVHGTADVQAELEDLIRASSDSKNINHPFKKIIQRKYRPQ  239

Query  806   LVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAA-LMSavvtgavgivttFASMLLV  982
             LVMA  +PFFQQVTG+N+I+FYAPVLFRTI L E+ + LMSA+VTG +G V+    M+L 
Sbjct  240   LVMAILIPFFQQVTGVNIISFYAPVLFRTIKLSENTSLLMSALVTGGIGTVSAILPMILA  299

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GR+ L ++GGI M V+Q+ +G +M A+LGD GG S G+A L+L+LI  Y AGFG SW
Sbjct  300   DKLGRKVLFLLGGIQMLVSQVMIGSIMAAQLGDHGGFSIGYAYLILVLICVYKAGFGFSW  359

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIFPLEIRSAGQSITVAV  LFT LV QTFLAMLCH K G+FFFFGGW+ V
Sbjct  360   GPLGWLVPSEIFPLEIRSAGQSITVAVGLLFTSLVAQTFLAMLCHFKAGVFFFFGGWLTV  419

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKK  1438
             MTTFV+  LPETKN+PIE MD VWREHWFW+K
Sbjct  420   MTTFVHFFLPETKNVPIELMDKVWREHWFWRK  451



>ref|XP_011076415.1| PREDICTED: hexose carrier protein HEX6-like [Sesamum indicum]
 ref|XP_011076416.1| PREDICTED: hexose carrier protein HEX6-like [Sesamum indicum]
Length=514

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/452 (67%), Positives = 368/452 (81%), Gaps = 1/452 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSME FLK+FF +VY +MKED+  +SNYCKFDS+LLTSFTSSLY++ L AS LA++V
Sbjct  45    GGVTSMESFLKKFFPEVYIQMKEDT-NLSNYCKFDSQLLTSFTSSLYVSCLIASFLAATV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR PSI+IGG+AFL GA LGG A NVYMLI GR+LLG+G+GF NQ+VPLYLSEMAP
Sbjct  104   TRDYGRKPSIIIGGMAFLTGAVLGGVAENVYMLIIGRLLLGVGIGFTNQSVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              K RG  N  FQLC+GIG ++A+L NYGTEKI+  WGWR+SLG+AA+PA VL +GA+ LP
Sbjct  164   PKSRGAFNCGFQLCIGIGSVLASLTNYGTEKIKSDWGWRISLGMAALPALVLIVGALFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSL+Q+  D++ AKR L++VRGTDDV+ E DDLV AS+ S+ I+ PFKNIL R+YRP
Sbjct  224   ETPNSLVQQGRDYEKAKRLLEKVRGTDDVEEEFDDLVTASKASKAIKHPFKNILQRKYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVM+ A+PFFQQVTGINVI+FYAP+LF TIG G SA+LMS ++ G V    T  S L+V
Sbjct  284   QLVMSIAIPFFQQVTGINVISFYAPILFMTIGSGASASLMSTLILGIVATSMTVVSSLVV  343

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR +   GGI MF+TQ+ +GG+M AKLG++G +S+G+ +LV++LI  Y  GF  SW
Sbjct  344   DKLGRRAIFHTGGITMFITQVLIGGIMAAKLGERGAMSEGYNILVVVLICIYSCGFAFSW  403

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+ SEIFPLEIRSA QSI V V+F  + L+ QTFLAMLCHLKY  FFFFG WVA+
Sbjct  404   GPLGWLVTSEIFPLEIRSAAQSINVGVSFFCSALISQTFLAMLCHLKYASFFFFGVWVAL  463

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKK  1438
             MT FVYLLLPETKN+PIEKMD VWR+H FWK+
Sbjct  464   MTVFVYLLLPETKNIPIEKMDTVWRKHKFWKR  495



>ref|XP_007148728.1| hypothetical protein PHAVU_005G009400g [Phaseolus vulgaris]
 gb|ESW20722.1| hypothetical protein PHAVU_005G009400g [Phaseolus vulgaris]
Length=504

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/456 (70%), Positives = 371/456 (81%), Gaps = 2/456 (0%)
 Frame = +2

Query  77    SVGGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLAS  256
             + GGVTSM+ FLK+FFH VY K KED+ KVSNYC FDS+LLTSFTSSLYIAGL  +  AS
Sbjct  42    TAGGVTSMDSFLKKFFHKVYLK-KEDA-KVSNYCVFDSQLLTSFTSSLYIAGLVTTFFAS  99

Query  257   SVTRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEM  436
              VT+A GR PSI+ GG AFLAG ALGGAA NVYMLI GR+LLG+GVGFANQAVPLYLSEM
Sbjct  100   HVTKAFGRKPSIVAGGAAFLAGTALGGAAFNVYMLIVGRLLLGVGVGFANQAVPLYLSEM  159

Query  437   APAKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVV  616
             A  + RG ++  FQL + IG++ ANLINYG EKI  GWGWRVSL LAAVPA+ LT+GA+ 
Sbjct  160   ALPRLRGAISNGFQLSICIGIVCANLINYGAEKIEGGWGWRVSLALAAVPASFLTLGALF  219

Query  617   LPETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRY  796
             LPETPNSLIQR +DH  AK  LQR+RGT+DV+AE DDL+ AS      ++  K IL  RY
Sbjct  220   LPETPNSLIQRSHDHQKAKLLLQRIRGTEDVEAEFDDLIKASSSKTNNKQSLKIILKPRY  279

Query  797   RPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASML  976
             RPQLVMA  +PFFQQ TGINVI FYAP+LFRTIGLGESA+L+SAVVTG VG  +TF SM 
Sbjct  280   RPQLVMAVVIPFFQQFTGINVIGFYAPLLFRTIGLGESASLLSAVVTGVVGTGSTFISMF  339

Query  977   LVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGL  1156
             +VDK+GRR L I+GGI MF +Q  VGG+M   L D GGLS+G+A +VL++I  YVAGFG 
Sbjct  340   IVDKLGRRTLFIIGGIQMFASQCIVGGIMAFHLRDHGGLSQGYACVVLVMILIYVAGFGW  399

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSEIFPLEIRS GQSITVAV+F+FTF V QTFL+MLCH KYGIFFFFGGWV
Sbjct  400   SWGPLGWLVPSEIFPLEIRSVGQSITVAVSFIFTFTVAQTFLSMLCHFKYGIFFFFGGWV  459

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              VMT FVY  LPETK++P+E+M+ VW++HWFWK+IV
Sbjct  460   VVMTIFVYYFLPETKSVPLEQMEKVWQDHWFWKRIV  495



>ref|XP_011076414.1| PREDICTED: hexose carrier protein HEX6-like [Sesamum indicum]
Length=514

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/452 (67%), Positives = 364/452 (81%), Gaps = 1/452 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSME FLK+FF  VY +MKED+  +SNYCKFDS+LLTSFTSSLYI+ L AS LA+ V
Sbjct  45    GGVTSMESFLKKFFPGVYIQMKEDT-NLSNYCKFDSQLLTSFTSSLYISCLIASFLAAPV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR PSI+IGGVAFL GA LGG A N+YMLI GR+LLG+G+GF NQ+VPLYLSEMAP
Sbjct  104   TRDYGRKPSIIIGGVAFLTGAVLGGVAENIYMLIIGRLLLGVGIGFTNQSVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              K RG  N  FQLCVGIG ++A+  NYGTE I+  WGWR+SLG+A++PA VL +GA+ LP
Sbjct  164   PKSRGAFNCGFQLCVGIGSVVASFTNYGTEMIKGDWGWRISLGMASLPALVLIVGALFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR +D+  AKR L+++RG DDVQ E DDLVAASE S+ I+ PFKNIL R+YRP
Sbjct  224   ETPNSLIQRDHDYGKAKRLLEKIRGIDDVQEEFDDLVAASEASKAIKHPFKNILERKYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVM+ A+PFFQQVTGINVI+FYAP+LF TIG G SA+L+S +V G V    T  S L+V
Sbjct  284   QLVMSVAIPFFQQVTGINVISFYAPILFMTIGSGVSASLLSTLVLGIVATSMTVVSSLVV  343

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR +  +GGI MF+TQM VGG+MGAKLG+ G +S+G+ +LV++LI  Y   F  SW
Sbjct  344   DKLGRRAIFHIGGIAMFITQMMVGGIMGAKLGEHGAMSQGYNILVVVLICIYSCAFAFSW  403

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+ SEIFPLEIRSA QSI V VNF  + L+ QTFLAMLCHLKY  FFFFG WVA+
Sbjct  404   GPLGWLVTSEIFPLEIRSAAQSINVGVNFFCSALISQTFLAMLCHLKYASFFFFGVWVAL  463

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKK  1438
             MT FVYLLLPETKN+PIEK+D +WREH FWK+
Sbjct  464   MTVFVYLLLPETKNIPIEKVDTIWREHNFWKR  495



>ref|XP_010678286.1| PREDICTED: hexose carrier protein HEX6 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=482

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/466 (69%), Positives = 378/466 (81%), Gaps = 14/466 (3%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFL +FF  VY KMKED+ KVSNYCKF+S+LLTSFTSSLY+AGL AS+ AS +
Sbjct  18    GGVTSMEPFLSKFFPKVYVKMKEDT-KVSNYCKFNSQLLTSFTSSLYVAGLVASIFASPI  76

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T+A GR PSI+I G+AFLAG+A GGAA+N+YMLI GR+LLG+GVGFANQ+VPLYLSEMAP
Sbjct  77    TKAYGRKPSIIIAGLAFLAGSAFGGAALNIYMLILGRLLLGVGVGFANQSVPLYLSEMAP  136

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              KYRG  N SFQL VGIG L A L N  TEKI+ GWGWR+SL  AA+PA++LT+GA++LP
Sbjct  137   PKYRGAFNNSFQLSVGIGFLTATLTNVATEKIKGGWGWRLSLATAALPASILTLGALLLP  196

Query  623   ETPNSLIQRR---------ND--HDGAKRRLQRVRGTDDVQAELDDLV-AASEISRTIER  766
             ET NSLIQR          ND  H+ AK  LQRVRGT DV AE +DL+ A+S IS+T   
Sbjct  197   ETANSLIQRSGNSSTTTISNDLLHE-AKLTLQRVRGTTDVDAEFNDLINASSTISKTNNN  255

Query  767   PFKNILHRRYRPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgav  946
              F  IL R++RPQL+M+F +PFFQQVTGINVI+FYAP+LFRTIG GESA+L+SAV+TG V
Sbjct  256   SFYQILQRKHRPQLIMSFFIPFFQQVTGINVISFYAPILFRTIGFGESASLLSAVMTGVV  315

Query  947   givttFASMLLVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLL  1126
             GI +TF SML+VDK GRR L I GG+ M + Q+AVG VM  +LGD GG+   +A LVL+L
Sbjct  316   GIGSTFISMLVVDKFGRRSLFIFGGVQMLICQIAVGIVMATQLGDHGGIKNVYAYLVLVL  375

Query  1127  ISSYVAGFGLSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKY  1306
             I  YVAGFGLSWGPLGWL+PSEIF LEIRSAGQSITVAVNF+FTF++ QTFLAMLC  K 
Sbjct  376   ICVYVAGFGLSWGPLGWLVPSEIFQLEIRSAGQSITVAVNFVFTFIIAQTFLAMLCCFKA  435

Query  1307  GIFFFFGGWVAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             GIFFFFGGWV VMT F+Y  LPETK++P+EKMD +WR+HWFW KIV
Sbjct  436   GIFFFFGGWVLVMTGFIYFFLPETKSIPLEKMDQIWRDHWFWSKIV  481



>ref|XP_010678285.1| PREDICTED: hexose carrier protein HEX6 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=508

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/466 (69%), Positives = 378/466 (81%), Gaps = 14/466 (3%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFL +FF  VY KMKED+ KVSNYCKF+S+LLTSFTSSLY+AGL AS+ AS +
Sbjct  44    GGVTSMEPFLSKFFPKVYVKMKEDT-KVSNYCKFNSQLLTSFTSSLYVAGLVASIFASPI  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T+A GR PSI+I G+AFLAG+A GGAA+N+YMLI GR+LLG+GVGFANQ+VPLYLSEMAP
Sbjct  103   TKAYGRKPSIIIAGLAFLAGSAFGGAALNIYMLILGRLLLGVGVGFANQSVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              KYRG  N SFQL VGIG L A L N  TEKI+ GWGWR+SL  AA+PA++LT+GA++LP
Sbjct  163   PKYRGAFNNSFQLSVGIGFLTATLTNVATEKIKGGWGWRLSLATAALPASILTLGALLLP  222

Query  623   ETPNSLIQRR---------ND--HDGAKRRLQRVRGTDDVQAELDDLV-AASEISRTIER  766
             ET NSLIQR          ND  H+ AK  LQRVRGT DV AE +DL+ A+S IS+T   
Sbjct  223   ETANSLIQRSGNSSTTTISNDLLHE-AKLTLQRVRGTTDVDAEFNDLINASSTISKTNNN  281

Query  767   PFKNILHRRYRPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgav  946
              F  IL R++RPQL+M+F +PFFQQVTGINVI+FYAP+LFRTIG GESA+L+SAV+TG V
Sbjct  282   SFYQILQRKHRPQLIMSFFIPFFQQVTGINVISFYAPILFRTIGFGESASLLSAVMTGVV  341

Query  947   givttFASMLLVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLL  1126
             GI +TF SML+VDK GRR L I GG+ M + Q+AVG VM  +LGD GG+   +A LVL+L
Sbjct  342   GIGSTFISMLVVDKFGRRSLFIFGGVQMLICQIAVGIVMATQLGDHGGIKNVYAYLVLVL  401

Query  1127  ISSYVAGFGLSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKY  1306
             I  YVAGFGLSWGPLGWL+PSEIF LEIRSAGQSITVAVNF+FTF++ QTFLAMLC  K 
Sbjct  402   ICVYVAGFGLSWGPLGWLVPSEIFQLEIRSAGQSITVAVNFVFTFIIAQTFLAMLCCFKA  461

Query  1307  GIFFFFGGWVAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             GIFFFFGGWV VMT F+Y  LPETK++P+EKMD +WR+HWFW KIV
Sbjct  462   GIFFFFGGWVLVMTGFIYFFLPETKSIPLEKMDQIWRDHWFWSKIV  507



>ref|XP_004146944.1| PREDICTED: hexose carrier protein HEX6-like [Cucumis sativus]
 gb|KGN53155.1| hypothetical protein Csa_4G022910 [Cucumis sativus]
Length=513

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/456 (72%), Positives = 379/456 (83%), Gaps = 2/456 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF +V  KMKED  ++SNYCKFDS+LLTSFTSSLYIAGL  +  ASSV
Sbjct  46    GGVTSMEPFLKKFFPEVNRKMKEDK-QISNYCKFDSQLLTSFTSSLYIAGLLFTFFASSV  104

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR PSI IGG AFLAGAALGGAA NVYML+ GR+LLGIGVGF NQA+PLYLSEMAP
Sbjct  105   TRTFGRKPSIHIGGAAFLAGAALGGAAANVYMLLLGRILLGIGVGFTNQAIPLYLSEMAP  164

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              KYRG +N  FQLCVGIGVL ANLINYGT K+ +  GWR+SL LA +PA++LT G++ LP
Sbjct  165   PKYRGAINNGFQLCVGIGVLSANLINYGTAKLNNTSGWRISLALAGLPASLLTFGSIFLP  224

Query  623   ETPNSLIQRRND-HDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYR  799
             ETPNSLIQR +D H  AK+ LQ++RGTDDV AE +DLV A+ IS+T+++PF  I   +YR
Sbjct  225   ETPNSLIQRCDDEHLTAKKMLQQIRGTDDVDAEFEDLVKANAISKTMKKPFVKITQPKYR  284

Query  800   PQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLL  979
             PQLVMA A+ FFQQVTGINVI+FYAP+LFRT+GL ESA+L+SAVVTG VG V TF SML+
Sbjct  285   PQLVMAIAIQFFQQVTGINVISFYAPILFRTVGLDESASLLSAVVTGVVGTVATFISMLI  344

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
             VDK GRR L  +GGI MF++Q+ VG VM AKLGD GGLSKG+A LVL+LI  YVAGF  S
Sbjct  345   VDKFGRRVLFTIGGIQMFISQIVVGSVMAAKLGDHGGLSKGYAYLVLVLICIYVAGFAWS  404

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPLGWL+PSEIF LEIRSAGQSITVA NFLFTF + Q+FL+MLCHLK G FFFFGGWV 
Sbjct  405   WGPLGWLVPSEIFQLEIRSAGQSITVAANFLFTFAIAQSFLSMLCHLKSGTFFFFGGWVL  464

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIVV  1447
             +MT FV L LPETKN+PIE+MD +W EHWFWK+IVV
Sbjct  465   IMTVFVLLFLPETKNIPIEQMDRIWMEHWFWKRIVV  500



>ref|XP_008803828.1| PREDICTED: hexose carrier protein HEX6-like [Phoenix dactylifera]
Length=514

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/454 (65%), Positives = 375/454 (83%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGV++ME FL++FF +VYT+MKED+ K+SNYC+F+SELLT+FTSSLY+AGL ASL AS +
Sbjct  41    GGVSTMEGFLEKFFPEVYTQMKEDA-KISNYCRFNSELLTAFTSSLYVAGLVASLFASPI  99

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR  S+LIGG  FLAGAALGGAA NVYM+IFGRVLLG G+GF NQ++PLYLSEMAP
Sbjct  100   TRAFGRRASMLIGGAMFLAGAALGGAAANVYMVIFGRVLLGAGIGFTNQSIPLYLSEMAP  159

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              ++RG +N  F++CV IG+L+AN INYG  K +  WGWR+SL LAAVPA+ LT+G V LP
Sbjct  160   PQHRGAINNGFEVCVSIGILVANFINYGINKTQARWGWRISLALAAVPASFLTVGTVFLP  219

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPN++IQR  D   A++ LQ++RGT DV+ ELDDL++A  I++ I  PF+ I+ ++YRP
Sbjct  220   ETPNNIIQRNGDLHKAEQLLQKIRGTTDVKKELDDLISAGIIAKGIHHPFRKIIQQKYRP  279

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMAF++PFFQQVTGINVI FYAP++FRTIGL ESA+LMSA++T  V +     +M+L 
Sbjct  280   QLVMAFSIPFFQQVTGINVINFYAPIMFRTIGLKESASLMSAILTRLVALSCNILAMVLA  339

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR L + GGI MF++Q+ VGGV+ A+  D GG+S+G A LVL+++ ++VAGF  SW
Sbjct  340   DKLGRRTLFLTGGIQMFLSQIIVGGVLAAEFKDYGGMSRGQAYLVLVILCAFVAGFSWSW  399

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIFPLEIRSAGQSI VAVNFL TFLV Q+FL MLCHLK G FFFFGGWVA 
Sbjct  400   GPLGWLVPSEIFPLEIRSAGQSIVVAVNFLATFLVAQSFLPMLCHLKSGTFFFFGGWVAA  459

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT F+Y+ LPETKN+P+E+MD VW++HWFWKKI+
Sbjct  460   MTLFIYMFLPETKNVPVEQMDQVWKKHWFWKKII  493



>ref|XP_011076405.1| PREDICTED: hexose carrier protein HEX6-like [Sesamum indicum]
Length=512

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/454 (64%), Positives = 371/454 (82%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGV+SM+PFLK+FF  VY KMKE+S  VSNYCKF+S+LLT FTSSLYIAGL  S +A++V
Sbjct  44    GGVSSMDPFLKKFFPGVYRKMKEES-DVSNYCKFNSQLLTCFTSSLYIAGLIFSFVAATV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR PSI+IGG++++ GAA+GGAA NVY+LI GRVLLG+G+GF NQ+VPLYL+EMAP
Sbjct  103   TRKYGRKPSIIIGGLSYMVGAAIGGAAYNVYVLILGRVLLGVGLGFTNQSVPLYLAEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             + YRG  N++FQ+C+ IG + A LINYGT +I+ GWGWR+S+ +A VPA  L +GA+ LP
Sbjct  163   STYRGAFNIAFQICISIGQISATLINYGTVRIKGGWGWRISIAMAGVPAAFLALGALFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQ  +D + AK+ LQ++RGTDDVQAEL+D+V AS  S+ I+ PF+N++ R+YRP
Sbjct  223   ETPNSLIQHSDDQEKAKKMLQKIRGTDDVQAELEDIVEASYASQAIKHPFRNLMQRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVM+ A+PFFQQ+TGINVI+FYAP+LF T+G GE+A+LM+A V G +G      +++LV
Sbjct  283   QLVMSVAIPFFQQITGINVISFYAPLLFLTMGSGENASLMAATVMGVIGSTFVLLALVLV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             D++GRR L  +GGI M V+Q+ VGG+M AKLGD G + KG+A+ +LLLI  Y+AGFGLSW
Sbjct  343   DRIGRRPLFHIGGIQMLVSQVLVGGLMAAKLGDHGSMEKGYALAILLLICVYIAGFGLSW  402

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGW++ SEIFPLEIRSA QSITVAVN   TF + Q FLAMLCH K GIFFFF  WV V
Sbjct  403   GPLGWVVTSEIFPLEIRSAAQSITVAVNLFMTFFIAQIFLAMLCHFKSGIFFFFAAWVVV  462

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             M+ F+Y LLPETKN+PIEKMD +W+EH+FWK+++
Sbjct  463   MSVFIYFLLPETKNIPIEKMDKIWKEHFFWKRVI  496



>ref|XP_004171207.1| PREDICTED: LOW QUALITY PROTEIN: hexose carrier protein HEX6-like 
[Cucumis sativus]
Length=513

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/456 (71%), Positives = 376/456 (82%), Gaps = 2/456 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPF +  F +V  KMKED  ++SNYCKFDS+LLTSFTSSLYIAGL  +  ASSV
Sbjct  46    GGVTSMEPFXEEIFPEVNRKMKEDK-QISNYCKFDSQLLTSFTSSLYIAGLLFTFFASSV  104

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR PSI IGG AFLAGAALGGAA NVYML+ GR+LLGIGVGF NQA+PLYLSEMAP
Sbjct  105   TRTFGRKPSIHIGGAAFLAGAALGGAAANVYMLLLGRILLGIGVGFTNQAIPLYLSEMAP  164

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              KYRG +N  FQLCVGIGVL ANLINYGT K+ +  GWR+SL LA +PA++LT G++ LP
Sbjct  165   PKYRGAINNGFQLCVGIGVLSANLINYGTAKLNNTSGWRISLALAGLPASLLTFGSIFLP  224

Query  623   ETPNSLIQRRND-HDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYR  799
             ETPNSLIQR +D H  AK+ LQ++RGTDDV AE +DLV A+ IS+T+++PF  I   +YR
Sbjct  225   ETPNSLIQRCDDEHLTAKKMLQQIRGTDDVDAEFEDLVKANAISKTMKKPFVKITQPKYR  284

Query  800   PQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLL  979
             PQLVMA A+ FFQQVTGINVI+FYAP+LFRT+GL ESA+L+SAVVTG VG V TF SML+
Sbjct  285   PQLVMAIAIQFFQQVTGINVISFYAPILFRTVGLDESASLLSAVVTGVVGTVATFISMLI  344

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
             VDK GRR L  +GGI MF++Q+ VG VM AKLGD GGLSKG+A LVL+LI  YVAGF  S
Sbjct  345   VDKFGRRVLFTIGGIQMFISQIVVGSVMAAKLGDHGGLSKGYAYLVLVLICIYVAGFAWS  404

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPLGWL+PSEIF LEIRSAGQSITVA NFLFTF + Q+FL+MLCHLK G FFFFGGWV 
Sbjct  405   WGPLGWLVPSEIFQLEIRSAGQSITVAANFLFTFAIAQSFLSMLCHLKSGTFFFFGGWVL  464

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIVV  1447
             +MT FV L LPETKN+PIE+MD +W EHWFWK+IVV
Sbjct  465   IMTVFVLLFLPETKNIPIEQMDRIWMEHWFWKRIVV  500



>ref|XP_011076417.1| PREDICTED: hexose carrier protein HEX6-like [Sesamum indicum]
Length=516

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/454 (66%), Positives = 360/454 (79%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGV+SMEPFLK+FF  VY +MKED+ K+SNYCKFDS+LLTSF SSLY+  L AS  A+S+
Sbjct  44    GGVSSMEPFLKKFFPGVYIQMKEDT-KLSNYCKFDSQLLTSFASSLYVTSLIASFFAASM  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR PSI+ GGVAFL GA LGGAA N+YML  GR+LLG+G+GFANQ+VPLYLSEMAP
Sbjct  103   TRDYGRKPSIITGGVAFLIGAILGGAAQNIYMLTIGRLLLGVGIGFANQSVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             +K+RG  N  FQ CV  G L+A+L+NYG EKI+  WGWR+SL +AA+PA VL +GA+ LP
Sbjct  163   SKFRGAFNYGFQFCVSAGGLLASLVNYGVEKIKGDWGWRISLAMAALPALVLVVGALFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQ+  DH  AKR LQ++RGTDDV+ E DDLV ASE S+ I+ PFK IL R+YRP
Sbjct  223   ETPNSLIQQGCDHGKAKRLLQKIRGTDDVEEEFDDLVTASEASKAIKHPFKKILQRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
              LVM+ A+PFFQQV+G+NVIAFYAP+LF T+G G SA+L+S V  G VGI  TF S L+V
Sbjct  283   HLVMSVAIPFFQQVSGVNVIAFYAPILFMTVGSGVSASLLSTVFLGIVGISMTFMSSLIV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR +  +GGI+MF+  M +GG+M AKLGD G LS+G++ LV++LI  Y A F  SW
Sbjct  343   DKLGRRMVFFIGGIIMFIAHMMIGGIMAAKLGDHGALSQGYSFLVVILICIYTAAFAFSW  402

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPL WL+ SEI PLEIRSA QSI VAV F  + L+ QTFLAMLCHLKYG FFFFG WV  
Sbjct  403   GPLAWLVASEISPLEIRSAAQSINVAVGFFSSALISQTFLAMLCHLKYGTFFFFGTWVVF  462

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY LLPETKN+PIEKM+++WR+H FWKK V
Sbjct  463   MTVFVYFLLPETKNVPIEKMNIIWRKHSFWKKFV  496



>ref|XP_006421596.1| hypothetical protein CICLE_v10006610mg [Citrus clementina]
 gb|ESR34836.1| hypothetical protein CICLE_v10006610mg [Citrus clementina]
Length=473

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/455 (65%), Positives = 346/455 (76%), Gaps = 40/455 (9%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF +VY KMKED+  +SNYCKFDS+LLT+FTSSLYIAGL ASL ASSV
Sbjct  45    GGVTSMEPFLKKFFPEVYRKMKEDT-NISNYCKFDSQLLTTFTSSLYIAGLIASLFASSV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR  SIL                                      +VPLYLSEMAP
Sbjct  104   TRAFGRKASIL--------------------------------------SVPLYLSEMAP  125

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              K RG  N+ FQ+CV IGVL ANL+NYGT+KI+ GWGWR+SL +AA PA++LTIGA+ LP
Sbjct  126   PKNRGAFNIGFQVCVAIGVLSANLLNYGTQKIKGGWGWRISLAMAAAPASILTIGALFLP  185

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNS+IQR NDH  A+R LQRVRGT DVQAELDDL+ A  IS+TI  PFK I+ R+YR 
Sbjct  186   ETPNSVIQRSNDHQKAERTLQRVRGTADVQAELDDLIRAGSISKTINHPFKKIIERKYRS  245

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAA-LMSavvtgavgivttFASMLL  979
             QLVMA  +PFFQQVTGINVI+FYAPVLFRTI L ES + LMSA+VTG VG ++T  SM+L
Sbjct  246   QLVMAILIPFFQQVTGINVISFYAPVLFRTIKLSESTSLLMSAIVTGGVGTISTILSMIL  305

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
              D++GR+ L +VGGI M V+Q+ +G +M A+LGD GG S G+A L+L+L+  Y  GF  S
Sbjct  306   ADRLGRKVLFLVGGIQMLVSQVMIGSIMAAQLGDHGGFSTGYAYLILVLVCVYTTGFAYS  365

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPLGWL+PSEIFPLEIRSAGQSITVAV  LFTFLV QTFLAMLCH K GIFFFFGGWVA
Sbjct  366   WGPLGWLVPSEIFPLEIRSAGQSITVAVGLLFTFLVAQTFLAMLCHFKAGIFFFFGGWVA  425

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              MTTFV+  LPETKNLPIE+MD +W EHWFW++IV
Sbjct  426   FMTTFVHFFLPETKNLPIEQMDKLWAEHWFWRRIV  460



>ref|XP_004986088.1| PREDICTED: hexose carrier protein HEX6-like [Setaria italica]
Length=516

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/454 (66%), Positives = 361/454 (80%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSME FL +FF DVY +M+ D  KVSNYC+FDSELLT FTSSLY+AGL A+L ASSV
Sbjct  47    GGVTSMESFLSKFFPDVYHQMRGDK-KVSNYCRFDSELLTVFTSSLYVAGLVATLFASSV  105

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  SILIGG  F+AG+  GGAA+NVYML+  R+LLGIG+GF NQ++PLYLSEMAP
Sbjct  106   TRRFGRRASILIGGSVFIAGSVFGGAAVNVYMLLLNRILLGIGLGFTNQSIPLYLSEMAP  165

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              +YRG ++  F+LC+ IG+LIANLINYG EKI DGWGWR+SL LAAVPA  LTIGA+ LP
Sbjct  166   PQYRGAISNGFELCISIGILIANLINYGVEKIADGWGWRISLSLAAVPAAFLTIGAIFLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETP+ +IQR  + D AK  LQR+RGT  +Q ELDDLV+AS ISRTI  P +NI  R+YRP
Sbjct  226   ETPSFIIQRDGNIDEAKILLQRLRGTTGIQKELDDLVSASNISRTIRHPLRNIFKRKYRP  285

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLV+A  +PFF QVTGINVI FYAPV+FRTIGL ESA+LMSAVVT     V    +M++V
Sbjct  286   QLVIALLIPFFNQVTGINVINFYAPVMFRTIGLKESASLMSAVVTRICATVANIVAMVVV  345

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             D+ GRR+L +VGG+ M ++Q+ VG V+ AK  D GG+ K +A LVL+++  +VAGF  SW
Sbjct  346   DRFGRRKLFLVGGVQMILSQIMVGAVLAAKFKDHGGMEKEYAYLVLIIMCVFVAGFAWSW  405

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPL +L+P+EI PLEIRSAGQSI +AV FL TF++GQTFLAMLCHLK+G FF FGGWV V
Sbjct  406   GPLTYLVPTEICPLEIRSAGQSIVIAVIFLVTFVIGQTFLAMLCHLKFGTFFLFGGWVCV  465

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY  LPETK LP+E+M+ VWR HWFWK+IV
Sbjct  466   MTVFVYFFLPETKQLPMEQMEQVWRRHWFWKRIV  499



>ref|XP_011076406.1| PREDICTED: hexose carrier protein HEX6-like [Sesamum indicum]
Length=470

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/450 (67%), Positives = 368/450 (82%), Gaps = 2/450 (0%)
 Frame = +2

Query  95    SMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSVTRAC  274
             SM  FL++FF  +Y KM     +V+ YCKFDS+LLT FTSSL+I+GL A+ LAS VTRA 
Sbjct  14    SMGSFLEKFFPGIYRKMNGKK-EVNIYCKFDSQLLTFFTSSLFISGLVATFLASPVTRAW  72

Query  275   GRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAPAKYR  454
             GR  SILIGG AF+AG+ALGGAA N+YMLIF R+LLGIG GF NQ+VPLYLSEMAP ++R
Sbjct  73    GRKASILIGGAAFIAGSALGGAAENIYMLIFSRLLLGIGFGFTNQSVPLYLSEMAPPRHR  132

Query  455   GGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLPETPN  634
             G  N  FQLC+  G+LI+ L+NY  EKI+ GWGWRVSL LAA+PA++LTI    LPETPN
Sbjct  133   GAFNSGFQLCLSCGILISYLVNYNIEKIKGGWGWRVSLALAALPASILTISTPFLPETPN  192

Query  635   SLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRPQLVM  814
             SL+Q+ N  + AKR LQ++RGT DV+AE DDL+AA+  S+TI+ PFKNI  R+YRPQLVM
Sbjct  193   SLVQQGN-QEKAKRMLQKIRGTADVEAEFDDLIAANNASKTIKHPFKNIFQRKYRPQLVM  251

Query  815   AFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLVDKVG  994
             + A+PFFQQVTGINVIAFYAP+LFRTIG G SA+L+S+VVTG  G+     S+L+VDKVG
Sbjct  252   SIAIPFFQQVTGINVIAFYAPILFRTIGSGVSASLLSSVVTGIAGLSMVILSLLIVDKVG  311

Query  995   RRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSWGPLG  1174
             RR L  +GG+LMFV QM +GG+M AKLGDQGGLS+G+++ VL+LI SY+AGFGLSWGPLG
Sbjct  312   RRALFHIGGVLMFVPQMIIGGIMAAKLGDQGGLSQGYSISVLVLICSYLAGFGLSWGPLG  371

Query  1175  WLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAVMTTF  1354
             WL+ SEIFPLEIRSA QSITVA +FLFTF+V QTFLAMLCH K  IFFFFG WV +MT +
Sbjct  372   WLVTSEIFPLEIRSAAQSITVATSFLFTFIVAQTFLAMLCHFKARIFFFFGVWVVLMTGY  431

Query  1355  VYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             VY+LLPETK++P+E MD +WREHWFWK+ V
Sbjct  432   VYVLLPETKDVPLETMDTIWREHWFWKRFV  461



>gb|KHN26456.1| Hexose carrier protein HEX6 [Glycine soja]
Length=438

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/435 (72%), Positives = 369/435 (85%), Gaps = 2/435 (0%)
 Frame = +2

Query  143   MKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSVTRACGRTPSiliggvaflag  322
             MK+D+ KVSNYCKFDS+LLT+FTSSLYIAGL AS  ASSVTRA GR PSILIGG AFL G
Sbjct  1     MKQDT-KVSNYCKFDSQLLTAFTSSLYIAGLIASFFASSVTRAFGRKPSILIGGAAFLIG  59

Query  323   aalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAPAKYRGGMNVSFQLCVGIGVL  502
             AALGGAA+N+YMLI GRV+LG+G+GFANQ+ PLYLSEMAP +YRG +N  FQLCVGIGVL
Sbjct  60    AALGGAALNIYMLILGRVMLGVGIGFANQSAPLYLSEMAPPRYRGAINTGFQLCVGIGVL  119

Query  503   IANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLPETPNSLIQRRNDHDGAKRRL  682
              ANL+N+GTEKI+ GWGWR+SL +AAVPA++LT G++ LPETPNS+IQ   +H  AK  L
Sbjct  120   SANLVNFGTEKIKAGWGWRISLVMAAVPASMLTFGSLFLPETPNSIIQHDKNHQKAKLML  179

Query  683   QRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRPQLVMAFAVPFFQQVTGINVI  862
             QR+RGTDDVQ EL+DL+ ASE+S +I+ PFKNILHR+YRPQLVMA A+PFFQQ TGINVI
Sbjct  180   QRIRGTDDVQQELEDLIEASEMSNSIKHPFKNILHRKYRPQLVMAIAIPFFQQFTGINVI  239

Query  863   AFYAPVLFRTIGLGESAA-LMSavvtgavgivttFASMLLVDKVGRRRLLIVGGILMFVT  1039
             +FYAP+LF TIGLGESA+ L+SAVVTG VG  +TF SML+VD++GRR L I GGI MF +
Sbjct  240   SFYAPILFLTIGLGESASLLLSAVVTGFVGTASTFISMLMVDRLGRRVLFISGGIQMFFS  299

Query  1040  QMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSWGPLGWLIPSEIFPLEIRSA  1219
             Q+ +G +M  +LGD G + K +A L+L+LI  YVAGF  SWGPLGWL+PSEIF LEIRSA
Sbjct  300   QVLIGSIMATQLGDHGEIDKKYAYLILVLICIYVAGFAWSWGPLGWLVPSEIFQLEIRSA  359

Query  1220  GQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAVMTTFVYLLLPETKNLPIEK  1399
              QSITVAVNF FTF+V QTFL MLCH K+G FFFFGGWV VMT FVYLLLPET+N+PIE+
Sbjct  360   AQSITVAVNFFFTFIVAQTFLIMLCHFKFGTFFFFGGWVVVMTAFVYLLLPETRNVPIEQ  419

Query  1400  MDLVWREHWFWKKIV  1444
             MD VWREH+FWK+IV
Sbjct  420   MDRVWREHFFWKRIV  434



>ref|XP_011076520.1| PREDICTED: hexose carrier protein HEX6-like [Sesamum indicum]
Length=500

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/450 (67%), Positives = 369/450 (82%), Gaps = 2/450 (0%)
 Frame = +2

Query  95    SMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSVTRAC  274
             SMEPFLK+FF ++Y KM E+    SNYCKF+S+LLT FTSS  I+GL A+  AS +TRA 
Sbjct  41    SMEPFLKKFFPEIYRKMNEEI-MTSNYCKFNSQLLTFFTSSFLISGLVATFFASPITRAL  99

Query  275   GRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAPAKYR  454
             GR  SILIGG AF+AG+ALGGAA N+YMLIF R+LLGIG GF NQ+VPLYLSEMAP ++R
Sbjct  100   GRKASILIGGTAFVAGSALGGAASNIYMLIFSRLLLGIGFGFTNQSVPLYLSEMAPPQHR  159

Query  455   GGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLPETPN  634
             G  N  FQ+C+G G+LIA L+NYG EKI+ GWGWRVSL L+AVPA+++TI A  LPETPN
Sbjct  160   GAFNSGFQVCLGSGILIAYLLNYGIEKIKGGWGWRVSLALSAVPASIMTISAPFLPETPN  219

Query  635   SLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRPQLVM  814
             SL+Q+ N ++ AKR LQ++RGT+DV+AE DDLVAAS  S+T+E  F  I  R+YRPQLVM
Sbjct  220   SLVQQGN-YEKAKRMLQKIRGTNDVEAEFDDLVAASNASKTVEHHFNKIFQRKYRPQLVM  278

Query  815   AFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLVDKVG  994
             + A+PFFQQVTGINV+AFYAP+LFRTIG G SA+L+S+VVTG  G+ TT  S+L+VDKVG
Sbjct  279   SIAIPFFQQVTGINVVAFYAPLLFRTIGSGVSASLLSSVVTGIAGMCTTVLSLLIVDKVG  338

Query  995   RRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSWGPLG  1174
             RR L  VGGI MFV  M +GG+M AKLGDQG LS+G+++ +L+LI  Y+AGFGLSWGPLG
Sbjct  339   RRALFHVGGIQMFVPLMIIGGIMAAKLGDQGQLSQGYSISLLVLICIYLAGFGLSWGPLG  398

Query  1175  WLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAVMTTF  1354
             WL+ SEIFPLEIRSA QSI VA +FLFTF+V QTFLAMLC+ K  IFFFF  WVA+M+ F
Sbjct  399   WLVTSEIFPLEIRSAAQSINVATSFLFTFIVAQTFLAMLCYFKARIFFFFAVWVALMSGF  458

Query  1355  VYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             VY+LLPETK++PIEKM+ +W+EHWFWK+ V
Sbjct  459   VYVLLPETKDVPIEKMEKIWKEHWFWKRFV  488



>ref|XP_011076404.1| PREDICTED: hexose carrier protein HEX6-like [Sesamum indicum]
Length=510

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/452 (66%), Positives = 368/452 (81%), Gaps = 1/452 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF  VY KMKED+ K+SNYCKFDS+LLTSFTSSLYIAGL +S  A+ V
Sbjct  44    GGVTSMEPFLKKFFPRVYRKMKEDT-KMSNYCKFDSQLLTSFTSSLYIAGLISSFFAAIV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR PSI++GGV ++AGAALG AA NVYMLI GR+LLG+G+GF NQ+VPLYLSEMAP
Sbjct  103   TRNYGRKPSIIVGGVTYMAGAALGSAAYNVYMLIIGRLLLGVGLGFTNQSVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             +KYRG  NV FQ+CV IG   A L NYGT KI+ GWGWR+S+G+A +PA +L  GA+ LP
Sbjct  163   SKYRGAFNVGFQICVAIGCNAAALTNYGTVKIKGGWGWRISIGMAGLPAAILAFGALFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQ  N+H  AK+ LQ++RGTDDVQAELDDL+ AS  S+ ++ PFKN++ R+YRP
Sbjct  223   ETPNSLIQHCNEHQRAKKMLQKIRGTDDVQAELDDLIEASYASKAVKHPFKNLMQRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVM+ A+PFFQQ+TGINV+AFYAP++F T+G GESA+L+SA+VTG VG   T  ++  V
Sbjct  283   QLVMSVAIPFFQQITGINVVAFYAPLIFLTMGFGESASLLSALVTGLVGSGFTVLTVFFV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR L  +GG  MF++ M +GG+M AKLGD G + KG+ ++VL+LI  Y++GFG+SW
Sbjct  343   DKLGRRPLFHIGGAQMFISLMLIGGIMTAKLGDHGTMEKGYGLIVLILICIYISGFGISW  402

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGW++ SEIFPLE+RS  QSI VAVN   TF++ Q FLAMLCHLK  IFFFFG WV +
Sbjct  403   GPLGWVVTSEIFPLEVRSVAQSIVVAVNLSMTFIIAQVFLAMLCHLKSAIFFFFGAWVLL  462

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKK  1438
             M+ FVYLLLPETKN+PIEKMD +W +H+FWKK
Sbjct  463   MSAFVYLLLPETKNIPIEKMDQIWGKHFFWKK  494



>ref|XP_010919657.1| PREDICTED: hexose carrier protein HEX6-like isoform X1 [Elaeis 
guineensis]
Length=512

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/454 (64%), Positives = 364/454 (80%), Gaps = 1/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGV++ME FL++FF +VYT+MKED+ K+SNYC+F+SELLT+FTSSLYIAGL ASL AS +
Sbjct  41    GGVSTMEGFLEKFFPEVYTQMKEDT-KISNYCRFNSELLTTFTSSLYIAGLVASLFASPI  99

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR  S+LIGG  FLAGAALGGAA NVYM+IFGRVLLG G+GF NQ++PLYLSEMAP
Sbjct  100   TRAFGRRASMLIGGAMFLAGAALGGAATNVYMVIFGRVLLGAGIGFTNQSIPLYLSEMAP  159

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              ++RG MN  F++CV IG+L+AN INYG  +    WGWR+SL LA+VPA+ LT+G   LP
Sbjct  160   PQHRGAMNNGFEVCVSIGILVANFINYGINQTHIRWGWRISLALASVPASFLTVGTFFLP  219

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPN++IQR  D   A++ LQ++RGT DV+ ELDDL++A  I++ I  PF+ I+ ++YRP
Sbjct  220   ETPNNIIQRNGDLHKAEQLLQKIRGTTDVKKELDDLISAGIIAKGIRHPFRKIIQQKYRP  279

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA  +PFFQQVTGINVI FYAP++FRTIGL ESA+LM+A+ T  V +     +M+L 
Sbjct  280   QLVMAILIPFFQQVTGINVINFYAPIMFRTIGLKESASLMAAICTRLVALSCNILAMVLA  339

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             D+ GRR L I GGI MF++Q+ VGG++ A+  D G + +G A LVL +I  +VAGF  SW
Sbjct  340   DRWGRRTLFITGGIQMFLSQIIVGGILAAEFKDHGEMIRGIAYLVLAIICFFVAGFSWSW  399

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIFPLEIRSAGQSI VAVNFL TFLV  +FL MLCHLK G FFFFGGWVA 
Sbjct  400   GPLGWLVPSEIFPLEIRSAGQSIVVAVNFLATFLVAHSFLPMLCHLKSGTFFFFGGWVAA  459

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT F+Y+ LPET+N+P+E+MD VW++HWFWKK+V
Sbjct  460   MTFFIYMFLPETRNVPVEQMDQVWKKHWFWKKMV  493



>ref|XP_009407139.1| PREDICTED: hexose carrier protein HEX6 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=508

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/455 (68%), Positives = 379/455 (83%), Gaps = 1/455 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSME FL++FF DVY KM+ DS  VSNYCKF+S+LLT+FTSSLY+AGLFA+ +AS V
Sbjct  45    GGVTSMESFLEKFFPDVYAKMRGDS-AVSNYCKFNSQLLTTFTSSLYVAGLFATFIASWV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  ++L GG AF+AGAALGGAA ++YM+IFGRVLLGIGVG ANQ+VPLYLSEMAP
Sbjct  104   TRRFGRRRTMLAGGFAFMAGAALGGAAADIYMVIFGRVLLGIGVGLANQSVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              +YRG  N  FQ  +GIG LIAN+INYGT  I+ GWGWRVSL LAAVPA +LT+G   LP
Sbjct  164   PQYRGAFNNGFQFSIGIGALIANIINYGTANIKGGWGWRVSLALAAVPALLLTLGTFFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQ+  D   AK+ LQ++RGT DV  EL+DLVAAS  SR + RP + I+ R YRP
Sbjct  224   ETPNSLIQQGGDVHDAKQLLQKIRGTTDVDQELEDLVAASNASRIVRRPLRTIVRRNYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA A+PFFQQVTGIN IAFY PVLFRTIGLG++A+L+SAVV GAVGI +T  SM++V
Sbjct  284   QLVMAIAIPFFQQVTGINAIAFYQPVLFRTIGLGQNASLISAVVGGAVGISSTLISMIVV  343

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             D++GRRRL ++GGI M ++Q+ + G++  +LGD GG+S+G+A LVLLLI  YVAGFG SW
Sbjct  344   DRLGRRRLFLIGGIQMLISQVIIAGILATQLGDHGGVSRGYAYLVLLLICVYVAGFGWSW  403

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEIFPLEIRSAGQSITVAV+F+FTF++ QTFLAMLCH+K GIFFFF GW+ +
Sbjct  404   GPLGWLVPSEIFPLEIRSAGQSITVAVSFIFTFIIAQTFLAMLCHMKSGIFFFFAGWLVI  463

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIVV  1447
             MT F+++LLPET+N+P+E+M  VWREH FW++IVV
Sbjct  464   MTMFIHMLLPETRNIPMEQMGRVWREHPFWRRIVV  498



>ref|XP_011076407.1| PREDICTED: hexose carrier protein HEX6-like isoform X1 [Sesamum 
indicum]
Length=502

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/454 (66%), Positives = 358/454 (79%), Gaps = 2/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGV SM PFL++FF  +Y +M E    VSNYCKFDS+LLTSFTSS+ ++GL A+  ASS 
Sbjct  37    GGVASMGPFLEKFFPAIYRQMNEKR-VVSNYCKFDSQLLTSFTSSVLLSGLLATFFASSA  95

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR  SILIGG+AF+AG+ALGGAA N+YMLIFGR+LLG+G GF NQ+VPLYLSEMAP
Sbjct  96    TRALGRRASILIGGLAFIAGSALGGAANNIYMLIFGRLLLGVGFGFTNQSVPLYLSEMAP  155

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              KYRG  N  FQLC+G G L+++L+NYGT  I  GWGWR+SL L A PA +LT+ A  LP
Sbjct  156   PKYRGAFNFGFQLCIGFGGLLSSLVNYGTVNISGGWGWRLSLALVAAPAFILTVWAPFLP  215

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSL+Q+  D + AKR LQ++RGT+DV+AE DDL+ AS  S+ I+ PFK IL R+YRP
Sbjct  216   ETPNSLVQQ-GDQENAKRMLQKIRGTNDVEAEFDDLITASNASKNIKHPFKKILQRKYRP  274

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVM+ A+PFFQQVTGI+VI+FYAP+LF T G G SA+LMS+VV G  G   T  S L+V
Sbjct  275   QLVMSIAIPFFQQVTGISVISFYAPILFLTTGSGVSASLMSSVVLGLAGTAMTLLSALIV  334

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK GR+ L  +GGILMFV QM +GGVM AKLGDQG LSKG+ VLVL+++  Y AGFGLSW
Sbjct  335   DKQGRKALFHIGGILMFVPQMMIGGVMAAKLGDQGELSKGYGVLVLIMMCIYSAGFGLSW  394

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+ SEIFPLEIRSA QSI VA +FL TF+  QTFL+MLC  K  IFFFF  WVAV
Sbjct  395   GPLGWLVTSEIFPLEIRSAAQSINVATSFLITFVFAQTFLSMLCCFKASIFFFFAAWVAV  454

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY  LPETK++PIEKM+ +WREHWFWKK V
Sbjct  455   MTAFVYAFLPETKDVPIEKMEKIWREHWFWKKFV  488



>ref|XP_009407138.1| PREDICTED: hexose carrier protein HEX6 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=515

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/459 (68%), Positives = 382/459 (83%), Gaps = 1/459 (0%)
 Frame = +2

Query  71    LLSVGGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLL  250
             +L VGGVTSME FL++FF DVY KM+ DS  VSNYCKF+S+LLT+FTSSLY+AGLFA+ +
Sbjct  48    VLLVGGVTSMESFLEKFFPDVYAKMRGDSA-VSNYCKFNSQLLTTFTSSLYVAGLFATFI  106

Query  251   ASSVTRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLS  430
             AS VTR  GR  ++L GG AF+AGAALGGAA ++YM+IFGRVLLGIGVG ANQ+VPLYLS
Sbjct  107   ASWVTRRFGRRRTMLAGGFAFMAGAALGGAAADIYMVIFGRVLLGIGVGLANQSVPLYLS  166

Query  431   EMAPAKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGA  610
             EMAP +YRG  N  FQ  +GIG LIAN+INYGT  I+ GWGWRVSL LAAVPA +LT+G 
Sbjct  167   EMAPPQYRGAFNNGFQFSIGIGALIANIINYGTANIKGGWGWRVSLALAAVPALLLTLGT  226

Query  611   VVLPETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHR  790
               LPETPNSLIQ+  D   AK+ LQ++RGT DV  EL+DLVAAS  SR + RP + I+ R
Sbjct  227   FFLPETPNSLIQQGGDVHDAKQLLQKIRGTTDVDQELEDLVAASNASRIVRRPLRTIVRR  286

