BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13303_g1_i1 len=5873 path=[75:0-230 36:231-5872]

Length=5873
                                                                      Score     E

ref|XP_010317858.1|  PREDICTED: protein RRP5 homolog                   2680   0.0      
ref|XP_009798479.1|  PREDICTED: protein RRP5 homolog isoform X2        2679   0.0      
ref|XP_009798470.1|  PREDICTED: protein RRP5 homolog isoform X1        2677   0.0      
ref|XP_010653854.1|  PREDICTED: protein RRP5 homolog                   2541   0.0      
emb|CBI29966.3|  unnamed protein product                               2496   0.0      
ref|XP_011078793.1|  PREDICTED: LOW QUALITY PROTEIN: protein RRP5...   2487   0.0      
emb|CDP14292.1|  unnamed protein product                               2474   0.0      
ref|XP_007029112.1|  RNA binding,RNA binding isoform 1                 2472   0.0      
ref|XP_006481689.1|  PREDICTED: protein RRP5 homolog isoform X2        2457   0.0      
ref|XP_008241151.1|  PREDICTED: protein RRP5 homolog                   2451   0.0      
ref|XP_006481688.1|  PREDICTED: protein RRP5 homolog isoform X1        2450   0.0      
ref|XP_010087548.1|  Protein RRP5-like protein                         2436   0.0      
gb|KDP21906.1|  hypothetical protein JCGZ_03044                        2406   0.0      
ref|XP_006429952.1|  hypothetical protein CICLE_v10013867mg            2394   0.0      
ref|XP_007029113.1|  RNA binding,RNA binding isoform 2                 2393   0.0      
ref|XP_010257601.1|  PREDICTED: protein RRP5 homolog                   2382   0.0      
ref|XP_011039519.1|  PREDICTED: protein RRP5 homolog                   2378   0.0      
ref|XP_007203056.1|  hypothetical protein PRUPE_ppa000079mg            2357   0.0      
gb|EYU20674.1|  hypothetical protein MIMGU_mgv1a000093mg               2356   0.0      
gb|KHF99545.1|  Protein RRP5                                           2349   0.0      
ref|XP_010058493.1|  PREDICTED: protein RRP5 homolog                   2297   0.0      
ref|XP_006575179.1|  PREDICTED: protein RRP5 homolog isoform X1        2284   0.0      
ref|XP_004303371.1|  PREDICTED: protein RRP5 homolog                   2280   0.0      
ref|XP_006575180.1|  PREDICTED: protein RRP5 homolog isoform X2        2278   0.0      
ref|XP_010557958.1|  PREDICTED: protein RRP5 homolog isoform X2        2278   0.0      
ref|XP_010557957.1|  PREDICTED: protein RRP5 homolog isoform X1        2274   0.0      
ref|XP_006587176.1|  PREDICTED: protein RRP5 homolog isoform X2        2256   0.0      
ref|XP_006587175.1|  PREDICTED: protein RRP5 homolog isoform X1        2256   0.0      
ref|XP_002322744.2|  hypothetical protein POPTR_0016s06250g            2250   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006587177.1|  PREDICTED: protein RRP5 homolog isoform X3        2248   0.0      
ref|XP_004514152.1|  PREDICTED: protein RRP5 homolog                   2219   0.0      
gb|KHN00023.1|  Protein RRP5 like                                      2217   0.0      
gb|KGN54856.1|  hypothetical protein Csa_4G553660                      2217   0.0      
ref|XP_008442208.1|  PREDICTED: LOW QUALITY PROTEIN: protein RRP5...   2212   0.0      
ref|XP_010696324.1|  PREDICTED: protein RRP5 homolog                   2191   0.0      
gb|KEH41780.1|  pre-rRNA processing protein Rrp5                       2191   0.0      
gb|KFK38561.1|  hypothetical protein AALP_AA3G129700                   2184   0.0      
ref|XP_006407387.1|  hypothetical protein EUTSA_v10019877mg            2183   0.0      
ref|XP_008789163.1|  PREDICTED: protein RRP5 homolog                   2182   0.0      
