BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13312_g1_i1 len=909 path=[887:0-64 952:65-88 976:89-908]

Length=909
                                                                      Score     E

ref|XP_001430538.1|  hypothetical protein                               409   2e-136   Paramecium tetraurelia strain d4-2
ref|XP_001434420.1|  hypothetical protein                               403   2e-135   Paramecium tetraurelia strain d4-2
gb|AGA16550.1|  ADP/ATP carrier                                         389   4e-132   
emb|CDW72723.1|  adp atp translocase 2                                  381   1e-128   
ref|NP_001133211.1|  solute carrier family 25-2                         378   2e-127   Salmo salar
ref|XP_010765274.1|  PREDICTED: ADP/ATP translocase 2-like              377   2e-127   
ref|XP_010886863.1|  PREDICTED: ADP/ATP translocase 1                   377   2e-127   
gb|EJY72727.1|  ADP/ATP carrier                                         378   2e-127   
ref|NP_001253938.1|  ADP/ATP translocase 2                              374   5e-126   
ref|XP_004645751.1|  PREDICTED: ADP/ATP translocase 2                   373   8e-126   
ref|XP_003797041.1|  PREDICTED: ADP/ATP translocase 2                   373   1e-125   
ref|XP_010611288.1|  PREDICTED: ADP/ATP translocase 2                   373   1e-125   
ref|NP_476443.1|  ADP/ATP translocase 2                                 373   1e-125   Rattus norvegicus [brown rat]
ref|XP_009437842.1|  PREDICTED: LOW QUALITY PROTEIN: ADP/ATP tran...    372   2e-125   
ref|XP_003467674.1|  PREDICTED: ADP/ATP translocase 2                   372   2e-125   
gb|AAH68199.1|  SLC25A5 protein                                         373   3e-125   Homo sapiens [man]
ref|NP_001143.2|  ADP/ATP translocase 2                                 372   3e-125   Homo sapiens [man]
ref|XP_006082242.1|  PREDICTED: ADP/ATP translocase 2                   372   3e-125   
ref|XP_005410502.1|  PREDICTED: ADP/ATP translocase 2                   372   3e-125   
dbj|BAG37698.1|  unnamed protein product                                372   3e-125   Homo sapiens [man]
ref|XP_004076397.1|  PREDICTED: ADP/ATP translocase 3-like isoform 1    372   3e-125   
ref|XP_851701.1|  PREDICTED: ADP/ATP translocase 2 isoform 2            372   4e-125   Canis lupus familiaris [dogs]
ref|XP_005319438.1|  PREDICTED: ADP/ATP translocase 2                   372   4e-125   
ref|XP_004900207.1|  PREDICTED: ADP/ATP translocase 2                   371   5e-125   
ref|NP_001126815.1|  ADP/ATP translocase 2                              371   6e-125   Pongo abelii [orang utan]
ref|XP_004653571.1|  PREDICTED: ADP/ATP translocase 2-like              371   6e-125   
gb|AAA35579.1|  ADP/ATP carrier protein                                 371   7e-125   Homo sapiens [man]
ref|XP_006741435.1|  PREDICTED: ADP/ATP translocase 2                   371   8e-125   
ref|NP_031477.1|  ADP/ATP translocase 2                                 370   9e-125   Mus musculus [mouse]
emb|CAG00577.1|  unnamed protein product                                370   1e-124   Tetraodon nigroviridis
ref|XP_005802974.1|  PREDICTED: ADP/ATP translocase 3-like              370   1e-124   
ref|XP_002720265.1|  PREDICTED: ADP/ATP translocase 2                   370   1e-124   Oryctolagus cuniculus [domestic rabbit]
ref|XP_004407897.1|  PREDICTED: ADP/ATP translocase 3-like              370   1e-124   
ref|XP_005859507.1|  PREDICTED: LOW QUALITY PROTEIN: solute carri...    370   2e-124   
ref|XP_003446896.1|  PREDICTED: ADP/ATP translocase 2-like isofor...    370   2e-124   
ref|XP_004685798.1|  PREDICTED: ADP/ATP translocase 2                   370   2e-124   
ref|XP_010360127.1|  PREDICTED: ADP/ATP translocase 2                   370   2e-124   
ref|XP_007254456.1|  PREDICTED: ADP/ATP translocase 2                   370   2e-124   
ref|XP_007555149.1|  PREDICTED: ADP/ATP translocase 2                   370   2e-124   
ref|XP_003414833.1|  PREDICTED: ADP/ATP translocase 2                   370   2e-124   
ref|XP_004275853.1|  PREDICTED: ADP/ATP translocase 2                   370   2e-124   
ref|XP_004286319.1|  PREDICTED: ADP/ATP translocase 3                   369   2e-124   
ref|XP_004316616.1|  PREDICTED: ADP/ATP translocase 3                   369   2e-124   
ref|XP_003422834.1|  PREDICTED: ADP/ATP translocase 3                   369   3e-124   
ref|XP_006993673.1|  PREDICTED: ADP/ATP translocase 2                   369   3e-124   
ref|XP_004587695.1|  PREDICTED: ADP/ATP translocase 2                   369   3e-124   
ref|XP_008842240.1|  PREDICTED: ADP/ATP translocase 2                   369   3e-124   
ref|NP_001122204.1|  ADP/ATP translocase 3                              369   3e-124   Danio rerio [leopard danio]
ref|XP_006882302.1|  PREDICTED: ADP/ATP translocase 1                   369   3e-124   
ref|XP_005368950.1|  PREDICTED: ADP/ATP translocase 2                   369   3e-124   
ref|NP_001279642.1|  solute carrier family 25 (mitochondrial carr...    369   4e-124   
ref|XP_008425992.1|  PREDICTED: ADP/ATP translocase 3                   369   4e-124   
ref|XP_002191653.1|  PREDICTED: ADP/ATP translocase 1                   369   4e-124   Taeniopygia guttata
ref|XP_007557479.1|  PREDICTED: ADP/ATP translocase 3                   369   4e-124   
ref|XP_004867368.1|  PREDICTED: ADP/ATP translocase 3 isoform X1        369   4e-124   
ref|XP_008306464.1|  PREDICTED: ADP/ATP translocase 3-like              370   4e-124   
ref|XP_006762396.1|  PREDICTED: ADP/ATP translocase 2                   369   5e-124   
ref|XP_008331551.1|  PREDICTED: ADP/ATP translocase 2                   369   6e-124   
ref|XP_003793083.1|  PREDICTED: ADP/ATP translocase 3                   369   6e-124   
ref|XP_006042514.1|  PREDICTED: ADP/ATP translocase 3                   369   6e-124   
ref|NP_777084.1|  ADP/ATP translocase 2                                 369   7e-124   Bos taurus [bovine]
dbj|BAD93059.1|  ADP,ATP carrier protein, liver isoform T2 variant      369   7e-124   Homo sapiens [man]
ref|XP_010744444.1|  PREDICTED: ADP/ATP translocase 2                   369   7e-124   
ref|XP_005483906.1|  PREDICTED: ADP/ATP translocase 1                   368   7e-124   
ref|XP_004564045.1|  PREDICTED: ADP/ATP translocase 2-like              368   7e-124   
ref|XP_005484488.1|  PREDICTED: ADP/ATP translocase 2                   368   7e-124   
ref|XP_008071797.1|  PREDICTED: LOW QUALITY PROTEIN: ADP/ATP tran...    368   9e-124   
ref|NP_777085.1|  ADP/ATP translocase 3                                 368   9e-124   Bos taurus [bovine]
ref|XP_010966571.1|  PREDICTED: ADP/ATP translocase 3                   368   9e-124   
ref|XP_007111376.1|  PREDICTED: ADP/ATP translocase 1                   368   9e-124   
ref|NP_001627.2|  ADP/ATP translocase 3                                 368   9e-124   Homo sapiens [man]
ref|XP_007536473.1|  PREDICTED: ADP/ATP translocase 2                   368   1e-123   
ref|XP_005735495.1|  PREDICTED: ADP/ATP translocase 2-like isofor...    368   1e-123   
ref|XP_004084342.1|  PREDICTED: ADP/ATP translocase 1-like              368   1e-123   
ref|NP_001120752.1|  ADP/ATP translocase 3                              368   1e-123   Ovis aries [domestic sheep]
ref|XP_005472164.1|  PREDICTED: ADP/ATP translocase 2-like isofor...    368   1e-123   
ref|NP_001232591.1|  putative solute carrier family 25 member 5 v...    368   1e-123   
ref|XP_004442317.1|  PREDICTED: ADP/ATP translocase 2                   368   1e-123   
ref|XP_008155059.1|  PREDICTED: ADP/ATP translocase 2                   368   1e-123   
gb|ACI67091.1|  ADP/ATP translocase 2                                   368   1e-123   Salmo salar
ref|XP_005045190.1|  PREDICTED: ADP/ATP translocase 1 isoform X2        368   1e-123   
ref|XP_004867369.1|  PREDICTED: ADP/ATP translocase 3 isoform X2        368   1e-123   
ref|XP_008409810.1|  PREDICTED: ADP/ATP translocase 1                   367   2e-123   
ref|NP_775354.1|  ADP/ATP translocase 2                                 367   2e-123   Danio rerio [leopard danio]
ref|XP_008419011.1|  PREDICTED: ADP/ATP translocase 2                   370   2e-123   
ref|XP_004076398.1|  PREDICTED: ADP/ATP translocase 3-like isoform 2    367   2e-123   
ref|XP_007460553.1|  PREDICTED: ADP/ATP translocase 3                   367   2e-123   
ref|XP_005149096.1|  PREDICTED: ADP/ATP translocase 1                   367   2e-123   
ref|XP_007444665.1|  PREDICTED: ADP/ATP translocase 3-like              367   2e-123   
ref|XP_008274460.1|  PREDICTED: ADP/ATP translocase 3-like              367   2e-123   
ref|XP_004385246.1|  PREDICTED: ADP/ATP translocase 3                   367   2e-123   
ref|NP_001037840.1|  adenine nucleotide translocator s254               367   2e-123   Takifugu rubripes [tiger puffer]
ref|XP_006916188.1|  PREDICTED: ADP/ATP translocase 3                   367   3e-123   
ref|XP_008851277.1|  PREDICTED: ADP/ATP translocase 3                   367   3e-123   
ref|XP_005922278.1|  PREDICTED: ADP/ATP translocase 2-like isofor...    367   3e-123   
gb|ACO09182.1|  ADP/ATP translocase 2                                   367   3e-123   Osmerus mordax
ref|XP_006892713.1|  PREDICTED: ADP/ATP translocase 2-like              367   3e-123   
ref|XP_010774339.1|  PREDICTED: ADP/ATP translocase 1                   367   3e-123   
ref|XP_006904765.1|  PREDICTED: ADP/ATP translocase 2-like              367   4e-123   
ref|XP_004712804.1|  PREDICTED: ADP/ATP translocase 2-like              367   4e-123   
ref|XP_007227925.1|  PREDICTED: ADP/ATP translocase 2-like              367   4e-123   
dbj|BAA36506.1|  ADP/ATP translocase                                    367   4e-123   Rugosa rugosa [wrinkled frog]
ref|NP_001006443.1|  ADP/ATP translocase 1                              367   4e-123   Gallus gallus [bantam]
ref|XP_010743221.1|  PREDICTED: ADP/ATP translocase 1                   366   4e-123   
gb|ACI69327.1|  ADP/ATP translocase 2                                   366   5e-123   Salmo salar
ref|XP_005526257.1|  PREDICTED: ADP/ATP translocase 2                   366   5e-123   
ref|XP_005735496.1|  PREDICTED: ADP/ATP translocase 2-like isofor...    366   5e-123   
ref|XP_004614519.1|  PREDICTED: ADP/ATP translocase 2                   366   6e-123   
ref|XP_006872184.1|  PREDICTED: ADP/ATP translocase 2-like              366   6e-123   
ref|XP_003221677.1|  PREDICTED: ADP/ATP translocase 1                   366   7e-123   
gb|ACH71014.1|  solute carrier family 25-1                              366   7e-123   Salmo salar
ref|XP_008851805.1|  PREDICTED: ADP/ATP translocase 1                   366   7e-123   
ref|NP_001232594.1|  putative solute carrier family 25 member 6 v...    366   7e-123   
ref|XP_008285023.1|  PREDICTED: ADP/ATP translocase 1                   366   8e-123   
ref|XP_007517722.1|  PREDICTED: ADP/ATP translocase 1                   365   8e-123   
ref|XP_004379870.1|  PREDICTED: ADP/ATP translocase 2                   365   8e-123   
ref|XP_010903992.1|  PREDICTED: ADP/ATP translocase 3                   365   9e-123   
ref|XP_005151465.1|  PREDICTED: ADP/ATP translocase 3                   365   9e-123   
dbj|BAA36508.1|  ADP/ATP translocase                                    365   1e-122   Rugosa rugosa [wrinkled frog]
ref|NP_989562.2|  ADP/ATP translocase 3                                 365   1e-122   Gallus gallus [bantam]
ref|NP_988913.1|  adenine nucleotide translocase                        365   1e-122   Xenopus tropicalis [western clawed frog]
ref|XP_004073178.1|  PREDICTED: ADP/ATP translocase 2-like              365   1e-122   
ref|XP_006003932.1|  PREDICTED: ADP/ATP translocase 2                   365   1e-122   
ref|NP_001037838.1|  adenine nucleotide translocator s6                 365   1e-122   Takifugu rubripes [tiger puffer]
ref|XP_010567246.1|  PREDICTED: ADP/ATP translocase 2                   365   1e-122   
gb|EFX66452.1|  hypothetical protein DAPPUDRAFT_302682                  365   1e-122   
ref|XP_005329274.1|  PREDICTED: ADP/ATP translocase 1                   365   1e-122   
gb|AAH14775.1|  Solute carrier family 25 (mitochondrial carrier; ...    365   1e-122   Homo sapiens [man]
ref|XP_006735085.1|  PREDICTED: ADP/ATP translocase 1                   365   1e-122   
dbj|BAA36507.1|  ADP/ATP translocase                                    365   1e-122   Rugosa rugosa [wrinkled frog]
ref|XP_004579066.1|  PREDICTED: ADP/ATP translocase 1                   365   1e-122   
ref|XP_010568310.1|  PREDICTED: ADP/ATP translocase 1                   365   1e-122   
ref|XP_008302071.1|  PREDICTED: ADP/ATP translocase 2                   365   1e-122   
ref|XP_004412790.1|  PREDICTED: ADP/ATP translocase 1                   365   2e-122   
dbj|BAC75536.1|  ADP/ATP translocase                                    365   2e-122   Rugosa rugosa [wrinkled frog]
ref|XP_006277426.1|  PREDICTED: ADP/ATP translocase 2                   365   2e-122   
ref|XP_004281779.1|  PREDICTED: ADP/ATP translocase 1                   364   2e-122   
ref|XP_007946558.1|  PREDICTED: ADP/ATP translocase 1                   364   2e-122   
ref|XP_004610414.1|  PREDICTED: ADP/ATP translocase 1                   364   2e-122   
ref|XP_007423762.1|  PREDICTED: ADP/ATP translocase 1                   364   2e-122   
gb|ACN11489.1|  ADP/ATP translocase 2                                   365   3e-122   Salmo salar
ref|XP_007951536.1|  PREDICTED: ADP/ATP translocase 2                   364   3e-122   
ref|XP_006916442.1|  PREDICTED: ADP/ATP translocase 1                   364   3e-122   
ref|XP_005362637.1|  PREDICTED: ADP/ATP translocase 1                   364   3e-122   
ref|XP_007177934.1|  PREDICTED: ADP/ATP translocase 1                   364   3e-122   
ref|XP_010744890.1|  PREDICTED: ADP/ATP translocase 3                   364   3e-122   
ref|XP_005282046.1|  PREDICTED: ADP/ATP translocase 1                   364   3e-122   
dbj|BAC75538.1|  ADP/ATP translocase                                    363   4e-122   Rugosa rugosa [wrinkled frog]
ref|XP_008306472.1|  PREDICTED: ADP/ATP translocase 2-like              363   4e-122   
gb|AAH60533.1|  Solute carrier family 25 (mitochondrial carrier; ...    364   4e-122   Rattus norvegicus [brown rat]
ref|XP_005066726.1|  PREDICTED: ADP/ATP translocase 1                   364   4e-122   
ref|XP_006876315.1|  PREDICTED: ADP/ATP translocase 3                   363   5e-122   
emb|CAG11525.1|  unnamed protein product                                363   5e-122   Tetraodon nigroviridis
ref|XP_007891022.1|  PREDICTED: ADP/ATP translocase 1                   363   5e-122   
gb|ADI58835.1|  adenine nucleotide translocator                         363   5e-122   
dbj|BAC75537.1|  ADP/ATP translocase                                    363   6e-122   Rugosa rugosa [wrinkled frog]
ref|XP_004853070.1|  PREDICTED: ADP/ATP translocase 1 isoform X2        363   6e-122   
ref|XP_003218854.1|  PREDICTED: ADP/ATP translocase 3                   363   6e-122   
ref|XP_008167258.1|  PREDICTED: ADP/ATP translocase 2                   363   7e-122   
ref|NP_001290700.1|  ADP/ATP translocase 2                              363   7e-122   
ref|NP_001076155.1|  ADP/ATP translocase 1                              363   7e-122   Oryctolagus cuniculus [domestic rabbit]
ref|XP_003792827.1|  PREDICTED: ADP/ATP translocase 1                   363   7e-122   
ref|XP_008315106.1|  PREDICTED: ADP/ATP translocase 1                   363   7e-122   
ref|XP_004666437.1|  PREDICTED: ADP/ATP translocase 1                   363   7e-122   
ref|XP_004457853.1|  PREDICTED: ADP/ATP translocase 1                   363   8e-122   
ref|NP_001279863.1|  solute carrier family 25 (mitochondrial carr...    363   8e-122   
gb|ACN10312.1|  ADP/ATP translocase 2                                   363   8e-122   Salmo salar
ref|XP_006128548.1|  PREDICTED: ADP/ATP translocase 1                   363   9e-122   
gb|EFB30227.1|  hypothetical protein PANDA_001915                       362   9e-122   Ailuropoda melanoleuca
ref|XP_003445278.1|  PREDICTED: ADP/ATP translocase 2-like              363   1e-121   
ref|XP_001363393.1|  PREDICTED: ADP/ATP translocase 1                   363   1e-121   Monodelphis domestica
ref|XP_007068661.1|  PREDICTED: ADP/ATP translocase 1                   363   1e-121   
ref|XP_004853069.1|  PREDICTED: ADP/ATP translocase 1 isoform X1        363   1e-121   
ref|NP_999867.1|  ADP/ATP translocase 1                                 363   1e-121   Danio rerio [leopard danio]
ref|XP_001362296.1|  PREDICTED: ADP/ATP translocase 3                   363   1e-121   Monodelphis domestica
dbj|BAC15533.1|  ATP/ADP antiporter                                     363   1e-121   Gallus gallus [bantam]
ref|XP_005807195.1|  PREDICTED: ADP/ATP translocase 1-like              363   1e-121   
ref|XP_008324945.1|  PREDICTED: ADP/ATP translocase 3                   362   1e-121   
ref|XP_003773072.1|  PREDICTED: ADP/ATP translocase 1                   362   1e-121   
ref|NP_445967.1|  ADP/ATP translocase 1                                 362   1e-121   Rattus norvegicus [brown rat]
ref|XP_010784438.1|  PREDICTED: ADP/ATP translocase 3                   362   1e-121   
dbj|BAC37117.1|  unnamed protein product                                362   1e-121   Mus musculus [mouse]
gb|ACO10137.1|  ADP/ATP translocase 2                                   362   1e-121   Osmerus mordax
ref|XP_008122452.1|  PREDICTED: LOW QUALITY PROTEIN: ADP/ATP tran...    362   2e-121   
ref|XP_007551819.1|  PREDICTED: ADP/ATP translocase 1                   362   2e-121   
ref|XP_010618050.1|  PREDICTED: ADP/ATP translocase 1                   362   2e-121   
ref|XP_006269122.1|  PREDICTED: ADP/ATP translocase 3                   362   2e-121   
ref|NP_031476.3|  ADP/ATP translocase 1                                 362   2e-121   Mus musculus [mouse]
gb|ERE86733.1|  ADP/ATP translocase 1-like protein                      362   2e-121   
ref|XP_006970947.1|  PREDICTED: ADP/ATP translocase 1                   362   2e-121   
ref|NP_001188059.1|  ADP/ATP translocase 2                              362   2e-121   
ref|XP_005997261.1|  PREDICTED: ADP/ATP translocase 2-like isofor...    362   2e-121   
ref|NP_999583.1|  ADP/ATP translocase 3                                 362   2e-121   Sus scrofa [pigs]
ref|XP_005997260.1|  PREDICTED: ADP/ATP translocase 2-like isofor...    362   3e-121   
sp|Q000K2.1|ADT2_TACAC  RecName: Full=ADP/ATP translocase 2; AltN...    362   3e-121   Tachyglossus aculeatus aculeatus
ref|XP_005283319.1|  PREDICTED: ADP/ATP translocase 3                   363   3e-121   
ref|XP_006092739.1|  PREDICTED: ADP/ATP translocase 1                   361   4e-121   
ref|XP_003469241.1|  PREDICTED: ADP/ATP translocase 1                   361   4e-121   
ref|XP_006834499.1|  PREDICTED: ADP/ATP translocase 1                   361   4e-121   
ref|NP_001037839.1|  adenine nucleotide translocator s598               361   5e-121   Takifugu rubripes [tiger puffer]
ref|XP_005723073.1|  PREDICTED: ADP/ATP translocase 2-like              361   5e-121   
gb|ETE68996.1|  ADP/ATP translocase 1                                   361   5e-121   
ref|XP_005913329.1|  PREDICTED: ADP/ATP translocase 3-like              361   5e-121   
ref|XP_008515509.1|  PREDICTED: ADP/ATP translocase 1                   361   5e-121   
ref|XP_005373536.1|  PREDICTED: ADP/ATP translocase 1                   361   5e-121   
gb|ACI66474.1|  ADP/ATP translocase 2                                   361   6e-121   Salmo salar
ref|XP_006011187.1|  PREDICTED: ADP/ATP translocase 1                   361   7e-121   
ref|NP_001080495.1|  adenine nucleotide translocator 2                  361   7e-121   Xenopus laevis [clawed frog]
gb|AAC52837.1|  adenine nucleotide translocase-1                        360   8e-121   Mus musculus [mouse]
ref|XP_003133393.1|  PREDICTED: ADP/ATP translocase 1 isoform 2         360   8e-121   
ref|XP_008584863.1|  PREDICTED: ADP/ATP translocase 1                   360   9e-121   
ref|NP_777083.1|  ADP/ATP translocase 1                                 360   1e-120   Bos taurus [bovine]
ref|XP_002914076.1|  PREDICTED: ADP/ATP translocase 1-like              362   1e-120   
ref|XP_006902474.1|  PREDICTED: ADP/ATP translocase 3                   360   1e-120   
pdb|1OKC|A  Chain A, Structure Of Mitochondrial Adp/atp Carrier I...    360   1e-120   
ref|NP_001085135.1|  solute carrier family 25 (mitochondrial carr...    360   1e-120   Xenopus laevis [clawed frog]
ref|XP_007957079.1|  PREDICTED: ADP/ATP translocase 3                   360   1e-120   
ref|XP_004639840.1|  PREDICTED: ADP/ATP translocase 1                   360   2e-120   
ref|XP_004428798.1|  PREDICTED: ADP/ATP translocase 1                   360   2e-120   
ref|XP_005972655.1|  PREDICTED: ADP/ATP translocase 1                   360   2e-120   
ref|XP_006276114.1|  PREDICTED: ADP/ATP translocase 1                   359   2e-120   
ref|XP_003452294.1|  PREDICTED: ADP/ATP translocase 1-like              359   2e-120   
ref|XP_006638960.1|  PREDICTED: ADP/ATP translocase 1-like              359   3e-120   
ref|NP_001153963.1|  adenine nucleotide translocator 2                  359   3e-120   Oncorhynchus mykiss
ref|XP_004940900.1|  PREDICTED: LOW QUALITY PROTEIN: ADP/ATP tran...    363   3e-120   
dbj|BAF84591.1|  unnamed protein product                                358   5e-120   Homo sapiens [man]
ref|XP_010951596.1|  PREDICTED: ADP/ATP translocase 1                   358   5e-120   
ref|NP_001142.2|  ADP/ATP translocase 1                                 358   5e-120   Homo sapiens [man]
ref|XP_004549538.1|  PREDICTED: ADP/ATP translocase 1-like              358   6e-120   
ref|XP_003055578.1|  mitochondrial carrier family                       360   7e-120   
ref|XP_006787200.1|  PREDICTED: ADP/ATP translocase 1-like              358   9e-120   
ref|XP_004093347.1|  PREDICTED: LOW QUALITY PROTEIN: ADP/ATP tran...    358   9e-120   
ref|XP_006834479.1|  PREDICTED: ADP/ATP translocase 2-like              358   1e-119   
ref|XP_005883911.1|  PREDICTED: ADP/ATP translocase 1 isoform X2        358   1e-119   
gb|AAI02995.2|  Solute carrier family 25 (mitochondrial carrier; ...    358   1e-119   Bos taurus [bovine]
ref|XP_004382819.1|  PREDICTED: ADP/ATP translocase 1                   357   1e-119   
gb|ADO32616.1|  adenine nucleotide translocator                         357   1e-119   
ref|XP_006028566.1|  PREDICTED: ADP/ATP translocase 2                   358   2e-119   
ref|XP_010868847.1|  PREDICTED: ADP/ATP translocase 3-like              357   2e-119   
ref|XP_006198043.1|  PREDICTED: ADP/ATP translocase 1                   357   2e-119   
ref|XP_006630034.1|  PREDICTED: ADP/ATP translocase 1-like              357   3e-119   
ref|XP_005883910.1|  PREDICTED: ADP/ATP translocase 1 isoform X1        356   4e-119   
emb|CAZ44323.1|  ADP/ATP translocase                                    356   4e-119   Haemonchus contortus [red stomach worm]
ref|NP_988909.1|  adenine nucleotide translocator 1                     356   4e-119   Xenopus tropicalis [western clawed frog]
ref|XP_003942672.1|  PREDICTED: ADP/ATP translocase 3                   356   4e-119   
ref|XP_007232858.1|  PREDICTED: ADP/ATP translocase 1                   355   7e-119   
ref|XP_004636294.1|  PREDICTED: ADP/ATP translocase 2-like              355   8e-119   
ref|XP_006219940.1|  PREDICTED: ADP,ATP carrier protein 1-like          355   8e-119   
ref|NP_001120750.1|  ADP/ATP translocase 1                              355   1e-118   Ovis aries [domestic sheep]
emb|CDJ80343.1|  Mitochondrial substrate solute carrier domain co...    355   1e-118   
gb|EYB89899.1|  hypothetical protein Y032_0226g2768                     355   1e-118   
gb|AAM97612.1|AF480922_1  ADP/ATP carrier                               355   1e-118   Nyctotherus ovalis
ref|XP_004458715.1|  PREDICTED: ADP/ATP translocase 2-like              355   1e-118   
gb|ELK09012.1|  ADP/ATP translocase 3                                   355   2e-118   
ref|XP_002503554.1|  mitochondrial carrier family                       355   2e-118   Micromonas commoda
gb|KIH67077.1|  ADP/ATP translocase 1                                   354   3e-118   
gb|EYB89900.1|  hypothetical protein Y032_0226g2768                     355   3e-118   
gb|ABM55522.1|  putative ADP/ATP translocase                            353   5e-118   Maconellicoccus hirsutus [pink hibiscus mealybug]
gb|AAQ17207.1|  ADP/ATP translocase                                     353   6e-118   Branchiostoma belcheri tsingtauense
ref|XP_002432332.1|  ADP,ATP carrier protein, putative                  353   8e-118   Pediculus humanus corporis [human body lice]
emb|CCI39877.1|  unnamed protein product                                353   9e-118   
gb|KDO25985.1|  hypothetical protein SPRG_08638                         353   1e-117   
ref|XP_008608886.1|  solute carrier family 25 (mitochondrial aden...    353   1e-117   
ref|XP_003109138.1|  hypothetical protein CRE_08158                     353   1e-117   
gb|AAM97611.1|AF480921_1  ADP/ATP carrier                               353   1e-117   Nyctotherus ovalis
ref|XP_006633075.1|  PREDICTED: solute carrier family 25 member 4...    364   1e-117   
gb|AAM97610.1|AF480920_1  ADP/ATP carrier                               352   1e-117   Nyctotherus ovalis
emb|CCI39878.1|  unnamed protein product                                353   2e-117   
ref|XP_005877839.1|  PREDICTED: ADP/ATP translocase 4                   357   2e-117   
ref|XP_005386805.1|  PREDICTED: ADP/ATP translocase 4                   353   2e-117   
ref|XP_001491279.2|  PREDICTED: LOW QUALITY PROTEIN: ADP/ATP tran...    352   2e-117   Equus caballus [domestic horse]
ref|XP_006263489.1|  PREDICTED: ADP/ATP translocase 4                   352   2e-117   
sp|P31692.1|ADT_PARKE  RecName: Full=ADP,ATP carrier protein; Alt...    353   2e-117   Parachlorella kessleri
gb|AEK78307.1|  adenine nucleotide translocase 2                        352   2e-117   
emb|CEF99364.1|  Adenine nucleotide translocator 1                      353   3e-117   
ref|XP_001649911.1|  adp,atp carrier protein                            352   3e-117   Aedes aegypti
ref|XP_005991360.1|  PREDICTED: ADP/ATP translocase 4                   352   3e-117   
ref|XP_004345739.1|  mitochondrial substrate carrier family prote...    352   3e-117   
gb|EGT54454.1|  hypothetical protein CAEBREN_10566                      352   3e-117   
emb|CCA19183.1|  ADP/ATP translocase putative                           352   3e-117   
ref|XP_009538820.1|  hypothetical protein PHYSODRAFT_289206             352   4e-117   
gb|ETN86377.1|  ADP/ATP translocase 1                                   351   4e-117   
gb|EGT47968.1|  hypothetical protein CAEBREN_21779                      352   4e-117   
gb|AAM97609.1|AF480919_1  ADP/ATP carrier                               352   4e-117   
ref|XP_002639182.1|  C. briggsae CBR-TAG-316 protein                    352   4e-117   
ref|XP_004545948.1|  PREDICTED: ADP/ATP translocase 2-like              360   6e-117   
ref|XP_004828690.1|  adenine nucleotide translocase, putative           351   6e-117   
ref|XP_007059219.1|  PREDICTED: ADP/ATP translocase 4                   351   6e-117   
ref|XP_003129255.3|  PREDICTED: ADP/ATP translocase 4                   352   7e-117   
gb|ABV25602.1|  putative mitochondrial ADP/ATP translocase              352   7e-117   
ref|XP_007997947.1|  PREDICTED: ADP/ATP translocase 4                   351   7e-117   
emb|CAM90524.1|  ADP/ATP translocator                                   350   8e-117   
ref|XP_001863205.1|  conserved hypothetical protein                     350   8e-117   
gb|EGT45796.1|  hypothetical protein CAEBREN_25116                      350   8e-117   
gb|AAA61223.1|  ADP/ADT translocator protein                            350   9e-117   
ref|XP_007641219.1|  PREDICTED: LOW QUALITY PROTEIN: ADP/ATP tran...    350   9e-117   
ref|NP_112581.1|  ADP/ATP translocase 4                                 351   9e-117   
ref|XP_004040422.1|  PREDICTED: ADP/ATP translocase 4                   351   1e-116   
ref|XP_002642805.1|  C. briggsae CBR-TAG-61 protein                     350   1e-116   
gb|AEE62118.1|  unknown                                                 350   1e-116   
ref|XP_010373344.1|  PREDICTED: ADP/ATP translocase 4                   351   1e-116   
ref|XP_517556.3|  PREDICTED: ADP/ATP translocase 1                      353   1e-116   
ref|NP_001181229.1|  ADP/ATP translocase 4                              350   1e-116   
ref|NP_501727.1|  Protein ANT-1.3                                       350   1e-116   
ref|XP_001363920.1|  PREDICTED: ADP/ATP translocase 4                   350   1e-116   
ref|XP_006987518.1|  PREDICTED: ADP/ATP translocase 4                   350   1e-116   
ref|XP_004466302.1|  PREDICTED: ADP/ATP translocase 4                   350   1e-116   
ref|NP_001233314.1|  ADP/ATP translocase 4                              350   2e-116   
ref|XP_006917821.1|  PREDICTED: ADP/ATP translocase 4                   350   2e-116   
ref|XP_003748187.1|  PREDICTED: ADP,ATP carrier protein 1-like          349   2e-116   
ref|XP_004747994.1|  PREDICTED: ADP/ATP translocase 4                   350   2e-116   
ref|XP_003927767.1|  PREDICTED: ADP/ATP translocase 4                   350   3e-116   
ref|XP_006887637.1|  PREDICTED: LOW QUALITY PROTEIN: ADP/ATP tran...    350   3e-116   
ref|XP_004876430.1|  PREDICTED: ADP/ATP translocase 4                   350   3e-116   
ref|XP_006153203.1|  PREDICTED: ADP/ATP translocase 4                   350   3e-116   
ref|NP_501440.1|  Protein ANT-1.4                                       349   3e-116   
ref|XP_002745417.1|  PREDICTED: ADP/ATP translocase 4                   349   3e-116   
ref|XP_006765205.1|  PREDICTED: ADP/ATP translocase 2-like              348   4e-116   
emb|CEF68345.1|  ADP/ATP translocase 4                                  348   5e-116   
gb|EPZ33262.1|  ADP/ATP translocase 2                                   349   5e-116   
gb|AAY66852.1|  ADP/ATP translocase                                     348   5e-116   
ref|XP_003094643.1|  CRE-TAG-61 protein                                 348   5e-116   
ref|XP_001900041.1|  ADP/ATP translocase                                348   5e-116   
ref|XP_006212283.1|  PREDICTED: ADP/ATP translocase 4                   349   6e-116   
ref|XP_002905571.1|  ADP/ATP translocase, putative                      348   7e-116   
emb|CAR63554.1|  putative cathepsin B-like cysteine protease 1          348   8e-116   
ref|NP_001022799.1|  Protein ANT-1.1, isoform a                         348   8e-116   
ref|XP_005282829.1|  PREDICTED: ADP/ATP translocase 4                   348   9e-116   
ref|XP_003477175.1|  PREDICTED: ADP/ATP translocase 4                   348   9e-116   
ref|XP_005335564.1|  PREDICTED: ADP/ATP translocase 4                   348   1e-115   
ref|XP_006762941.1|  PREDICTED: ADP/ATP translocase 4                   353   1e-115   
sp|Q27238.2|ADT1_ANOGA  RecName: Full=ADP,ATP carrier protein 1; ...    348   1e-115   
ref|XP_002922236.1|  PREDICTED: ADP/ATP translocase 4-like              348   1e-115   
tpg|DAA34568.1|  TPA: ADP/ATP translocase                               347   1e-115   
gb|EFB27960.1|  hypothetical protein PANDA_011197                       348   1e-115   
ref|XP_006082032.1|  PREDICTED: ADP/ATP translocase 4                   355   1e-115   
ref|XP_010350029.1|  PREDICTED: LOW QUALITY PROTEIN: ADP/ATP tran...    348   1e-115   
ref|XP_006015693.1|  PREDICTED: ADP/ATP translocase 4                   348   1e-115   
ref|XP_308964.2|  AGAP006782-PA                                         347   1e-115   
ref|XP_006131864.1|  PREDICTED: ADP/ATP translocase 4                   348   2e-115   
ref|XP_008895218.1|  ADP/ATP translocase 1                              347   2e-115   
emb|CAM90525.1|  ADP/ATP translocator                                   347   2e-115   
ref|XP_009690159.1|  putative ADP/ATP transporter                       347   2e-115   
ref|XP_004001144.1|  PREDICTED: ADP/ATP translocase 4                   348   2e-115   
ref|XP_005069743.1|  PREDICTED: ADP/ATP translocase 4                   348   2e-115   
gb|KDD73840.1|  hypothetical protein H632_c1793p0                       350   2e-115   
gb|AAL02100.1|AF401758_1  ADP-ATP translocator                          347   2e-115   
ref|XP_005343984.1|  PREDICTED: ADP/ATP translocase 4                   348   2e-115   
gb|KHN77672.1|  ADP,ATP carrier protein                                 347   2e-115   
ref|XP_007952023.1|  PREDICTED: ADP/ATP translocase 4                   347   2e-115   
ref|XP_002717308.1|  PREDICTED: ADP/ATP translocase 4                   347   3e-115   
ref|XP_764710.1|  adenine nucleotide translocase                        346   3e-115   
ref|XP_004393664.1|  PREDICTED: ADP/ATP translocase 4                   347   4e-115   
emb|CEF68281.1|  ADP/ATP translocase 4                                  346   4e-115   
ref|XP_006178675.1|  PREDICTED: ADP/ATP translocase 4                   347   4e-115   
ref|NP_848473.2|  ADP/ATP translocase 4                                 347   4e-115   
ref|XP_968561.1|  PREDICTED: ADP,ATP carrier protein                    346   5e-115   
gb|ABV60316.1|  putative ADP/ATP translocase                            346   5e-115   
gb|EFO26117.2|  ADP/ATP translocase                                     347   5e-115   
ref|XP_006067361.1|  PREDICTED: ADP/ATP translocase 4                   347   5e-115   
ref|NP_001039965.1|  ADP/ATP translocase 4                              347   6e-115   
ref|XP_010588841.1|  PREDICTED: LOW QUALITY PROTEIN: ADP/ATP tran...    347   6e-115   
ref|XP_006876160.1|  PREDICTED: ADP/ATP translocase 4                   346   7e-115   
ref|XP_003795579.1|  PREDICTED: ADP/ATP translocase 4                   346   7e-115   
ref|XP_001612130.1|  adenine nucleotide translocase                     345   7e-115   
gb|ABU68467.1|  adenine nucleotide translocase                          345   7e-115   
ref|XP_004017311.1|  PREDICTED: ADP/ATP translocase 4                   346   8e-115   
ref|XP_005904876.1|  PREDICTED: ADP/ATP translocase 4                   346   8e-115   
ref|XP_008579833.1|  PREDICTED: ADP/ATP translocase 4                   346   8e-115   
ref|NP_001083023.1|  uncharacterized protein LOC100038774               345   9e-115   
tpg|DAA20854.1|  TPA: ADP/ATP translocase 4                             346   9e-115   
gb|AIC38345.1|  ADP/ATP translocase 4                                   346   9e-115   
emb|CAP24569.2|  Protein CBR-TAG-316                                    346   1e-114   
ref|XP_008419012.1|  PREDICTED: ADP/ATP translocase 2                   345   1e-114   
ref|XP_004389337.1|  PREDICTED: ADP/ATP translocase 4                   346   1e-114   
ref|XP_005691327.1|  PREDICTED: ADP/ATP translocase 4                   346   1e-114   
ref|XP_007908874.1|  PREDICTED: ADP/ATP translocase 4                   345   1e-114   
ref|XP_004426673.1|  PREDICTED: ADP/ATP translocase 4                   345   1e-114   
ref|XP_002422901.1|  ADP,ATP carrier protein, putative                  345   1e-114   
ref|XP_001502898.1|  PREDICTED: ADP/ATP translocase 4                   345   1e-114   
ref|XP_005985458.1|  PREDICTED: ADP/ATP translocase 4                   345   2e-114   
ref|XP_008141618.1|  PREDICTED: ADP/ATP translocase 4                   345   2e-114   
ref|XP_952570.1|  ADP/ATP transporter, putatve                          345   2e-114   
gb|AAH50810.1|  Solute carrier family 25 (mitochondrial carrier; ...    345   2e-114   
gb|AEZ68611.1|  adenine nucleotide translocase                          345   2e-114   
gb|KFB51590.1|  hypothetical protein ZHAS_00019661                      344   3e-114   
ref|NP_727448.1|  stress-sensitive B, isoform C                         344   3e-114   
ref|XP_001069558.2|  PREDICTED: ADP/ATP translocase 4 isoform X2        345   3e-114   
gb|KHJ89864.1|  ADP/ATP translocase 1                                   344   3e-114   
ref|XP_540952.3|  PREDICTED: ADP/ATP translocase 4                      345   3e-114   
ref|XP_002600712.1|  hypothetical protein BRAFLDRAFT_114756             343   4e-114   
ref|XP_010617154.1|  PREDICTED: ADP/ATP translocase 4                   344   4e-114   
ref|XP_004657151.1|  PREDICTED: ADP/ATP translocase 4                   344   4e-114   
ref|XP_007113562.1|  PREDICTED: ADP/ATP translocase 4                   344   5e-114   
ref|XP_002591981.1|  hypothetical protein BRAFLDRAFT_280633             343   5e-114   
ref|NP_511109.1|  stress-sensitive B, isoform A                         343   5e-114   
ref|XP_003702410.1|  PREDICTED: ADP,ATP carrier protein 2-like          343   5e-114   
gb|ABN04118.1|  ATP/ADP translocase                                     343   5e-114   
gb|AAB04104.1|  ADP/ATP carrier protein                                 343   6e-114   
ref|XP_003504902.1|  PREDICTED: ADP/ATP translocase 4                   343   8e-114   
ref|XP_004711916.1|  PREDICTED: ADP/ATP translocase 4                   343   8e-114   
ref|XP_006944019.1|  PREDICTED: ADP/ATP translocase 2                   343   9e-114   
ref|XP_008821908.1|  PREDICTED: ADP/ATP translocase 4                   343   9e-114   
gb|ABI34072.1|  ATP/ADP translocase                                     343   1e-113   
gb|KFM72665.1|  ADP/ATP translocase 1                                   342   1e-113   
ref|XP_006107541.1|  PREDICTED: ADP/ATP translocase 2-like              342   1e-113   
gb|AAM97613.1|AF480923_1  ADP/ATP carrier                               342   1e-113   
ref|XP_001895160.1|  ADP,ATP carrier protein, heart/skeletal musc...    343   1e-113   
gb|ERG78914.1|  carrier protein 1                                       342   1e-113   
ref|XP_001354870.1|  sesB                                               342   1e-113   
gb|ENN73401.1|  hypothetical protein YQE_09963                          343   1e-113   
gb|EJW87204.1|  mitochondrial adenine nucleotide translocase 1.3        343   1e-113   
ref|XP_002411592.1|  ADP/ATP translocase, putative                      342   1e-113   
ref|XP_001977206.1|  GG18900                                            342   2e-113   
ref|XP_002739982.1|  PREDICTED: ADP,ATP carrier protein-like            342   2e-113   
ref|XP_006618690.1|  PREDICTED: ADP,ATP carrier protein 2-like          342   2e-113   
gb|AFK93891.1|  adenine nucleotide translocase                          342   2e-113   
ref|NP_001010975.1|  ADP/ATP translocase                                342   3e-113   
ref|XP_002057927.1|  GJ15782                                            341   3e-113   
ref|XP_003692955.1|  PREDICTED: ADP,ATP carrier protein-like            341   3e-113   
ref|XP_002011564.1|  GI11098                                            341   4e-113   
gb|ETN60885.1|  adp,atp carrier protein                                 343   4e-113   
ref|XP_004710169.1|  PREDICTED: ADP/ATP translocase 2                   340   5e-113   
ref|XP_973257.1|  PREDICTED: ADP,ATP carrier protein 1                  341   5e-113   
ref|XP_007523232.1|  PREDICTED: ADP/ATP translocase 4                   342   5e-113   
gb|ERG84220.1|  carrier protein 1                                       342   5e-113   
gb|KFM79062.1|  ADP,ATP carrier protein                                 341   5e-113   
ref|XP_005181459.1|  PREDICTED: ADP,ATP carrier protein-like isof...    341   5e-113   
gb|ABV25599.1|  putative mitochondrial ADP/ATP translocase              341   6e-113   
ref|XP_005829781.1|  hypothetical protein GUITHDRAFT_73589              340   7e-113   
ref|XP_001420132.1|  MC family transporter: ADP/ATP                     340   7e-113   
ref|XP_005651635.1|  ADP,ATP carrier protein                            341   7e-113   
ref|XP_002139857.1|  carrier protein                                    341   8e-113   
gb|ABD98753.1|  putative ADP/ATP translocase                            340   8e-113   
ref|XP_009832051.1|  ADP/ATP translocase 1                              341   8e-113   
gb|ACN94645.1|  GA14229                                                 340   8e-113   
ref|XP_003137956.1|  ADP/ATP translocase                                341   9e-113   
gb|EWM25443.1|  adp atp                                                 342   9e-113   
ref|XP_010304174.1|  PREDICTED: ADP/ATP translocase 4                   340   9e-113   
ref|XP_005828292.1|  hypothetical protein GUITHDRAFT_96015              340   1e-112   
gb|KDR12333.1|  ADP,ATP carrier protein                                 340   1e-112   
gb|KFO12529.1|  ADP/ATP translocase 4                                   339   1e-112   
ref|NP_001155502.1|  adenine nucleotide translocator-like               340   1e-112   
gb|ABR27934.1|  truncated mitochondrial ADP/ATP translocase             340   1e-112   
ref|XP_004319917.1|  PREDICTED: ADP/ATP translocase 4                   340   1e-112   
gb|AET74069.1|  adenine nucleotide translocase                          340   1e-112   
emb|CEF64642.1|  ADP/ATP translocase 4                                  340   1e-112   
ref|XP_003142821.1|  ADP/ATP carrier protein                            340   2e-112   
ref|XP_005846192.1|  ATP/ADP translocator                               341   2e-112   
dbj|BAM17721.1|  stress-sensitive B                                     339   2e-112   
ref|XP_003753614.1|  PREDICTED: ADP/ATP translocase 4 isoform X1        340   2e-112   
ref|XP_008195942.1|  PREDICTED: ADP,ATP carrier protein 1-like          339   2e-112   
ref|XP_004265166.1|  PREDICTED: ADP/ATP translocase 4                   339   4e-112   
ref|XP_532844.2|  PREDICTED: ADP/ATP translocase 1                      338   4e-112   
ref|XP_002067253.1|  GK16281                                            338   4e-112   
ref|NP_001165432.1|  ADP/ATP translocase 3-like                         338   6e-112   
gb|AAF32322.1|AF218587_1  ADP/ATP translocase                           338   7e-112   
ref|XP_004535229.1|  PREDICTED: ADP,ATP carrier protein-like isof...    338   7e-112   
gb|ADE27970.1|  ADP/ATP translocase                                     338   8e-112   
ref|XP_003487769.1|  PREDICTED: ADP,ATP carrier protein 2-like          338   9e-112   
ref|XP_003098374.1|  CRE-TAG-194 protein                                337   1e-111   
dbj|BAA11765.1|  ADT/ATP translocase                                    337   1e-111   
ref|XP_011059688.1|  PREDICTED: ADP,ATP carrier protein 2               337   1e-111   
gb|ETE69090.1|  ADP/ATP translocase 4                                   337   2e-111   
gb|ETN68284.1|  ADP/ATP translocase 1                                   337   2e-111   
ref|XP_001991370.1|  GH12090                                            337   2e-111   
ref|XP_003396620.1|  PREDICTED: ADP,ATP carrier protein 2-like          337   2e-111   
gb|EFN73281.1|  ADP,ATP carrier protein 2                               336   3e-111   
ref|XP_006774978.1|  PREDICTED: ADP/ATP translocase 3-like              336   3e-111   
gb|ENN77548.1|  hypothetical protein YQE_05844                          336   3e-111   
ref|XP_008556189.1|  PREDICTED: ADP,ATP carrier protein 2               336   4e-111   
gb|ABD64222.1|  adenine nucleotide translocator                         336   4e-111   
gb|ABS57449.1|  ADP/ATP tranlocase                                      336   5e-111   
ref|XP_001963485.1|  GF20265                                            335   5e-111   
gb|EZA48443.1|  ADP,ATP carrier protein                                 335   5e-111   
ref|XP_005862981.1|  PREDICTED: ADP/ATP translocase 3-like              335   8e-111   
gb|EPQ05679.1|  ADP/ATP translocase 3                                   335   8e-111   
emb|CDR93903.1|  adenine nucleotide translocase, putative               335   1e-110   
ref|XP_002122572.1|  PREDICTED: ADP/ATP translocase 3-like              335   1e-110   
gb|AHC54390.1|  adenine nucleotide translocase 2                        335   1e-110   
emb|CDJ86379.1|  Mitochondrial substrate solute carrier domain co...    335   1e-110   
gb|ADV40146.1|  ADP/ATP translocase                                     334   2e-110   
ref|XP_002773704.1|  ADP/ATP carrier, putative                          335   2e-110   
ref|XP_007510088.1|  ADP/ATP translocase                                337   2e-110   
ref|XP_003221810.1|  PREDICTED: ADP/ATP translocase 4                   335   2e-110   
ref|XP_002431847.1|  ADP,ATP carrier protein, putative                  334   3e-110   
gb|EDL16266.1|  mCG21672                                                333   3e-110   
ref|XP_007172442.1|  PREDICTED: ADP/ATP translocase 4                   334   3e-110   
ref|XP_006085483.1|  PREDICTED: ADP/ATP translocase 3-like              333   3e-110   
ref|XP_005651634.1|  ADP,ATP carrier protein                            335   4e-110   
ref|XP_007446314.1|  PREDICTED: ADP/ATP translocase 4                   334   4e-110   
ref|XP_001977207.1|  GG18901                                            333   4e-110   
emb|CCF72974.1|  unnamed protein product                                333   4e-110   
ref|XP_002041900.1|  GM11287                                            333   4e-110   
ref|NP_001037072.1|  ADP/ATP translocase                                333   5e-110   
ref|XP_002776068.1|  adenine nucleotide translocase, putative           333   5e-110   
ref|NP_511110.1|  adenine nucleotide translocase 2, isoform A           333   5e-110   
ref|XP_002773703.1|  ADP/ATP carrier, putative                          333   5e-110   
ref|XP_001847389.1|  ADP,ATP carrier protein 2                          333   6e-110   
dbj|BAM19077.1|  stress-sensitive B                                     333   6e-110   