Query  791   RYRPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFAS  970
              YRPQLVMA A+PFFQQVTGIN IAFY PVLFRTIGLG++A+L+SAVV GAVGI +T  S
Sbjct  287   NYRPQLVMAIAIPFFQQVTGINAIAFYQPVLFRTIGLGQNASLISAVVGGAVGISSTLIS  346

Query  971   MLLVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGF  1150
             M++VD++GRRRL ++GGI M ++Q+ + G++  +LGD GG+S+G+A LVLLLI  YVAGF
Sbjct  347   MIVVDRLGRRRLFLIGGIQMLISQVIIAGILATQLGDHGGVSRGYAYLVLLLICVYVAGF  406

Query  1151  GLSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGG  1330
             G SWGPLGWL+PSEIFPLEIRSAGQSITVAV+F+FTF++ QTFLAMLCH+K GIFFFF G
Sbjct  407   GWSWGPLGWLVPSEIFPLEIRSAGQSITVAVSFIFTFIIAQTFLAMLCHMKSGIFFFFAG  466

Query  1331  WVAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIVV  1447
             W+ +MT F+++LLPET+N+P+E+M  VWREH FW++IVV
Sbjct  467   WLVIMTMFIHMLLPETRNIPMEQMGRVWREHPFWRRIVV  505



>ref|XP_008454476.1| PREDICTED: hexose carrier protein HEX6-like [Cucumis melo]
Length=459

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/451 (68%), Positives = 362/451 (80%), Gaps = 6/451 (1%)
 Frame = +2

Query  98    MEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSVTRACG  277
             MEPFLK+FF +V  KMKED  ++SNYCKFDS+L TSFTSSLYIAGL  +  ASSVTR  G
Sbjct  1     MEPFLKKFFPEVNRKMKEDK-EISNYCKFDSQLSTSFTSSLYIAGLLFTFFASSVTRTFG  59

Query  278   RTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAPAKYRG  457
             R PSI IGG AFLAGAALGGAA NVYML+ GR+LLG+GVGF NQ   L+ +     +   
Sbjct  60    RKPSIHIGGAAFLAGAALGGAAANVYMLLLGRILLGVGVGFTNQVCFLFCT----LRQFL  115

Query  458   GMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLPETPNS  637
              +N  FQLCVGIGVL ANLINYGT K+ +  GWR+SL LA VPA++LT G++ LPETPNS
Sbjct  116   FINNGFQLCVGIGVLSANLINYGTAKLNNTSGWRISLALAGVPASLLTFGSIFLPETPNS  175

Query  638   LIQRRND-HDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRPQLVM  814
             LIQR +D H  AK+ LQ++RGTDDV AE +DLV A+ IS+T+++PF  I   +YRPQ VM
Sbjct  176   LIQRCDDEHLTAKKMLQQIRGTDDVDAEFEDLVKANAISKTMKKPFVKITQPKYRPQFVM  235

Query  815   AFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLVDKVG  994
             A A+ FFQQVTGINVI+FYAP+LFRT+GL ESA+L+SAVVTG VG V TF SML+VDK G
Sbjct  236   AIAIQFFQQVTGINVISFYAPILFRTVGLDESASLLSAVVTGVVGTVATFVSMLIVDKFG  295

Query  995   RRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSWGPLG  1174
             RR L  +GGI MF++Q+ +G VM AKLGDQGGLS+G+A LVL+LI  YVAGF  SWGPLG
Sbjct  296   RRVLFTIGGIQMFISQIVIGSVMAAKLGDQGGLSEGYAYLVLVLICIYVAGFAWSWGPLG  355

Query  1175  WLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAVMTTF  1354
             WL+PSEIF LEIRSAGQSITVA NFLFTF + Q+FL+MLCHLK G FFFFGGWV +MT F
Sbjct  356   WLVPSEIFQLEIRSAGQSITVAANFLFTFAIAQSFLSMLCHLKSGTFFFFGGWVLIMTVF  415

Query  1355  VYLLLPETKNLPIEKMDLVWREHWFWKKIVV  1447
             V L LPETKN+PIE+MD +W EHWFWK+IVV
Sbjct  416   VLLFLPETKNIPIEQMDRIWMEHWFWKRIVV  446



>ref|XP_011076410.1| PREDICTED: hexose carrier protein HEX6-like [Sesamum indicum]
Length=504

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/455 (63%), Positives = 353/455 (78%), Gaps = 1/455 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSME FLK+FF  +Y KM E+    SNYCKFDS++LT F S   ++GL A+  AS V
Sbjct  37    GGVTSMESFLKQFFPGIYRKMNEEKQTTSNYCKFDSQVLTFFNSGFLVSGLIATFFASPV  96

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR  SI IGGVAF  G+ LGGAA NVYMLIF R+LLGIG GF NQ+VPLYLSEMAP
Sbjct  97    TRALGRKASIFIGGVAFFVGSVLGGAANNVYMLIFSRLLLGIGFGFTNQSVPLYLSEMAP  156

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              ++RG  N  FQLCV  G L+++L+NYGT+KI+ GWGWR+SL L AVPA +LTI A  LP
Sbjct  157   PQFRGAFNFGFQLCVANGGLLSSLVNYGTQKIKGGWGWRISLALTAVPALILTISAPFLP  216

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSL+QR    + +K+ LQ++RGT+DVQAE DDL+AAS  S TI  PFK IL R+YRP
Sbjct  217   ETPNSLVQR-GSQERSKKMLQKIRGTNDVQAEFDDLIAASNASATIRHPFKKILQRKYRP  275

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVM+ A+PFFQQVTGIN++AFYAP+LF TIG G SA+LM++V  G  G ++TF S+ +V
Sbjct  276   QLVMSIAIPFFQQVTGINLVAFYAPMLFLTIGSGVSASLMASVFIGISGNLSTFCSLFVV  335

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GR+ L  +GGI+MFV  + +GG+M AKLGDQGGLS+ + + +L+ +  Y AGF LSW
Sbjct  336   DKLGRKALFRIGGIMMFVPLIIIGGIMAAKLGDQGGLSQAYGISILIFVCIYTAGFALSW  395

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPL WL+ SEIFPLEIRSA QSI VAV+FL TF++ Q FLAMLCHLK  +FFFF  W+ V
Sbjct  396   GPLAWLVTSEIFPLEIRSAAQSINVAVSFLCTFIIAQLFLAMLCHLKAALFFFFATWLVV  455

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIVV  1447
             MT FVY+ LPETK++PIEKMD +WR HWFWK+ V 
Sbjct  456   MTGFVYIFLPETKDVPIEKMDQIWRAHWFWKRFVC  490



>ref|XP_009417127.1| PREDICTED: hexose carrier protein HEX6-like [Musa acuminata subsp. 
malaccensis]
Length=507

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/453 (62%), Positives = 357/453 (79%), Gaps = 2/453 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFL++FF DVY  MK+ +   SNYC FDS+LLT+FTSSLYIAGLFASL AS V
Sbjct  42    GGVTSMEPFLEKFFPDVYADMKDSN--TSNYCLFDSQLLTAFTSSLYIAGLFASLCASKV  99

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T+A GR  S+L+GG AF+ GAALGG A+NV+MLI GRVLLG+GVGF NQ+ PLYLSEMAP
Sbjct  100   TQAFGRRASMLLGGAAFIVGAALGGLAVNVFMLILGRVLLGVGVGFTNQSAPLYLSEMAP  159

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              ++RG +N  F   VG+G+L ANLINYGT+KI    GWR+S+G A  PAT++  G + LP
Sbjct  160   PEHRGAINNGFDFFVGLGILSANLINYGTQKIHSDLGWRISIGFAIFPATIMAFGTLFLP  219

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETP+S+IQR N    A   L+++RGTDDV AELDD++AA  +S+   RP   I+ R+YRP
Sbjct  220   ETPSSIIQRTNSLQKATEMLRKIRGTDDVHAELDDMIAAGNVSKAARRPLLTIMQRKYRP  279

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
              L++A  +PFF+Q+TGI  I FY+P++FRT+GLGES++L+S V++G + + +   +M++V
Sbjct  280   HLLIAILIPFFKQMTGITAITFYSPLIFRTVGLGESSSLLSTVISGVINVGSVVVAMIIV  339

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             D+VGRR+L IVGG+LMFVT + VGGV+ A+LGD GG+SKG+A ++L+LI  + AGF  SW
Sbjct  340   DRVGRRKLFIVGGVLMFVTHLMVGGVLAAQLGDHGGISKGYAYMILVLICVFTAGFASSW  399

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEI PLEIRS GQS+ +AV  L   +VGQT L+MLCH K G+FFFFGGWV +
Sbjct  400   GPLGWLVPSEILPLEIRSVGQSMGIAVALLLVSIVGQTLLSMLCHFKSGVFFFFGGWVLI  459

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKI  1441
             MT FV LLLPETK LPIEKMD +WREHWFWKK+
Sbjct  460   MTVFVILLLPETKGLPIEKMDQIWREHWFWKKV  492



>ref|XP_009374462.1| PREDICTED: hexose carrier protein HEX6-like [Pyrus x bretschneideri]
Length=467

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/455 (66%), Positives = 350/455 (77%), Gaps = 44/455 (10%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSME FLK+FF +V TKMK D+ K+SNYCKFDSELLTSFTSSLYIAGL ASL AS V
Sbjct  44    GGVTSMEQFLKKFFPEVNTKMKSDT-KISNYCKFDSELLTSFTSSLYIAGLVASLFASLV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR PSIL GG AFLAG+AL GAA+N+YMLI GR+LLG+G+GF NQAVPLYLSEMAP
Sbjct  103   TRAYGRKPSILAGGAAFLAGSALNGAAMNIYMLILGRLLLGVGIGFGNQAVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              KYRG +N  FQ  VGIGVL ANLINYG+EKI+ GWGWR+SL +AAVPA++LT+GA  LP
Sbjct  163   PKYRGAINNGFQFSVGIGVLSANLINYGSEKIKGGWGWRISLAMAAVPASMLTLGAFFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR  DH  AK+ LQR+RG DDVQAELDDL+ A+ IS+ I+ PFK IL R+YRP
Sbjct  223   ETPNSLIQRSTDHQTAKQMLQRIRGVDDVQAELDDLIKANSISKNIKHPFKKILERKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtg-avgivttFASMLL  979
             QLVMA A+PFFQQ+TGINVI+FY+ +LFRTIGLGESA+L+S  +T   VG  +TF SML+
Sbjct  283   QLVMAIAIPFFQQLTGINVISFYSAILFRTIGLGESASLLSVAMTTGVVGTSSTFVSMLI  342

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
             VDK GRR L + GGI M V+Q+ VGGVM A+LGD+GG+SKG+A L               
Sbjct  343   VDKFGRRALFLAGGIQMLVSQIMVGGVMAAQLGDRGGVSKGYAYL---------------  387

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
                                        VNFLFTF+V QTFLAMLC+ K GIFFFFGGWVA
Sbjct  388   ---------------------------VNFLFTFIVAQTFLAMLCYFKAGIFFFFGGWVA  420

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             VMT FVYL LPETKN+PIEKM++VW+EHWFW +IV
Sbjct  421   VMTVFVYLFLPETKNVPIEKMEIVWQEHWFWWRIV  455



>emb|CDP05361.1| unnamed protein product [Coffea canephora]
Length=478

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/431 (68%), Positives = 348/431 (81%), Gaps = 1/431 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FLK+FF DVY KMKEDS   SNYCKFDS+LLTSFTSSLYIAGL ASL AS V
Sbjct  45    GGVTSMDHFLKKFFPDVYKKMKEDS-MTSNYCKFDSQLLTSFTSSLYIAGLVASLCASPV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR  SIL+ G +FLAG+A+GGAA NV+MLI  RVLLG+G+GFANQ+VP+YLSEMAP
Sbjct  104   TRAFGRKSSILLAGASFLAGSAIGGAAYNVFMLILARVLLGVGIGFANQSVPMYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              K RG   + F LC+ IGVL+ANL+NYG EK++ GWGWR+SL LA  PA+ L +GA+ LP
Sbjct  164   PKSRGAFGIGFDLCIAIGVLLANLVNYGAEKVKGGWGWRISLALAGAPASFLILGALFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLI+   +H+ AKR LQ+VRG DDVQ ELDDL+ AS +S+  + PFK+I+ R+YRP
Sbjct  224   ETPNSLIEHDKNHEKAKRLLQQVRGVDDVQIELDDLIRASNVSKITKHPFKHIIKRKYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVM+ A+PFFQQ+TGINVI FYAP+LFRTIGLGESA+LMSAVVTGAV   T F ++L+ 
Sbjct  284   QLVMSIAIPFFQQITGINVITFYAPILFRTIGLGESASLMSAVVTGAVVSTTIFFTLLIA  343

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DKVGRR L +VGG +M V Q  +GG+M  KLGD G LS  + +LVL+L+ +YVAGFGLSW
Sbjct  344   DKVGRRVLFMVGGAVMLVCQFLIGGIMAIKLGDHGRLSNSYGILVLILVCTYVAGFGLSW  403

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEI PLEIRSA  SI VAV+FL  FLV Q FLAMLCH K GIFFFFGGWVA+
Sbjct  404   GPLGWLVPSEISPLEIRSAALSIRVAVDFLLLFLVAQAFLAMLCHFKAGIFFFFGGWVAL  463

Query  1343  MTTFVYLLLPE  1375
             MT F  L+L E
Sbjct  464   MTAFGALVLEE  474



>ref|XP_010679174.1| PREDICTED: hexose carrier protein HEX6-like [Beta vulgaris subsp. 
vulgaris]
Length=511

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/454 (64%), Positives = 359/454 (79%), Gaps = 2/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+PFLK+FF DVY KMKED+ K+SNYCKFDSELLTSFTSSLY +GLFA+LLAS V
Sbjct  47    GGVTSMDPFLKKFFPDVYIKMKEDT-KISNYCKFDSELLTSFTSSLYFSGLFAALLASKV  105

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T+A GR  SIL+GG+  +AG+ALGGAA+N+YMLI GRVLLGIGVGFANQ +P+YL E+AP
Sbjct  106   TKAFGRKLSILVGGITVVAGSALGGAALNIYMLILGRVLLGIGVGFANQVIPIYLVEIAP  165

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             +KYRG  N  F L +  G+L+A L+N+GTEKI  GWGWRVS+   A PA ++T+G+  LP
Sbjct  166   SKYRGAFNNGFHLSLSFGILLATLVNFGTEKINGGWGWRVSIAATAFPAVIITLGSFFLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR+N+H  A+  LQR+RGT DVQ EL+DL+ AS  S+ I      +L R YRP
Sbjct  226   ETPNSLIQRKNNHQQARLTLQRIRGTTDVQEELNDLIEASSSSQNITLKMF-LLQRNYRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA A+PFFQQ+TGINV+ FYAPV FRTIG GESA+L S++V G V I     ++L V
Sbjct  285   QLVMATAIPFFQQMTGINVVGFYAPVFFRTIGFGESASLFSSIVVGIVQIFADGFAVLTV  344

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK GRRRL + GGILM V  + VG ++ AKLGD G LSKG++ ++L+L+  Y AGF  SW
Sbjct  345   DKFGRRRLFLWGGILMLVPFIVVGSILSAKLGDHGNLSKGYSYIILILLCIYSAGFSFSW  404

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             G LGWLIPSEIF LEIRSA Q ITVA++F+FTFL+ QT L MLCH K GIFFFF GW+ +
Sbjct  405   GSLGWLIPSEIFQLEIRSAAQGITVALSFIFTFLIAQTLLTMLCHFKAGIFFFFAGWIVL  464

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FV+ LLPETKN+P+EK+DL+W++H  W++I+
Sbjct  465   MTAFVHFLLPETKNVPLEKIDLLWKQHPIWRRII  498



>ref|XP_010546155.1| PREDICTED: sugar transport protein 3 [Tarenaya hassleriana]
Length=494

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/457 (67%), Positives = 372/457 (81%), Gaps = 8/457 (2%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSG-KVSNYCKFDSELLTSFTSSLYIAGLFASLLASS  259
             GGV SMEPFLK+FF  VY KM  + G + S+YC F+S+LLTSFTSSLY+AGL AS++ASS
Sbjct  36    GGVASMEPFLKKFFPGVYKKMMMNRGTRSSDYCVFNSQLLTSFTSSLYVAGLVASIMASS  95

Query  260   VTRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMA  439
             VTR  GR PS++IGG AFLAG+ALGGAA NV+MLI GR+LLG+GVGFANQ+VPLYLSEMA
Sbjct  96    VTRVFGRRPSMVIGGAAFLAGSALGGAAQNVFMLILGRLLLGVGVGFANQSVPLYLSEMA  155

Query  440   PAKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVL  619
             PA+YRG  N  FQL +GIG L ANLINYGT+KI+ G+GWR+SL +AAVPA++LT+G++ L
Sbjct  156   PARYRGAFNTGFQLSIGIGALTANLINYGTQKIKHGFGWRISLAMAAVPASILTLGSLFL  215

Query  620   PETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLV-AASEI-SRTIERPFKNILHRR  793
             PETPNS+IQR  D   A+  L+RVRGT DV+ EL DLV A SEI +   + PF  +L R+
Sbjct  216   PETPNSIIQRTGDVHRAELVLRRVRGTPDVRDELSDLVRAGSEIKTDYADNPFVKMLQRK  275

Query  794   YRPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASM  973
             YRPQLVMA A+PFFQQVTGINVIAFYAP+LFRT+G GESA+LMSAVVTG VG+V+TF SM
Sbjct  276   YRPQLVMALAIPFFQQVTGINVIAFYAPILFRTVGFGESASLMSAVVTGIVGMVSTFVSM  335

Query  974   LLVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFG  1153
             L+VDK GR+ L +VGGI M V+Q+ VG +M A+L  Q     G+A +VL+LI  YVAGFG
Sbjct  336   LVVDKFGRKTLFLVGGIQMLVSQVMVGIIMIAELRGQ-----GYAYVVLVLICVYVAGFG  390

Query  1154  LSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGW  1333
              SWGPLGWL+PSEIFPLEIRSA QS+TVAV+F+FTF V Q+FLAMLC L+ GIFFF+GGW
Sbjct  391   WSWGPLGWLVPSEIFPLEIRSAAQSVTVAVSFVFTFAVAQSFLAMLCRLEAGIFFFYGGW  450

Query  1334  VAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             V VMT  + + LPETKN+P+EK+  VW  HWFWK+ V
Sbjct  451   VVVMTAAMQMFLPETKNVPLEKVAGVWEHHWFWKRFV  487



>ref|NP_001149551.1| hexose carrier protein HEX6 [Zea mays]
 ref|XP_008677192.1| PREDICTED: hexose carrier protein HEX6 isoform X1 [Zea mays]
 gb|ACF84922.1| unknown [Zea mays]
 gb|ACG35804.1| hexose carrier protein HEX6 [Zea mays]
 gb|ACN25462.1| unknown [Zea mays]
 tpg|DAA42791.1| TPA: hexose carrier protein HEX6 isoform 1 [Zea mays]
 tpg|DAA42792.1| TPA: hexose carrier protein HEX6 isoform 2 [Zea mays]
Length=525

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/457 (64%), Positives = 357/457 (78%), Gaps = 5/457 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSME FL++FF DVY +MK D   VSNYC+FDSELLT FTSSLYIAGL A+L ASSV
Sbjct  45    GGVTSMESFLRKFFPDVYHQMKGDK-DVSNYCRFDSELLTVFTSSLYIAGLVATLFASSV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  SILIGG  F+ G+  GGAA+NVYML+  R+LLG+G+GF NQ++PLYLSEMAP
Sbjct  104   TRRFGRRTSILIGGTVFVIGSVFGGAAVNVYMLLLNRILLGVGLGFTNQSIPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              +YRG +N  F+LC+ IG+LIANLINYG EKI  GWGWR+SL LAAVPA  LT+GA+ LP
Sbjct  164   PQYRGAINNGFELCISIGILIANLINYGVEKIAGGWGWRISLSLAAVPAAFLTVGAIYLP  223

Query  623   ETPNSLIQRR---NDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRR  793
             ETP+ +IQRR   N+ D A+  LQR+RGT  VQ ELDDLV+A+  + T  RPF+ IL R+
Sbjct  224   ETPSFIIQRRGGSNNVDEARLLLQRLRGTTRVQKELDDLVSATRTT-TTGRPFRTILRRK  282

Query  794   YRPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASM  973
             YRPQLV+A  VPFF QVTGINVI FYAPV+FRTIGL ESA+LMSAVVT          +M
Sbjct  283   YRPQLVIALLVPFFNQVTGINVINFYAPVMFRTIGLKESASLMSAVVTRVCATAANVVAM  342

Query  974   LLVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFG  1153
             ++VD+ GRR+L +VGG+ M ++Q  VG V+ AK  + GG+ K +A LVL+++  +VAGF 
Sbjct  343   VVVDRFGRRKLFLVGGVQMILSQAMVGAVLAAKFQEHGGMEKEYAYLVLVIMCVFVAGFA  402

Query  1154  LSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGW  1333
              SWGPL +L+P+EI PLEIRSAGQS+ +AV F  TFL+GQTFLAMLCHLK+G FF FGGW
Sbjct  403   WSWGPLTYLVPTEICPLEIRSAGQSVVIAVIFFVTFLIGQTFLAMLCHLKFGTFFLFGGW  462

Query  1334  VAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             V VMT FVY  LPETK LP+E+M+ VWR HWFWK+IV
Sbjct  463   VCVMTLFVYFFLPETKQLPMEQMEQVWRTHWFWKRIV  499



>ref|NP_001065385.1| Os10g0561300 [Oryza sativa Japonica Group]
 gb|AAK31286.1|AC079890_22 putative hexose carrier protein [Oryza sativa Japonica Group]
 gb|AAL79779.1|AC079874_2 putative monosaccharide transporter [Oryza sativa Japonica Group]
 gb|AAP55016.1| Hexose carrier protein HEX6, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27222.1| Os10g0561300 [Oryza sativa Japonica Group]
 dbj|BAG90869.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67439.1| hypothetical protein OsI_34645 [Oryza sativa Indica Group]
 gb|EEE51400.1| hypothetical protein OsJ_32460 [Oryza sativa Japonica Group]
Length=518

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/454 (62%), Positives = 356/454 (78%), Gaps = 2/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FLKRFF DVY K K+D+ +VS+YC FDSELLT FTSSLYIAGL A+L ASSV
Sbjct  51    GGVTSMDSFLKRFFPDVYQK-KQDT-RVSHYCAFDSELLTVFTSSLYIAGLVATLFASSV  108

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+LIGG  F+AG+  GGAA+NV+ML+  R+LLGIG+GF NQ++PLYLSEMAP
Sbjct  109   TRRYGRRTSMLIGGTVFIAGSVFGGAAVNVFMLLINRILLGIGLGFTNQSIPLYLSEMAP  168

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              +YRG +N  F+LC+ +G+L AN++NY   KI  GWGWR+SL +AAVPA  LTIGAV LP
Sbjct  169   PRYRGAINNGFELCISLGILFANVLNYCVVKITAGWGWRISLSMAAVPAAFLTIGAVFLP  228

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETP+ +I+R  D D A+  LQR+RGT  VQ ELDDLVAAS +SRT++ PF+NI  R+YRP
Sbjct  229   ETPSFIIERDGDTDKARILLQRLRGTTSVQKELDDLVAASNLSRTVQYPFRNIFKRKYRP  288

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLV+A  VPFF Q+TGINV+ FYAPV+FRTIGL ESA+L+S+VV           +M++V
Sbjct  289   QLVIALLVPFFNQLTGINVMNFYAPVMFRTIGLKESASLLSSVVNRLCATFANIMAMIVV  348

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             D+ GRR+L +VGGI M ++Q+AVG ++ A+  D G + + +A LVL+ +  +VAGF  SW
Sbjct  349   DRFGRRKLFLVGGIQMILSQLAVGAILAAEFKDYGSMDREYAYLVLITMCVFVAGFAWSW  408

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPL +L+P+EI PLEIRSAGQSI VAV FL TF++GQTFLA+LC +K G FFFF GW+ +
Sbjct  409   GPLTFLVPTEICPLEIRSAGQSIVVAVVFLMTFVIGQTFLAVLCRIKSGTFFFFAGWICL  468

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY  LPETK LP+E+M+ VWR+HWFWKKIV
Sbjct  469   MTVFVYFFLPETKKLPMEQMEQVWRKHWFWKKIV  502



>ref|XP_011076412.1| PREDICTED: hexose carrier protein HEX6-like [Sesamum indicum]
 ref|XP_011076413.1| PREDICTED: hexose carrier protein HEX6-like [Sesamum indicum]
Length=509

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/452 (67%), Positives = 363/452 (80%), Gaps = 1/452 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSME FLK+FF  VY +MKED+  +SNYCKFDS+LLTSF+SSLYI+ L AS LA++V
Sbjct  45    GGVTSMESFLKKFFPVVYKEMKEDT-NLSNYCKFDSQLLTSFSSSLYISCLIASFLAATV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR PSI+IGGVAFL+GA LGG A N+YMLI GR+LLG+G+GF NQ+VPLYLSEMAP
Sbjct  104   TRDYGRKPSIIIGGVAFLSGAVLGGVAENIYMLIIGRLLLGVGIGFTNQSVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              K RG  N  FQLC+G G ++A+LINYGTEKI+  WGWR+SL  AA+PA VL  GAV LP
Sbjct  164   PKSRGAFNYGFQLCIGTGSVLASLINYGTEKIKGDWGWRISLATAALPALVLLAGAVFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQ+ +D++ AKR LQR+RG DDV+ ELDDLV AS  S+ I+ PFK IL R+YRP
Sbjct  224   ETPNSLIQQGHDYEKAKRLLQRIRGIDDVEEELDDLVRASNASKKIKHPFKKILQRKYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVM+ A+PFFQQVTGINVI FYAP+LF TIG G S++L+SA+V G V    T  S  +V
Sbjct  284   QLVMSVAIPFFQQVTGINVITFYAPILFLTIGSGVSSSLLSALVLGIVATSMTVISSFIV  343

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR +   GGI MF+TQM +GG+M AKLG+ G +S+G+++LV+ LI  Y  GF  SW
Sbjct  344   DKLGRRVIFHAGGITMFITQMLIGGIMAAKLGEHGQMSQGYSLLVVALICIYSCGFAFSW  403

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+ SEIFPLEIRSA QSI V V+F  + L+ QTFLAMLCHLKYG FFFFG WVA+
Sbjct  404   GPLGWLVTSEIFPLEIRSAAQSINVGVSFFCSALISQTFLAMLCHLKYGAFFFFGVWVAL  463

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKK  1438
             MT FVYLLLPETKN+PIEKMD VWR+H FWK+
Sbjct  464   MTVFVYLLLPETKNIPIEKMDTVWRKHKFWKR  495



>ref|XP_008453892.1| PREDICTED: hexose carrier protein HEX6 isoform X2 [Cucumis melo]
Length=468

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/409 (72%), Positives = 346/409 (85%), Gaps = 1/409 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSME FLK+FF +V  KMKED   +SNYCKFDS+LLTSFTSSLY+AGL ASL ASS+
Sbjct  44    GGVTSMESFLKKFFPEVDRKMKEDK-DISNYCKFDSQLLTSFTSSLYLAGLVASLFASSM  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T++ GR PSIL  G+ F+ GA LGGAA+NVYMLI GRVLLG+GVGFANQAVPLYLSEMAP
Sbjct  103   TKSLGRRPSILFSGLVFIVGATLGGAAMNVYMLILGRVLLGVGVGFANQAVPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             + YRG +N  FQ  VGIG L ANLIN+GT+KI+ G GWR+SL +A  PA++LT+GA  LP
Sbjct  163   SNYRGAINNGFQFSVGIGGLTANLINFGTQKIKSGNGWRISLAMAGFPASILTLGAFFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLIQR N H      LQR+RGT +VQ+EL DL+ ASEI+++I+ PFKNI+ R+YRP
Sbjct  223   ETPNSLIQRGNSHQLVDEMLQRIRGTPNVQSELADLIKASEIAKSIDNPFKNIMRRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA A+PFFQQVTGINVIAFYAPVLFRTIGLGESA+L SA++TGAVG+VTTF SML+V
Sbjct  283   QLVMAIAIPFFQQVTGINVIAFYAPVLFRTIGLGESASLFSAIMTGAVGLVTTFISMLVV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR L I GG+ MFV+Q+ VGG++ A LGDQG +SKG++ L+L+LI  YVAGFG SW
Sbjct  343   DKLGRRVLFIAGGLQMFVSQVIVGGLLAALLGDQGTVSKGYSYLLLVLICVYVAGFGWSW  402

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYG  1309
             GPLGWL+PSEIFPLEIRSAGQSITVA NF+FTF++ QTFLAMLCHLK G
Sbjct  403   GPLGWLVPSEIFPLEIRSAGQSITVATNFVFTFIIAQTFLAMLCHLKAG  451



>ref|XP_006650945.1| PREDICTED: hexose carrier protein HEX6-like [Oryza brachyantha]
Length=574

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/453 (65%), Positives = 359/453 (79%), Gaps = 1/453 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF DVY +MK D   VSNYC+FDSELLT FTSSLYIAGL A+L ASSV
Sbjct  44    GGVTSMEPFLKKFFPDVYHQMKGDK-NVSNYCRFDSELLTVFTSSLYIAGLVATLCASSV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  SILIGG  F+AG+  GGAA+N+YML+  R+LLGIG+GF NQ++PLYLSEMAP
Sbjct  103   TRRFGRRASILIGGSVFVAGSVFGGAAVNIYMLLLNRILLGIGLGFTNQSIPLYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              ++RG +N  F+LC+ IG+LIANLINYG +KI  GWGWR+SL LAAVPA  L +GAV LP
Sbjct  163   PQHRGAINNGFELCISIGILIANLINYGVDKIEGGWGWRISLSLAAVPAAFLPVGAVFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETP+ +IQR  D D A+  L+R+RGTD VQ ELDDLVAASE+S+TI  P +N+L RRYRP
Sbjct  223   ETPSFVIQRGGDVDEARALLRRLRGTDGVQKELDDLVAASEVSKTIRHPLRNMLRRRYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLV+A  VPFF QVTGINVI FYAPV+FRTIGL ESA+LMSAVVT     V    +M +V
Sbjct  283   QLVIAVLVPFFNQVTGINVINFYAPVMFRTIGLRESASLMSAVVTRVCATVANVVAMAVV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             D+ GRR+LL+VGG+ M V+Q+ VG ++ +K  + GG+ K +A LVL ++  +VAGF  SW
Sbjct  343   DRFGRRKLLLVGGVQMVVSQVMVGAILASKFKEHGGMEKEYAYLVLTVMCVFVAGFAWSW  402

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPL +L+P+EI PLE+RSAGQSI +AV FL TF++GQTFLAMLCHLK+  FF FGGWV  
Sbjct  403   GPLTYLVPAEICPLEVRSAGQSIVIAVIFLLTFVIGQTFLAMLCHLKFATFFLFGGWVCT  462

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKI  1441
             MT FV+  LPETK LP+E+MD +WR HWFWK+I
Sbjct  463   MTLFVFFFLPETKQLPMEQMDQLWRTHWFWKRI  495



>gb|KCW46316.1| hypothetical protein EUGRSUZ_K00178 [Eucalyptus grandis]
Length=464

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/454 (64%), Positives = 352/454 (78%), Gaps = 46/454 (10%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF DVY KM ED+ K+SNYCK+D++LLT FTSSLYI+GL AS  ASSV
Sbjct  45    GGVTSMEPFLKKFFRDVYDKMNEDT-KISNYCKYDNQLLTLFTSSLYISGLVASFFASSV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR PSIL+GG +FLAG+ALGGAA NVYMLIFGR+LLG+GVGFANQ+VPLY+SEMAP
Sbjct  104   TRAFGRKPSILVGGASFLAGSALGGAASNVYMLIFGRILLGVGVGFANQSVPLYISEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              ++RG  N  FQ CVGIGVL ANLINYGTEKI  GWGWR+SL +AAVPA++LT+GA+ LP
Sbjct  164   PRHRGLFNNGFQFCVGIGVLSANLINYGTEKIEGGWGWRISLAMAAVPASILTVGALFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ET NSLIQR +DH+  +  L+R+RG +DVQAEL+DLV AS IS+T++ PF+NI+ R YRP
Sbjct  224   ETANSLIQRSDDHEKVETMLRRIRGVNDVQAELNDLVKASSISKTVDHPFRNIIQREYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVM+ A+PFFQQVTGINVI+FYAPVLFRTIGLGESA+L+SAVVTG VG ++TF SML+V
Sbjct  284   QLVMSIAIPFFQQVTGINVISFYAPVLFRTIGLGESASLLSAVVTGVVGTISTFISMLVV  343

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR+L ++GG  M  +Q  VGG+M +KLGD GG+S+ +  LVL+LI  YVAGF  SW
Sbjct  344   DKLGRRKLFMIGGFQMLASQAMVGGIMASKLGDHGGISQAYGYLVLVLICIYVAGFAWSW  403

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWL+PSEI+PLEIRSAGQSITVA                                  
Sbjct  404   GPLGWLVPSEIYPLEIRSAGQSITVA----------------------------------  429

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
                        TKN+PIE+M+ +WREHWFWK ++
Sbjct  430   -----------TKNVPIEQMNKIWREHWFWKNVM  452



>ref|XP_009412437.1| PREDICTED: sugar carrier protein C-like [Musa acuminata subsp. 
malaccensis]
Length=516

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/456 (63%), Positives = 355/456 (78%), Gaps = 4/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL +FF +V  K K D    + YCKFDS+LLTSFTSSLY+A L AS  ASSV
Sbjct  45    GGVTSMDSFLNKFFPEVLAKEKADK-STNQYCKFDSQLLTSFTSSLYLAALIASFFASSV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR  S+L GG+ FL G+AL GAA+NV MLI GR+LLGIGVGFANQ+VPLYLSEMAP
Sbjct  104   TRAFGRKWSMLGGGLTFLVGSALNGAAVNVLMLILGRILLGIGVGFANQSVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A+ RG +N+ FQL + +G+  ANLINYGT KI+ GWGWRVSL LAAVPA ++++GA+ LP
Sbjct  164   ARLRGMLNIGFQLMITVGIFAANLINYGTSKIKGGWGWRVSLALAAVPACIISLGALFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSLI+R +  + AK+ L+R+RGTDD+  E +DLVAAS+ S+ ++ P+ NI+ R+YRP
Sbjct  224   DTPNSLIERGHSEE-AKQMLRRIRGTDDINEEYNDLVAASQESKVVKHPWSNIMKRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QL M   +PFFQQVTGINVI FYAPVLF+TIG G  A+LMSAV++G V +  TF S+  V
Sbjct  283   QLTMTILIPFFQQVTGINVIMFYAPVLFKTIGFGSEASLMSAVISGLVNVFATFVSIFTV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG--GLSKGWAVLVLLLISSYVAGFGL  1156
             DK+GRR+L + GGI M + Q+ VG ++  K G  G   LSK +A  V+L I  YVAGF  
Sbjct  343   DKLGRRKLFLQGGIQMIICQIIVGTLIAIKFGTSGEATLSKAYAAFVVLFICVYVAGFAW  402

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSEIFPLEIRSAGQSI V+VN LFTF++ Q FL+MLCH+K+G+F+FF GWV
Sbjct  403   SWGPLGWLVPSEIFPLEIRSAGQSINVSVNMLFTFVIAQAFLSMLCHMKFGLFYFFAGWV  462

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              VMT F+ L LPETKN+PIE+M LVW+ HWFW K +
Sbjct  463   VVMTIFIALFLPETKNVPIEEMILVWKAHWFWGKFI  498



>ref|XP_011076411.1| PREDICTED: hexose carrier protein HEX6-like [Sesamum indicum]
Length=502

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/450 (63%), Positives = 348/450 (77%), Gaps = 1/450 (0%)
 Frame = +2

Query  95    SMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSVTRAC  274
             S +PFLK+FF  +Y KM E+    SNYCKFDS+LLT FTSS  I+GL ++  AS VTRA 
Sbjct  39    STDPFLKKFFPAIYRKMNEEGETTSNYCKFDSQLLTFFTSSFLISGLISTFFASPVTRAL  98

Query  275   GRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAPAKYR  454
             GR  SI IGGVAF+ G+ LGGAA N+YMLI  R+ LGIG GF NQ+VPLYLSEMAP ++R
Sbjct  99    GRKASIFIGGVAFIVGSVLGGAAENIYMLICSRLSLGIGFGFTNQSVPLYLSEMAPPQHR  158

Query  455   GGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLPETPN  634
             G  N  FQLCVG G L+A L+NYGTEKI  GWGWRVSL LAA+PA +LTI    LPETPN
Sbjct  159   GAFNFGFQLCVGSGGLMALLVNYGTEKITGGWGWRVSLALAAIPALILTISTPFLPETPN  218

Query  635   SLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRPQLVM  814
             SL+Q+ N  + AK+ LQ++RGTDDV+AE DDL+ AS  S+TI  PFK I  R+YRPQLVM
Sbjct  219   SLVQQGN-QEKAKKMLQKIRGTDDVEAEFDDLITASNASKTINHPFKKIFQRKYRPQLVM  277

Query  815   AFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLVDKVG  994
             + A+PFFQQVTGIN+I+FYAP+LF TIG G SA+L+S+V+ G  G + T  S+L+VDKVG
Sbjct  278   SIAIPFFQQVTGINLISFYAPMLFLTIGSGVSASLLSSVIVGTAGTIMTVLSLLIVDKVG  337

Query  995   RRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSWGPLG  1174
             RR +  +GGI + V Q+ +GG+M AKLGD G LS G+++ VL+L+  +  GF LSWGPL 
Sbjct  338   RRAIFHIGGIQILVPQLIIGGIMAAKLGDHGILSPGYSIAVLILMCIFSIGFSLSWGPLA  397

Query  1175  WLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAVMTTF  1354
             WL+ SEIFPLEIRSAGQSI VA +FL TF+  QTFLAMLCHLK  IFFFF  W  +MT F
Sbjct  398   WLVTSEIFPLEIRSAGQSINVATSFLITFVFAQTFLAMLCHLKAAIFFFFAVWAVLMTAF  457

Query  1355  VYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             VY+LLPETK++PIEKM+ +W+EHWFW++ V
Sbjct  458   VYVLLPETKDVPIEKMEKIWKEHWFWERFV  487



>ref|XP_009418748.1| PREDICTED: sugar carrier protein C-like [Musa acuminata subsp. 
malaccensis]
Length=520

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/456 (62%), Positives = 361/456 (79%), Gaps = 4/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL++FF +VY K K+D+   + YCKFDS+LLT+FTSSLY+A L AS LAS+V
Sbjct  45    GGVTSMDSFLEKFFPEVYRKEKKDT-STNQYCKFDSQLLTTFTSSLYLAALIASFLASAV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+  GG+ FL GAAL GAA N+ MLI GR+LLGIGVGFANQ+VP+YLSEMAP
Sbjct  104   TRMFGRKWSMFGGGLVFLVGAALNGAARNILMLILGRILLGIGVGFANQSVPVYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A+ RG +N+ FQL + +G+L ANLINYGT KI+ GWGWR+SL LAAVPA ++T+GA+ LP
Sbjct  164   AQLRGMLNIGFQLMITVGILAANLINYGTAKIKGGWGWRISLALAAVPAGIITLGALFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSLI+R +  + AK  L+R+RGTDD+  E +DLVAASE S+ ++ P+ NI+ R+YRP
Sbjct  224   DTPNSLIERGHPQE-AKEMLRRIRGTDDIHEEYNDLVAASEESKLVKHPWANIIQRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QL MA  +PFFQQ+TGINVI FYAPVLF+TIG G++A+LMSAV+TG V + +T  S+  V
Sbjct  283   QLTMAILIPFFQQLTGINVIMFYAPVLFKTIGFGDNASLMSAVITGLVNVFSTLVSVFTV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGD--QGGLSKGWAVLVLLLISSYVAGFGL  1156
             DK+GRR+L + GG  M + Q+ VG ++  KLG   +G  SK +A  ++  I +YVAGF  
Sbjct  343   DKLGRRKLFLQGGFQMILCQIIVGTLIAIKLGTSGEGHFSKTYAAFMVFFICAYVAGFAW  402

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSEIFPLEIRSAGQSI V+VN LFTF++ Q FLAMLCH+K+G+F+FF GWV
Sbjct  403   SWGPLGWLVPSEIFPLEIRSAGQSINVSVNMLFTFIIAQAFLAMLCHMKFGLFYFFAGWV  462

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              +MTTF+ L LPETKN+PIE+M LVW+ HWFW K +
Sbjct  463   VIMTTFIALFLPETKNVPIEEMILVWKAHWFWSKFI  498



>ref|XP_009388857.1| PREDICTED: sugar carrier protein C-like [Musa acuminata subsp. 
malaccensis]
Length=522

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/456 (63%), Positives = 356/456 (78%), Gaps = 4/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+PFLK+FF +V+ K KED    + YCKFDS+LLT+FTSSLY+A L AS  A++V
Sbjct  45    GGVTSMDPFLKKFFPEVFRK-KEDDKTTNQYCKFDSQLLTTFTSSLYLAALVASFFAATV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+L GG+ FL GAAL GAA NV MLI GR+LLGIGVGFANQ+VP+YLSEMAP
Sbjct  104   TRVFGRKWSMLGGGLTFLVGAALNGAAQNVLMLILGRILLGIGVGFANQSVPVYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             AK RG +N+ FQL + +G+L A+LINYGT+KI+ GWGWRVSL LAAVPA ++T+G+V LP
Sbjct  164   AKLRGMLNIGFQLMITVGILAASLINYGTDKIKAGWGWRVSLALAAVPAAIITVGSVFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSLI+R    + A+R L+R+RGTDD+  E  DLV ASE S+ ++ P+ NI+ R+YRP
Sbjct  224   DTPNSLIERGYPEE-AQRMLRRIRGTDDIHDEYRDLVVASEESKLVKHPWANIVKRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QL MA  +PFFQQ+TGINVI FYAPVLF+TIG G +A+LMSAV+TG V +  TF S+  V
Sbjct  283   QLTMAILIPFFQQLTGINVIMFYAPVLFQTIGFGSNASLMSAVITGLVNVFATFVSIFTV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGD--QGGLSKGWAVLVLLLISSYVAGFGL  1156
             DK+GRR+L + GG  M V Q+ VG ++  K G   +G LSK +A  V+L I  YVAGF  
Sbjct  343   DKLGRRKLFLEGGAQMIVCQIIVGTLIAIKFGTNGEGHLSKAYAAFVVLFICIYVAGFAW  402

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSEIFPLEIRSAGQSI V+VN  FTF + Q FL MLCH+K+G+F+FF GWV
Sbjct  403   SWGPLGWLVPSEIFPLEIRSAGQSINVSVNMFFTFAIAQAFLTMLCHMKFGLFYFFAGWV  462

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              +MTTF+ + LPETKN+PIE+M LVWR HWFW K +
Sbjct  463   LIMTTFISIFLPETKNVPIEEMILVWRSHWFWSKFI  498



>ref|XP_009407859.1| PREDICTED: hexose carrier protein HEX6-like [Musa acuminata subsp. 
malaccensis]
Length=519

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/455 (63%), Positives = 355/455 (78%), Gaps = 1/455 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKE-DSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASS  259
             GGVTSMEPFLK+FF DVY +M E +S   SNYCKFDS+LL++FTSSLY AGLFASL AS 
Sbjct  44    GGVTSMEPFLKKFFPDVYAEMHEKNSHATSNYCKFDSQLLSTFTSSLYAAGLFASLCASW  103

Query  260   VTRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMA  439
             VT+A GR  S+L+GG  F+AGA LG  AINVYMLI GRVLLGIGVGF NQ+VPLYLSEMA
Sbjct  104   VTQAFGRRTSMLLGGAFFMAGAVLGALAINVYMLILGRVLLGIGVGFTNQSVPLYLSEMA  163

Query  440   PAKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVL  619
             P ++RG +N  F   VG+G L ANLINYGT+KI  GWGWR+S+GLA +PAT+L +G + L
Sbjct  164   PPEHRGAINNGFFFFVGLGTLSANLINYGTQKIHSGWGWRISIGLAVLPATILALGTLFL  223

Query  620   PETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYR  799
             PETP SLIQ  +    A   L+++RGTDDVQAELD L+AA EIS+  + P + I+ R+YR
Sbjct  224   PETPTSLIQHTDSVHKATATLRKIRGTDDVQAELDHLIAAGEISKAAQHPLRIIMRRKYR  283

Query  800   PQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLL  979
             PQLVMA  +PFF+ +TGI  I FY+P++FR++GL ES++L+SAV+TG + +     +M +
Sbjct  284   PQLVMAILIPFFKHMTGIAAITFYSPLIFRSMGLEESSSLLSAVITGVIDVGFILIAMTV  343

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
             VD+VGRR L IVGG+ M  T + VGG++  +LGD GG+ KG A +VL+L+  YVAGFGLS
Sbjct  344   VDRVGRRTLFIVGGVQMLATHVTVGGILAKQLGDHGGVGKGSAYVVLVLVCVYVAGFGLS  403

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPL WL+P+E+FPLEIRS GQSI VAV  L   +VGQT L MLCHL+ G+FFFFGGW  
Sbjct  404   WGPLAWLVPTEMFPLEIRSVGQSIVVAVVLLLASVVGQTLLPMLCHLRSGVFFFFGGWTL  463

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             +MT FV L +PETKNLP+EKMD +WREHWFWKK+V
Sbjct  464   IMTVFVILFVPETKNLPMEKMDQIWREHWFWKKVV  498



>ref|XP_008812644.1| PREDICTED: sugar carrier protein C-like [Phoenix dactylifera]
Length=520

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/456 (63%), Positives = 351/456 (77%), Gaps = 4/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FLK+FF  VY + KED    + YCKFDS++L  FTSSLY+A L AS  AS V
Sbjct  45    GGVTSMDSFLKKFFPTVYRQEKEDK-STNQYCKFDSQVLQMFTSSLYLAALVASFFASVV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR  S+  GGV FL GAAL G A NV MLI GR+LLGIGVGFANQ+VP+YLSEMAP
Sbjct  104   TRAFGRKWSMFGGGVTFLIGAALNGFAKNVLMLILGRILLGIGVGFANQSVPVYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A+ RG +N+ FQL + IG+L ANLINYGT KI+ GWGWRVSL LAAVPA ++T+G++ LP
Sbjct  164   ARLRGMLNIGFQLMITIGILAANLINYGTSKIKGGWGWRVSLALAAVPAGIITLGSLFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSLI+R  D D AK+ L+R+RGTDD+  E +DLVAASE ++ +E P++NIL R+YRP
Sbjct  224   DTPNSLIERGYD-DKAKKMLRRIRGTDDIHEEYNDLVAASEEAKLVEHPWRNILQRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QL MA  +PFFQQ+TGINVI FYAPVLF+TIG G  A+LMS+V+TG V +  T  S+  V
Sbjct  283   QLTMAILIPFFQQLTGINVIMFYAPVLFKTIGFGGEASLMSSVITGLVNVFATLVSVFTV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG--GLSKGWAVLVLLLISSYVAGFGL  1156
             DK+GRR+L + GG  M V Q+ VG ++  K G  G   LSK +A  V+L I  YVAGF  
Sbjct  343   DKLGRRKLFLQGGAQMLVCQIIVGTLIAIKFGTSGEANLSKSYAAFVVLFICVYVAGFAW  402

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSEIFPLEIRSAGQSI V+VN LFTF++ Q FL MLCH+K+G+F+FF GWV
Sbjct  403   SWGPLGWLVPSEIFPLEIRSAGQSINVSVNMLFTFIIAQAFLTMLCHMKFGLFYFFAGWV  462

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              +MTTFV L LPETKN+PIE+M LVW+ HWFW   +
Sbjct  463   VIMTTFVALFLPETKNVPIEEMVLVWKSHWFWGNFI  498



>gb|ABG66260.1| Hexose carrier protein HEX6, putative, expressed [Oryza sativa 
Japonica Group]
Length=463

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/449 (62%), Positives = 351/449 (78%), Gaps = 2/449 (0%)
 Frame = +2

Query  98    MEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSVTRACG  277
             M+ FLKRFF DVY K K+D+ +VS+YC FDSELLT FTSSLYIAGL A+L ASSVTR  G
Sbjct  1     MDSFLKRFFPDVYQK-KQDT-RVSHYCAFDSELLTVFTSSLYIAGLVATLFASSVTRRYG  58

Query  278   RTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAPAKYRG  457
             R  S+LIGG  F+AG+  GGAA+NV+ML+  R+LLGIG+GF NQ++PLYLSEMAP +YRG
Sbjct  59    RRTSMLIGGTVFIAGSVFGGAAVNVFMLLINRILLGIGLGFTNQSIPLYLSEMAPPRYRG  118

Query  458   GMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLPETPNS  637
              +N  F+LC+ +G+L AN++NY   KI  GWGWR+SL +AAVPA  LTIGAV LPETP+ 
Sbjct  119   AINNGFELCISLGILFANVLNYCVVKITAGWGWRISLSMAAVPAAFLTIGAVFLPETPSF  178

Query  638   LIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRPQLVMA  817
             +I+R  D D A+  LQR+RGT  VQ ELDDLVAAS +SRT++ PF+NI  R+YRPQLV+A
Sbjct  179   IIERDGDTDKARILLQRLRGTTSVQKELDDLVAASNLSRTVQYPFRNIFKRKYRPQLVIA  238

Query  818   FAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLVDKVGR  997
               VPFF Q+TGINV+ FYAPV+FRTIGL ESA+L+S+VV           +M++VD+ GR
Sbjct  239   LLVPFFNQLTGINVMNFYAPVMFRTIGLKESASLLSSVVNRLCATFANIMAMIVVDRFGR  298

Query  998   RRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSWGPLGW  1177
             R+L +VGGI M ++Q+AVG ++ A+  D G + + +A LVL+ +  +VAGF  SWGPL +
Sbjct  299   RKLFLVGGIQMILSQLAVGAILAAEFKDYGSMDREYAYLVLITMCVFVAGFAWSWGPLTF  358

Query  1178  LIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAVMTTFV  1357
             L+P+EI PLEIRSAGQSI VAV FL TF++GQTFLA+LC +K G FFFF GW+ +MT FV
Sbjct  359   LVPTEICPLEIRSAGQSIVVAVVFLMTFVIGQTFLAVLCRIKSGTFFFFAGWICLMTVFV  418