ref|XP_007145812.1|  hypothetical protein PHAVU_007G270000g            2180   0.0      
ref|XP_004144698.1|  PREDICTED: protein RRP5 homolog                   2179   0.0      
ref|XP_010498340.1|  PREDICTED: protein RRP5 homolog                   2161   0.0      
ref|XP_010934562.1|  PREDICTED: protein RRP5 homolog isoform X2        2161   0.0      
ref|XP_010934559.1|  PREDICTED: protein RRP5 homolog isoform X1        2156   0.0      
emb|CDY01077.1|  BnaC05g41230D                                         2154   0.0      
emb|CDY08474.1|  BnaA05g27100D                                         2149   0.0      
ref|XP_009146661.1|  PREDICTED: protein RRP5 homolog isoform X2        2144   0.0      
ref|XP_009146660.1|  PREDICTED: protein RRP5 homolog isoform X1        2144   0.0      
ref|XP_009121016.1|  PREDICTED: protein RRP5 homolog                   2124   0.0      
ref|NP_187803.4|  protein ribosomal RNA processing 5                   2120   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010489787.1|  PREDICTED: protein RRP5 homolog                   2099   0.0      
ref|XP_009407776.1|  PREDICTED: protein RRP5 homolog                   2093   0.0      
gb|KHN22182.1|  rRNA biogenesis protein rrp5                           2086   0.0      
dbj|BAB03107.1|  pre-rRNA processing protein RRP5                      2033   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006858995.1|  hypothetical protein AMTR_s00068p00137340         2029   0.0      
gb|EPS59007.1|  hypothetical protein M569_15804                        2025   0.0      
ref|XP_010227625.1|  PREDICTED: protein RRP5 homolog                   1955   0.0      
ref|XP_002884876.1|  S1 RNA-binding domain-containing protein          1938   0.0      
ref|XP_008652169.1|  PREDICTED: protein RRP5 homolog isoform X2        1937   0.0      
ref|XP_008652168.1|  PREDICTED: protein RRP5 homolog isoform X1        1937   0.0      
ref|XP_004955773.1|  PREDICTED: protein RRP5 homolog                   1934   0.0      
gb|EEE66766.1|  hypothetical protein OsJ_23484                         1926   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006296818.1|  hypothetical protein CARUB_v10012800mg            1916   0.0      
ref|XP_002459519.1|  hypothetical protein SORBIDRAFT_02g006000         1865   0.0      Sorghum bicolor [broomcorn]
ref|XP_009623835.1|  PREDICTED: protein RRP5 homolog                   1861   0.0      
gb|EMS48920.1|  rRNA biogenesis protein rrp5                           1844   0.0      
ref|XP_007029114.1|  RNA binding,RNA binding isoform 3                 1835   0.0      
gb|EEC81702.1|  hypothetical protein OsI_25303                         1831   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_006657541.1|  PREDICTED: protein RRP5 homolog                   1779   0.0      
gb|KDO70795.1|  hypothetical protein CISIN_1g0001731mg                 1712   0.0      
gb|KDO70796.1|  hypothetical protein CISIN_1g0001731mg                 1702   0.0      
dbj|BAC79783.2|  putative pre-rRNA processing protein RRP5             1701   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|KDO70799.1|  hypothetical protein CISIN_1g0001731mg                 1630   0.0      
gb|KDO70800.1|  hypothetical protein CISIN_1g0001731mg                 1620   0.0      
ref|XP_002531584.1|  programmed cell death protein, putative           1537   0.0      Ricinus communis
gb|AAG51058.1|AC069473_20  rRNA biogenesis protein, putative, 3' ...   1518   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KDO70801.1|  hypothetical protein CISIN_1g0001731mg                 1491   0.0      
ref|XP_004166831.1|  PREDICTED: protein RRP5 homolog                   1425   0.0      