>ref|XP_001430538.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK63140.1| unnamed protein product [Paramecium tetraurelia]
Length=521

 Score =   409 bits (1050),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 211/298 (71%), Positives = 245/298 (82%), Gaps = 6/298 (2%)
 Frame = +3

Query  24   VKTGNFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKL----TKKYTGIVDCLTR  191
            ++  +F+ DF +GG+SAAVSKTAVAPIERVKLLLQTQDAN K+     KKY GIVDC  R
Sbjct  217  LQMADFIRDFMIGGVSAAVSKTAVAPIERVKLLLQTQDANKKIQEGGAKKYNGIVDCFIR  276

Query  192  VPKEEGISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCPYNPKTEFWKfffgnlasgg  371
            VPKEEG+SA WRGNLANVIRYFPTQALNFAFKD YKK+ CP++PK E + FF GN+ASGG
Sbjct  277  VPKEEGLSALWRGNLANVIRYFPTQALNFAFKDAYKKLLCPFDPKKERFLFFLGNMASGG  336

Query  372  aagaTSLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSV  551
            AAGATSLMVVYPLDFARTRLAAD+GK  +ERQFTGL DCL+KVYKSDG+ GLY+GFGVSV
Sbjct  337  AAGATSLMVVYPLDFARTRLAADIGKK-SERQFTGLSDCLSKVYKSDGFIGLYRGFGVSV  395

Query  552  LGIIAYRACYFGGYDTLKRVLFSEGK-TSILFKFLVAQVVTAASGLVSYPLDTVRRRLMM  728
            LGI+ YR  YFG YDT K  +F      +I+ KF+VAQ +T  +G++SYPLDT+RRR+MM
Sbjct  396  LGIVVYRGVYFGTYDTAKGTIFKNPMMNNIIAKFIVAQFITGTAGVISYPLDTIRRRMMM  455

Query  729  QSGGKTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAYFAP  902
            QSG   I+Y  T+DC  KI KNEG KAFFKGALSN FRG+GASLVLVLYDE+Q + AP
Sbjct  456  QSGRADILYKNTLDCAVKIAKNEGTKAFFKGALSNFFRGIGASLVLVLYDEIQQFVAP  513



>ref|XP_001434420.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK67023.1| unnamed protein product [Paramecium tetraurelia]
Length=433

 Score =   403 bits (1035),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 210/298 (70%), Positives = 244/298 (82%), Gaps = 6/298 (2%)
 Frame = +3

Query  24   VKTGNFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKL----TKKYTGIVDCLTR  191
            ++  +F+ DF +GG+SAAVSKTAVAPIERVKLLLQTQDAN K+     KKY GIVDC  R
Sbjct  129  IQMADFLRDFLIGGVSAAVSKTAVAPIERVKLLLQTQDANKKIQEGGAKKYNGIVDCFIR  188

Query  192  VPKEEGISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCPYNPKTEFWKfffgnlasgg  371
            VPKEEG+SA WRGNLANVIRYFPTQALNFAFKD YKK+ CP++PK E + FF GN+ASGG
Sbjct  189  VPKEEGLSALWRGNLANVIRYFPTQALNFAFKDAYKKLLCPFDPKKEKFLFFLGNMASGG  248

Query  372  aagaTSLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSV  551
            AAGATSLMVVYPLDFARTRLAAD+GK  +ERQF GL DCL+KVYKSDG+ GLY+GFGVSV
Sbjct  249  AAGATSLMVVYPLDFARTRLAADIGKK-SERQFAGLSDCLSKVYKSDGFIGLYRGFGVSV  307

Query  552  LGIIAYRACYFGGYDTLKRVLFSEGKT-SILFKFLVAQVVTAASGLVSYPLDTVRRRLMM  728
            LGI+ YR  YFG YDT K  +F      +IL KF+VAQ +T  +G++SYPLDT+RRR+MM
Sbjct  308  LGIVVYRGVYFGTYDTAKGTIFKHPMMGNILAKFIVAQFITGTAGVISYPLDTIRRRMMM  367

Query  729  QSGGKTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAYFAP  902
            QSG   ++Y  T+DC  KI KNEG KAFFKGALSN FRG+GASLVLVLYDE+Q + AP
Sbjct  368  QSGRADVLYKNTLDCAVKIAKNEGTKAFFKGALSNFFRGIGASLVLVLYDEIQQFVAP  425



>gb|AGA16550.1| ADP/ATP carrier [Cryptocaryon irritans]
Length=303

 Score =   389 bits (1000),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 212/290 (73%), Positives = 245/290 (84%), Gaps = 5/290 (2%)
 Frame = +3

Query  33   GNFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKL----TKKYTGIVDCLTRVPK  200
            GNF++DF +GG+SAAVSK AVAPIERVKLLLQTQDAN K+     K+YTGI+DC +RV K
Sbjct  3    GNFLIDFFVGGVSAAVSKAAVAPIERVKLLLQTQDANKKIQEGKAKRYTGIIDCFSRVAK  62

Query  201  EEGISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCPYNPKTEFWKfffgnlasggaag  380
            EEG+ A WRGN ANV+RYFPTQALNFAFKDTYKK  CP+NPKTE +KFF GNLASGGAAG
Sbjct  63   EEGVGALWRGNFANVLRYFPTQALNFAFKDTYKKYLCPFNPKTEKFKFFLGNLASGGAAG  122

Query  381  aTSLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGI  560
            A+SLM VYPLDFARTRLAAD+GK   ERQF GL DC+ K++KSDG KGLYQGF +SVLGI
Sbjct  123  ASSLMFVYPLDFARTRLAADIGKGAGERQFHGLGDCIGKIFKSDGPKGLYQGFSISVLGI  182

Query  561  IAYRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSGG  740
            I YRACYFGG+DT +R++F E K SI+ +F+ AQ VTA SG++SYPLDTVRRRLMMQSG 
Sbjct  183  IVYRACYFGGFDTGRRLIFGEQKASIIGRFVFAQCVTAVSGIISYPLDTVRRRLMMQSGR  242

Query  741  KTIMYNGTMDCFAKIYKNEGG-KAFFKGALSNIFRGMGASLVLVLYDEMQ  887
            K I+Y GT+DCF KIY NEGG   FFKGA+SN+FRG+GASLVLVLY+E  
Sbjct  243  KQILYTGTIDCFRKIYANEGGLSPFFKGAMSNVFRGVGASLVLVLYEEFH  292



>emb|CDW72723.1| adp atp translocase 2 [Stylonychia lemnae]
Length=307

 Score =   381 bits (978),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 206/304 (68%), Positives = 242/304 (80%), Gaps = 8/304 (3%)
 Frame = +3

Query  6    MSEGSEVKTG-NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLTK--KYTGIV  176
            M E + ++ G +F  DF +GG+SAAVSKTAVAPIERVKLLLQ QDA+  + +  KY GI 
Sbjct  1    MGESTPMRGGKHFFRDFMIGGVSAAVSKTAVAPIERVKLLLQVQDASKHIAQEDKYKGIS  60

Query  177  DCLTRVPKEEGISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCPYNPKTEFWKfffgn  356
            DC  RV +E+G ++FWRGNLANVIRYFPTQALNFAFKDTYKK+FCP+NPK + + FF GN
Sbjct  61   DCFQRVHREQGFASFWRGNLANVIRYFPTQALNFAFKDTYKKVFCPFNPKVQPFMFFLGN  120

Query  357  lasggaagaTSLMVVYPLDFARTRLAADV--GKTGAERQFTGLVDCLTKVYKSDGYKGLY  530
            +ASGGAAGATSLM VYPLDFARTRLAADV  GK G ER+F GLVDCL K+YKSDG KGLY
Sbjct  121  MASGGAAGATSLMFVYPLDFARTRLAADVGKGKKGGEREFNGLVDCLQKIYKSDGSKGLY  180

Query  531  QGFGVSVLGIIAYRACYFGGYDTLKRVLFSEGKTSILFK-FLVAQVVTAASGLVSYPLDT  707
            +GF +SV+GIIAYRA YFG +DT K  LF + K +  F  +  AQ VT ++G+ SYPLDT
Sbjct  181  RGFVISVVGIIAYRASYFGMFDTGKVFLFEDIKKANFFAMWAFAQAVTVSAGIASYPLDT  240

Query  708  VRRRLMMQSG--GKTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDE  881
            VRRRLMMQSG  G  +MY GTMDCF KI KNEGGKAFFKG+LSN+ RG G +LVLV YD+
Sbjct  241  VRRRLMMQSGRTGADVMYTGTMDCFRKILKNEGGKAFFKGSLSNVIRGTGGALVLVFYDK  300

Query  882  MQAY  893
            +Q Y
Sbjct  301  IQNY  304



>ref|NP_001133211.1| solute carrier family 25-2 [Salmo salar]
 gb|ACH71015.1| solute carrier family 25-2 [Salmo salar]
 emb|CDQ73092.1| unnamed protein product [Oncorhynchus mykiss]
 emb|CDQ64205.1| unnamed protein product [Oncorhynchus mykiss]
Length=298

 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 199/291 (68%), Positives = 238/291 (82%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLTK--KYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++TK  +Y GI+DC+ R+PKE+G
Sbjct  7    SFIKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASQQITKEMQYKGIMDCVRRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    + KT+FW++F GNLASGGAAGAT
Sbjct  67   FISFWRGNLANVIRYFPTQALNFAFKDKYKKIFLGGVDQKTQFWRWFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAAD+GK+GAER+F+GL  CL+K+YK+DG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADIGKSGAEREFSGLGSCLSKIYKADGIKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSGGKT  746
            YRA YFG YDT K +L     T I   +++AQ VTAA+G++SYP DTVRRR+MMQSG K+
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNTHIFVSWMIAQSVTAAAGIISYPFDTVRRRMMMQSGRKS  246