Query  1358  YLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             Y  LPETK LP+E+M+ VWR+HWFWKKIV
Sbjct  419   YFFLPETKKLPMEQMEQVWRKHWFWKKIV  447



>ref|XP_006662062.1| PREDICTED: hexose carrier protein HEX6-like [Oryza brachyantha]
Length=518

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/454 (61%), Positives = 351/454 (77%), Gaps = 2/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVT+M+ FLK+FF DVY K K+DS   S+YC FDSELLT FTSSLYIAGL A+L ASSV
Sbjct  50    GGVTTMDSFLKKFFPDVYQK-KQDS-STSHYCAFDSELLTVFTSSLYIAGLVATLFASSV  107

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+LIGG  F+AG+  GGAA+NV+ML+  R+LLG+G+GF NQ++PLYLSEMAP
Sbjct  108   TRRYGRRTSMLIGGTVFIAGSVFGGAAVNVFMLLMNRILLGVGLGFTNQSIPLYLSEMAP  167

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              +YRG +N  F+LC+ +G+L AN++NY   KI  GWGWR+SL +AAVPA  LTIGAV LP
Sbjct  168   PRYRGAINNGFELCISLGILFANVLNYCVVKITAGWGWRISLSMAAVPAAFLTIGAVFLP  227

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETP+ +I+R  D D A+  LQR+RGT  VQ ELDDLVAAS +SRT++ PF+NI  R+YRP
Sbjct  228   ETPSFIIERDGDTDKARILLQRLRGTTSVQKELDDLVAASNLSRTVQYPFRNIFKRKYRP  287

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLV+   VPFF Q+TGINV+ FYAPV+FRTIGL ESA+L+S+VV           +M++V
Sbjct  288   QLVVVLLVPFFNQLTGINVMNFYAPVMFRTIGLKESASLLSSVVNRLCATFANIIAMIVV  347

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             D+ GRR+L +VGGI M ++Q AVG ++ A+  D G + K +A LVL+ +  +VAGF  SW
Sbjct  348   DRFGRRKLFLVGGIQMILSQFAVGAILAAEFKDYGSMDKEYAYLVLITMCVFVAGFAWSW  407

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPL +L+P+EI PLEIRSAGQSI VAV FL TF++GQTFL +LC +K G FFFF GW+ +
Sbjct  408   GPLTFLVPTEICPLEIRSAGQSIVVAVVFLMTFVIGQTFLVVLCRIKSGTFFFFAGWICL  467

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT F+Y  LPETK LP+E+M+ VWR+HWFWK+IV
Sbjct  468   MTVFIYFFLPETKKLPMEQMEQVWRKHWFWKRIV  501



>gb|AFW85928.1| hexose carrier protein HEX6 [Zea mays]
Length=518

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/457 (65%), Positives = 364/457 (80%), Gaps = 4/457 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGV+SMEPFL+RFF DVY +M+ D+ +VSNYCKFDS+LLT+FTSSLY+AGL  + LAS V
Sbjct  46    GGVSSMEPFLRRFFPDVYRRMRGDT-RVSNYCKFDSQLLTAFTSSLYVAGLLTTFLASRV  104

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T   GR  S+++GG AFLAGAA+GGA++NVYM+I GRVLLG+G+GFANQAVPLYLSEMAP
Sbjct  105   TAGRGRRASMVLGGAAFLAGAAVGGASVNVYMVILGRVLLGVGLGFANQAVPLYLSEMAP  164

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A+ RG  +  FQL VG+G L AN+IN+GTEKI  GWGWRVSL LAAVPA +LT+GA+ LP
Sbjct  165   ARLRGAFSNGFQLSVGVGALAANVINFGTEKIGGGWGWRVSLALAAVPAGLLTLGALFLP  224

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTD-DVQAELDDLVAASEISRTIERPF--KNILHRR  793
             ETP+SL+Q+  D     R LQ+VRG   DV  ELDD+VAA E +         + ++ RR
Sbjct  225   ETPSSLVQQGRDRRDVARLLQKVRGAGVDVGDELDDIVAAGESAAGAGGGGLRRLLVERR  284

Query  794   YRPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASM  973
             YRPQLVMA A+PFFQQVTGIN IAFYAPVL RTIG+GESA+L+SAVVTG VG+ +T ASM
Sbjct  285   YRPQLVMAVAIPFFQQVTGINAIAFYAPVLLRTIGMGESASLLSAVVTGVVGVASTSASM  344

Query  974   LLVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFG  1153
             L VD+ GRR L + GG  M  +Q+ +G +M A+L D GG+ K WA +++LLI+ YVAGFG
Sbjct  345   LAVDRFGRRTLFLAGGAQMLASQVLIGAIMAAELRDSGGVGKAWAGVLILLIAVYVAGFG  404

Query  1154  LSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGW  1333
              SWGPLGWL+PSEIFPLE+R+AGQS+TVAV+F FT  V Q FL+MLCH+K GIFFFF  W
Sbjct  405   WSWGPLGWLVPSEIFPLEVRAAGQSVTVAVSFAFTVFVAQAFLSMLCHMKAGIFFFFAVW  464

Query  1334  VAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             +AVMT FVYLLLPETK +PIE+M  VWR HWFW ++V
Sbjct  465   LAVMTAFVYLLLPETKGVPIEQMAGVWRAHWFWSRVV  501



>gb|ACL36483.1| hexose carrier [Aegilops tauschii]
 gb|ACN41353.1| hexose carrier [Triticum aestivum]
Length=512

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/456 (65%), Positives = 360/456 (79%), Gaps = 3/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGV SMEPFL++FF DVY +MK DS  VSNYCKFDS+LLT+FTSSLY+AGL  + LAS V
Sbjct  47    GGVLSMEPFLRKFFPDVYRRMKGDS-HVSNYCKFDSQLLTAFTSSLYVAGLLTTFLASGV  105

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T   GR PS+L+GG AFLAGAA+GGA++NVYM I GRVLLG+G+GFANQAVPLYLSEMAP
Sbjct  106   TARRGRRPSMLLGGAAFLAGAAVGGASLNVYMAILGRVLLGVGLGFANQAVPLYLSEMAP  165

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              ++RG  +  FQ  VG+G L AN+IN+GTEKI+ GWGWRVSL LAAVPA +L +GAV LP
Sbjct  166   PRHRGAFSNGFQFSVGVGALAANVINFGTEKIKGGWGWRVSLSLAAVPAGLLLVGAVFLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNIL--HRRY  796
             ETPNSL+Q+  D       L+++RGTDDV  ELD +VAA++           +L   RRY
Sbjct  226   ETPNSLVQQGKDRREVAVLLRKIRGTDDVDRELDGIVAAADSGAVAGSSGLRMLLTQRRY  285

Query  797   RPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASML  976
             RPQLVMA A+PFFQQVTGIN IAFYAPVL RTIG+GESA+L+SAVVTG VG  +T  SM 
Sbjct  286   RPQLVMAVAIPFFQQVTGINAIAFYAPVLLRTIGMGESASLLSAVVTGVVGAASTLLSMF  345

Query  977   LVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGL  1156
             LVD+ GRR L + GG  M  +Q+ +G +M AKLGD GG+SK WA  ++LLI+ YVAGFG 
Sbjct  346   LVDRFGRRTLFLAGGAQMLASQLLIGAIMAAKLGDDGGVSKTWAAALILLIAVYVAGFGW  405

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSEIFPLE+RSAGQ +TVA +F+FT  V QTFLAMLC ++ GIFFFF  W+
Sbjct  406   SWGPLGWLVPSEIFPLEVRSAGQGVTVATSFVFTVFVAQTFLAMLCRMRAGIFFFFAAWL  465

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             A MT FVYLLLPET+ +PIE++D VWREHWFW+++V
Sbjct  466   AAMTVFVYLLLPETRGVPIEQVDRVWREHWFWRRVV  501



>ref|XP_010905889.1| PREDICTED: sugar carrier protein C-like [Elaeis guineensis]
Length=505

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/456 (61%), Positives = 354/456 (78%), Gaps = 4/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSME FL +FF  V  K +ED+   S YCKFDS+LLT+FTSSLY+A L AS  AS+V
Sbjct  45    GGVTSMESFLVKFFPSVLQKEEEDT-STSQYCKFDSQLLTAFTSSLYLAALVASFFASTV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+  GG+ FLAG+A+ GAA NV+MLI GR+LLGIGVGFANQ+VPLYLSEMAP
Sbjct  104   TRVFGRKWSMFGGGITFLAGSAINGAAENVFMLILGRILLGIGVGFANQSVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             AK RG +N+ FQL + +G+L A LINY T KI  GWGWRVSL LAAVPA ++T+G++ LP
Sbjct  164   AKLRGMLNIGFQLMITVGILAATLINYATAKISGGWGWRVSLALAAVPAAIITVGSLFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSLI+R ++ D AK  LQ++RGTDD+Q+E DD+VAASE ++T++ P+ NI+ ++YRP
Sbjct  224   DTPNSLIERGHN-DRAKAMLQKIRGTDDIQSEYDDIVAASEEAKTVQHPWSNIIKKKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QL M+  +PFFQQ+TGINVI FYAPVLF+TIG G+ A+LMSAV+TG V +  TF S+  V
Sbjct  283   QLTMSILIPFFQQLTGINVIMFYAPVLFKTIGFGDDASLMSAVITGLVNMFATFVSIATV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG--GLSKGWAVLVLLLISSYVAGFGL  1156
             DK GRR L + GG  M ++Q+ VG ++G K G  G   LSK +A LV+  I  +VA F  
Sbjct  343   DKFGRRILFLEGGTQMLISQIIVGSLIGIKFGTSGEATLSKEYAFLVVFFICVFVAAFAW  402

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSEIFPLEIRSAGQ+I V+VN  FTF++GQ FL MLCH+K+G+F+FF GW 
Sbjct  403   SWGPLGWLVPSEIFPLEIRSAGQAINVSVNMFFTFVIGQFFLTMLCHMKFGLFYFFAGWE  462

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              +MT F+ L LPETKN+PIE+M LVW+ HWFW K +
Sbjct  463   LIMTIFIALFLPETKNVPIEEMVLVWKRHWFWGKFI  498



>gb|EPS64704.1| hypothetical protein M569_10076, partial [Genlisea aurea]
Length=431

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/428 (64%), Positives = 335/428 (78%), Gaps = 0/428 (0%)
 Frame = +2

Query  161   KVSNYCKFDSELLTSFTSSLYIAGLFASLLASSVTRACGRTPSiliggvaflagaalgga  340
             K+SNYCKFDS+LLTSFTSSL+IAGL AS  AS+VTR  GR  SIL GG +FL+GAA+GGA
Sbjct  3     KISNYCKFDSQLLTSFTSSLFIAGLVASFFASTVTRKFGRRSSILFGGASFLSGAAIGGA  62

Query  341   aiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAPAKYRGGMNVSFQLCVGIGVLIANLIN  520
             ++NVYML+ GR++LGIGVGF NQ+VPLYLSEMAPAKYRG  N+ FQ+CV IGV+ ANLIN
Sbjct  63    SVNVYMLLLGRIMLGIGVGFTNQSVPLYLSEMAPAKYRGAFNIGFQVCVAIGVISANLIN  122

Query  521   YGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLPETPNSLIQRRNDHDGAKRRLQRVRGT  700
             Y T +I  GWGWRVSL LA VPA V+T+G + L ETPNSLI+  + H+ AKR LQ++RG 
Sbjct  123   YFTNQISGGWGWRVSLSLAGVPAAVITVGGIFLTETPNSLIENGDSHENAKRLLQKIRGV  182

Query  701   DDVQAELDDLVAASEISRTIERPFKNILHRRYRPQLVMAFAVPFFQQVTGINVIAFYAPV  880
              DV+ E +DLVAAS  SR +  PF+NIL R+YRPQLVMA  +PFFQQVTGINVI FYAP+
Sbjct  183   ADVEDEFNDLVAASATSRAVRHPFRNILRRKYRPQLVMAVLIPFFQQVTGINVIGFYAPI  242

Query  881   LFRTIGLGESAALMSavvtgavgivttFASMLLVDKVGRRRLLIVGGILMFVTQMAVGGV  1060
             LFRT G    A+++  V+ G VG   T  SM +VD+VGRR L ++GG+ M + Q  VG +
Sbjct  243   LFRTTGASVGASILFCVIIGVVGTTMTVVSMAVVDRVGRRILFLIGGLQMLMAQFVVGSI  302

Query  1061  MGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSWGPLGWLIPSEIFPLEIRSAGQSITVA  1240
             M  K+ D G L K ++VL+L+ I  Y+ GFGLSWGPLGWL+ SEIFP+EIRSAGQSI VA
Sbjct  303   MALKVKDHGSLDKSYSVLLLVFICFYLCGFGLSWGPLGWLVTSEIFPMEIRSAGQSINVA  362

Query  1241  VNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAVMTTFVYLLLPETKNLPIEKMDLVWRE  1420
              NF+  F+V Q FLAMLCH+K G+FFFFGGWVA MT FVY  LPETK++PIEKMD VWR 
Sbjct  363   TNFVVIFVVVQLFLAMLCHMKAGVFFFFGGWVAAMTAFVYWWLPETKDVPIEKMDRVWRG  422

Query  1421  HWFWKKIV  1444
             HW+WK+ V
Sbjct  423   HWYWKRFV  430



>gb|ADK62367.1| hexose carrier [Triticum aestivum]
Length=514

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/457 (65%), Positives = 363/457 (79%), Gaps = 4/457 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGV+SMEPFL++FF +VY +MK DS  VSNYCKFDS+LLT+FTSSLY+AGL  + LAS V
Sbjct  46    GGVSSMEPFLRKFFPEVYRRMKGDS-HVSNYCKFDSQLLTAFTSSLYVAGLLTTFLASGV  104

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T   GR PS+L+GG AFLAGAA+GGA++NVYM I GRVLLG+G+GFANQAVPLYLSEMAP
Sbjct  105   TARRGRRPSMLLGGAAFLAGAAVGGASLNVYMAILGRVLLGVGLGFANQAVPLYLSEMAP  164

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              ++RG  +  FQ  VG+G L AN+IN+GTEKI+ GWGWRVSL LAAVPA +L +GAV LP
Sbjct  165   PRHRGAFSNGFQFSVGVGALAANVINFGTEKIKGGWGWRVSLSLAAVPAGLLLVGAVFLP  224

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISR--TIERPFKNIL-HRR  793
             ETPNSL+Q+  D       L+++RGTDDV  ELD +VAA++     T     + +L  R+
Sbjct  225   ETPNSLVQQGKDRRDVALLLRKIRGTDDVDRELDCIVAAADSGAMATGRSGLRMLLTQRQ  284

Query  794   YRPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASM  973
             YRPQLVMA A+PFFQQVTGIN IAFYAPVL RTIG+GESA+L+SAVVTG VG  +T  SM
Sbjct  285   YRPQLVMAVAIPFFQQVTGINAIAFYAPVLLRTIGMGESASLLSAVVTGVVGAASTLLSM  344

Query  974   LLVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFG  1153
              LVD+ GRR L + GG  M  +Q+ +G +M AKLGD GG+SK WA  ++ LI+ YVAGFG
Sbjct  345   FLVDRFGRRTLFLAGGTQMLASQLLIGAIMAAKLGDDGGVSKTWAAALIFLIAVYVAGFG  404

Query  1154  LSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGW  1333
              SWGPLGWL+PSEIFPLE+RSAGQ +TVA +F+FT  V QTFLAMLCH++ GIFFFF  W
Sbjct  405   WSWGPLGWLVPSEIFPLEVRSAGQGVTVATSFVFTVFVAQTFLAMLCHMRAGIFFFFAAW  464

Query  1334  VAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             +A MT FVYLLLPET+ +PIE++D VWREHWFW++++
Sbjct  465   LAAMTAFVYLLLPETRGVPIEQVDRVWREHWFWRRVL  501



>ref|XP_009416065.1| PREDICTED: sugar carrier protein C-like [Musa acuminata subsp. 
malaccensis]
Length=519

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/456 (62%), Positives = 351/456 (77%), Gaps = 4/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL++FF +VY K K D    + YCKFDS+LLT+FTSSLY+A L AS  AS+V
Sbjct  45    GGVTSMDSFLEKFFPEVYRKEKLDK-STNQYCKFDSQLLTTFTSSLYLAALIASFFASTV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+  GG+ FL GAAL GAA NV MLI GR+LLG+GVGFANQ+VP+YLSEMAP
Sbjct  104   TRTFGRKWSMFGGGLVFLIGAALNGAAKNVLMLILGRILLGVGVGFANQSVPVYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A+ RG +N+ FQL + IG+L ANLINYGT KI  GWGWRVSL LAAVPA ++++GA+ LP
Sbjct  164   ARLRGMLNIGFQLMITIGILAANLINYGTAKIEGGWGWRVSLALAAVPAGIISLGALFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSLI+R +  + AK  L+R+RGTDDV  E DDLVAAS+ S  ++ P+ NI+ R+YRP
Sbjct  224   DTPNSLIERGHPEE-AKHMLRRIRGTDDVDEEYDDLVAASQESNRVKHPWANIVKRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QL M   +PFFQQ+TGINVI FYAPVLF+TIG G  A+LMSAV+TG V +  TF S+   
Sbjct  283   QLTMTILIPFFQQLTGINVIMFYAPVLFKTIGFGNDASLMSAVITGLVNVFATFVSIFTA  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGD--QGGLSKGWAVLVLLLISSYVAGFGL  1156
             DK+GRR+L + GG  M V Q+ VG ++  K G   +G  SK +A  V+L I  YVAGF  
Sbjct  343   DKLGRRKLFLQGGSQMIVCQIIVGTLIAIKYGTSGEGHFSKAYAAFVVLFICVYVAGFAW  402

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSEIFPLEIRSAGQSI V+VN LFTF++ Q FLAMLCH+K+G+F+FFGGWV
Sbjct  403   SWGPLGWLVPSEIFPLEIRSAGQSINVSVNMLFTFVIAQAFLAMLCHMKFGLFYFFGGWV  462

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              +MT F+ L LPETKN+PIE+M LVW+ HWFW K +
Sbjct  463   LIMTIFIALFLPETKNVPIEEMILVWKAHWFWGKFI  498



>ref|XP_010936607.1| PREDICTED: sugar carrier protein C-like [Elaeis guineensis]
Length=512

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/456 (61%), Positives = 354/456 (78%), Gaps = 4/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSME FL RFF  V  K KED    + YCKFDS+LLT+FTSSLY+A L AS  AS+V
Sbjct  45    GGVTSMESFLVRFFPSVLKKEKEDV-STNQYCKFDSQLLTAFTSSLYLAALIASFFASTV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+  GG+ FLAG+A+ GAA NV+MLI GR+LLGIGVGFANQ+VPLYLSEMAP
Sbjct  104   TRVFGRKWSMFGGGITFLAGSAINGAAENVFMLILGRILLGIGVGFANQSVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             AK RG +N+ FQL + IG+L ANLINYGT +I  GWGWRVSL LAAVPA ++TIG+++LP
Sbjct  164   AKLRGMLNIGFQLMITIGILAANLINYGTAQISGGWGWRVSLALAAVPAAIITIGSLILP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSL++R +D   AK  L+R+RGTDD+Q+E +D+VAASE ++T++ P+ NI+ R+YRP
Sbjct  224   DTPNSLVERGHDEQ-AKVMLKRIRGTDDIQSEYEDIVAASEEAKTVQHPWSNIMKRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QL MA  +P FQQ+TGINVI FYAPVLF+TIG G  A+LMS+V+TG V +  TF S+  V
Sbjct  283   QLTMAVLIPLFQQLTGINVIMFYAPVLFKTIGFGSDASLMSSVITGLVNMFATFVSIATV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG--GLSKGWAVLVLLLISSYVAGFGL  1156
             DK GRR L + GG  M ++Q+ VG ++  K G+ G   LSK +A  V+L +  +V+ F  
Sbjct  343   DKFGRRILFLEGGSQMLISQIIVGTLIAIKFGNNGEATLSKEYAFFVVLFVCIFVSAFAW  402

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGP+GWL+PSEIFPLEIR AGQ+I V+VN  FTF++GQ FLAMLCH+K+G+F+FF GW 
Sbjct  403   SWGPMGWLVPSEIFPLEIRPAGQAINVSVNMFFTFVIGQFFLAMLCHMKFGLFYFFAGWE  462

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              +MT F+ L LPETKN+PIE+M LVW++HWFW K +
Sbjct  463   LLMTIFIALFLPETKNVPIEEMVLVWKKHWFWGKFI  498



>gb|ACL36477.1| hexose transporter [Triticum aestivum]
Length=510

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/456 (65%), Positives = 360/456 (79%), Gaps = 5/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGV SMEPFL++FF DVY +MK DS  VSNYCKFDS+LLT+FTSSLY+AGL  + LAS V
Sbjct  47    GGVLSMEPFLRKFFPDVYRRMKGDS-HVSNYCKFDSQLLTAFTSSLYVAGLLTTFLASGV  105

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T   GR PS+L+GG AFLAGAA+GGA++NVYM I GRVLLG+G+GFANQAVPLYLSEMAP
Sbjct  106   TARRGRRPSMLLGGAAFLAGAAVGGASLNVYMAILGRVLLGVGLGFANQAVPLYLSEMAP  165

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              ++RG  +  FQ  VG+G L AN+IN+GTEKI+ GWGWRVSL LAAVPA +L +GAV LP
Sbjct  166   PRHRGAFSNGFQFSVGVGALAANVINFGTEKIKGGWGWRVSLSLAAVPAGLLLVGAVFLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNIL--HRRY  796
             ETPNSL+Q+  D       L+++RGTDDV  ELD +VAA++           +L   RRY
Sbjct  226   ETPNSLVQQGKDRREVAVLLRKIRGTDDVDRELDGIVAAADSGAVAGSSGLRMLLTQRRY  285

Query  797   RPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASML  976
             RPQLVMA A+PFFQQVTGIN IAFYAPVL RTIG+GESA+L+SAVVTG VG  +T  SM 
Sbjct  286   RPQLVMAVAIPFFQQVTGINAIAFYAPVLLRTIGMGESASLLSAVVTGVVGAASTLLSMF  345

Query  977   LVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGL  1156
             LVD+ GRR L + GG  M  +Q+ +G +M AKLGD GG+SK WA++  LLI+ YVAGFG 
Sbjct  346   LVDRFGRRTLFLAGGAQMLASQLLIGAIMAAKLGDDGGVSKTWALI--LLIAVYVAGFGW  403

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSEIFPLE+RSAGQ +TVA +F+FT  V QTFLAMLC ++ GIFFFF  W+
Sbjct  404   SWGPLGWLVPSEIFPLEVRSAGQGVTVATSFVFTVFVAQTFLAMLCRMRAGIFFFFAAWL  463

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             A MT FVYLLLPET+ +PIE++D VWREHWFW+++V
Sbjct  464   AAMTVFVYLLLPETRGVPIEQVDRVWREHWFWRRVV  499



>ref|XP_009402797.1| PREDICTED: sugar carrier protein C-like [Musa acuminata subsp. 
malaccensis]
Length=519

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/457 (61%), Positives = 350/457 (77%), Gaps = 5/457 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL RFF  VY +   DS   + YCKFDS+LLT FTSSLY+A L +S LAS+V
Sbjct  45    GGVTSMDSFLSRFFPSVYRQQMADS-STNQYCKFDSQLLTLFTSSLYVAALISSFLASTV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+  GG+ FL G+A+ GAA+NV MLI GRVLLGIG+GFANQ+VPLYLSEMAP
Sbjct  104   TRVFGRKWSMFAGGITFLLGSAINGAAVNVLMLILGRVLLGIGIGFANQSVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             AK RG +N+ FQL + IG+  ANLINYGT  I  GWGWRVSLGLAAVPA ++T+G++VLP
Sbjct  164   AKLRGMLNIGFQLMITIGIFAANLINYGTASIEGGWGWRVSLGLAAVPAVIITVGSLVLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSLI+R  D + AK  L+++R T+D+QAE  DLVAAS  +++I+ P+ NIL RRYRP
Sbjct  224   DTPNSLIERGYDEE-AKAMLRKIRRTEDIQAEYGDLVAASAEAKSIDHPWSNILQRRYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QL MA  +P FQQ+TGINVI FYAPVLF+TIG G  A+L SAV++G V +  TF S+  V
Sbjct  283   QLCMAILIPSFQQLTGINVIMFYAPVLFKTIGFGSEASLASAVISGIVNVFATFVSIATV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG---GLSKGWAVLVLLLISSYVAGFG  1153
             DK+GRR+L + GG  M V+Q+ VG ++  K G  G    +S  +A +++L I  YVA F 
Sbjct  343   DKLGRRKLFLQGGTQMLVSQLLVGTLIALKFGTSGVATDMSTNYASIIVLFICFYVAAFA  402

Query  1154  LSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGW  1333
              SWGPLGWL+PSEIFPLEIRSAGQSITV+VN LFTF++ Q FL  LCHLK+G+F+FF GW
Sbjct  403   WSWGPLGWLVPSEIFPLEIRSAGQSITVSVNMLFTFIIAQVFLTALCHLKFGLFYFFAGW  462

Query  1334  VAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             V +MT FV L LPETKN+PIE++ LVW++HWFW K +
Sbjct  463   VVIMTVFVALFLPETKNVPIEEIVLVWKKHWFWGKFI  499



>gb|EMS51881.1| Hexose carrier protein HEX6 [Triticum urartu]
Length=510

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/454 (62%), Positives = 349/454 (77%), Gaps = 2/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FLK FF +VY + K+DS  VSNYC+FDSELLT FTSSLYIAGL A+L ASSV
Sbjct  47    GGVTSMDSFLKTFFPEVY-RHKQDS-NVSNYCQFDSELLTVFTSSLYIAGLIATLFASSV  104

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+LIGG  F+AG+A GGAA+NV ML+  R+LLGIG+GF NQ++PLYLSEMAP
Sbjct  105   TRRFGRRVSMLIGGTVFIAGSAFGGAAVNVPMLLLNRILLGIGLGFTNQSIPLYLSEMAP  164

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              +YRG +N  F+L + IG+LIAN++NY   K+  GWGWR+SL +AAVPA  LTIGA+ LP
Sbjct  165   PQYRGAINNGFELSISIGILIANILNYCVVKLTAGWGWRISLSMAAVPAAFLTIGAIFLP  224

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETP+ +IQR  D D A+  LQ++RGT  VQ ELDDLV+AS +SR  + PF+NI  R+YRP
Sbjct  225   ETPSFIIQRDGDTDKARALLQKLRGTTSVQNELDDLVSASNLSRAAKYPFRNIFKRKYRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QL M   +PFF Q+TGINV+ FYAPV+FRTIGL ESA+L+S+VVT          +ML+V
Sbjct  285   QLAMVLLIPFFNQLTGINVMNFYAPVMFRTIGLKESASLLSSVVTRLCATFANIVAMLVV  344

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             D+ GRR+L +VGGI M ++Q+AVG ++ AK  D G + K +A LVL+ +  +VAGF  SW
Sbjct  345   DRFGRRKLFLVGGIQMILSQLAVGAILAAKFKDDGLMDKDYAFLVLITMCVFVAGFAWSW  404

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPL +L+P+EI PLEIRSAGQSI VAV FL TF++GQTFLA+LC +K G FF F  W+ V
Sbjct  405   GPLTFLVPTEICPLEIRSAGQSIVVAVVFLMTFVIGQTFLAVLCRIKSGTFFVFAAWICV  464

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT  VYL LPETK LP+E+M+ VWR HWFWKKIV
Sbjct  465   MTLVVYLFLPETKKLPMEQMEQVWRRHWFWKKIV  498



>ref|NP_001062724.1| Os09g0268300 [Oryza sativa Japonica Group]
 dbj|BAD26263.1| putative hexose carrier protein HEX6 [Oryza sativa Japonica Group]
 dbj|BAF24638.1| Os09g0268300 [Oryza sativa Japonica Group]
Length=511

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/455 (62%), Positives = 348/455 (76%), Gaps = 3/455 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL  FF +VY +MK  S  VSNYCKFDSELLT+FTSSLYIAGL  + LASSV
Sbjct  46    GGVTSMDGFLSMFFPEVYRRMKGTS--VSNYCKFDSELLTAFTSSLYIAGLLTTFLASSV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T  CGR PS++I G A LAG+A+GG A+NV M+I GRVLLG+G+GF NQAVPLYLSEMAP
Sbjct  104   TARCGRRPSMVIAGSAILAGSAIGGTAVNVSMVILGRVLLGVGLGFGNQAVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
               +RG  +  FQLCVGIG + A L N+ T+KIR GWGWRVSL +AAVP  +LT+GA+ LP
Sbjct  164   PLHRGAFSNGFQLCVGIGAVTARLTNFFTQKIRQGWGWRVSLAVAAVPGGLLTLGALFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNIL-HRRYR  799
             ETPNSL+Q+  D    +  L R+RG  DV+ EL+D+VAA+       R  + I+  R+YR
Sbjct  224   ETPNSLLQQGRDKRRVRVLLTRIRGVSDVEDELEDIVAANSDKANSSRGLQMIVTQRQYR  283

Query  800   PQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLL  979
             PQLVMA  +PFFQQVTGIN I+FYAPVL RTIG+GESA+L+S VVTG VG  +TF SM L
Sbjct  284   PQLVMAIMIPFFQQVTGINAISFYAPVLLRTIGMGESASLLSVVVTGLVGTSSTFVSMFL  343

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
             VD+ GRR L +VGG  M V+Q+ +GG+M  +LGD G +SK  A++++ LI+ YVAGF  S
Sbjct  344   VDRYGRRTLFLVGGAQMLVSQLMIGGIMATQLGDHGQVSKTCALVLIFLIAVYVAGFAWS  403

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPLGWL+PSE+FPLE+RSAGQSITVAVNFL T  V Q FLA LC ++ GIFFFF  W+ 
Sbjct  404   WGPLGWLVPSEVFPLEVRSAGQSITVAVNFLMTTAVAQLFLATLCRMRAGIFFFFAAWLV  463

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              MT FVYLLLPETK LPIE++  +W +HWFW++ V
Sbjct  464   AMTAFVYLLLPETKGLPIEQVRRLWAQHWFWRRFV  498



>ref|XP_009385295.1| PREDICTED: sugar carrier protein C-like [Musa acuminata subsp. 
malaccensis]
Length=519

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/457 (60%), Positives = 352/457 (77%), Gaps = 5/457 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL RFF  VY +   DS   + YCKFDS+LLT FTSSLY A L +S LAS+V
Sbjct  45    GGVTSMDSFLSRFFPSVYKQQMADS-STNQYCKFDSQLLTLFTSSLYWAALLSSFLASTV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+  GG+ FL G+A+ GAA+NV MLI GRVLLGIG+GFANQAVPLYLSEMAP
Sbjct  104   TRMFGRKWSMFAGGITFLLGSAINGAAMNVLMLILGRVLLGIGIGFANQAVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A  RG +N+ FQL + +G+ +ANLINYGT  I+ GWGWRVSLGLAAVPA V+TIG++VLP
Sbjct  164   ADLRGTLNIGFQLMITVGIFVANLINYGTASIKGGWGWRVSLGLAAVPALVITIGSLVLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNS+I+R +D + AK  L+++RGT+D++AE DDLVAAS+ ++++  P+ NIL R+YRP
Sbjct  224   DTPNSIIERGHDEE-AKAMLRKIRGTEDIRAEYDDLVAASDAAKSVHHPWSNILQRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QL MA  +P FQQ+TGINVI FYAPVLF+TIG G  A+L SAV+TG V +  TF S+  V
Sbjct  283   QLTMAILIPCFQQLTGINVIMFYAPVLFKTIGFGSEASLASAVITGIVIVFGTFVSIATV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG---GLSKGWAVLVLLLISSYVAGFG  1153
             D +GRR+L + GG  M ++Q+ VG ++  K G  G    ++K +A +++L I  YVA F 
Sbjct  343   DNLGRRKLFLQGGAQMLISQLVVGTLIAFKFGISGVATDVTKNYASIIVLFICFYVAAFA  402

Query  1154  LSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGW  1333
              SWGPLGWL+PSEIFPLEIRSAGQSITV+VN  FTFL+ Q FL  LCHLK+G+F+FF GW
Sbjct  403   WSWGPLGWLVPSEIFPLEIRSAGQSITVSVNMFFTFLIAQVFLTALCHLKFGLFYFFAGW  462

Query  1334  VAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             VA+MT F+   LPETK++PIE++ LVW++HWFW K +
Sbjct  463   VAIMTAFIAFFLPETKSVPIEEITLVWKKHWFWSKFI  499



>ref|XP_003559033.1| PREDICTED: hexose carrier protein HEX6 [Brachypodium distachyon]
 gb|ACF22763.1| sugar transport protein [Brachypodium distachyon]
Length=534

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/456 (62%), Positives = 351/456 (77%), Gaps = 3/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSME FLK+FF +VY +MK D   VSNYC+FDSELLT FTSSLY+AGL A+L ASSV
Sbjct  50    GGVTSMESFLKKFFPEVYHQMKGDKVDVSNYCRFDSELLTVFTSSLYVAGLVATLFASSV  109

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T   GR  SILIGG  F+AG+  GGAA+NVYML+  R+LLGIG+GF NQ++PLYLSEMAP
Sbjct  110   TTRYGRRASILIGGSVFIAGSVFGGAAVNVYMLLLNRILLGIGLGFTNQSIPLYLSEMAP  169

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              +YRG +N  F+LC+ IG+LIANLINYG  KI  GWGWR+SL +AAVPA  LT+GA+ LP
Sbjct  170   PQYRGAINNGFELCISIGILIANLINYGVAKIEGGWGWRISLSMAAVPAAFLTVGAIFLP  229

Query  623   ETPNSLIQRRN-DHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNIL-HRRY  796
             ETP+ LIQR   + D AK  LQR+RGT  VQ ELDDLVAA+   +   RP + +L  ++Y
Sbjct  230   ETPSFLIQRGGGNTDAAKAMLQRLRGTAGVQKELDDLVAAAGAGQQ-GRPLRTLLGKKKY  288

Query  797   RPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASML  976
             RPQL MA  +PFF QVTGINVI FYAPV+FRTIGL ESA+LMSAVVT          +M+
Sbjct  289   RPQLAMAILIPFFNQVTGINVINFYAPVMFRTIGLKESASLMSAVVTRLCATAANVVAMV  348

Query  977   LVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGL  1156
             +VD+ GRR+LL+ GG+ M ++Q AVG ++ AK  D G + K +A LVL+++  +VAGF  
Sbjct  349   VVDRSGRRKLLLAGGVQMILSQFAVGAILAAKFKDHGAMDKEYAYLVLVIMCVFVAGFAW  408

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPL +L+P+EI PLEIRSAGQS+ +AV FL TF++GQTFLAMLCHL+ G FF FGGWV
Sbjct  409   SWGPLTYLVPTEICPLEIRSAGQSVVIAVIFLATFVIGQTFLAMLCHLRSGTFFLFGGWV  468

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              +MT FV+  LPETK LP+E+M+ VWR HWFW+++V
Sbjct  469   CLMTLFVFFFLPETKQLPMEQMEQVWRRHWFWRRVV  504



>gb|ACN35012.1| unknown [Zea mays]
Length=491

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/457 (60%), Positives = 334/457 (73%), Gaps = 39/457 (9%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSME FL++FF DVY +MK D   VSNYC+FDSELLT FTSSLYIAGL A+L ASSV
Sbjct  45    GGVTSMESFLRKFFPDVYHQMKGDK-DVSNYCRFDSELLTVFTSSLYIAGLVATLFASSV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR                                  R+LLG+G+GF NQ++PLYLSEMAP
Sbjct  104   TR----------------------------------RILLGVGLGFTNQSIPLYLSEMAP  129

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              +YRG +N  F+LC+ IG+LIANLINYG EKI  GWGWR+SL LAAVPA  LT+GA+ LP
Sbjct  130   PQYRGAINNGFELCISIGILIANLINYGVEKIAGGWGWRISLSLAAVPAAFLTVGAIYLP  189

Query  623   ETPNSLIQRR---NDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRR  793
             ETP+ +IQRR   N+ D A+  LQR+RGT  VQ ELDDLV+A+  + T  RPF+ IL R+
Sbjct  190   ETPSFIIQRRGGSNNVDEARLLLQRLRGTTRVQKELDDLVSATRTT-TTGRPFRTILRRK  248

Query  794   YRPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASM  973
             YRPQLV+A  VPFF QVTGINVI FYAPV+FRTIGL ESA+LMSAVVT          +M
Sbjct  249   YRPQLVIALLVPFFNQVTGINVINFYAPVMFRTIGLKESASLMSAVVTRVCATAANVVAM  308

Query  974   LLVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFG  1153
             ++VD+ GRR+L +VGG+ M ++Q  VG V+ AK  + GG+ K +A LVL+++  +VAGF 
Sbjct  309   VVVDRFGRRKLFLVGGVQMILSQAMVGAVLAAKFQEHGGMEKEYAYLVLVIMCVFVAGFA  368

Query  1154  LSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGW  1333
              SWGPL +L+P+EI PLEIRSAGQS+ +AV F  TFL+GQTFLAMLCHLK+G FF FGGW
Sbjct  369   WSWGPLTYLVPTEICPLEIRSAGQSVVIAVIFFVTFLIGQTFLAMLCHLKFGTFFLFGGW  428

Query  1334  VAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             V VMT FVY  LPETK LP+E+M+ VWR HWFWK+IV
Sbjct  429   VCVMTLFVYFFLPETKQLPMEQMEQVWRTHWFWKRIV  465



>ref|XP_010904882.1| PREDICTED: sugar carrier protein C-like [Elaeis guineensis]
Length=520

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/456 (61%), Positives = 345/456 (76%), Gaps = 4/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FLK+FF  VY + KED    + YCKFDS++L  FTSSLY+A L AS  AS+V
Sbjct  45    GGVTSMDSFLKKFFPTVYRQEKEDQ-STNQYCKFDSQVLQLFTSSLYVAALIASFFASAV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+  GG+ FL GAAL G A NV MLI GR+LLGIGVGFANQ+VP+YLSEMAP
Sbjct  104   TRMFGRKWSMFGGGITFLIGAALNGLAKNVLMLILGRILLGIGVGFANQSVPVYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A+ RG +N+ FQL + IG+  ANLINYGT KI+ GWGWRVSL LAAVPA ++T+G++ LP
Sbjct  164   ARLRGMLNIGFQLMITIGIFAANLINYGTSKIKGGWGWRVSLALAAVPAGIITLGSLFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSLI+R  D   AK  L+R+RG DD+  E +DLVAASE S+ +  P++NI+ R+YR 
Sbjct  224   DTPNSLIERGYDEK-AKNMLRRIRGVDDIHEEYNDLVAASEESKLVVHPWRNIIQRKYRA  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QL MA  +PFFQQ+TGINVI FYAPVLF+TIG    A+LMS+V+TG V +  T  S+  V
Sbjct  283   QLTMAILIPFFQQLTGINVIMFYAPVLFKTIGFATDASLMSSVITGLVNVFATLVSVFTV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG--GLSKGWAVLVLLLISSYVAGFGL  1156
             DK+GRR+L + GG  M V Q+ VG ++  K G  G   LSK +A  V+L I  YVAGF  
Sbjct  343   DKLGRRKLFLQGGSQMLVCQIIVGTLIAIKFGTNGEANLSKTYAAFVVLFICIYVAGFAW  402

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSEIFPLEIRSAGQSI V+VN LFTF++ Q FL MLCH+K+G+F+FFGGWV
Sbjct  403   SWGPLGWLVPSEIFPLEIRSAGQSINVSVNMLFTFIIAQAFLTMLCHMKFGLFYFFGGWV  462

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              +MT FV L LPETKN+PIE+M LVW+ HWFW K +
Sbjct  463   VIMTIFVALFLPETKNVPIEEMILVWKAHWFWGKFI  498



>ref|XP_010905564.1| PREDICTED: sugar carrier protein C-like [Elaeis guineensis]
Length=521

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/456 (61%), Positives = 349/456 (77%), Gaps = 4/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVT+M+PFL +FF  VY K KE+    + YC FDS++L  FTSSLY+A L AS  AS V
Sbjct  45    GGVTTMDPFLSKFFPAVYRKSKENH-STNEYCAFDSQVLQMFTSSLYLAALIASFFASVV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+  GG+ FL GA L G A ++ MLI GR+LLGIGVGFANQ+VP+YLSEMAP
Sbjct  104   TRMFGRKWSMFGGGITFLVGATLNGFAKDILMLILGRILLGIGVGFANQSVPVYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A+ RG +N+ FQL + IG+L ANLINYGT KI+ GWGWR+SLGLAAVPA ++T+G++ LP
Sbjct  164   ARLRGMLNIGFQLMITIGILAANLINYGTSKIKGGWGWRLSLGLAAVPAGIITLGSLFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSLI+R    D A R L+R+RGTDD+ AE +DLVAASE ++ ++ P++NI+ R+YRP
Sbjct  224   DTPNSLIER-GHADEAMRMLRRIRGTDDIHAEYNDLVAASEEAKLVKHPWRNIVARKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QL MA  +P FQQ+TGINVI FYAPVLF+TIG G +AALMSAV+TG V +  T  S+L V
Sbjct  283   QLTMAILIPLFQQLTGINVIMFYAPVLFKTIGFGGNAALMSAVITGLVNVFATVVSILTV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG--GLSKGWAVLVLLLISSYVAGFGL  1156
             DK+GRR+L + GG  M   Q+ VG ++  K G  G   LSK ++  V+  I  YVAGF  
Sbjct  343   DKLGRRKLFLQGGSQMLACQIIVGTLIAIKFGTSGEATLSKTYSAFVVFFICIYVAGFAW  402

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSEIFPLEIRSAGQSI V+VN LFTFL+ Q FL MLCH+K+G+F+FFGGWV
Sbjct  403   SWGPLGWLVPSEIFPLEIRSAGQSINVSVNMLFTFLIAQAFLTMLCHMKFGLFYFFGGWV  462

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              +MTTFV L LPETK++PIE+M LVW+ HWFW K +
Sbjct  463   LIMTTFVALFLPETKSVPIEEMILVWKSHWFWSKFI  498



>gb|EEC84216.1| hypothetical protein OsI_30627 [Oryza sativa Indica Group]
Length=511

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/455 (62%), Positives = 348/455 (76%), Gaps = 3/455 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL +FF +VY +MK  S  VSNYCKFDSELLT+FTSSLYIAGL  + LASSV
Sbjct  46    GGVTSMDGFLSKFFPEVYRRMKGTS--VSNYCKFDSELLTAFTSSLYIAGLLTTFLASSV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T  CGR PS++I G A LAG+A+GG A+NV M+I GRVLLG+G+GF NQAVPLYLSEMAP
Sbjct  104   TARCGRRPSMVIAGSAILAGSAIGGTAVNVSMVILGRVLLGVGLGFGNQAVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
               +RG  +  FQLCVGIG + A L N+ T+KIR GWGWRVSL +AAVP  +LT+GA+ LP
Sbjct  164   PLHRGAFSNGFQLCVGIGAVTARLTNFFTQKIRQGWGWRVSLAVAAVPGGLLTLGALFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNIL-HRRYR  799
             ETPNSL+Q+  D    +  L  +RG  DV+ EL+D+VAA+       R  + I+  R+YR
Sbjct  224   ETPNSLLQQGRDKRRVRVLLTTIRGVSDVEDELEDIVAANSDKANSSRGLQMIVTQRQYR  283

Query  800   PQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLL  979
             PQLVMA  +PFFQQVTGIN I+FYAPVL RTIG+GE+A+L+S VVTG VG  +TF SM L
Sbjct  284   PQLVMAIMIPFFQQVTGINAISFYAPVLLRTIGMGENASLLSVVVTGLVGTSSTFVSMFL  343

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
             VD+ GRR L +VGG  M V+Q+ +GG+M  +LGD G +SK  A++++ LI+ YVAGF  S
Sbjct  344   VDRFGRRTLFLVGGAQMLVSQLMIGGIMATQLGDHGQVSKTCALVLIFLIAVYVAGFAWS  403

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPLGWL+PSE+FPLE+RSAGQSITVAVNFL T  V Q FLA LC ++ GIFFFF  W+ 
Sbjct  404   WGPLGWLVPSEVFPLEVRSAGQSITVAVNFLMTTAVAQLFLATLCRMRAGIFFFFAAWLV  463

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              MT FVYLLLPETK LPIE++  +W +HWFW++ V
Sbjct  464   AMTAFVYLLLPETKGLPIEQVRRLWAQHWFWRRFV  498



>gb|EPS60332.1| hypothetical protein M569_14469, partial [Genlisea aurea]
Length=497

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/455 (63%), Positives = 354/455 (78%), Gaps = 2/455 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+PFL+ FF  V  KMK D+  +SNYCKFDS+LLT FTSSLYIAGL +S LAS V
Sbjct  44    GGVTSMDPFLEEFFPGVRRKMKGDA-NLSNYCKFDSQLLTCFTSSLYIAGLISSFLASPV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T   GR PSI+IGG+ +L G+ +GGAA N+YMLI GR+LLG+G+GF NQ+VPLY+SEMAP
Sbjct  103   TGKYGRRPSIVIGGICYLLGSGIGGAAFNIYMLILGRLLLGVGLGFTNQSVPLYVSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A YRG  NVSFQ+CV IG   A LINYGT KIR GWGWR+S+ +A V A +LT+GA+ LP
Sbjct  163   ANYRGAFNVSFQICVSIGYTSATLINYGTSKIRGGWGWRISVAMAGVLAMMLTVGALFLP  222

Query  623   ETPNSLIQRRN-DHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYR  799
             ETPNSL++  + +HD A+R L+++RGTDDV+ E  DLV AS  ++ I+ PF+N+L R+YR
Sbjct  223   ETPNSLLKISDANHDEARRVLKKIRGTDDVEEEFADLVNASSAAKKIKHPFRNMLKRKYR  282

Query  800   PQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLL  979
             PQLVM+  +PFFQQVTGINVIAFY P+LFRT+G  ESA+L +A + G VG   T  + + 
Sbjct  283   PQLVMSVLIPFFQQVTGINVIAFYTPILFRTVGAAESASLFAATLAGIVGFTFTVIAGIS  342

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
             VD+ GRR L +VGGILM V Q  VG +M AKL D G + K +A+ +LL    YVAGFGLS
Sbjct  343   VDRFGRRPLFLVGGILMLVCQSLVGVLMSAKLTDHGAMPKSYALAILLSTCVYVAGFGLS  402

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPLGW++P+EIFPLEIR+AGQSI VAVN L TF++ Q FLAMLCHLK GIFFFF  WV 
Sbjct  403   WGPLGWVVPAEIFPLEIRAAGQSIVVAVNLLLTFVIAQAFLAMLCHLKSGIFFFFAAWVL  462

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              M+ FVYLLLPETK +PIEKMD +W EH+FWK+ +
Sbjct  463   TMSIFVYLLLPETKGIPIEKMDKIWAEHFFWKRFI  497



>gb|ACF85014.1| unknown [Zea mays]
Length=461

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/437 (64%), Positives = 340/437 (78%), Gaps = 5/437 (1%)
 Frame = +2

Query  143   MKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSVTRACGRTPSiliggvaflag  322
             MK D   VSNYC+FDSELLT FTSSLYIAGL A+L ASSVTR  GR  SILIGG  F+ G
Sbjct  1     MKGDK-DVSNYCRFDSELLTVFTSSLYIAGLVATLFASSVTRRFGRRTSILIGGTVFVIG  59

Query  323   aalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAPAKYRGGMNVSFQLCVGIGVL  502
             +  GGAA+NVYML+  R+LLG+G+GF NQ++PLYLSEMAP +YRG +N  F+LC+ IG+L
Sbjct  60    SVFGGAAVNVYMLLLNRILLGVGLGFTNQSIPLYLSEMAPPQYRGAINNGFELCISIGIL  119

Query  503   IANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLPETPNSLIQRR---NDHDGAK  673
             IANLINYG EKI  GWGWR+SL LAAVPA  LT+GA+ LPETP+ +IQRR   N+ D A+
Sbjct  120   IANLINYGVEKIAGGWGWRISLSLAAVPAAFLTVGAIYLPETPSFIIQRRGGSNNVDEAR  179

Query  674   RRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRPQLVMAFAVPFFQQVTGI  853
               LQR+RGT  VQ ELDDLV+A+  + T  RPF+ IL R+YRPQLV+A  VPFF QVTGI
Sbjct  180   LLLQRLRGTTRVQKELDDLVSATRTT-TTGRPFRTILRRKYRPQLVIALLVPFFNQVTGI  238

Query  854   NVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLVDKVGRRRLLIVGGILMF  1033
             NVI FYAPV+FRTIGL ESA+LMSAVVT          +M++VD+ GRR+L +VGG+ M 
Sbjct  239   NVINFYAPVMFRTIGLKESASLMSAVVTRVCATAANVVAMVVVDRFGRRKLFLVGGVQMI  298

Query  1034  VTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSWGPLGWLIPSEIFPLEIR  1213
             ++Q  VG V+ AK  + GG+ K +A LVL+++  +VAGF  SWGPL +L+P+EI PLEIR
Sbjct  299   LSQAMVGAVLAAKFQEHGGMEKEYAYLVLVIMCVFVAGFAWSWGPLTYLVPTEICPLEIR  358

Query  1214  SAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAVMTTFVYLLLPETKNLPI  1393
             SAGQS+ +AV F  TFL+GQTFLAMLCHLK+G FF FGGWV VMT FVY  LPETK LP+
Sbjct  359   SAGQSVVIAVIFFVTFLIGQTFLAMLCHLKFGTFFLFGGWVCVMTLFVYFFLPETKQLPM  418

Query  1394  EKMDLVWREHWFWKKIV  1444
             E+M+ VWR HWFWK+IV
Sbjct  419   EQMEQVWRTHWFWKRIV  435



>ref|NP_001105681.1| monosaccharide transporter1 [Zea mays]
 gb|AAT90503.1| monosaccharide transport protein 1 [Zea mays]
 gb|ACG28751.1| sugar transport protein 1 [Zea mays]
Length=523