ref|XP_001768429.1|  predicted protein                                 1346   0.0      
ref|XP_008387226.1|  PREDICTED: protein RRP5 homolog                   1345   0.0      
emb|CDY47905.1|  BnaAnng09370D                                         1332   0.0      
ref|XP_002971843.1|  hypothetical protein SELMODRAFT_451253            1300   0.0      
gb|EMT17935.1|  rRNA biogenesis protein rrp5                           1217   0.0      
ref|XP_002972371.1|  hypothetical protein SELMODRAFT_451250            1179   0.0      
gb|AAF23213.1|AC016795_26  putative pre-rRNA processing protein, ...   1161   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008350258.1|  PREDICTED: LOW QUALITY PROTEIN: rRNA biogene...   1148   0.0      
tpg|DAA59938.1|  TPA: hypothetical protein ZEAMMB73_957052             1134   0.0      
ref|XP_009631714.1|  PREDICTED: protein RRP5 homolog                    839   0.0      
ref|XP_010464942.1|  PREDICTED: protein RRP5 homolog                    837   0.0      
emb|CDY69691.1|  BnaCnng64810D                                          778   0.0      
emb|CDY69738.1|  BnaCnng65100D                                          776   0.0      
ref|XP_002531583.1|  programmed cell death protein, putative            766   0.0      Ricinus communis
emb|CDY47904.1|  BnaAnng09360D                                          786   0.0      
ref|XP_004161672.1|  PREDICTED: LOW QUALITY PROTEIN: protein RRP5...    741   0.0      
gb|KDO70789.1|  hypothetical protein CISIN_1g0001732mg                  738   0.0      
ref|NP_001059139.1|  Os07g0203300                                       712   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_005647924.1|  hypothetical protein COCSUDRAFT_28807              676   0.0      
ref|XP_010468130.1|  PREDICTED: protein RRP5 homolog                    655   0.0      
emb|CEF99246.1|  Suppressor of forked                                   663   0.0      
ref|XP_003081436.1|  rRNA processing protein Rrp5 (ISS)                 663   0.0      
ref|XP_001419873.1|  predicted protein                                  626   0.0      Ostreococcus lucimarinus CCE9901
ref|XP_002504340.1|  predicted protein                                  621   0.0      Micromonas commoda
ref|XP_004334641.1|  S1 RNA binding domain containing protein           610   5e-180   
ref|XP_007510306.1|  predicted protein                                  578   3e-168   
emb|CCI11234.1|  unnamed protein product                                554   2e-160   
gb|KDO70793.1|  hypothetical protein CISIN_1g0001732mg                  506   2e-158   
ref|XP_002954137.1|  rRNA processing protein Rrp5/programmed cell...    549   1e-157   
dbj|BAK04508.1|  predicted protein                                      495   2e-154   
ref|XP_005834243.1|  hypothetical protein GUITHDRAFT_137461             504   2e-145   
ref|XP_008862834.1|  hypothetical protein H310_01497                    457   1e-128   
gb|ETK91126.1|  hypothetical protein L915_05266                         457   3e-128   
gb|ETP48926.1|  hypothetical protein F442_05459                         456   6e-128   
gb|ETL97664.1|  hypothetical protein L917_05106                         455   1e-127   
gb|ETO79951.1|  hypothetical protein F444_05454                         455   1e-127   
gb|ETI51209.1|  hypothetical protein F443_05409                         455   1e-127   
gb|ETL44499.1|  hypothetical protein L916_05221                         455   1e-127   
ref|XP_008902842.1|  hypothetical protein PPTG_09583                    455   1e-127   
gb|ETP20972.1|  hypothetical protein F441_05416                         455   1e-127   
ref|XP_004989312.1|  hypothetical protein PTSG_12966                    447   6e-125   