Query  747  --IMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI KNEGGKAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYTGTIDCWKKIAKNEGGKAFFKGAWSNVIRGMGGAFVLVLYDEIKKY  297



>ref|XP_010765274.1| PREDICTED: ADP/ATP translocase 2-like [Notothenia coriiceps]
Length=296

 Score =   377 bits (969),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 201/287 (70%), Positives = 230/287 (80%), Gaps = 3/287 (1%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLTKKYTGIVDCLTRVPKEEGIS  215
            +F  DF  GGISAA+SKTAVAPIERVKLLLQ Q A+ ++T  Y GI+DCL R+PKE+G  
Sbjct  7    SFAKDFLAGGISAAISKTAVAPIERVKLLLQVQHASKQITVHYKGIMDCLVRIPKEQGFL  66

Query  216  AFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaTSL  392
            +FWRGNLANVIRYFPTQALNFAFKD YK IF    + +T+FW++F GNLASGGAAGATSL
Sbjct  67   SFWRGNLANVIRYFPTQALNFAFKDKYKNIFLDGVDKRTQFWRYFAGNLASGGAAGATSL  126

Query  393  MVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIAYR  572
              VYPLDFARTRLAADVGK GA R+F GL DCLTKV++SDG KGLYQGF VSV GII YR
Sbjct  127  CFVYPLDFARTRLAADVGKAGAGREFNGLGDCLTKVFRSDGLKGLYQGFNVSVQGIIIYR  186

Query  573  ACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--GKT  746
            A YFG YDT K +L  + K SIL  +++AQ VTA +GL SYP DTVRRR+MMQSG  G  
Sbjct  187  AAYFGIYDTAKGMLPDDKKNSILVSWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKGAD  246

Query  747  IMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
            IMY GTMDC+ KI KNEG  AFFKGALSN+ RGMG + VLVLYDE++
Sbjct  247  IMYTGTMDCWRKIAKNEGSNAFFKGALSNVLRGMGGAFVLVLYDELK  293



>ref|XP_010886863.1| PREDICTED: ADP/ATP translocase 1 [Esox lucius]
Length=298

 Score =   377 bits (969),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 199/291 (68%), Positives = 238/291 (82%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLTK--KYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++TK  +Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASQQITKEKQYKGIMDCVRRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    + KT+FW++F GNLASGGAAGAT
Sbjct  67   FISFWRGNLANVIRYFPTQALNFAFKDKYKKIFLGGIDQKTQFWRWFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAAD+GKTG +R+F+GL +CLTK+YK+DG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADIGKTGPDREFSGLGNCLTKIYKADGIKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSGGKT  746
            YRA YFG YDT K +L     T I   +++AQ VTAA+G++SYP DTVRRR+MMQSG KT
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNTHIFISWMIAQSVTAAAGIISYPFDTVRRRMMMQSGRKT  246

Query  747  --IMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI KNEGGKAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  VDIMYTGTIDCWRKILKNEGGKAFFKGAWSNVIRGMGGAFVLVLYDEIKKY  297



>gb|EJY72727.1| ADP/ATP carrier [Oxytricha trifallax]
Length=306

 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 210/300 (70%), Positives = 240/300 (80%), Gaps = 8/300 (3%)
 Frame = +3

Query  18   SEVKTG-NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLTK--KYTGIVDCLT  188
            S V+ G +F  DF +GG+SAAVSKTAVAPIERVKLLLQ QDA+  + +  KY GIVDC T
Sbjct  4    SPVRGGKHFFRDFMIGGVSAAVSKTAVAPIERVKLLLQVQDASKHIAQEDKYKGIVDCFT  63

Query  189  RVPKEEGISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCPYNPKTEFWKfffgnlasg  368
            RV KE+G  +FWRGNLANVIRYFPTQALNFAFKDTYKK+FCP+NPKT+ + FF GN+ASG
Sbjct  64   RVNKEQGFKSFWRGNLANVIRYFPTQALNFAFKDTYKKVFCPFNPKTQPYMFFLGNMASG  123

Query  369  gaagaTSLMVVYPLDFARTRLAADV--GKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFG  542
            GAAGATSLM VYPLDFARTRLAADV  GK G ER+F+GLVDCL K+YKSDG KGLY+GF 
Sbjct  124  GAAGATSLMFVYPLDFARTRLAADVGKGKKGGEREFSGLVDCLQKIYKSDGPKGLYRGFV  183

Query  543  VSVLGIIAYRACYFGGYDTLKRVLFSEGKTSILFKFL-VAQVVTAASGLVSYPLDTVRRR  719
            +SV+GIIAYRA YFG +DT K  LF + K +  F     AQ VT  SG+VSYPLDTVRRR
Sbjct  184  ISVIGIIAYRASYFGMFDTGKVFLFEDIKKANFFAMWGFAQCVTILSGVVSYPLDTVRRR  243

Query  720  LMMQSGGKT--IMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
            LMMQSG     IMY GT+DCF KI KNEG KAFFKG+LSN+ RG G +LVLV YD++Q Y
Sbjct  244  LMMQSGRSQGDIMYTGTVDCFNKILKNEGPKAFFKGSLSNVIRGTGGALVLVFYDKIQNY  303



>ref|NP_001253938.1| ADP/ATP translocase 2 [Macaca mulatta]
 ref|XP_002763256.1| PREDICTED: ADP/ATP translocase 2 [Callithrix jacchus]
 ref|XP_003262295.1| PREDICTED: ADP/ATP translocase 2 [Nomascus leucogenys]
 ref|XP_003812675.1| PREDICTED: ADP/ATP translocase 2 [Pan paniscus]
 ref|XP_003918246.1| PREDICTED: ADP/ATP translocase 2 [Papio anubis]
 ref|XP_004064821.1| PREDICTED: ADP/ATP translocase 2 [Gorilla gorilla gorilla]
 ref|XP_005594508.1| PREDICTED: ADP/ATP translocase 2 [Macaca fascicularis]
 ref|XP_008017609.1| PREDICTED: ADP/ATP translocase 2 [Chlorocebus sabaeus]
 gb|AAA51737.1| adenine nucleotide translocator-2 [Homo sapiens]
 gb|AAB39266.1| ADP/ATP carrier protein [Homo sapiens]
 gb|AAH56160.1| Solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 5 [Homo sapiens]
 gb|EAW89870.1| solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 5, isoform CRA_c [Homo sapiens]
 gb|ADQ32589.1| solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 5 [synthetic construct]
 gb|AIC54001.1| SLC25A5, partial [synthetic construct]
Length=298

 Score =   374 bits (959),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 197/291 (68%), Positives = 234/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+YKSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIVISWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  TDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_004645751.1| PREDICTED: ADP/ATP translocase 2 [Octodon degus]
Length=298

 Score =   373 bits (958),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 197/291 (68%), Positives = 234/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+YKSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLVKIYKSDGIKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIIISWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  TDIMYTGTVDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_003797041.1| PREDICTED: ADP/ATP translocase 2 [Otolemur garnettii]
Length=298

 Score =   373 bits (958),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 196/291 (67%), Positives = 235/291 (81%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFIKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+YKSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLVKIYKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIIVSWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  TDIMYTGTVDCWRKILRDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_010611288.1| PREDICTED: ADP/ATP translocase 2 [Fukomys damarensis]
 gb|KFO19704.1| hypothetical protein H920_18902 [Fukomys damarensis]
Length=298

 Score =   373 bits (958),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 195/291 (67%), Positives = 234/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQISADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDVYKQIFLSGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL VVYPLDFARTRLAADVGK GAER+F GL DCL K+YKSDG KGLYQGF VSV GI  
Sbjct  127  SLCVVYPLDFARTRLAADVGKAGAEREFKGLGDCLVKIYKSDGIKGLYQGFNVSVQGIFI  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIIISWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  TDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>ref|NP_476443.1| ADP/ATP translocase 2 [Rattus norvegicus]
 sp|Q09073.3|ADT2_RAT RecName: Full=ADP/ATP translocase 2; AltName: Full=ADP,ATP carrier 
protein 2; AltName: Full=Adenine nucleotide translocator 
2; Short=ANT 2; AltName: Full=Solute carrier family 25 member 
5; Contains: RecName: Full=ADP/ATP translocase 2, N-terminally 
processed [Rattus norvegicus]
 dbj|BAA02238.1| adenine nucleotide translocator [Rattus norvegicus]
 gb|AAH59108.1| Solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 5 [Rattus norvegicus]
 gb|EDM10821.1| rCG53232, isoform CRA_b [Rattus norvegicus]
Length=298

 Score =   373 bits (957),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 197/291 (68%), Positives = 233/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+YKSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLVKIYKSDGIKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I   +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  TDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_009437842.1| PREDICTED: LOW QUALITY PROTEIN: ADP/ATP translocase 2 [Pan troglodytes]
Length=298

 Score =   372 bits (956),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 196/291 (67%), Positives = 234/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER++ GL DCL K+YKSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREYRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIVISWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  TDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_003467674.1| PREDICTED: ADP/ATP translocase 2 [Cavia porcellus]
Length=298

 Score =   372 bits (956),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 196/291 (67%), Positives = 234/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+YKSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLVKIYKSDGIKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIIVSWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  TDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>gb|AAH68199.1| SLC25A5 protein, partial [Homo sapiens]
Length=323

 Score =   373 bits (957),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 197/291 (68%), Positives = 233/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  32   SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  91

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW +F GNLASGGAAGAT
Sbjct  92   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWLYFAGNLASGGAAGAT  151

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+YKSDG KGLYQGF VSV GII 
Sbjct  152  SLCFVYPLDFARTRLAADVGKAGAEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIII  211

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  212  YRAAYFGIYDTAKGMLPDPKNTHIVISWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKG  271

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  272  TDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  322



>ref|NP_001143.2| ADP/ATP translocase 2 [Homo sapiens]
 sp|P05141.7|ADT2_HUMAN RecName: Full=ADP/ATP translocase 2; AltName: Full=ADP,ATP carrier 
protein 2; AltName: Full=ADP,ATP carrier protein, fibroblast 
isoform; AltName: Full=Adenine nucleotide translocator 
2; Short=ANT 2; AltName: Full=Solute carrier family 25 member 
5; Contains: RecName: Full=ADP/ATP translocase 2, N-terminally 
processed [Homo sapiens]
 gb|AAB96347.1| ADP/ATP carrier protein (adenine nucleotide translocator 2) [Homo 
sapiens]
Length=298

 Score =   372 bits (955),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 197/291 (68%), Positives = 233/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW +F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWLYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+YKSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIVISWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  TDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_006082242.1| PREDICTED: ADP/ATP translocase 2 [Myotis lucifugus]
Length=297

 Score =   372 bits (954),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 195/290 (67%), Positives = 231/290 (80%), Gaps = 4/290 (1%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCPYNPKTEFWKfffgnlasggaagaTS  389
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF     K +FW++F GNLASGGAAGATS
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKAQFWRYFAGNLASGGAAGATS  126

Query  390  LMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIAY  569
            L  VYPLDFARTRLAADVGK GAER+F GL DCL K+YKSDG +GLYQGF VSV GII Y
Sbjct  127  LCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLVKIYKSDGLRGLYQGFNVSVQGIIIY  186

Query  570  RACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--GK  743
            RA YFG YDT K +L     T I   +++AQ VTA +GL SYP DTVRRR+MMQSG  G 
Sbjct  187  RAAYFGVYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKGS  246

Query  744  TIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
             IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  DIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  296



>ref|XP_005410502.1| PREDICTED: ADP/ATP translocase 2 [Chinchilla lanigera]
Length=298

 Score =   372 bits (954),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 196/291 (67%), Positives = 234/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+YKSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLVKIYKSDGIKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIIISWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  TDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>dbj|BAG37698.1| unnamed protein product [Homo sapiens]
Length=298

 Score =   372 bits (954),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 197/291 (68%), Positives = 233/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASMQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW +F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWLYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+YKSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIVISWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  TDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_004076397.1| PREDICTED: ADP/ATP translocase 3-like isoform 1 [Oryzias latipes]
Length=298

 Score =   372 bits (954),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 196/289 (68%), Positives = 232/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGISAA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGISAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGN+ANVIRYFPTQALNFAFKD YKK+F    + +T+FW++F GNLASGGAAGAT
Sbjct  67   ALSFWRGNMANVIRYFPTQALNFAFKDKYKKVFLDGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK G ER+F GL DCL K++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGQEREFRGLADCLKKIFKSDGLKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T IL  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHILVSWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY+GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYSGTIDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_851701.1| PREDICTED: ADP/ATP translocase 2 isoform 2 [Canis lupus familiaris]
Length=298

 Score =   372 bits (954),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 197/293 (67%), Positives = 234/293 (80%), Gaps = 5/293 (2%)
 Frame = +3

Query  30   TGNFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKE  203
            T +F  DF  GG+SAA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE
Sbjct  5    TVSFTKDFLAGGVSAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKE  64

Query  204  EGISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaag  380
            +G+ +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAG
Sbjct  65   QGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAG  124

Query  381  aTSLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGI  560
            ATSL  VYPLDFARTRLAADVGK GAER+F GL DCL K+YKSDG +GLYQGF VSV GI
Sbjct  125  ATSLCFVYPLDFARTRLAADVGKAGAEREFRGLGDCLVKIYKSDGIRGLYQGFNVSVQGI  184

Query  561  IAYRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG-  737
            I YRA YFG YDT K +L     T I   +++AQ VTA +GL SYP DTVRRR+MMQSG 
Sbjct  185  IIYRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGR  244

Query  738  -GKTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
             G  IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  245  KGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>ref|XP_005319438.1| PREDICTED: ADP/ATP translocase 2 [Ictidomys tridecemlineatus]
Length=298

 Score =   372 bits (954),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 197/291 (68%), Positives = 233/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            I +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   ILSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+YKSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLVKIYKSDGIKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I   +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  TDIMYTGTIDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>ref|XP_004900207.1| PREDICTED: ADP/ATP translocase 2 [Heterocephalus glaber]
 ref|XP_004872213.1| PREDICTED: ADP/ATP translocase 2 [Heterocephalus glaber]
 gb|EHB12828.1| ADP/ATP translocase 2 [Heterocephalus glaber]
Length=298

 Score =   371 bits (953),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 195/291 (67%), Positives = 234/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+Y+SDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLVKIYRSDGIKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIIISWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  TDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>ref|NP_001126815.1| ADP/ATP translocase 2 [Pongo abelii]
 sp|Q5R5A1.3|ADT2_PONAB RecName: Full=ADP/ATP translocase 2; AltName: Full=ADP,ATP carrier 
protein 2; AltName: Full=Adenine nucleotide translocator 
2; Short=ANT 2; AltName: Full=Solute carrier family 25 member 
5; Contains: RecName: Full=ADP/ATP translocase 2, N-terminally 
processed [Pongo abelii]
 emb|CAH93065.1| hypothetical protein [Pongo abelii]
Length=298

 Score =   371 bits (953),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 195/291 (67%), Positives = 233/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIR+FPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRHFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+YKSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIVISWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG +  LVLYDE++ Y
Sbjct  247  TDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFALVLYDEIKKY  297



>ref|XP_004653571.1| PREDICTED: ADP/ATP translocase 2-like [Jaculus jaculus]
Length=298

 Score =   371 bits (952),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 196/291 (67%), Positives = 233/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GIVDC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIVDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            I +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   ILSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+YKSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLAKIYKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I   +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ K+ ++EGGKAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  SDIMYTGTVDCWRKVARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>gb|AAA35579.1| ADP/ATP carrier protein [Homo sapiens]
Length=298

 Score =   371 bits (952),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 196/291 (67%), Positives = 233/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+ 
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQE  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+YKSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIVISWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  TDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_006741435.1| PREDICTED: ADP/ATP translocase 2 [Leptonychotes weddellii]
Length=298

 Score =   371 bits (952),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 196/291 (67%), Positives = 233/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+YKSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I   +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  TDIMYTGTIDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>ref|NP_031477.1| ADP/ATP translocase 2 [Mus musculus]
 sp|P51881.3|ADT2_MOUSE RecName: Full=ADP/ATP translocase 2; AltName: Full=ADP,ATP carrier 
protein 2; AltName: Full=Adenine nucleotide translocator 
2; Short=ANT 2; AltName: Full=Solute carrier family 25 member 
5; Contains: RecName: Full=ADP/ATP translocase 2, N-terminally 
processed [Mus musculus]
 gb|AAF64471.1|AF240003_1 adenine nucleotide translocase 2 [Mus musculus]
 gb|AAA19009.1| adenine nucleotide translocase [Mus musculus]
 gb|AAC52838.1| adenine nucleotide translocase-2 [Mus musculus]
 emb|CAA50196.1| adenine nucleotide translocase [Mus musculus]
 dbj|BAB22804.1| unnamed protein product [Mus musculus]
 dbj|BAB28445.1| unnamed protein product [Mus musculus]
 gb|AAH04570.1| Solute carrier family 25 (mitochondrial carrier, adenine nucleotide 
translocator), member 5 [Mus musculus]
 dbj|BAC40533.1| unnamed protein product [Mus musculus]
 gb|AAH86756.1| Solute carrier family 25 (mitochondrial carrier, adenine nucleotide 
translocator), member 5 [Mus musculus]
 gb|EDL28975.1| mCG11560 [Mus musculus]
Length=298

 Score =   370 bits (951),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 196/291 (67%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+YKSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLVKIYKSDGIKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I   +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  TDIMYTGTLDCWRKIARDEGSKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>emb|CAG00577.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=299

 Score =   370 bits (951),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 197/288 (68%), Positives = 231/288 (80%), Gaps = 4/288 (1%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGISAA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  9    SFAKDFLAGGISAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  68

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    + +T+FW++F GNLASGGAAGAT
Sbjct  69   FLSFWRGNLANVIRYFPTQALNFAFKDKYKKIFLDGVDKRTQFWRYFAGNLASGGAAGAT  128

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K++KSDG +GLYQGF VSV GII 
Sbjct  129  SLCFVYPLDFARTRLAADVGKAGAEREFNGLGDCLVKIFKSDGLRGLYQGFNVSVQGIII  188

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSGGK-  743
            YRA YFG YDT K +L     T IL  +++AQ VTA +GL SYP DTVRRR+MMQSG K 
Sbjct  189  YRAAYFGIYDTAKGMLPDPKNTHILVSWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKG  248

Query  744  TIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
             IMY GT+DC+ KI ++EG KAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  249  EIMYTGTIDCWRKIARDEGSKAFFKGAWSNVLRGMGGAFVLVLYDELK  296



>ref|XP_005802974.1| PREDICTED: ADP/ATP translocase 3-like [Xiphophorus maculatus]
Length=298

 Score =   370 bits (950),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 198/289 (69%), Positives = 231/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGISAA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGISAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKKIFLDGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK G ER+F GL DCL K+ KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGTEREFKGLGDCLVKISKSDGIKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T IL  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHILVSWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY+GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYSGTIDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_002720265.1| PREDICTED: ADP/ATP translocase 2 [Oryctolagus cuniculus]
 ref|XP_002720308.1| PREDICTED: ADP/ATP translocase 2 [Oryctolagus cuniculus]
Length=298

 Score =   370 bits (950),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 195/291 (67%), Positives = 233/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+YKSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFRGLGDCLVKIYKSDGIRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I   +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  TDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>ref|XP_004407897.1| PREDICTED: ADP/ATP translocase 3-like [Odobenus rosmarus divergens]
Length=298

 Score =   370 bits (950),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 196/289 (68%), Positives = 232/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GIVDC+ R+PKE+G
Sbjct  7    SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +  T+FWK+F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWKYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK+G ER+F GL DCL K+ KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKSGTEREFKGLGDCLVKITKSDGIRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +G+VSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI+K+EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYKGTIDCWRKIFKDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_005859507.1| PREDICTED: LOW QUALITY PROTEIN: solute carrier family 25 (mitochondrial 
carrier; adenine nucleotide translocator), member 
5 [Myotis brandtii]
Length=297

 Score =   370 bits (950),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 194/290 (67%), Positives = 230/290 (79%), Gaps = 4/290 (1%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCPYNPKTEFWKfffgnlasggaagaTS  389
            + +FWRGNLANVIRYFPTQALNFAF D YK+IF     K +FW++F GNLASGGAAGATS
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFXDKYKQIFLGGVEKAQFWRYFAGNLASGGAAGATS  126

Query  390  LMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIAY  569
            L  VYPLDFARTRLAADVGK GAER+F GL DCL K+YKSDG +GLYQGF VSV GII Y
Sbjct  127  LCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLVKIYKSDGLRGLYQGFNVSVQGIIIY  186

Query  570  RACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--GK  743
            RA YFG YDT K +L     T I   +++AQ VTA +GL SYP DTVRRR+MMQSG  G 
Sbjct  187  RAAYFGVYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKGS  246

Query  744  TIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
             IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  DIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  296



>ref|XP_003446896.1| PREDICTED: ADP/ATP translocase 2-like isoform X1 [Oreochromis 
niloticus]
Length=298

 Score =   370 bits (949),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 196/289 (68%), Positives = 233/289 (81%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGISAA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGISAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKK+F    + +T+FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKKVFLDGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F+GL +CL K++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFSGLGNCLMKIFKSDGLKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  TEIMYTGTIDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_004685798.1| PREDICTED: ADP/ATP translocase 2 [Condylura cristata]
Length=298

 Score =   370 bits (949),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 196/291 (67%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+ KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLVKISKSDGIKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I   +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  TDIMYTGTIDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_010360127.1| PREDICTED: ADP/ATP translocase 2 [Rhinopithecus roxellana]
Length=298

 Score =   370 bits (949),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 196/291 (67%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+YKSD  KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFRGLGDCLVKIYKSDVIKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIVISWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE + Y
Sbjct  247  TDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEFKKY  297



>ref|XP_007254456.1| PREDICTED: ADP/ATP translocase 2 [Astyanax mexicanus]
Length=298

 Score =   370 bits (949),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 196/289 (68%), Positives = 233/289 (81%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++T  K Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQITADKHYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKK+F    + +T+FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKKVFLDGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+FTGL +CL K++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFTGLGNCLAKIFKSDGLKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIVVSWMIAQSVTAVAGLASYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY+GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYSGTIDCWKKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_007555149.1| PREDICTED: ADP/ATP translocase 2 [Poecilia formosa]
Length=298

 Score =   370 bits (949),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 197/289 (68%), Positives = 231/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GIVDC+ R+PKE+G
Sbjct  7    SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIVDCIVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKKIFLDGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK G ER+F GL DCL K++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGQEREFKGLGDCLVKIFKSDGLKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNTHIVVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI ++EG KAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYTGTLDCWRKIARDEGSKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_003414833.1| PREDICTED: ADP/ATP translocase 2 [Loxodonta africana]
Length=298

 Score =   370 bits (949),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 194/291 (67%), Positives = 233/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNL NVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLVNVIRYFPTQALNFAFKDKYKEIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+YKSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLAKIYKSDGIKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VT+ +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRATYFGVYDTAKGMLPDPRNTHIIISWMIAQTVTSVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  TDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>ref|XP_004275853.1| PREDICTED: ADP/ATP translocase 2 [Orcinus orca]
 ref|XP_004329128.1| PREDICTED: ADP/ATP translocase 2-like isoform 1 [Tursiops truncatus]
 ref|XP_004329129.1| PREDICTED: ADP/ATP translocase 2-like isoform 2 [Tursiops truncatus]
 ref|XP_007465511.1| PREDICTED: ADP/ATP translocase 2 [Lipotes vexillifer]
Length=298

 Score =   370 bits (949),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 195/291 (67%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+YKSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I   +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EG KAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  TDIMYTGTLDCWRKIARDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>ref|XP_004286319.1| PREDICTED: ADP/ATP translocase 3 [Orcinus orca]
Length=298

 Score =   369 bits (948),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 195/289 (67%), Positives = 232/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GIVDC+ R+PKE+G
Sbjct  7    SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +  T+FWK+F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWKYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK+G ER+F GL DCL K+ KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKSGTEREFKGLGDCLVKITKSDGIRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +G+VSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI+K+EGG+AFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYRGTLDCWRKIFKDEGGRAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_004316616.1| PREDICTED: ADP/ATP translocase 3 [Tursiops truncatus]
Length=298

 Score =   369 bits (948),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 195/289 (67%), Positives = 232/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GIVDC+ R+PKE+G
Sbjct  7    SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +  T+FWK+F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWKYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK+G ER+F GL DCL K+ KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKSGTEREFKGLGDCLVKITKSDGIRGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +G+VSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI+K+EGG+AFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYRGTLDCWRKIFKDEGGRAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_003422834.1| PREDICTED: ADP/ATP translocase 3 [Loxodonta africana]
Length=298

 Score =   369 bits (948),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 194/289 (67%), Positives = 233/289 (81%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GIVDC+ R+PKE+G
Sbjct  7    SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK++F    +  T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKHTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK+GAER+F GL DCL K+ KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKSGAEREFKGLGDCLVKITKSDGVRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +G+VSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIVISWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI+K+EGGKAFFKGA SN+ RGMG + VLV+YDE++
Sbjct  247  ADIMYTGTIDCWRKIFKDEGGKAFFKGAWSNVLRGMGGAFVLVIYDELK  295



>ref|XP_006993673.1| PREDICTED: ADP/ATP translocase 2 [Peromyscus maniculatus bairdii]
 ref|XP_007638943.1| PREDICTED: ADP/ATP translocase 2 [Cricetulus griseus]
 ref|XP_007610149.1| PREDICTED: ADP/ATP translocase 2 [Cricetulus griseus]
 gb|ERE65868.1| ADP/ATP translocase 2-like protein [Cricetulus griseus]
Length=298

 Score =   369 bits (948),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 195/291 (67%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+YKSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLVKIYKSDGIRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I   +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  TDIMYTGTIDCWRKIARDEGSKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_004587695.1| PREDICTED: ADP/ATP translocase 2 [Ochotona princeps]
Length=298

 Score =   369 bits (948),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 194/291 (67%), Positives = 233/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+Y+SDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLVKIYRSDGIRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I   +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  TDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>ref|XP_008842240.1| PREDICTED: ADP/ATP translocase 2 [Nannospalax galili]
Length=298

 Score =   369 bits (948),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 195/291 (67%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+YKSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLVKIYKSDGIKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I   +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EG KAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  TDIMYTGTLDCWRKIARDEGSKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>ref|NP_001122204.1| ADP/ATP translocase 3 [Danio rerio]
 gb|AAI62779.1| Solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 6 [Danio rerio]
 gb|AAI62783.1| Solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 6 [Danio rerio]
Length=298

 Score =   369 bits (948),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 193/291 (66%), Positives = 233/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ +++  K+Y GIVDC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQISADKQYKGIVDCIVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
             ++FWRGNLANVIRYFPTQALNFAFKD YK+IF    +  T+FW++F GNLASGGAAGAT
Sbjct  67   FASFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK G+ R+F+GL DCL K++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGSTREFSGLADCLAKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +G+VSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNTHIMVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EG KAFFKGALSN+ RGMG + VLVLYDE + Y
Sbjct  247  ADIMYTGTLDCWRKIARDEGSKAFFKGALSNVLRGMGGAFVLVLYDEFKKY  297



>ref|XP_006882302.1| PREDICTED: ADP/ATP translocase 1 [Elephantulus edwardii]
Length=298

 Score =   369 bits (948),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 196/291 (67%), Positives = 234/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AAVSKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FISFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  A+R+F+GL DCLTK++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGAAQREFSGLGDCLTKIFKSDGLKGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY+GT+DC+ KI K+EGGKAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  TDIMYSGTLDCWRKIAKDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_005368950.1| PREDICTED: ADP/ATP translocase 2 [Microtus ochrogaster]
Length=298

 Score =   369 bits (948),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 195/291 (67%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+YKSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLIKIYKSDGIRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I   +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  TDIMYTGTIDCWRKIARDEGSKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|NP_001279642.1| solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 5 [Callorhinchus milii]
 gb|AFK11172.1| adenine nucleotide translocator [Callorhinchus milii]
 gb|AFM88223.1| adenine nucleotide translocator [Callorhinchus milii]
 gb|AFM89386.1| adenine nucleotide translocator [Callorhinchus milii]
 gb|AFM90392.1| adenine nucleotide translocator [Callorhinchus milii]
 gb|AFM90994.1| adenine nucleotide translocator [Callorhinchus milii]
Length=298

 Score =   369 bits (947),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 193/291 (66%), Positives = 234/291 (80%), Gaps = 4/291 (1%)
 Frame = +3

Query  27   KTGNFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLTK--KYTGIVDCLTRVPK  200
            K  +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ +++   +Y GI+DC+ R+PK
Sbjct  5    KALSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQISADMQYKGIIDCVVRIPK  64

Query  201  EEGISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCPYNPKTEFWKfffgnlasggaag  380
            E+G  +FWRGN+ANVIRYFPTQALNFAFKD YK++F     KT+FW++F GNLASGGAAG
Sbjct  65   EQGFMSFWRGNMANVIRYFPTQALNFAFKDVYKQVFLGGIDKTQFWRYFAGNLASGGAAG  124

Query  381  aTSLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGI  560
            ATSL  VYPLDFARTRLAADVGK+GAER+F GL DCL+K++KSDG+KGLYQGF VSV GI
Sbjct  125  ATSLCFVYPLDFARTRLAADVGKSGAEREFKGLGDCLSKIFKSDGFKGLYQGFNVSVQGI  184