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/456 (60%), Positives = 353/456 (77%), Gaps = 5/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM PFL++FF +VY K +E   K + YCK+D++LL +FTSSLY+A L AS  A++V
Sbjct  45    GGVTSMNPFLEKFFPEVYRKKQE--AKTNQYCKYDNQLLQTFTSSLYLAALVASFFAATV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR  S+L+GG+ FL GAAL GAA N+ MLI GR+LLG+GVGFANQ+VP+YLSEMAP
Sbjct  103   TRAVGRKWSMLVGGLTFLVGAALNGAAQNIAMLIIGRILLGVGVGFANQSVPVYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A+ RG +N+ FQL + IG+L A LINYGT KI+ G+GWRVSL LAAVPA ++T+G++ LP
Sbjct  163   ARLRGMLNIGFQLMITIGILAAELINYGTNKIKAGYGWRVSLALAAVPAAIITLGSLFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSL++R +  + A+R L+R+RGTDD+  E  DLVAASE +R +  P++NIL RRYR 
Sbjct  223   DTPNSLLERGHPEE-ARRMLRRIRGTDDIGEEYADLVAASEEARQVRHPWRNILRRRYRA  281

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QL MA A+PFFQQ+TGINVI FYAPVLF T+G    A+LMS+V+TG V +  T  S++ V
Sbjct  282   QLTMAVAIPFFQQLTGINVIMFYAPVLFDTLGFKNDASLMSSVITGLVNVFATVVSIVTV  341

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG--GLSKGWAVLVLLLISSYVAGFGL  1156
             D+VGRR+L + GG  M V Q+ VG ++ AK G  G   ++KG+A +V++ I +YVAGF  
Sbjct  342   DRVGRRKLFLQGGAQMIVCQLIVGTLIAAKFGTSGTGDIAKGYAAVVVVFICAYVAGFAW  401

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSEIFPLEIR AGQSI V+VN  FTF + Q FL MLCH K+G+F+FF GWV
Sbjct  402   SWGPLGWLVPSEIFPLEIRPAGQSINVSVNMFFTFCIAQAFLTMLCHFKFGLFYFFAGWV  461

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              +MT F+   LPETKN+PIE+M LVW+ HWFWK+ +
Sbjct  462   VIMTVFIAFFLPETKNVPIEEMVLVWKSHWFWKRFI  497



>gb|ACN34678.1| unknown [Zea mays]
 tpg|DAA59348.1| TPA: monosaccharide transport protein 1Sugar transport protein 
1 [Zea mays]
Length=523

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/456 (60%), Positives = 353/456 (77%), Gaps = 5/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM PFL++FF +VY K +E   K + YCK+D++LL +FTSSLY+A L AS  A++V
Sbjct  45    GGVTSMNPFLEKFFPEVYRKKQE--AKTNQYCKYDNQLLQTFTSSLYLAALVASFFAATV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR  S+L+GG+ FL GAAL GAA N+ MLI GR+LLG+GVGFANQ+VP+YLSEMAP
Sbjct  103   TRAVGRKWSMLVGGLTFLVGAALNGAAQNIAMLIVGRILLGVGVGFANQSVPVYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A+ RG +N+ FQL + IG+L A LINYGT KI+ G+GWRVSL LAAVPA ++T+G++ LP
Sbjct  163   ARLRGMLNIGFQLMITIGILAAELINYGTNKIKAGYGWRVSLALAAVPAAIITLGSLFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSL++R +  + A+R L+R+RGTDD+  E  DLVAASE +R +  P++NIL RRYR 
Sbjct  223   DTPNSLLERGHPEE-ARRMLRRIRGTDDIGEEYADLVAASEEARQVRHPWRNILRRRYRA  281

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QL MA A+PFFQQ+TGINVI FYAPVLF T+G    A+LMS+V+TG V +  T  S++ V
Sbjct  282   QLTMAVAIPFFQQLTGINVIMFYAPVLFDTLGFKNDASLMSSVITGLVNVFATVVSIVTV  341

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG--GLSKGWAVLVLLLISSYVAGFGL  1156
             D+VGRR+L + GG  M V Q+ VG ++ AK G  G   ++KG+A +V++ I +YVAGF  
Sbjct  342   DRVGRRKLFLQGGAQMIVCQLIVGTLIAAKFGTSGTGDIAKGYAAVVVVFICAYVAGFAW  401

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSEIFPLEIR AGQSI V+VN  FTF + Q FL MLCH K+G+F+FF GWV
Sbjct  402   SWGPLGWLVPSEIFPLEIRPAGQSINVSVNMFFTFCIAQAFLTMLCHFKFGLFYFFAGWV  461

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              +MT F+   LPETKN+PIE+M LVW+ HWFWK+ +
Sbjct  462   VIMTVFIAFFLPETKNVPIEEMVLVWKSHWFWKRFI  497



>ref|NP_001048652.1| Os03g0101300 [Oryza sativa Japonica Group]
 gb|ABF93479.1| Hexose carrier protein HEX6, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF10566.1| Os03g0101300 [Oryza sativa Japonica Group]
 gb|EAY88173.1| hypothetical protein OsI_09614 [Oryza sativa Indica Group]
 gb|EAZ25252.1| hypothetical protein OsJ_09056 [Oryza sativa Japonica Group]
 dbj|BAG91661.1| unnamed protein product [Oryza sativa Japonica Group]
Length=519

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/455 (64%), Positives = 355/455 (78%), Gaps = 1/455 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF DVY +MK D  KVSNYC+FDSELLT FTSSLYIAGL A+L+ASSV
Sbjct  44    GGVTSMEPFLKKFFPDVYHQMKGDKKKVSNYCRFDSELLTVFTSSLYIAGLVATLVASSV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  SILIGG  F+AG+  GGAA+N+YMLI  RVLLGIG+GF NQ++PLYLSEMAP
Sbjct  104   TRRFGRRASILIGGSVFVAGSVFGGAAVNIYMLILNRVLLGIGLGFTNQSIPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              ++RG +N  F+LC+ IG+LIANLINYG +KI  GWGWR+SL +AAVPA  LT+GA+ LP
Sbjct  164   PQHRGAINNGFELCISIGILIANLINYGVDKIEGGWGWRISLSMAAVPAAFLTVGALFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETP+ +IQR  D D A+  LQR+RGT  V  EL+DLV ASE+S+TI  P +N+L RRYRP
Sbjct  224   ETPSFVIQRSGDVDSARALLQRLRGTAAVHKELEDLVMASEVSKTIRHPLRNMLRRRYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLV+A  VP F QVTGINVI FYAPV+FRTIGL ESA+LMSAVVT          +M +V
Sbjct  284   QLVIAVLVPLFNQVTGINVINFYAPVMFRTIGLRESASLMSAVVTRVCATAANVVAMAVV  343

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG-GLSKGWAVLVLLLISSYVAGFGLS  1159
             D++GRRRLL+VGG+ M V+Q+ VG ++  K  + G  + K +A LVL ++  +VAGF  S
Sbjct  344   DRLGRRRLLLVGGVQMLVSQVMVGAILAGKFREHGEEMEKEYAYLVLSVMCVFVAGFAWS  403

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPL +L+P+EI PLE+RSAGQSI +AV FL TFL+GQTFLAMLCHLK+  FF F   + 
Sbjct  404   WGPLTYLVPAEICPLEVRSAGQSIVIAVIFLLTFLIGQTFLAMLCHLKFATFFLFAACLC  463

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             VMT FV+  LPETK LP+E+MD +WR HWFWK+IV
Sbjct  464   VMTLFVFFFLPETKQLPMEQMDQLWRTHWFWKRIV  498



>gb|ADK62370.1| hexose carrier [Triticum aestivum]
Length=504

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/456 (64%), Positives = 360/456 (79%), Gaps = 3/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGV+SMEPFL++FF +VY +MK DS  VSNYCKFDS++LT+FTSSLY+AGL  + LAS V
Sbjct  46    GGVSSMEPFLRKFFPEVYRRMKGDS-HVSNYCKFDSQMLTAFTSSLYVAGLLTTFLASGV  104

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T   GR PS+L+GG AFLAGAA+GG+++NVYM I GRVLLG+G+GFANQAVPLYLSEMAP
Sbjct  105   TARLGRRPSMLLGGAAFLAGAAVGGSSLNVYMAILGRVLLGVGLGFANQAVPLYLSEMAP  164

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              ++RG  +  FQ  VG+G L AN+IN+GTEKI+ GWGWRVSL LAAVPA +L +GAV LP
Sbjct  165   PRHRGAFSNGFQFSVGVGALAANVINFGTEKIKGGWGWRVSLSLAAVPAGLLLVGAVFLP  224

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNIL--HRRY  796
             ETPNSL+Q+  D       L+++RG  DV  ELD +VAA++ +         +L   RRY
Sbjct  225   ETPNSLVQQGKDRRDVALLLRKIRGIHDVDHELDGIVAAADSATAAGSSGLRMLLTQRRY  284

Query  797   RPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASML  976
             RPQLVMA A+PFFQQVTGIN IAFYAPVL RTIG+GESA+L+S+VVTG VG  +T  SM 
Sbjct  285   RPQLVMAVAIPFFQQVTGINAIAFYAPVLLRTIGMGESASLLSSVVTGVVGAASTLLSMF  344

Query  977   LVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGL  1156
             LVD+ GRR L + GG  M  +Q+ +G +M AKLGD GG+SKGWA  ++ LI+ YVAGFG 
Sbjct  345   LVDRFGRRTLFLAGGTQMLGSQLLIGAIMAAKLGDDGGVSKGWAATLIFLIAVYVAGFGW  404

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSEIFPLE+RS+GQ +TVA +F+FT  V QTFLAMLC ++ GIFFFF  W+
Sbjct  405   SWGPLGWLVPSEIFPLEVRSSGQGVTVATSFVFTVFVAQTFLAMLCRMRAGIFFFFAAWL  464

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             A MT FVYLLLPET+ +PIE++D VWREHWFW++++
Sbjct  465   AAMTAFVYLLLPETRGVPIEQVDRVWREHWFWRRVL  500



>ref|NP_001058832.1| Os07g0131600 [Oryza sativa Japonica Group]
 dbj|BAC24924.1| putative hexose carrier protein HEX6 [Oryza sativa Japonica Group]
 dbj|BAD31930.1| putative hexose carrier protein HEX6 [Oryza sativa Japonica Group]
 dbj|BAF20746.1| Os07g0131600 [Oryza sativa Japonica Group]
 dbj|BAG90852.1| unnamed protein product [Oryza sativa Japonica Group]
Length=524

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/458 (60%), Positives = 339/458 (74%), Gaps = 3/458 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL+RFF +VY +M     +VSNYC+FDS+LLT+FTSSLY++GL  + LAS V
Sbjct  48    GGVTSMDAFLERFFPEVYRRMHGGGERVSNYCRFDSQLLTAFTSSLYVSGLATTFLASHV  107

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T   GR  S+L+ G A  AGA +G +A  +  +I GRVLLG+GVGF NQAVPLYLSEMAP
Sbjct  108   TARRGRRASMLVAGAAIAAGATVGASAAGLATVILGRVLLGVGVGFGNQAVPLYLSEMAP  167

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
                RG  +  FQLCV +G  +A LIN+G EKI  GWGWRVSL +AAVPA  L +GAV LP
Sbjct  168   PSRRGAFSNGFQLCVSVGAFVAQLINFGAEKIAGGWGWRVSLAVAAVPAAFLAVGAVFLP  227

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDD--VQAELDDLVAASEISRTIERPFKNIL-HRR  793
             ETPNSL+Q+  DH   +  L ++RG+D   V  ELDD+VAA     T  R    +L HRR
Sbjct  228   ETPNSLVQQGEDHGKVRALLSKIRGSDGAGVDDELDDIVAADRCKVTARRGLTLMLTHRR  287

Query  794   YRPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASM  973
             YRPQLVMA  +PFFQQ+TGIN IAFYAPVL RT+G+GESAAL++ V+   VGI  T ASM
Sbjct  288   YRPQLVMAVMIPFFQQMTGINAIAFYAPVLLRTVGMGESAALLAVVIKQVVGIGATLASM  347

Query  974   LLVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFG  1153
             L VD+ GRR L + GG  M ++Q+ +G +M A+LGD G LS+  A+L+++L++ YVAGF 
Sbjct  348   LAVDRFGRRTLFLAGGAQMVISQLLIGAIMAAQLGDDGELSQASALLLIVLVAVYVAGFA  407

Query  1154  LSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGW  1333
              SWGPLGWL+PSEIFPLE+RSAGQSI VAVNFL T  V Q+FLAMLCH+K GIFFFF  W
Sbjct  408   WSWGPLGWLVPSEIFPLEVRSAGQSIAVAVNFLLTTAVAQSFLAMLCHMKAGIFFFFAAW  467

Query  1334  VAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIVV  1447
             +  MT FVYLLLPETK LPIE++  +W  HWFW++ VV
Sbjct  468   LVAMTAFVYLLLPETKGLPIEQVGKLWARHWFWRRFVV  505



>gb|EAZ02666.1| hypothetical protein OsI_24778 [Oryza sativa Indica Group]
 gb|EAZ38575.1| hypothetical protein OsJ_22963 [Oryza sativa Japonica Group]
Length=522

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/458 (60%), Positives = 338/458 (74%), Gaps = 3/458 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL+RFF +VY +M     +VSNYC+FDS+LLT+FTSSLY+AGL  + LAS V
Sbjct  47    GGVTSMDAFLERFFPEVYRRMHGGGERVSNYCRFDSQLLTAFTSSLYVAGLATTFLASHV  106

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T   GR  S+L+ G A  AGA +G +A  +  +I GRVLLG+GVGF NQAVPLYLSEMAP
Sbjct  107   TARRGRRASMLVAGAAIAAGATVGASAAGLATVILGRVLLGVGVGFGNQAVPLYLSEMAP  166

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
                RG  +  FQLCV +G  +A LIN+G EKI  GWGWRVSL +AAVPAT L +GAV LP
Sbjct  167   PSRRGAFSNGFQLCVSVGAFVAQLINFGAEKIAGGWGWRVSLAVAAVPATFLAVGAVFLP  226

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDD--VQAELDDLVAASEISRTIERPFKNIL-HRR  793
             ETPNSL+Q+  DH   +  L ++RG+D   V  ELDD+VAA     T  R    +L  RR
Sbjct  227   ETPNSLVQQGEDHGKVRALLSKIRGSDGTGVDDELDDIVAADRCKVTARRGLTLMLTRRR  286

Query  794   YRPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASM  973
             YRPQLVMA  +PFFQQ+TGIN IAFYAPVL RT+G+GESAAL++ V+   VG+  T ASM
Sbjct  287   YRPQLVMAVMIPFFQQMTGINAIAFYAPVLLRTVGMGESAALLAVVIKQVVGVGATLASM  346

Query  974   LLVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFG  1153
             L VD+ GRR L + GG  M V+Q+ +G +M A+LGD G LS+  A+L++ L++ YVAGF 
Sbjct  347   LAVDRFGRRTLFLAGGAQMVVSQLLIGAIMAAQLGDDGELSQASALLLIALVAVYVAGFA  406

Query  1154  LSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGW  1333
              SWGPLGWL+PSEIFPLE+RSAGQSI VAVNFL T  V Q+FLAMLCH+K GIFFFF  W
Sbjct  407   WSWGPLGWLVPSEIFPLEVRSAGQSIAVAVNFLLTTAVAQSFLAMLCHMKAGIFFFFAAW  466

Query  1334  VAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIVV  1447
             +  MT FVYLLLPETK LPIE++  +W  HWFW++ VV
Sbjct  467   LVAMTAFVYLLLPETKGLPIEQVGKLWARHWFWRRFVV  504



>ref|XP_007038316.1| Major facilitator superfamily protein, putative [Theobroma cacao]
 gb|EOY22817.1| Major facilitator superfamily protein, putative [Theobroma cacao]
Length=452

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/456 (60%), Positives = 329/456 (72%), Gaps = 60/456 (13%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK FF  VY+KM++D+ ++SNYCKFDS+LLT FTSSLYIA LF    ASSV
Sbjct  44    GGVTSMEPFLKAFFSQVYSKMEQDT-EISNYCKFDSQLLTIFTSSLYIADLF----ASSV  98

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQA--VPLYLSEM  436
             TRA GR PS                            +L+G     A  A  VPLY+SEM
Sbjct  99    TRAFGRKPS----------------------------ILVGGASFLAGSALGVPLYISEM  130

Query  437   APAKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVV  616
             A  ++RG MN+ F++ VG GVL+ANL+N+GTEKI+ GWGWR+SL +AAVPA ++T+  + 
Sbjct  131   ALPRHRGAMNIGFEVGVGFGVLVANLVNFGTEKIKGGWGWRISLAVAAVPAAIVTLSTLF  190

Query  617   LPETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRY  796
             LPETPNSLIQ+ N+H  AK  LQRVRGT DVQAELDDL+ AS  S+T++ PFK I+ ++Y
Sbjct  191   LPETPNSLIQQSNNHQKAKHVLQRVRGTTDVQAELDDLIKASSNSKTMKHPFKKIVQKQY  250

Query  797   RPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASML  976
             RPQ VM+ A+PFFQQVTGINVI FYAP+LFRT GLG+                       
Sbjct  251   RPQFVMSIAIPFFQQVTGINVITFYAPILFRTTGLGK-----------------------  287

Query  977   LVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGL  1156
               +K GRR L +VGG LMFV+Q+ VGG+M A LGDQG LS+G A LVL+LI  YVAGF L
Sbjct  288   --NKFGRRALFMVGGALMFVSQIVVGGIMTAMLGDQGALSQGCAYLVLILICIYVAGFSL  345

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSEI+PLEIRSAGQSITVA+ FL  FLVGQTFLAMLC +K GI FFFGGWV
Sbjct  346   SWGPLGWLVPSEIYPLEIRSAGQSITVAIGFLLCFLVGQTFLAMLCRMKSGILFFFGGWV  405

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             AVMT FV+ LLPET N+P E+M+ VWREHWFW++ V
Sbjct  406   AVMTAFVHFLLPETMNVPFEQMEKVWREHWFWRRFV  441



>dbj|BAJ90307.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=510

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/458 (60%), Positives = 349/458 (76%), Gaps = 3/458 (1%)
 Frame = +2

Query  77    SVGGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLF-ASLLA  253
             + GGV+SMEPFL+ FF DV+ +M+  +G V NYCKFDS+LLT FTSSLY++GL  A L+A
Sbjct  43    TAGGVSSMEPFLRDFFPDVHRRMQAGAG-VGNYCKFDSQLLTLFTSSLYVSGLLTAVLVA  101

Query  254   SSVTRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSE  433
             S  T   GR PS+++GG+A+L GAA+ G A+NVYM I GR LLG+G+GFANQAVPLYLSE
Sbjct  102   SWFTERHGRRPSMILGGLAYLGGAAVSGGAVNVYMAILGRALLGVGLGFANQAVPLYLSE  161

Query  434   MAPAKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAV  613
             MAPA+YRG  +  FQ  + +G L A ++NYG EKI+ GWGWR+SLGLA +PA +LT+GA+
Sbjct  162   MAPARYRGAFSNGFQFSLCLGALAATIVNYGAEKIKAGWGWRLSLGLAGLPAVLLTVGAI  221

Query  614   VLPETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNIL-HR  790
              LPETPNSLIQ+       K  LQ++RG D V  ELDD+VAA+   +  +   + IL  R
Sbjct  222   FLPETPNSLIQQGKGLGEVKPLLQKIRGIDAVDKELDDIVAANATGQAGDNGLRMILSQR  281

Query  791   RYRPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFAS  970
             RYRPQL MA  +P F Q+TGIN I FYAPVL RTIG+ ESAAL+S +V   V   +TFAS
Sbjct  282   RYRPQLAMAILIPSFTQLTGINAIGFYAPVLLRTIGMSESAALLSTIVMVIVSSASTFAS  341

Query  971   MLLVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGF  1150
             MLLVD+ GRR LLI+GG+ MF+++M +GG+M AKLGD+G +S+ +AV+++ LI  Y  GF
Sbjct  342   MLLVDRFGRRTLLILGGVQMFLSEMLIGGIMAAKLGDEGQVSRTYAVVLIFLIGVYSTGF  401

Query  1151  GLSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGG  1330
             G SWGPL WL+PSEIFPLE+RSAGQSITVA  F+FT LV Q FLAMLC LK  +FFFF G
Sbjct  402   GWSWGPLSWLVPSEIFPLEVRSAGQSITVASGFVFTILVAQYFLAMLCRLKAWLFFFFAG  461

Query  1331  WVAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             W+ VMT F YL LPETK +PIEK++ +W +HW+WK++V
Sbjct  462   WIVVMTAFAYLFLPETKGIPIEKIENLWGKHWYWKRVV  499



>ref|XP_009385289.1| PREDICTED: sugar carrier protein C-like [Musa acuminata subsp. 
malaccensis]
Length=501

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/457 (60%), Positives = 346/457 (76%), Gaps = 5/457 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL RFF  VY K   DS   + YCKFDS+LLT FTSSLY+A L +S LAS+V
Sbjct  27    GGVTSMDSFLSRFFPSVYKKQMADS-STNQYCKFDSQLLTLFTSSLYVAALLSSFLASTV  85

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+  GG+ FL G+A+  AA+NV MLI GRVLLGIG+G   QAVPLYLSEMAP
Sbjct  86    TRMFGRKWSMFAGGITFLLGSAINCAAMNVLMLILGRVLLGIGIGACVQAVPLYLSEMAP  145

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A  RG +N+ FQ  + IG+  ANLINYGT  I+ GWGWRVSLGLAAVPA  +TIG++VLP
Sbjct  146   ADLRGTLNIGFQFMITIGIFAANLINYGTASIKGGWGWRVSLGLAAVPALFITIGSLVLP  205

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSLI+R +D + AK  L+++RGT+DV+ E DDLVAAS+ +++++ P+ NIL R+YRP
Sbjct  206   DTPNSLIERGHDEE-AKAMLRKIRGTEDVRDEYDDLVAASDEAKSVDHPWSNILQRKYRP  264

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QL +A  +PFFQQ+TGINVI FYAPVLF+TIG G  A+L SAV+TG V +  TF S+  V
Sbjct  265   QLTIAILIPFFQQLTGINVIMFYAPVLFKTIGFGSEASLASAVITGIVNVFATFVSIATV  324

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG---GLSKGWAVLVLLLISSYVAGFG  1153
             DK+GRR L + GG  M ++Q  VG ++  K G  G    ++K +A +++L I  YVA F 
Sbjct  325   DKLGRRALFLQGGTQMLLSQFLVGTLIAFKFGISGVATDVTKNYASIIVLFICFYVAAFA  384

Query  1154  LSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGW  1333
              SWGPLGWL+PSEIFPLEIRSAGQSITV+VN  FTFL+ Q FL  LCHLK+G+F+FF GW
Sbjct  385   WSWGPLGWLVPSEIFPLEIRSAGQSITVSVNMFFTFLIAQVFLTALCHLKFGLFYFFAGW  444

Query  1334  VAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             VA+MT F+   LPETK++PIE++ LVW++HWFW K +
Sbjct  445   VAIMTAFITFFLPETKSVPIEEITLVWKKHWFWSKFI  481



>dbj|BAJ85833.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=514

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/456 (64%), Positives = 362/456 (79%), Gaps = 3/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGV+SMEPFL++FF +VY +MK DS  VSNYCKFDS+LLT+FTSSLY+AGL  + LAS V
Sbjct  47    GGVSSMEPFLRKFFPEVYRRMKGDS-HVSNYCKFDSQLLTAFTSSLYVAGLLTTFLASGV  105

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T   GR PS+L+GG AFLAGAA+GGA++NVYM I GRVLLG+G+GFANQAVPLYLSEMAP
Sbjct  106   TARRGRRPSMLLGGAAFLAGAAVGGASLNVYMAILGRVLLGVGLGFANQAVPLYLSEMAP  165

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              ++RG  +  FQ  VG+G L AN+IN+GTEKI+ GWGWRVSL LAAVPA +L +GAV LP
Sbjct  166   PRHRGAFSNGFQFSVGVGALAANVINFGTEKIKGGWGWRVSLSLAAVPAGLLLVGAVFLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNIL--HRRY  796
             ETPNSL+Q+  D       L+++RGTDDV  ELD +VAA++ ++   R    +L   +RY
Sbjct  226   ETPNSLVQQGKDRRDVALLLRKIRGTDDVDRELDGIVAAADSAKAAGRSGLRMLLTQQRY  285

Query  797   RPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASML  976
             RPQLVMA A+PFFQQVTGIN IAFYAPVL RTIG+GESA+L+S+VVTG VG  +T  SM 
Sbjct  286   RPQLVMAVAIPFFQQVTGINAIAFYAPVLLRTIGMGESASLLSSVVTGVVGAASTLLSMF  345

Query  977   LVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGL  1156
             LVD+ GRR L + GG  M  +Q+ +G ++ AKLGD G +SK WA  ++ LI+ YVAGFG 
Sbjct  346   LVDRFGRRTLFLAGGTQMLASQLMIGAILAAKLGDDGAVSKEWAAALIFLIAVYVAGFGW  405

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSEIFPLE+RSAGQ +TVA +F+FT LV QTFL+MLC ++ GIFFFF  W+
Sbjct  406   SWGPLGWLVPSEIFPLEVRSAGQGVTVATSFVFTVLVAQTFLSMLCRMRAGIFFFFAAWL  465

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             A MT FVYLLLPET+ + IE++D VWREHWFW++++
Sbjct  466   AAMTAFVYLLLPETRGVLIEQVDRVWREHWFWRRVL  501



>ref|XP_004983651.1| PREDICTED: hexose carrier protein HEX6-like [Setaria italica]
Length=516

 Score =   528 bits (1361),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 272/455 (60%), Positives = 350/455 (77%), Gaps = 3/455 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM  FLKRFF +VY + K+DS KVS+YC+F+SELLT FTSSLYIAGL A+L+ASS+
Sbjct  46    GGVTSMNSFLKRFFPEVY-RQKQDS-KVSHYCQFNSELLTLFTSSLYIAGLVATLVASSI  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+LIGG  F+AG+  GGAA+NV ML+  R+LLGIG+GF NQ++PLYLSEMAP
Sbjct  104   TRKFGRRASMLIGGAFFIAGSVFGGAAVNVPMLLLNRILLGIGLGFTNQSIPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              +YRG +N  F+LC+ +G+L AN++NY   KI+ GWGWR+SL +AA+P   LT+GA+ LP
Sbjct  164   PQYRGAINNGFELCLSLGILCANILNYFVVKIKAGWGWRISLSMAALPGAFLTMGAIFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETP+ +IQ   D D A+  LQ++RGT+ VQ ELDDLV+AS +SRT   PF+NI  R+YRP
Sbjct  224   ETPSFIIQHDGDADKARVLLQKLRGTESVQKELDDLVSASNLSRTTRYPFRNIFKRKYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLV+A  +PFF QVTGINVI FYAPV+FRTIGL E+A+L+S+VVT          +++LV
Sbjct  284   QLVIALLIPFFNQVTGINVINFYAPVMFRTIGLKENASLLSSVVTRLCATFANIVAIILV  343

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             D+ GRR+LL+VG I M ++   VG ++ AK  D   + K +A LVL+++S +VAG+G SW
Sbjct  344   DRSGRRKLLLVGNIQMILSLFTVGAILAAKFKDHEEMDKDYAYLVLIIMSVFVAGYGWSW  403

Query  1163  GPLGWLIPSEIFPLEI-RSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             GPL +LIPSE+ PLEI RSAGQSI VAV FL TF++ QTFLA+LC +K   FF FG W+ 
Sbjct  404   GPLTFLIPSEVCPLEISRSAGQSIVVAVTFLMTFVISQTFLAILCRIKSATFFVFGAWIC  463

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             +MT FVY+ LPETK LP+E++  VWR HWFWKKIV
Sbjct  464   LMTLFVYMFLPETKRLPMEQVKHVWRRHWFWKKIV  498



>ref|XP_008800390.1| PREDICTED: sugar carrier protein C-like [Phoenix dactylifera]
Length=521

 Score =   528 bits (1361),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 277/456 (61%), Positives = 346/456 (76%), Gaps = 4/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL +FF  VY K KE+    + YCKFDS++L  FTSSLY+A L AS  AS+V
Sbjct  45    GGVTSMDSFLSKFFPSVYRKEKENQ-STNQYCKFDSQVLQMFTSSLYLAALIASFFASAV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+  GG+ FL GA L G A +V MLI GR+LLGIGVGFA Q+VP+YLSEMAP
Sbjct  104   TRMFGRKWSMFGGGITFLVGATLNGFAQDVLMLILGRILLGIGVGFAGQSVPVYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A+ RG +N+SFQL + IG+L ANLINYGT KI+ GWGWR+SLGLAAVPA ++T+G+++LP
Sbjct  164   ARMRGMLNISFQLMITIGILSANLINYGTSKIKGGWGWRISLGLAAVPAGIITLGSLLLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSLI+R    D A R L R+RGT D+  E  DLVAASE ++ ++ P++NIL R+YRP
Sbjct  224   DTPNSLIER-GHADEAMRMLCRIRGTKDIHEEYSDLVAASEEAKLVKHPWRNILERKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QL+M   +PFFQQ+TGINVI FYAPVLF+TIG G +A+LMSAV+TG V ++ T  S+  V
Sbjct  283   QLIMVILIPFFQQLTGINVIMFYAPVLFKTIGFGGNASLMSAVITGLVNVLATVVSIFTV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG--GLSKGWAVLVLLLISSYVAGFGL  1156
             DK+GRR+L + GG  M   Q+ VG ++  K G  G    SK +A  V+L I  YVAGF  
Sbjct  343   DKLGRRKLFLQGGSQMLACQIIVGTLIAIKFGTSGEANPSKTYAAFVVLFICVYVAGFAW  402

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLG L+PSEIFPLEIRSAGQSI V+VN LFTF++ Q FL MLCH+K+G+F+FFGGWV
Sbjct  403   SWGPLGILVPSEIFPLEIRSAGQSINVSVNMLFTFMIAQAFLTMLCHMKFGLFYFFGGWV  462

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              +MTTFV   LPETKN+PIE+M LVW+ HWFW K +
Sbjct  463   LIMTTFVAFFLPETKNVPIEEMILVWKAHWFWGKFI  498



>ref|XP_010268857.1| PREDICTED: sugar carrier protein C-like [Nelumbo nucifera]
Length=521

 Score =   528 bits (1361),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 283/457 (62%), Positives = 348/457 (76%), Gaps = 5/457 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL +FF  VY K K D  K + YCKFDS+ LT FTSSLY+A L ASL AS++
Sbjct  46    GGVTSMDSFLSKFFPSVYRKEKADQSK-NQYCKFDSQTLTMFTSSLYLAALVASLFASTM  104

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+ +GG+ FLAGAA+  AA+NV MLI GR+LLGIGVGFANQ+VPLYLSEMAP
Sbjct  105   TRKFGRKLSMFLGGLVFLAGAAINAAAVNVAMLIVGRLLLGIGVGFANQSVPLYLSEMAP  164

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
               YRG +N+ FQL + +G+L ANLINYGT KI+ GWGWR+SLG AAVPA ++ +G+  LP
Sbjct  165   YNYRGALNIGFQLMITLGILFANLINYGTAKIKGGWGWRISLGGAAVPAFIIAVGSFFLP  224

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNS+I+R N  + A+  L+R+RGT+DV  E +DLVAASE S+ +E P++ IL R+YRP
Sbjct  225   DTPNSIIER-NMPEKARNMLRRIRGTEDVTEEFNDLVAASEASKLVEHPWRKILQRKYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
              LVMA A+PFFQQ+TGINVI FYAPVLF+TIG    A+LMSAV+TG V +V TF S+L  
Sbjct  284   HLVMAIAIPFFQQLTGINVIMFYAPVLFKTIGFKSDASLMSAVITGLVNVVATFVSILTS  343

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG---GLSKGWAVLVLLLISSYVAGFG  1153
             DK GRR+L + GG  M V Q+AV  ++  K G  G   G+SKG+A +V+  I  YVAGF 
Sbjct  344   DKWGRRKLFLEGGAQMLVCQIAVAILIALKFGTDGQADGISKGYAGVVVFFICVYVAGFA  403

Query  1154  LSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGW  1333
              SWGPLGWL+PSEIFPLEIRSA QSI VAVN LFTF++ Q FL MLCH K+G+F FF GW
Sbjct  404   WSWGPLGWLVPSEIFPLEIRSAAQSINVAVNMLFTFVIAQVFLTMLCHFKFGLFCFFAGW  463

Query  1334  VAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             V VMT FV  LLPETK +PIE+M  VW++HWFW K +
Sbjct  464   VVVMTIFVLFLLPETKGVPIEEMMRVWKQHWFWSKYI  500



>ref|XP_002437798.1| hypothetical protein SORBIDRAFT_10g002770 [Sorghum bicolor]
 gb|EER89165.1| hypothetical protein SORBIDRAFT_10g002770 [Sorghum bicolor]
Length=521

 Score =   526 bits (1356),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 287/462 (62%), Positives = 356/462 (77%), Gaps = 9/462 (2%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGV+SMEPFL++FF DVY +M+ D+ +VSNYCKFDS+LLT+FTSSLY+AGL  + LAS V
Sbjct  46    GGVSSMEPFLRKFFPDVYRRMRGDT-RVSNYCKFDSQLLTAFTSSLYVAGLLTTFLASRV  104

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T   GR  S+++GG AFLAGAA+GGA++N+YM+I GRVLLG+G+GFANQAVPLYLSEMAP
Sbjct  105   TAGRGRKASMVLGGAAFLAGAAVGGASVNIYMVILGRVLLGVGLGFANQAVPLYLSEMAP  164

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A+ RG  +  FQL VGIG L AN+IN+GTEKI  GWGWRVSL LA VPA +LT+GA+ LP
Sbjct  165   ARLRGAFSNGFQLSVGIGALAANVINFGTEKISGGWGWRVSLALAGVPAGLLTLGALFLP  224

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTD-DVQAELDDLVAASEISRTIERPF----KNILH  787
             ETP+SL+Q+  D     R LQ+VRG   DV  ELDD+VAA+              + ++ 
Sbjct  225   ETPSSLVQQGKDRRDVARLLQKVRGAGVDVGDELDDIVAAAAAGEAAGAGGDGLRRLLVE  284

Query  788   RRYRPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavg-ivttF  964
             RRYRPQLVMA A+PFFQQVTGIN IAFYAPVL RTIG+GESA+L+S+ +   V  + +TF
Sbjct  285   RRYRPQLVMAVAIPFFQQVTGINAIAFYAPVLLRTIGMGESASLLSSAMVTGVVGVASTF  344

Query  965   ASMLLVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAV--LVLLLISSY  1138
             ASML VD+ GRR L + GG  M  +Q+ +G +M A+L D GG   G     +++LLI+ Y
Sbjct  345   ASMLAVDRFGRRTLFLAGGAQMLASQVLIGAIMAAELRDSGGGGVGKGWAGVLILLIAVY  404

Query  1139  VAGFGLSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFF  1318
             VAGFG SWGPLGWL+PSEIFPLE+R+AGQS+TVAV+F FT  V Q FL+MLCH+K GIFF
Sbjct  405   VAGFGWSWGPLGWLVPSEIFPLEVRAAGQSVTVAVSFAFTVFVAQAFLSMLCHMKAGIFF  464

Query  1319  FFGGWVAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             FF  W+AVMT FVYLLLPETK +PIE++  VWR HWFW ++V
Sbjct  465   FFAAWLAVMTAFVYLLLPETKGVPIEQVGRVWRAHWFWSRVV  506



>ref|XP_008351458.1| PREDICTED: LOW QUALITY PROTEIN: hexose carrier protein HEX6-like, 
partial [Malus domestica]
Length=362

 Score =   520 bits (1338),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 252/350 (72%), Positives = 293/350 (84%), Gaps = 1/350 (0%)
 Frame = +2

Query  398   FANQAVPLYLSEMAPAKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLA  577
             F NQAVPLYLSEMAP KYRG +N  FQ  VGIGVL ANLINYG+EKI+ GWGWR+SL +A
Sbjct  1     FGNQAVPLYLSEMAPPKYRGAINNGFQFSVGIGVLSANLINYGSEKIKGGWGWRISLAMA  60

Query  578   AVPATVLTIGAVVLPETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRT  757
             AVPA++LT+GA  LP+TPNSLIQ   DH  AK+ LQR+RG +DVQAELDDL+ A+ I + 
Sbjct  61    AVPASMLTLGAFFLPKTPNSLIQHSADHHTAKQMLQRIRGVNDVQAELDDLIKANNIWKN  120

Query  758   IERPFKNILHRRYRPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvt  937
             I+ PFK IL R+YRPQLVMA A+PFFQQVTGINVI+FY+ VLF TIGLGESA+L+S V+T
Sbjct  121   IKHPFKKILERKYRPQLVMAIAIPFFQQVTGINVISFYSAVLFXTIGLGESASLLSVVLT  180

Query  938   gavg-ivttFASMLLVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVL  1114
               V    +TF SML+VDK GRR L + GGI M V+Q+ VGGVM A+LGD+GG+SKG+A L
Sbjct  181   TGVVGTXSTFVSMLIVDKFGRRALFLAGGIQMLVSQIXVGGVMAAQLGDRGGVSKGYAYL  240

Query  1115  VLLLISSYVAGFGLSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLC  1294
             VL+LI  YVAGFG SWGPLGWL+PSEIFPLEIRSAG+SI V VNFLFTF+V QTFLAMLC
Sbjct  241   VLVLICIYVAGFGWSWGPLGWLVPSEIFPLEIRSAGZSINVVVNFLFTFIVAQTFLAMLC  300

Query  1295  HLKYGIFFFFGGWVAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             H K GIFFFFGGWVAVMT FVYL LPETKN PIEKM++VW+EHWFW++IV
Sbjct  301   HFKAGIFFFFGGWVAVMTVFVYLFLPETKNXPIEKMEIVWQEHWFWRRIV  350



>ref|XP_004955303.1| PREDICTED: sugar carrier protein C-like isoform X1 [Setaria italica]
Length=516

 Score =   525 bits (1351),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 272/456 (60%), Positives = 346/456 (76%), Gaps = 5/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+PFL++FF  V+ K KE   K + YCK+D++LL +FTSSLY+A L AS  A++V
Sbjct  45    GGVTSMDPFLEKFFPQVFHKKKEV--KTNQYCKYDNQLLQTFTSSLYLAALVASFFAATV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+  GG+ FL GAAL GAA NV MLI GR+LLG+GVGFANQ+VP+YLSEMAP
Sbjct  103   TRVMGRKWSMFGGGLTFLIGAALNGAAENVAMLIIGRILLGVGVGFANQSVPVYLSEMAP  162

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A+ RG +N+ FQL + IG+L A LINYGT KI+ G+GWRVSL LAAVPA ++T+G++ LP
Sbjct  163   ARLRGMLNIGFQLMITIGILAAELINYGTNKIKAGYGWRVSLALAAVPAGIITLGSLFLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSL++R    D A+R L+R+RGT+D+  E  DLVAASE +R +  P++NI+ RRYR 
Sbjct  223   DTPNSLLER-GHADEARRMLRRIRGTEDIGEEYADLVAASEEARQVRHPWRNIVKRRYRA  281

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QL MA  +PFFQQ+TGINVI FYAPVLF T+G    A+LMS+V+TG V +  T  S+  V
Sbjct  282   QLTMAIMIPFFQQLTGINVIMFYAPVLFETLGFKGDASLMSSVITGLVNVFATVVSIFTV  341

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG--GLSKGWAVLVLLLISSYVAGFGL  1156
             D++GRR L + GG  M + Q+ VG ++ AK G  G   + KG+A +V+L I  YVAGF  
Sbjct  342   DRLGRRALFLQGGAQMIICQVVVGSLIAAKFGTSGIGEMPKGYAAVVVLFICVYVAGFAW  401

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSEIFPLEIR AGQSI V+VN  FTF + Q FL MLCH K+G+F+FFGGWV
Sbjct  402   SWGPLGWLVPSEIFPLEIRPAGQSINVSVNMFFTFCIAQAFLTMLCHFKFGLFYFFGGWV  461

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              +MT F+ L LPETKN+PIE+M LVW+ HWFWKK +
Sbjct  462   VIMTIFIALFLPETKNVPIEEMVLVWKSHWFWKKFI  497



>gb|EMS50017.1| Hexose carrier protein HEX6 [Triticum urartu]
Length=476

 Score =   523 bits (1347),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 259/454 (57%), Positives = 319/454 (70%), Gaps = 50/454 (11%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSME FLK+FF DVY +M  D   VSNYC+FDSELLT FTSSLY+AGL A+LL    
Sbjct  47    GGVTSMESFLKKFFPDVYHQMNGDKAAVSNYCRFDSELLTVFTSSLYVAGLVATLL----  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
                                                           A+ ++PLYLSEMAP
Sbjct  103   ----------------------------------------------ASTSIPLYLSEMAP  116

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              +YRG +N  F+LC+ IG+LIAN+INYG +KI  GWGWR+SL +AAVPA  LTIGA+ LP
Sbjct  117   PQYRGAINNGFELCISIGILIANVINYGVQKIEGGWGWRISLSMAAVPAAFLTIGAIFLP  176

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETP+ LIQR  + D AK  LQR+RGT  VQ ELDDLV AS ISR I+ P++NIL ++YRP
Sbjct  177   ETPSFLIQRDGNVDEAKMMLQRLRGTTGVQKELDDLVTASNISRAIKNPYRNILKKKYRP  236

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLV+A  +PFF QVTGINVI FYAPV+FRTIGLGESAALMSAVVT     V    +M++V
Sbjct  237   QLVIALLIPFFNQVTGINVINFYAPVMFRTIGLGESAALMSAVVTRLCATVANIVAMIVV  296

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK GRR+LL+VGG+ M ++Q  VG ++  K  D G + K +  LVL+++  +VAGF  SW
Sbjct  297   DKFGRRKLLLVGGVQMILSQFTVGAILAVKFKDHGVMDKEYGYLVLIIMCVFVAGFAWSW  356

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPL +L+P+EI PLEIRSAGQS+ +AV FL TF++GQTFL MLCHLK+G FF FGGWV V
Sbjct  357   GPLTYLVPTEICPLEIRSAGQSVVIAVIFLMTFVIGQTFLNMLCHLKFGTFFLFGGWVCV  416

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FV+  LPETK LP+E+M+ VWR+HWFWK+I+
Sbjct  417   MTLFVFFFLPETKQLPMEQMEQVWRKHWFWKRII  450



>ref|NP_001058704.1| Os07g0106200 [Oryza sativa Japonica Group]
 dbj|BAB19864.1| monosaccharide transporter 3 [Oryza sativa]
 dbj|BAC10381.1| putative monosaccharide transport protein MST1 [Oryza sativa 
Japonica Group]
 dbj|BAD31944.1| putative monosaccharide transport protein MST1 [Oryza sativa 
Japonica Group]
 dbj|BAF20618.1| Os07g0106200 [Oryza sativa Japonica Group]
 gb|EAZ02492.1| hypothetical protein OsI_24597 [Oryza sativa Indica Group]
 gb|EAZ38424.1| hypothetical protein OsJ_22802 [Oryza sativa Japonica Group]
 dbj|BAG95854.1| unnamed protein product [Oryza sativa Japonica Group]
Length=518

 Score =   525 bits (1351),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 272/457 (60%), Positives = 351/457 (77%), Gaps = 5/457 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+PFL++FF +VY K K+ + K + YCK+D++LL +FTSSLY+A L +S  A++V
Sbjct  45    GGVTSMDPFLRKFFPEVYRK-KQMADKNNQYCKYDNQLLQTFTSSLYLAALVSSFFAATV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+  GG+ FL GAAL GAA NV MLI GR+LLG+GVGFANQ+VP+YLSEMAP
Sbjct  104   TRVLGRKWSMFAGGLTFLIGAALNGAAENVAMLIVGRILLGVGVGFANQSVPVYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A+ RG +N+ FQL + IG+L A LINYGT KI+ GWGWRVSL LAAVPA ++T+G++ LP
Sbjct  164   ARLRGMLNIGFQLMITIGILAAELINYGTAKIKAGWGWRVSLALAAVPAAIITLGSLFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTD-DVQAELDDLVAASEISRTIERPFKNILHRRYR  799
             +TPNSLI R +  + A+R L+R+RG+D DV  E  DLVAASE S+ ++ P++NIL R+YR
Sbjct  224   DTPNSLIDRGHP-EAAERMLRRIRGSDVDVSEEYADLVAASEESKLVQHPWRNILRRKYR  282

Query  800   PQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLL  979
              QL MA  +PFFQQ+TGINVI FYAPVLF T+G    A+LMSAV+TG V +  T  S+  
Sbjct  283   AQLTMAICIPFFQQLTGINVIMFYAPVLFDTLGFKSDASLMSAVITGLVNVFATLVSIFT  342

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG--GLSKGWAVLVLLLISSYVAGFG  1153
             VD++GRR+L + GG  M V Q+ VG ++  K G  G   + KG+A +V+L I  YVAGF 
Sbjct  343   VDRLGRRKLFLQGGAQMVVCQVVVGTLIAVKFGTSGIGDIPKGYAAVVVLFICMYVAGFA  402

Query  1154  LSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGW  1333
              SWGPLGWL+PSEIFPLEIR AGQSI V+VN LFTF++ Q FL MLCH+K+G+F+FF GW
Sbjct  403   WSWGPLGWLVPSEIFPLEIRPAGQSINVSVNMLFTFVIAQAFLTMLCHMKFGLFYFFAGW  462

Query  1334  VAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             V +MT F+ L LPETKN+PIE+M LVW+ HWFW++ +
Sbjct  463   VVIMTVFIALFLPETKNVPIEEMVLVWKSHWFWRRFI  499



>gb|EMT31642.1| Sugar carrier protein C [Aegilops tauschii]
Length=526

 Score =   524 bits (1350),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 288/457 (63%), Positives = 348/457 (76%), Gaps = 4/457 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSN-YCKFDSELLTSFTSSLYIAGLFASLLASS  259
             GGVTSM PFL +FF  VY K +E     SN YCKFDS+LLT FTSSLY+A L AS  A++
Sbjct  45    GGVTSMNPFLMKFFPGVYHKEQEAERNQSNQYCKFDSQLLTMFTSSLYLAALVASFFAAT  104

Query  260   VTRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMA  439
             VTR  GR  S+  GGV FL GAAL GAA NV MLI GRVLLGIGVGFANQ+VP+YLSEMA
Sbjct  105   VTRVAGRKWSMFAGGVTFLVGAALNGAAKNVLMLILGRVLLGIGVGFANQSVPVYLSEMA  164

Query  440   PAKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVL  619
             PA+ RG +N+ FQL V IG+L ANLINYGT KI+ GWGWRVSL LAAVPA ++ IGA+ L
Sbjct  165   PARLRGMLNIGFQLMVTIGILCANLINYGTAKIKGGWGWRVSLALAAVPAGIIAIGALFL  224

Query  620   PETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYR  799
             P+TPNSLI R    D AK+ L+RVRGTDD++ E  DLVAASE S+ +  P++NIL RRYR
Sbjct  225   PDTPNSLIDRGYTED-AKKMLRRVRGTDDIEEEYSDLVAASEESKLVSHPWRNILQRRYR  283

Query  800   PQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLL  979
             PQL  A A+PFFQQ+TGINVI FYAPVLF+T+G  + A+LMSAV+TG V +  TF S++ 
Sbjct  284   PQLTFAIAIPFFQQLTGINVIMFYAPVLFKTLGFADDASLMSAVITGLVNVFATFVSIVT  343

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG--GLSKGWAVLVLLLISSYVAGFG  1153
             VD++GRR+L + GG  M   Q+ VG ++GAK G  G   + KG+A  V+L I +YVAGF 
Sbjct  344   VDRLGRRKLFLQGGTQMLACQIVVGSLIGAKFGFTGVADIPKGYAAFVVLFICAYVAGFA  403

Query  1154  LSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGW  1333
              SWGPLGWL+PSEIFPLEIRSAGQSITV++N L TF++ Q FL MLC  K+ +FFFFG W
Sbjct  404   WSWGPLGWLVPSEIFPLEIRSAGQSITVSMNMLCTFIIAQAFLPMLCRFKFMLFFFFGAW  463

Query  1334  VAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             V VMT FV   LPETKN+PIE+M LVW+ HW+W + +
Sbjct  464   VVVMTLFVAFFLPETKNVPIEEMVLVWKAHWYWGRFI  500



>ref|XP_008797206.1| PREDICTED: sugar transport protein 4-like [Phoenix dactylifera]
Length=507

 Score =   523 bits (1348),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 278/456 (61%), Positives = 347/456 (76%), Gaps = 3/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM  FL++FF  VY   K      + +C FDS+LLT+FTSSLYIAGL ++  AS+V
Sbjct  45    GGVTSMNVFLEKFFPSVYEDQKNAGTSKNQWCSFDSQLLTAFTSSLYIAGLISTFFASTV  104

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+L GG AFL G+AL GAA+NV MLI GRVLLG+G+GFANQAVPLYLSEMAP
Sbjct  105   TRVLGRKASMLCGGAAFLIGSALNGAAVNVAMLIIGRVLLGVGIGFANQAVPLYLSEMAP  164

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              K RG +N+ FQL   IG+LIANL+NYGT KI+ G+GWR+SL LAAVPA ++TIGA+ LP
Sbjct  165   PKLRGALNIGFQLATTIGILIANLVNYGTNKIKGGYGWRISLALAAVPAGIMTIGALFLP  224

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSLI+R    + A+R LQ+ RGTDDV  EL D+V AS+ +  +  P+KNIL + YRP
Sbjct  225   DTPNSLIER-GKLETARRILQKARGTDDVGEELQDMVEASQAAGQVRHPWKNILQKHYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMAF +P FQQ+TGIN+I FYAPVLF+TIG G++A+LMSAV+TG V +  T  S+  V
Sbjct  284   QLVMAFFIPGFQQLTGINIIMFYAPVLFKTIGFGDNASLMSAVITGLVNVGATLVSIATV  343