ref|XP_005154602.1|  PREDICTED: protein RRP5 homolog                    443   5e-124   
tpg|DAA59939.1|  TPA: hypothetical protein ZEAMMB73_130902              400   4e-123   
ref|XP_009085460.1|  PREDICTED: protein RRP5 homolog                    440   5e-123   
ref|XP_009910115.1|  PREDICTED: LOW QUALITY PROTEIN: protein RRP5...    439   7e-123   
ref|XP_003787398.1|  PREDICTED: protein RRP5 homolog                    439   2e-122   
ref|XP_421739.4|  PREDICTED: protein RRP5 homolog isoform X6            437   4e-122   Gallus gallus [bantam]
gb|AAI11041.1|  PDCD11 protein                                          432   4e-122   Homo sapiens [man]
gb|AAH49838.1|  PDCD11 protein                                          431   7e-122   Homo sapiens [man]
gb|EPQ15169.1|  Protein RRP5 like protein                               436   8e-122   
ref|XP_005508595.1|  PREDICTED: protein RRP5 homolog                    436   8e-122   
ref|XP_005878278.1|  PREDICTED: protein RRP5 homolog isoform X1         436   9e-122   
ref|XP_010624754.1|  PREDICTED: protein RRP5 homolog isoform X3         436   9e-122   
ref|XP_010624753.1|  PREDICTED: protein RRP5 homolog isoform X2         436   1e-121   
ref|XP_010407659.1|  PREDICTED: protein RRP5 homolog                    436   1e-121   
ref|XP_006166456.1|  PREDICTED: LOW QUALITY PROTEIN: protein RRP5...    436   1e-121   
ref|XP_010624752.1|  PREDICTED: protein RRP5 homolog isoform X1         436   1e-121   
ref|XP_008932318.1|  PREDICTED: protein RRP5 homolog                    435   2e-121   
ref|XP_009276113.1|  PREDICTED: protein RRP5 homolog                    435   2e-121   
ref|XP_005481186.1|  PREDICTED: protein RRP5 homolog                    435   2e-121   
ref|XP_006756519.1|  PREDICTED: protein RRP5 homolog isoform X1         435   3e-121   
gb|AAH64486.1|  PDCD11 protein                                          429   3e-121   Homo sapiens [man]
ref|XP_006756521.1|  PREDICTED: protein RRP5 homolog isoform X3         434   4e-121   
ref|XP_009326711.1|  PREDICTED: protein RRP5 homolog                    434   4e-121   
ref|XP_010563090.1|  PREDICTED: protein RRP5 homolog                    434   4e-121   
ref|XP_009499859.1|  PREDICTED: protein RRP5 homolog                    434   5e-121   
ref|XP_005269704.1|  PREDICTED: protein RRP5 homolog isoform X1         433   7e-121   
ref|NP_055791.1|  protein RRP5 homolog                                  433   7e-121   Homo sapiens [man]
ref|XP_005416455.1|  PREDICTED: protein RRP5 homolog                    433   8e-121   
ref|XP_009008468.1|  PREDICTED: protein RRP5 homolog isoform X3         433   9e-121   
ref|XP_009953050.1|  PREDICTED: protein RRP5 homolog                    432   1e-120   
ref|XP_010080219.1|  PREDICTED: protein RRP5 homolog isoform X1         432   2e-120   
dbj|BAA11502.1|  KIAA0185                                               432   2e-120   Homo sapiens [man]
dbj|BAG10300.1|  RRP5 protein homolog                                   432   2e-120   
ref|XP_008142487.1|  PREDICTED: protein RRP5 homolog                    431   3e-120   
ref|XP_009457466.1|  PREDICTED: protein RRP5 homolog isoform X1         431   3e-120   
ref|XP_508013.3|  PREDICTED: protein RRP5 homolog isoform X2            431   4e-120   Pan troglodytes
gb|EMS58523.1|  Protein RRP5-like protein                               393   5e-120   
ref|XP_009008467.1|  PREDICTED: protein RRP5 homolog isoform X2         431   5e-120   
ref|XP_009008466.1|  PREDICTED: protein RRP5 homolog isoform X1         431   6e-120   
ref|XP_008652170.1|  PREDICTED: protein RRP5 homolog                    395   6e-120   