Query  561  IAYRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSGG  740
            I YRA YFG YDT K +L     T I+  +++AQ VTA +G+ SYP DTVRRR+MMQSG 
Sbjct  185  IIYRAAYFGIYDTAKGMLPDPKNTHIVVSWMIAQSVTAVAGVTSYPFDTVRRRMMMQSGR  244

Query  741  KT--IMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
            KT  IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE +
Sbjct  245  KTADIMYTGTIDCWRKILQDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEFK  295



>ref|XP_008425992.1| PREDICTED: ADP/ATP translocase 3 [Poecilia reticulata]
Length=298

 Score =   369 bits (947),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 197/289 (68%), Positives = 231/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGISAA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGISAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKKIFLDGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK G ER+F GL DCL K+ KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGTEREFKGLGDCLVKISKSDGIRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T IL  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHILVSWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY+GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYSGTIDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_002191653.1| PREDICTED: ADP/ATP translocase 1 [Taeniopygia guttata]
Length=298

 Score =   369 bits (947),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 196/291 (67%), Positives = 233/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AAVSKTAVAPIERVKLLLQ Q A+ ++T  K+Y GIVDC+ R+PKE+G
Sbjct  7    SFVKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQITADKQYKGIVDCIVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            I++FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   IASFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  +ER+F+GL DC+ K++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGASEREFSGLGDCIVKIFKSDGLKGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYKGTIDCWRKIAKDEGSKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_007557479.1| PREDICTED: ADP/ATP translocase 3 [Poecilia formosa]
Length=298

 Score =   369 bits (947),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 197/289 (68%), Positives = 231/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGISAA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGISAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKKIFLDGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK G ER+F GL DCL K+ KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGTEREFKGLGDCLVKISKSDGIRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T IL  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHILVSWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY+GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYSGTIDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_004867368.1| PREDICTED: ADP/ATP translocase 3 isoform X1 [Heterocephalus glaber]
Length=298

 Score =   369 bits (947),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 196/289 (68%), Positives = 232/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GIVDC+ R+PKE+G
Sbjct  7    SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAAEKQYKGIVDCIVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +  T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK+GAER+F GL DCL K+ KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKSGAEREFKGLGDCLVKITKSDGIRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +G+VSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIVVSWMIAQSVTAVAGVVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI K+EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYTGTIDCWRKILKDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_008306464.1| PREDICTED: ADP/ATP translocase 3-like [Cynoglossus semilaevis]
Length=322

 Score =   370 bits (949),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 196/289 (68%), Positives = 233/289 (81%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLTK--KYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AAVSKT VAPIERVKLLLQ Q A+ ++TK  +Y GIVDC+ R+PKE+G
Sbjct  31   SFAKDFLAGGVAAAVSKTTVAPIERVKLLLQVQHASRQITKDQQYKGIVDCIVRIPKEQG  90

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK +F    + +T+FW++F GNLASGGAAGAT
Sbjct  91   VLSFWRGNLANVIRYFPTQALNFAFKDKYKAVFLDGVDSRTQFWRYFAGNLASGGAAGAT  150

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL KV++SDG KGLYQGF VSV GII 
Sbjct  151  SLCFVYPLDFARTRLAADVGKAGAEREFNGLGDCLIKVFQSDGLKGLYQGFNVSVQGIII  210

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T IL  +++AQ VTA +GL SYPLDTVRRR+MMQSG  G
Sbjct  211  YRAAYFGIYDTAKGMLPDPKNTPILVSWMIAQTVTAVAGLASYPLDTVRRRMMMQSGRKG  270

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY+GT+DC+ KI ++EG KAFFKGALSN+ RGMG + VLV+YDE++
Sbjct  271  ADIMYSGTIDCWRKISRDEGIKAFFKGALSNVLRGMGGAFVLVIYDELK  319



>ref|XP_006762396.1| PREDICTED: ADP/ATP translocase 2 [Myotis davidii]
 gb|ELK31325.1| ADP/ATP translocase 2 [Myotis davidii]
Length=297

 Score =   369 bits (946),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 194/290 (67%), Positives = 230/290 (79%), Gaps = 4/290 (1%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCPYNPKTEFWKfffgnlasggaagaTS  389
            + +FWRGNLANVIRYFPTQALNFAFKD YK+I      K +FW++F GNLASGGAAGATS
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQICLGGVDKAQFWRYFAGNLASGGAAGATS  126

Query  390  LMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIAY  569
            L  VYPLDFARTRLAADVGK GAER+F GL DCL K+YKSDG +GLYQGF VSV GII Y
Sbjct  127  LCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLVKIYKSDGLRGLYQGFNVSVQGIIIY  186

Query  570  RACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--GK  743
            RA YFG YDT K +L     T I   +++AQ VTA +GL SYP DTVRRR+MMQSG  G 
Sbjct  187  RAAYFGVYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKGS  246

Query  744  TIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
             IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  DIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  296



>ref|XP_008331551.1| PREDICTED: ADP/ATP translocase 2 [Cynoglossus semilaevis]
Length=298

 Score =   369 bits (946),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 196/289 (68%), Positives = 233/289 (81%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLTK--KYTGIVDCLTRVPKEEG  209
            +F  DF  GGISAA+SKTAVAPIERVKLLLQ Q A+ ++T   +Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGISAAISKTAVAPIERVKLLLQVQHASKQITADMQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YKKIF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKKIFLDGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GA R+F+GL +CL K++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAGREFSGLGNCLAKIFKSDGLKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T IL  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDSKNTHILVSWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY+GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYSGTIDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_003793083.1| PREDICTED: ADP/ATP translocase 3 [Otolemur garnettii]
Length=298

 Score =   369 bits (946),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 194/289 (67%), Positives = 233/289 (81%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GIVDC+ R+P+E+G
Sbjct  7    SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCVVRIPREQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +  T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK+GAER+F GL DCL K+ KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKSGAEREFKGLGDCLVKITKSDGVRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +G+VSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI+++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYKGTVDCWRKIFRDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_006042514.1| PREDICTED: ADP/ATP translocase 3 [Bubalus bubalis]
Length=298

 Score =   369 bits (946),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 195/289 (67%), Positives = 233/289 (81%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GIVDC+ R+PKE+G
Sbjct  7    SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK+G+ER+F GL DCL K+ KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKSGSEREFKGLGDCLVKITKSDGIRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +G+VSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI K+EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYKGTVDCWRKILKDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|NP_777084.1| ADP/ATP translocase 2 [Bos taurus]
 ref|NP_001120751.1| ADP/ATP translocase 2 [Ovis aries]
 ref|NP_001281255.1| solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 5 [Bos mutus]
 ref|XP_001927475.1| PREDICTED: ADP/ATP translocase 2 [Sus scrofa]
 ref|XP_006046161.1| PREDICTED: ADP/ATP translocase 2 [Bubalus bubalis]
 sp|Q8SQH5.3|ADT2_BOVIN RecName: Full=ADP/ATP translocase 2; AltName: Full=ADP,ATP carrier 
protein 2; AltName: Full=Adenine nucleotide translocator 
2; Short=ANT 2; AltName: Full=Solute carrier family 25 member 
5; Contains: RecName: Full=ADP/ATP translocase 2, N-terminally 
processed [Bos taurus]
 dbj|BAB84673.1| adenine nucleotide translocator 2 [Bos taurus]
 gb|AAI02951.1| Solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 5 [Bos taurus]
 gb|ACC93604.1| SLC25A5 [Ovis aries]
 tpg|DAA13433.1| TPA: ADP/ATP translocase 2 [Bos taurus]
 gb|ELR62606.1| hypothetical protein M91_03225 [Bos mutus]
 gb|AIC38343.1| ADP/ATP translocase 2 [Bos mutus]
Length=298

 Score =   369 bits (946),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 194/291 (67%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+YKSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFRGLGDCLVKIYKSDGIRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I   +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EG KAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  TDIMYTGTLDCWRKIARDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>dbj|BAD93059.1| ADP,ATP carrier protein, liver isoform T2 variant [Homo sapiens]
Length=323

 Score =   369 bits (948),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 194/289 (67%), Positives = 232/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GIVDC+ R+PKE+G
Sbjct  32   SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQG  91

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +  T+FW++F GNLASGGAAGAT
Sbjct  92   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGGAAGAT  151

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK+G ER+F GL DCL K+ KSDG +GLYQGF VSV GII 
Sbjct  152  SLCFVYPLDFARTRLAADVGKSGTEREFRGLGDCLVKITKSDGIRGLYQGFSVSVQGIII  211

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +G+VSYP DTVRRR+MMQSG  G
Sbjct  212  YRAAYFGVYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKG  271

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI+++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  272  ADIMYTGTVDCWRKIFRDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  320



>ref|XP_010744444.1| PREDICTED: ADP/ATP translocase 2 [Larimichthys crocea]
Length=298

 Score =   369 bits (946),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 196/289 (68%), Positives = 232/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGISAA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGISAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKKIFLDGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GA R+F GL DCL K+++SDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAGREFNGLGDCLVKIFRSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T IL  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHILVSWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY+GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYSGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_005483906.1| PREDICTED: ADP/ATP translocase 1 [Zonotrichia albicollis]
 ref|XP_009099118.1| PREDICTED: ADP/ATP translocase 1 [Serinus canaria]
Length=298

 Score =   368 bits (945),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 196/291 (67%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AAVSKTAVAPIERVKLLLQ Q A+ ++T  K+Y GIVDC+ R+PKE+G
Sbjct  7    SFVKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQITADKQYKGIVDCIVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            I++FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   IASFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK   ER+F+GL DC+ K++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGATEREFSGLGDCIVKIFKSDGLKGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYKGTIDCWRKIAKDEGSKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_004564045.1| PREDICTED: ADP/ATP translocase 2-like [Maylandia zebra]
 ref|XP_005922277.1| PREDICTED: ADP/ATP translocase 2-like isoform X1 [Haplochromis 
burtoni]
 ref|XP_006802325.1| PREDICTED: ADP/ATP translocase 2-like [Neolamprologus brichardi]
Length=298

 Score =   368 bits (945),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 196/289 (68%), Positives = 232/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGISAA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGISAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKK+F    + +T+FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKKVFLDGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GA R+F+GL DCL K++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAGREFSGLGDCLVKIFKSDGLKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  AEIMYTGTIDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_005484488.1| PREDICTED: ADP/ATP translocase 2 [Zonotrichia albicollis]
Length=298

 Score =   368 bits (945),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 193/291 (66%), Positives = 235/291 (81%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GI+DC+ R+P+E+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIIDCVVRIPREQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            I +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   ILSFWRGNLANVIRYFPTQALNFAFKDKYKEIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GA+R+F+GL DCL KV++SDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGADREFSGLGDCLVKVFRSDGLRGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIVISWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY+GT+DC+ KI ++EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYSGTLDCWRKIARDEGSKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_008071797.1| PREDICTED: LOW QUALITY PROTEIN: ADP/ATP translocase 2 [Tarsius 
syrichta]
Length=298

 Score =   368 bits (945),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 195/291 (67%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFART LA DVGK GAER+F GL DCL K+YKSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTCLATDVGKAGAEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIIISWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  TDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|NP_777085.1| ADP/ATP translocase 3 [Bos taurus]
 sp|P32007.3|ADT3_BOVIN RecName: Full=ADP/ATP translocase 3; AltName: Full=ADP,ATP carrier 
protein 3; AltName: Full=ADP,ATP carrier protein, isoform 
T2; Short=ANT 2; AltName: Full=Adenine nucleotide translocator 
3; Short=ANT 3; AltName: Full=Solute carrier family 25 
member 6; Contains: RecName: Full=ADP/ATP translocase 3, N-terminally 
processed [Bos taurus]
 gb|AAA30769.1| translocase [Bos taurus]
 gb|ABM06156.1| solute carrier family 25, member A6 [Bos taurus]
 gb|AAI50035.1| Solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 6 [Bos taurus]
 tpg|DAA33747.1| TPA: ADP/ATP translocase 3 [Bos taurus]
 gb|AIC38344.1| ADP/ATP translocase 3 [Bos mutus]
Length=298

 Score =   368 bits (945),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 195/289 (67%), Positives = 233/289 (81%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GIVDC+ R+PKE+G
Sbjct  7    SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK+G+ER+F GL DCL K+ KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKSGSEREFRGLGDCLVKITKSDGIRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +G+VSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI K+EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYKGTVDCWRKILKDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_010966571.1| PREDICTED: ADP/ATP translocase 3 [Camelus bactrianus]
 ref|XP_010994920.1| PREDICTED: ADP/ATP translocase 3 [Camelus dromedarius]
Length=298

 Score =   368 bits (945),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 194/289 (67%), Positives = 232/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GIVDC+ R+PKE+G
Sbjct  7    SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +  T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK+G ER+F GL DCL K+ KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKSGKEREFKGLGDCLVKITKSDGVRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +G+VSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI+++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYRGTLDCWRKIFRDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_007111376.1| PREDICTED: ADP/ATP translocase 1 [Physeter catodon]
Length=298

 Score =   368 bits (945),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 193/291 (66%), Positives = 236/291 (81%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AA+SKTAVAPIERVKLLLQ Q A+A+++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASAQISAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK+ A+R+FTGL +CLTK++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKSAAQREFTGLGNCLTKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY+GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYSGTVDCWRKIAKDEGPKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|NP_001627.2| ADP/ATP translocase 3 [Homo sapiens]
 ref|NP_001271588.1| solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 6 [Macaca fascicularis]
 ref|XP_004063771.1| PREDICTED: ADP/ATP translocase 3 [Gorilla gorilla gorilla]
 ref|XP_008017851.1| PREDICTED: ADP/ATP translocase 3 [Chlorocebus sabaeus]
 ref|XP_010362788.1| PREDICTED: ADP/ATP translocase 3 [Rhinopithecus roxellana]
 sp|P12236.4|ADT3_HUMAN RecName: Full=ADP/ATP translocase 3; AltName: Full=ADP,ATP carrier 
protein 3; AltName: Full=ADP,ATP carrier protein, isoform 
T2; Short=ANT 2; AltName: Full=Adenine nucleotide translocator 
3; Short=ANT 3; AltName: Full=Solute carrier family 25 
member 6; Contains: RecName: Full=ADP/ATP translocase 3, N-terminally 
processed [Homo sapiens]
 gb|AAG01998.1| similar to bovine ADP/ATP translocase T1 mRNA with GenBank Accession 
Number M24102.1 [Homo sapiens]
 gb|AAH07295.1| Solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 6 [Homo sapiens]
 gb|AAH07850.1| Solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 6 [Homo sapiens]
 gb|AAH08737.1| Solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 6 [Homo sapiens]
 gb|AAH08935.1| Solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 6 [Homo sapiens]
 gb|AAH31912.1| Solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 6 [Homo sapiens]
 emb|CAG33681.1| SLC25A6 [Homo sapiens]
 dbj|BAE91533.1| unnamed protein product [Macaca fascicularis]
 gb|EAW98680.1| solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 6 [Homo sapiens]
 dbj|BAG35257.1| unnamed protein product [Homo sapiens]
 gb|AIC48265.1| SLC25A6, partial [synthetic construct]
 gb|AIC54002.1| SLC25A6, partial [synthetic construct]
Length=298

 Score =   368 bits (945),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 194/289 (67%), Positives = 232/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GIVDC+ R+PKE+G
Sbjct  7    SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +  T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK+G ER+F GL DCL K+ KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKSGTEREFRGLGDCLVKITKSDGIRGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +G+VSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI+++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYTGTVDCWRKIFRDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_007536473.1| PREDICTED: ADP/ATP translocase 2 [Erinaceus europaeus]
Length=298

 Score =   368 bits (944),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 195/291 (67%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+YKSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLVKIYKSDGLKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I   +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIFVSWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EG KAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  TDIMYTGTIDCWKKIARDEGSKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>ref|XP_005735495.1| PREDICTED: ADP/ATP translocase 2-like isoform X1 [Pundamilia 
nyererei]
Length=298

 Score =   368 bits (944),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 196/289 (68%), Positives = 232/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGISAA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGISAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKK+F    + +T+FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKKVFLDGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GA R+F+GL DCL K++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAGREFSGLGDCLVKIFKSDGLKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIVVSWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  AEIMYTGTIDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_004084342.1| PREDICTED: ADP/ATP translocase 1-like [Oryzias latipes]
Length=298

 Score =   368 bits (944),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 196/291 (67%), Positives = 234/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLTK--KYTGIVDCLTRVPKEEG  209
            +FM DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++T   +Y GI+DC+ R+PKE+G
Sbjct  7    SFMKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQITAETQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    + KT+FW++F GNLASGGAAGAT
Sbjct  67   FISFWRGNLANVIRYFPTQALNFAFKDKYKKIFLGGVDQKTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAAD+GK  AER+FTGL +C+TK++KSDG KGLY GF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADIGKGTAEREFTGLGNCITKIFKSDGLKGLYLGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG +DT K +L     T I+  +++AQ VTAA+GL+SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGCFDTAKGMLPDPKNTHIVVSWMIAQTVTAAAGLISYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GTMDC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  ADIMYKGTMDCWKKILKDEGSKAFFKGAWSNVIRGMGGAFVLVLYDEIKKF  297



>ref|NP_001120752.1| ADP/ATP translocase 3 [Ovis aries]
 gb|ACC93605.1| SLC25A6 [Ovis aries]
Length=298

 Score =   368 bits (944),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 195/289 (67%), Positives = 232/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GIVDC+ R+PKE+G
Sbjct  7    SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +  T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK+G+ER+F GL DCL K+ KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKSGSEREFRGLGDCLVKITKSDGIRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +G+VSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI K+EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYKGTVDCWRKILKDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_005472164.1| PREDICTED: ADP/ATP translocase 2-like isoform X2 [Oreochromis 
niloticus]
Length=300

 Score =   368 bits (944),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 196/291 (67%), Positives = 233/291 (80%), Gaps = 7/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGISAA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGISAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKK+F    + +T+FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKKVFLDGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F+GL +CL K++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFSGLGNCLMKIFKSDGLKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSGGK-  743
            YRA YFG YDT K +L     T I+  +++AQ VTA +GL SYP DTVRRR+MMQSG K 
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  744  ---TIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
                IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  SESEIMYTGTIDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  297



>ref|NP_001232591.1| putative solute carrier family 25 member 5 variant 1 [Taeniopygia 
guttata]
 gb|ACH44053.1| putative solute carrier family 25 member 5 variant 1 [Taeniopygia 
guttata]
Length=298

 Score =   368 bits (944),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 192/291 (66%), Positives = 236/291 (81%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+P+E+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQISADKQYKGIIDCVVRIPREQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            I +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   ILSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GA+R+F+GL DCL K+++SDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGADREFSGLGDCLVKIFRSDGLRGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIVVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY+GT+DC+ KI ++EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYSGTLDCWRKIARDEGSKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_004442317.1| PREDICTED: ADP/ATP translocase 2 [Ceratotherium simum simum]
Length=298

 Score =   368 bits (944),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 195/291 (67%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+YKSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSGGKT  746
            YRA YFG YDT K +L     T I   +++AQ VTA +GL SYP DTVRRR+MMQSG K 
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKA  246

Query  747  --IMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EG KAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  TDIMYTGTLDCWRKIARDEGPKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>ref|XP_008155059.1| PREDICTED: ADP/ATP translocase 2 [Eptesicus fuscus]
Length=298

 Score =   368 bits (944),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 194/291 (67%), Positives = 231/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + + +FW++F GNLASGGAAGAT
Sbjct  67   ALSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRAQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+YKSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLVKIYKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I   +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  TDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>gb|ACI67091.1| ADP/ATP translocase 2 [Salmo salar]
 gb|ADM15907.1| ADP/ATP translocase 2 [Salmo salar]
 emb|CDQ72367.1| unnamed protein product [Oncorhynchus mykiss]
Length=297

 Score =   368 bits (944),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/288 (68%), Positives = 228/288 (79%), Gaps = 4/288 (1%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGISAA+SKTAVAPIER+KLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGISAAISKTAVAPIERIKLLLQVQHASKQITVDKQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCPYNPKTEFWKfffgnlasggaagaTS  389
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF     K +FW++F GNLASGGAAGATS
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLDGVDKKQFWRYFAGNLASGGAAGATS  126

Query  390  LMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIAY  569
            L  VYPLDFARTRLAADVGK GA R+F GL DCL K+YK+DG KGLYQGF VSV GII Y
Sbjct  127  LCFVYPLDFARTRLAADVGKAGAGREFNGLGDCLKKIYKADGLKGLYQGFSVSVQGIIIY  186

Query  570  RACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--GK  743
            RA YFG YDT K +L      SIL  + +AQ VTA +GL SYP DTVRRR+MMQSG  G 
Sbjct  187  RASYFGVYDTAKGMLPDPKNASILVSWAIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKGG  246

Query  744  TIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
             IMY GT+DC+ KI K+EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  DIMYTGTIDCWKKIAKDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  294



>ref|XP_005045190.1| PREDICTED: ADP/ATP translocase 1 isoform X2 [Ficedula albicollis]
 ref|XP_005517719.1| PREDICTED: ADP/ATP translocase 1 [Pseudopodoces humilis]
Length=298

 Score =   368 bits (944),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 196/291 (67%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AAVSKTAVAPIERVKLLLQ Q A+ ++T  K+Y GIVDC+ R+PKE+G
Sbjct  7    SFVKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQITADKQYKGIVDCIVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            I++FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   IASFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK   ER+F+GL DC+ K++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGATEREFSGLGDCIVKIFKSDGLKGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIVVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYKGTIDCWRKIAKDEGSKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_004867369.1| PREDICTED: ADP/ATP translocase 3 isoform X2 [Heterocephalus glaber]
Length=300

 Score =   368 bits (944),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 196/291 (67%), Positives = 232/291 (80%), Gaps = 7/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GIVDC+ R+PKE+G
Sbjct  7    SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAAEKQYKGIVDCIVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +  T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK+GAER+F GL DCL K+ KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKSGAEREFKGLGDCLVKITKSDGIRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSGGK-  743
            YRA YFG YDT K +L     T I+  +++AQ VTA +G+VSYP DTVRRR+MMQSG K 
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIVVSWMIAQSVTAVAGVVSYPFDTVRRRMMMQSGRKG  246

Query  744  ---TIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
                IMY GT+DC+ KI K+EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  GESDIMYTGTIDCWRKILKDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  297



>ref|XP_008409810.1| PREDICTED: ADP/ATP translocase 1 [Poecilia reticulata]
Length=298

 Score =   367 bits (943),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 196/291 (67%), Positives = 234/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLTK--KYTGIVDCLTRVPKEEG  209
            +FM DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++T   +Y GIVDC+ R+PKE+G
Sbjct  7    SFMKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQITADMQYKGIVDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    + KT+FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKKIFLGGVDQKTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAAD+GK  AER+FTGL +C+TK+YK+DG KGLY GF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADIGKGPAEREFTGLGNCITKIYKTDGLKGLYLGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG +DT K +L     T I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGCFDTAKGMLPDPKNTHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EGG+AFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  ADIMYKGTIDCWKKILKDEGGRAFFKGAWSNVIRGMGGAFVLVLYDEIKKF  297



>ref|NP_775354.1| ADP/ATP translocase 2 [Danio rerio]
 ref|NP_001120174.1| uncharacterized protein LOC100145214 [Xenopus (Silurana) tropicalis]
 gb|AAM34660.1|AF506216_1 solute carrier family 25 member 5 protein [Danio rerio]
 gb|AAH59462.1| Solute carrier family 25 alpha, member 5 [Danio rerio]
 gb|AAQ97853.1| solute carrier family 25, member 5 [Danio rerio]
 gb|AAH65434.1| Solute carrier family 25 alpha, member 5 [Danio rerio]
 gb|AAI52235.1| Solute carrier family 25 alpha, member 5 [Danio rerio]
 gb|AAI53471.1| Solute carrier family 25 alpha, member 5 [Danio rerio]
 gb|AAI54210.1| Solute carrier family 25 alpha, member 5 [Danio rerio]
 gb|AAI54239.1| Solute carrier family 25 alpha, member 5 [Danio rerio]
 gb|AAI59276.1| LOC100145214 protein [Xenopus (Silurana) tropicalis]
Length=298

 Score =   367 bits (943),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 195/289 (67%), Positives = 233/289 (81%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKK+F    + +T+FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKKVFLDGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F+GL +CL K+ KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFSGLGNCLVKISKSDGIKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIVVSWMIAQSVTAVAGLASYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY+GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYSGTIDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_008419011.1| PREDICTED: ADP/ATP translocase 2 [Poecilia reticulata]
Length=369

 Score =   370 bits (949),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/289 (68%), Positives = 231/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GIVDC+ R+PKE+G
Sbjct  78   SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIVDCVVRIPKEQG  137

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    + +T+FW++F GNLASGGAAGAT
Sbjct  138  FLSFWRGNLANVIRYFPTQALNFAFKDKYKKIFLDGVDKRTQFWRYFAGNLASGGAAGAT  197

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK G ER+F GL DCL K++KSDG KGLYQGF VSV GII 
Sbjct  198  SLCFVYPLDFARTRLAADVGKAGQEREFKGLGDCLVKIFKSDGLKGLYQGFNVSVQGIII  257

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  258  YRAAYFGVYDTAKGMLPDPKNTHIVVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  317

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI ++EG KAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  318  ADIMYTGTLDCWRKIARDEGSKAFFKGAWSNVLRGMGGAFVLVLYDELK  366



>ref|XP_004076398.1| PREDICTED: ADP/ATP translocase 3-like isoform 2 [Oryzias latipes]
Length=296

 Score =   367 bits (942),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 194/287 (68%), Positives = 229/287 (80%), Gaps = 3/287 (1%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGISAA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGISAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGN+ANVIRYFPTQALNFAFKD YKK+F    + +T+FW++F GNLASGGAAGAT
Sbjct  67   ALSFWRGNMANVIRYFPTQALNFAFKDKYKKVFLDGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK G ER+F GL DCL K++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGQEREFRGLADCLKKIFKSDGLKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSGGKT  746
            YRA YFG YDT K +L     T IL  +++AQ VTA +GL SYP DTVRRR+MMQSG K 
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHILVSWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  747  IMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              Y GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  GEYFGTIDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  293



>ref|XP_007460553.1| PREDICTED: ADP/ATP translocase 3 [Lipotes vexillifer]
Length=298

 Score =   367 bits (942),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 194/289 (67%), Positives = 231/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GIVDC+ R+PKE+G
Sbjct  7    SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK++F    +   +FWK+F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDKHAQFWKYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK+GAER+F GL DCL KV KSDG +GLYQGFGVSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKSGAEREFRGLGDCLVKVTKSDGIRGLYQGFGVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +G+VSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNTHIMVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI+ +EGG+A FKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYRGTLDCWRKIFTDEGGRALFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_005149096.1| PREDICTED: ADP/ATP translocase 1 [Melopsittacus undulatus]
Length=298

 Score =   367 bits (942),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 195/291 (67%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+P+E+G
Sbjct  7    SFLKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPREQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            I +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   ILSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  +ER+FTGL DC+ K++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGASEREFTGLGDCIVKIFKSDGLKGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA SGLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIVVSWMIAQTVTAVSGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYKGTIDCWRKIAKDEGTKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_007444665.1| PREDICTED: ADP/ATP translocase 3-like [Python bivittatus]
Length=298

 Score =   367 bits (942),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 192/289 (66%), Positives = 234/289 (81%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            I +FWRGNLANVIRYFPTQALNFAFKD YK++F    +  T+FW++F GNLASGGAAGAT
Sbjct  67   ILSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKHTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GA+R+FTGL DCL K++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGADREFTGLGDCLIKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSGGKT  746
            YRA YFG YDT K +L     T I+  +++AQ VT+ +G+VSYP DTVRRR+MMQSG K 
Sbjct  187  YRAAYFGIYDTAKGMLPDPRNTHIVISWMIAQTVTSVAGVVSYPFDTVRRRMMMQSGRKA  246

Query  747  --IMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY+GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYSGTIDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_008274460.1| PREDICTED: ADP/ATP translocase 3-like [Stegastes partitus]
Length=298

 Score =   367 bits (942),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 196/289 (68%), Positives = 231/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGISAA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+P+E+G
Sbjct  7    SFAKDFLAGGISAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIMDCVVRIPREQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKKIFLDGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GA R+F GL DCL K+ KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAGREFNGLGDCLVKISKSDGIRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T IL  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHILVSWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY+GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYSGTIDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_004385246.1| PREDICTED: ADP/ATP translocase 3 [Trichechus manatus latirostris]
Length=298

 Score =   367 bits (942),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 195/289 (67%), Positives = 231/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GIVDC+ R+PKE+G
Sbjct  7    SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK+GAER+F GL DCL K+ KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKSGAEREFRGLGDCLVKITKSDGVRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +G+VSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIVISWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI K+EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYTGTVDCWRKILKDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|NP_001037840.1| adenine nucleotide translocator s254 [Takifugu rubripes]
 dbj|BAD86710.1| adenine nucleotide translocator s254 [Takifugu rubripes]
Length=299

 Score =   367 bits (942),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 194/291 (67%), Positives = 234/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +FM DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++T   +Y GI+DC+ R+PKE+G
Sbjct  7    SFMKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQITVETQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    + KT+FW++F GNLASGGAAGAT
Sbjct  67   FISFWRGNLANVIRYFPTQALNFAFKDKYKKIFLGGVDQKTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAAD+GK  AER+FTGL +C+TK++K+DG KGLY GF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADIGKGSAEREFTGLGNCITKIFKTDGLKGLYLGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG +DT K +L     T I+  +++AQ VTA +GL+SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGCFDTAKGMLPDPKNTHIIVSWMIAQTVTAVAGLISYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EGGKAFF+GA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYKGTIDCWRKILKDEGGKAFFRGAWSNVIRGMGGAFVLVLYDEIKKY  297