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG--GLSKGWAVLVLLLISSYVAGFGL  1156
             D+ GRR L I GG  M ++Q+A+  ++G K G  G   +SK +A  VL+LI +YVA F  
Sbjct  344   DRFGRRFLFIEGGAQMLLSQVAIAVILGVKFGADGTGAMSKPYADAVLVLICTYVAAFAW  403

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSEIFPLEIRSAGQSI V+VNFL+TFLV Q FL  LCHLK+G+F  F  +V
Sbjct  404   SWGPLGWLVPSEIFPLEIRSAGQSIVVSVNFLWTFLVAQFFLLALCHLKFGLFLLFAAFV  463

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
               MT F+ LLLPETKN+PIE+M++VW++HW WK  V
Sbjct  464   IAMTLFIVLLLPETKNVPIEEMNVVWKKHWCWKNYV  499



>ref|XP_006661064.1| PREDICTED: hexose carrier protein HEX6-like [Oryza brachyantha]
Length=518

 Score =   524 bits (1349),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 275/455 (60%), Positives = 344/455 (76%), Gaps = 3/455 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL++FF DVY +M+  S  VSNYCKFDSELLT+FTSSLYIAGL  + LAS V
Sbjct  47    GGVTSMDGFLRKFFPDVYRRMEGTS--VSNYCKFDSELLTAFTSSLYIAGLVTTFLASWV  104

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T  CGR PS+++ G A LAG+A+GG A+N+ M+I GRVLLG+G+GF NQAVPLY+SEMAP
Sbjct  105   TARCGRRPSMIVAGTAILAGSAIGGTAVNLSMVILGRVLLGVGLGFGNQAVPLYMSEMAP  164

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
               +RG  +  FQLCVGIG     L N+ T+KIR GWGWRVSL  AAVP   LT+GA+ LP
Sbjct  165   PLHRGAFSNGFQLCVGIGPPPPRLTNFFTQKIRQGWGWRVSLAAAAVPGGFLTLGALFLP  224

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNIL-HRRYR  799
             ETPNS++Q+  DHD  +  L+++RG  DV+ EL+D+ AA+    +  R    I+  R+YR
Sbjct  225   ETPNSVLQQGKDHDTVRVLLRKIRGIHDVEDELNDIAAANRERASSRRGMHMIVTQRQYR  284

Query  800   PQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLL  979
             PQL MA  +PFFQQVTGIN I+FYAPVL RTIG+GESA+L+S VVTG VG  +T  SM L
Sbjct  285   PQLAMAIMIPFFQQVTGINAISFYAPVLLRTIGMGESASLLSVVVTGLVGTTSTLLSMFL  344

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
             VD+ GRR L +VGG+ M  +Q+ +GG+M  +LGD G +S+  A +++ LI+ YVAGF  S
Sbjct  345   VDRFGRRTLFLVGGVQMLASQLMIGGIMTTQLGDHGQVSRTCAFVLIFLIAVYVAGFAWS  404

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPLGWL+PSEIFPLE+RSAGQSITVAVNFL T  V Q FL +LC +K GIFFFF  W+ 
Sbjct  405   WGPLGWLVPSEIFPLEVRSAGQSITVAVNFLMTTAVAQLFLPVLCRMKAGIFFFFAAWLV  464

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              MT FVYLLLPETK LPIE++  +W +HWFW++ V
Sbjct  465   AMTAFVYLLLPETKGLPIEQVGRLWSQHWFWRRFV  499



>gb|EMS66971.1| Sugar carrier protein C [Triticum urartu]
Length=526

 Score =   524 bits (1349),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 288/457 (63%), Positives = 348/457 (76%), Gaps = 4/457 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSN-YCKFDSELLTSFTSSLYIAGLFASLLASS  259
             GGVTSM PFL +FF  VY + +E     SN YCKFDS+LLT FTSSLY+A L AS  A++
Sbjct  45    GGVTSMNPFLMKFFPGVYHQEQEAERNQSNQYCKFDSQLLTMFTSSLYLAALVASFFAAT  104

Query  260   VTRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMA  439
             VTR  GR  S+  GGV FL GAAL GAA NV MLI GRVLLGIGVGFANQ+VP+YLSEMA
Sbjct  105   VTRVAGRKWSMFAGGVTFLVGAALNGAAKNVLMLILGRVLLGIGVGFANQSVPVYLSEMA  164

Query  440   PAKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVL  619
             PA+ RG +N+ FQL V IG+L ANLINYGT KI+ GWGWRVSL LAAVPA ++ IGA+ L
Sbjct  165   PARLRGMLNIGFQLMVTIGILCANLINYGTAKIKGGWGWRVSLALAAVPAGIIAIGALFL  224

Query  620   PETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYR  799
             P+TPNSLI R    D AK+ L+RVRGTDDV+ E  DLVAASE S+ +  P++NIL RRYR
Sbjct  225   PDTPNSLIDRGYTED-AKKMLRRVRGTDDVEEEYSDLVAASEESKLVSHPWRNILQRRYR  283

Query  800   PQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLL  979
             PQL  A A+PFFQQ+TGINVI FYAPVLF+T+G  + A+LMSAV+TG V +  TF S++ 
Sbjct  284   PQLTFAIAIPFFQQLTGINVIMFYAPVLFKTLGFADDASLMSAVITGLVNVFATFVSIVT  343

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG--GLSKGWAVLVLLLISSYVAGFG  1153
             VD++GRR+L + GG  M   Q+ VG ++GAK G  G   + KG+A  V+L I +YVAGF 
Sbjct  344   VDRLGRRKLFLQGGTQMLACQIVVGSLIGAKFGFTGVADIPKGYAAFVVLFICAYVAGFA  403

Query  1154  LSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGW  1333
              SWGPLGWL+PSEIFPLEIRSAGQSITV++N L TF++ Q FL MLC  K+ +FFFFG W
Sbjct  404   WSWGPLGWLVPSEIFPLEIRSAGQSITVSMNMLCTFIIAQAFLPMLCRFKFMLFFFFGAW  463

Query  1334  VAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             V VMT FV   LPETKN+PIE+M LVW+ HW+W + +
Sbjct  464   VVVMTLFVAFFLPETKNVPIEEMVLVWKAHWYWGRFI  500



>ref|XP_008441746.1| PREDICTED: sugar transport protein 10-like [Cucumis melo]
Length=518

 Score =   523 bits (1348),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 273/460 (59%), Positives = 357/460 (78%), Gaps = 11/460 (2%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSME FLK FF  VY +  + SG  + YCKFDS+LLT FTSSLY+A L AS LAS+V
Sbjct  45    GGVTSMEHFLKLFFPSVYEQQAKASGG-NQYCKFDSQLLTLFTSSLYLAALVASFLASAV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR  S+L GG  FL G+ L GAA+NV MLI GR+LLG+GVGFANQ+VP+YLSEMAP
Sbjct  104   TRAFGRKMSMLTGGSVFLVGSILNGAAVNVEMLIIGRLLLGVGVGFANQSVPVYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             AK RG +N+ FQ+ + IG+L+ANL+NYGT +I+DGWGWR+SL LAAVPA ++TIGA  LP
Sbjct  164   AKIRGALNIGFQMAITIGILVANLVNYGTAQIKDGWGWRLSLALAAVPAIMMTIGAFFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNS+++R  D + A++ L+++RG D+V  E  DLV A E S+ ++ P+KNI+  +YRP
Sbjct  224   DTPNSILER-GDMEKARQMLKKIRGLDNVDEEFQDLVDACEASKKVQHPWKNIMQPKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLV+   +PFFQQ+TGINVI FYAPVL++T+G G+SA+LMSAV++GAV ++ T  S++ V
Sbjct  283   QLVICCVIPFFQQLTGINVITFYAPVLYKTLGFGDSASLMSAVISGAVNVLATIVSIVTV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLG------DQGGLSKGWAVLVLLLISSYVA  1144
             DK GR+ L + GGI MF+ Q+AVG ++    G       QGG+    A ++L LI  YVA
Sbjct  343   DKFGRKFLFLEGGIQMFICQIAVGSMIWKNFGVNGEGSMQGGID---ADILLALICVYVA  399

Query  1145  GFGLSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFF  1324
             GF  SWGPLGWL+PSEI PLEIRSAGQ+I V+VN L+TF++GQ FL+MLCH+K+G+F+FF
Sbjct  400   GFAWSWGPLGWLVPSEICPLEIRSAGQAINVSVNMLWTFVIGQLFLSMLCHMKFGLFYFF  459

Query  1325  GGWVAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              G+VA+MT F+Y  LPETKN+PIE+M+ VW+ HWFW K +
Sbjct  460   AGFVALMTIFIYWFLPETKNVPIEEMNRVWKAHWFWGKFI  499



>gb|ABK24644.1| unknown [Picea sitchensis]
Length=514

 Score =   523 bits (1346),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 284/456 (62%), Positives = 359/456 (79%), Gaps = 5/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FLK+FF DVY K +  +   ++YCKFDS+LLT+FTSSLYIAGL AS  AS+ 
Sbjct  45    GGVTSMDAFLKKFFPDVYRK-QHATTNTNDYCKFDSQLLTTFTSSLYIAGLIASFFASAS  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+LIGG  FL GAAL GAA+NV MLI GR+LLGIGVGFANQ++PLYLSEMAP
Sbjct  104   TRLLGRRTSMLIGGATFLVGAALNGAAVNVAMLIIGRILLGIGVGFANQSIPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              K RGG+N+ FQL + IG+L A+ INYGT+KI+D WGWRVSL LAAVPA ++TIG++ L 
Sbjct  164   PKLRGGLNMCFQLFITIGILAASCINYGTQKIQD-WGWRVSLALAAVPALIITIGSLFLA  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSLI+R    + A+  L ++RGT +VQ E DDL+ ASE S+ ++ PF+NIL R+YRP
Sbjct  223   DTPNSLIER-GYPEKAQAMLVKIRGTPNVQEEFDDLIEASEASKMVKHPFRNILQRKYRP  281

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
              LVMA A+PFFQQ+TGINVI FYAPVLF+TIG G +A+L+SAV+TG V +V T  S+  V
Sbjct  282   HLVMAIAIPFFQQLTGINVIMFYAPVLFKTIGFGSNASLLSAVITGLVNVVATTVSIFSV  341

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGD--QGGLSKGWAVLVLLLISSYVAGFGL  1156
             D++GRR L + GG+ MF +Q+ +  V+G K G   +G LSKG+A  V++LI  YVA F  
Sbjct  342   DRIGRRFLFMEGGVQMFFSQILIAIVLGVKFGSSGEGSLSKGFAAFVVVLICVYVAAFAW  401

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSEIFPLEIRSAGQSI V+VN LFTF++ Q FLAMLCH+K+G+F FF G+V
Sbjct  402   SWGPLGWLVPSEIFPLEIRSAGQSINVSVNLLFTFIIAQAFLAMLCHMKFGLFLFFAGFV  461

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              +M+ F+Y+ LPETKN+PIE+M +VW+ HWFWK  V
Sbjct  462   LIMSIFIYMFLPETKNIPIEEMGMVWKRHWFWKNYV  497



>ref|XP_008793638.1| PREDICTED: sugar carrier protein C-like [Phoenix dactylifera]
Length=508

 Score =   522 bits (1344),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 271/456 (59%), Positives = 342/456 (75%), Gaps = 4/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL +FF  VY K  EDS   + YC+F+S+LLT+FTSSLY+A L AS  AS+ 
Sbjct  45    GGVTSMDSFLSKFFPSVYRKQAEDS-STNQYCEFNSQLLTAFTSSLYLAALLASFFASTT  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+L GG+ FL GA L GAA +V MLI GR+LLGIGVGFANQAVPLYLSEMAP
Sbjct  104   TRVFGRKWSMLGGGLTFLVGAVLNGAAKDVAMLIIGRILLGIGVGFANQAVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A+ RG +N+ FQL + IG+ +ANL+NYGT KI+ GWGWRVSL LAAVPA  + IG+++LP
Sbjct  164   ARLRGMLNIGFQLMITIGIFVANLVNYGTSKIKGGWGWRVSLALAAVPAATIAIGSLLLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TP+SLI R +    A+  L+R+RGT DV AE DDLV+ASE S+ I+ P+  +  RRYRP
Sbjct  224   DTPSSLIDRGHSEK-ARAMLRRIRGTSDVDAEYDDLVSASEESKLIKHPWATLRERRYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
              + MA  +PFFQQ+TG+N+I FYAPVLF+TIG G  A+LMS+V+ G V    T  S+  V
Sbjct  283   HVTMAILIPFFQQLTGMNIIMFYAPVLFKTIGFGADASLMSSVIIGLVNAFATLVSIFSV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGG--LSKGWAVLVLLLISSYVAGFGL  1156
             D+ GRR L I GGI M V Q+ +G ++G K G  G   LSKG+A  V+L I  +V G+  
Sbjct  343   DRAGRRVLFIEGGIQMTVCQIIIGVLIGIKFGTSGVAVLSKGYAAAVVLFICFFVCGYAW  402

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSEIFPLEIRSA QSITVAVN LFTF++ Q FL +LCH+K+G+FFFF GW 
Sbjct  403   SWGPLGWLVPSEIFPLEIRSAAQSITVAVNMLFTFVIAQIFLPLLCHMKFGLFFFFAGWE  462

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              +MT F+ + LPETKN+PIE+M+ VW++HW+W K V
Sbjct  463   LLMTIFIAMFLPETKNVPIEEMNTVWKKHWYWSKYV  498



>ref|XP_003574336.1| PREDICTED: hexose carrier protein HEX6-like [Brachypodium distachyon]
Length=520

 Score =   522 bits (1344),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 268/454 (59%), Positives = 345/454 (76%), Gaps = 2/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GG+TSM+ FLKRFF  VY + K+D  KVS+YC+FDSELLT FTSSLYIAGL A+LLAS V
Sbjct  48    GGLTSMDSFLKRFFPKVYHQ-KQDR-KVSHYCQFDSELLTVFTSSLYIAGLVATLLASYV  105

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+LIGG  F+AG+  GGAA+NV ML+  R+LLGIG+GF NQ++PLYLSEMAP
Sbjct  106   TRRYGRRASMLIGGTVFIAGSVFGGAAVNVPMLLLNRILLGIGLGFTNQSIPLYLSEMAP  165

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              +YRG +N  F+L + IG+LIAN++NY   KI  GWGWR+SL +AAVPA  LTIGA+ LP
Sbjct  166   PQYRGAINNGFELSISIGILIANILNYCVVKITAGWGWRISLSMAAVPAAFLTIGAIFLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TP+ +IQ   + D A+  LQ++RGT  VQ ELDDL++AS +SRT   PF+NI  R+YRP
Sbjct  226   DTPSFIIQHDGNTDKARALLQKMRGTTSVQNELDDLISASNLSRTTRYPFRNIFKRKYRP  285

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QL +   +PFF Q+TGINV+ FYAPV+FRTIG  ESA+L+S+VVT          +M++V
Sbjct  286   QLAIVLLIPFFNQLTGINVMNFYAPVMFRTIGFHESASLLSSVVTRLCATFANIGAMIVV  345

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             D+ GRR+L IVGG+ M ++Q+AVG ++ A+  D G + K +A LVL+ +  +VAGF  SW
Sbjct  346   DRFGRRKLFIVGGVQMILSQLAVGAILAAEFKDYGLMDKSYAYLVLVTMCVFVAGFAWSW  405

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPL +L+P+EI  LEIRSA QSI VAV FL TF++GQTFLA+LC +K G FF F  W+ +
Sbjct  406   GPLTFLVPTEICSLEIRSAAQSIVVAVVFLMTFVIGQTFLAVLCRIKSGTFFVFAAWICL  465

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT  VYL LPETK LP+E+M+ +WR+HWFWKKIV
Sbjct  466   MTLLVYLFLPETKKLPMEQMEQLWRKHWFWKKIV  499



>gb|EMT12033.1| Hexose carrier protein HEX6 [Aegilops tauschii]
Length=642

 Score =   525 bits (1351),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 273/458 (60%), Positives = 348/458 (76%), Gaps = 3/458 (1%)
 Frame = +2

Query  77    SVGGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLF-ASLLA  253
             + GGV+SMEPFL+ FF DV+ +M+  +G V NYCKFDS+LLT FTSSLY++GL  A L+A
Sbjct  45    TAGGVSSMEPFLRDFFPDVHRRMQAGAG-VGNYCKFDSQLLTLFTSSLYVSGLLTAVLVA  103

Query  254   SSVTRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSE  433
             S  T   GR PS+++GGVA+L GAA+ G A+NVYM I GR LLG+G+GFANQAVPLYLSE
Sbjct  104   SWFTERHGRRPSMILGGVAYLGGAAVSGGAVNVYMAILGRALLGVGLGFANQAVPLYLSE  163

Query  434   MAPAKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAV  613
             MAPA+YRG  +  FQ  + +G L A ++NYG EKI+ GWGWR+SLGLA VPA +LT+GA+
Sbjct  164   MAPARYRGAFSNGFQFSLCLGALAATVVNYGAEKIKAGWGWRLSLGLAGVPAVLLTVGAI  223

Query  614   VLPETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNIL-HR  790
              LPETPNSL+Q+       K  LQ++RG D V  ELDD+VAA+   +  +   + IL  R
Sbjct  224   FLPETPNSLVQQGKGRGEVKALLQKIRGVDAVDEELDDIVAANATGQAGDNGLRLILSQR  283

Query  791   RYRPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFAS  970
             RYRPQL MAF +P F Q+TGIN I FYAPVL RTIG+ ESAAL+S +V   +   +TFAS
Sbjct  284   RYRPQLAMAFLIPSFTQLTGINAIGFYAPVLLRTIGMSESAALLSTIVMVIISSTSTFAS  343

Query  971   MLLVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGF  1150
             MLLVD+ GRR LL++GG+ MF++++ +GG+M AKL D+G +S+ +AV+++ LI+ Y  GF
Sbjct  344   MLLVDRFGRRTLLVLGGVQMFLSEVLIGGIMAAKLRDEGQVSRAYAVVLIFLIAIYSTGF  403

Query  1151  GLSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGG  1330
             G SWGPL WLIPSEIFPLE+RSAGQSITVA  F+FT LV Q FLAMLC LK  +FFFF G
Sbjct  404   GWSWGPLSWLIPSEIFPLEVRSAGQSITVASGFVFTILVAQYFLAMLCRLKAWLFFFFAG  463

Query  1331  WVAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             W+ VMT F YL LPETK +PIE++  +W  HW+WK++V
Sbjct  464   WILVMTAFAYLFLPETKGIPIEQIGNLWGRHWYWKRVV  501



>ref|XP_007013711.1| Sugar transporter protein 7 isoform 1 [Theobroma cacao]
 ref|XP_007013712.1| Sugar transporter protein 7 isoform 1 [Theobroma cacao]
 ref|XP_007013713.1| Sugar transporter protein 7 isoform 1 [Theobroma cacao]
 gb|EOY31330.1| Sugar transporter protein 7 isoform 1 [Theobroma cacao]
 gb|EOY31331.1| Sugar transporter protein 7 isoform 1 [Theobroma cacao]
 gb|EOY31332.1| Sugar transporter protein 7 isoform 1 [Theobroma cacao]
Length=510

 Score =   520 bits (1338),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 266/457 (58%), Positives = 349/457 (76%), Gaps = 4/457 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM  FL++FFH VY  +K+     +NYCK+D++ L +FTSSLY+AGL ASL+AS +
Sbjct  49    GGVTSMNGFLRKFFHSVY--IKKQHAHENNYCKYDNQGLAAFTSSLYLAGLVASLVASPI  106

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  SI+ GG++FL GA L  AA+N+ ML+ GR++LG+G+GF NQAVPLYLSEM+P
Sbjct  107   TREYGRRASIICGGISFLIGATLNAAAVNIAMLLLGRIMLGVGIGFGNQAVPLYLSEMSP  166

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             +  RGG+N+ FQL   +G+  AN++NYGT+K+ + WGWR+SLGLAA+PA ++T+G   LP
Sbjct  167   SHLRGGLNMMFQLATTLGIFTANMVNYGTQKL-EPWGWRLSLGLAAIPAFLMTVGGFCLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLI+R +   G ++ L R+RGTD+V AE  D+V ASE++ +I+ PF+NIL RR RP
Sbjct  226   ETPNSLIERGSKERG-RKVLVRIRGTDNVDAEFQDMVDASELANSIKHPFRNILERRNRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA  +P  Q +TGIN I FYAPVLF+++G G +AA  S+ +TGAV   +TF SM  V
Sbjct  285   QLVMAICMPTCQILTGINSILFYAPVLFQSMGFGRNAAFYSSALTGAVLAGSTFISMATV  344

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR LLI GGI M + Q+ V  ++G K G+   LSK +++LV+++I  +V  FG SW
Sbjct  345   DKLGRRVLLISGGIQMIICQVIVAIILGLKFGENQELSKSYSILVVIVICLFVLAFGWSW  404

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGW +PSEIFPLE RSAGQSITVAVN LFTF++ Q FLAMLCH K+GIF FFG W+ V
Sbjct  405   GPLGWTVPSEIFPLETRSAGQSITVAVNLLFTFIIAQCFLAMLCHFKFGIFLFFGAWITV  464

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIVV*Y  1453
             MT FVY+ LPETK +PIE+M  +WR+HWFWK+IV  Y
Sbjct  465   MTLFVYVFLPETKGVPIEEMIFLWRKHWFWKRIVPEY  501



>ref|XP_003563688.1| PREDICTED: hexose carrier protein HEX6-like [Brachypodium distachyon]
Length=513

 Score =   520 bits (1338),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 292/458 (64%), Positives = 367/458 (80%), Gaps = 4/458 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGV+SMEPFLK+FF +VY +MK D G +SNYCKFDS+LLT+FTSSLY+AGL  + LAS+V
Sbjct  45    GGVSSMEPFLKKFFPEVYRRMKGD-GSISNYCKFDSQLLTAFTSSLYVAGLLTTFLASTV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T   GR PS+L+GG +FLAG+A+G AA+++YM+I GRVLLG+G+GFAN AVPLYLSEMAP
Sbjct  104   TARRGRRPSMLLGGASFLAGSAVGAAAVDIYMVILGRVLLGVGLGFANLAVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             +++RG  +  FQL VG+G L ANLIN+ T+KIR GWGWRVSL LAAVPA +L +GA+ LP
Sbjct  164   SRHRGAFSNGFQLSVGVGALAANLINFSTQKIRGGWGWRVSLALAAVPAALLLVGAIFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIE--RPFKNIL-HRR  793
             ETPNSLIQ+  D       L+++RGTDDV AELDD+VAA+  +         + +L  R+
Sbjct  224   ETPNSLIQQGRDRQDVAVLLRKIRGTDDVDAELDDIVAAAAANSEGAAGSGLRMLLTQRK  283

Query  794   YRPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASM  973
             YRPQL MA  +PFFQQVTGIN IAFYAPVL R+IG+GESA+L+SAVVTG VG  +TF SM
Sbjct  284   YRPQLAMAVMIPFFQQVTGINAIAFYAPVLLRSIGMGESASLLSAVVTGVVGAGSTFLSM  343

Query  974   LLVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFG  1153
              LVD+ GRR L + GG  M  +Q+ +GG+M AKLGD GG+SK WA +++LLI+ YVAGFG
Sbjct  344   FLVDRFGRRTLFLAGGAQMLASQVLIGGIMAAKLGDDGGVSKAWAGVLVLLIAVYVAGFG  403

Query  1154  LSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGW  1333
              SWGPLGWL+PSEIFPLE+RSAGQ +TVAV+F+FT +V Q FLAMLCH++ GIFFFF  W
Sbjct  404   WSWGPLGWLVPSEIFPLEVRSAGQGVTVAVSFVFTVVVAQAFLAMLCHMRAGIFFFFAAW  463

Query  1334  VAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIVV  1447
             +A MT FVYLLLPETK +P+E+M  +W EHWFWK++++
Sbjct  464   LAAMTAFVYLLLPETKGVPMEQMAALWAEHWFWKRVLL  501



>ref|XP_002452988.1| hypothetical protein SORBIDRAFT_04g036140 [Sorghum bicolor]
 gb|EES05964.1| hypothetical protein SORBIDRAFT_04g036140 [Sorghum bicolor]
Length=526

 Score =   520 bits (1338),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 282/456 (62%), Positives = 344/456 (75%), Gaps = 3/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+PFL RFF  VY K  E     + YCKFDS+LLT FTSSLY++ L ASL A+SV
Sbjct  49    GGVTSMDPFLSRFFPSVYQKQAELLDGGNQYCKFDSQLLTLFTSSLYVSALVASLFAASV  108

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR  S+  GGV FLAG AL GAA+NV MLI GRVLLG+GVGFANQ+VP+YLSEMAP
Sbjct  109   TRAAGRKWSMFAGGVTFLAGCALNGAAVNVAMLILGRVLLGVGVGFANQSVPVYLSEMAP  168

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              + RG +N  FQL + +G+L+ANLINYGT KI  GWGWR+SLGLAAVPA ++T+G++ LP
Sbjct  169   MRMRGMLNNGFQLMITLGILLANLINYGTVKIAGGWGWRLSLGLAAVPAAIITVGSLFLP  228

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSL++R    + AKR L+RVRGTDDV AE DDLVAA E SR +  P+++I  RRYRP
Sbjct  229   DTPNSLLERGRPEE-AKRMLRRVRGTDDVAAEYDDLVAAGEASRAVTHPWRDIRQRRYRP  287

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA A+P FQQ+TGINVI FYAPVLF+T+G G +A+LMSAV+TG V +V+T  S+  V
Sbjct  288   QLVMAVAIPLFQQLTGINVIMFYAPVLFKTLGFGGTASLMSAVITGLVNLVSTLVSVFTV  347

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG--GLSKGWAVLVLLLISSYVAGFGL  1156
             D+VGRR L + GG  M   Q+AVG ++GAK G  G   +  G+A   ++++  YVAGF  
Sbjct  348   DRVGRRALFLEGGAQMLAAQVAVGALIGAKFGWSGVATVPAGYAAATVVVMCVYVAGFAW  407

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSE+ PLE+R AGQSITVAVN L TF V Q FL MLC LK+ +FF F   V
Sbjct  408   SWGPLGWLVPSEVMPLEVRPAGQSITVAVNMLMTFAVAQAFLPMLCRLKFVLFFAFAACV  467

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              VMT FV L LPETK +PIE M  VW+ HW+WK+ V
Sbjct  468   VVMTLFVALFLPETKGVPIEDMAGVWKTHWYWKRFV  503



>ref|XP_010277922.1| PREDICTED: sugar carrier protein C [Nelumbo nucifera]
Length=519

 Score =   519 bits (1337),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 286/457 (63%), Positives = 351/457 (77%), Gaps = 5/457 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FLK+FF  VY K KED+   + YCKFDS+ LT FTSSLY+A L ASL AS V
Sbjct  46    GGVTSMDSFLKKFFPSVYRKEKEDT-STNQYCKFDSQTLTMFTSSLYLAALVASLFASIV  104

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+ +GG+ FLAGAA+  AA+NV MLI GR+LLG+GVGFANQ+VPLYLSEMAP
Sbjct  105   TRRFGRKLSMFLGGIVFLAGAAINAAAVNVAMLIIGRILLGVGVGFANQSVPLYLSEMAP  164

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
               YRG +N+ FQL + +G+L ANLINYGT KI  GWGWR+SLG AAVPA ++  G+  LP
Sbjct  165   YNYRGALNIGFQLMITLGILFANLINYGTAKIEGGWGWRISLGGAAVPAFLIAFGSFFLP  224

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNS+I+R N  + A+  L+R+RGTDD+  E +DLVAASE S+T+E P+ NIL R+YRP
Sbjct  225   DTPNSIIER-NMPEKARNMLRRIRGTDDITEEFNDLVAASEASKTVEHPWTNILQRKYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
              LVMA A+PFFQQ+TGINVI FYAPVLF+TIG G  A+LMSA++TG V ++ TF S++  
Sbjct  284   HLVMAIAIPFFQQLTGINVIMFYAPVLFKTIGFGSDASLMSAIITGLVNVLATFVSIVTS  343

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG---GLSKGWAVLVLLLISSYVAGFG  1153
             DK GRR L + GG  MFV Q+AV  ++G K G  G   GLSKG+A +V+  I  YV+GF 
Sbjct  344   DKWGRRALFLEGGTQMFVCQIAVAILIGMKFGLDGQTDGLSKGYAGVVVFFICLYVSGFA  403

Query  1154  LSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGW  1333
              SWGPLGWL+PSEIFPLEIRSA QSI VAVN LFTF + Q FL MLCH K+G+FFFF GW
Sbjct  404   WSWGPLGWLVPSEIFPLEIRSAAQSINVAVNMLFTFAIAQVFLTMLCHFKFGLFFFFAGW  463

Query  1334  VAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             V +MT F++ LLPETK +PIE+M  VWR+HWFW K +
Sbjct  464   VLIMTIFIFFLLPETKGVPIEEMMHVWRQHWFWGKYI  500



>gb|EMT33361.1| Hexose carrier protein HEX6 [Aegilops tauschii]
Length=550

 Score =   520 bits (1338),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 278/483 (58%), Positives = 347/483 (72%), Gaps = 31/483 (6%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FLK FF +VY + K+DS  VSNYC+FDSELLT FTSSLYIAGL A+L AS V
Sbjct  47    GGVTSMDSFLKTFFPEVY-RHKQDS-NVSNYCQFDSELLTVFTSSLYIAGLIATLFASFV  104

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQ-----------  409
             TR  GR  S+LIGG  F+AG+A GGAA+NV ML+  R+LLGIG+GF NQ           
Sbjct  105   TRRFGRRASMLIGGTVFIAGSAFGGAAVNVPMLLLNRILLGIGLGFTNQLMTMDSYMFTM  164

Query  410   ------------------AVPLYLSEMAPAKYRGGMNVSFQLCVGIGVLIANLINYGTEK  535
                               ++PLYLSEMAP +YRG +N  F+L + IG+LIAN++NY   K
Sbjct  165   TIYMSVSQIPKNHCIDYPSIPLYLSEMAPPQYRGAINNGFELSISIGILIANILNYCVVK  224

Query  536   IRDGWGWRVSLGLAAVPATVLTIGAVVLPETPNSLIQRRNDHDGAKRRLQRVRGTDDVQA  715
             +  GWGWR+SL +AAVPAT LTIGA+ LPETP+ +IQR  D D A+  LQ++RGT  VQ 
Sbjct  225   LAAGWGWRISLSMAAVPATFLTIGAIFLPETPSFIIQRDGDTDKARALLQKLRGTTSVQN  284

Query  716   ELDDLVAASEISRTIERPFKNILHRRYRPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTI  895
             ELDDLV+AS +SR    PF+ I  R+YRPQL M   +PFF Q+TGINV+ FYAPV+FRTI
Sbjct  285   ELDDLVSASNLSRAARYPFRKIFKRKYRPQLAMVLLIPFFNQLTGINVMNFYAPVMFRTI  344

Query  896   GLGESAALMSavvtgavgivttFASMLLVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKL  1075
             GL ESA+L+S+VVT          +ML+VD+ GRR+L +VGGI M ++Q+AVG ++ A+ 
Sbjct  345   GLKESASLLSSVVTRLCATFANIIAMLVVDRFGRRKLFLVGGIQMILSQLAVGAILAAEF  404

Query  1076  GDQGGLSKGWAVLVLLLISSYVAGFGLSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLF  1255
              D G + K +A LVL+ +  +VAGF  SWGPL +L+P+EI PLEIRSAGQSI VAV FL 
Sbjct  405   KDNGLMDKDYAFLVLITMCVFVAGFAWSWGPLTFLVPTEICPLEIRSAGQSIVVAVVFLM  464

Query  1256  TFLVGQTFLAMLCHLKYGIFFFFGGWVAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWK  1435
             TF++GQTFLA+LC +K G FF F  W+ VMT  VYL LPETK LP+E+M+ VWR HWFWK
Sbjct  465   TFVIGQTFLAVLCRIKSGTFFLFAAWICVMTLVVYLFLPETKKLPMEQMEQVWRRHWFWK  524

Query  1436  KIV  1444
             KIV
Sbjct  525   KIV  527



>dbj|BAK07271.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=511

 Score =   518 bits (1333),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 274/457 (60%), Positives = 342/457 (75%), Gaps = 4/457 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL  FF  VY + K +  K + YCKFDS+LLT FTSSLY+A L  S LA+SV
Sbjct  45    GGVTSMDSFLSEFFPSVYAQAKANKEK-NQYCKFDSQLLTLFTSSLYLAALATSFLAASV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+  GG+ FLAG+AL GAA NV MLI GR+LLGIGVGFANQ+VPLYLSEMAP
Sbjct  104   TRIFGRKWSMFCGGITFLAGSALNGAATNVMMLILGRILLGIGVGFANQSVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A  RG +N+ FQL   IG+L ANLINY T  I  GWGWR+ LGLA VPA ++T+GA+ LP
Sbjct  164   ANLRGMLNIGFQLMTTIGILSANLINYATVSIEGGWGWRIGLGLAGVPALIITLGALALP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSLI R    + AK+ L +VRGT DV  E DD+VAASE +  IE P++NIL R+YRP
Sbjct  224   DTPNSLIARGYTAE-AKKVLVKVRGTSDVHDEYDDMVAASEEANAIEHPWRNILERKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QL +A  +PFFQQ+TGINVI FYAPVLF TIG G  A+LMSAV+TG V +  T  S++ V
Sbjct  283   QLTIAVLIPFFQQLTGINVIMFYAPVLFLTIGFGGDASLMSAVITGLVNMFATIVSIISV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGD--QGGLSKGWAVLVLLLISSYVAGFGL  1156
             D++GRR L + GG  MFV+Q+ VG ++  + G   +G +S+ +A+L++L I  YVAGF  
Sbjct  343   DRLGRRALFLQGGTQMFVSQIVVGTLIALQFGTTGEGEMSRSYAMLLVLFICLYVAGFAW  402

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSE+F LEIRSAGQSI V VN   TF++GQ FL MLCHLK+G+F+FF  W+
Sbjct  403   SWGPLGWLVPSEVFALEIRSAGQSIAVCVNMTLTFIIGQAFLTMLCHLKFGLFYFFAAWM  462

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIVV  1447
              +MTTF+ L LPETK +PI++M+L+W  HWFW K V+
Sbjct  463   VIMTTFIALFLPETKGVPIDEMNLIWSRHWFWSKYVI  499



>ref|XP_010483824.1| PREDICTED: sugar transport protein 3 [Camelina sativa]
Length=516

 Score =   518 bits (1333),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 281/456 (62%), Positives = 357/456 (78%), Gaps = 3/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSN--YCKFDSELLTSFTSSLYIAGLFASLLAS  256
             GGV SM PFLK+FF  VY   +ED  + SN  YC F+S+LLTSFTSSLY++G  A+LLAS
Sbjct  49    GGVMSMGPFLKKFFPKVYKLQEEDRTRRSNNHYCLFNSQLLTSFTSSLYVSGFVATLLAS  108

Query  257   SVTRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEM  436
             SVTR+ GR PSI +GG+AFLAG+ALGG+A NV MLI  R+LLG+GVGFANQ+VPLYLSEM
Sbjct  109   SVTRSWGRKPSIFLGGLAFLAGSALGGSAQNVAMLIIARLLLGVGVGFANQSVPLYLSEM  168

Query  437   APAKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVV  616
             APAKYRG ++  FQLC+GIG L ANLINY T+KI+ G+GWR+SL  AA+PA++LT+G++ 
Sbjct  169   APAKYRGAISNGFQLCIGIGFLTANLINYETQKIKHGYGWRISLATAAIPASILTLGSLY  228

Query  617   LPETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRY  796
             LPETPNS+IQ   D   A+  L+RVRGT +VQ EL DLV AS  S T    F  +L ++Y
Sbjct  229   LPETPNSIIQTTGDVRKAEFMLRRVRGTQNVQDELTDLVEASSDSATDSNAFVILLQKKY  288

Query  797   RPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASML  976
             RP+LVMA A+PFFQQVTGINV+AFYAPVLFRT+G GES +LMS +VTG VG  +TF SML
Sbjct  289   RPELVMALAIPFFQQVTGINVVAFYAPVLFRTVGFGESGSLMSTLVTGIVGTASTFLSML  348

Query  977   LVDKVGRRRLLIVGGILMFVTQMAVGG-VMGAKLGDQGGLSKGWAVLVLLLISSYVAGFG  1153
             +VD++GR+ L ++GGI M V Q+ +G  +M A+  + G + +G+   V++L+  YV+GFG
Sbjct  349   VVDRIGRKTLFLIGGIQMLVAQVTIGVIIMVAEGHNNGVIGEGYGYTVVVLVCVYVSGFG  408

Query  1154  LSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGW  1333
              SWGPLGWL+PSEIFPLEIRSA QS+TVAV+F+FTF V Q+   MLC  + GIFFF+GGW
Sbjct  409   WSWGPLGWLVPSEIFPLEIRSAAQSVTVAVSFVFTFAVAQSVPPMLCKFRAGIFFFYGGW  468

Query  1334  VAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKI  1441
             V VMT  V L LPETKN+PIE++  +W +HWFW+++
Sbjct  469   VVVMTVAVQLFLPETKNVPIEQVAGLWDKHWFWRRM  504



>ref|XP_002969912.1| hypothetical protein SELMODRAFT_170916 [Selaginella moellendorffii]
 gb|EFJ29036.1| hypothetical protein SELMODRAFT_170916 [Selaginella moellendorffii]
Length=535

 Score =   518 bits (1335),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 272/454 (60%), Positives = 345/454 (76%), Gaps = 2/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL++FF  VY   ++     ++YCK+D++ LT+FTSSLY+A L AS +A+ V
Sbjct  47    GGVTSMDDFLEKFFPVVYRNKQKPVSGNAHYCKYDNQGLTTFTSSLYLAALIASFVAAWV  106

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T+  GR PSIL+GG++FL GA L GAA N+ MLI GR++LGIGVGF NQAVPLYLSE+AP
Sbjct  107   TKRYGRRPSILLGGLSFLVGAVLTGAAENIEMLILGRIMLGIGVGFGNQAVPLYLSELAP  166

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             AK RG MN+ FQL + IG+L ANLINYGT KI   WGWR+SL LA VPA  +T+G   LP
Sbjct  167   AKIRGAMNIMFQLAITIGILCANLINYGTAKITP-WGWRLSLALAGVPAVFMTLGGFFLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSLI+R   HD  ++ LQ+VRGT+ V  E +D+V AS+ +  ++ P+KN+L  + RP
Sbjct  226   DTPNSLIER-GRHDRGRKVLQKVRGTEKVDVEYEDIVEASQKANMVKHPYKNLLMSKNRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVM+  +PFFQQ+TGINVI FYAPVLF TIG G  A+L SAV+TGAV +V+TF S++ V
Sbjct  285   QLVMSILIPFFQQLTGINVIMFYAPVLFETIGFGHDASLYSAVITGAVNLVSTFISIITV  344

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK GRR LL+ GG+ MF +Q+ +G V+G K      + KGWA  V++LI  YV+ F  SW
Sbjct  345   DKYGRRLLLLEGGVQMFFSQIVIGIVLGVKFSSSSNIPKGWAAFVVVLICIYVSAFAWSW  404

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWLIPSEI+PLE RSAGQSITV+VN LFTF++ Q FL MLC  K+G+F FF GWV +
Sbjct  405   GPLGWLIPSEIYPLETRSAGQSITVSVNMLFTFVIAQAFLKMLCTFKFGVFLFFAGWVLI  464

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY  +PETKN+PIE+M LVWR HWFWK+IV
Sbjct  465   MTIFVYFFVPETKNVPIEEMMLVWRSHWFWKRIV  498



>dbj|BAJ89694.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ94198.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=517

 Score =   518 bits (1333),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 267/457 (58%), Positives = 348/457 (76%), Gaps = 5/457 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM PFLK+FF +VY + K+     + YCK+D++LL +FTSSLY+A L +S  A++V
Sbjct  45    GGVTSMNPFLKKFFPEVYHR-KQMKDSANQYCKYDNQLLQTFTSSLYLAALVSSFFAATV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR  S+  GG+ FL GAAL GAA N+ MLI GR+LLG+GVGFANQ+VP+YLSEMAP
Sbjct  104   TRAVGRKWSMFTGGLTFLIGAALNGAAENIAMLIVGRILLGVGVGFANQSVPVYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A+ RG +N+ FQL + IG+L A LINYGT KI+ G+GWR+SL LAAVPA ++T+G++ LP
Sbjct  164   ARLRGMLNIGFQLMITIGILAAALINYGTNKIKAGYGWRISLALAAVPAGIITLGSLFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTD-DVQAELDDLVAASEISRTIERPFKNILHRRYR  799
             +TPNSLI+R +  + A+R L R+RG D D+  E  DLV ASE S+ ++ P++NIL R+YR
Sbjct  224   DTPNSLIERGHP-EAARRMLNRIRGNDVDISEEYADLVVASEESKLVQHPWRNILQRKYR  282

Query  800   PQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLL  979
             PQL MA  +PFFQQ+TGINVI FYAPVLF T+G    A+LMSAV+TG V +  T  S+  
Sbjct  283   PQLTMAIMIPFFQQLTGINVIMFYAPVLFETLGFKGDASLMSAVITGLVNVFATLVSVFT  342

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG--GLSKGWAVLVLLLISSYVAGFG  1153
             VD++GRR+L + GG  M ++Q+ VG ++  K G  G   + KG+A  V+L I  YVAGF 
Sbjct  343   VDRLGRRKLFLQGGTQMLLSQLVVGTLIAVKFGTSGVGEMPKGYAAAVVLFICLYVAGFA  402

Query  1154  LSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGW  1333
              SWGPLGWL+PSEIFPLEIR AGQSI V+VN LFTF++ Q FL MLCH+K+G+F+FF GW
Sbjct  403   WSWGPLGWLVPSEIFPLEIRPAGQSINVSVNMLFTFVIAQAFLTMLCHMKFGLFYFFAGW  462

Query  1334  VAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             V +MT F+ L LPETKN+PIE+M LVW+ HWFW++ +
Sbjct  463   VVIMTVFIALFLPETKNVPIEEMVLVWKGHWFWRRYI  499



>gb|EMT27396.1| Sugar transport protein 1 [Aegilops tauschii]
Length=514

 Score =   517 bits (1332),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 268/456 (59%), Positives = 351/456 (77%), Gaps = 4/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+PFL +FF +VY + K+ + K + YC++D++LL +FTSSLY+A L AS  AS+V
Sbjct  45    GGVTSMDPFLLKFFPEVY-RQKQAASKSNQYCQYDNQLLQAFTSSLYLAALVASFFASAV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+L GG  FL GAAL GAA NV MLI GR+LLG+G+GFANQ+VP+YLSEMAP
Sbjct  104   TRILGRKWSMLAGGFTFLVGAALNGAAQNVAMLIVGRMLLGVGIGFANQSVPVYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A  RG +N+ FQL + IG+L A LINYGT KI+ G GWRVSL LAAVPA ++T+GA+ LP
Sbjct  164   AHLRGMLNIGFQLMITIGILAAELINYGTNKIKGGHGWRVSLALAAVPAVIITVGALFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSL++R +  + ++R L+R+RGTDD+  E  DLVAA EIS+ ++ P++NIL R+YR 
Sbjct  224   DTPNSLMERGHP-EASRRMLRRIRGTDDIGEEYADLVAAREISKQVQHPWRNILMRKYRA  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QL MA  +PFFQQV+GINVI FYAPVLF T+G    A+L+S+V+TG V ++ +  SM  V
Sbjct  283   QLTMAVLIPFFQQVSGINVINFYAPVLFETLGFKGDASLLSSVMTGGVLVLGSVVSMFTV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG--GLSKGWAVLVLLLISSYVAGFGL  1156
             D++GRR+L + GG  M V+Q+AVG ++  + G  G   + +G+A  V+L I  YVAGF  
Sbjct  343   DRLGRRKLFLQGGAQMLVSQIAVGTLIAVRFGTSGVGEMPRGYAAAVVLFICVYVAGFVW  402

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWG LGWL+PSEIFPLEIRSAGQSITV+VN LFTF++ Q FL MLCH+K+G+F+FF GWV
Sbjct  403   SWGALGWLVPSEIFPLEIRSAGQSITVSVNMLFTFVIAQAFLTMLCHMKFGLFYFFAGWV  462

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              +MT FV L LPETKN+P+E+M LVW+ HWFW + +
Sbjct  463   VIMTAFVALFLPETKNVPMEEMVLVWKGHWFWSRFI  498



>ref|XP_006658204.1| PREDICTED: sugar carrier protein C-like [Oryza brachyantha]
Length=519

 Score =   518 bits (1333),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 274/457 (60%), Positives = 348/457 (76%), Gaps = 7/457 (2%)
 Frame = +2

Query  89    VTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSVTR  268
             VTSM+PFLK+FF +V+ K K+ S K + YCK+D++LL +FTSSLY+A L AS  A++VTR
Sbjct  44    VTSMDPFLKKFFPEVFRK-KQASNKNNQYCKYDNQLLQTFTSSLYLAALVASFFAATVTR  102

Query  269   ACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAPAK  448
               GR  S+  GG+ FL GAAL GAA NV MLI GR+LLG+GVGFANQ+VP+YLSEMAPA+
Sbjct  103   VLGRKWSMFGGGLTFLIGAALNGAAENVAMLIIGRILLGVGVGFANQSVPVYLSEMAPAR  162

Query  449   YRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLPET  628
              RG +N+ FQL + IG+L A LINYGT KI+ GWGWRVSL LAAVPA ++T+GA+ LP+T
Sbjct  163   LRGMLNIGFQLMITIGILAAELINYGTAKIKAGWGWRVSLALAAVPAGIITLGALFLPDT  222

Query  629   PNSLIQRRNDHDGAKRRLQRVRGTD-DVQAELDDLVAASEISRTIERPFKNILHRRYRPQ  805
             PNSLI R +  + A+R L+R+RG+D DV  E  DLVAASE S+ ++ P++NIL R+YR Q
Sbjct  223   PNSLIDRGHP-EAAERMLKRIRGSDVDVSEEYADLVAASEESKLVQHPWRNILRRKYRAQ  281

Query  806   LVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLVD  985
             L MA  +PFFQQ+TGINVI FYAPVLF T+G    A+LMSAV+TG V +  T  S+  VD
Sbjct  282   LTMAICIPFFQQLTGINVIMFYAPVLFDTLGFKSDASLMSAVITGLVNVFATLVSIFTVD  341

Query  986   KVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG--GLSKG--WAVLVLLLISSYVAGFG  1153
             ++GRR+L + GG  M V Q+ VG ++ AK G  G   + KG   A +V+L I  YVAGF 
Sbjct  342   RLGRRKLFLQGGAQMMVCQVVVGTLIAAKFGTSGIGDIPKGDAAAAVVVLFICVYVAGFA  401

Query  1154  LSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGW  1333
              SWGPLGWL+PSEIFPLEIR AGQSI V+VN LFTF++ Q FL MLCH+K+G+F+FF GW
Sbjct  402   WSWGPLGWLVPSEIFPLEIRPAGQSINVSVNMLFTFVIAQAFLTMLCHMKFGLFYFFAGW  461

Query  1334  VAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             V +MT F+ L LPETKN+PIE+M LVW+ HWFW + +
Sbjct  462   VVIMTVFIALFLPETKNVPIEEMVLVWKSHWFWSRFI  498



>gb|AAQ24872.1| monosaccharide transporter 6 [Oryza sativa Japonica Group]
Length=529

 Score =   518 bits (1333),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 286/457 (63%), Positives = 346/457 (76%), Gaps = 5/457 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSN-YCKFDSELLTSFTSSLYIAGLFASLLASS  259
             GGVTSM PFL +FF  VY K +      SN YCKFDS LLT FTSSLY+A L AS  AS+
Sbjct  45    GGVTSMNPFLIKFFPSVYRKEQAAEKNQSNQYCKFDSPLLTMFTSSLYLAALVASFFAST  104

Query  260   VTRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMA  439
             VTR  GR  S+  GGV FL GAAL GAA NV MLI GRVLLG+GVGFANQ+VPLYLSEMA
Sbjct  105   VTRVAGRKWSMFGGGVTFLVGAALNGAAKNVLMLILGRVLLGVGVGFANQSVPLYLSEMA  164

Query  440   PAKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVL  619
             PA+ RG +N+ FQL + IG+L ANLINYGT KI+ GWGWRVSL LAAVPA ++ +GA+ L
Sbjct  165   PARLRGMLNIGFQLMITIGILCANLINYGTAKIKGGWGWRVSLALAAVPAAIIAVGALFL  224

Query  620   PETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYR  799
             P+TPNSLI R    D AKR L+RVRGTDD++ E +DLVAASE S+ +  P++NIL RRYR
Sbjct  225   PDTPNSLIDR-GHTDAAKRMLRRVRGTDDIEEEYNDLVAASEESKLVAHPWRNILQRRYR  283

Query  800   PQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLL  979
             PQL MA A+P FQQ+TGINVI FYAPVLF+T+G  + A+LMSAV+TG V +  TF S++ 
Sbjct  284   PQLTMAIAIPLFQQLTGINVIMFYAPVLFKTLGFADDASLMSAVITGLVNVFATFVSIVT  343

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG--GLSKGWAVLVLLLISSYVAGFG  1153
             VD++GRR+L + GG  M   Q+ VGG++GA+ G  G   + K +A  V+L I +YVAGF 
Sbjct  344   VDRLGRRKLFLQGGTQMLACQIVVGGLIGAEFGFSGVADIPKAYAAFVVLFICAYVAGFA  403

Query  1154  LSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGW  1333
              SWGPLGWL+PSEIFPLEIRSAGQSI V+VN LFTF++ Q FL MLC  K+ I FFFG W
Sbjct  404   WSWGPLGWLVPSEIFPLEIRSAGQSINVSVNMLFTFIIAQAFLPMLCRFKF-ILFFFGAW  462

Query  1334  VAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             V +MT FV   LPETKN+PIE+M LVW+ HW+W + +
Sbjct  463   VVIMTLFVAFFLPETKNVPIEEMVLVWKSHWYWGRFI  499



>ref|XP_002467490.1| hypothetical protein SORBIDRAFT_01g029030 [Sorghum bicolor]
 gb|EER94488.1| hypothetical protein SORBIDRAFT_01g029030 [Sorghum bicolor]
Length=520