ref|XP_010307786.1|  PREDICTED: protein RRP5 homolog                    430   7e-120   
ref|XP_010009634.1|  PREDICTED: protein RRP5 homolog                    430   9e-120   
ref|XP_007962202.1|  PREDICTED: protein RRP5 homolog isoform X1         430   1e-119   
ref|XP_010080220.1|  PREDICTED: protein RRP5 homolog isoform X2         429   1e-119   
ref|XP_008488612.1|  PREDICTED: protein RRP5 homolog                    429   1e-119   
ref|XP_007962203.1|  PREDICTED: protein RRP5 homolog isoform X2         429   2e-119   
ref|XP_004909385.1|  PREDICTED: LOW QUALITY PROTEIN: protein RRP5...    429   2e-119   
ref|XP_010354505.1|  PREDICTED: protein RRP5 homolog isoform X2         429   2e-119   
ref|XP_010354504.1|  PREDICTED: protein RRP5 homolog isoform X1         429   2e-119   
ref|XP_005437307.1|  PREDICTED: protein RRP5 homolog                    429   2e-119   
ref|XP_009663893.1|  PREDICTED: protein RRP5 homolog isoform X2         428   2e-119   
ref|XP_009663892.1|  PREDICTED: protein RRP5 homolog isoform X1         428   2e-119   
ref|XP_004866538.1|  PREDICTED: protein RRP5 homolog                    428   4e-119   
ref|NP_001101074.2|  protein RRP5 homolog                               428   4e-119   Rattus norvegicus [brown rat]
ref|XP_009636363.1|  PREDICTED: LOW QUALITY PROTEIN: protein RRP5...    427   4e-119   
ref|XP_005520764.1|  PREDICTED: protein RRP5 homolog                    427   5e-119   
ref|XP_010712959.1|  PREDICTED: LOW QUALITY PROTEIN: protein RRP5...    427   6e-119   
ref|XP_006216414.1|  PREDICTED: protein RRP5 homolog                    427   6e-119   
ref|XP_006183046.1|  PREDICTED: protein RRP5 homolog                    427   7e-119   
ref|XP_006096002.1|  PREDICTED: protein RRP5 homolog                    427   1e-118   
ref|XP_008605603.1|  hypothetical protein SDRG_01830                    426   1e-118   
ref|XP_003904261.1|  PREDICTED: protein RRP5 homolog isoform X3         426   1e-118   
ref|XP_010354506.1|  PREDICTED: protein RRP5 homolog isoform X3         426   1e-118   
ref|XP_009213551.1|  PREDICTED: protein RRP5 homolog isoform X1         426   1e-118   
ref|XP_009213552.1|  PREDICTED: protein RRP5 homolog isoform X2         426   1e-118   
ref|XP_009474297.1|  PREDICTED: protein RRP5 homolog isoform X2         426   2e-118   
gb|EHH19346.1|  hypothetical protein EGK_20032                          426   2e-118   
ref|XP_009998400.1|  PREDICTED: protein RRP5 homolog isoform X3         425   2e-118   
ref|XP_005566405.1|  PREDICTED: protein RRP5 homolog isoform X2         426   2e-118   
ref|XP_005566404.1|  PREDICTED: protein RRP5 homolog isoform X1         426   3e-118   
ref|XP_010173696.1|  PREDICTED: LOW QUALITY PROTEIN: protein RRP5...    425   3e-118   
ref|XP_002193665.2|  PREDICTED: protein RRP5 homolog                    425   3e-118   Taeniopygia guttata
ref|XP_009474296.1|  PREDICTED: protein RRP5 homolog isoform X1         425   3e-118   
ref|XP_009998398.1|  PREDICTED: protein RRP5 homolog isoform X1         425   3e-118   
ref|XP_009865038.1|  PREDICTED: LOW QUALITY PROTEIN: protein RRP5...    425   4e-118   
ref|XP_009554059.1|  PREDICTED: protein RRP5 homolog                    424   4e-118   
ref|XP_004265938.1|  PREDICTED: protein RRP5 homolog isoform 2          425   4e-118   
ref|XP_009998399.1|  PREDICTED: protein RRP5 homolog isoform X2         424   4e-118   
ref|XP_004265937.1|  PREDICTED: protein RRP5 homolog isoform 1          425   4e-118   
ref|XP_009701863.1|  PREDICTED: LOW QUALITY PROTEIN: protein RRP5...    424   6e-118   
ref|XP_007187277.1|  PREDICTED: protein RRP5 homolog isoform X2         424   6e-118   
ref|XP_007187276.1|  PREDICTED: protein RRP5 homolog isoform X1         424   7e-118   