>ref|XP_006916188.1| PREDICTED: ADP/ATP translocase 3 [Pteropus alecto]
Length=298

 Score =   367 bits (942),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 194/289 (67%), Positives = 231/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GIVDC+ R+PKE+G
Sbjct  7    SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK++F    +  T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKHTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK+G ER+F GL DCL K+ KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKSGTEREFKGLGDCLVKITKSDGIRGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K  L     T I+  +++AQ VTA +G+VSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGKLPDPKNTHIVVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI+K+EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYTGTVDCWRKIFKDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_008851277.1| PREDICTED: ADP/ATP translocase 3 [Nannospalax galili]
Length=298

 Score =   367 bits (941),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 190/289 (66%), Positives = 235/289 (81%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++   ++Y GIVDC+ R+P+E+G
Sbjct  7    SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADQQYKGIVDCIVRIPREQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK++F    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDQRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK+G+ER+F GL DCL K+ +SDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKSGSEREFKGLGDCLVKISRSDGLRGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +G+VSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY+GT+DC+ KI+K+EGGKAFFKGA SN+ RGMG + VLV+YDE++
Sbjct  247  ADIMYSGTLDCWRKIFKDEGGKAFFKGAWSNVLRGMGGAFVLVIYDELK  295



>ref|XP_005922278.1| PREDICTED: ADP/ATP translocase 2-like isoform X2 [Haplochromis 
burtoni]
Length=300

 Score =   367 bits (942),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 196/291 (67%), Positives = 232/291 (80%), Gaps = 7/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGISAA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGISAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKK+F    + +T+FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKKVFLDGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GA R+F+GL DCL K++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAGREFSGLGDCLVKIFKSDGLKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSGGK-  743
            YRA YFG YDT K +L     T I+  +++AQ VTA +GL SYP DTVRRR+MMQSG K 
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  744  ---TIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
                IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  GESEIMYTGTIDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  297



>gb|ACO09182.1| ADP/ATP translocase 2 [Osmerus mordax]
Length=298

 Score =   367 bits (941),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 195/289 (67%), Positives = 231/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLTK--KYTGIVDCLTRVPKEEG  209
            +F  DF  GGISAA+SKTAVAPIERVKLLLQ Q A+ ++T   +Y GI+DC+TR+PKE+G
Sbjct  7    SFAKDFLAGGISAAISKTAVAPIERVKLLLQVQHASKQITADMQYKGIMDCVTRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKK+F    + +T+FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKKVFLDGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GA R+F GL DCL K+++SDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAGREFNGLGDCLAKIFRSDGLKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L      +IL  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNATILVSWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYTGTIDCWKKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_006892713.1| PREDICTED: ADP/ATP translocase 2-like [Elephantulus edwardii]
Length=298

 Score =   367 bits (941),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 195/291 (67%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+ KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLVKISKSDGIRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIIISWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  TDIMYIGTVDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_010774339.1| PREDICTED: ADP/ATP translocase 1 [Notothenia coriiceps]
Length=298

 Score =   367 bits (941),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 195/291 (67%), Positives = 234/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLTK--KYTGIVDCLTRVPKEEG  209
            +FM DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T   +Y GI+DC+ R+P+E+G
Sbjct  7    SFMKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADMQYKGIMDCIRRIPQEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKK+F    + KT+FW++F GNLASGGAAGAT
Sbjct  67   FISFWRGNLANVIRYFPTQALNFAFKDKYKKVFLGGVDQKTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAAD+GK  A R+FTGL +CLTKV+KSDG+KGLY GF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADIGKGAAGREFTGLGNCLTKVFKSDGFKGLYLGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG +DT K +L     T I+  + +AQ VTA +G++SYPLDTVRRR+MMQSG  G
Sbjct  187  YRAAYFGCFDTAKGMLPDPKNTHIVVTWAIAQTVTAVAGIISYPLDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GTMDC+ KI K+EGGKAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYTGTMDCWRKILKDEGGKAFFKGAWSNVIRGMGGAFVLVLYDEIKKY  297



>ref|XP_006904765.1| PREDICTED: ADP/ATP translocase 2-like [Pteropus alecto]
 gb|ELK18868.1| ADP/ATP translocase 2 [Pteropus alecto]
Length=298

 Score =   367 bits (941),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 193/291 (66%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+YKSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLVKIYKSDGIRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I   +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EG KAFFKGA SN+ RGMG + VL+LYDE++ +
Sbjct  247  TDIMYTGTLDCWRKIARDEGSKAFFKGAWSNVLRGMGGAFVLLLYDEIKKF  297



>ref|XP_004712804.1| PREDICTED: ADP/ATP translocase 2-like, partial [Echinops telfairi]
Length=296

 Score =   367 bits (941),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 193/291 (66%), Positives = 230/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  5    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  64

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGA GAT
Sbjct  65   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGATGAT  124

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+ KSDG +GLYQGF VSV GII 
Sbjct  125  SLCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLVKITKSDGIRGLYQGFNVSVQGIII  184

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I   +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  185  YRAAYFGIYDTAKGMLPDPKNTHIFVSWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  244

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  245  TDIMYTGTLDCWRKIARDEGSKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  295



>ref|XP_007227925.1| PREDICTED: ADP/ATP translocase 2-like [Astyanax mexicanus]
Length=298

 Score =   367 bits (941),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 192/291 (66%), Positives = 234/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQISADKQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
             ++FWRGNLANVIRYFPTQALNFAFKD YK+IF    +  T+FW++F GNLASGGAAGAT
Sbjct  67   FASFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK G+ R+F+GL DCL+K++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGSTREFSGLGDCLSKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +G+VSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNTHIMVSWMIAQSVTAVAGVVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE + Y
Sbjct  247  ADIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEFKKY  297



>dbj|BAA36506.1| ADP/ATP translocase [Glandirana rugosa]
 dbj|BAA36511.1| ADP/ATP translocase [Glandirana rugosa]
 dbj|BAA36512.1| ADP/ATP translocase [Glandirana rugosa]
 dbj|BAA36513.1| ADP/ATP translocase [Glandirana rugosa]
Length=298

 Score =   367 bits (941),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 193/291 (66%), Positives = 231/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   FVSFWRGNLANVIRYFPTQALNFAFKDKYKKIFLDNVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GA+R+F GL DCL K++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGADREFKGLGDCLAKIFKSDGLKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I   +++AQ VTA +G  SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQTVTAVAGFASYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY+GT+DC+ KI ++EG +AFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  AEIMYSGTIDCWKKIARDEGSRAFFKGAWSNVLRGMGGAFVLVLYDELKKY  297



>ref|NP_001006443.1| ADP/ATP translocase 1 [Gallus gallus]
 emb|CAG31047.1| hypothetical protein RCJMB04_1n4 [Gallus gallus]
Length=298

 Score =   367 bits (941),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 194/291 (67%), Positives = 233/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            I +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   IISFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  +ER+FTGL DC+ K++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGVSEREFTGLGDCIVKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTAA+GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAAAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYKGTIDCWKKIAKDEGSKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_010743221.1| PREDICTED: ADP/ATP translocase 1 [Larimichthys crocea]
Length=298

 Score =   366 bits (940),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 193/291 (66%), Positives = 235/291 (81%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLTK--KYTGIVDCLTRVPKEEG  209
            +FM DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T   +Y GI+DC+ R+PKE+G
Sbjct  7    SFMKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITAEMQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    + KT+FW++F GNLASGGAAGAT
Sbjct  67   FISFWRGNLANVIRYFPTQALNFAFKDKYKKIFLGGVDQKTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAAD+GK  +ER+FTGL +CLTK++K+DG +GLY GF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADIGKGASEREFTGLGNCLTKIFKTDGLRGLYLGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG +DT K +L     T I+  +++AQ VTAA+G+VSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGCFDTAKGMLPDPKNTHIVVSWMIAQTVTAAAGIVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EGGKAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  ADIMYKGTIDCWRKILKDEGGKAFFKGAWSNVIRGMGGAFVLVLYDEIKKF  297



>gb|ACI69327.1| ADP/ATP translocase 2 [Salmo salar]
Length=297

 Score =   366 bits (940),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 196/288 (68%), Positives = 228/288 (79%), Gaps = 4/288 (1%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGISAA+SKTAVAPIER+KLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFGKDFLAGGISAAISKTAVAPIERIKLLLQVQHASKQITVDKQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCPYNPKTEFWKfffgnlasggaagaTS  389
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF     K +FW++F GNLASGGAAGATS
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLDGVDKKQFWRYFAGNLASGGAAGATS  126

Query  390  LMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIAY  569
            L  VYPLDFARTRLAADVGK GA R+F GL DCL K+YK+DG KGLYQGF VSV GII Y
Sbjct  127  LCFVYPLDFARTRLAADVGKAGAGREFNGLGDCLKKIYKADGLKGLYQGFSVSVQGIIIY  186

Query  570  RACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--GK  743
            RA YFG YDT K +L      SIL  + +AQ VTA +G  SYP DTVRRR+MMQSG  G 
Sbjct  187  RASYFGVYDTAKGMLPDPKNASILVSWAIAQSVTAVAGFTSYPFDTVRRRMMMQSGRKGG  246

Query  744  TIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
             IMY GT+DC+ KI ++EGGKAFFKGA SN+FRGMG + VLVLYDE++
Sbjct  247  DIMYTGTIDCWKKIARDEGGKAFFKGAWSNVFRGMGGAFVLVLYDELK  294



>ref|XP_005526257.1| PREDICTED: ADP/ATP translocase 2 [Pseudopodoces humilis]
Length=298

 Score =   366 bits (940),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 191/291 (66%), Positives = 235/291 (81%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+P+E+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQISADKQYKGIIDCVVRIPREQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            I +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   ILSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK G +R+F+GL DCL K+++SDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGTDREFSGLGDCLVKIFRSDGLRGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIVVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY+GT+DC+ KI ++EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYSGTLDCWRKIARDEGSKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_005735496.1| PREDICTED: ADP/ATP translocase 2-like isoform X2 [Pundamilia 
nyererei]
Length=300

 Score =   366 bits (940),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 196/291 (67%), Positives = 232/291 (80%), Gaps = 7/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGISAA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGISAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKK+F    + +T+FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKKVFLDGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GA R+F+GL DCL K++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAGREFSGLGDCLVKIFKSDGLKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSGGK-  743
            YRA YFG YDT K +L     T I+  +++AQ VTA +GL SYP DTVRRR+MMQSG K 
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIVVSWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  744  ---TIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
                IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  GESEIMYTGTIDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  297



>ref|XP_004614519.1| PREDICTED: ADP/ATP translocase 2 [Sorex araneus]
Length=298

 Score =   366 bits (939),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 195/291 (67%), Positives = 231/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+ KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLVKISKSDGIKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I   +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIFVSWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  TDIMYTGTIDCWRKIARDEGTKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_006872184.1| PREDICTED: ADP/ATP translocase 2-like [Chrysochloris asiatica]
Length=298

 Score =   366 bits (939),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 195/291 (67%), Positives = 231/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+ KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLVKISKSDGIKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I   +++AQ VTA +GL SYP DTV RR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIFVSWMIAQSVTAVAGLTSYPFDTVGRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  TDIMYTGTVDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_003221677.1| PREDICTED: ADP/ATP translocase 1 [Anolis carolinensis]
Length=298

 Score =   366 bits (939),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 195/291 (67%), Positives = 231/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++T   +Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASQQITAANQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            I +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   IISFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  +ERQFTGL +C+ K+YKSDG KGLY GF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGASERQFTGLGNCIAKIYKSDGLKGLYLGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EGGKAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYKGTIDCWKKIAKDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>gb|ACH71014.1| solute carrier family 25-1 [Salmo salar]
 gb|ACI67623.1| ADP/ATP translocase 2 [Salmo salar]
 gb|ACN10101.1| ADP/ATP translocase 2 [Salmo salar]
 gb|ACN12449.1| ADP/ATP translocase 2 [Salmo salar]
 emb|CDQ77105.1| unnamed protein product [Oncorhynchus mykiss]
Length=297

 Score =   366 bits (939),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 196/288 (68%), Positives = 228/288 (79%), Gaps = 4/288 (1%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGISAA+SKTAVAPIER+KLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFGKDFLAGGISAAISKTAVAPIERIKLLLQVQHASKQITVDKQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCPYNPKTEFWKfffgnlasggaagaTS  389
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF     K +FW++F GNLASGGAAGATS
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLDGVDKKQFWRYFAGNLASGGAAGATS  126

Query  390  LMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIAY  569
            L  VYPLDFARTRLAADVGK GA R+F GL DCL K+YK+DG KGLYQGF VSV GII Y
Sbjct  127  LCFVYPLDFARTRLAADVGKAGAGREFNGLGDCLKKIYKADGLKGLYQGFSVSVQGIIIY  186

Query  570  RACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--GK  743
            RA YFG YDT K +L      SIL  + +AQ VTA +GL SYP DTVRRR+MMQSG  G 
Sbjct  187  RASYFGVYDTAKGMLPDPKNASILVSWAIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKGG  246

Query  744  TIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
             IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  DIMYTGTIDCWKKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  294



>ref|XP_008851805.1| PREDICTED: ADP/ATP translocase 1 [Nannospalax galili]
Length=298

 Score =   366 bits (939),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 195/291 (67%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AAVSKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFVKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  A+R+F+GL DCLTK++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGSAQREFSGLGDCLTKIFKSDGLKGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYTGTLDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|NP_001232594.1| putative solute carrier family 25 member 6 variant 1 [Taeniopygia 
guttata]
 gb|ACH44054.1| putative solute carrier family 25 member 6 variant 1 [Taeniopygia 
guttata]
Length=298

 Score =   366 bits (939),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 191/289 (66%), Positives = 233/289 (81%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK++F    +  T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKHTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GA+R+F+GL DCL K+ KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGADREFSGLGDCLVKITKSDGVRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +G+VSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPQNTHIVISWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY+GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE +
Sbjct  247  ADIMYSGTIDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEFK  295



>ref|XP_008285023.1| PREDICTED: ADP/ATP translocase 1 [Stegastes partitus]
Length=299

 Score =   366 bits (939),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 194/291 (67%), Positives = 234/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLTK--KYTGIVDCLTRVPKEEG  209
            +FM DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++T   +Y GI+DC+ R+PKE+G
Sbjct  7    SFMKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQITAEMQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    + KT+FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKKIFLGGVDQKTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAAD+GK  AER+FTGL +C+TK++K+DG KGLY GF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADIGKGTAEREFTGLGNCITKIFKTDGLKGLYLGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG +DT K +L     T I+  +++AQ VTAA+GL+SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGCFDTAKGMLPDPKNTHIVVSWMIAQTVTAAAGLISYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  ADIMYKGTIDCWRKILKDEGSKAFFKGAWSNVIRGMGGAFVLVLYDEIKKF  297



>ref|XP_007517722.1| PREDICTED: ADP/ATP translocase 1 [Erinaceus europaeus]
Length=298

 Score =   365 bits (938),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 194/291 (67%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AAVSKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFVKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCIVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FVSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  A+R+F GL DCLTK++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGSAQREFNGLGDCLTKIFKSDGLKGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY+GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYSGTVDCWKKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_004379870.1| PREDICTED: ADP/ATP translocase 2 [Trichechus manatus latirostris]
Length=298

 Score =   365 bits (938),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 193/291 (66%), Positives = 231/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNL NVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLVNVIRYFPTQALNFAFKDKYKEIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  AER+F GL DCL K+YKSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAAAEREFRGLGDCLLKIYKSDGIKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I   +L+AQ VT+ +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRATYFGVYDTAKGMLPDPKNTHIFISWLIAQTVTSVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EGG+AFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  TDIMYTGTIDCWRKIARDEGGRAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>ref|XP_010903992.1| PREDICTED: ADP/ATP translocase 3 [Esox lucius]
Length=299

 Score =   365 bits (938),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 200/299 (67%), Positives = 233/299 (78%), Gaps = 9/299 (3%)
 Frame = +3

Query  6    MSEGSEVKTGNFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVD  179
            M+EG+     +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GIVD
Sbjct  1    MAEGAI----SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITVDKQYKGIVD  56

Query  180  CLTRVPKEEGISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgn  356
            C  R+PKE+G  AFWRGN ANVIRYFPTQALNFAFKD YK+IF    +  T+FW++F GN
Sbjct  57   CFVRIPKEQGFIAFWRGNTANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGN  116

Query  357  lasggaagaTSLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQG  536
            LASGGAAGATSL  VYPLDFARTRLAADVGK G  R+FTGLVDC+ KV KSDG KGLYQG
Sbjct  117  LASGGAAGATSLCFVYPLDFARTRLAADVGKAGDTREFTGLVDCIKKVSKSDGMKGLYQG  176

Query  537  FGVSVLGIIAYRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRR  716
            FGVSV GII YRA YFG YDT K +L     T I+  + +AQ VTA +G+VSYP DTVRR
Sbjct  177  FGVSVQGIIIYRASYFGVYDTAKGMLPDPKNTHIVISWAIAQTVTAVAGVVSYPFDTVRR  236

Query  717  RLMMQSG--GKTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
            R+MMQSG  G  IMY GT+DC+ KI ++EG KAFFKGALSN+ RGMG + VLVLYDE +
Sbjct  237  RMMMQSGRKGADIMYTGTLDCWRKIARDEGPKAFFKGALSNVLRGMGGAFVLVLYDEFK  295



>ref|XP_005151465.1| PREDICTED: ADP/ATP translocase 3 [Melopsittacus undulatus]
 ref|XP_005516555.1| PREDICTED: ADP/ATP translocase 3 [Pseudopodoces humilis]
 gb|ACH44055.1| putative solute carrier family 25 member 6 variant 1 [Taeniopygia 
guttata]
Length=298

 Score =   365 bits (938),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 191/289 (66%), Positives = 233/289 (81%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK++F    +  T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKHTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GA+R+F+GL DCL K+ KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGADREFSGLGDCLVKITKSDGVRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +G+VSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPRNTHIVISWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY+GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE +
Sbjct  247  ADIMYSGTIDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEFK  295



>dbj|BAA36508.1| ADP/ATP translocase [Glandirana rugosa]
 dbj|BAA36509.1| ADP/ATP translocase [Glandirana rugosa]
 dbj|BAA36510.1| ADP/ATP translocase [Glandirana rugosa]
Length=298

 Score =   365 bits (938),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 192/291 (66%), Positives = 231/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   FVSFWRGNLANVIRYFPTQALNFAFKDKYKKIFLDNVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GA+R+F GL DCL K+++SDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGADREFKGLGDCLAKIFRSDGLKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I   +++AQ VTA +G  SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQTVTAVAGFASYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY+GT+DC+ KI ++EG +AFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  AEIMYSGTIDCWKKIARDEGSRAFFKGAWSNVLRGMGGAFVLVLYDELKKY  297



>ref|NP_989562.2| ADP/ATP translocase 3 [Gallus gallus]
 emb|CAG31426.1| hypothetical protein RCJMB04_6e4 [Gallus gallus]
Length=298

 Score =   365 bits (938),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 191/289 (66%), Positives = 233/289 (81%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK++F    +  T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKHTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GA+R+F+GL DCL K+ KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGADREFSGLGDCLVKITKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +G+VSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPRNTHIVISWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY+GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE +
Sbjct  247  ADIMYSGTIDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEFK  295



>ref|NP_988913.1| adenine nucleotide translocase [Xenopus (Silurana) tropicalis]
 gb|AAH59739.1| adenine nucleotide translocase [Xenopus (Silurana) tropicalis]
 emb|CAJ82402.1| slc25a5 [Xenopus (Silurana) tropicalis]
 emb|CAJ82932.1| slc25a5 [Xenopus (Silurana) tropicalis]
Length=298

 Score =   365 bits (938),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 194/291 (67%), Positives = 230/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKHYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    + KT+FW++F GNLASGGAAGAT
Sbjct  67   FMSFWRGNLANVIRYFPTQALNFAFKDKYKKIFLDNVDKKTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  AER+F GL DCL K+ +SDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGNAEREFKGLGDCLVKISRSDGIKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +G VSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIIISWMIAQTVTAVAGFVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY+GT+DC+ KI ++EG +AFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYSGTIDCWRKIARDEGSRAFFKGAWSNVLRGMGGAFVLVLYDELKKY  297



>ref|XP_004073178.1| PREDICTED: ADP/ATP translocase 2-like [Oryzias latipes]
Length=298

 Score =   365 bits (938),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 196/289 (68%), Positives = 231/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ +++  K+Y GIVDC+ R+PKE+G
Sbjct  7    SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQISVDKQYKGIVDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   FISFWRGNLANVIRYFPTQALNFAFKDKYKKIFLDGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGKTG  R+F GL DCL K++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKTGQGREFKGLGDCLAKIFKSDGLKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I   +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNTHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT++C+ KI ++EG KAFFKGALSN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYTGTINCWRKIARDEGPKAFFKGALSNVLRGMGGAFVLVLYDELK  295



>ref|XP_006003932.1| PREDICTED: ADP/ATP translocase 2 [Latimeria chalumnae]
Length=298

 Score =   365 bits (938),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 192/291 (66%), Positives = 231/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++   ++Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQIAVDQQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFC-PYNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   ALSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGNVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GA+R+FTGL DCL K+++SDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGADREFTGLGDCLAKIFRSDGLKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPQNTHIIVSWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EG KAFFKGA SN+ RGMG + VLVLYDE + Y
Sbjct  247  AEIMYTGTLDCWRKIARDEGSKAFFKGAWSNVLRGMGGAFVLVLYDEFKKY  297



>ref|NP_001037838.1| adenine nucleotide translocator s6 [Takifugu rubripes]
 dbj|BAD86709.1| adenine nucleotide translocator s6 [Takifugu rubripes]
Length=298

 Score =   365 bits (938),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 196/289 (68%), Positives = 229/289 (79%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGISAA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGISAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFK  YKKIF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKGKYKKIFLDGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GA R+F GL DCL K+ KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAGREFNGLGDCLVKISKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T IL  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHILVSWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  AEIMYTGTIDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_010567246.1| PREDICTED: ADP/ATP translocase 2 [Haliaeetus leucocephalus]
Length=298

 Score =   365 bits (937),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 190/291 (65%), Positives = 234/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GI+DC+ R+P+E+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIIDCVVRIPREQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GA+R+F+GL DCL K+++SDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGADREFSGLGDCLVKIFRSDGLRGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY+GT+DC+ KI ++EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYSGTIDCWRKIARDEGSKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>gb|EFX66452.1| hypothetical protein DAPPUDRAFT_302682 [Daphnia pulex]
Length=302

 Score =   365 bits (938),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 196/290 (68%), Positives = 230/290 (79%), Gaps = 5/290 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG+SAAVSKTAVAPIERVKLLLQ Q A+ ++T  K+Y GIVD   R+PKE+G
Sbjct  10   SFAKDFIAGGVSAAVSKTAVAPIERVKLLLQVQHASKQITADKQYKGIVDAFVRIPKEQG  69

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            ++AFWRGNLANVIRYFPTQALNFAFKD YK IF    + KT+FW +F  NLASGGAAGAT
Sbjct  70   MTAFWRGNLANVIRYFPTQALNFAFKDVYKNIFMKGVDKKTQFWAWFAANLASGGAAGAT  129

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRL ADVGK  AER+++GLV+CLTK  K+DG  GLY+GF VSV GII 
Sbjct  130  SLCFVYPLDFARTRLGADVGKGAAEREYSGLVNCLTKTVKTDGLVGLYRGFNVSVQGIII  189

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YD+   +L    KT +L K+++AQVVT ASG++SYP DTVRRR+MMQSG   
Sbjct  190  YRAAYFGLYDSASGMLPDPKKTPLLIKWMIAQVVTTASGIISYPFDTVRRRMMMQSGRAK  249

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQA  890
              IMY  T+DC+AKIYK EGGKAFFKGALSN+ RG G +LVLV YDE++A
Sbjct  250  ADIMYKNTIDCWAKIYKAEGGKAFFKGALSNVLRGTGGALVLVFYDEVKA  299



>ref|XP_005329274.1| PREDICTED: ADP/ATP translocase 1 [Ictidomys tridecemlineatus]
Length=298

 Score =   365 bits (937),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 193/291 (66%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AAVSKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASQQISAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK   +R+F+GL +CLTK++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGAHQREFSGLGNCLTKIFKSDGLKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EGGKAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYTGTIDCWKKIAKDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>gb|AAH14775.1| Solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 6 [Homo sapiens]
 gb|ABM82404.1| solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 6 [synthetic construct]
 gb|ABM85593.1| solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 6 [synthetic construct]
 gb|AIC54003.1| SLC25A6, partial [synthetic construct]
Length=298

 Score =   365 bits (937),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 193/289 (67%), Positives = 231/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GIVDC+ R+PKE+G
Sbjct  7    SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +  T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK+G ER+F GL DCL K+ KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKSGTEREFRGLGDCLVKITKSDGIRGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +G+VSYP DTVRRR+MMQ G  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQFGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI+++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYTGTVDCWRKIFRDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_006735085.1| PREDICTED: ADP/ATP translocase 1 [Leptonychotes weddellii]
Length=298

 Score =   365 bits (937),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 193/291 (66%), Positives = 233/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AAVSKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASQQISAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  A+R+F+GL DCLTK++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGAAQREFSGLGDCLTKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY+GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYSGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>dbj|BAA36507.1| ADP/ATP translocase [Glandirana rugosa]
Length=298

 Score =   365 bits (937),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 192/291 (66%), Positives = 231/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   FVSFWRGNLANVIRYFPTQALNFAFKDKYKKIFLDNVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GA+R+F GL DCL K+++SDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGADREFKGLGDCLAKIFRSDGLKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I   +++AQ VTA +G  SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGFASYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY+GT+DC+ KI ++EG +AFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  AEIMYSGTIDCWKKIARDEGSRAFFKGAWSNVLRGMGGAFVLVLYDELKKY  297



>ref|XP_004579066.1| PREDICTED: ADP/ATP translocase 1 [Ochotona princeps]
 ref|XP_004757791.1| PREDICTED: ADP/ATP translocase 1 [Mustela putorius furo]
 ref|XP_004794177.1| PREDICTED: ADP/ATP translocase 1 [Mustela putorius furo]
Length=298

 Score =   365 bits (937),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 194/291 (67%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AAVSKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  ++R+F+GL DCLTK++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGASQREFSGLGDCLTKIFKSDGLKGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_010568310.1| PREDICTED: ADP/ATP translocase 1 [Haliaeetus leucocephalus]
Length=298

 Score =   365 bits (937),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 193/291 (66%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITAEKQYKGIIDCIVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            I +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   IISFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  +ER+FTGL DC+ K++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGVSEREFTGLGDCIIKIFKSDGLRGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIVVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYKGTIDCWKKIAKDEGSKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_008302071.1| PREDICTED: ADP/ATP translocase 2 [Stegastes partitus]
Length=298

 Score =   365 bits (937),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 195/289 (67%), Positives = 229/289 (79%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++   ++Y GIVDC+ R+PKE+G
Sbjct  7    SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADQQYKGIVDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKKIFLDGVDKHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+ KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLVKISKSDGIKGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIVVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY+GT+DC+ KI ++EG KAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYSGTIDCWKKIARDEGSKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_004412790.1| PREDICTED: ADP/ATP translocase 1 [Odobenus rosmarus divergens]
Length=298

 Score =   365 bits (937),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 194/291 (67%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AAVSKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKEIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  A+R+F+GL DCLTK++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGAAQREFSGLGDCLTKIFKSDGLKGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYAGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>dbj|BAC75536.1| ADP/ATP translocase [Glandirana rugosa]
Length=290

 Score =   365 bits (936),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 192/287 (67%), Positives = 229/287 (80%), Gaps = 5/287 (2%)
 Frame = +3

Query  48   DFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEGISAF  221
            DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G  +F
Sbjct  3    DFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIMDCVVRIPKEQGFVSF  62

Query  222  WRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaTSLMV  398
            WRGNLANVIRYFPTQALNFAFKD YKKIF    + +T+FW++F GNLASGGAAGATSL  
Sbjct  63   WRGNLANVIRYFPTQALNFAFKDKYKKIFLDNVDKRTQFWRYFAGNLASGGAAGATSLCF  122

Query  399  VYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIAYRAC  578
            VYPLDFARTRLAADVGK GA+R+F GL DCL K++KSDG KGLYQGF VSV GII YRA 
Sbjct  123  VYPLDFARTRLAADVGKAGADREFKGLGDCLAKIFKSDGLKGLYQGFNVSVQGIIIYRAA  182

Query  579  YFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--GKTIM  752
            YFG YDT K +L     T I   +++AQ VTA +G  SYP DTVRRR+MMQSG  G  IM
Sbjct  183  YFGIYDTAKGMLPDPKNTHIFISWMIAQTVTAVAGFASYPFDTVRRRMMMQSGRKGAEIM  242

Query  753  YNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
            Y+GT+DC+ KI ++EG +AFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  243  YSGTIDCWKKIARDEGSRAFFKGAWSNVLRGMGGAFVLVLYDELKKY  289



>ref|XP_006277426.1| PREDICTED: ADP/ATP translocase 2 [Alligator mississippiensis]
Length=298

 Score =   365 bits (936),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 192/291 (66%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+P+E+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITVEKQYKGIIDCVVRIPREQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFRGLGDCLVKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSGGKT  746
            YRA YFG YDT K +L     T I   +++AQ VTA +GL SYP DTVRRR+MMQSG K 
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNTHIFISWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKA  246

Query  747  --IMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
               MY+GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  ADXMYSGTIDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>ref|XP_004281779.1| PREDICTED: ADP/ATP translocase 1 [Orcinus orca]
 ref|XP_004316486.1| PREDICTED: LOW QUALITY PROTEIN: ADP/ATP translocase 1 [Tursiops 
truncatus]
 ref|XP_007466585.1| PREDICTED: ADP/ATP translocase 1 [Lipotes vexillifer]
Length=298