 Score =   517 bits (1332),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 267/454 (59%), Positives = 344/454 (76%), Gaps = 2/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FLKRFF  VY + K+DS KVS+YC+F+SELLT FTSSLYIAGL A+L A+S+
Sbjct  48    GGVTSMDSFLKRFFPKVY-RQKQDS-KVSHYCEFNSELLTVFTSSLYIAGLVATLAAASI  105

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+LIGG  F+AG+  GGAA NV ML+  R+LLGIG+GF NQ++PLYLSEMAP
Sbjct  106   TRRYGRRTSMLIGGTVFIAGSVFGGAASNVPMLLVNRILLGIGLGFTNQSIPLYLSEMAP  165

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              +YRG +N  F+LC+ +G+L AN++NY   KIR GWGWR+SL +AA+PA  LTI A+ LP
Sbjct  166   PRYRGAINNGFELCISLGILFANILNYFVIKIRAGWGWRISLSMAALPAAFLTISAIFLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETP+ +IQ   + D A+  LQ++RGT  VQ ELDDLV AS +SR    PFK IL R+YRP
Sbjct  226   ETPSFIIQCDGNTDKARVLLQKLRGTTSVQKELDDLVCASNLSRATRYPFKTILKRKYRP  285

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLV+A  + FF QVTGINV+ FYAPV+FRTIGL ESA+L+S+VVT          +M++V
Sbjct  286   QLVVARLISFFNQVTGINVMNFYAPVMFRTIGLKESASLLSSVVTRLCATFANIIAMMVV  345

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             D+ GRR+L +VGG+ M ++Q  VG ++ AK  D   +   +A LVL+ +  +VAGF  SW
Sbjct  346   DRFGRRKLFLVGGVQMILSQFTVGAILAAKFKDYEEMDDAYAYLVLITMCVFVAGFAWSW  405

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPL +L+P+E+ PLEIRSAGQSI VAV FL TF++GQTFL +LC +K   FF FGGW+ +
Sbjct  406   GPLTFLVPAEVCPLEIRSAGQSIVVAVVFLMTFVIGQTFLEVLCRIKSMTFFVFGGWICL  465

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVYL LPETK LP+E+M+ VW++HWFWKK++
Sbjct  466   MTLFVYLFLPETKKLPMEQMEQVWKKHWFWKKVL  499



>dbj|BAJ94378.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=527

 Score =   517 bits (1332),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 285/457 (62%), Positives = 346/457 (76%), Gaps = 4/457 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSN-YCKFDSELLTSFTSSLYIAGLFASLLASS  259
             GGVTSM PFL +FF  VY K +E     SN YCKFDS+LLT FTSSLY+A L AS  A++
Sbjct  45    GGVTSMNPFLMKFFPGVYHKEQEAERNQSNQYCKFDSQLLTMFTSSLYLAALVASFFAAT  104

Query  260   VTRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMA  439
             VTR  GR  S+  GGV FL GAAL GAA NV MLI GRVLLGIGVGFANQ+VP+YLSEMA
Sbjct  105   VTRVAGRKWSMFAGGVTFLVGAALNGAAKNVLMLILGRVLLGIGVGFANQSVPVYLSEMA  164

Query  440   PAKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVL  619
             PA+ RG +N+ FQL V IG+L ANLINYGT KI+ GWGWRVSL LAAVPA ++ IGA+ L
Sbjct  165   PARLRGMLNIGFQLMVTIGILCANLINYGTSKIKGGWGWRVSLALAAVPAGIIAIGALFL  224

Query  620   PETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYR  799
             P+TPNSLI R    D AK+ L+RVRGTDDV+ E  DLVAAS+ S+ +  P++NIL RRYR
Sbjct  225   PDTPNSLIDRGYTDD-AKKMLRRVRGTDDVEEEYSDLVAASDESKLVSHPWRNILQRRYR  283

Query  800   PQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLL  979
             PQL  A A+PFFQQ+TGINVI  YAPVLF+T+G  + A+LMSAV+TG V +  TF S++ 
Sbjct  284   PQLTFAIAIPFFQQLTGINVIMSYAPVLFKTLGFADDASLMSAVITGLVNVFATFVSIVT  343

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG--GLSKGWAVLVLLLISSYVAGFG  1153
             VD++GRR+L + GG  M   Q+ VG ++GAK G  G   + +G+A  V+  I +YVAGF 
Sbjct  344   VDRLGRRKLFLQGGTQMLACQIVVGSLIGAKFGFTGVADIPRGYAAFVVFFICAYVAGFA  403

Query  1154  LSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGW  1333
              SWGPLGWL+PSEIFPLEIRSAGQSITV++N L TF++ Q FL MLC  K+ +FFFFG W
Sbjct  404   WSWGPLGWLVPSEIFPLEIRSAGQSITVSMNMLCTFIIAQAFLPMLCRFKFMLFFFFGAW  463

Query  1334  VAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             V VMT FV   LPETKN+PIE+M LVW+ HW+W + +
Sbjct  464   VIVMTLFVAFFLPETKNVPIEEMVLVWKAHWYWGRFI  500



>gb|KHG17738.1| Sugar transport 7 -like protein [Gossypium arboreum]
Length=510

 Score =   517 bits (1331),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 263/457 (58%), Positives = 348/457 (76%), Gaps = 4/457 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL+ FFH VY  + +     +NYCK+D++ L +FTSSLY AGL ASL+AS +
Sbjct  49    GGVTSMDGFLREFFHSVY--ISKQHAHENNYCKYDNQGLAAFTSSLYFAGLVASLVASPI  106

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  SI+ GG +FL GA +  AA N+ ML+FGR++LG+G+GF NQAVPLYLSEMAP
Sbjct  107   TRKYGRRTSIICGGFSFLVGATVNAAAQNLAMLLFGRIMLGVGIGFGNQAVPLYLSEMAP  166

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
                RG +N+ FQL   +G+  AN++NYGT+K+ + WGWR+SLGLAA+PAT++T+G  +LP
Sbjct  167   THLRGALNMMFQLATTLGIFTANMVNYGTQKL-EPWGWRLSLGLAAIPATLMTVGGCLLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLI+  +   G ++ L+R+RGTD V AE +D++ ASE++ +I+ PF+NIL +R RP
Sbjct  226   ETPNSLIEMGSKERG-RKVLERIRGTDKVDAEFEDMLDASELANSIKHPFRNILKKRNRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA  +P FQ +TGIN I FYAPVLF+++G G +A+L S+ VTGAV   +TF S+  V
Sbjct  285   QLVMAICMPTFQILTGINSILFYAPVLFQSMGFGGNASLYSSAVTGAVLAGSTFISIAAV  344

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             D++GRR LLI GGI M + Q+ V  ++G K GD   LSKG+++LV+++I  +V  FG SW
Sbjct  345   DRLGRRVLLISGGIQMIICQVIVAIILGVKFGDNQELSKGYSILVVVVICLFVLAFGWSW  404

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGW +PSEIFPLEIRSAGQSITVAVN LFTF++ Q FLAMLCH K+GIF FF  W+ V
Sbjct  405   GPLGWTVPSEIFPLEIRSAGQSITVAVNLLFTFIIAQCFLAMLCHFKFGIFLFFASWITV  464

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIVV*Y  1453
             MT FVY  LPETK +PIE++  +WR+HWFWK+I+  Y
Sbjct  465   MTVFVYFFLPETKGVPIEEIIFLWRKHWFWKRIIPEY  501



>ref|XP_003557694.1| PREDICTED: LOW QUALITY PROTEIN: sugar carrier protein C-like 
[Brachypodium distachyon]
Length=518

 Score =   516 bits (1330),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 270/457 (59%), Positives = 345/457 (75%), Gaps = 5/457 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM PFLK+FF + Y K +  +G  + YCK+D++LL +FTSSLY+A L AS  A++V
Sbjct  45    GGVTSMNPFLKKFFPEXYEKKQSATGT-NQYCKYDNQLLQTFTSSLYLAALVASFFAATV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+  GG+ FL GAAL GAA N+ MLI GR+LLG+GVGFANQ+VP+YLSEMAP
Sbjct  104   TRVMGRKWSMFAGGLTFLVGAALNGAAENIAMLIIGRILLGVGVGFANQSVPVYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A+ RG +N+ FQL + IG+L A LINYGT KI+ G+GWRVSL LAAVPA ++T+G++ LP
Sbjct  164   ARLRGMLNIGFQLMITIGILAAALINYGTNKIKSGYGWRVSLALAAVPAGIITLGSLFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTD-DVQAELDDLVAASEISRTIERPFKNILHRRYR  799
             +TPNSLI+R +  + A+  L R+RG D D+ AE  DLV ASE S+ +  P++NIL RRYR
Sbjct  224   DTPNSLIERGHP-ESARAMLARIRGADVDISAEYGDLVVASEESKLVTHPWRNILERRYR  282

Query  800   PQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLL  979
              QL MA A+PFFQQ+TGINVI FYAPVLF T+G     ALMSAV+TG V +  T  S+  
Sbjct  283   AQLTMAIAIPFFQQLTGINVIMFYAPVLFETLGFKGDGALMSAVITGLVNVFATLVSVFT  342

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG--GLSKGWAVLVLLLISSYVAGFG  1153
             VD++GRR+L + GG  M ++Q+ VG ++  + G  G   + KG+A  V+L I  YVAGF 
Sbjct  343   VDRLGRRKLFLQGGSQMLLSQLVVGTLIAVRFGTSGVGEMPKGYAAAVVLFICVYVAGFA  402

Query  1154  LSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGW  1333
              SWGPLGWL+PSEIFPLEIR AGQSI V+VN LFTF++ Q FL MLCHLK+G+F+FF GW
Sbjct  403   WSWGPLGWLVPSEIFPLEIRPAGQSINVSVNMLFTFVIAQAFLTMLCHLKFGLFYFFAGW  462

Query  1334  VAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             V +MT F+ L LPETKN+PIE+M LVW+ HWFWK+ +
Sbjct  463   VVIMTVFIALFLPETKNVPIEEMVLVWKGHWFWKRFI  499



>ref|XP_004955304.1| PREDICTED: sugar carrier protein C-like isoform X2 [Setaria italica]
Length=490

 Score =   514 bits (1325),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 258/456 (57%), Positives = 330/456 (72%), Gaps = 31/456 (7%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+PFL++FF  V+ K KE   K + YCK+D++LL +FTSSLY+A L AS  A++V
Sbjct  45    GGVTSMDPFLEKFFPQVFHKKKEV--KTNQYCKYDNQLLQTFTSSLYLAALVASFFAATV  102

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR                          NV MLI GR+LLG+GVGFANQ+VP+YLSEMAP
Sbjct  103   TR--------------------------NVAMLIIGRILLGVGVGFANQSVPVYLSEMAP  136

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A+ RG +N+ FQL + IG+L A LINYGT KI+ G+GWRVSL LAAVPA ++T+G++ LP
Sbjct  137   ARLRGMLNIGFQLMITIGILAAELINYGTNKIKAGYGWRVSLALAAVPAGIITLGSLFLP  196

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSL++R    D A+R L+R+RGT+D+  E  DLVAASE +R +  P++NI+ RRYR 
Sbjct  197   DTPNSLLER-GHADEARRMLRRIRGTEDIGEEYADLVAASEEARQVRHPWRNIVKRRYRA  255

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QL MA  +PFFQQ+TGINVI FYAPVLF T+G    A+LMS+V+TG V +  T  S+  V
Sbjct  256   QLTMAIMIPFFQQLTGINVIMFYAPVLFETLGFKGDASLMSSVITGLVNVFATVVSIFTV  315

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG--GLSKGWAVLVLLLISSYVAGFGL  1156
             D++GRR L + GG  M + Q+ VG ++ AK G  G   + KG+A +V+L I  YVAGF  
Sbjct  316   DRLGRRALFLQGGAQMIICQVVVGSLIAAKFGTSGIGEMPKGYAAVVVLFICVYVAGFAW  375

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSEIFPLEIR AGQSI V+VN  FTF + Q FL MLCH K+G+F+FFGGWV
Sbjct  376   SWGPLGWLVPSEIFPLEIRPAGQSINVSVNMFFTFCIAQAFLTMLCHFKFGLFYFFGGWV  435

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              +MT F+ L LPETKN+PIE+M LVW+ HWFWKK +
Sbjct  436   VIMTIFIALFLPETKNVPIEEMVLVWKSHWFWKKFI  471



>ref|XP_002981389.1| hypothetical protein SELMODRAFT_154400 [Selaginella moellendorffii]
 gb|EFJ17577.1| hypothetical protein SELMODRAFT_154400 [Selaginella moellendorffii]
Length=535

 Score =   516 bits (1330),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 271/454 (60%), Positives = 345/454 (76%), Gaps = 2/454 (0%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL++FF  VY   ++     ++YCK+D++ LT+FTSSLY+A L AS +A+ V
Sbjct  47    GGVTSMDDFLEKFFPVVYRNKQKPVSGNAHYCKYDNQGLTTFTSSLYLAALIASFVAAWV  106

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T+  GR PSIL+GG++FL GA L GAA N+ MLI GR++LGIGVGF NQAVPLYLSE+AP
Sbjct  107   TKRYGRRPSILLGGLSFLVGAVLTGAAENIEMLILGRIMLGIGVGFGNQAVPLYLSELAP  166

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             AK RG MN+ FQL + IG+L ANLINYGT KI   WGWR+SL LA VPA  +T+G   LP
Sbjct  167   AKIRGAMNIMFQLAITIGILCANLINYGTAKIHP-WGWRLSLALAGVPAVFMTLGGFFLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSLI+R   HD  ++ L++VRGT+ V  E +D+V AS+ +  ++ P+KN+L  + RP
Sbjct  226   DTPNSLIER-GRHDRGRKVLRKVRGTEKVDVEYEDIVEASQKANMVKHPYKNLLMSKNRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVM+  +PFFQQ+TGINVI FYAPVLF TIG G  A+L SAV+TGAV +V+TF S++ V
Sbjct  285   QLVMSILIPFFQQLTGINVIMFYAPVLFETIGFGHDASLYSAVITGAVNLVSTFLSIITV  344

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK GRR LL+ GG+ MF +Q+ +G V+G K      + KGWA  V++LI  YV+ F  SW
Sbjct  345   DKYGRRLLLLEGGVQMFFSQIVIGIVLGVKFSSSSNIPKGWAAFVVVLICLYVSAFAWSW  404

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGWLIPSEI+PLE RSAGQSITV+VN LFTF++ Q FL MLC  K+G+F FF GWV +
Sbjct  405   GPLGWLIPSEIYPLETRSAGQSITVSVNMLFTFVIAQAFLKMLCTFKFGVFLFFAGWVLI  464

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY  +PETKN+PIE+M LVWR HWFWK+IV
Sbjct  465   MTIFVYFFVPETKNVPIEEMMLVWRSHWFWKRIV  498



>ref|XP_010112199.1| Sugar transport protein 7 [Morus notabilis]
 gb|EXC32908.1| Sugar transport protein 7 [Morus notabilis]
Length=501

 Score =   515 bits (1326),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 267/457 (58%), Positives = 346/457 (76%), Gaps = 4/457 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL+RFF +VY K K  S   +NYCKF+++ L +FTSSLY+AGL +SLLAS V
Sbjct  49    GGVTSMDGFLERFFKEVYRKKK--SAHENNYCKFNNQELAAFTSSLYLAGLVSSLLASPV  106

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  SI+ GGV+F  GA L   A+N+ MLI GR+LLG+G+GF NQAVPLYLSEMAP
Sbjct  107   TRNYGRRASIISGGVSFFVGATLNALAVNMAMLILGRILLGVGIGFGNQAVPLYLSEMAP  166

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A  RG +N+ FQL   +G+  AN++NYGT+K+ + WGWRVSLGLAAVPA ++T+G + LP
Sbjct  167   AHLRGALNMMFQLATTLGIFTANMVNYGTQKLGN-WGWRVSLGLAAVPALMMTVGGIFLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPN+L++R     G ++ LQ++RGT +V AE  D+V AS IS  IE PF+NI   R RP
Sbjct  226   ETPNNLVERGFKERG-RKGLQKIRGTKNVDAEFQDIVDASAISSAIEHPFENIFENRNRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA  +P FQ +TGIN I FYAPVLF+++G G +A+L S+ +TGAV   +T  SM +V
Sbjct  285   QLVMAIFMPMFQILTGINSILFYAPVLFQSMGFGRNASLYSSAITGAVLASSTLISMAIV  344

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             D++GRR LLI GGI M + Q+ +  ++G KLGD   LSK +++LV+++I  +V  FG SW
Sbjct  345   DRLGRRALLISGGIQMIICQVILAIILGVKLGDNQELSKDFSILVVIVICLFVLAFGWSW  404

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGW +PSEIFPLE RSAGQSITVAVN LFTF++GQ FL++LC  K+GIF FF GW+ +
Sbjct  405   GPLGWTVPSEIFPLETRSAGQSITVAVNLLFTFIIGQFFLSLLCAFKFGIFLFFAGWITL  464

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIVV*Y  1453
             MT FVY+ LPETK +PIE+M  +WR+HWFWK+IV  Y
Sbjct  465   MTIFVYVFLPETKGVPIEEMTFLWRKHWFWKRIVPEY  501



>ref|XP_006396402.1| hypothetical protein EUTSA_v10028576mg [Eutrema salsugineum]
 gb|ESQ37855.1| hypothetical protein EUTSA_v10028576mg [Eutrema salsugineum]
Length=523

 Score =   515 bits (1327),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 263/454 (58%), Positives = 350/454 (77%), Gaps = 4/454 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL+ FFH VY K K      SNYCK+D + L +FTSSLY+AGL ++L+AS +
Sbjct  49    GGVTSMDEFLEEFFHSVYEKKKH--AHESNYCKYDDQGLAAFTSSLYLAGLVSTLVASPI  106

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  SI+ GG++F  GAAL   A+N+ ML+ GR+LLGIG+GF NQAVPLYLSE+AP
Sbjct  107   TRNYGRRASIVCGGISFFLGAALNAGAVNLAMLLAGRILLGIGIGFGNQAVPLYLSEVAP  166

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
                RGG+N+ FQL   +G+  AN++N+GT+K++  WGWR+SLGLAA PA ++T+G  +LP
Sbjct  167   THLRGGLNMMFQLATTLGIFTANMVNFGTQKLKP-WGWRLSLGLAAFPALLMTLGGFLLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSL++R     G +R L+++RGT +V AEL D+V ASE++ +I+ PF+NIL +R+RP
Sbjct  226   ETPNSLVERGLTERG-RRVLEKLRGTKNVNAELQDMVDASELANSIKHPFRNILQKRHRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA  +P FQ +TGIN I FYAPVLF+T+G G +A+L S+ +TGAV +++T  S+ LV
Sbjct  285   QLVMAICMPMFQILTGINSILFYAPVLFQTMGFGGNASLYSSALTGAVLVLSTLVSIALV  344

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             D++GRR LLI GG+ M + Q+ V  ++G K GD   LSKG++++V++ I  +V  FG SW
Sbjct  345   DRLGRRALLISGGLQMIICQVIVAVILGVKFGDNQELSKGYSIVVVIFICLFVIAFGWSW  404

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGW IPSEIFPLE RSAGQSITVAVN LFTF++ Q FL++LC  K+GIF FF GWV+V
Sbjct  405   GPLGWTIPSEIFPLETRSAGQSITVAVNLLFTFIIAQAFLSLLCAFKFGIFLFFAGWVSV  464

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY LLPETK +PIE+M L+W++HWFWKKI+
Sbjct  465   MTIFVYFLLPETKGVPIEEMTLLWKKHWFWKKIL  498



>ref|NP_192114.1| sugar transport protein 7 [Arabidopsis thaliana]
 sp|O04249.1|STP7_ARATH RecName: Full=Sugar transport protein 7; AltName: Full=Hexose 
transporter 7 [Arabidopsis thaliana]
 gb|AAC78697.1| putative hexose transporter [Arabidopsis thaliana]
 emb|CAB80698.1| putative hexose transporter [Arabidopsis thaliana]
 emb|CAC69067.1| STP7 protein [Arabidopsis thaliana]
 gb|AEE82116.1| sugar transport protein 7 [Arabidopsis thaliana]
Length=513

 Score =   514 bits (1325),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 263/454 (58%), Positives = 349/454 (77%), Gaps = 4/454 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL+ FFH VY K K+     SNYCK+D++ L +FTSSLY+AGL ++L+AS +
Sbjct  49    GGVTSMDEFLEEFFHTVYEKKKQ--AHESNYCKYDNQGLAAFTSSLYLAGLVSTLVASPI  106

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  SI+ GG++FL G+ L   A+N+ ML+ GR++LG+G+GF NQAVPLYLSE+AP
Sbjct  107   TRNYGRRASIVCGGISFLIGSGLNAGAVNLAMLLAGRIMLGVGIGFGNQAVPLYLSEVAP  166

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
                RGG+N+ FQL   IG+  AN++NYGT++++  WGWR+SLGLAA PA ++T+G   LP
Sbjct  167   THLRGGLNMMFQLATTIGIFTANMVNYGTQQLKP-WGWRLSLGLAAFPALLMTLGGYFLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSL++R     G +R L ++RGT++V AEL D+V ASE++ +I+ PF+NIL +R+RP
Sbjct  226   ETPNSLVERGLTERG-RRVLVKLRGTENVNAELQDMVDASELANSIKHPFRNILQKRHRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA  +P FQ +TGIN I FYAPVLF+T+G G +A+L S+ +TGAV +++TF S+ LV
Sbjct  285   QLVMAICMPMFQILTGINSILFYAPVLFQTMGFGGNASLYSSALTGAVLVLSTFISIGLV  344

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             D++GRR LLI GGI M + Q+ V  ++G K GD   LSKG++V+V++ I  +V  FG SW
Sbjct  345   DRLGRRALLITGGIQMIICQVIVAVILGVKFGDNQELSKGYSVIVVIFICLFVVAFGWSW  404

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGW IPSEIFPLE RSAGQSITVAVN LFTF++ Q FL +LC  K+GIF FF GWV V
Sbjct  405   GPLGWTIPSEIFPLETRSAGQSITVAVNLLFTFIIAQAFLGLLCAFKFGIFLFFAGWVTV  464

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY LLPETK +PIE+M L+W +HWFWKK++
Sbjct  465   MTIFVYFLLPETKGVPIEEMTLLWSKHWFWKKVL  498



>ref|XP_010106347.1| Sugar transport protein 7 [Morus notabilis]
 gb|EXC10160.1| Sugar transport protein 7 [Morus notabilis]
Length=501

 Score =   514 bits (1324),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 265/454 (58%), Positives = 346/454 (76%), Gaps = 4/454 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL+RFF +VY K K  S   +NYCK+++++L +FTSSLY+AGL +SLLAS V
Sbjct  49    GGVTSMDGFLERFFKEVYRKKK--SAHENNYCKYNNQVLAAFTSSLYLAGLVSSLLASLV  106

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  SI+ GGV+F  GA L  +A+N+ MLI GR+LLG+G+GF NQAVPLYLSEMAP
Sbjct  107   TRNHGRRASIISGGVSFFVGATLNASAVNMAMLILGRILLGVGIGFGNQAVPLYLSEMAP  166

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A  RG +N+ FQL   +G+  AN++NYGT+K+ + WGWRVSLGLAAVPA ++T+G + LP
Sbjct  167   AHLRGALNMMFQLATTLGIFTANMVNYGTQKLGN-WGWRVSLGLAAVPALMMTVGGIFLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPN+L++R     G ++ LQ++RGT +V AE  D+V AS IS  IE PF+NI   R RP
Sbjct  226   ETPNNLVERGFKERG-RKGLQKIRGTKNVDAEFQDIVDASAISSAIEHPFENIFENRNRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA  +P FQ +TGIN I FYAPVLF+++G G +A+L S+ +TGAV   +T  SM  V
Sbjct  285   QLVMAIFMPMFQILTGINSILFYAPVLFQSMGFGRNASLYSSAITGAVLASSTLISMATV  344

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             D++GRR LLI GGI M + Q+ V  ++G KLGD   LSK +++LV+++I  +V  FG SW
Sbjct  345   DRLGRRALLISGGIQMIICQVIVAIILGVKLGDNQELSKDFSILVVIVICLFVLAFGWSW  404

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGW +PSEIFPLE RSAGQSITVAVN LFTF++ Q+FL++LC  K+GIF FF GW+ +
Sbjct  405   GPLGWTVPSEIFPLETRSAGQSITVAVNLLFTFIIAQSFLSLLCAFKFGIFLFFAGWITL  464

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY+ LPETK +PIE+M  +WR+HWFWK+IV
Sbjct  465   MTIFVYVFLPETKGVPIEEMTFLWRKHWFWKRIV  498



>ref|XP_008441745.1| PREDICTED: sugar transport protein 10-like [Cucumis melo]
Length=518

 Score =   514 bits (1325),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 267/457 (58%), Positives = 357/457 (78%), Gaps = 5/457 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSME FLK+FF  VY +  + SG  + YCKFDS+LLT FTSSLY+A L AS  AS V
Sbjct  45    GGVTSMEHFLKQFFPSVYEQEAKASGG-NQYCKFDSQLLTLFTSSLYLAALVASFFASIV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR  S+L GG+ FL G+ L GAA+NV MLI GR+LLG+GVGFANQ+VP+YLSEMAP
Sbjct  104   TRAFGRKMSMLTGGLVFLVGSILNGAAVNVEMLIIGRLLLGVGVGFANQSVPVYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              K RG +N+ FQ+ + IG+L+ANL+NYGT +I+DGWGWR+SL LAAVPA ++T+GA  LP
Sbjct  164   PKIRGALNIGFQMAITIGILVANLVNYGTAQIKDGWGWRLSLALAAVPAIMMTVGAFFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNS+++R  D + A++ L+++RG ++V  E  +LV A E ++ ++ P+KNI+  RYRP
Sbjct  224   DTPNSILER-GDMEKARQMLKKIRGLENVDGEFQELVDACEAAKKVQHPWKNIMQPRYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLV+   +PFFQQ+TGINVI FYAPVL++T+G G+SA+LMSAV++GAV ++ T  S++ V
Sbjct  283   QLVICCVIPFFQQLTGINVITFYAPVLYKTLGFGDSASLMSAVISGAVNVLATIVSIVTV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLG--DQGGLSKG-WAVLVLLLISSYVAGFG  1153
             DK GR+ L + GG  MF++Q+AVG ++    G   +G +S G  A ++L LI  YVAGF 
Sbjct  343   DKFGRKFLFLEGGAQMFISQVAVGSMIWKTFGVNGEGSMSGGVEADILLALICVYVAGFA  402

Query  1154  LSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGW  1333
              SWGPLGWL+PSEI PLEIRSAGQ+I V+VN L+TF++GQ FL+MLCH+K+G+F+FF G+
Sbjct  403   WSWGPLGWLVPSEICPLEIRSAGQAINVSVNMLWTFVIGQLFLSMLCHMKFGLFYFFAGF  462

Query  1334  VAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             VA+MT F+Y  LPETKN+PIE+M+ VW+ HWFW K +
Sbjct  463   VALMTIFIYWFLPETKNVPIEEMNRVWKAHWFWGKFI  499



>ref|XP_008336926.1| PREDICTED: sugar transport protein 7 isoform X2 [Malus domestica]
Length=518

 Score =   514 bits (1324),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 264/454 (58%), Positives = 347/454 (76%), Gaps = 4/454 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FLK+FF  VY    +   + +NYCK+D++ L +FTSSLY+AGL ASL+AS V
Sbjct  49    GGVTSMDGFLKKFFKTVYKN--KTHARENNYCKYDNQGLAAFTSSLYLAGLVASLVASPV  106

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  SI+ GG++FL GA L  +A N+ MLI GR++LG+G+GF NQA+PLYLSEMAP
Sbjct  107   TRNYGRRGSIICGGISFLVGATLNASAANLAMLILGRIMLGVGIGFGNQAIPLYLSEMAP  166

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
                RG +N+ FQL   +G+  AN++NYGT+K+ + WGWR+SLGLA VPA V+T+G + LP
Sbjct  167   THLRGALNMMFQLATTLGIFTANMVNYGTQKL-EPWGWRLSLGLALVPAAVMTVGGICLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLI+R    +G ++ L+R+RGT +V AE  D++ ASE +  I+ PF+N+L RR RP
Sbjct  226   ETPNSLIERGCKDEG-RKILERIRGTKNVSAEFQDMLDASEFASAIKHPFRNVLERRNRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA  +P FQ +TGIN I FYAPVLF+++G G +AAL S+ +TGAV + +T  S+  V
Sbjct  285   QLVMAIFMPTFQILTGINSILFYAPVLFQSMGFGGNAALYSSALTGAVLVTSTLLSIAAV  344

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR LLI GGI M V Q+ V  ++G KLGD   LSKG++VLV+ +I  +V  FG SW
Sbjct  345   DKLGRRVLLITGGIQMIVCQVIVAVILGTKLGDNQELSKGFSVLVVAVICLFVIAFGYSW  404

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGW +PSEIFPLE RSAGQSITV+VN LFTF++ Q+FL++LC LK+GIF FF GW+ +
Sbjct  405   GPLGWTVPSEIFPLETRSAGQSITVSVNLLFTFIIAQSFLSLLCALKFGIFLFFAGWITI  464

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVYL LPETK +PIE+M L+WR+HWFWK+I+
Sbjct  465   MTVFVYLFLPETKGIPIEEMILMWRKHWFWKRIM  498



>ref|NP_001145934.1| monosaccharide transport protein 2 [Zea mays]
 gb|ACN25319.1| unknown [Zea mays]
 gb|AFW61108.1| monosaccharide transport protein 2 [Zea mays]
Length=514

 Score =   514 bits (1324),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 277/456 (61%), Positives = 343/456 (75%), Gaps = 4/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM  FLK FF  VY K   +    + YCKFDS+LLT FTSSLY+A L  S +A+SV
Sbjct  45    GGVTSMASFLKEFFPSVYAKAAANK-DTNQYCKFDSQLLTLFTSSLYLAALATSFVAASV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+  GGV FLAG+AL GAA +V MLI GR+LLG+GVGFANQ+VPLYLSEMAP
Sbjct  104   TRVFGRKWSMFCGGVTFLAGSALNGAATDVMMLIMGRILLGVGVGFANQSVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             AK RG +N+ FQL   IG+L ANLIN+ T  I  GWGWR+ LGLA VPA ++T+GA+VLP
Sbjct  164   AKLRGMLNIGFQLMTTIGILAANLINFWTAGIEGGWGWRIGLGLAGVPALIITLGALVLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSLI R  + D AK  L ++RGTDDVQ E DD+VAASE +  IE P++NIL RRYRP
Sbjct  224   DTPNSLIARGFNDD-AKAVLVKIRGTDDVQDEYDDMVAASEEANAIEHPWRNILERRYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QL +A  +PFFQQ+TGINVI FYAPVLF TIG G+ A+LM+AV+TG V +  T  S++ V
Sbjct  283   QLTVAALIPFFQQLTGINVIMFYAPVLFLTIGFGDDASLMAAVITGLVNMFATVVSIVCV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG--GLSKGWAVLVLLLISSYVAGFGL  1156
             D++GRR L + GG  MFV+Q+ VG ++  + G  G   +S+  A L++L I  YVAGF  
Sbjct  343   DRLGRRALFLQGGTQMFVSQIVVGTLIALQFGTAGVGEMSRSNAWLLVLFICLYVAGFAW  402

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSE+F LE+RSAGQSI V VN L TF++GQ FL+MLC LK+G+F+FF GW+
Sbjct  403   SWGPLGWLVPSEVFALEVRSAGQSIAVCVNMLLTFIIGQAFLSMLCSLKFGLFYFFAGWM  462

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              +MTTF+ L LPETK +PIE+M+LVW  HWFW K V
Sbjct  463   FIMTTFIALFLPETKGVPIEEMNLVWSRHWFWGKYV  498



>ref|XP_010422647.1| PREDICTED: sugar transport protein 7 [Camelina sativa]
 ref|XP_010422648.1| PREDICTED: sugar transport protein 7 [Camelina sativa]
Length=515

 Score =   514 bits (1324),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 265/454 (58%), Positives = 348/454 (77%), Gaps = 4/454 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL  FFH VY K K      SNYCK+D++ L +FTSSLY+AGL ++L+AS +
Sbjct  49    GGVTSMDEFLDEFFHAVYEKKKH--AHESNYCKYDNQGLAAFTSSLYLAGLVSTLVASPI  106

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  SI+ GG++FL GA L   A+N+ ML+ GR++LG+G+GF NQAVPLYLSE+AP
Sbjct  107   TRNYGRRASIVCGGISFLVGAGLNAGAVNLAMLLAGRIMLGVGIGFGNQAVPLYLSEVAP  166

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
                RGG+N+ FQL   +G+  AN++N+GT+K++  WGWR+SLGLAA PA ++T+G   LP
Sbjct  167   THLRGGLNMMFQLATTLGIFTANMVNFGTQKLKP-WGWRLSLGLAAFPALLMTLGGYFLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSL++R     G +R L+++RGT +V AEL D+V ASE++ +I+ PF+NIL +R+RP
Sbjct  226   ETPNSLVERGLTERG-RRVLEKLRGTKNVDAELQDMVDASELANSIKHPFRNILQKRHRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA  +P FQ +TGIN I FYAPVLF+T+G G +A+L S+ +TGAV +++T  S+ LV
Sbjct  285   QLVMAICMPMFQILTGINSILFYAPVLFQTMGFGGNASLYSSALTGAVLVLSTLISIGLV  344

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR LLI GGI M + Q+ V  ++G K GD+  LSKG++V+V++ I  +V  FG SW
Sbjct  345   DKLGRRALLISGGIQMIICQVIVAVILGVKFGDKQELSKGYSVIVVIFICLFVVAFGWSW  404

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGW IPSEIFPLE RSAGQSITVAVN LFTF++ Q FLA+LC  K+GIF FF GWV V
Sbjct  405   GPLGWTIPSEIFPLETRSAGQSITVAVNLLFTFIIAQAFLALLCAFKFGIFLFFAGWVTV  464

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY LLPETK +PIE+M L+W +HWFWKKI+
Sbjct  465   MTIFVYFLLPETKGVPIEEMTLLWSKHWFWKKIL  498



>ref|XP_008670623.1| PREDICTED: sugar transport protein 1-like [Zea mays]
 tpg|DAA41650.1| TPA: hypothetical protein ZEAMMB73_552417 [Zea mays]
Length=510

 Score =   514 bits (1323),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 267/457 (58%), Positives = 338/457 (74%), Gaps = 4/457 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+PFLKRFF  VY K +++  + + YCKFDS LLT FTSSLY+A L ASL A  +
Sbjct  43    GGVTSMDPFLKRFFPSVYAK-EQEVVETNQYCKFDSVLLTLFTSSLYLAALVASLFAGYI  101

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T+ CGR  S+L GG  FL GA L G A NV MLI GR+ LGIGVGF+NQ+VPLYLSEMAP
Sbjct  102   TKRCGRRVSMLGGGAIFLVGAVLNGLAQNVAMLIIGRIFLGIGVGFSNQSVPLYLSEMAP  161

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             AK RG +N+SFQL   +G+L+ANLINY T KI  GWGWR+ LGLAAVPA ++  G++ LP
Sbjct  162   AKMRGMLNISFQLMTTVGILVANLINYFTAKIPGGWGWRIGLGLAAVPAVIMVGGSIFLP  221

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSL+ R    + A+  L+R+RGTDDV  E DDLVAASE S  I+ P+  +L RRYRP
Sbjct  222   DTPNSLVAR-GKVESARAMLRRIRGTDDVSLEFDDLVAASEASEAIQNPWGTLLQRRYRP  280

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA  +P  QQ+TGINV+ FYAPVLF+TIG G +A+LMSAV+TG V + +TF S+  V
Sbjct  281   QLVMAVLIPTLQQLTGINVVMFYAPVLFKTIGFGGTASLMSAVITGLVNMFSTFVSIATV  340

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG--GLSKGWAVLVLLLISSYVAGFGL  1156
             D++GRR+LL+ GGI M + Q  +G ++  K G  G   +S+ +A+ V+  I  +V+ F  
Sbjct  341   DRLGRRKLLLEGGIQMILAQFVLGTLIAVKFGTTGVAAISRPYAIGVVFCICVFVSAFAW  400

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSEIFPLEIRSA QS+ V  N +FTF++ Q FL +LCHLK+G+F+FFG W 
Sbjct  401   SWGPLGWLVPSEIFPLEIRSAAQSVVVVFNMIFTFIIAQIFLMLLCHLKFGLFYFFGAWE  460

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIVV  1447
               MT FVY  LPETK +PIE+MD +W  HW+WK+  V
Sbjct  461   IAMTLFVYFFLPETKGIPIEEMDRIWANHWYWKRFAV  497



>ref|NP_001141959.1| uncharacterized protein LOC100274108 [Zea mays]
 gb|ACF87379.1| unknown [Zea mays]
Length=523

 Score =   514 bits (1324),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 270/454 (59%), Positives = 353/454 (78%), Gaps = 4/454 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+PFL++FF  V+ +  ++SG  +NYCK+D++ L +FTSSLY+AGL ASL+AS V
Sbjct  49    GGVTSMDPFLEKFFPVVFHR--KNSGGKNNYCKYDNQGLAAFTSSLYLAGLVASLVASPV  106

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  SI+ GGV+FL GAAL  AA+N+ MLI GR++LG+G+GF NQAVPLYLSEMAP
Sbjct  107   TRNYGRKASIVCGGVSFLIGAALNVAAVNLAMLILGRIMLGVGIGFGNQAVPLYLSEMAP  166

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A  RGG+N+ FQL   +G+  ANLINYGT+ I+  WGWR+SLGLAAVPA ++T+G + LP
Sbjct  167   AHLRGGLNMMFQLATTLGIFTANLINYGTQNIKP-WGWRLSLGLAAVPALLMTLGGLFLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLI+R    +G +R L+R+RGT DV AE  D+V ASE++ T+E PF+NIL  R RP
Sbjct  226   ETPNSLIERGRVEEG-RRVLERIRGTADVDAEFTDMVEASELANTVEHPFRNILQPRNRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA  +P FQ +TGIN I FYAPVLF+++G G +A+L S+V+TGAV   +T  S+ +V
Sbjct  285   QLVMAVCMPAFQILTGINSILFYAPVLFQSMGFGGNASLYSSVLTGAVLFSSTLISIGIV  344

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             D++GRR+LLI GGI M V Q+ V  ++G K G +  L++ ++V V+++I  +V  FG SW
Sbjct  345   DRLGRRKLLISGGIQMIVCQVIVAVILGVKFGAEKQLARSYSVAVVVVICLFVLAFGWSW  404

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGW +PSEIFPLE RSAGQSITVAVN LFTF + Q FL++LC  K+GIF FF GW+ V
Sbjct  405   GPLGWTVPSEIFPLETRSAGQSITVAVNLLFTFAIAQAFLSLLCAFKFGIFLFFAGWITV  464

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY+ LPETK +PIE+M L+WR+HWFWKK++
Sbjct  465   MTVFVYVFLPETKGVPIEEMVLLWRKHWFWKKVM  498



>ref|XP_008811880.1| PREDICTED: sugar transport protein 1-like [Phoenix dactylifera]
Length=515

 Score =   514 bits (1323),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 265/456 (58%), Positives = 342/456 (75%), Gaps = 4/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL +FF  VY + KE+    + YCKFDS+LLT+FTSSLY+A L AS +AS++
Sbjct  45    GGVTSMDSFLLKFFPSVYKEEKENV-STNQYCKFDSQLLTAFTSSLYLAALIASFVASTM  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+ + GV+ L G+AL G A NV +LI GR+LLG+GVGFANQ+VP+YLSEMAP
Sbjct  104   TRMYGRRWSMFVSGVSVLVGSALNGLAENVLILIVGRILLGVGVGFANQSVPVYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A+ RG +N+ FQL   IG+ +AN++NYGT KI  GWGWRVSL L AVPA ++TIG++ L 
Sbjct  164   ARLRGMLNICFQLMTTIGIFVANVVNYGTAKISGGWGWRVSLALGAVPAVIITIGSLFLF  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSLI+R    + AK  L R+RGTDD+  E DDLV ASE S+ ++ P+ NIL R+YRP
Sbjct  224   DTPNSLIER-GHKEKAKVVLSRIRGTDDIYHEYDDLVVASEESKAVKHPWSNILKRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QL MA  +PFFQQVTGIN I  YAPVLF+TIG G  A+LMSAV+ G V +++T  S+  V
Sbjct  283   QLTMAILIPFFQQVTGINAIMLYAPVLFKTIGFGTEASLMSAVIIGVVKVLSTLVSIATV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGG--LSKGWAVLVLLLISSYVAGFGL  1156
             DK+GRR L + GG  M + Q+ VG ++  K G +G   +SK +A+ V++ I  Y+AGF  
Sbjct  343   DKLGRRVLFLQGGTQMIICQIIVGTLIAIKFGTEGHAIVSKPYAISVVVFICLYMAGFAW  402

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSEIFPLEIRSAGQSITV+VN   TF+  Q FL + CH+K+G+F+FF GWV
Sbjct  403   SWGPLGWLVPSEIFPLEIRSAGQSITVSVNMFVTFVNAQIFLTLFCHMKFGLFYFFSGWV  462

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              +MT F+ L LPETKN+PIE+M LVW++HWFW K +
Sbjct  463   TMMTIFIALFLPETKNVPIEEMVLVWKKHWFWGKFI  498



>ref|XP_010457418.1| PREDICTED: sugar transport protein 3-like [Camelina sativa]
Length=514

 Score =   513 bits (1322),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 279/457 (61%), Positives = 355/457 (78%), Gaps = 4/457 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSG---KVSNYCKFDSELLTSFTSSLYIAGLFASLLA  253
             GGV SM PFLKRFF  VY   +ED       ++YC F+S+LLTSFTSSLY++G  A+LLA
Sbjct  46    GGVMSMGPFLKRFFPKVYKLQEEDRTIRRSNNHYCLFNSQLLTSFTSSLYVSGFVATLLA  105

Query  254   SSVTRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSE  433
             SSVTR+ GR PSI +GG+AFLAG+ALGG+A NV MLI  R+LLG+GVGFANQ+VPLYLSE
Sbjct  106   SSVTRSWGRKPSIFLGGLAFLAGSALGGSAQNVAMLIIARLLLGVGVGFANQSVPLYLSE  165

Query  434   MAPAKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAV  613
             MAPAKYRG ++  FQLC+GIG L ANLINY T+KI+ G+GWR+SL  AA+PA++LT+G++
Sbjct  166   MAPAKYRGAISNGFQLCIGIGFLTANLINYETQKIKHGYGWRISLATAAIPASILTLGSL  225

Query  614   VLPETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRR  793
              LPETPNS+IQ   D   A+  L+RVRGT +VQ EL DL+ AS  S T    F  +L ++
Sbjct  226   FLPETPNSIIQTTGDVRKAELMLRRVRGTQNVQDELTDLIEASSDSATDSNAFVVLLQKK  285

Query  794   YRPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASM  973
             YRP+LVMA A+PFFQQVTGINV+AFYAPVLFRT+G GES +LMS +VTG VG  +TF SM
Sbjct  286   YRPELVMALAIPFFQQVTGINVVAFYAPVLFRTVGFGESGSLMSTLVTGIVGTASTFLSM  345

Query  974   LLVDKVGRRRLLIVGGILMFVTQMAVGG-VMGAKLGDQGGLSKGWAVLVLLLISSYVAGF  1150
             L+VD++GR+ L  +GG+ M V Q+ +G  +M A+  + G + +G+   V++L+  YVAGF
Sbjct  346   LVVDRIGRKTLFFIGGLQMLVAQVTIGVIIMVAEGHNNGVIGEGYDYTVVVLVCVYVAGF  405

Query  1151  GLSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGG  1330
             G SWGPLGWL+PSEIFPLEIRSA QS+TVAV+F+FTF V Q+   MLC  + GIFFF+GG
Sbjct  406   GWSWGPLGWLVPSEIFPLEIRSAAQSVTVAVSFVFTFAVAQSVPPMLCKFRAGIFFFYGG  465

Query  1331  WVAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKI  1441
             WV VMT  V L LPETKN+PIE++  +W +HWFW+++
Sbjct  466   WVVVMTVAVQLFLPETKNVPIEQVAGLWDKHWFWRRM  502



>ref|XP_009338427.1| PREDICTED: sugar carrier protein A-like [Pyrus x bretschneideri]
Length=518

 Score =   514 bits (1323),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 266/454 (59%), Positives = 346/454 (76%), Gaps = 4/454 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FLK+FF  VY    +   + +NYCK+D++ L +FTSSLY+AGL ASL+AS V
Sbjct  49    GGVTSMDGFLKKFFKTVYKN--KTHARENNYCKYDNQGLAAFTSSLYLAGLVASLVASPV  106

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  SI+ GG++FL GA L   A N+ MLI GR++LG+G+GF NQA+PLYLSEMAP
Sbjct  107   TRNYGRRGSIICGGISFLVGATLNALAANLAMLILGRIMLGVGIGFGNQAIPLYLSEMAP  166

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
                RG +N+ FQL   +G+  AN++NYGT+K+ + WGWR+SLGLA VPA V+T+G ++LP
Sbjct  167   THLRGALNMMFQLATTLGIFTANMVNYGTQKL-EPWGWRLSLGLALVPAAVMTVGGILLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLI+R    +G ++ L+R+RGT +V AE  D++ ASE +  I+ PF+NIL RR RP
Sbjct  226   ETPNSLIERGCKDEG-RKVLERIRGTKNVSAEFQDMLDASEFASAIKHPFRNILERRNRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA  +P FQ +TGIN I FYAPVLF+++G G  AAL S+ +TGAV + +T  S+  V
Sbjct  285   QLVMAIFMPTFQILTGINSILFYAPVLFQSMGFGGDAALYSSALTGAVLVTSTLLSIAAV  344

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR LLI GGI M V Q+ V  ++G KLGD   LSKG++VLV+ +I  +V  FG SW
Sbjct  345   DKLGRRVLLITGGIQMIVCQVIVAVILGIKLGDNQELSKGFSVLVVAVICLFVIAFGYSW  404

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGW +PSEIFPLE RSAGQSITV+VN LFTF+V Q+FL++LC LK+GIF FF GW+ +
Sbjct  405   GPLGWTVPSEIFPLETRSAGQSITVSVNLLFTFIVAQSFLSLLCALKFGIFLFFAGWITI  464

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVYL LPETK +PIE+M L+WR+HWFWK+I+
Sbjct  465   MTVFVYLFLPETKGIPIEEMILMWRKHWFWKRIM  498



>ref|XP_010456090.1| PREDICTED: sugar transport protein 7-like [Camelina sativa]
 ref|XP_010456091.1| PREDICTED: sugar transport protein 7-like [Camelina sativa]
Length=515

 Score =   513 bits (1322),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 265/454 (58%), Positives = 347/454 (76%), Gaps = 4/454 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL  FFH VY K K      SNYCK+D++ L +FTSSLY+AGL ++L+AS +
Sbjct  49    GGVTSMDEFLDEFFHAVYEKKKH--AHESNYCKYDNQGLAAFTSSLYLAGLVSTLVASPI  106

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  SI+ GG++FL GA L   A N+ ML+ GR++LG+G+GF NQAVPLYLSE+AP
Sbjct  107   TRNYGRRASIVCGGISFLVGAGLNAGAANLAMLLAGRIMLGVGIGFGNQAVPLYLSEVAP  166

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
                RGG+N+ FQL   +G+  AN++N+GT+K++  WGWR+SLGLAA PA ++T+G   LP
Sbjct  167   THLRGGLNMMFQLATTLGIFTANMVNFGTQKLKP-WGWRLSLGLAAFPALLMTLGGYFLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSL++R     G +R L+++RGT +V AEL D+V ASE++ +I+ PF+NIL +R+RP
Sbjct  226   ETPNSLVERGLTERG-RRVLEKLRGTKNVDAELQDMVDASELANSIKHPFRNILQKRHRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA  +P FQ +TGIN I FYAPVLF+T+G G +A+L S+ +TGAV +++T  S+ LV
Sbjct  285   QLVMAICMPMFQILTGINSILFYAPVLFQTMGFGGNASLYSSALTGAVLVLSTLISIGLV  344

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR LLI GGI M + Q+ V  ++G K GD+  LSKG++V+V++ I  +V  FG SW
Sbjct  345   DKLGRRALLISGGIQMIICQVIVAVILGVKFGDKEELSKGYSVIVVIFICLFVVAFGWSW  404

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGW IPSEIFPLE RSAGQSITVAVN LFTF++ Q FLA+LC  K+GIF FF GWV V
Sbjct  405   GPLGWTIPSEIFPLETRSAGQSITVAVNLLFTFIIAQAFLALLCAFKFGIFLFFAGWVTV  464

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY LLPETK +PIE+M L+W +HWFWKKI+
Sbjct  465   MTIFVYFLLPETKGVPIEEMTLLWSKHWFWKKIL  498



>gb|EMS67764.1| Sugar carrier protein C [Triticum urartu]
Length=511

 Score =   513 bits (1322),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 273/457 (60%), Positives = 341/457 (75%), Gaps = 4/457 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL  FF  VY + K +  K + YCKFDS+LLT FTSSLY+A L  S LA+SV
Sbjct  45    GGVTSMDSFLSEFFPSVYAQAKANKEK-NQYCKFDSQLLTLFTSSLYLAALATSFLAASV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+  GG+ FLAG+AL GAA N+ MLI GR+LLGIGVGFANQ+VPLYLSEMAP
Sbjct  104   TRIFGRKWSMFCGGITFLAGSALNGAATNLMMLILGRILLGIGVGFANQSVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A  RG +N+ FQL   IG+L ANLINY T  I  GWGWR+ LGLA VPA ++T+GA+ LP
Sbjct  164   ANLRGMLNIGFQLMTTIGILSANLINYATVSIEGGWGWRIGLGLAGVPALIITLGALALP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSLI R    + AK+ L +VRGT DV  E DD+VAASE ++ IE P++NIL  +YRP
Sbjct  224   DTPNSLIARGYTAE-AKKVLVKVRGTSDVHDEYDDMVAASEEAKAIEHPWRNILEHKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QL +A  +PFFQQ+TGINVI FYAPVLF TIG G  A+LMSAV+TG V +  T  S++ V
Sbjct  283   QLTIAVLIPFFQQLTGINVIMFYAPVLFLTIGFGGDASLMSAVITGLVNMFATIISIVSV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGD--QGGLSKGWAVLVLLLISSYVAGFGL  1156
             D++GRR L + GG  MFV+Q+ VG ++  + G   +G +S+ +A+L++L I  YVAGF  
Sbjct  343   DRLGRRALFLQGGTQMFVSQIVVGTLIALQFGTTGEGEMSRTYAMLLVLFICLYVAGFAW  402