ref|XP_008642084.1|  PREDICTED: protein RRP5 homolog                    424   7e-118   
ref|XP_009489276.1|  PREDICTED: protein RRP5 homolog                    424   8e-118   
ref|XP_009574119.1|  PREDICTED: LOW QUALITY PROTEIN: protein RRP5...    424   9e-118   
ref|XP_004050088.1|  PREDICTED: protein RRP5 homolog                    424   9e-118   
ref|XP_005980813.1|  PREDICTED: protein RRP5 homolog                    424   1e-117   
ref|XP_010969272.1|  PREDICTED: protein RRP5 homolog                    424   1e-117   
ref|XP_008947621.1|  PREDICTED: protein RRP5 homolog                    422   2e-117   
ref|XP_009940336.1|  PREDICTED: protein RRP5 homolog                    422   3e-117   
gb|EAW49640.1|  programmed cell death 11, isoform CRA_b                 422   3e-117   
ref|XP_005048644.1|  PREDICTED: protein RRP5 homolog isoform X1         422   4e-117   
ref|XP_004020210.1|  PREDICTED: protein RRP5 homolog                    422   4e-117   
ref|XP_005048646.1|  PREDICTED: protein RRP5 homolog isoform X3         421   4e-117   
ref|XP_009906512.1|  PREDICTED: protein RRP5 homolog                    421   7e-117   
ref|XP_009083159.1|  PREDICTED: LOW QUALITY PROTEIN: protein RRP5...    421   8e-117   
ref|XP_010127609.1|  PREDICTED: protein RRP5 homolog                    420   1e-116   
dbj|BAE24688.1|  unnamed protein product                                416   1e-116   Mus musculus [mouse]
ref|XP_010857719.1|  PREDICTED: protein RRP5 homolog                    421   1e-116   
ref|XP_009978432.1|  PREDICTED: protein RRP5 homolog                    420   2e-116   
ref|XP_008540795.1|  PREDICTED: protein RRP5 homolog isoform X1         419   2e-116   
ref|XP_005888100.1|  PREDICTED: protein RRP5 homolog                    419   2e-116   
ref|XP_008540797.1|  PREDICTED: protein RRP5 homolog isoform X2         419   3e-116   
ref|XP_005026522.1|  PREDICTED: protein RRP5 homolog isoform X1         419   4e-116   
ref|XP_009879840.1|  PREDICTED: LOW QUALITY PROTEIN: protein RRP5...    419   4e-116   
gb|EOA96406.1|  Protein RRP5-like protein                               418   5e-116   
ref|XP_535003.3|  PREDICTED: protein RRP5 homolog                       419   5e-116   Canis lupus familiaris [dogs]
ref|XP_005602324.1|  PREDICTED: protein RRP5 homolog isoform X2         419   5e-116   
ref|XP_010587316.1|  PREDICTED: protein RRP5 homolog isoform X2         418   6e-116   
ref|XP_007130625.1|  PREDICTED: protein RRP5 homolog isoform X2         418   6e-116   
ref|XP_003409186.1|  PREDICTED: protein RRP5 homolog isoform X1         418   6e-116   
dbj|BAC97890.1|  mKIAA0185 protein                                      418   6e-116   Mus musculus [mouse]
ref|NP_035183.2|  protein RRP5 homolog                                  418   7e-116   Mus musculus [mouse]
gb|AAH70468.1|  Programmed cell death 11                                418   8e-116   Mus musculus [mouse]
ref|XP_005698481.1|  PREDICTED: protein RRP5 homolog isoform X2         418   8e-116   
ref|XP_001499541.3|  PREDICTED: protein RRP5 homolog isoform X1         418   8e-116   Equus caballus [domestic horse]
ref|XP_004370161.1|  PREDICTED: protein RRP5 homolog                    418   8e-116   
ref|XP_005698480.1|  PREDICTED: protein RRP5 homolog isoform X1         418   8e-116   
ref|XP_006831373.1|  PREDICTED: protein RRP5 homolog                    417   1e-115   
ref|XP_009805522.1|  PREDICTED: LOW QUALITY PROTEIN: protein RRP5...    417   1e-115   
ref|XP_005698482.1|  PREDICTED: protein RRP5 homolog isoform X3         417   1e-115   
ref|XP_010281642.1|  PREDICTED: protein RRP5 homolog isoform X1         417   1e-115   