 Score =   364 bits (935),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 192/291 (66%), Positives = 234/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASQQISAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  A+R+FTGL +CLTK++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGAAQREFTGLGNCLTKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY+GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYSGTVDCWRKIAKDEGPKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_007946558.1| PREDICTED: ADP/ATP translocase 1 [Orycteropus afer afer]
Length=298

 Score =   364 bits (935),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 193/291 (66%), Positives = 233/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AAVSKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  A+R+FTGL +C+TK++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGAAQREFTGLGNCITKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EGGKAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYTGTIDCWRKIAKDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_004610414.1| PREDICTED: ADP/ATP translocase 1 [Sorex araneus]
Length=298

 Score =   364 bits (935),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 194/291 (67%), Positives = 233/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AAVSKTAVAPIERVKLLLQ Q A+ +++  K+Y GIVDC+ R+PKE+G
Sbjct  7    SFVKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIVDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
             ++FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FASFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  A+R+F+GL DCL+K++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGSAQREFSGLGDCLSKIFKSDGLKGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC++KI K+EG  AFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYTGTLDCWSKIAKDEGVNAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_007423762.1| PREDICTED: ADP/ATP translocase 1 [Python bivittatus]
Length=298

 Score =   364 bits (935),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 194/291 (67%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASQQITAEKQYKGIIDCVIRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            I +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + + +FW++F GNLASGGAAGAT
Sbjct  67   IISFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK   ERQFTGL +C+ K+YKSDG +GLY GF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGLNERQFTGLGNCIAKIYKSDGLRGLYLGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIISWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EGGKAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  ADIMYKGTIDCWKKIAKDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>gb|ACN11489.1| ADP/ATP translocase 2 [Salmo salar]
Length=314

 Score =   365 bits (937),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 196/288 (68%), Positives = 228/288 (79%), Gaps = 4/288 (1%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGISAA+SKTAVAPIER+KLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFGKDFLAGGISAAISKTAVAPIERIKLLLQVQHASKQITVDKQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCPYNPKTEFWKfffgnlasggaagaTS  389
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF     K +FW++F GNLASGGAAGATS
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLDGVDKKQFWRYFAGNLASGGAAGATS  126

Query  390  LMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIAY  569
            L  VYPLDFARTRLAADVGK GA R+F GL DCL K+YK+DG KGLYQGF VSV GII Y
Sbjct  127  LCFVYPLDFARTRLAADVGKAGAGREFNGLGDCLKKIYKADGLKGLYQGFSVSVQGIIIY  186

Query  570  RACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--GK  743
            RA YFG YDT K +L      SIL  + +AQ VTA +GL SYP DTVRRR+MMQSG  G 
Sbjct  187  RASYFGVYDTAKGMLPDPKNASILVSWAIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKGG  246

Query  744  TIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
             IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  DIMYTGTIDCWKKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  294



>ref|XP_007951536.1| PREDICTED: ADP/ATP translocase 2 [Orycteropus afer afer]
Length=298

 Score =   364 bits (935),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 193/291 (66%), Positives = 231/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+  +PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVHIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FW GNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWCGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+YKSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFRGLGDCLIKIYKSDGIRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I   +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  TDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>ref|XP_006916442.1| PREDICTED: ADP/ATP translocase 1 [Pteropus alecto]
 gb|ELK08835.1| ADP/ATP translocase 1 [Pteropus alecto]
Length=298

 Score =   364 bits (935),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 194/291 (67%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AAVSKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFVKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  ++R+F+GL DCLTK++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGASQREFSGLGDCLTKIFKSDGLKGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_005362637.1| PREDICTED: ADP/ATP translocase 1 [Microtus ochrogaster]
Length=298

 Score =   364 bits (935),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 193/291 (66%), Positives = 231/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AAVSKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  A+R+F+GL DCL+K++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGSAQREFSGLFDCLSKIFKSDGVKGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG  AFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYTGTLDCWRKIAKDEGANAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_007177934.1| PREDICTED: ADP/ATP translocase 1 [Balaenoptera acutorostrata 
scammoni]
Length=298

 Score =   364 bits (935),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 192/291 (66%), Positives = 234/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  A+R+FTGL +CLTK++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGAAQREFTGLGNCLTKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY+GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYSGTVDCWRKIAKDEGPKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_010744890.1| PREDICTED: ADP/ATP translocase 3 [Larimichthys crocea]
Length=298

 Score =   364 bits (935),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 194/289 (67%), Positives = 230/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQISVDKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    + + +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKKIFLDGVDKRKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK G  R+F GL DCL K+ KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGGSREFKGLGDCLVKITKSDGIKGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNTHIVVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY+GT+DC+ KI ++EG KAFFKGALSN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYSGTIDCWRKIARDEGSKAFFKGALSNVLRGMGGAFVLVLYDELK  295



>ref|XP_005282046.1| PREDICTED: ADP/ATP translocase 1 [Chrysemys picta bellii]
Length=298

 Score =   364 bits (935),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 192/291 (66%), Positives = 234/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASQQITVDKQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            I +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   IISFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  +ERQFTGL +C++K++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGMSERQFTGLGNCISKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K ++       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMMPDPKNVHIVVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EGGKAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  ADIMYKGTIDCWKKIAKDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>dbj|BAC75538.1| ADP/ATP translocase [Glandirana rugosa]
 dbj|BAC75539.1| ADP/ATP translocase [Glandirana rugosa]
Length=290

 Score =   363 bits (933),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 191/287 (67%), Positives = 229/287 (80%), Gaps = 5/287 (2%)
 Frame = +3

Query  48   DFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEGISAF  221
            DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G  +F
Sbjct  3    DFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIMDCVVRIPKEQGFVSF  62

Query  222  WRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaTSLMV  398
            WRGNLANVIRYFPTQALNFAFKD YKKIF    + +T+FW++F GNLASGGAAGATSL  
Sbjct  63   WRGNLANVIRYFPTQALNFAFKDKYKKIFLDNVDKRTQFWRYFAGNLASGGAAGATSLCF  122

Query  399  VYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIAYRAC  578
            VYPLDFARTRLAADVGK GA+R+F GL DCL K+++SDG KGLYQGF VSV GII YRA 
Sbjct  123  VYPLDFARTRLAADVGKAGADREFKGLGDCLAKIFRSDGLKGLYQGFNVSVQGIIIYRAA  182

Query  579  YFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--GKTIM  752
            YFG YDT K +L     T I   +++AQ VTA +G  SYP DTVRRR+MMQSG  G  IM
Sbjct  183  YFGIYDTAKGMLPDPKNTHIFISWMIAQTVTAVAGFASYPFDTVRRRMMMQSGRKGAEIM  242

Query  753  YNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
            Y+GT+DC+ KI ++EG +AFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  243  YSGTIDCWKKIARDEGSRAFFKGAWSNVLRGMGGAFVLVLYDELKKY  289



>ref|XP_008306472.1| PREDICTED: ADP/ATP translocase 2-like, partial [Cynoglossus semilaevis]
Length=285

 Score =   363 bits (933),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 193/281 (69%), Positives = 229/281 (81%), Gaps = 5/281 (2%)
 Frame = +3

Query  60   GGISAAVSKTAVAPIERVKLLLQTQDANAKLTK--KYTGIVDCLTRVPKEEGISAFWRGN  233
            GG++AAVSKT VAPIERVKLLLQ Q A+ ++TK  +Y GIVDC+ R+PKE+G+ +FWRGN
Sbjct  2    GGVAAAVSKTTVAPIERVKLLLQVQHASRQITKDQQYKGIVDCIVRIPKEQGVLSFWRGN  61

Query  234  LANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaTSLMVVYPL  410
            LANVIRYFPTQALNFAFKD YK +F    + +T+FW++F GNLASGGAAGATSL  VYPL
Sbjct  62   LANVIRYFPTQALNFAFKDKYKAVFLDGVDSRTQFWRYFAGNLASGGAAGATSLCFVYPL  121

Query  411  DFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIAYRACYFGG  590
            DFARTRLAADVGK GAER+F GL DCL KV++SDG KGLYQGF VSV GII YRA YFG 
Sbjct  122  DFARTRLAADVGKAGAEREFNGLGDCLIKVFQSDGLKGLYQGFNVSVQGIIIYRAAYFGI  181

Query  591  YDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--GKTIMYNGT  764
            YDT K +L     T IL  +++AQ VTA +GL SYPLDTVRRR+MMQSG  G  IMY+GT
Sbjct  182  YDTAKGMLPDPKNTPILVSWMIAQTVTAVAGLASYPLDTVRRRMMMQSGRKGADIMYSGT  241

Query  765  MDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
            +DC+ KI ++EG KAFFKGALSN+ RGMG + VLV+YDE++
Sbjct  242  IDCWRKISRDEGIKAFFKGALSNVLRGMGGAFVLVIYDELK  282



>gb|AAH60533.1| Solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 4 [Rattus norvegicus]
 gb|EDL78880.1| solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 4, isoform CRA_a [Rattus norvegicus]
Length=298

 Score =   364 bits (934),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 194/291 (67%), Positives = 231/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AAVSKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  ++R+F GL DCLTK++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGSSQREFNGLGDCLTKIFKSDGLKGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_005066726.1| PREDICTED: ADP/ATP translocase 1 [Mesocricetus auratus]
Length=298

 Score =   364 bits (934),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 194/291 (67%), Positives = 231/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AAVSKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFFKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISVEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  A+R+F+GL DCL+K++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGSAQREFSGLGDCLSKIFKSDGVKGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYTGTIDCWKKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_006876315.1| PREDICTED: ADP/ATP translocase 3 [Chrysochloris asiatica]
Length=298

 Score =   363 bits (933),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 191/289 (66%), Positives = 231/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++   ++Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADQQYKGIMDCIVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK++F    +  T+FW++F GNLASGGAAGAT
Sbjct  67   MLSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKHTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK+G ER+F GL DCL K+ KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKSGTEREFKGLGDCLVKISKSDGIRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +G+VSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+ C+ KI+K+EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYTGTLHCWRKIFKDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>emb|CAG11525.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=299

 Score =   363 bits (933),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 193/291 (66%), Positives = 233/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLTK--KYTGIVDCLTRVPKEEG  209
            +FM DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++T   +Y GI+DC+ R+PKE+G
Sbjct  7    SFMKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQITAETQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    + KT+FW++F GNLASGGAAGAT
Sbjct  67   FISFWRGNLANVIRYFPTQALNFAFKDKYKKIFLGGVDQKTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAAD+GK  AER+FTGL +C+ K++K+DG KGLY GF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADIGKGPAEREFTGLGNCIAKIFKTDGIKGLYLGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG +DT K +L     T I+  +++AQ VTA +GL+SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGCFDTAKGMLPDPKNTHIIVSWMIAQTVTAVAGLISYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EGGKAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  ADIMYKGTIDCWRKILKDEGGKAFFKGAWSNVIRGMGGAFVLVLYDEIKKF  297



>ref|XP_007891022.1| PREDICTED: ADP/ATP translocase 1 [Callorhinchus milii]
Length=298

 Score =   363 bits (933),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 193/291 (66%), Positives = 229/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLTK--KYTGIVDCLTRVPKEEG  209
            +FM DF  GG++AA+SKTAVAPIERVKLLLQ Q  + ++T   +Y GI+DC+ R+PKE+G
Sbjct  7    SFMKDFLAGGVAAAISKTAVAPIERVKLLLQVQHTSKQITAEMQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK IF    + K +FW++F GNLASGGAAGAT
Sbjct  67   FISFWRGNLANVIRYFPTQALNFAFKDKYKTIFLGGVDQKKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  +ER+FTGL +CL+K++K DG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGASEREFTGLANCLSKIFKLDGLKGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K ++       I   +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMMPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GTMDC+ KI K+EG KAFFKGALSN+ RGMG + VLVLYDE++ Y
Sbjct  247  TDIMYKGTMDCWKKIAKDEGSKAFFKGALSNVIRGMGGAFVLVLYDEIKKY  297



>gb|ADI58835.1| adenine nucleotide translocator [Chiloscyllium plagiosum]
Length=298

 Score =   363 bits (933),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 187/290 (64%), Positives = 232/290 (80%), Gaps = 4/290 (1%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++   ++Y GI+DC+ R+P+E+G
Sbjct  8    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQIAVEQQYKGIIDCVVRIPREQG  67

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCPYNPKTEFWKfffgnlasggaagaTS  389
              +FWRGNLANVIRYFPTQALNFAFKD YK++F     K +FW++F GNLASGGAAGATS
Sbjct  68   FMSFWRGNLANVIRYFPTQALNFAFKDVYKQMFLGGIDKKQFWRYFAGNLASGGAAGATS  127

Query  390  LMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIAY  569
            L  VYPLDFARTRLAADVGK+  ER+FTGL +CLTK++KSDG++GLYQGF VSV GII Y
Sbjct  128  LCFVYPLDFARTRLAADVGKSATEREFTGLGNCLTKIFKSDGFRGLYQGFNVSVQGIIIY  187

Query  570  RACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--GK  743
            RA YFG YDT K +L     T I+  +++AQ VTA +G+ SYP DTVRRR+MMQSG  G 
Sbjct  188  RAAYFGIYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGVTSYPFDTVRRRMMMQSGRKGA  247

Query  744  TIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
             IMY GT+DC+ KI+++EGG+AFFKGA SN+ RGMG + VLVLYDE + +
Sbjct  248  DIMYKGTVDCWRKIFRDEGGRAFFKGAWSNVLRGMGGAFVLVLYDEFKKF  297



>dbj|BAC75537.1| ADP/ATP translocase [Glandirana rugosa]
Length=290

 Score =   363 bits (932),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 191/287 (67%), Positives = 229/287 (80%), Gaps = 5/287 (2%)
 Frame = +3

Query  48   DFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEGISAF  221
            DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G  +F
Sbjct  3    DFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIMDCVVRIPKEQGFVSF  62

Query  222  WRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaTSLMV  398
            WRGNLANVIRYFPTQALNFAFKD YKKIF    + +T+FW++F GNLASGGAAGATSL  
Sbjct  63   WRGNLANVIRYFPTQALNFAFKDKYKKIFLDNVDKRTQFWRYFAGNLASGGAAGATSLCF  122

Query  399  VYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIAYRAC  578
            VYPLDFARTRLAADVGK GA+R+F GL DCL K+++SDG KGLYQGF VSV GII YRA 
Sbjct  123  VYPLDFARTRLAADVGKAGADREFKGLGDCLAKIFRSDGLKGLYQGFNVSVQGIIIYRAA  182

Query  579  YFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--GKTIM  752
            YFG YDT K +L     T I   +++AQ VTA +G  SYP DTVRRR+MMQSG  G  IM
Sbjct  183  YFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGFASYPFDTVRRRMMMQSGRKGAEIM  242

Query  753  YNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
            Y+GT+DC+ KI ++EG +AFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  243  YSGTIDCWKKIARDEGSRAFFKGAWSNVLRGMGGAFVLVLYDELKKY  289



>ref|XP_004853070.1| PREDICTED: ADP/ATP translocase 1 isoform X2 [Heterocephalus glaber]
Length=296

 Score =   363 bits (932),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 191/289 (66%), Positives = 229/289 (79%), Gaps = 3/289 (1%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AAVSKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQITAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK   +R+FTGL +C+TK++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGADQREFTGLGNCITKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSGGKT  746
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQ G   
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQGGESD  246

Query  747  IMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
            IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  IMYTGTIDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  295



>ref|XP_003218854.1| PREDICTED: ADP/ATP translocase 3 [Anolis carolinensis]
Length=298

 Score =   363 bits (933),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 192/289 (66%), Positives = 231/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YKKIF    +  T+FW++F GNLASGGAAGAT
Sbjct  67   MLSFWRGNLANVIRYFPTQALNFAFKDKYKKIFLGGVDKHTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK   +R+F GL DCL K++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKASGDREFKGLGDCLAKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSGGKT  746
            YRA YFG YDT K +L     T I   +++AQ VTA +G+VSYP DTVRRR+MMQSG K 
Sbjct  187  YRAAYFGIYDTAKGMLPDPRNTHIFISWMIAQSVTAVAGVVSYPFDTVRRRMMMQSGRKA  246

Query  747  --IMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY+GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  SDIMYSGTIDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_008167258.1| PREDICTED: ADP/ATP translocase 2 [Chrysemys picta bellii]
Length=298

 Score =   363 bits (932),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 192/291 (66%), Positives = 231/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++   ++Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQIAVDQQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   ALSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GA+R+F GL DCL K++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGADREFKGLGDCLVKIFKSDGLKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSGGKT  746
            YRA YFG YDT K +L     T I   +++AQ VTA +GL SYP DTVRRR+MMQSG K 
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKA  246

Query  747  --IMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY+GT+DC+ KI ++EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  TDIMYSGTIDCWRKIARDEGSKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|NP_001290700.1| ADP/ATP translocase 2 [Esox lucius]
 gb|ACO14350.1| ADP/ATP translocase 2 [Esox lucius]
Length=297

 Score =   363 bits (932),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 194/288 (67%), Positives = 227/288 (79%), Gaps = 4/288 (1%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGISAA+SKTA APIER+KLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGISAAISKTAAAPIERIKLLLQVQHASKQITVDKQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCPYNPKTEFWKfffgnlasggaagaTS  389
              +FWRGNLANVIRYFPTQALNFAFKD YK++F     K +FW++F GNLASGGAAGATS
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLDGIDKKQFWRYFAGNLASGGAAGATS  126

Query  390  LMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIAY  569
            L  VYPLDFARTRLAADVGK GA R+F GL DCL K+YK+DG KGLYQGF VSV GII Y
Sbjct  127  LCFVYPLDFARTRLAADVGKAGATREFNGLGDCLKKIYKADGLKGLYQGFSVSVQGIIIY  186

Query  570  RACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--GK  743
            RA YFG YDT K +L      SIL  + +AQ VTA +GL SYP DTVRRR+MMQSG  G 
Sbjct  187  RASYFGVYDTAKGMLPDPKNASILVSWAIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKGG  246

Query  744  TIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
             IMY GT+DC+ KI K++GGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  DIMYTGTIDCWKKIMKDKGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  294



>ref|NP_001076155.1| ADP/ATP translocase 1 [Oryctolagus cuniculus]
 ref|XP_002715967.1| PREDICTED: ADP/ATP translocase 1 [Oryctolagus cuniculus]
 sp|O46373.3|ADT1_RABIT RecName: Full=ADP/ATP translocase 1; AltName: Full=30 kDa calsequestrin-binding 
protein; Short=30 kDa CSQ-binding protein; 
AltName: Full=ADP,ATP carrier protein 1; AltName: Full=Adenine 
nucleotide translocator 1; Short=ANT 1; AltName: Full=Solute 
carrier family 25 member 4 [Oryctolagus cuniculus]
 dbj|BAA23777.1| ADP/ATP translocase [Oryctolagus cuniculus]
Length=298

 Score =   363 bits (932),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 192/291 (66%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AAVSKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  A+R+F+GL +CLTK++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGAAQREFSGLGNCLTKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYTGTVDCWKKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_003792827.1| PREDICTED: ADP/ATP translocase 1 [Otolemur garnettii]
Length=298

 Score =   363 bits (932),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 194/291 (67%), Positives = 231/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AAVSKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  A+R+FTGL +C+TK++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGAAQREFTGLGNCITKIFKSDGLKGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I   +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_008315106.1| PREDICTED: ADP/ATP translocase 1 [Cynoglossus semilaevis]
Length=299

 Score =   363 bits (932),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 193/291 (66%), Positives = 234/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +FM DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++T   +Y GI+DC+ R+PKE+G
Sbjct  7    SFMKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQITVETQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    + KT+FW++F GNLASGGAAGAT
Sbjct  67   FVSFWRGNLANVIRYFPTQALNFAFKDKYKKIFLGGVDQKTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAAD+GK  A+R+F+GL +CL+K++K+DG KGLY GF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADIGKGTAQREFSGLGNCLSKIFKTDGLKGLYLGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG +DT K +L     T I+  +++AQ VTAA+GL+SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGCFDTAKGMLPDPKNTHIVVSWMIAQTVTAAAGLISYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYKGTIDCWRKILKDEGSKAFFKGAWSNVIRGMGGAFVLVLYDEIKKY  297



>ref|XP_004666437.1| PREDICTED: ADP/ATP translocase 1 [Jaculus jaculus]
Length=298

 Score =   363 bits (932),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 193/291 (66%), Positives = 230/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AAVSKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASQQISADKQYKGIMDCIVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK++F    +   +FW++F GNLASGGAAGAT
Sbjct  67   FISFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  A+RQF GL DC+TK++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGSAQRQFNGLGDCITKIFKSDGLKGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I   +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYTGTVDCWKKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_004457853.1| PREDICTED: ADP/ATP translocase 1 [Dasypus novemcinctus]
Length=298

 Score =   363 bits (932),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 192/291 (66%), Positives = 233/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AAVSKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQITAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  A+R+F+GL +CLTK++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGAAQREFSGLGNCLTKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY+GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  ADIMYSGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>ref|NP_001279863.1| solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 4 [Callorhinchus milii]
 gb|AFK11369.1| solute carrier family 25 mitochondrial carrier [Callorhinchus 
milii]
 gb|AFM90513.1| solute carrier family 25 (mitochondrial carrier) [Callorhinchus 
milii]
Length=298

 Score =   363 bits (932),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 193/291 (66%), Positives = 229/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +FM DF  GG++AA+SKTAVAPIERVKLLLQ Q  + ++T   +Y GI+DC+ R+PKE+G
Sbjct  7    SFMKDFLAGGVAAAISKTAVAPIERVKLLLQVQHTSKQITVEMQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK IF    + K +FW++F GNLASGGAAGAT
Sbjct  67   FISFWRGNLANVIRYFPTQALNFAFKDKYKTIFLGGVDQKKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  +ER+FTGL +CL+K++K DG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGASEREFTGLANCLSKIFKLDGLKGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K ++       I   +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMMPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GTMDC+ KI K+EG KAFFKGALSN+ RGMG + VLVLYDE++ Y
Sbjct  247  TDIMYKGTMDCWKKIAKDEGSKAFFKGALSNVIRGMGGAFVLVLYDEIKKY  297



>gb|ACN10312.1| ADP/ATP translocase 2 [Salmo salar]
 gb|ACN12672.1| ADP/ATP translocase 2 [Salmo salar]
Length=297

 Score =   363 bits (932),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 194/289 (67%), Positives = 229/289 (79%), Gaps = 6/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLTK--KYTGIVDCLTRVPKEEG  209
            +F  DF  GGISAA+SKTAVAPIERVKLLLQ Q AN +++K  +Y GI+DC+TR+PKE+G
Sbjct  7    SFAKDFLAGGISAAISKTAVAPIERVKLLLQVQHANKQISKEMQYEGIIDCVTRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              AFWRGNLANVIRYFPTQALNFAFKD YK +F    + + +FW++F GNLASGGAAGAT
Sbjct  67   FLAFWRGNLANVIRYFPTQALNFAFKDKYKSVFLDGVDKRKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRL ADVGK GA R++ GL DCL K ++SDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLGADVGKAGA-REYNGLADCLAKTFRSDGMRGLYQGFAVSVQGIII  185

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     TSIL  + +AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  186  YRASYFGIYDTAKGMLPDSKNTSILVSWAIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  245

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY+GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  246  ADIMYSGTIDCWKKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  294



>ref|XP_006128548.1| PREDICTED: ADP/ATP translocase 1 [Pelodiscus sinensis]
Length=298

 Score =   363 bits (932),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 191/291 (66%), Positives = 233/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F++DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLVDFLAGGVAAAISKTAVAPIERVKLLLQVQHASQQITVEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            I +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   IISFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK   ERQFTGL +C++K++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGLNERQFTGLGNCISKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K ++       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMMPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  ADIMYKGTIDCWKKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>gb|EFB30227.1| hypothetical protein PANDA_001915 [Ailuropoda melanoleuca]
Length=288

 Score =   362 bits (930),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 193/287 (67%), Positives = 229/287 (80%), Gaps = 5/287 (2%)
 Frame = +3

Query  48   DFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEGISAF  221
            DF  GG++AAVSKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G  +F
Sbjct  1    DFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSF  60

Query  222  WRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaTSLMV  398
            WRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGATSL  
Sbjct  61   WRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGATSLCF  120

Query  399  VYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIAYRAC  578
            VYPLDFARTRLAADVGK  A+R+F+GL DCLTK++KSDG KGLYQGF VSV GII YRA 
Sbjct  121  VYPLDFARTRLAADVGKGAAQREFSGLGDCLTKIFKSDGLKGLYQGFSVSVQGIIIYRAA  180

Query  579  YFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--GKTIM  752
            YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G  IM
Sbjct  181  YFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIM  240

Query  753  YNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
            Y GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  241  YTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  287



>ref|XP_003445278.1| PREDICTED: ADP/ATP translocase 2-like [Oreochromis niloticus]
Length=298

 Score =   363 bits (931),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 192/291 (66%), Positives = 229/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAVDKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    + + +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKKIFLDGVDKRKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK G ER+F GL DCL K+++SDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGHEREFKGLGDCLVKIFRSDGLKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIIVSWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EG KAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  ADIMYTGTIDCWKKIARDEGSKAFFKGAWSNVLRGMGGAFVLVLYDELKKF  297



>ref|XP_001363393.1| PREDICTED: ADP/ATP translocase 1 [Monodelphis domestica]
Length=298

 Score =   363 bits (931),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 193/291 (66%), Positives = 230/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKL--TKKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AAVSKTAVAPIERVKLLLQ Q A+ ++   ++Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQIKAEQQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK   +R+F+GL DCLTK++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGATQREFSGLGDCLTKIFKSDGLKGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYTGTLDCWRKIAKDEGSKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_007068661.1| PREDICTED: ADP/ATP translocase 1 [Chelonia mydas]
 gb|EMP27524.1| ADP/ATP translocase 1 [Chelonia mydas]
Length=298

 Score =   363 bits (931),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 191/291 (66%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASQQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            I +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   IISFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  +ERQFTGL +C+ K++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGLSERQFTGLGNCIAKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K ++       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMMPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  ADIMYKGTIDCWKKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>ref|XP_004853069.1| PREDICTED: ADP/ATP translocase 1 isoform X1 [Heterocephalus glaber]
Length=298

 Score =   363 bits (931),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 193/291 (66%), Positives = 231/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AAVSKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQITAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK   +R+FTGL +C+TK++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGADQREFTGLGNCITKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYTGTIDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|NP_999867.1| ADP/ATP translocase 1 [Danio rerio]
 gb|AAH67329.1| Solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 4 [Danio rerio]
Length=298

 Score =   363 bits (931),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 191/291 (66%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLTK--KYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T   +Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADMQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    +  T+FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKKIFLGGVDKNTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAAD+GK  AER+FTGL +C+ K++KSDG +GLY GF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADIGKGAAEREFTGLGNCVAKIFKSDGLRGLYLGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +G++SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKHTHIVVSWMIAQTVTAVAGIISYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EGGKAFFKGALSN+ RG G + VLVLYDE++ Y
Sbjct  247  ADIMYKGTIDCWKKIAKDEGGKAFFKGALSNVIRGAGGAFVLVLYDEIKKY  297



>ref|XP_001362296.1| PREDICTED: ADP/ATP translocase 3 [Monodelphis domestica]
Length=298

 Score =   363 bits (931),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 192/289 (66%), Positives = 230/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIMDCIVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRG LANVIRYFPTQALNFAFKD YK++F    +  T+FW++F GNLASGGAAGAT
Sbjct  67   MLSFWRGTLANVIRYFPTQALNFAFKDKYKQVFLGGVDKHTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK+G ER+F GL DCL K+ KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKSGTEREFKGLGDCLVKITKSDGIRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +G+VSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIVISWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI K+EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYTGTIDCWRKIAKDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>dbj|BAC15533.1| ATP/ADP antiporter [Gallus gallus]
Length=298

 Score =   363 bits (931),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 190/289 (66%), Positives = 232/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF   G++AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLARGVAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK++F    +  T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKHTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GA+R+F+GL DCL K+ KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGADREFSGLGDCLVKITKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +G+VSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPRNTHIVISWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY+GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE +
Sbjct  247  ADIMYSGTIDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEFK  295



>ref|XP_005807195.1| PREDICTED: ADP/ATP translocase 1-like [Xiphophorus maculatus]
Length=299

 Score =   363 bits (931),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 193/291 (66%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLTK--KYTGIVDCLTRVPKEEG  209
            +FM DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++T   +Y GI+DC+ R+PKE+G
Sbjct  7    SFMKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQITADMQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    + KT+FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKKIFLGGVDQKTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAAD+GK  AER+FTGL +C+ K++K+DG KGLY GF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADIGKGTAEREFTGLGNCIGKIFKTDGLKGLYLGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG +DT K +L     T I   +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGCFDTAKGMLPDPKNTHIFVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EGG+AFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  ADIMYKGTIDCWKKILKDEGGRAFFKGAWSNVIRGMGGAFVLVLYDEIKKF  297



>ref|XP_008324945.1| PREDICTED: ADP/ATP translocase 3 [Cynoglossus semilaevis]
Length=298

 Score =   362 bits (930),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 193/289 (67%), Positives = 231/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG +AA+SKTAVAPIERVKLLLQ Q A+ +++   +Y GIVDC+ R+PKE+G
Sbjct  7    SFAKDFLAGGTAAAISKTAVAPIERVKLLLQVQHASKQISVDMQYKGIVDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKKIFLDGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK G+ R+F GL DCL ++ KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGSGREFKGLGDCLVRITKSDGIRGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPQNTHIVVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY+GT+DC+ KI ++EGGKAFFKGALSN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYSGTLDCWRKIARDEGGKAFFKGALSNVLRGMGGAFVLVLYDELK  295