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSE+F LEIRSAGQSI V VN   TF++GQ FL MLCHLK+G+F+FF  W+
Sbjct  403   SWGPLGWLVPSEVFALEIRSAGQSIAVCVNMTLTFIIGQAFLTMLCHLKFGLFYFFAAWM  462

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIVV  1447
              +MTTF+ L LPETK +PI++M+LVW  HWFW   VV
Sbjct  463   VIMTTFIALFLPETKGVPIDEMNLVWSRHWFWSNYVV  499



>gb|ACG38482.1| sugar carrier protein A [Zea mays]
Length=523

 Score =   514 bits (1323),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 270/454 (59%), Positives = 353/454 (78%), Gaps = 4/454 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+PFL++FF  V+ +  ++SG  +NYCK+D++ L +FTSSLY+AGL ASL+AS V
Sbjct  49    GGVTSMDPFLEKFFPVVFHR--KNSGGKNNYCKYDNQGLAAFTSSLYLAGLVASLVASPV  106

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  SI+ GGV+FL GAAL  AA+N+ MLI GR++LG+G+GF NQAVPLYLSEMAP
Sbjct  107   TRNYGRKASIVCGGVSFLIGAALNVAAVNLAMLILGRIMLGVGIGFGNQAVPLYLSEMAP  166

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A  RGG+N+ FQL   +G+  ANLINYGT+ I+  WGWR+SLGLAAVPA ++T+G + LP
Sbjct  167   AHLRGGLNMMFQLATTLGIFTANLINYGTQNIKP-WGWRLSLGLAAVPALLMTLGGLFLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLI+R    +G +R L+R+RGT DV AE  D+V ASE++ T+E PF+NIL  R RP
Sbjct  226   ETPNSLIERGRVEEG-RRVLERIRGTADVDAEFTDMVEASELANTVEHPFRNILQPRNRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA  +P FQ +TGIN I FYAPVLF+++G G +A+L S+V+TGAV   +T  S+ +V
Sbjct  285   QLVMAVCMPAFQILTGINSILFYAPVLFQSMGFGGNASLYSSVLTGAVLFSSTLISIGIV  344

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             D++GRR+LLI GGI M V Q+ V  ++G K G +  L++ ++V V+++I  +V  FG SW
Sbjct  345   DRLGRRKLLISGGIQMIVCQVIVAVILGVKFGAEKQLARSYSVAVVVVICLFVLAFGWSW  404

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGW +PSEIFPLE RSAGQSITVAVN LFTF + Q FL++LC  K+GIF FF GW+ V
Sbjct  405   GPLGWTVPSEIFPLETRSAGQSITVAVNLLFTFAIAQAFLSLLCAFKFGIFLFFAGWITV  464

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY+ LPETK +PIE+M L+WR+HWFWKK++
Sbjct  465   MTVFVYVFLPETKGVPIEEMVLLWRKHWFWKKVM  498



>gb|ABK24474.1| unknown [Picea sitchensis]
Length=517

 Score =   513 bits (1322),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 279/457 (61%), Positives = 356/457 (78%), Gaps = 4/457 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSME FLK+FF DVY K  E + K S+YCKFDS++LTSFTSSLYIAGL +S +AS+ 
Sbjct  46    GGVTSMESFLKKFFPDVYKK--ESTAKNSDYCKFDSQILTSFTSSLYIAGLVSSFMASAT  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TRA GR  S+L+GG  FL+GAAL GAA+NV MLI GR+LLG+GVGFA Q+VP+YLSEMAP
Sbjct  104   TRAFGRQKSMLMGGFTFLSGAALNGAAVNVAMLILGRILLGLGVGFAVQSVPIYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              + RG +N+ FQL +GIGVL ANLINY T KI++ WGWR+SLGLAAVPA ++  G+  LP
Sbjct  164   PRMRGALNIGFQLFLGIGVLSANLINYRTAKIQN-WGWRLSLGLAAVPALIMLAGSFTLP  222

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSLI+R    + AK  L R+RGT DVQ EL D++ A EIS  ++ PF+NI+ R+YRP
Sbjct  223   DTPNSLIER-GQLEKAKAVLVRIRGTPDVQEELQDMIEACEISNKMKHPFRNIIRRKYRP  281

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA A+PFFQQ+TGINVIAFYAPVLF+TIG G  AAL++AV+ G + + +   S+ +V
Sbjct  282   QLVMALAIPFFQQLTGINVIAFYAPVLFKTIGFGSDAALLAAVILGVMNLSSIIISIFIV  341

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR L + GG+ M + Q+ +  ++  K G +GG++KG++  V+ L  +Y  GFG SW
Sbjct  342   DKLGRRALFLEGGLQMIICQVLIAIILALKFGGEGGMTKGYSSFVVFLFCAYALGFGWSW  401

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPL WL+PSEIFPLEIRSAGQ+I VAVN L TF++ Q FL+MLCH ++GIF F+ GW  +
Sbjct  402   GPLSWLVPSEIFPLEIRSAGQTINVAVNLLVTFVLSQVFLSMLCHFRFGIFLFYAGWTVI  461

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIVV*Y  1453
             MTTFVY LLPETKN+PIE+M  VW+EHWFW K+ + Y
Sbjct  462   MTTFVYFLLPETKNVPIEEMTRVWKEHWFWSKMNLDY  498



>ref|XP_004146734.1| PREDICTED: sugar transport protein 7-like [Cucumis sativus]
 ref|XP_004162461.1| PREDICTED: sugar transport protein 7-like [Cucumis sativus]
 gb|KGN65220.1| hypothetical protein Csa_1G266170 [Cucumis sativus]
Length=512

 Score =   513 bits (1322),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 265/455 (58%), Positives = 348/455 (76%), Gaps = 6/455 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVY-TKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASS  259
             GGVTSM PFLK+FF  VY  KM+      +NYCK++++ L +FTSSLY+AGL +SL+AS 
Sbjct  49    GGVTSMNPFLKKFFPTVYRNKMRAHE---NNYCKYNNQGLAAFTSSLYLAGLVSSLVASP  105

Query  260   VTRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMA  439
             +TR  GR  SI+ GG++FL GA L  AA+N+ MLI GR++LG+G+GF NQAVPLYLSEMA
Sbjct  106   ITRNYGRRASIVCGGISFLVGATLNAAAVNIEMLILGRIMLGVGIGFGNQAVPLYLSEMA  165

Query  440   PAKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVL  619
             P   RGG+N+ FQL   +G+  AN+INYGT+KI D WGWR+SLGLAA PA ++T+G ++L
Sbjct  166   PTHLRGGLNMMFQLATTLGIFTANMINYGTQKI-DPWGWRLSLGLAAFPALLMTVGGLLL  224

Query  620   PETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYR  799
             PETPNSL++R     G ++ L+++RGT+DV AE +D+  ASE + +I+ PF+NI  +R R
Sbjct  225   PETPNSLMERGAKEKG-RKTLEKIRGTNDVNAEYEDIQEASEFANSIKHPFRNIFQKRNR  283

Query  800   PQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLL  979
             PQLVMAF +P FQ +TGIN I FYAPVLF+++G G  AAL S+ +TGAV   +T  S+  
Sbjct  284   PQLVMAFFMPTFQILTGINSILFYAPVLFQSMGFGGDAALYSSALTGAVLASSTLISIAT  343

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
             VD++GRR LLI GGI M   Q+ V  ++G K G+   LSKG+++LV+++I  +V  FG S
Sbjct  344   VDRLGRRVLLISGGIQMITCQVVVAIILGVKFGNNEELSKGFSILVVIVICLFVLAFGWS  403

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPLGW IPSEIFPLE RSAGQSITVAVN LFTF++ Q+FL++LC LKYGIF FF GW+ 
Sbjct  404   WGPLGWTIPSEIFPLETRSAGQSITVAVNLLFTFVIAQSFLSLLCALKYGIFLFFAGWII  463

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             VMT FVY+ LPETK +PIE+M L+WR+HWFWK ++
Sbjct  464   VMTVFVYIFLPETKGVPIEEMILMWRKHWFWKNVM  498



>ref|XP_002443949.1| hypothetical protein SORBIDRAFT_07g004950 [Sorghum bicolor]
 gb|EES13444.1| hypothetical protein SORBIDRAFT_07g004950 [Sorghum bicolor]
Length=521

 Score =   513 bits (1322),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 273/456 (60%), Positives = 343/456 (75%), Gaps = 4/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FLK FF  VY K  E +   + YCKFDS+LLT FTSSLY+A L  S +A+SV
Sbjct  45    GGVTSMDSFLKEFFPSVYAK-AEANKDTNQYCKFDSQLLTLFTSSLYLAALATSFVAASV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+  GG+ F+AG+A+ GAA +V MLI GR+LLG+GVGFANQ+VPLYLSEMAP
Sbjct  104   TRVFGRKWSMFCGGLTFMAGSAMNGAATDVMMLIMGRILLGVGVGFANQSVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             AK RG +N+ FQL   IG+L ANLIN+ T KI  GWGWR+ LGLA VPA ++T+GA+VLP
Sbjct  164   AKLRGMLNIGFQLMTTIGILAANLINFWTVKIEGGWGWRIGLGLAGVPALIITVGALVLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSLI R  + D AK+ L ++RGTDDV  E DD+VAASE +  IE P++NIL RRYRP
Sbjct  224   DTPNSLIARGYNDD-AKKVLVKIRGTDDVHDEYDDMVAASEEASAIEHPWRNILERRYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QL +A  +P FQQ+TGINVI FYAPVLF TIG G+ A+LM+AV+TG V +  T  S++ V
Sbjct  283   QLTVAALIPCFQQLTGINVIMFYAPVLFLTIGFGDDASLMAAVITGLVNMFATMVSIVCV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG--GLSKGWAVLVLLLISSYVAGFGL  1156
             D++GRR L + GG  MFV+Q+ VG ++ A+ G  G   +S+  A L++L I  YVAGF  
Sbjct  343   DRLGRRALFLQGGTQMFVSQIVVGTMIAAQFGTAGVGTMSRNNAWLLVLFICLYVAGFAW  402

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSE+F LE+RSAGQSI V VN   TF++GQ+FL MLC LK+G+F+FF GW+
Sbjct  403   SWGPLGWLVPSEVFALEVRSAGQSIAVCVNMTLTFIIGQSFLTMLCTLKFGLFYFFAGWM  462

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              VMT F+ L LPETK +PIE+M+ VW  HWFW K V
Sbjct  463   FVMTAFIALFLPETKGVPIEEMNHVWSRHWFWSKYV  498



>ref|XP_009358503.1| PREDICTED: sugar carrier protein A-like [Pyrus x bretschneideri]
Length=518

 Score =   513 bits (1322),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 265/454 (58%), Positives = 346/454 (76%), Gaps = 4/454 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FLK+FF  VY    +   + +NYCK+D++ L +FTSSLY+AGL ASL+AS V
Sbjct  49    GGVTSMDGFLKKFFKTVYKN--KTHARENNYCKYDNQGLAAFTSSLYLAGLVASLVASPV  106

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  SI+ GG++FL GA L   A N+ MLI GR++LG+G+GF NQA+PLYLSEMAP
Sbjct  107   TRNYGRRGSIICGGISFLVGATLNALAANLAMLILGRIMLGVGIGFGNQAIPLYLSEMAP  166

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
                RG +N+ FQL   +G+  AN++NYGT+K+ + WGWR+SLGLA VPA V+T+G ++LP
Sbjct  167   THLRGALNMMFQLATTLGIFTANMVNYGTQKL-EPWGWRLSLGLALVPAAVMTVGGILLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLI+R    +G ++ L+R+RGT +V AE  D++ ASE +  I+ PF+NIL RR RP
Sbjct  226   ETPNSLIERGCKDEG-RKVLERIRGTKNVSAEFQDMLDASEFASAIKHPFRNILERRNRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA  +P FQ +TGIN I FYAPVLF+++G G  AAL S+ +TGAV + +T  S+  V
Sbjct  285   QLVMAIFMPTFQILTGINSILFYAPVLFQSMGFGGDAALYSSALTGAVLVTSTLLSIAAV  344

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR LLI GGI M V Q+ V  ++G KLGD   LSKG++VLV+ +I  +V  FG SW
Sbjct  345   DKLGRRVLLITGGIQMIVCQVIVAVILGIKLGDNQELSKGFSVLVVAVICLFVIAFGYSW  404

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGW +PSEIFPLE RSAGQSITV+VN LFTF++ Q+FL++LC LK+GIF FF GW+ +
Sbjct  405   GPLGWTVPSEIFPLETRSAGQSITVSVNLLFTFIIAQSFLSLLCALKFGIFLFFAGWITI  464

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVYL LPETK +PIE+M L+WR+HWFWK+I+
Sbjct  465   MTVFVYLFLPETKGIPIEEMILMWRKHWFWKRIM  498



>ref|XP_002872859.1| hypothetical protein ARALYDRAFT_327595 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49118.1| hypothetical protein ARALYDRAFT_327595 [Arabidopsis lyrata subsp. 
lyrata]
Length=515

 Score =   513 bits (1321),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 265/454 (58%), Positives = 348/454 (77%), Gaps = 4/454 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL+ FFH VY K K      SNYCK+D++ L +FTSSLY+AGL ++L+AS V
Sbjct  49    GGVTSMDEFLEEFFHTVYEKKKH--AHESNYCKYDNQGLAAFTSSLYLAGLVSTLVASPV  106

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  SI+ GG++FL G+AL   A+N+ ML+ GR++LG+G+GF NQAVPLYLSE+AP
Sbjct  107   TRNYGRRASIVCGGISFLIGSALNAGAVNLAMLLAGRIMLGVGIGFGNQAVPLYLSEVAP  166

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
                RGG+N+ FQL   IG+  AN++NYGT++++  WGWR+SLGLAA PA ++T+G   LP
Sbjct  167   THLRGGLNMMFQLATTIGIFTANMVNYGTQQLKP-WGWRLSLGLAAFPALLMTLGGYFLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSL++R     G +R L ++RGT+ V AEL D+V ASE++ +I+ PF+NIL +R+RP
Sbjct  226   ETPNSLVERGLTERG-RRVLVKLRGTETVNAELQDMVDASELANSIKHPFRNILQKRHRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA  +P FQ +TGIN I FYAPVLF+T+G G +A+L S+ +TGAV +++TF S+ LV
Sbjct  285   QLVMAICMPMFQILTGINSILFYAPVLFQTMGFGGNASLYSSALTGAVLVLSTFISIGLV  344

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             D++GRR LLI GGI M + Q+ V  ++G K GD   LSKG++V+V++ I  +V  FG SW
Sbjct  345   DRLGRRALLITGGIQMIICQVIVAVILGVKFGDNQELSKGYSVIVVVFICLFVIAFGWSW  404

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGW IPSEIFPLE RSAGQSITVAVN LFTF++ Q FL +LC  K+GIF FF GWV V
Sbjct  405   GPLGWTIPSEIFPLETRSAGQSITVAVNLLFTFIIAQAFLGLLCAFKFGIFLFFAGWVTV  464

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY LLPETK +PIE+M L+W +HWFWKK++
Sbjct  465   MTIFVYFLLPETKGVPIEEMTLLWSKHWFWKKVL  498



>gb|EAZ05797.1| hypothetical protein OsI_28032 [Oryza sativa Indica Group]
Length=519

 Score =   513 bits (1321),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 276/456 (61%), Positives = 340/456 (75%), Gaps = 4/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL  FF  VY + K  S   + YCKFDS+LLT FTSSLY+A L  S +A+ V
Sbjct  45    GGVTSMDSFLSEFFPSVYAQAKA-SKDTNQYCKFDSQLLTLFTSSLYLAALATSFVAAWV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+  GGV FLAG+AL GAA +V MLI GR+LLGIGVGFANQ+VPLYLSEMAP
Sbjct  104   TRVFGRKWSMFCGGVTFLAGSALNGAATDVMMLILGRILLGIGVGFANQSVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A  RG +N+ FQL   IG+L ANLINY T  I  GWGWR+ LGLA VPA ++T+GA+VLP
Sbjct  164   ANLRGMLNIGFQLMTTIGILSANLINYATSSIEGGWGWRIGLGLAGVPALIITLGALVLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSLI R    D AKR L ++RGTDDV  E DD+VAASE + +IE P++NILHR+YRP
Sbjct  224   DTPNSLIARGYAGD-AKRVLVKIRGTDDVHDEYDDMVAASEEAASIEHPWRNILHRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QL +A  +P FQQ+TGINVI FYAPVLF TIG    A+LMSAV+TG V +  T  S++ V
Sbjct  283   QLTIAILIPCFQQLTGINVIMFYAPVLFLTIGFAGDASLMSAVITGLVNMFATVVSIISV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLG--DQGGLSKGWAVLVLLLISSYVAGFGL  1156
             D++GRR L + GG  MF++Q+ VG ++  + G    G +S+ +A+L++L I  YVAGF  
Sbjct  343   DRLGRRVLFLQGGTQMFISQVVVGTLIALQFGVAGVGEMSRSYAILLVLFICMYVAGFAW  402

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSE+F LEIRSAGQSI V VN + TF++GQ FL MLCHLK+G+F+FF GW+
Sbjct  403   SWGPLGWLVPSEVFALEIRSAGQSIAVCVNMMLTFVIGQAFLTMLCHLKFGLFYFFAGWM  462

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              VMTTFV L LPETK +PIE+M+ VW  HWFW   V
Sbjct  463   LVMTTFVALFLPETKGVPIEEMNHVWSRHWFWGSYV  498



>ref|NP_001061127.1| Os08g0178200 [Oryza sativa Japonica Group]
 dbj|BAD03049.1| putative monosaccharide transporter 3 [Oryza sativa Japonica 
Group]
 dbj|BAF23041.1| Os08g0178200 [Oryza sativa Japonica Group]
 gb|EAZ41712.1| hypothetical protein OsJ_26248 [Oryza sativa Japonica Group]
 dbj|BAG92188.1| unnamed protein product [Oryza sativa Japonica Group]
Length=519

 Score =   513 bits (1321),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 276/456 (61%), Positives = 340/456 (75%), Gaps = 4/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL  FF  VY + K  S   + YCKFDS+LLT FTSSLY+A L  S +A+ V
Sbjct  45    GGVTSMDSFLSEFFPSVYAQAKA-SKDTNQYCKFDSQLLTLFTSSLYLAALATSFVAAWV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+  GGV FLAG+AL GAA +V MLI GR+LLGIGVGFANQ+VPLYLSEMAP
Sbjct  104   TRVFGRKWSMFCGGVTFLAGSALNGAATDVMMLILGRILLGIGVGFANQSVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A  RG +N+ FQL   IG+L ANLINY T  I  GWGWR+ LGLA VPA ++T+GA+VLP
Sbjct  164   ANLRGMLNIGFQLMTTIGILSANLINYATSSIEGGWGWRIGLGLAGVPALIITLGALVLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSLI R    D AKR L ++RGTDDV  E DD+VAASE + +IE P++NILHR+YRP
Sbjct  224   DTPNSLIARGYAGD-AKRVLVKIRGTDDVHDEYDDMVAASEEAASIEHPWRNILHRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QL +A  +P FQQ+TGINVI FYAPVLF TIG    A+LMSAV+TG V +  T  S++ V
Sbjct  283   QLTIAILIPCFQQLTGINVIMFYAPVLFLTIGFAGDASLMSAVITGLVNMFATVVSIISV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLG--DQGGLSKGWAVLVLLLISSYVAGFGL  1156
             D++GRR L + GG  MF++Q+ VG ++  + G    G +S+ +A+L++L I  YVAGF  
Sbjct  343   DRLGRRVLFLQGGTQMFISQVVVGTLIALQFGVAGVGEMSRSYAILLVLFICMYVAGFAW  402

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSE+F LEIRSAGQSI V VN + TF++GQ FL MLCHLK+G+F+FF GW+
Sbjct  403   SWGPLGWLVPSEVFALEIRSAGQSIAVCVNMMLTFVIGQAFLTMLCHLKFGLFYFFAGWM  462

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              VMTTFV L LPETK +PIE+M+ VW  HWFW   V
Sbjct  463   LVMTTFVALFLPETKGVPIEEMNHVWSRHWFWGSYV  498



>ref|XP_008336925.1| PREDICTED: sugar transport protein 7 isoform X1 [Malus domestica]
Length=583

 Score =   515 bits (1327),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 264/454 (58%), Positives = 347/454 (76%), Gaps = 4/454 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FLK+FF  VY    +   + +NYCK+D++ L +FTSSLY+AGL ASL+AS V
Sbjct  114   GGVTSMDGFLKKFFKTVYKN--KTHARENNYCKYDNQGLAAFTSSLYLAGLVASLVASPV  171

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  SI+ GG++FL GA L  +A N+ MLI GR++LG+G+GF NQA+PLYLSEMAP
Sbjct  172   TRNYGRRGSIICGGISFLVGATLNASAANLAMLILGRIMLGVGIGFGNQAIPLYLSEMAP  231

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
                RG +N+ FQL   +G+  AN++NYGT+K+ + WGWR+SLGLA VPA V+T+G + LP
Sbjct  232   THLRGALNMMFQLATTLGIFTANMVNYGTQKL-EPWGWRLSLGLALVPAAVMTVGGICLP  290

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLI+R    +G ++ L+R+RGT +V AE  D++ ASE +  I+ PF+N+L RR RP
Sbjct  291   ETPNSLIERGCKDEG-RKILERIRGTKNVSAEFQDMLDASEFASAIKHPFRNVLERRNRP  349

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA  +P FQ +TGIN I FYAPVLF+++G G +AAL S+ +TGAV + +T  S+  V
Sbjct  350   QLVMAIFMPTFQILTGINSILFYAPVLFQSMGFGGNAALYSSALTGAVLVTSTLLSIAAV  409

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR LLI GGI M V Q+ V  ++G KLGD   LSKG++VLV+ +I  +V  FG SW
Sbjct  410   DKLGRRVLLITGGIQMIVCQVIVAVILGTKLGDNQELSKGFSVLVVAVICLFVIAFGYSW  469

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGW +PSEIFPLE RSAGQSITV+VN LFTF++ Q+FL++LC LK+GIF FF GW+ +
Sbjct  470   GPLGWTVPSEIFPLETRSAGQSITVSVNLLFTFIIAQSFLSLLCALKFGIFLFFAGWITI  529

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVYL LPETK +PIE+M L+WR+HWFWK+I+
Sbjct  530   MTVFVYLFLPETKGIPIEEMILMWRKHWFWKRIM  563



>ref|NP_001043369.1| Os01g0567500 [Oryza sativa Japonica Group]
 dbj|BAB63495.2| putative monosaccharide transport protein [Oryza sativa Japonica 
Group]
 gb|AAV71143.1| monosaccharide transporter 8 [Oryza sativa Japonica Group]
 dbj|BAF05283.1| Os01g0567500 [Oryza sativa Japonica Group]
 dbj|BAG91380.1| unnamed protein product [Oryza sativa Japonica Group]
Length=513

 Score =   513 bits (1320),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 270/456 (59%), Positives = 346/456 (76%), Gaps = 4/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL +FF  VY K KE   + + YCKFDSELLT FTSSLY+A L ASL AS +
Sbjct  46    GGVTSMDSFLIKFFPSVYAKEKEMV-ETNQYCKFDSELLTLFTSSLYLAALIASLFASVI  104

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  ++L GGV FL GA L GAA +V MLI GR+LLGIGVGF+NQAVPLYLSEMAP
Sbjct  105   TRKFGRRITMLGGGVIFLVGAILNGAAADVAMLIIGRILLGIGVGFSNQAVPLYLSEMAP  164

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A+ RG +N+SFQL + +G+L ANLINY T+KI  GWGWRVSLGLAAVPA ++  G++ LP
Sbjct  165   ARMRGMLNISFQLMITVGILAANLINYFTDKIAGGWGWRVSLGLAAVPAVIMAGGSLFLP  224

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSL+ R  +++ A+  L+R+RGTDDV  E DDLVAASE S+ IE P++ +L RRYRP
Sbjct  225   DTPNSLLSRGKENE-ARAMLRRIRGTDDVGPEYDDLVAASEASKAIENPWRTLLERRYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVM+  +P  QQ+TGINV+ FYAPVLF+TIG G +A+LMSAV+TG V +  TF S+  V
Sbjct  284   QLVMSVLIPTLQQLTGINVVMFYAPVLFKTIGFGGTASLMSAVITGLVNMFATFVSIATV  343

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG--GLSKGWAVLVLLLISSYVAGFGL  1156
             D++GRR+LL+ GG+ M   Q  +G ++  K G  G   +S+G+A++V+L I  +V+ F  
Sbjct  344   DRLGRRKLLLQGGVQMIFAQFILGTLIAVKFGTAGVANISRGYAIVVVLCICVFVSAFAW  403

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSEIFPLEIRSA QS+ V  N  FTF++ Q FL MLCHLK+G+F+FFG   
Sbjct  404   SWGPLGWLVPSEIFPLEIRSAAQSVVVVFNMAFTFIIAQIFLMMLCHLKFGLFYFFGAME  463

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              +MT FV+  LPETK +PIE+MD +W +HW+W++ V
Sbjct  464   LIMTGFVFFFLPETKGIPIEEMDRIWGKHWYWRRFV  499



>ref|XP_008675375.1| PREDICTED: sugar transport protein 1-like [Zea mays]
 tpg|DAA58613.1| TPA: hypothetical protein ZEAMMB73_992999 [Zea mays]
Length=509

 Score =   512 bits (1319),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 266/456 (58%), Positives = 339/456 (74%), Gaps = 4/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+PFLKRFF  VY K +++  + + YCKFDS LLT FTSSLY+A L ASL A  V
Sbjct  43    GGVTSMDPFLKRFFPSVYAK-EQEVVETNQYCKFDSVLLTLFTSSLYLAALVASLFAGYV  101

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T+ CGR  S+L GG  FL GA L G A NV MLI GR+ LGIGVGF+NQ+VPLYLSEMAP
Sbjct  102   TKKCGRRMSMLGGGAIFLVGAVLNGFAQNVAMLIVGRIFLGIGVGFSNQSVPLYLSEMAP  161

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A+ RG +N+SFQL   +G+L+ANLINY T KI  GWGWR+ LGLAAVPA ++  G++ LP
Sbjct  162   ARMRGMLNISFQLMTTVGILVANLINYFTAKIPGGWGWRIGLGLAAVPAVIMVGGSIFLP  221

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSL+ R    + A+  L+R+RGTDDV  E DD+VAASE ++ I+ P+  +L RRYRP
Sbjct  222   DTPNSLVSR-GKVESARAMLRRIRGTDDVSLEFDDMVAASEATKAIQNPWGTLLQRRYRP  280

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA  +P  QQ+TGINV+ FYAPVLF+TIG G +A+LMSAV+TG V + +TF S+  V
Sbjct  281   QLVMAVLIPTLQQLTGINVVMFYAPVLFKTIGFGGTASLMSAVITGLVNMFSTFVSIATV  340

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG--GLSKGWAVLVLLLISSYVAGFGL  1156
             D++GRR+LL+ GGI M + Q  +G ++  K G  G   +S+ +A+ V+  I  +VA F  
Sbjct  341   DRLGRRKLLLEGGIQMILAQFVLGTLIAVKFGTAGVAAISRPYAIGVVFCICVFVAAFAW  400

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSEIFPLEIRSAGQS+ V  N +FTF++ Q FL +LC LK+G+F+FFG W 
Sbjct  401   SWGPLGWLVPSEIFPLEIRSAGQSVVVVFNMIFTFIIAQIFLMLLCRLKFGLFYFFGAWE  460

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
               MT FVY  LPETK +PIE+MD +W  HW+WK+ V
Sbjct  461   IAMTLFVYFFLPETKGIPIEEMDQIWANHWYWKRFV  496



>ref|XP_009397582.1| PREDICTED: sugar transport protein 10-like [Musa acuminata subsp. 
malaccensis]
Length=575

 Score =   515 bits (1326),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 270/454 (59%), Positives = 343/454 (76%), Gaps = 3/454 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL++FF  VY + K  SG  + +C+FDS++LTSFTSSLY+AGL ++  AS V
Sbjct  107   GGVTSMDEFLEKFFPSVYQQEKTASGSKNQWCQFDSQMLTSFTSSLYVAGLISTYFASMV  166

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T+A GR  S+L GG AFL G+A+ G A+NV MLI GR+LLG+GVGFANQAVPLYLSEMAP
Sbjct  167   TQAFGRKSSMLFGGAAFLLGSAINGVAMNVAMLIIGRILLGVGVGFANQAVPLYLSEMAP  226

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              + RG +N+ FQ+   IG+ +A L+NYGT K+  G+GWR+S+ LAAVPA ++T+GA+ LP
Sbjct  227   PQLRGALNMGFQMATTIGIFVAGLVNYGTGKLHAGYGWRISVALAAVPALIMTLGAIALP  286

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSL++R    D AK  LQ++RGTDDV+AEL D++ A+E ++ +  P+ +IL   +RP
Sbjct  287   DTPNSLVER-GLRDQAKATLQKIRGTDDVEAELQDMIEATEEAKKVSDPWSSILRPEHRP  345

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
              LVMA A+P FQQ+TGINVI FYAPVLF+TIG G+SA+LMSAV++G V +  T  S+  V
Sbjct  346   HLVMAIAIPMFQQLTGINVIMFYAPVLFKTIGFGDSASLMSAVISGLVNVFATTVSIATV  405

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGD--QGGLSKGWAVLVLLLISSYVAGFGL  1156
             DK GRR L + GGI M V+Q+AVG ++G   GD   G LS G A LVL LI  YVA F  
Sbjct  406   DKFGRRILFLEGGIQMVVSQVAVGAILGTFFGDAGTGKLSPGLANLVLALICVYVAAFAW  465

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSEIFPL IRSAGQSI V VNF FTF++ Q FL  LCHLK G+F  F  +V
Sbjct  466   SWGPLGWLVPSEIFPLNIRSAGQSIVVGVNFFFTFVIAQLFLMALCHLKSGLFHLFAAFV  525

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKK  1438
              VMT FV  L+PETK +PIE+M LVW++HWFWKK
Sbjct  526   VVMTLFVVFLVPETKGVPIEEMTLVWKKHWFWKK  559



>emb|CDY07098.1| BnaCnng01130D [Brassica napus]
Length=508

 Score =   512 bits (1319),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 264/454 (58%), Positives = 347/454 (76%), Gaps = 4/454 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL+ FF  VY K K+     SNYCK+D + L +FTSSLY+AGL ++L AS +
Sbjct  49    GGVTSMDEFLEEFFKTVYDKKKQ--AHESNYCKYDDQGLAAFTSSLYLAGLVSTLAASPI  106

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  SI+ GG++FL GAAL   A+N+ ML+ GR+LLG+G+GF NQAVPLYLSE+AP
Sbjct  107   TRNYGRRASIVCGGISFLVGAALNAGAVNLPMLLAGRILLGVGIGFGNQAVPLYLSEVAP  166

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
                RGG+N+ FQL   IG+  AN++NYGT++++  WGWR+SLGLAA PA ++T+G  +LP
Sbjct  167   THLRGGLNMMFQLATTIGIFTANMVNYGTQQLKP-WGWRLSLGLAAFPALLMTLGGYLLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSL++R    D  +R L+++RGT +V AEL D+V ASE++ +I+ PF+NIL R++RP
Sbjct  226   ETPNSLVER-GLTDKGRRVLEKLRGTQNVDAELQDMVDASELANSIKHPFRNILQRQHRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA  +P FQ +TGIN I FYAPVLF+T+G G +A+L S+ +TGAV +++T  S+ LV
Sbjct  285   QLVMAICMPMFQILTGINSILFYAPVLFQTMGFGGNASLYSSALTGAVLVLSTLISIALV  344

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR LLI GG+ M + Q  V  ++G K GD   LSKG++++V++ I  +V  FG SW
Sbjct  345   DKLGRRALLISGGVQMIICQAIVSVILGLKFGDDQALSKGYSIVVVIFICLFVVAFGWSW  404

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGW IPSEIFPLE RSAGQSITVAVN LFTF++ Q FL+MLC  K+GIF FF GWV V
Sbjct  405   GPLGWTIPSEIFPLETRSAGQSITVAVNLLFTFIIAQAFLSMLCAFKFGIFLFFAGWVLV  464

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY LLPETK +PIE+M L+W+ HWFWKK++
Sbjct  465   MTVFVYFLLPETKGVPIEEMTLLWKRHWFWKKVL  498



>tpg|DAA61441.1| TPA: sugar carrier protein A [Zea mays]
Length=482

 Score =   511 bits (1316),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 269/453 (59%), Positives = 352/453 (78%), Gaps = 4/453 (1%)
 Frame = +2

Query  86    GVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSVT  265
             GVTSM+PFL++FF  V+ +  ++SG  +NYCK+D++ L +FTSSLY+AGL ASL+AS VT
Sbjct  9     GVTSMDPFLEKFFPVVFHR--KNSGGKNNYCKYDNQGLAAFTSSLYLAGLVASLVASPVT  66

Query  266   RACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAPA  445
             R  GR  SI+ GGV+FL GAAL  AA+N+ MLI GR++LG+G+GF NQAVPLYLSEMAPA
Sbjct  67    RNYGRKASIVCGGVSFLIGAALNVAAVNLAMLILGRIMLGVGIGFGNQAVPLYLSEMAPA  126

Query  446   KYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLPE  625
               RGG+N+ FQL   +G+  ANLINYGT+ I+  WGWR+SLGLAAVPA ++T+G + LPE
Sbjct  127   HLRGGLNMMFQLATTLGIFTANLINYGTQNIKP-WGWRLSLGLAAVPALLMTLGGLFLPE  185

Query  626   TPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRPQ  805
             TPNSLI+R    +G +R L+R+RGT DV AE  D+V ASE++ T+E PF+NIL  R RPQ
Sbjct  186   TPNSLIERGRVEEG-RRVLERIRGTADVDAEFTDMVEASELANTVEHPFRNILQPRNRPQ  244

Query  806   LVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLVD  985
             LVMA  +P FQ +TGIN I FYAPVLF+++G G +A+L S+V+TGAV   +T  S+ +VD
Sbjct  245   LVMAVCMPAFQILTGINSILFYAPVLFQSMGFGGNASLYSSVLTGAVLFSSTLISIGIVD  304

Query  986   KVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSWG  1165
             ++GRR+LLI GGI M V Q+ V  ++G K G +  L++ ++V V+++I  +V  FG SWG
Sbjct  305   RLGRRKLLISGGIQMIVCQVIVAVILGVKFGAEKQLARSYSVAVVVVICLFVLAFGWSWG  364

Query  1166  PLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAVM  1345
             PLGW +PSEIFPLE RSAGQSITVAVN LFTF + Q FL++LC  K+GIF FF GW+ VM
Sbjct  365   PLGWTVPSEIFPLETRSAGQSITVAVNLLFTFAIAQAFLSLLCAFKFGIFLFFAGWITVM  424

Query  1346  TTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             T FVY+ LPETK +PIE+M L+WR+HWFWKK++
Sbjct  425   TVFVYVFLPETKGVPIEEMVLLWRKHWFWKKVM  457



>ref|XP_010687752.1| PREDICTED: sugar transport protein 7 [Beta vulgaris subsp. vulgaris]
Length=518

 Score =   512 bits (1318),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 267/454 (59%), Positives = 348/454 (77%), Gaps = 4/454 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL  FF  VY K K      +NYCKF+ + L +FTSSLY+AGL ASLLAS V
Sbjct  49    GGVTSMDGFLHHFFRGVYEKKKH--ALENNYCKFNDQGLAAFTSSLYLAGLVASLLASPV  106

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  +I+ GG+ FL GA L  AA+N+ ML+ GR++LG G+GF NQAVPLYLSEMAP
Sbjct  107   TRNYGRRITIICGGIFFLIGATLNAAAVNLAMLLLGRIMLGFGIGFGNQAVPLYLSEMAP  166

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
                RGG+N+ FQL   +G+  AN+IN+GT K+ + WGWR+SLGLAA+PAT++TIG +++P
Sbjct  167   THIRGGVNMMFQLATTLGIFTANMINFGTSKL-EPWGWRLSLGLAALPATLMTIGGLLVP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLI+R     G ++ L+R+RGT++V AE  D+V ASE +++I+ PF+NIL RR RP
Sbjct  226   ETPNSLIERGLSEKG-RKVLERIRGTENVSAEFQDMVDASEFAKSIKNPFRNILERRNRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QL+MA  +P FQ +TGIN I FYAPVLF+++G G +A+L S+ +TGAV   +T  S+  V
Sbjct  285   QLIMAIFMPTFQILTGINSILFYAPVLFQSMGFGANASLYSSALTGAVLAFSTLISIAAV  344

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             D++GRR LLI GGILM   Q+ V  ++G KLG  G LSKG++V+V+++I  +V  FG SW
Sbjct  345   DRLGRRVLLISGGILMITCQVIVAIILGVKLGTNGELSKGYSVVVVIVICLFVLAFGWSW  404

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGW IPSEIFPLE RSAGQSITVAVN LFTF++ Q+FL++LCHLK+GIF FF GW+ +
Sbjct  405   GPLGWTIPSEIFPLETRSAGQSITVAVNLLFTFIIAQSFLSLLCHLKFGIFLFFSGWITI  464

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FV L LPETK +PIE+M L+WR+HWFWK+I+
Sbjct  465   MTIFVCLFLPETKGVPIEEMILLWRKHWFWKRIM  498



>ref|XP_008443895.1| PREDICTED: sugar transport protein 7 [Cucumis melo]
Length=512

 Score =   512 bits (1318),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 265/455 (58%), Positives = 348/455 (76%), Gaps = 6/455 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVY-TKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASS  259
             GGVTSM PFLK+FF  VY  KM+      +NYCK++++ L +FTSSLY+AGL +SL+AS 
Sbjct  49    GGVTSMNPFLKKFFPTVYRNKMRAHE---NNYCKYNNQGLAAFTSSLYLAGLVSSLVASP  105

Query  260   VTRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMA  439
             +TR  GR  SI+ GG++FL GA L  AA+N+ MLI GR++LG+G+GF NQAVPLYLSEMA
Sbjct  106   ITRNYGRRASIVCGGLSFLVGATLNAAAVNIEMLILGRIMLGVGIGFGNQAVPLYLSEMA  165

Query  440   PAKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVL  619
             P   RGG+N+ FQL   +G+  AN+INYGT+KI D WGWR+SLGLAA PA ++T+G ++L
Sbjct  166   PTHLRGGLNMMFQLATTLGIFTANMINYGTQKI-DPWGWRLSLGLAAFPAFLMTVGGLLL  224

Query  620   PETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYR  799
             PETPNSL++R     G ++ L+++RGT+DV AE +D+  ASE + +I+ PF+NI  +R R
Sbjct  225   PETPNSLMERGAKEKG-RKTLEKIRGTNDVNAEYEDIQEASEFANSIKHPFRNIFQKRNR  283

Query  800   PQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLL  979
             PQLVMAF +P FQ +TGIN I FYAPVLF+++G G  AAL S+ +TGAV   +T  S+  
Sbjct  284   PQLVMAFFMPTFQILTGINSILFYAPVLFQSMGFGGDAALYSSALTGAVLAFSTLISIAT  343

Query  980   VDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLS  1159
             VD++GRR LLI GGI M   Q+ V  ++G K G+   LSKG+++LV+++I  +V  FG S
Sbjct  344   VDRLGRRVLLISGGIQMITCQVVVAIILGVKFGNNEELSKGFSILVVIVICLFVLAFGWS  403

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPLGW IPSEIFPLE RSAGQSITVAVN LFTF++ Q+FL++LC LKYGIF FF GW+ 
Sbjct  404   WGPLGWTIPSEIFPLETRSAGQSITVAVNLLFTFVIAQSFLSLLCALKYGIFLFFAGWII  463

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             VMT FVY+ LPETK +PIE+M L+WR+HWFWK ++
Sbjct  464   VMTVFVYVFLPETKGVPIEEMILMWRKHWFWKNVM  498



>ref|XP_009134451.1| PREDICTED: sugar transport protein 7 [Brassica rapa]
 ref|XP_009134452.1| PREDICTED: sugar transport protein 7 [Brassica rapa]
 ref|XP_009134453.1| PREDICTED: sugar transport protein 7 [Brassica rapa]
 ref|XP_009134454.1| PREDICTED: sugar transport protein 7 [Brassica rapa]
Length=513

 Score =   512 bits (1318),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 262/454 (58%), Positives = 348/454 (77%), Gaps = 4/454 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL +FFH VY K K+     SNYCK+D++ L +FTSSLY+AGL ++L AS +
Sbjct  49    GGVTSMDEFLDQFFHTVYEKKKQ--AHESNYCKYDNQGLAAFTSSLYLAGLVSTLAASPI  106

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  SI+ GGV+F  GAAL   A+N+ ML+ GR+LLG+G+GF NQAVPLYLSE+AP
Sbjct  107   TRNYGRRASIVCGGVSFFIGAALNAGAVNLAMLLAGRILLGVGIGFGNQAVPLYLSEVAP  166

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
                RGG+N+ FQL   +G+  AN++NYGT++++  WGWR+SLGLAA PA ++T+G   LP
Sbjct  167   THLRGGLNMMFQLATTLGIFTANMVNYGTQQLKP-WGWRLSLGLAAFPAFLMTLGGYFLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSL++R     G +R L+++RGT +V AEL D+V ASE++ +I+ PF+NIL +++RP
Sbjct  226   ETPNSLVERGLTERG-RRVLEKLRGTKNVDAELQDMVDASELANSIKHPFRNILQKQHRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA  +P FQ +TGIN I FYAPVLF+T+G G +A+L S+ +TGAV +++T  S+ LV
Sbjct  285   QLVMAICMPMFQILTGINSILFYAPVLFQTMGFGGNASLYSSALTGAVLVLSTLISISLV  344

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR LLI GG+ M + Q  V  ++G K GD   LSKG++++V++ I  +V  FG SW
Sbjct  345   DKLGRRALLISGGVQMIICQAIVSVILGVKFGDNQELSKGYSIVVVIFICLFVVAFGWSW  404

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGW IPSEIFPLE RSAGQSITVAVN LFTF + Q FL++LC  K+GIF FF GWV+V
Sbjct  405   GPLGWTIPSEIFPLETRSAGQSITVAVNLLFTFFIAQAFLSLLCAFKFGIFLFFAGWVSV  464

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY LLPETK +PIE+M L+W++HWFWKK++
Sbjct  465   MTIFVYFLLPETKGVPIEEMTLLWKKHWFWKKVL  498



>ref|XP_008798484.1| PREDICTED: sugar transport protein 10-like [Phoenix dactylifera]
Length=512

 Score =   511 bits (1317),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 283/458 (62%), Positives = 355/458 (78%), Gaps = 8/458 (2%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSN--YCKFDSELLTSFTSSLYIAGLFASLLAS  256
             GGVTSMEPFL +FF  V  K KE    VSN  YCKFDS LLT+FTSSLY+A L ASLLAS
Sbjct  45    GGVTSMEPFLAKFFPSVLEKEKE---AVSNNQYCKFDSPLLTAFTSSLYLAALVASLLAS  101

Query  257   SVTRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEM  436
             +VTR  GR  S+  GG+ FLAG+A+ GAA NV MLI GR+LLGIGVGFANQ+VPLYLSEM
Sbjct  102   TVTRVFGRKWSMFGGGITFLAGSAINGAAENVLMLILGRILLGIGVGFANQSVPLYLSEM  161

Query  437   APAKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVV  616
             APAK RG +N+ FQL + IG+L AN INYGT +I  GWGWRVSL LAAVPA ++T G++V
Sbjct  162   APAKLRGMLNIGFQLMITIGILAANFINYGTNQISGGWGWRVSLALAAVPAAIITFGSLV  221

Query  617   LPETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRY  796
             LP+TPNSL++R +  D AK  L+R+RGTD++Q E +D+VAASE ++ ++ P+ NI+ R+Y
Sbjct  222   LPDTPNSLVERGHS-DHAKVMLRRIRGTDEIQCEYEDIVAASEEAKAVQHPWSNIIKRKY  280

Query  797   RPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASML  976
             RPQL MA  +PFFQQ+TGINVI FYAPVLF+TIG G+ A+LMSAV++G V +V TF S+ 
Sbjct  281   RPQLTMAILIPFFQQLTGINVIMFYAPVLFKTIGFGDDASLMSAVISGLVNVVATFVSIA  340

Query  977   LVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG--GLSKGWAVLVLLLISSYVAGF  1150
              VDK GRR L + GG  MF++Q+ VG ++G K G  G   LSK +A  V+L +  +VA F
Sbjct  341   TVDKFGRRILFLEGGTQMFISQIIVGTLIGIKFGTTGEATLSKEYAFFVVLFVCVFVAAF  400

Query  1151  GLSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGG  1330
               SWGP+GWL+PSEIFPLEIRSAGQ+I V+VN  FTF++GQ FL +LCH+K+G+F+FF G
Sbjct  401   AWSWGPMGWLVPSEIFPLEIRSAGQAINVSVNMFFTFVIGQFFLTLLCHMKFGLFYFFAG  460

Query  1331  WVAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             W  VMT F+ L LPETKN+PIE+M  VW++HWFW K +
Sbjct  461   WQLVMTIFIALFLPETKNVPIEEMVHVWKKHWFWGKFI  498



>ref|XP_010918337.1| PREDICTED: sugar carrier protein C-like [Elaeis guineensis]
Length=508

 Score =   511 bits (1317),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 263/456 (58%), Positives = 341/456 (75%), Gaps = 4/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL++FF  VY + KE++   + YCKFDS+LLT+FTSSLY+A L AS  AS++
Sbjct  45    GGVTSMDSFLEKFFPSVYKEEKENT-STNQYCKFDSQLLTAFTSSLYLAALIASFFASTM  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+ + G+  L GA + GAA NV+MLI GR+L+G GVGFANQ+VP+YLSEMAP
Sbjct  104   TRVFGRKWSMFMSGIVVLMGATINGAAGNVFMLILGRILVGAGVGFANQSVPVYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A+ RG +N+ FQL + IGV IAN INYGT  I  GWGWR+SL L  +PATV+T+G++ LP
Sbjct  164   ARLRGMLNIGFQLMITIGVFIANFINYGTANISGGWGWRISLALVGIPATVITLGSLFLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSL++R    + AK  L ++RGT+++Q E DDLV ASE S  I+ P+ NI+ R+YRP
Sbjct  224   DTPNSLVER-GHKEKAKAILSKIRGTNEIQDEYDDLVKASEESIAIKHPWSNIIKRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QL MA  +PFFQQVTGIN +  Y PVLF+TIG G +A+LMSA++ G V +++TF S+ +V
Sbjct  283   QLTMALLIPFFQQVTGINALMLYGPVLFKTIGFGGNASLMSALIIGLVKVLSTFVSIAIV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG--GLSKGWAVLVLLLISSYVAGFGL  1156
             DK+GRR LL+ GG  M + Q+ VG ++  K G  G   LSK +A  V+  I  Y+AGF  
Sbjct  343   DKLGRRMLLLQGGTQMIICQIIVGTLIWIKFGTHGEATLSKTYARCVVSFICLYMAGFAW  402

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWLIPSEIFPLEIRSAGQSI V++N L T +  Q FLAM C +K+G+F+FF GWV
Sbjct  403   SWGPLGWLIPSEIFPLEIRSAGQSINVSLNMLVTSINAQVFLAMFCRMKFGLFYFFSGWV  462

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              +MT FV L LPETKN+PIE+M LVW++HWFW K +
Sbjct  463   IIMTIFVALFLPETKNVPIEEMILVWKKHWFWGKFI  498



>ref|XP_010429078.1| PREDICTED: sugar transport protein 7-like [Camelina sativa]
 ref|XP_010429087.1| PREDICTED: sugar transport protein 7-like [Camelina sativa]
Length=516

 Score =   511 bits (1317),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 264/454 (58%), Positives = 347/454 (76%), Gaps = 4/454 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL  FFH VY K K      SNYCK+D++ L +FTSSLY+AGL ++L+AS +
Sbjct  49    GGVTSMDEFLDEFFHAVYEKKKH--AHESNYCKYDNQGLAAFTSSLYLAGLVSTLVASPI  106

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  SI+ GG++FL GA L   A+N+ ML+ GR++LG+G+GF NQAVPLYLSE+AP
Sbjct  107   TRNYGRRASIVCGGISFLVGAGLNAGAVNLAMLLTGRIMLGVGIGFGNQAVPLYLSEVAP  166

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
                RGG+N+ FQL   +G+  AN++N+GT+K++  WGWR+SLGLAA PA ++T+G   LP
Sbjct  167   THLRGGLNMMFQLATTLGIFTANMVNFGTQKLKP-WGWRLSLGLAAFPALLMTLGGYFLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSL++R     G +  L+++RGT +V AEL D+V ASE++ +I+ PF+NIL +R+RP
Sbjct  226   ETPNSLVERGLTERG-RHVLEKLRGTKNVDAELQDMVDASELANSIKHPFRNILQKRHRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA  +P FQ +TGIN I FYAPVLF+T+G G +A+L S+ +TGAV +++T  S+ LV
Sbjct  285   QLVMAICMPMFQILTGINSILFYAPVLFQTMGFGGNASLYSSALTGAVLVLSTLISIGLV  344

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR LLI GGI M + Q+ V  ++G K GD+  LSKG++V+V++ I  +V  FG SW
Sbjct  345   DKLGRRALLISGGIQMIICQVIVAVILGVKFGDKQELSKGYSVIVVIFICLFVVAFGWSW  404

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGW IPSEIFPLE RSAGQSITVAVN LFTF++ Q FLA+LC  K+GIF FF GWV V
Sbjct  405   GPLGWTIPSEIFPLETRSAGQSITVAVNLLFTFIIAQAFLALLCAFKFGIFLFFAGWVTV  464