dbj|BAE28246.1|  unnamed protein product                                412   1e-115   Mus musculus [mouse]
ref|XP_005352491.1|  PREDICTED: protein RRP5 homolog                    417   1e-115   
ref|XP_008576345.1|  PREDICTED: protein RRP5 homolog isoform X2         417   1e-115   
ref|XP_010206934.1|  PREDICTED: protein RRP5 homolog                    417   2e-115   
ref|XP_008576343.1|  PREDICTED: protein RRP5 homolog isoform X1         417   2e-115   
ref|XP_007130624.1|  PREDICTED: protein RRP5 homolog isoform X1         417   2e-115   
ref|XP_010223262.1|  PREDICTED: LOW QUALITY PROTEIN: protein RRP5...    417   2e-115   
ref|XP_010281643.1|  PREDICTED: protein RRP5 homolog isoform X2         417   2e-115   
ref|NP_001095573.1|  protein RRP5 homolog                               416   3e-115   Bos taurus [bovine]
ref|XP_007470493.1|  PREDICTED: LOW QUALITY PROTEIN: protein RRP5...    416   5e-115   
ref|XP_005333660.1|  PREDICTED: protein RRP5 homolog                    415   7e-115   
ref|XP_005225611.1|  PREDICTED: protein RRP5 homolog isoform X1         415   9e-115   
tpg|DAA14811.1|  TPA: programmed cell death 11                          415   1e-114   
ref|XP_010131602.1|  PREDICTED: protein RRP5 homolog                    413   2e-114   
ref|XP_004659438.1|  PREDICTED: protein RRP5 homolog                    414   2e-114   
ref|XP_006067815.1|  PREDICTED: protein RRP5 homolog isoform X2         414   2e-114   
ref|XP_006067814.1|  PREDICTED: protein RRP5 homolog isoform X1         414   2e-114   
ref|XP_004428085.1|  PREDICTED: protein RRP5 homolog isoform 1          413   3e-114   
ref|XP_004428086.1|  PREDICTED: protein RRP5 homolog isoform 2          413   3e-114   
gb|KFM28261.1|  RRP5-like protein                                       410   3e-114   
ref|XP_007080304.1|  PREDICTED: protein RRP5 homolog isoform X1         413   3e-114   
ref|XP_007080305.1|  PREDICTED: protein RRP5 homolog isoform X2         413   3e-114   
gb|ELK04989.1|  Protein RRP5 like protein                               414   5e-114   
ref|XP_003994430.1|  PREDICTED: LOW QUALITY PROTEIN: protein RRP5...    411   2e-113   
gb|EFB27668.1|  hypothetical protein PANDA_001797                       410   2e-113   Ailuropoda melanoleuca
ref|XP_008062393.1|  PREDICTED: protein RRP5 homolog                    410   3e-113   
ref|XP_009523037.1|  hypothetical protein PHYSODRAFT_490560             410   3e-113   
ref|XP_002913967.1|  PREDICTED: protein RRP5 homolog                    410   3e-113   
ref|XP_004749399.1|  PREDICTED: protein RRP5 homolog isoform X2         410   3e-113   
ref|XP_006921013.1|  PREDICTED: protein RRP5 homolog                    409   4e-113   
ref|XP_004794993.1|  PREDICTED: protein RRP5 homolog isoform X3         410   4e-113   
ref|XP_006739528.1|  PREDICTED: protein RRP5 homolog                    409   4e-113   
ref|XP_004749398.1|  PREDICTED: protein RRP5 homolog isoform X1         410   4e-113   
ref|XP_008104788.1|  PREDICTED: protein RRP5 homolog isoform X1         409   4e-113   
ref|XP_008104790.1|  PREDICTED: protein RRP5 homolog isoform X3         409   4e-113   
ref|XP_008104789.1|  PREDICTED: protein RRP5 homolog isoform X2         409   4e-113   
gb|KDO28237.1|  hypothetical protein SPRG_06286                         409   5e-113   
gb|ELR61959.1|  Protein RRP5-like protein                               401   2e-112   
ref|XP_004616447.1|  PREDICTED: LOW QUALITY PROTEIN: protein RRP5...    407   2e-112   
ref|XP_004631631.1|  PREDICTED: protein RRP5 homolog                    407   2e-112   
gb|EHH64994.1|  hypothetical protein EGM_18331                          407   4e-112   
