BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13324_g2_i1 len=848 path=[537:0-535 530:536-579 306:580-803
530:804-847]

Length=848
                                                                      Score     E

gb|EPS62639.1|  hypothetical protein M569_12151                         143   1e-38   
ref|XP_011074828.1|  PREDICTED: uncharacterized protein LOC105159450    141   1e-37   
gb|EYU29075.1|  hypothetical protein MIMGU_mgv1a015411mg                140   3e-37   
ref|XP_007040120.1|  Uncharacterized protein TCM_016174               49.7    5e-04   



>gb|EPS62639.1| hypothetical protein M569_12151, partial [Genlisea aurea]
Length=123

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 87/121 (72%), Gaps = 1/121 (1%)
 Frame = -2

Query  376  KRVEIENNHTSYLSIRCFSFEESLELKHLAAGEKYTFDLKVRTFFPSATMYNCSTNMGTF  197
            K V + NNHT+YLS+RCFSF+    + HL    +Y F    R F+ S+TM+NCSTNMGTF
Sbjct  4    KTVVVTNNHTNYLSLRCFSFDNDYTVVHLQTWGQYRFRFNTRVFYASSTMFNCSTNMGTF  63

Query  196  MAFRHNYQCASKAEFNVCNWRFDDLMTYLYNPSINQWGSYEFNPNYESLSRGGVIRGYFV  17
            +A+R++Y+C S   F  C+WRFD+   Y+++P    W +YE++PNYESL+RGGVI+GYF 
Sbjct  64   VAYRYDYEC-SDWRFETCDWRFDEESAYIWHPKSKTWATYEYDPNYESLNRGGVIQGYFA  122

Query  16   N  14
            N
Sbjct  123  N  123



>ref|XP_011074828.1| PREDICTED: uncharacterized protein LOC105159450 [Sesamum indicum]
Length=150

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 90/121 (74%), Gaps = 1/121 (1%)
 Frame = -2

Query  376  KRVEIENNHTSYLSIRCFSFEESLELKHLAAGEKYTFDLKVRTFFPSATMYNCSTNMGTF  197
            K + + NNHT+YLS+RCFSF    ++ HL +  +Y F ++ R  +PS+TM+NCSTNMGTF
Sbjct  31   KIIVVTNNHTNYLSVRCFSFNNEFDVVHLPSWGQYKFRVRKRYIYPSSTMFNCSTNMGTF  90

Query  196  MAFRHNYQCASKAEFNVCNWRFDDLMTYLYNPSINQWGSYEFNPNYESLSRGGVIRGYFV  17
            +A++ +Y+C SK ++  C+WRFD+  +Y + P +  W SY++ PNYESL+RGGVI+GYF 
Sbjct  91   VAYKFDYEC-SKDKYESCDWRFDEDSSYRWEPKVKSWVSYDYAPNYESLNRGGVIQGYFA  149

Query  16   N  14
            N
Sbjct  150  N  150



>gb|EYU29075.1| hypothetical protein MIMGU_mgv1a015411mg [Erythranthe guttata]
 gb|EYU29076.1| hypothetical protein MIMGU_mgv1a015411mg [Erythranthe guttata]
Length=158

 Score =   140 bits (354),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 91/126 (72%), Gaps = 1/126 (1%)
 Frame = -2

Query  391  QAGTMKRVEIENNHTSYLSIRCFSFEESLELKHLAAGEKYTFDLKVRTFFPSATMYNCST  212
            Q    K + + NNHT+YLSIRCFSF+   ++ HL +  +Y F ++ R  +PS+TM+NCST
Sbjct  34   QPPPGKVIVLTNNHTNYLSIRCFSFDNEFDVTHLRSWGQYKFRVRKRVVYPSSTMFNCST  93

Query  211  NMGTFMAFRHNYQCASKAEFNVCNWRFDDLMTYLYNPSINQWGSYEFNPNYESLSRGGVI  32
            NMGTF+AF+++Y+C  K ++  C+WRFD+   Y ++P +  W S ++ PNYESL+RGGVI
Sbjct  94   NMGTFVAFKYDYECC-KDKYQTCDWRFDEDGAYRWDPKMLTWISVDYAPNYESLNRGGVI  152

Query  31   RGYFVN  14
            +GYF N
Sbjct  153  KGYFAN  158



>ref|XP_007040120.1| Uncharacterized protein TCM_016174 [Theobroma cacao]
 gb|EOY24621.1| Uncharacterized protein TCM_016174 [Theobroma cacao]
Length=185

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 54/114 (47%), Gaps = 6/114 (5%)
 Frame = -2

Query  397  KGQAGTMKRVEIENNHTSYLSIRCFSFEES---LELKHLAAGEKYTFDLKVRTFFPSATM  227
            K +   +  + I N+      +RCF ++ +   L  K L   E+  F  +     P  T 
Sbjct  29   KPEELPLHEIYITNSMPHEAPVRCFRYDLTDNYLGNKWLKPREETKFQFRYE-LLPETTY  87

Query  226  YNCSTNMGTFMAFRHNYQCASKAEFNVCNWRFDDLMTYLYNPSINQWGSYEFNP  65
            Y C+T  G+F A+R +Y CA + + N+C WR  +    LY+    +W  +++ P
Sbjct  88   Y-CTTTNGSFAAYRQSYDCA-QNKVNLCEWRVHETYAELYSLIQQRWVHFDYEP  139



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1690861144275