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY LLPETK +PIE+M L+W +HWFWKKI+
Sbjct  465   MTIFVYFLLPETKGVPIEEMTLLWSKHWFWKKIL  498



>ref|XP_006366202.1| PREDICTED: sugar carrier protein A-like [Solanum tuberosum]
Length=513

 Score =   511 bits (1315),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 260/454 (57%), Positives = 347/454 (76%), Gaps = 4/454 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL+RFF+ VY  +K+      NYCK+++++L +FTSSLY+AGL ASL+AS +
Sbjct  49    GGVTSMDEFLRRFFYSVY--LKKQHVHEDNYCKYNNQVLAAFTSSLYMAGLVASLVASPI  106

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  SI+ GG++F  GA L  AAIN+ ML+FGR++LG+G+GF NQAVPLYLSEMAP
Sbjct  107   TRNHGRRASIICGGISFFLGAVLNAAAINLGMLLFGRIMLGVGIGFGNQAVPLYLSEMAP  166

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A  RG +N+ FQL   +G+  AN+INYGT K+   WGWR+SLGLAA PA V+T+G ++LP
Sbjct  167   AHLRGCLNMMFQLATTLGIFTANMINYGTSKLHP-WGWRLSLGLAAAPAFVMTVGGMLLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLI++ N   G +R L+R+RGT++V AE +D+V ASE++R ++ PF+NIL RR RP
Sbjct  226   ETPNSLIEQGNKTKG-RRVLERIRGTENVDAEFEDMVDASELARLVKHPFRNILKRRNRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QL+MA  +P FQ +TGIN+I FYAPVLF+++G   SA+L S+ +TGAV   +T  SM  V
Sbjct  285   QLIMAILMPTFQILTGINIILFYAPVLFQSMGFKRSASLYSSALTGAVLASSTLVSMATV  344

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             D+ GRR LLI GGI M + Q+ V  ++G K G    LS+G++++V++ I  +VA FG SW
Sbjct  345   DRWGRRILLITGGIQMIICQVIVAIILGLKFGSDKELSRGYSIIVVVFICLFVAAFGYSW  404

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGW +PSEIFPLE RSAGQSITV VN  FTF + Q+FL++LC +++GIF FF GW+A+
Sbjct  405   GPLGWTVPSEIFPLETRSAGQSITVTVNLFFTFAIAQSFLSLLCVMRFGIFLFFSGWIAI  464

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT F+YL LPETK +PIE+M  +W +HWFWKKIV
Sbjct  465   MTIFIYLFLPETKGVPIEEMMRLWEKHWFWKKIV  498



>emb|CDX90958.1| BnaA03g26380D [Brassica napus]
Length=513

 Score =   511 bits (1315),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 261/454 (57%), Positives = 347/454 (76%), Gaps = 4/454 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL +FFH VY K K+     SNYCK+D++ L +FTSSLY+AGL ++L AS +
Sbjct  49    GGVTSMDEFLDQFFHTVYEKKKQ--AHESNYCKYDNQGLAAFTSSLYLAGLVSTLAASPI  106

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  SI+ GGV+F  GA L   A+N+ ML+ GR+LLG+G+GF NQAVPLYLSE+AP
Sbjct  107   TRNYGRRASIVCGGVSFFIGAGLNAGAVNLAMLLAGRILLGVGIGFGNQAVPLYLSEVAP  166

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
                RGG+N+ FQL   +G+  AN++NYGT++++  WGWR+SLGLAA PA ++T+G   LP
Sbjct  167   THLRGGLNMMFQLATTLGIFTANMVNYGTQQLKP-WGWRLSLGLAAFPALLMTLGGYFLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSL++R     G +R L+++RGT +V AEL D+V ASE++ +I+ PF+NIL +++RP
Sbjct  226   ETPNSLVERGLTERG-RRVLEKLRGTKNVDAELQDMVDASELANSIKHPFRNILQKQHRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA  +P FQ +TGIN I FYAPVLF+T+G G +A+L S+ +TGAV +++T  S+ LV
Sbjct  285   QLVMAICMPMFQILTGINSILFYAPVLFQTMGFGGNASLYSSALTGAVLVLSTLISISLV  344

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR LLI GG+ M + Q  V  ++G K GD   LSKG++++V++ I  +V  FG SW
Sbjct  345   DKLGRRALLISGGVQMIICQAIVSVILGVKFGDNQELSKGYSIVVVIFICLFVVAFGWSW  404

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGW IPSEIFPLE RSAGQSITVAVN LFTF + Q FL++LC  K+GIF FF GWV+V
Sbjct  405   GPLGWTIPSEIFPLETRSAGQSITVAVNLLFTFFIAQAFLSLLCAFKFGIFLFFAGWVSV  464

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY LLPETK +PIE+M L+W++HWFWKK++
Sbjct  465   MTIFVYFLLPETKGVPIEEMTLLWKKHWFWKKVL  498



>ref|XP_006281983.1| hypothetical protein CARUB_v10028207mg [Capsella rubella]
 gb|EOA14881.1| hypothetical protein CARUB_v10028207mg [Capsella rubella]
Length=519

 Score =   511 bits (1315),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 278/458 (61%), Positives = 354/458 (77%), Gaps = 5/458 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSN----YCKFDSELLTSFTSSLYIAGLFASLL  250
             GGV SM PFLKRFF  VY   +ED  +  N    YC F+S+LLTSFTSSLY++G  A+LL
Sbjct  47    GGVMSMGPFLKRFFPKVYNLEEEDRRRRGNNSNHYCLFNSQLLTSFTSSLYVSGFVATLL  106

Query  251   ASSVTRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLS  430
             ASSVTR+ GR PSI +GGVAFLAGA LGG+A NV MLI  R+LLG+GVGFANQ+VPLYLS
Sbjct  107   ASSVTRSWGRKPSIFLGGVAFLAGATLGGSAQNVAMLIIARLLLGVGVGFANQSVPLYLS  166

Query  431   EMAPAKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGA  610
             EMAPAK+RG ++  FQLC+GIG L AN+INY T++I+  +GWR+SL  AA+PA++LT+G+
Sbjct  167   EMAPAKFRGAISNGFQLCIGIGFLSANVINYETQQIKHSYGWRISLATAAIPASILTLGS  226

Query  611   VVLPETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHR  790
             + LPETPNS+IQ   D   A+  L+RVRGT +VQ EL+DLV AS  S T    F  +L R
Sbjct  227   LFLPETPNSIIQTTGDVHKAELILRRVRGTQNVQDELNDLVEASSDSATDTNGFVILLQR  286

Query  791   RYRPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFAS  970
             +YRP+LVMA A+PFFQQVTGINV+ FYAPVLFRT+G GES +LMS +VTG VG  +T  S
Sbjct  287   KYRPELVMALAIPFFQQVTGINVVGFYAPVLFRTVGFGESGSLMSTLVTGIVGTTSTLLS  346

Query  971   MLLVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGG-LSKGWAVLVLLLISSYVAG  1147
             ML+VD++GR+ L ++GG+ M V+Q+A+G ++    G   G + +G+   V++L+  YVAG
Sbjct  347   MLVVDRIGRKTLFLIGGLQMLVSQVAIGVIIMVAEGHHNGVIGEGYGYTVVVLVCVYVAG  406

Query  1148  FGLSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFG  1327
             FG SWGPLGWL+PSEIFPLEIRSA QS+TVAV+F+FTF V Q+   MLC L+ GIFFF+G
Sbjct  407   FGWSWGPLGWLVPSEIFPLEIRSAAQSVTVAVSFVFTFAVAQSVPPMLCKLRAGIFFFYG  466

Query  1328  GWVAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKI  1441
             GW+ VMT  V L LPETKN+PIEK+  +W +HWFW+++
Sbjct  467   GWLVVMTVAVQLFLPETKNVPIEKVAGLWEKHWFWRRM  504



>ref|XP_006394496.1| hypothetical protein EUTSA_v10003990mg [Eutrema salsugineum]
 gb|ESQ31782.1| hypothetical protein EUTSA_v10003990mg [Eutrema salsugineum]
Length=526

 Score =   511 bits (1315),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 277/464 (60%), Positives = 350/464 (75%), Gaps = 11/464 (2%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKED------SGKVSNYCKFDSELLTSFTSSLYIAGLFAS  244
             GGV SM PFLKRFF  VY   +ED      +   ++YC F+S+LLTSFTSSLY++G  + 
Sbjct  48    GGVMSMGPFLKRFFPKVYKLEEEDRIRSRSNNSKNHYCLFNSQLLTSFTSSLYVSGFVSC  107

Query  245   LLASSVTRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLY  424
             LLASSVTR+ GR PSI +GGVAFLAG+ALGG+A NV ML+  R+LLG+GVGFANQ+VPLY
Sbjct  108   LLASSVTRSFGRKPSIFLGGVAFLAGSALGGSAQNVAMLLVARLLLGVGVGFANQSVPLY  167

Query  425   LSEMAPAKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTI  604
             LSEMAPAKYRG ++  FQLC+GIG L AN  NY T+KI+DG+GWR+SL   A+PA+VLT+
Sbjct  168   LSEMAPAKYRGAISNGFQLCIGIGFLTANFTNYETQKIKDGYGWRISLATTAIPASVLTL  227

Query  605   GAVVLPETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTI-----ERP  769
             G+V LPETPNS+IQ   D   A+  L+R+RGT+DVQ EL DLV AS  S +       + 
Sbjct  228   GSVFLPETPNSIIQTTGDIRKAELMLRRIRGTNDVQDELTDLVEASSESSSSSNSNAHKM  287

Query  770   FKNILHRRYRPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavg  949
             F  +L R+YRP+LVMA  +P FQQVTGINV+AFYAPVLFRT+G GES +LMS +VTG VG
Sbjct  288   FLKLLQRKYRPELVMALMIPIFQQVTGINVVAFYAPVLFRTVGFGESGSLMSTLVTGIVG  347

Query  950   ivttFASMLLVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLI  1129
               +TF SM +VD++GR+ L +VGG+ M V+Q+ +G  +       G + +G+   VL+L+
Sbjct  348   TASTFLSMFVVDRIGRKTLFLVGGLQMLVSQVIIGVTIMVAEAHGGVIGEGYGYAVLVLV  407

Query  1130  SSYVAGFGLSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYG  1309
               YVAGFG SWGPLGWL+PSEIFPLEIRSA QS+TVAV+F+FTF V Q+   MLC  + G
Sbjct  408   CVYVAGFGWSWGPLGWLVPSEIFPLEIRSAAQSVTVAVSFVFTFAVAQSVPPMLCKFRAG  467

Query  1310  IFFFFGGWVAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKI  1441
             IFFF+GGWV VMT  V L LPETKN+PIEK+  +W +HWFW+++
Sbjct  468   IFFFYGGWVVVMTVAVQLFLPETKNVPIEKVAGLWEKHWFWRRM  511



>gb|KDO36125.1| hypothetical protein CISIN_1g017485mg [Citrus sinensis]
Length=371

 Score =   505 bits (1300),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 247/364 (68%), Positives = 298/364 (82%), Gaps = 1/364 (0%)
 Frame = +2

Query  356   MLIFGRVLLGIGVGFANQAVPLYLSEMAPAKYRGGMNVSFQLCVGIGVLIANLINYGTEK  535
             MLIFGRVLLGIG+GFANQ+VPLYLSEMAP K+RG  N+ FQ+C+ IGVL ANL+NYGT+K
Sbjct  1     MLIFGRVLLGIGIGFANQSVPLYLSEMAPPKHRGAFNIGFQVCLAIGVLSANLLNYGTQK  60

Query  536   IRDGWGWRVSLGLAAVPATVLTIGAVVLPETPNSLIQRRNDHDGAKRRLQRVRGTDDVQA  715
             I+ GWGWR+SL +AA PA++LT+GA+ +PETPNS+IQR ND   AKR LQRVRGT DV+A
Sbjct  61    IKGGWGWRISLAMAAAPASILTVGALFMPETPNSIIQRSNDPQKAKRMLQRVRGTADVEA  120

Query  716   ELDDLVAASEISRTIERPFKNILHRRYRPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTI  895
             EL+DL+ AS IS+TI  PFK I+ R+YRPQLVMA  +PFFQQVTGIN+I  YAPVL RT+
Sbjct  121   ELNDLIRASSISKTINHPFKKIIQRKYRPQLVMAILIPFFQQVTGINIIGLYAPVLLRTL  180

Query  896   GLGESAALMSavvtg-avgivttFASMLLVDKVGRRRLLIVGGILMFVTQMAVGGVMGAK  1072
              L ESA+L+ + V    +G V T  SM+LVDK+GR+ L +VGGI MFV+Q+ +G +M A+
Sbjct  181   KLSESASLLLSAVVTGGIGTVLTIISMILVDKLGRKILFLVGGIQMFVSQVIIGSIMAAE  240

Query  1073  LGDQGGLSKGWAVLVLLLISSYVAGFGLSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFL  1252
             LGD GG S+G+A L+L+L+  Y AGF  SWGPL WL+PSEIFPLEIRSAGQSITVAV  +
Sbjct  241   LGDHGGFSEGYAYLILVLVCVYSAGFSYSWGPLAWLVPSEIFPLEIRSAGQSITVAVCLV  300

Query  1253  FTFLVGQTFLAMLCHLKYGIFFFFGGWVAVMTTFVYLLLPETKNLPIEKMDLVWREHWFW  1432
             F F   QTFLAMLCH K GIFFFFGGWV VMTTF++L LPETKN+PIE+MD VWR+HWFW
Sbjct  301   FIFFTAQTFLAMLCHFKAGIFFFFGGWVIVMTTFMHLFLPETKNVPIEQMDKVWRQHWFW  360

Query  1433  KKIV  1444
             KK V
Sbjct  361   KKYV  364



>gb|EEC70918.1| hypothetical protein OsI_02481 [Oryza sativa Indica Group]
Length=507

 Score =   510 bits (1313),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 269/455 (59%), Positives = 345/455 (76%), Gaps = 4/455 (1%)
 Frame = +2

Query  86    GVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSVT  265
             GVTSM+ FL +FF  VY K KE   + + YCKFDSELLT FTSSLY+A L ASL AS +T
Sbjct  41    GVTSMDSFLIKFFPSVYAKEKEMV-ETNQYCKFDSELLTLFTSSLYLAALIASLFASVIT  99

Query  266   RACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAPA  445
             R  GR  ++L GGV FL GA L GAA +V MLI GR+LLGIGVGF+NQAVPLYLSEMAPA
Sbjct  100   RKFGRRITMLGGGVIFLVGAILNGAAADVAMLIIGRILLGIGVGFSNQAVPLYLSEMAPA  159

Query  446   KYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLPE  625
             + RG +N+SFQL + +G+L ANLINY T+KI  GWGWRVSLGLAAVPA ++  G++ LP+
Sbjct  160   RMRGMLNISFQLMITVGILAANLINYFTDKIAGGWGWRVSLGLAAVPAVIMAGGSLFLPD  219

Query  626   TPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRPQ  805
             TPNSL+ R  +++ A+  L+R+RGTDDV  E DDLVAASE S+ IE P++ +L RRYRPQ
Sbjct  220   TPNSLLSRGKENE-ARAMLRRIRGTDDVGPEYDDLVAASEASKAIENPWRTLLERRYRPQ  278

Query  806   LVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLVD  985
             LVM+  +P  QQ+TGINV+ FYAPVLF+TIG G +A+LMSAV+TG V +  TF S+  VD
Sbjct  279   LVMSVLIPTLQQLTGINVVMFYAPVLFKTIGFGGTASLMSAVITGLVNMFATFVSIATVD  338

Query  986   KVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG--GLSKGWAVLVLLLISSYVAGFGLS  1159
             ++GRR+LL+ GG+ M   Q  +G ++  K G  G   +S+G+A++V+L I  +V+ F  S
Sbjct  339   RLGRRKLLLQGGVQMIFAQFILGTLIAVKFGTAGVANISRGYAIVVVLCICVFVSAFAWS  398

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPLGWL+PSEIFPLEIRSA QS+ V  N  FTF++ Q FL MLCHLK+G+F+FFG    
Sbjct  399   WGPLGWLVPSEIFPLEIRSAAQSVVVVFNMAFTFIIAQIFLMMLCHLKFGLFYFFGAMEL  458

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             +MT FV+  LPETK +PIE+MD +W +HW+W++ V
Sbjct  459   IMTGFVFFFLPETKGIPIEEMDRIWGKHWYWRRFV  493



>emb|CDY22024.1| BnaA09g00530D [Brassica napus]
Length=508

 Score =   509 bits (1312),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 263/454 (58%), Positives = 348/454 (77%), Gaps = 4/454 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL+ FF  VY K K+     SNYCK+D + L +FTSSLY+AGL ++L AS +
Sbjct  49    GGVTSMDEFLEEFFKTVYDKKKQ--AHESNYCKYDDQGLAAFTSSLYLAGLVSTLAASPI  106

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  SI+ GG++FL GAAL   A+N+ ML+ GR+LLG+G+GF NQAVPLYLSE+AP
Sbjct  107   TRNYGRRASIVCGGISFLVGAALNAGAVNLPMLLAGRILLGVGIGFGNQAVPLYLSEVAP  166

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
                RGG+N+ FQL   +G+  AN++NYGT++++  WGWR+SLGLAA PA ++T+G  +LP
Sbjct  167   THLRGGLNMMFQLATTLGIFTANMVNYGTQQLKP-WGWRLSLGLAAFPALLMTLGGYLLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSL++R     G +R L+++RGT +V AEL D+V ASE++ +I+ PF+NIL +++RP
Sbjct  226   ETPNSLVERGLTERG-RRVLEKLRGTQNVDAELQDMVDASELANSIKHPFRNILQKQHRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA  +P FQ +TGIN I FYAPVLF+T+G G +A+L S+ +TGAV +++T  S+ LV
Sbjct  285   QLVMAVCMPMFQILTGINSILFYAPVLFQTMGFGGNASLYSSALTGAVLVLSTLISIALV  344

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR LLI GG+ M + Q  V  ++G K GD   LSKG++++V++ I  +V  FG SW
Sbjct  345   DKLGRRALLISGGVQMIICQAIVSVILGLKFGDDQELSKGYSIVVVIFICLFVVAFGWSW  404

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGW IPSEIFPLEIRSAGQSITVAVN LFTF++ Q FL+MLC  K+GIF FF GWV V
Sbjct  405   GPLGWTIPSEIFPLEIRSAGQSITVAVNLLFTFVIAQAFLSMLCAFKFGIFLFFAGWVLV  464

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY LLPETK +PIE+M L+W+ HWFWKK++
Sbjct  465   MTVFVYFLLPETKGVPIEEMTLLWKRHWFWKKVL  498



>gb|AHC98497.1| putative hexose transporter [Zea mays]
Length=523

 Score =   509 bits (1312),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 269/454 (59%), Positives = 352/454 (78%), Gaps = 4/454 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL++FF  V+ +  ++SG  +NYCK+D++ L +FTSSLY+AGL ASL+AS V
Sbjct  49    GGVTSMDLFLEKFFPVVFHR--KNSGGKNNYCKYDNQGLAAFTSSLYLAGLVASLVASPV  106

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  SI+ GGV+FL GAAL  AA+N+ MLI GR++LG+G+GF NQAVPLYLSEMAP
Sbjct  107   TRNYGRKASIVCGGVSFLIGAALNVAAVNLAMLILGRIMLGVGIGFGNQAVPLYLSEMAP  166

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A  RGG+N+ FQL   +G+  ANLINYGT+ I+  WGWR+SLGLAAVPA ++T+G + LP
Sbjct  167   AHLRGGLNMMFQLATTLGIFTANLINYGTQNIKP-WGWRLSLGLAAVPALLMTLGGLFLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSLI+R    +G +R L+R+RGT DV AE  D+V ASE++ T+E PF+NIL  R RP
Sbjct  226   ETPNSLIERGRVEEG-RRVLERIRGTADVDAEFTDMVEASELANTVEHPFRNILQPRNRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA  +P FQ +TGIN I FYAPVLF+++G G +A+L S+V+TGAV   +T  S+ +V
Sbjct  285   QLVMAVCMPAFQILTGINSILFYAPVLFQSMGFGGNASLYSSVLTGAVLFSSTLISIGIV  344

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             D++GRR+LLI GGI M V Q+ V  ++G K G +  L++ ++V V+++I  +V  FG SW
Sbjct  345   DRLGRRKLLISGGIQMIVCQVIVAVILGVKFGAEKQLARSYSVAVVVVICLFVLAFGWSW  404

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGW +PSEIFPLE RSAGQSITVAVN LFTF + Q FL++LC  K+GIF FF GW+ V
Sbjct  405   GPLGWTVPSEIFPLETRSAGQSITVAVNLLFTFAIAQAFLSLLCAFKFGIFLFFAGWITV  464

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY+ LPETK +PIE+M L+WR+HWFWKK++
Sbjct  465   MTVFVYVFLPETKGVPIEEMVLLWRKHWFWKKVM  498



>gb|KFK30778.1| hexose transporter [Arabis alpina]
Length=516

 Score =   509 bits (1311),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 264/455 (58%), Positives = 349/455 (77%), Gaps = 5/455 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL+ FFH VY K K      SNYCK+D + L +FTSSLY+AGL ++L+AS V
Sbjct  49    GGVTSMDEFLEEFFHSVYEKKKL--AHESNYCKYDDQGLATFTSSLYLAGLVSTLVASPV  106

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  SI+ GG++FL G+AL   A+++ ML+ GR+LLG+G+GF NQAVPLYLSE+AP
Sbjct  107   TRNYGRRASIVCGGISFLLGSALNAGAVHLAMLLVGRILLGVGIGFGNQAVPLYLSEVAP  166

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
                RGG+N+ FQL   +G+  AN++N+GT+K++  WGWR+SLGLAA PA ++T+G   LP
Sbjct  167   THLRGGLNMMFQLATTLGIFTANMVNFGTQKLKP-WGWRLSLGLAAFPALLMTLGGYYLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSL++R     G +R L+++RGT++V AEL D+V ASE++ +I+ PFKNI+ ++YRP
Sbjct  226   ETPNSLVERGLTERG-RRVLEKLRGTENVNAELQDMVDASELANSIKHPFKNIMRKQYRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA  +P FQ +TGIN I FYAPVLF+T+G G +A+L S+ +TGAV +++T  S+ LV
Sbjct  285   QLVMAICMPMFQILTGINSILFYAPVLFQTMGFGGNASLYSSALTGAVLVLSTVVSISLV  344

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGD-QGGLSKGWAVLVLLLISSYVAGFGLS  1159
             D+VGRR LLI GGI M + Q+ V  ++G K GD Q  LSKG+ +LV++ I  +V  FG S
Sbjct  345   DRVGRRALLISGGIQMIICQVIVSVILGLKFGDTQDNLSKGYTILVVVFICLFVIAFGWS  404

Query  1160  WGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVA  1339
             WGPLGW IPSEIFPLEIRSAGQSITVAVN  FTF++ Q FL++LC  K+GIF FF GWV 
Sbjct  405   WGPLGWTIPSEIFPLEIRSAGQSITVAVNLFFTFIIAQAFLSLLCAFKFGIFIFFAGWVT  464

Query  1340  VMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             VMT FVY LLPETK +PIE+M L+W++HWFW K++
Sbjct  465   VMTIFVYFLLPETKGVPIEEMTLLWKKHWFWNKLL  499



>ref|XP_006644257.1| PREDICTED: sugar carrier protein C-like [Oryza brachyantha]
Length=514

 Score =   509 bits (1310),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 270/456 (59%), Positives = 344/456 (75%), Gaps = 4/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+PFL +FF  VY K KE   + + YCKFDSELLT FTSSLY+A L ASL AS +
Sbjct  46    GGVTSMDPFLIKFFPSVYAKEKEMV-ETNQYCKFDSELLTLFTSSLYLAALVASLFASVI  104

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  ++L GGV FL GA L GAA +V MLI GR+LLGIGVGF+NQAVPLYLSEMAP
Sbjct  105   TRKFGRRMTMLGGGVIFLVGAILNGAAADVAMLIIGRILLGIGVGFSNQAVPLYLSEMAP  164

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A+ RG +N+SFQL + +G+L ANLINY T+KI  GWGWRVSLGLAAVPA +++ G++ LP
Sbjct  165   ARMRGMLNISFQLMITVGILAANLINYFTDKIAGGWGWRVSLGLAAVPAFIMSGGSLFLP  224

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSL+ R    D A+  L+R+RGT+DV  E DDLVAASE S+ I  P   +L RRYR 
Sbjct  225   DTPNSLLAR-GKEDEARTMLRRIRGTNDVGPEYDDLVAASEASKAIVNPCSTLLERRYRA  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLV++  +P  QQ+TGINV+ FYAPVLF+TIG G +A+LMSAV+TG V +V  F S+  V
Sbjct  284   QLVVSLRIPTLQQLTGINVVMFYAPVLFKTIGFGGTASLMSAVITGLVNMVAPFVSIATV  343

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG--GLSKGWAVLVLLLISSYVAGFGL  1156
             D++GRR+LL+ GG+ M + Q+ +G ++  K G  G   +S+ +A++V+L I  +V+ F  
Sbjct  344   DRLGRRKLLLQGGVQMIIAQLILGTLIAIKFGTAGVANISRTYAIVVVLCICVFVSAFAW  403

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSEIFPLEIRSA QS+ V  N LFTF++ Q FL MLCHLK+G+F+FFG   
Sbjct  404   SWGPLGWLVPSEIFPLEIRSAAQSVVVVFNMLFTFIIAQVFLMMLCHLKFGLFYFFGACE  463

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              VMT FVY  LPETK +PIE+MD +W +HW+W++ V
Sbjct  464   LVMTAFVYFFLPETKGIPIEEMDRIWGKHWYWRRFV  499



>ref|XP_010253802.1| PREDICTED: sugar transport protein 4 [Nelumbo nucifera]
Length=516

 Score =   509 bits (1310),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 283/456 (62%), Positives = 354/456 (78%), Gaps = 3/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM PFLK+FF  VY +M +D+   + YCKFDS+LLTSFTSSLYIA L AS  AS++
Sbjct  45    GGVTSMSPFLKKFFPSVYERMNDDTDTHNQYCKFDSQLLTSFTSSLYIAALIASFFASAI  104

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+ IGG  F  G+ L G A NV +LI GR+LLG+GVGFANQ+VP+YLSEMAP
Sbjct  105   TRLFGRKISMAIGGAVFFIGSILNGIANNVGILILGRLLLGVGVGFANQSVPVYLSEMAP  164

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             AK RG +N+ FQL + IG+L+ANL+NYGT+KI+ G+GWR+SL LAAVPA V+T+G++ LP
Sbjct  165   AKLRGALNMGFQLAITIGILVANLVNYGTDKIKGGYGWRISLILAAVPAAVMTVGSLFLP  224

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNSLI+R +    AK  LQ+VRGT DV  E  DL+ ASE ++ ++ P+KNI+ RRYRP
Sbjct  225   DTPNSLIERGHTEK-AKAMLQKVRGTTDVDEEFQDLIDASESAKQVQHPWKNIIDRRYRP  283

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVM+  +PFFQQ+TGINVI FYAPVLF T+G G +A+LMSAV+TG V    T  S++ V
Sbjct  284   QLVMSIMIPFFQQLTGINVIMFYAPVLFMTLGFGGAASLMSAVITGLVNFFATIVSIVTV  343

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGD--QGGLSKGWAVLVLLLISSYVAGFGL  1156
             DK GRR L I GGI M + Q+ VG V+G K G+  QG LSKG+A  VL LI SYVA F  
Sbjct  344   DKYGRRFLFIEGGIQMIICQIGVGTVLGIKFGESGQGSLSKGYADFVLFLICSYVAAFAW  403

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSEIFPLEIRSAGQ+I V+VN LFTF + Q FLAMLCH+K+G+FFFF G+V
Sbjct  404   SWGPLGWLVPSEIFPLEIRSAGQAINVSVNMLFTFGIAQAFLAMLCHMKFGLFFFFAGFV  463

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              +MT F++  LPETKN+PIE+M+ VW++HWFW K +
Sbjct  464   LIMTLFIFFFLPETKNVPIEEMNRVWKQHWFWGKYI  499



>dbj|BAA83554.1| putative hexose transport protein HEX6 [Oryza sativa Japonica 
Group]
 gb|EAY99596.1| hypothetical protein OsI_21574 [Oryza sativa Indica Group]
 gb|EAZ35781.1| hypothetical protein OsJ_20072 [Oryza sativa Japonica Group]
Length=520

 Score =   509 bits (1311),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 288/457 (63%), Positives = 363/457 (79%), Gaps = 4/457 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGV+SMEPFL++FF +V+ +M+ D  +VSNYCKFDS+LLT+FTSSLY+AGL  +  AS V
Sbjct  50    GGVSSMEPFLRKFFPEVHRRMEGDV-RVSNYCKFDSQLLTAFTSSLYVAGLLTTFAASRV  108

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             T   GR PS+L+GG AFLAGAA+GGA++++YM+I GRVLLG+G+GFANQAVPLYLSEMAP
Sbjct  109   TAGRGRRPSMLLGGAAFLAGAAVGGASVDIYMVILGRVLLGVGLGFANQAVPLYLSEMAP  168

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             +++RG  +  FQL VG+G L AN+INYGTEKIR GWGWRVSL LAAVPA +LT+GA+ LP
Sbjct  169   SRWRGAFSNGFQLSVGVGALAANVINYGTEKIRGGWGWRVSLALAAVPAGLLTLGALFLP  228

Query  623   ETPNSLIQR-RNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNIL--HRR  793
             ETPNSLIQ+ + +    ++ L+++RG DDV  ELD +VAA+  +  +      +L   RR
Sbjct  229   ETPNSLIQQGKVERCDVEQLLKKIRGADDVADELDTIVAANSATAGVGGGGLLMLLTQRR  288

Query  794   YRPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASM  973
             YRPQL MA  +PFFQQVTGIN IAFYAPVL RTIG+GESA+L+SAVVTG VG+  T  SM
Sbjct  289   YRPQLAMAVMIPFFQQVTGINAIAFYAPVLLRTIGMGESASLLSAVVTGVVGVGATLLSM  348

Query  974   LLVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFG  1153
               VD+ GRR L + GG  M  +Q+ +GG+M AKLGD GG+S+ WA  ++LLI++YVAGFG
Sbjct  349   FAVDRFGRRTLFLAGGAQMLASQVLIGGIMAAKLGDDGGVSRAWAAALILLIAAYVAGFG  408

Query  1154  LSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGW  1333
              SWGPLGWL+PSE+FPLE+RSAGQS+TVA +F+FT  V Q FLAMLC ++ GIFFFF  W
Sbjct  409   WSWGPLGWLVPSEVFPLEVRSAGQSVTVATSFVFTVFVAQAFLAMLCRMRAGIFFFFAAW  468

Query  1334  VAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             +A MT FVYLLLPETK +PIE++  VWR HWFW ++V
Sbjct  469   LAAMTAFVYLLLPETKGVPIEEVAGVWRGHWFWSRVV  505



>ref|XP_006663022.1| PREDICTED: hexose carrier protein HEX6-like [Oryza brachyantha]
Length=518

 Score =   509 bits (1310),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 270/460 (59%), Positives = 341/460 (74%), Gaps = 4/460 (1%)
 Frame = +2

Query  77    SVGGVTSMEPFLKRFFHDVYTKMKEDSG---KVSNYCKFDSELLTSFTSSLYIAGLF-AS  244
             + GGV+SMEPFL+ FF DV  +M    G   +VSNYCKFDS+LLT FTSSLYI+GL  A 
Sbjct  42    TAGGVSSMEPFLREFFPDVLRRMAGGGGAPRRVSNYCKFDSQLLTLFTSSLYISGLLTAV  101

Query  245   LLASSVTRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLY  424
             LLAS VT + GR  S+++GGVA++AGAA+ GAA+NV M I GR LLG+G+GF  Q+VPLY
Sbjct  102   LLASWVTASRGRRTSMILGGVAYIAGAAVSGAAVNVSMAILGRALLGVGLGFTTQSVPLY  161

Query  425   LSEMAPAKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTI  604
             ++EMAPA+YRG  +   Q  + +G L A  +N+  EKIR GWGWR+SL LA VPA +LT+
Sbjct  162   MAEMAPARYRGAFSNGIQFSLCLGALAATTVNFAVEKIRGGWGWRLSLSLAGVPAVLLTV  221

Query  605   GAVVLPETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNIL  784
             GA+ LPETPNSL+Q+  D D  K  LQ++RG D V  ELD++VAA+  ++     +  + 
Sbjct  222   GAIFLPETPNSLVQQGEDRDKVKALLQKIRGVDAVDNELDEIVAANAAAQGENGMWLILS  281

Query  785   HRRYRPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttF  964
              RRYRPQL MA  +P F Q+TGINVI FYAPVL RTIG+GESA+LMS V+   V   +T 
Sbjct  282   QRRYRPQLAMAVLIPAFTQLTGINVIGFYAPVLLRTIGMGESASLMSTVILVIVSSASTL  341

Query  965   ASMLLVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVA  1144
              SM LVD  GRR LL+VGG  M V+++ +GGVM AKL D+GGLS+ +A+L++ +I+ Y A
Sbjct  342   ISMFLVDSFGRRTLLLVGGFQMLVSEVLIGGVMAAKLRDEGGLSRTYALLLIFVINVYSA  401

Query  1145  GFGLSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFF  1324
             GF LSWGPL WL+PSEIFPLEIRSAGQS+ VA  F+FT +V Q FLAMLC +K  IFFFF
Sbjct  402   GFSLSWGPLSWLVPSEIFPLEIRSAGQSVAVASCFVFTVIVAQCFLAMLCRMKACIFFFF  461

Query  1325  GGWVAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              GW+A MT FVYL LPETK +PIE++  VW EHWFW+ I+
Sbjct  462   AGWIAAMTAFVYLFLPETKGMPIEQVGRVWEEHWFWRWIL  501



>ref|XP_009417436.1| PREDICTED: sugar transport protein 7 [Musa acuminata subsp. malaccensis]
Length=521

 Score =   509 bits (1310),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 269/454 (59%), Positives = 353/454 (78%), Gaps = 4/454 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+PFLK+FF  VY K  ++S   +NYC++D++ L +FTSSLY+AGL ASL AS V
Sbjct  51    GGVTSMDPFLKKFFPVVYRK--KNSQSHNNYCEYDNQGLAAFTSSLYLAGLVASLAASPV  108

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  SI+ GG++FL GA L  AA+N+ MLI GR++LGIG+GF NQAVPLYLSEMAP
Sbjct  109   TRKHGRRASIVCGGISFLVGATLNSAAVNLPMLILGRIMLGIGIGFGNQAVPLYLSEMAP  168

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             A  RGG+N+ FQL   +G+  AN+INYGTEKI+  WGWR+SLGLAA PA ++TIG  +LP
Sbjct  169   AHLRGGLNMMFQLATTLGIFSANMINYGTEKIKP-WGWRLSLGLAAAPAILMTIGGALLP  227

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSL+++    +G +R L+++RGT+DV AEL D+V ASE++ +IE PF+NIL RR RP
Sbjct  228   ETPNSLVEQGRAEEG-RRVLEKIRGTNDVDAELQDIVEASELANSIEHPFRNILERRNRP  286

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QL+MA  +P FQ +TGIN I FYAPVLF+++G G +AAL S+V+TGAV   +T  S+  V
Sbjct  287   QLIMAILMPTFQILTGINSILFYAPVLFQSMGFGGNAALYSSVMTGAVLASSTLVSIATV  346

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             D+ GRR LLI GG+ M V Q+AV  ++G K G    LSK ++++V+++I  +VA FG SW
Sbjct  347   DRWGRRPLLIGGGLQMIVCQVAVAVILGVKFGGDKQLSKDFSIVVVVVICLFVAAFGWSW  406

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGW +PSEIFPLE RSAGQSITV+VN LFTF + Q+FL++LC  K+GIF FF GW+ +
Sbjct  407   GPLGWTVPSEIFPLETRSAGQSITVSVNLLFTFAIAQSFLSLLCSFKFGIFLFFAGWITI  466

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY+ LPETK +PIE+M L+WR+HWFWK+++
Sbjct  467   MTVFVYVFLPETKGVPIEEMILLWRKHWFWKRVM  500



>ref|XP_006287526.1| hypothetical protein CARUB_v10000732mg [Capsella rubella]
 gb|EOA20424.1| hypothetical protein CARUB_v10000732mg [Capsella rubella]
Length=516

 Score =   509 bits (1310),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 262/454 (58%), Positives = 348/454 (77%), Gaps = 4/454 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL+ FFH VY K K      SNYCK+D++ L +FTSSLY+AGL ++L+AS +
Sbjct  49    GGVTSMDEFLEEFFHAVYEKKKH--AHESNYCKYDNQGLAAFTSSLYLAGLVSTLVASPI  106

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  SI+ GG++FL GAAL   A+N+ ML+ GR++LG+G+GF NQAVPLYLSE+AP
Sbjct  107   TRNYGRRASIVCGGISFLVGAALNAGAVNLVMLLAGRIMLGVGIGFGNQAVPLYLSEVAP  166

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
                RGG+N+ FQL   +G+  AN++N+GT++++  WGWR+SLGLAA PA ++T+G   LP
Sbjct  167   THLRGGLNMMFQLATTLGIFTANMVNFGTQQLKP-WGWRLSLGLAAFPALLMTLGGYFLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNSL++R     G +  L+++RGT +V AEL D+V ASE++ +I+ PF+NIL +R+RP
Sbjct  226   ETPNSLVERGLTERG-RHVLEKLRGTKNVNAELQDMVDASELANSIKHPFRNILQKRHRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLVMA  +P FQ +TGIN I FYAPVLF+T+G G +A+L S+ +TGAV +++T  S+ LV
Sbjct  285   QLVMAICMPMFQILTGINSILFYAPVLFQTMGFGGNASLYSSALTGAVLVLSTLISIGLV  344

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVAGFGLSW  1162
             DK+GRR LLI GGI M + Q+ V  ++G K GD+  LSKG++V+V++ I  +V  FG SW
Sbjct  345   DKLGRRALLISGGIQMIICQVIVAVILGVKFGDKEELSKGYSVIVVIFICLFVMAFGWSW  404

Query  1163  GPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWVAV  1342
             GPLGW IPSEIFPLE RSAGQSITVAVN L TF++ Q FLA+LC  K+GIF FF GWV V
Sbjct  405   GPLGWTIPSEIFPLETRSAGQSITVAVNLLLTFIIAQAFLALLCAFKFGIFLFFAGWVTV  464

Query  1343  MTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             MT FVY LLPETK +PIE+M L+W +HWFWKK++
Sbjct  465   MTIFVYFLLPETKGVPIEEMTLLWSKHWFWKKVL  498



>ref|XP_006343267.1| PREDICTED: sugar carrier protein C-like [Solanum tuberosum]
Length=524

 Score =   509 bits (1310),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 270/455 (59%), Positives = 344/455 (76%), Gaps = 7/455 (2%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL +FFH VYTK K D+   + YCKFDS+ LT FTSSLY+A LF+S++AS+V
Sbjct  47    GGVTSMDSFLSKFFHSVYTKQKADT-STNQYCKFDSQTLTMFTSSLYLAALFSSIVASTV  105

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+L GGV F  GA + G A +V MLI GR+LLG G+GFANQ+VPLYLSEMAP
Sbjct  106   TRKLGRKLSMLFGGVLFCVGALINGLARDVAMLIVGRILLGFGIGFANQSVPLYLSEMAP  165

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              KYRG +N+ FQL + IG+L+AN++N+   K    WGWR+SLG A VP  ++T+G+++LP
Sbjct  166   YKYRGALNIGFQLSITIGILVANVLNFFFAKFD--WGWRLSLGGAMVPGLIITVGSLLLP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNS+I+R N+ + AK +L+R+RG DDV  E +DLV ASE SR +E P++N+L R+YRP
Sbjct  224   ETPNSMIERGNNEE-AKTKLKRIRGVDDVDEEFNDLVVASEASRKVEHPWRNLLQRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
              L MA A+PFFQQ+TGINVI FYAPVLF+TIG G  A+LMSAV+TG V +  T  S+  V
Sbjct  283   HLTMAIAIPFFQQLTGINVIMFYAPVLFKTIGFGGDASLMSAVITGIVNVGATIVSIYYV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQG---GLSKGWAVLVLLLISSYVAGFG  1153
             DK+GRR L + GGI M + Q+AV   +G K G  G    L K +A LV++ I  YVAGF 
Sbjct  343   DKLGRRFLFLEGGIQMLICQIAVAICIGTKFGTDGYAGELPKWYATLVVIFICIYVAGFA  402

Query  1154  LSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGW  1333
              SWGPLGWL+PSEIFPLEIRSA QSI V+VN +FTF+V Q FL +LCHLK+G+F FF  +
Sbjct  403   WSWGPLGWLVPSEIFPLEIRSAAQSINVSVNMIFTFIVAQVFLTLLCHLKFGLFIFFAFF  462

Query  1334  VAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKK  1438
             V VMT F+Y  LPETKN+PIE+M +VW++HWFW +
Sbjct  463   VCVMTVFIYFFLPETKNVPIEEMVVVWKQHWFWSR  497



>emb|CDO99641.1| unnamed protein product [Coffea canephora]
Length=520

 Score =   509 bits (1310),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 278/457 (61%), Positives = 348/457 (76%), Gaps = 5/457 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSM+ FL +FF  VY K K D    + YCKFDSE LT FTSSLY+A L +SL+AS+V
Sbjct  45    GGVTSMDSFLHKFFRSVYDK-KNDHKSTNQYCKFDSETLTMFTSSLYLAALASSLVASTV  103

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+L GGV FLAGA + G A  V+MLI GR+LLG G+GFANQ+VPLYLSEMAP
Sbjct  104   TRKMGRKLSMLFGGVLFLAGALVNGFARKVWMLIVGRILLGFGIGFANQSVPLYLSEMAP  163

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
              KYRG +N+ FQL + IG+L+AN++NY   KI+ GWGWR+SLG A VPA ++T+G+++LP
Sbjct  164   YKYRGALNIGFQLSITIGILVANVLNYFFAKIKGGWGWRLSLGGAMVPALIITVGSLILP  223

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             ETPNS+I+R   ++ AK RL R+RG D+V  E +DLVAASE S+ +E P++NIL R+YRP
Sbjct  224   ETPNSMIERGQTNE-AKARLIRIRGIDNVDEEFNDLVAASEASKMVEHPWRNILQRKYRP  282

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QL MA A+PFFQQ TGINVI FYAPVLF+TIG   +A+LMSAV+TG V +V T  S+  V
Sbjct  283   QLTMAIAIPFFQQFTGINVIMFYAPVLFQTIGFKSNASLMSAVITGIVNVVATMVSIYGV  342

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLG---DQGGLSKGWAVLVLLLISSYVAGFG  1153
             DK GRR L + GG+ M + Q+ V   +G K G   D G L K +AV+V+L I  YVAGF 
Sbjct  343   DKWGRRALFLEGGVQMLICQIIVSICIGVKFGVNGDPGDLPKWYAVVVVLFICIYVAGFA  402

Query  1154  LSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGW  1333
              SWGPLGWL+PSEIFPLEIRSA QS+ V+VN  FTFLV Q FL MLCH+K+G+F FFGG+
Sbjct  403   WSWGPLGWLVPSEIFPLEIRSAAQSVNVSVNMFFTFLVAQVFLNMLCHMKFGLFLFFGGF  462

Query  1334  VAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
             V +MT F+Y  LPETKN+PIE+M +VW++HWFW + V
Sbjct  463   VLIMTIFIYFFLPETKNIPIEEMHMVWKQHWFWSRYV  499



>ref|XP_009136482.1| PREDICTED: sugar transport protein 3 isoform X1 [Brassica rapa]
Length=518

 Score =   508 bits (1308),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 279/459 (61%), Positives = 354/459 (77%), Gaps = 6/459 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSN-----YCKFDSELLTSFTSSLYIAGLFASL  247
             GGV SM PFL+RFF  VY   +ED  + S+     YC F+S+LLTSFTSSLY++G  A+L
Sbjct  46    GGVMSMGPFLERFFPKVYKLQEEDRIRRSHNNKNHYCLFNSQLLTSFTSSLYVSGFIATL  105

Query  248   LASSVTRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYL  427
             LASSVTR+ GR PSI +GGVAFLAG+ALGG+A NV MLI  R+LLG+GVGFANQ+VPLYL
Sbjct  106   LASSVTRSWGRKPSIFLGGVAFLAGSALGGSAQNVAMLIIARLLLGVGVGFANQSVPLYL  165

Query  428   SEMAPAKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIG  607
             SEMAPA+YRG ++  FQLC+GIG L AN  NY T+KI++G+GWR+SL  AAVPA++LT+G
Sbjct  166   SEMAPARYRGAISNGFQLCIGIGFLTANFTNYETQKIKEGYGWRISLATAAVPASILTLG  225

Query  608   AVVLPETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERP-FKNIL  784
             ++ LPETPNSLIQ   D   A+  L+R+RGT++VQ EL DLV AS  S +  R  F N+L
Sbjct  226   SLFLPETPNSLIQTTGDVHKAELMLRRIRGTNNVQDELADLVEASSESNSNARHGFLNLL  285

Query  785   HRRYRPQLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttF  964
               RYRP+L MAFA+PFFQQVTGINV+AFYAPVLFRT+G GES +LMS +V+G VG  +TF
Sbjct  286   QTRYRPELAMAFAIPFFQQVTGINVVAFYAPVLFRTVGFGESGSLMSTLVSGIVGTASTF  345

Query  965   ASMLLVDKVGRRRLLIVGGILMFVTQMAVGGVMGAKLGDQGGLSKGWAVLVLLLISSYVA  1144
              SML+VD++GR+ L ++GG+ M  +Q+ +G ++       G + + +   V++L+  YVA
Sbjct  346   LSMLVVDRIGRKTLFLLGGLQMLASQVIIGVIIMVAEVRDGVIGERYGYAVVVLVCVYVA  405

Query  1145  GFGLSWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFF  1324
             GFG SWGPLGWL+PSEIFPLEIRSA QS+TVAV+F+FTF V Q+   MLC  + GIFFF+
Sbjct  406   GFGWSWGPLGWLVPSEIFPLEIRSAAQSVTVAVSFVFTFAVAQSVPPMLCKFQAGIFFFY  465

Query  1325  GGWVAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKI  1441
             GGWVAVMT  V L LPETKN+PIEK+  +W +HWFW K+
Sbjct  466   GGWVAVMTVAVQLFLPETKNVPIEKVAGLWEKHWFWGKL  504



>ref|XP_007043258.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOX99089.1| Major facilitator superfamily protein [Theobroma cacao]
Length=517

 Score =   508 bits (1308),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 267/456 (59%), Positives = 346/456 (76%), Gaps = 3/456 (1%)
 Frame = +2

Query  83    GGVTSMEPFLKRFFHDVYTKMKEDSGKVSNYCKFDSELLTSFTSSLYIAGLFASLLASSV  262
             GGVTSMEPFLK+FF  V+ K  + +   S YCKFDS+LLT FTSSLY+A L AS  AS V
Sbjct  46    GGVTSMEPFLKKFFPSVFAKQNDAAKHESEYCKFDSQLLTLFTSSLYLAALVASFFASVV  105

Query  263   TRACGRTPSiliggvaflagaalggaaiNVYMLIFGRVLLGIGVGFANQAVPLYLSEMAP  442
             TR  GR  S+ +GG+AFL G+ L G A+NV +LI GR+LLG+GVGFANQ+VP+YLSEMAP
Sbjct  106   TRIFGRKVSMFVGGLAFLVGSILNGVAMNVAVLIIGRLLLGVGVGFANQSVPVYLSEMAP  165

Query  443   AKYRGGMNVSFQLCVGIGVLIANLINYGTEKIRDGWGWRVSLGLAAVPATVLTIGAVVLP  622
             AK RG +N+ FQ+ + IG+L+A LINYGT KI  GWGWRVSL LA VPA V+T+GA+VLP
Sbjct  166   AKIRGALNIGFQMAITIGILVAGLINYGTAKIEGGWGWRVSLALAVVPALVMTLGAIVLP  225

Query  623   ETPNSLIQRRNDHDGAKRRLQRVRGTDDVQAELDDLVAASEISRTIERPFKNILHRRYRP  802
             +TPNS+++R +    A++ LQ+VRGT +V  E  DLV ASE ++ ++ P++NIL  RYRP
Sbjct  226   DTPNSILERGHSEK-ARQMLQKVRGTQNVDDEFQDLVDASEAAKKVDHPWRNILQPRYRP  284

Query  803   QLVMAFAVPFFQQVTGINVIAFYAPVLFRTIGLGESAALMSavvtgavgivttFASMLLV  982
             QLV+   +PFFQQ+TGINVI FYAPVLF+T+G G+ A+LMSAV++G V ++ T  S+   
Sbjct  285   QLVLCILIPFFQQLTGINVIMFYAPVLFKTLGFGDDASLMSAVISGTVNVLATIVSIYSA  344

Query  983   DKVGRRRLLIVGGILMFVTQMAVGGVMGAKLG--DQGGLSKGWAVLVLLLISSYVAGFGL  1156
             D+ GRR L + GG+ M ++Q AVG ++  K G   +G LSK  A  +L LI  YVA F  
Sbjct  345   DRYGRRILFLEGGVQMIISQFAVGIMIALKFGLNGEGTLSKSDANFLLFLICVYVAAFAW  404

Query  1157  SWGPLGWLIPSEIFPLEIRSAGQSITVAVNFLFTFLVGQTFLAMLCHLKYGIFFFFGGWV  1336
             SWGPLGWL+PSEI PLEIRSAGQ+I VAVN +FTF++ Q FL+MLCH+K+G+FFFF  +V
Sbjct  405   SWGPLGWLVPSEICPLEIRSAGQAINVAVNMIFTFIIAQVFLSMLCHMKFGLFFFFAAFV  464

Query  1337  AVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV  1444
              +MT  +Y  LPETKN+PIE+M+ VW++HWFW K +
Sbjct  465   IIMTIVIYFFLPETKNVPIEEMNKVWKQHWFWAKYI  500



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4188154807536