>ref|XP_003773072.1| PREDICTED: ADP/ATP translocase 1 [Sarcophilus harrisii]
Length=298

 Score =   362 bits (930),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 193/291 (66%), Positives = 230/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKL--TKKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AAVSKTAVAPIERVKLLLQ Q A+ ++   ++Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQIKAEQQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK   +R+F+GL DCLTK++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGATQREFSGLGDCLTKIFKSDGLKGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYTGTIDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|NP_445967.1| ADP/ATP translocase 1 [Rattus norvegicus]
 sp|Q05962.3|ADT1_RAT RecName: Full=ADP/ATP translocase 1; AltName: Full=ADP,ATP carrier 
protein 1; AltName: Full=Adenine nucleotide translocator 
1; Short=ANT 1; AltName: Full=Solute carrier family 25 member 
4 [Rattus norvegicus]
 dbj|BAA02237.1| adenine nucleotide translocator [Rattus norvegicus]
 emb|CAA43842.1| adenine nucleotide translocator [Rattus norvegicus]
Length=298

 Score =   362 bits (930),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 194/291 (67%), Positives = 231/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AAVSKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  ++R+F GL DCLTK++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGSSQREFNGLGDCLTKIFKSDGLKGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYTGTVDCWRKIAKDEGRKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_010784438.1| PREDICTED: ADP/ATP translocase 3 [Notothenia coriiceps]
Length=298

 Score =   362 bits (930),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 193/289 (67%), Positives = 229/289 (79%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++T   +Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQITVDMQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              A+WRGNLANVIRYFPTQALNFAFKD YKK+F    + + +FW++F GNLASGGAAGAT
Sbjct  67   FLAYWRGNLANVIRYFPTQALNFAFKDKYKKVFLDGVDKRKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRL ADVG TG  R+F GL DCL K+ KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLGADVGTTGKGREFKGLADCLVKITKSDGIKGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L      +IL  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDSKNATILVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY+GT+DC+ KI ++EGGKAFFKGALSN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYSGTIDCWRKIARDEGGKAFFKGALSNVLRGMGGAFVLVLYDELK  295



>dbj|BAC37117.1| unnamed protein product [Mus musculus]
Length=298

 Score =   362 bits (930),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 194/294 (66%), Positives = 231/294 (79%), Gaps = 5/294 (2%)
 Frame = +3

Query  27   KTGNFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPK  200
            K  +F+ DF  GGI+AAVSKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PK
Sbjct  4    KALSFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPK  63

Query  201  EEGISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaa  377
            E+G  +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAA
Sbjct  64   EQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAA  123

Query  378  gaTSLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLG  557
            GATSL  VYPLDFARTRLAADVGK  ++R+F GL DCLTK++KSDG KGLYQGF VSV G
Sbjct  124  GATSLCFVYPLDFARTRLAADVGKGSSQREFNGLGDCLTKIFKSDGLKGLYQGFSVSVQG  183

Query  558  IIAYRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG  737
            II YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG
Sbjct  184  IIIYRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSG  243

Query  738  --GKTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              G  IMY GT+DC+ KI K+EG  AFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  244  RKGADIMYTGTLDCWRKIAKDEGANAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>gb|ACO10137.1| ADP/ATP translocase 2 [Osmerus mordax]
Length=298

 Score =   362 bits (930),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 193/289 (67%), Positives = 229/289 (79%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLTK--KYTGIVDCLTRVPKEEG  209
            +F  DF  GGISAA+SKTAVAPIERVKLLLQ Q A+ ++T   +Y GI+DC+TR+PKE+G
Sbjct  7    SFAKDFLAGGISAAISKTAVAPIERVKLLLQVQHASKQITADMQYKGIMDCVTRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK++F    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLDGVDKHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GA R+F+GL DCL K++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAGREFSGLGDCLKKIFKSDGLKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  + +AQ VTA +G  SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNTHIIVSWAIAQTVTAVAGFTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY+GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYSGTIDCWKKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_008122452.1| PREDICTED: LOW QUALITY PROTEIN: ADP/ATP translocase 2 [Anolis 
carolinensis]
Length=299

 Score =   362 bits (930),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 192/292 (66%), Positives = 233/292 (80%), Gaps = 6/292 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +FM DF  GG++AA+SKTAVAPIER+KLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+ 
Sbjct  7    SFMKDFLAGGVAAAISKTAVAPIERIKLLLQVQHASMQITAEKQYKGIMDCVVRIPKEQR  66

Query  210  IS-AFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaaga  383
            +  +FWRGN ANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGA
Sbjct  67   LQXSFWRGNXANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGA  126

Query  384  TSLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGII  563
            TSL  VYPLDFARTRLAADVGK G ER+F GL DCL K+++SDG +GLYQGF VSV GII
Sbjct  127  TSLCFVYPLDFARTRLAADVGKAGMEREFKGLGDCLVKIFRSDGLRGLYQGFNVSVQGII  186

Query  564  AYRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--  737
             YRA YFG YDT K +L     T IL  +++AQ VTA +GL SYP DTVRRR+MMQSG  
Sbjct  187  IYRAAYFGIYDTAKGMLPDPKNTHILISWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRK  246

Query  738  GKTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
            G  IMY+GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  GADIMYSGTIDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  298



>ref|XP_007551819.1| PREDICTED: ADP/ATP translocase 1 [Poecilia formosa]
Length=299

 Score =   362 bits (930),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 193/291 (66%), Positives = 233/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLTK--KYTGIVDCLTRVPKEEG  209
            +FM DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++T   +Y GI+DC+ R+PKE+G
Sbjct  7    SFMKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQITADMQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    + KT+FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKKIFLGGVDQKTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAAD+GK  AER+FTGL +C+ K++K+DG KGLY GF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADIGKGPAEREFTGLGNCIGKIFKTDGLKGLYLGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG +DT K +L     T I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGCFDTAKGMLPDPKNTHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EGG+AFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  ADIMYKGTIDCWKKILKDEGGRAFFKGAWSNVIRGMGGAFVLVLYDEIKKF  297



>ref|XP_010618050.1| PREDICTED: ADP/ATP translocase 1 [Fukomys damarensis]
 gb|KFO35122.1| hypothetical protein H920_03452 [Fukomys damarensis]
Length=298

 Score =   362 bits (930),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 192/291 (66%), Positives = 231/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AAVSKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISVEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK+  +R+FTGL +C+TK++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKSADQREFTGLGNCITKIFKSDGLKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG  AFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYTGTIDCWRKIAKDEGANAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_006269122.1| PREDICTED: ADP/ATP translocase 3 [Alligator mississippiensis]
Length=298

 Score =   362 bits (930),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 190/291 (65%), Positives = 231/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQIAVDKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGN ANVIRYFPTQALNFAFKD YK++F    +  T+FW++F GNLASGGAAGAT
Sbjct  67   MLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKHTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GA+R+F GL DCL K+ KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGADREFAGLGDCLVKITKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +G+VSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPRNTHIVISWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE + +
Sbjct  247  ADIMYKGTIDCWKKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEFKKF  297



>ref|NP_031476.3| ADP/ATP translocase 1 [Mus musculus]
 sp|P48962.4|ADT1_MOUSE RecName: Full=ADP/ATP translocase 1; AltName: Full=ADP,ATP carrier 
protein 1; AltName: Full=ADP,ATP carrier protein, heart/skeletal 
muscle isoform T1; AltName: Full=Adenine nucleotide 
translocator 1; Short=ANT 1; AltName: Full=Solute carrier 
family 25 member 4; AltName: Full=mANC1 [Mus musculus]
 gb|AAF64470.1|AF240002_1 adenine nucleotide translocase 1 [Mus musculus]
 emb|CAA52616.1| adenine nucleotide carrier [Mus musculus]
 gb|AAH03791.1| Solute carrier family 25 (mitochondrial carrier, adenine nucleotide 
translocator), member 4 [Mus musculus]
 gb|AAH26925.1| Solute carrier family 25 (mitochondrial carrier, adenine nucleotide 
translocator), member 4 [Mus musculus]
 gb|EDL35568.1| mCG7017 [Mus musculus]
Length=298

 Score =   362 bits (930),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 193/291 (66%), Positives = 230/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AAVSKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  ++R+F GL DCLTK++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGSSQREFNGLGDCLTKIFKSDGLKGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG  AFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYTGTLDCWRKIAKDEGANAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>gb|ERE86733.1| ADP/ATP translocase 1-like protein [Cricetulus griseus]
Length=298

 Score =   362 bits (929),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 193/291 (66%), Positives = 230/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AAVSKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFFKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  A+R+F+GL DCL+K++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGSAQREFSGLGDCLSKIFKSDGVKGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG  AFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYTGTLDCWRKIAKDEGANAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_006970947.1| PREDICTED: ADP/ATP translocase 1 [Peromyscus maniculatus bairdii]
Length=298

 Score =   362 bits (929),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 192/291 (66%), Positives = 231/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AAVSKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFVKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGN+ANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNMANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  A+R+F+GL DCL+K++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGSAQREFSGLGDCLSKIFKSDGLKGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG  AFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYTGTLDCWRKIAKDEGANAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|NP_001188059.1| ADP/ATP translocase 2 [Ictalurus punctatus]
 gb|ADO29492.1| ADP/ATP translocase 2 [Ictalurus punctatus]
Length=298

 Score =   362 bits (929),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 193/289 (67%), Positives = 228/289 (79%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLTK--KYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T   +Y GIVDC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADMQYKGIVDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKK+F    +  T+FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKKVFLDGVDKHTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F+GL +CL K+ KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFSGLGNCLVKISKSDGIKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQS--GG  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GL SYP DTVRRR+MMQS   G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGLASYPFDTVRRRMMMQSERKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE +
Sbjct  247  ADIMYTGTIDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEFK  295



>ref|XP_005997261.1| PREDICTED: ADP/ATP translocase 2-like isoform X2 [Latimeria chalumnae]
Length=295

 Score =   362 bits (929),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 190/289 (66%), Positives = 230/289 (80%), Gaps = 4/289 (1%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLTK--KYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T   +Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADMQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGN ANVIRYFPTQALNFAFKD YK+IF    +  T+FWK+F GNLASGGAAGAT
Sbjct  67   MLSFWRGNFANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWKYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GA+R+F+GL +CL K++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGADREFSGLGNCLGKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSGGKT  746
            YRA YFG YDT K +L     T I+  +++AQ VTA +GL SYP DTVRRR+MMQS G+ 
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNTHIMISWMIAQTVTAVAGLTSYPFDTVRRRMMMQS-GRD  245

Query  747  IMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
            IMY GT+DC+ KI ++EG KAFFKGA SN+ RGMG + VLVLYDE + Y
Sbjct  246  IMYTGTLDCWRKIARDEGSKAFFKGAWSNVLRGMGGAFVLVLYDEFKKY  294



>ref|NP_999583.1| ADP/ATP translocase 3 [Sus scrofa]
 sp|Q6QRN9.3|ADT3_PIG RecName: Full=ADP/ATP translocase 3; AltName: Full=ADP,ATP carrier 
protein 3; AltName: Full=Adenine nucleotide translocator 
3; Short=ANT 3; AltName: Full=Solute carrier family 25 member 
6; Contains: RecName: Full=ADP/ATP translocase 3, N-terminally 
processed [Sus scrofa]
 gb|AAS20953.1| mitochondrial solute carrier family 25 member 6 [Sus scrofa]
Length=298

 Score =   362 bits (929),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 192/289 (66%), Positives = 229/289 (79%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GIVDC+ R+PKE+G
Sbjct  7    SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +  T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK+  ER+F GL DCL K+ KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKSATEREFKGLGDCLVKITKSDGIRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG Y T K +L     T I+  +++AQ VTA +G+ SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYGTAKGMLPDPRNTHIVVSWMIAQTVTAVAGVFSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI+K+EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYKGTLDCWRKIFKDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_005997260.1| PREDICTED: ADP/ATP translocase 2-like isoform X1 [Latimeria chalumnae]
Length=298

 Score =   362 bits (928),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 191/291 (66%), Positives = 230/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLTK--KYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T   +Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADMQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGN ANVIRYFPTQALNFAFKD YK+IF    +  T+FWK+F GNLASGGAAGAT
Sbjct  67   MLSFWRGNFANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWKYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GA+R+F+GL +CL K++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGADREFSGLGNCLGKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNTHIMISWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EG KAFFKGA SN+ RGMG + VLVLYDE + Y
Sbjct  247  GDIMYTGTLDCWRKIARDEGSKAFFKGAWSNVLRGMGGAFVLVLYDEFKKY  297



>sp|Q000K2.1|ADT2_TACAC RecName: Full=ADP/ATP translocase 2; AltName: Full=ADP,ATP carrier 
protein 2; AltName: Full=Adenine nucleotide translocator 
2; Short=ANT 2; AltName: Full=Solute carrier family 25 member 
5; Contains: RecName: Full=ADP/ATP translocase 2, N-terminally 
processed [Tachyglossus aculeatus aculeatus]
 gb|ABJ90459.1| adenine nucleotide translocator 2 [Tachyglossus aculeatus]
Length=298

 Score =   362 bits (928),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 192/291 (66%), Positives = 229/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK G  R+F GL DCL K+ KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGDAREFKGLGDCLVKITKSDGIRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I   +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  SDIMYTGTIDCWKKIARDEGSKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_005283319.1| PREDICTED: ADP/ATP translocase 3 [Chrysemys picta bellii]
Length=328

 Score =   363 bits (931),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 190/289 (66%), Positives = 232/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GI+DC+ R+PKE+G
Sbjct  37   SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIIDCVVRIPKEQG  96

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK++F    +  T+FW++F GNLASGGAAGAT
Sbjct  97   MLSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKHTQFWRYFAGNLASGGAAGAT  156

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GA+R+F GL DCL K+ KSDG +GLYQGF VSV GII 
Sbjct  157  SLCFVYPLDFARTRLAADVGKAGADREFRGLGDCLVKITKSDGLRGLYQGFNVSVQGIII  216

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VT+ +G+VSYP DTVRRR+MMQSG  G
Sbjct  217  YRAAYFGIYDTAKGMLPDPRNTHIVISWMIAQTVTSVAGIVSYPFDTVRRRMMMQSGRKG  276

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY+GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  277  ADIMYSGTIDCWKKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  325



>ref|XP_006092739.1| PREDICTED: ADP/ATP translocase 1 [Myotis lucifugus]
Length=298

 Score =   361 bits (927),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 193/289 (67%), Positives = 230/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AAVSKTAVAPIERVKLLLQ Q A+ +++  ++Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEQQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  A+R+F+GL DCLTK++KSDG  GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGSAQREFSGLGDCLTKIFKSDGLGGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I   +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIFISWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI K+EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYTGTLDCWRKIAKDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIK  295



>ref|XP_003469241.1| PREDICTED: ADP/ATP translocase 1 [Cavia porcellus]
Length=298

 Score =   361 bits (927),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 191/291 (66%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AAVSKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK+  +R+FTGL +C+TK++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKSADQREFTGLGNCITKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  ADIMYKGTIDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>ref|XP_006834499.1| PREDICTED: ADP/ATP translocase 1 [Chrysochloris asiatica]
Length=298

 Score =   361 bits (927),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 192/291 (66%), Positives = 231/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AAVSKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFVKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  ++R+F+GL DCL+K++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGASQREFSGLGDCLSKIFKSDGLKGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I   +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY+GT+DC+ KI K+EG  AFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYSGTLDCWRKIAKDEGANAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|NP_001037839.1| adenine nucleotide translocator s598 [Takifugu rubripes]
 dbj|BAD86711.1| adenine nucleotide translocator s598 [Takifugu rubripes]
Length=298

 Score =   361 bits (927),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 193/289 (67%), Positives = 226/289 (78%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++   ++Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAVDQQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    +  T+FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKKIFLDGVDKHTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK   ER+F GL DCL K+ KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKASTEREFKGLGDCLVKISKSDGIKGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GTMDC+ KI ++EG  AFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYTGTMDCWRKIARDEGTNAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_005723073.1| PREDICTED: ADP/ATP translocase 2-like [Pundamilia nyererei]
 ref|XP_006781325.1| PREDICTED: ADP/ATP translocase 2-like [Neolamprologus brichardi]
Length=298

 Score =   361 bits (927),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 191/289 (66%), Positives = 228/289 (79%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAVDKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    + + +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKKIFLDGVDKRKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK G ER+F GL DCL K+++SDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGGHEREFKGLGDCLVKIFRSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIIVSWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI ++EG KAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYTGTIDCWKKIARDEGSKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>gb|ETE68996.1| ADP/ATP translocase 1 [Ophiophagus hannah]
Length=298

 Score =   361 bits (926),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 194/291 (67%), Positives = 230/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASQQITAEKQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            I +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   IISFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK   ERQFTGL +C+ K+YKSDG KGLY GF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGLNERQFTGLGNCIAKIYKSDGLKGLYLGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLASYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EGGKAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  ADIMYKGTIDCWKKIAKDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>ref|XP_005913329.1| PREDICTED: ADP/ATP translocase 3-like [Haplochromis burtoni]
Length=298

 Score =   361 bits (926),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 191/289 (66%), Positives = 228/289 (79%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAVDKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    + + +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKKIFLDGVDKRKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK G ER+F GL DCL K+++SDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGGHEREFKGLGDCLVKIFRSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIIVSWMIAQSVTAVAGLASYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI ++EG KAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYTGTIDCWKKIARDEGSKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_008515509.1| PREDICTED: ADP/ATP translocase 1 [Equus przewalskii]
Length=298

 Score =   361 bits (926),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 192/291 (66%), Positives = 231/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AAVSKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQITAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  A+R+F+GL +CL K++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGAAQREFSGLGNCLAKIFKSDGIRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYTGTVDCWRKIAKDEGPKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_005373536.1| PREDICTED: ADP/ATP translocase 1 [Chinchilla lanigera]
Length=298

 Score =   361 bits (926),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 191/291 (66%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AAVSKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK+  +R+FTGL +C+TK++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKSVDQREFTGLGNCITKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYTGTIDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>gb|ACI66474.1| ADP/ATP translocase 2 [Salmo salar]
Length=297

 Score =   361 bits (926),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 193/289 (67%), Positives = 229/289 (79%), Gaps = 6/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLTK--KYTGIVDCLTRVPKEEG  209
            +F  DF  GGISAA+SKTAVAPIERVKLLLQ Q A+ +++K  +Y GI+DC+TR+PKE+G
Sbjct  7    SFAKDFLAGGISAAISKTAVAPIERVKLLLQVQHASKQISKEMQYKGIIDCVTRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              AFWRGNLANVIRYFPTQALNFAFKD YK +F    + + +FW++F GNLASGGAAGAT
Sbjct  67   FLAFWRGNLANVIRYFPTQALNFAFKDKYKSVFLDGVDKRKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRL ADVGK GA R++ GL DCL K ++SDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLGADVGKAGA-REYNGLADCLAKTFRSDGMRGLYQGFAVSVQGIII  185

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     TSIL  + +AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  186  YRASYFGIYDTAKGMLPDSKNTSILVSWAIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  245

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY+GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  246  ADIMYSGTIDCWKKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  294



>ref|XP_006011187.1| PREDICTED: ADP/ATP translocase 1 [Latimeria chalumnae]
Length=298

 Score =   361 bits (926),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 192/291 (66%), Positives = 231/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++T   +Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASRQITVETQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    +  T+FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKKIFLGGVDKHTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK   ER+FTGL +CL+K++KSDG +GLY GF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGANEREFTGLGNCLSKIFKSDGIRGLYLGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K ++       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMMPDPKNVHIVISWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EGGKAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  ADIMYKGTIDCWRKIIKDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>ref|NP_001080495.1| adenine nucleotide translocator 2 [Xenopus laevis]
 gb|AAF63471.1|AF231347_1 adenine nucleotide translocase [Xenopus laevis]
 gb|AAH43821.1| Slc25a5-prov protein [Xenopus laevis]
Length=298

 Score =   361 bits (926),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 193/289 (67%), Positives = 226/289 (78%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKHYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    + KT+FW++F GNLASGGAAGAT
Sbjct  67   FVSFWRGNLANVIRYFPTQALNFAFKDKYKKIFLDNVDKKTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK   ER+F GL DCL K+ KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGANEREFKGLGDCLVKISKSDGIKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I   +++AQ VTA +G  SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIFVSWMIAQTVTAVAGFASYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY+GT+DC+ KI ++EG KAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYSGTIDCWKKIARDEGSKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>gb|AAC52837.1| adenine nucleotide translocase-1 [Mus musculus]
Length=298

 Score =   360 bits (925),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 192/291 (66%), Positives = 229/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AAVSKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLD ARTRLAADVGK  ++R+F GL DCLTK++KSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDLARTRLAADVGKGSSQREFNGLGDCLTKIFKSDGLKGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG  AFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYTGTLDCWRKIAKDEGANAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_003133393.1| PREDICTED: ADP/ATP translocase 1 isoform 2 [Sus scrofa]
Length=298

 Score =   360 bits (925),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 191/291 (66%), Positives = 231/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  A+R+FTGL +CL K++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGAAQREFTGLGNCLAKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYTGTVDCWRKIAKDEGPKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_008584863.1| PREDICTED: ADP/ATP translocase 1 [Galeopterus variegatus]
Length=298

 Score =   360 bits (925),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 191/291 (66%), Positives = 231/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AAVSKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK++F    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  A+R+F+GL +CLTK++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGAAQREFSGLGNCLTKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I   +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|NP_777083.1| ADP/ATP translocase 1 [Bos taurus]
 ref|NP_001281256.1| solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 4 [Bos mutus]
 ref|XP_005698776.1| PREDICTED: ADP/ATP translocase 1 [Capra hircus]
 ref|XP_006075174.1| PREDICTED: ADP/ATP translocase 1 [Bubalus bubalis]
 ref|XP_010834070.1| PREDICTED: ADP/ATP translocase 1 [Bison bison bison]
 sp|P02722.3|ADT1_BOVIN RecName: Full=ADP/ATP translocase 1; AltName: Full=ADP,ATP carrier 
protein 1; AltName: Full=ADP,ATP carrier protein, heart 
isoform T1; AltName: Full=Adenine nucleotide translocator 
1; Short=ANT 1; AltName: Full=Solute carrier family 25 member 
4 [Bos taurus]
 gb|AAA30768.1| translocase [Bos taurus]
 tpg|DAA14523.1| TPA: ADP/ATP translocase 1 [Bos taurus]
 gb|ELR46422.1| hypothetical protein M91_14159 [Bos mutus]
 gb|AIC38342.1| ADP/ATP translocase 1 [Bos mutus]
Length=298

 Score =   360 bits (925),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 190/291 (65%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  A+R+FTGL +C+TK++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGAAQREFTGLGNCITKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  ADIMYTGTVDCWRKIAKDEGPKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>ref|XP_002914076.1| PREDICTED: ADP/ATP translocase 1-like [Ailuropoda melanoleuca]
Length=346

 Score =   362 bits (929),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 193/287 (67%), Positives = 229/287 (80%), Gaps = 5/287 (2%)
 Frame = +3

Query  48   DFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEGISAF  221
            DF  GG++AAVSKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G  +F
Sbjct  59   DFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSF  118

Query  222  WRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaTSLMV  398
            WRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGATSL  
Sbjct  119  WRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGATSLCF  178

Query  399  VYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIAYRAC  578
            VYPLDFARTRLAADVGK  A+R+F+GL DCLTK++KSDG KGLYQGF VSV GII YRA 
Sbjct  179  VYPLDFARTRLAADVGKGAAQREFSGLGDCLTKIFKSDGLKGLYQGFSVSVQGIIIYRAA  238

Query  579  YFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--GKTIM  752
            YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G  IM
Sbjct  239  YFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIM  298

Query  753  YNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
            Y GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  299  YTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  345



>ref|XP_006902474.1| PREDICTED: ADP/ATP translocase 3 [Elephantulus edwardii]
Length=298

 Score =   360 bits (924),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 190/289 (66%), Positives = 230/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GIVDC+ R+P+E+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPREQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVI YFPTQALNFAFKD YK++F    +  T+FW++F GNLASGGAAGAT
Sbjct  67   MLSFWRGNLANVICYFPTQALNFAFKDKYKQVFLGGVDKHTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK+G ER+F GL DCL K+ KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKSGTEREFKGLGDCLVKISKSDGIRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +G+VSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI K+EGGKAFFKGA SN+ RGMG + VLV+YDE++
Sbjct  247  ADIMYTGTIDCWRKILKDEGGKAFFKGAWSNVLRGMGGAFVLVIYDELK  295



>pdb|1OKC|A Chain A, Structure Of Mitochondrial Adp/atp Carrier In Complex 
With Carboxyatractyloside
 pdb|2C3E|A Chain A, The Bovine Mitochondrial Adp-atp Carrier
Length=297

 Score =   360 bits (924),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 190/291 (65%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  6    SFLKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG  65

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  66   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  125

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  A+R+FTGL +C+TK++KSDG +GLYQGF VSV GII 
Sbjct  126  SLCFVYPLDFARTRLAADVGKGAAQREFTGLGNCITKIFKSDGLRGLYQGFNVSVQGIII  185

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  186  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKG  245

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  246  ADIMYTGTVDCWRKIAKDEGPKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  296



>ref|NP_001085135.1| solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 4 [Xenopus laevis]
 gb|AAH72091.1| MGC79005 protein [Xenopus laevis]
Length=298

 Score =   360 bits (924),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 193/291 (66%), Positives = 229/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ +++   +Y GI+DC+TR+PKE+G
Sbjct  7    SFLKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQISVEMQYKGIMDCVTRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW+FF GNLASGGAAGAT
Sbjct  67   FISFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHKQFWRFFVGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK   ER+FTGL +C+ K+YKSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGLNEREFTGLANCIAKIYKSDGLKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K ++       I   +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMMPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYKGTIDCWKKIAKDEGSKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_007957079.1| PREDICTED: ADP/ATP translocase 3 [Orycteropus afer afer]
Length=298

 Score =   360 bits (924),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 188/289 (65%), Positives = 231/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++   ++Y GIVDC+ R+P+E+G
Sbjct  7    SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASRQIAADQQYKGIVDCVVRIPREQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK++F    +  T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKHTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK+ +ER+F GL DCL KV KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKSSSEREFRGLGDCLVKVTKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +G+VSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+ C+ KI+++EGG+AFFKGA SN+ RGMG + VLV+YDE++
Sbjct  247  ADIMYTGTLHCWRKIFRDEGGRAFFKGAWSNVLRGMGGAFVLVIYDELK  295



>ref|XP_004639840.1| PREDICTED: ADP/ATP translocase 1 [Octodon degus]
Length=298

 Score =   360 bits (923),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 191/291 (66%), Positives = 230/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AAVSKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK   +R+FTGL +C+TK++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGADQREFTGLGNCITKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG  AFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYTGTIDCWRKIAKDEGANAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_004428798.1| PREDICTED: ADP/ATP translocase 1 [Ceratotherium simum simum]
Length=298

 Score =   360 bits (923),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 191/291 (66%), Positives = 231/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AAVSKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQITAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  A+R+F+GL +CL K++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGAAQREFSGLGNCLVKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  ADIMYTGTVDCWRKIAKDEGPKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>ref|XP_005972655.1| PREDICTED: ADP/ATP translocase 1 [Pantholops hodgsonii]
Length=298

 Score =   360 bits (923),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 190/291 (65%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  A+R+FTGL +C+TK++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGAAQREFTGLGNCITKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  ADIMYTGTVDCWRKIAKDEGPKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>ref|XP_006276114.1| PREDICTED: ADP/ATP translocase 1 [Alligator mississippiensis]
Length=298

 Score =   359 bits (922),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 190/291 (65%), Positives = 232/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQITVEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            I +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   IISFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  +ER+FTGL +C+ K++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGLSEREFTGLGNCIAKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K ++       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMMPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG +AFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  ADIMYKGTIDCWKKIAKDEGPRAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>ref|XP_003452294.1| PREDICTED: ADP/ATP translocase 1-like [Oreochromis niloticus]
Length=299

 Score =   359 bits (922),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 192/291 (66%), Positives = 231/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLTK--KYTGIVDCLTRVPKEEG  209
            +FM DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++T   +Y GI+DC+ R+PKE+G
Sbjct  7    SFMKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQITAETQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    + K +FW++F GNLASGGAAGAT
Sbjct  67   FISFWRGNLANVIRYFPTQALNFAFKDKYKKIFLGGVDQKKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAAD+GK  AER+FTGL +C+ K++K+DG +GLY GF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADIGKGPAEREFTGLGNCIAKIFKTDGLRGLYLGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG +DT K +L     T I+  +++AQ VTAA+GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGCFDTAKGMLPDPKNTHIIVSWMIAQTVTAAAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE + +
Sbjct  247  ADIMYKGTIDCWKKIIKDEGPKAFFKGAWSNVIRGMGGAFVLVLYDEFKKF  297



>ref|XP_006638960.1| PREDICTED: ADP/ATP translocase 1-like [Lepisosteus oculatus]
Length=298

 Score =   359 bits (922),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 188/289 (65%), Positives = 228/289 (79%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQIAVDKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK++F    +   +FW++F GNLASGGAAGAT
Sbjct  67   FVSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GA R+F GL DCL K+++SDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGASREFNGLGDCLVKIFRSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +G++SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGVMSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI K+EGG+AFFKGA SN+ RGMG + VLVLYDE +
Sbjct  247  ADIMYTGTIDCWKKIAKDEGGRAFFKGAWSNVLRGMGGAFVLVLYDEFK  295



>ref|NP_001153963.1| adenine nucleotide translocator 2 [Oncorhynchus mykiss]
 gb|ACM24764.1| adenine nucleotide translocator 2 [Oncorhynchus mykiss]
 gb|ACO08209.1| ADP/ATP translocase 2 [Oncorhynchus mykiss]
 emb|CDQ69043.1| unnamed protein product [Oncorhynchus mykiss]
Length=297

 Score =   359 bits (922),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 192/289 (66%), Positives = 228/289 (79%), Gaps = 6/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLTK--KYTGIVDCLTRVPKEEG  209
            +F  DF  GGISAA+SKTAVAPIERVKLLLQ Q A+ +++K  +Y GI+DC+TR+PKE+G
Sbjct  7    SFAKDFLAGGISAAISKTAVAPIERVKLLLQVQHASKQISKEMQYKGIIDCVTRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              AFWRGNLANVIRYFPTQALNFAFKD YK +F    + + +FW++F GNLASGGAAGAT
Sbjct  67   FLAFWRGNLANVIRYFPTQALNFAFKDKYKSVFLDGVDKRKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRL ADVGK GA R++ GL DCL K ++SDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLGADVGKAGA-REYNGLADCLAKTFRSDGMRGLYQGFAVSVQGIII  185

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L      SIL  + +AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  186  YRASYFGIYDTAKGMLPDSKNASILVSWAIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKG  245

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY+GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  246  ADIMYSGTIDCWKKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  294



>ref|XP_004940900.1| PREDICTED: LOW QUALITY PROTEIN: ADP/ATP translocase 2 [Gallus 
gallus]
Length=407

 Score =   363 bits (931),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 189/291 (65%), Positives = 234/291 (80%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GI+DC+ R+P+E+G
Sbjct  116  SFLKDFLTGGVAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIIDCVVRIPREQG  175

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFK  YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  176  VLSFWRGNLANVIRYFPTQALNFAFKXKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  235

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GA+R+F+GL DCL K+++SDG +GLYQGF VSV GII 
Sbjct  236  SLCFVYPLDFARTRLAADVGKAGADREFSGLGDCLVKIFRSDGLRGLYQGFNVSVQGIII  295

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  296  YRAAYFGIYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKG  355

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY+GT+DC+ KI ++EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  356  TDIMYSGTIDCWRKIARDEGSKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  406



>dbj|BAF84591.1| unnamed protein product [Homo sapiens]
Length=298

 Score =   358 bits (920),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 189/291 (65%), Positives = 229/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AAVSKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK++F    +   +FW++F GNLASGGAAG+T
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGGAAGST  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  A+R+F GL DC+ K++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I   +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_010951596.1| PREDICTED: ADP/ATP translocase 1 [Camelus bactrianus]
 ref|XP_010972871.1| PREDICTED: ADP/ATP translocase 1 [Camelus dromedarius]
Length=298

 Score =   358 bits (920),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 190/291 (65%), Positives = 231/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AAVSKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+P+E+G
Sbjct  7    SFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPREQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  A+R+FTGL +CL K++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGAAQREFTGLGNCLAKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  ADIMYTGTVDCWRKIAKDEGPKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>ref|NP_001142.2| ADP/ATP translocase 1 [Homo sapiens]
 ref|NP_001245094.1| ADP/ATP translocase 1 [Macaca mulatta]
 ref|XP_002815389.1| PREDICTED: ADP/ATP translocase 1 [Pongo abelii]
 ref|XP_004040745.1| PREDICTED: ADP/ATP translocase 1 [Gorilla gorilla gorilla]
 ref|XP_005556469.1| PREDICTED: ADP/ATP translocase 1 isoform X2 [Macaca fascicularis]
 ref|XP_007998609.1| PREDICTED: ADP/ATP translocase 1 [Chlorocebus sabaeus]
 ref|XP_010376244.1| PREDICTED: ADP/ATP translocase 1 [Rhinopithecus roxellana]
 sp|P12235.4|ADT1_HUMAN RecName: Full=ADP/ATP translocase 1; AltName: Full=ADP,ATP carrier 
protein 1; AltName: Full=ADP,ATP carrier protein, heart/skeletal 
muscle isoform T1; AltName: Full=Adenine nucleotide 
translocator 1; Short=ANT 1; AltName: Full=Solute carrier 
family 25 member 4 [Homo sapiens]
 gb|AAA51736.1| ATP/ADP translocator [Homo sapiens]
 gb|AAH08664.1| Solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 4 [Homo sapiens]
 gb|AAH61589.1| Solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 4 [Homo sapiens]
 gb|AAH63643.1| Solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 4 [Homo sapiens]
 gb|EAX04655.1| solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 4, isoform CRA_a [Homo sapiens]
 gb|EAX04656.1| solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 4, isoform CRA_a [Homo sapiens]
 gb|ABM82473.1| solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 4 [synthetic construct]
 gb|ABM85661.1| solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 4 [synthetic construct]
 dbj|BAG73744.1| solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 4 [synthetic construct]
 gb|ADP92294.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92295.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92296.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92297.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92298.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92299.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92300.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92301.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92302.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92303.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92304.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92305.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92306.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92307.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92308.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92309.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92310.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92311.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92312.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92313.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92314.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92315.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92316.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92317.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92318.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92319.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92320.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92321.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92322.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92323.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92324.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92325.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92326.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92327.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92328.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92329.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92330.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92331.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92332.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|ADP92333.1| ADP/ATP translocase 1 [Homo sapiens]
 gb|AIC48264.1| SLC25A4, partial [synthetic construct]
Length=298

 Score =   358 bits (920),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 190/291 (65%), Positives = 229/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AAVSKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK++F    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  A+R+F GL DC+ K++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I   +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_004549538.1| PREDICTED: ADP/ATP translocase 1-like [Maylandia zebra]
 ref|XP_005726852.1| PREDICTED: ADP/ATP translocase 1-like [Pundamilia nyererei]
 ref|XP_005942089.1| PREDICTED: ADP/ATP translocase 1-like [Haplochromis burtoni]
Length=299

 Score =   358 bits (920),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 191/291 (66%), Positives = 230/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLTK--KYTGIVDCLTRVPKEEG  209
            +FM DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++T   +Y GI+DC+ R+PKE+G
Sbjct  7    SFMKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQITAETQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    + K +FW++F GNLASGGAAGAT
Sbjct  67   FISFWRGNLANVIRYFPTQALNFAFKDKYKKIFLGGVDQKKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAAD+GK  AER+FTGL +C+ K++K+DG KGLY GF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADIGKGTAEREFTGLGNCIAKIFKTDGLKGLYLGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG +DT K +L     T I+  +++AQ VTA +GL+SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGCFDTAKGMLPDPKNTHIIVSWMIAQTVTAVAGLISYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE + +
Sbjct  247  ADIMYKGTIDCWKKIIKDEGPKAFFKGAWSNVIRGMGGAFVLVLYDEFKKF  297



>ref|XP_003055578.1| mitochondrial carrier family [Micromonas pusilla CCMP1545]
 gb|EEH60830.1| mitochondrial carrier family [Micromonas pusilla CCMP1545]
Length=341

 Score =   360 bits (923),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 188/292 (64%), Positives = 226/292 (77%), Gaps = 7/292 (2%)
 Frame = +3

Query  39   FMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKL----TKKYTGIVDCLTRVPKEE  206
            F  D A+GG+S +++KTA APIERVKLL+QTQDAN K+      +YTGIV+C TRV  E+
Sbjct  53   FATDLAIGGVSGSIAKTATAPIERVKLLIQTQDANPKIMSGEVARYTGIVNCFTRVSAEQ  112

Query  207  GISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCPYNPKTEFWKfffgnlasggaagaT  386
            G  +FWRGN+AN++RYFPTQA NFAFKDT K +F  YNPKT+FW FF  N+ASGG AGA 
Sbjct  113  GFGSFWRGNMANIVRYFPTQAFNFAFKDTIKDLFPTYNPKTDFWPFFGVNMASGGMAGAG  172

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL++VYPLDFARTRLAADVG +G  R+FTGLVDCLTKV    G   LYQGFGVSV GII 
Sbjct  173  SLLIVYPLDFARTRLAADVG-SGKGREFTGLVDCLTKVAAKSGPMSLYQGFGVSVQGIIV  231

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSGGKT  746
            YR  YFG YDT K  L ++  +SI+ KF+VAQV T A+G++SYP DTVRRRLMM SGGK 
Sbjct  232  YRGSYFGLYDTGKGALLTK-DSSIVAKFVVAQVATNAAGVLSYPFDTVRRRLMMTSGGKK  290

Query  747  IMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAYFAP  902
             +YNGT+D F KIY NEG  AFFKGA SN+ RG+G +LVL++YDE++A   P
Sbjct  291  -LYNGTIDAFVKIYSNEGAGAFFKGAFSNVLRGVGGALVLIMYDEIKAMINP  341



>ref|XP_006787200.1| PREDICTED: ADP/ATP translocase 1-like [Neolamprologus brichardi]
Length=299

 Score =   358 bits (918),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 191/289 (66%), Positives = 229/289 (79%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLTK--KYTGIVDCLTRVPKEEG  209
            +FM DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++T   +Y GI+DC+ R+PKE+G
Sbjct  7    SFMKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQITAETQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKKIF    + K +FW++F GNLASGGAAGAT
Sbjct  67   FISFWRGNLANVIRYFPTQALNFAFKDKYKKIFLGGVDQKKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAAD+GK  AER+FTGL +C+ K++K+DG KGLY GF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADIGKGTAEREFTGLGNCIAKIFKTDGLKGLYLGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG +DT K +L     T I+  +++AQ VTA +GL+SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGCFDTAKGMLPDPKNTHIIVSWMIAQTVTAVAGLISYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE +
Sbjct  247  ADIMYKGTIDCWKKIIKDEGPKAFFKGAWSNVIRGMGGAFVLVLYDEFK  295



>ref|XP_004093347.1| PREDICTED: LOW QUALITY PROTEIN: ADP/ATP translocase 3 [Nomascus 
leucogenys]
Length=300

 Score =   358 bits (918),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 192/291 (66%), Positives = 230/291 (79%), Gaps = 7/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GIVDC+ R+PKE+G
Sbjct  7    SFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHRQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK+  ER+F GL DCL K+ KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKSSTEREFRGLGDCLVKITKSDGIRGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKR--VLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG-  737
            YRA YFG YDT K   +L     T I+  +++AQ VTA +G+VSYP DTVRRR+MMQSG 
Sbjct  187  YRAAYFGVYDTAKGTCMLPDPRNTHIVVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGR  246

Query  738  -GKTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
             G  IMY GT+DC+ KI+++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  KGADIMYTGTVDCWRKIFRDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  297



>ref|XP_006834479.1| PREDICTED: ADP/ATP translocase 2-like [Chrysochloris asiatica]
Length=298

 Score =   358 bits (918),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 191/291 (66%), Positives = 227/291 (78%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAP ERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPFERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            S   VYPLD ARTRLAADVGK GAER+F GL DCL K+ KSDG KGLYQGF VSV GII 
Sbjct  127  SFCFVYPLDLARTRLAADVGKAGAEREFKGLGDCLLKISKSDGIKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT+K +L       I   +++A  V A +GL SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTVKGMLPDPKNIHIFVSWMIAHSVMAVAGLTSYPFDTVRRRMMMQSGLKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI  +EGGKAFFKGA SN+FRGMG + VLVLYDE++ Y
Sbjct  247  TDIMYTGTVDCWRKIACDEGGKAFFKGAWSNVFRGMGGAFVLVLYDEIKKY  297



>ref|XP_005883911.1| PREDICTED: ADP/ATP translocase 1 isoform X2 [Myotis brandtii]
Length=298

 Score =   358 bits (918),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 191/289 (66%), Positives = 228/289 (79%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AAVSKTAVAPIERVKLLLQ Q A+ +++  ++Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEQQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  A+R+F+GL DCLTK++KSDG  GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGSAQREFSGLGDCLTKIFKSDGLGGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YD    +L       I   +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDXXAGMLPDPKNVHIFISWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI K+EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYTGTLDCWRKIAKDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIK  295



>gb|AAI02995.2| Solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 4 [Bos taurus]
Length=298

 Score =   358 bits (918),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/291 (65%), Positives = 231/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FW GNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWSGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  A+R+FTGL +C+TK++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGAAQREFTGLGNCITKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  ADIMYTGTVDCWRKIAKDEGPKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>ref|XP_004382819.1| PREDICTED: ADP/ATP translocase 1 [Trichechus manatus latirostris]
Length=298

 Score =   357 bits (917),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/291 (65%), Positives = 231/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  A+R+FTGL +CL K++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGAAQREFTGLGNCLVKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I   +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY+GT+DC+ KI K+EG +AFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  ADIMYSGTVDCWRKIAKDEGPRAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>gb|ADO32616.1| adenine nucleotide translocator [Artemia franciscana]
Length=301

 Score =   357 bits (917),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 190/289 (66%), Positives = 230/289 (80%), Gaps = 7/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGISAAVSKTAVAPIERVKLLLQ Q  + ++   K+Y GI+DC  R+PKE+G
Sbjct  11   SFLKDFMAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAVDKQYKGIIDCFVRIPKEQG  70

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLANVIRYFPTQALNFAFKD +K+IF    + KT+FW++F  NLASGGAAGAT
Sbjct  71   VLSFWRGNLANVIRYFPTQALNFAFKDVFKQIFMSGVDKKTQFWRWFGANLASGGAAGAT  130

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAAD GK  AER+F+GL +CL K++KSDG  GLY+GFGVSV GII 
Sbjct  131  SLCFVYPLDFARTRLAADTGKGAAEREFSGLGNCLVKIFKSDGLTGLYRGFGVSVQGIII  190

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSGGK-  743
            YRA YFG YDT++ +L    K ++   + +AQ VT  SG+VSYP DTVRRR+MMQSG   
Sbjct  191  YRAAYFGFYDTVRGML--PPKQNLFISWAIAQCVTTVSGIVSYPFDTVRRRMMMQSGRAK  248

Query  744  -TIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              +MY GT+DC+AKIYK+EGG AFFKGALSN+FRG G +LVLV YDE++
Sbjct  249  GDMMYKGTLDCWAKIYKSEGGGAFFKGALSNVFRGTGGALVLVFYDELK  297



>ref|XP_006028566.1| PREDICTED: ADP/ATP translocase 2 [Alligator sinensis]
Length=319

 Score =   358 bits (919),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 188/283 (66%), Positives = 227/283 (80%), Gaps = 5/283 (2%)
 Frame = +3

Query  60   GGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEGISAFWRGN  233
            GG++ A+SK AVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+P+E+G  +FWRGN
Sbjct  36   GGLAPAISKPAVAPIERVKLLLQVQHASKQITVEKQYKGIIDCVVRIPREQGFLSFWRGN  95

Query  234  LANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaTSLMVVYPL  410
            LANVIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGATSL  VYPL
Sbjct  96   LANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGATSLCFVYPL  155

Query  411  DFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIAYRACYFGG  590
            DFARTRLAADVGK GAER+F GL DCL K++KSDG +GLYQGF VSV GII YRA YFG 
Sbjct  156  DFARTRLAADVGKAGAEREFRGLGDCLVKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGV  215

Query  591  YDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSGGKT--IMYNGT  764
            YDT K +L     T I   +++AQ VTA +GL SYP DTVRRR+MMQSG K   IMY+GT
Sbjct  216  YDTAKGMLPDPKNTHIFISWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKAADIMYSGT  275

Query  765  MDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
            +DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  276  IDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  318



>ref|XP_010868847.1| PREDICTED: ADP/ATP translocase 3-like [Esox lucius]
Length=297

 Score =   357 bits (915),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 192/289 (66%), Positives = 227/289 (79%), Gaps = 6/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLTK--KYTGIVDCLTRVPKEEG  209
            +F  DF  GGISAA+SKTAVAPIERVKLLLQ Q A+ ++ K  +Y GI+DC++R+PKE+G
Sbjct  7    SFAKDFLAGGISAAISKTAVAPIERVKLLLQVQHASKQIAKDQQYKGILDCVSRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              AFWRGNLANVIRYFPTQALNFAFKD YK IF    + + +FW++F GNLASGGAAGAT
Sbjct  67   FLAFWRGNLANVIRYFPTQALNFAFKDKYKSIFLDGVDKRKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRL ADVGK GA R++ GL DCL K ++SDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLGADVGKAGA-REYNGLADCLAKTFRSDGLRGLYQGFNVSVQGIII  185

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     TSI   + +AQ VTA +GL SYP DTVRRR+MMQSG  G
Sbjct  186  YRASYFGIYDTAKGMLPDPKNTSIFVSWAIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKG  245

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY+GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  246  ADIMYSGTIDCWKKILRDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  294



>ref|XP_006198043.1| PREDICTED: ADP/ATP translocase 1 [Vicugna pacos]
Length=298

 Score =   357 bits (915),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 189/291 (65%), Positives = 230/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AAVSKTAVAPIERVKLLL  Q A+ +++  K+Y GI+DC+ R+P+E+G
Sbjct  7    SFLKDFLAGGVAAAVSKTAVAPIERVKLLLHVQHASKQISAEKQYKGIIDCVVRIPREQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  A+R+FTGL +CL K++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGAAQREFTGLGNCLAKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ +
Sbjct  247  ADIMYTGTVDCWRKIAKDEGPKAFFKGAWSNVLRGMGGAFVLVLYDEIKKF  297



>ref|XP_006630034.1| PREDICTED: ADP/ATP translocase 1-like [Lepisosteus oculatus]
Length=298

 Score =   357 bits (915),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 190/289 (66%), Positives = 230/289 (80%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQISVEKQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK +F    + +T+FW++F GNLASGGAAGAT
Sbjct  67   FISFWRGNLANVIRYFPTQALNFAFKDKYKTVFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK   ER+F+GL +CLTK++KSDG +GLY GF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGVTEREFSGLGNCLTKIFKSDGLRGLYLGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K ++       I+  +++AQ VTA SGLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMMPDPKNVHIIISWMIAQTVTAVSGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYKGTIDCWKKIAKDEGPKAFFKGAWSNVLRGMGGAFVLVLYDEIK  295



>ref|XP_005883910.1| PREDICTED: ADP/ATP translocase 1 isoform X1 [Myotis brandtii]
Length=298

 Score =   356 bits (914),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 191/289 (66%), Positives = 228/289 (79%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AAVSKTAVAPIERVKLLLQ Q A+ +++  ++Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEQQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  A+R+F+GL DCLTK++KSDG  GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGSAQREFSGLGDCLTKIFKSDGLGGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YD    +L       I   +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDLPAGMLPDPKNVHIFISWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI K+EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYTGTLDCWRKIAKDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIK  295



>emb|CAZ44323.1| ADP/ATP translocase [Haemonchus contortus]
 emb|CAZ44324.1| ADP/ATP translocase [Haemonchus contortus]
Length=297

 Score =   356 bits (914),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 197/291 (68%), Positives = 228/291 (78%), Gaps = 4/291 (1%)
 Frame = +3

Query  30   TGNFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKE  203
            T  F +D A GG +AA+SKTAVAPIERVKLLLQ QDA++ +   K+Y GI+D L RVPKE
Sbjct  7    TKKFFIDLASGGTAAAISKTAVAPIERVKLLLQVQDASSTIAVDKRYKGIIDVLVRVPKE  66

Query  204  EGISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaag  380
            +G +A WRGNLANVIRYFPTQALNFAFKD+YKKIF    + K +FWKFF GNLASGGAAG
Sbjct  67   QGFAALWRGNLANVIRYFPTQALNFAFKDSYKKIFLEGLDKKKDFWKFFAGNLASGGAAG  126

Query  381  aTSLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGI  560
            ATSL  VYPLDFARTRLAADVGK GA R+F GL+DCL KV KSDG  GLY+GF VSV GI
Sbjct  127  ATSLCFVYPLDFARTRLAADVGK-GAGREFKGLLDCLIKVTKSDGPIGLYRGFFVSVQGI  185

Query  561  IAYRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSGG  740
            I YRA YFG +DT K +L SEGK +    + +AQVVT  SG++SYP DTVRRR+MMQSG 
Sbjct  186  IIYRAAYFGLFDTAKMLLASEGKLNFFVAWAIAQVVTVGSGILSYPWDTVRRRMMMQSGR  245

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
            K I+Y  T+DC  KI KNEG  A FKGALSN+FRG G +LVL +YDE+Q +
Sbjct  246  KDILYKNTLDCAKKIIKNEGIGAMFKGALSNVFRGTGGALVLAIYDEIQKF  296



>ref|NP_988909.1| adenine nucleotide translocator 1 [Xenopus (Silurana) tropicalis]
 gb|AAH61600.1| solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 4 [Xenopus (Silurana) tropicalis]
 emb|CAJ83819.1| solute carrier family 25 (mitochondrial carrier; adenine nucleotide 
translocator), member 4 [Xenopus (Silurana) tropicalis]
Length=298

 Score =   356 bits (914),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 192/291 (66%), Positives = 229/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQISVDKQYKGIMDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW+FF GNLASGGAAGAT
Sbjct  67   FISFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHKQFWRFFVGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK   ER+FTGL +C+ K+YK DG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGLNEREFTGLGNCIAKIYKLDGLKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K ++       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMMPDPKNVHIVVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYKGTIDCWKKISKDEGPKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_003942672.1| PREDICTED: ADP/ATP translocase 3 [Saimiri boliviensis boliviensis]
Length=298

 Score =   356 bits (914),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 189/289 (65%), Positives = 227/289 (79%), Gaps = 5/289 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF   GI+AA+SKTAVAPIERVKLLLQ Q A+ ++   K+Y GIVDC+ R+PKE+G
Sbjct  7    SFAKDFLARGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +FWRGNLAN+IRYFP QALNF FKD YK+IF    +  T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFWRGNLANIIRYFPMQALNFVFKDKYKQIFLGGVDKHTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK+G ER+F GL DCL K+ KSDG  GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKSGTEREFRGLGDCLVKITKSDGMCGLYQGFSVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YD  K +L     T I+  +++AQ VTA +G+VSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDAAKGMLPDPKNTHIVVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQ  887
              IMY GT+DC+ KI+++EGGKAFFKGA SN+ RGMG + VLVLYDE++
Sbjct  247  ADIMYTGTVDCWRKIFRDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELK  295



>ref|XP_007232858.1| PREDICTED: ADP/ATP translocase 1 [Astyanax mexicanus]
Length=298

 Score =   355 bits (912),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 189/291 (65%), Positives = 229/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLTK--KYTGIVDCLTRVPKEEG  209
            +F+ DF  GGI+AA+SKTAVAPIERVKLLLQ Q A+ ++T   +Y GI+DC  R+PKE+G
Sbjct  7    SFLKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQITADMQYKGIIDCAIRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YKK+F    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKKVFLGGVDKNKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAAD+GK  AER+FTGL +CL K++KSDG +GLY GF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADIGKGTAEREFTGLGNCLAKIFKSDGVRGLYLGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L     T I+  +++AQ VTA +G++SYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGIISYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ +I K+EG KAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  ADIMYKGTIDCWKRITKDEGPKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_004636294.1| PREDICTED: ADP/ATP translocase 2-like [Octodon degus]
Length=298

 Score =   355 bits (912),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 192/291 (66%), Positives = 229/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F  DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ ++T  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
            + +F RGNLA VIRYFPTQALNFAFKD YK+IF    + +T+FW++F GNLASGGAAGAT
Sbjct  67   VLSFRRGNLAKVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK GAER+F GL DCL K+YKSDG KGLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLVKIYKSDGIKGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSGGKT  746
            YRA YFG YDT K +L     T I+  +++AQ  TA +GL SY  DTVRRR+MMQ G K 
Sbjct  187  YRAAYFGIYDTAKGMLPDPKNTHIIISWMIAQSDTAVAGLTSYLFDTVRRRMMMQPGRKE  246

Query  747  --IMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY GT+DC+ KI ++EGGKAFFKGA SN+ RGMG + VLVLYDE++ Y
Sbjct  247  TDIMYTGTVDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKY  297



>ref|XP_006219940.1| PREDICTED: ADP,ATP carrier protein 1-like, partial [Vicugna pacos]
Length=295

 Score =   355 bits (912),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 194/288 (67%), Positives = 225/288 (78%), Gaps = 4/288 (1%)
 Frame = +3

Query  39   FMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEGI  212
            F +D A GG +AA+SKTAVAPIERVKLLLQ QDA++ +   K+Y GI+D L RVPKE+G 
Sbjct  8    FFIDLASGGTAAAISKTAVAPIERVKLLLQVQDASSTIAVDKRYKGIIDILVRVPKEQGF  67

Query  213  SAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaTS  389
            +A WRGNLANVIRYFPTQALNFAFKD+YKK+F    + K +FWK+F GNLASGGAAGATS
Sbjct  68   AALWRGNLANVIRYFPTQALNFAFKDSYKKVFLEGLDKKKDFWKYFAGNLASGGAAGATS  127

Query  390  LMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIAY  569
            L  VYPLDFARTRLAADVGK GA R+F GL DCL KV KSDG  GLY+GF VSV GII Y
Sbjct  128  LCFVYPLDFARTRLAADVGK-GAGREFKGLADCLIKVVKSDGPIGLYRGFFVSVQGIIIY  186

Query  570  RACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSGGKTI  749
            RA YFG +DT K VL SEGK +    + +AQVVT  SG++SYP DTVRRR+MMQSG K I
Sbjct  187  RAAYFGLFDTAKMVLASEGKLNFFIAWAIAQVVTVGSGILSYPWDTVRRRMMMQSGRKDI  246

Query  750  MYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
            +Y  T+DC  KI  NEG  A FKGALSN+FRG G +LVL +YDE+Q +
Sbjct  247  LYKNTLDCAKKIIANEGMSAMFKGALSNVFRGTGGALVLAIYDEIQKF  294



>ref|NP_001120750.1| ADP/ATP translocase 1 [Ovis aries]
 gb|ACC93603.1| SLC25A4 [Ovis aries]
Length=298

 Score =   355 bits (911),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 188/291 (65%), Positives = 230/291 (79%), Gaps = 5/291 (2%)
 Frame = +3

Query  36   NFMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEG  209
            +F+ DF  GG++AA+SKTAVAPIERVKLLLQ Q A+ +++  K+Y GI+DC+ R+PKE+G
Sbjct  7    SFLKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG  66

Query  210  ISAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaT  386
              +FWRGNLANVIRYFPTQALNFAFKD YK+IF    +   +FW++F GNLASGGAAGAT
Sbjct  67   FLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGAT  126

Query  387  SLMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIA  566
            SL  VYPLDFARTRLAADVGK  A+R+FTGL +C+TK++KSDG +GLYQGF VSV GII 
Sbjct  127  SLCFVYPLDFARTRLAADVGKGAAQREFTGLGNCITKIFKSDGLRGLYQGFNVSVQGIII  186

Query  567  YRACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSG--G  740
            YRA YFG YDT K +L       I+  +++AQ VTA +GLVSYP DTVRRR+MMQSG  G
Sbjct  187  YRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKG  246

Query  741  KTIMYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAY  893
              IMY  T+DC+ KI K+EG KAFFKGA SN+ RG G + VLVLYDE++ +
Sbjct  247  ADIMYTXTVDCWRKIAKDEGPKAFFKGAWSNVLRGTGGAFVLVLYDEIKKF  297



>emb|CDJ80343.1| Mitochondrial substrate solute carrier domain containing protein 
[Haemonchus contortus]
Length=297

 Score =   355 bits (911),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 196/289 (68%), Positives = 227/289 (79%), Gaps = 4/289 (1%)
 Frame = +3

Query  39   FMLDFALGGISAAVSKTAVAPIERVKLLLQTQDANAKLT--KKYTGIVDCLTRVPKEEGI  212
            F +D A GG +AA+SKTAVAPIERVKLLLQ QDA++ +   K+Y GI+D L RVPKE+G 
Sbjct  10   FFIDLASGGTAAAISKTAVAPIERVKLLLQVQDASSTIAVDKRYKGIIDVLVRVPKEQGF  69

Query  213  SAFWRGNLANVIRYFPTQALNFAFKDTYKKIFCP-YNPKTEFWKfffgnlasggaagaTS  389
            +A WRGNLANVIRYFPTQALNFAFKD+YKKIF    + K +FWKFF GNLASGGAAGATS
Sbjct  70   AALWRGNLANVIRYFPTQALNFAFKDSYKKIFLEGLDKKKDFWKFFAGNLASGGAAGATS  129

Query  390  LMVVYPLDFARTRLAADVGKTGAERQFTGLVDCLTKVYKSDGYKGLYQGFGVSVLGIIAY  569
            L  VYPLDFARTRLAADVGK GA R+F GL+DCL KV KSDG  GLY+GF VSV GII Y
Sbjct  130  LCFVYPLDFARTRLAADVGK-GAGREFKGLLDCLIKVTKSDGPIGLYRGFFVSVQGIIIY  188

Query  570  RACYFGGYDTLKRVLFSEGKTSILFKFLVAQVVTAASGLVSYPLDTVRRRLMMQSGGKTI  749
            RA YFG +DT K +L SEGK +    + +AQVVT  SG++SYP DTVRRR+MMQSG K I
Sbjct  189  RAAYFGLFDTAKMLLASEGKLNFFVAWAIAQVVTVGSGILSYPWDTVRRRMMMQSGRKDI  248

Query  750  MYNGTMDCFAKIYKNEGGKAFFKGALSNIFRGMGASLVLVLYDEMQAYF  896
            +Y  T+DC  KI KNEG  A FKGALSN+FRG G +LVL +YDE+Q + 
Sbjct  249  LYKNTLDCAKKIIKNEGIGAMFKGALSNVFRGTGGALVLAIYDEIQKFL  297



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1887598073020