ref|XP_001105950.2|  PREDICTED: protein RRP5 homolog                    406   6e-112   
gb|ERE80911.1|  putative protein RRP5 like protein                      404   2e-111   
gb|ERE80910.1|  putative protein RRP5 like protein                      404   2e-111   
ref|XP_003475276.1|  PREDICTED: protein RRP5 homolog                    404   3e-111   
ref|XP_003512187.1|  PREDICTED: protein RRP5 homolog isoform X1         404   3e-111   
ref|XP_004402058.1|  PREDICTED: protein RRP5 homolog                    403   4e-111   
ref|XP_002718640.1|  PREDICTED: protein RRP5 homolog                    403   5e-111   
ref|XP_007938068.1|  PREDICTED: protein RRP5 homolog                    403   6e-111   
ref|XP_007423301.1|  PREDICTED: protein RRP5 homolog isoform X2         401   1e-110   
ref|XP_003755479.1|  PREDICTED: protein RRP5 homolog                    401   2e-110   
ref|XP_006880025.1|  PREDICTED: protein RRP5 homolog                    400   4e-110   
ref|XP_007423300.1|  PREDICTED: protein RRP5 homolog isoform X1         399   7e-110   
ref|XP_004474045.1|  PREDICTED: protein RRP5 homolog isoform 2          399   1e-109   
ref|XP_004474044.1|  PREDICTED: protein RRP5 homolog isoform 1          399   1e-109   
ref|XP_010187074.1|  PREDICTED: LOW QUALITY PROTEIN: protein RRP5...    398   2e-109   
ref|XP_007628914.1|  PREDICTED: LOW QUALITY PROTEIN: protein RRP5...    398   3e-109   
ref|XP_004701004.1|  PREDICTED: protein RRP5 homolog                    397   4e-109   
ref|XP_005403868.1|  PREDICTED: protein RRP5 homolog isoform X2         396   7e-109   
ref|XP_005403867.1|  PREDICTED: protein RRP5 homolog isoform X1         396   7e-109   
ref|XP_007530608.1|  PREDICTED: protein RRP5 homolog                    396   1e-108   
ref|XP_005658894.1|  PREDICTED: protein RRP5 homolog                    396   2e-108   
ref|XP_004680525.1|  PREDICTED: protein RRP5 homolog                    394   4e-108   
ref|XP_007057934.1|  PREDICTED: protein RRP5 homolog                    393   7e-108   
ref|XP_789726.3|  PREDICTED: protein RRP5 homolog                       393   8e-108   
ref|XP_007784902.1|  hypothetical protein W97_08845                     392   1e-107   
ref|XP_007259121.1|  PREDICTED: protein RRP5 homolog                    391   2e-107   
ref|XP_008843904.1|  PREDICTED: protein RRP5 homolog                    392   3e-107   
ref|XP_008315591.1|  PREDICTED: protein RRP5 homolog                    390   9e-107   
ref|XP_008281079.1|  PREDICTED: protein RRP5 homolog                    388   3e-106   
ref|XP_007665837.1|  PREDICTED: protein RRP5 homolog isoform X2         387   8e-106   
ref|XP_007665838.1|  PREDICTED: protein RRP5 homolog isoform X3         386   1e-105   
ref|XP_007665835.1|  PREDICTED: protein RRP5 homolog isoform X1         386   1e-105   
ref|XP_006273719.1|  PREDICTED: protein RRP5 homolog                    386   1e-105   
gb|EHB18554.1|  RRP5-like protein                                       385   2e-105   
ref|XP_005735828.1|  PREDICTED: protein RRP5 homolog isoform X1         385   2e-105   
ref|XP_005735829.1|  PREDICTED: protein RRP5 homolog isoform X2         385   2e-105   
ref|XP_008684806.1|  PREDICTED: LOW QUALITY PROTEIN: protein RRP5...    386   2e-105   
gb|EGC41713.1|  ribosomal RNA processing protein RRP5                   385   3e-105   
ref|XP_005797325.1|  PREDICTED: protein RRP5 homolog                    384   3e-105   
ref|XP_005458592.1|  PREDICTED: protein RRP5 homolog isoform X2         384   4e-105   
ref|XP_003453834.1|  PREDICTED: protein RRP5 homolog isoform X1         384   5e-105   
ref|XP_006630880.1|  PREDICTED: protein RRP5 homolog                    384   5e-105   
emb|CCA14782.1|  rRNA biogenesis protein rrp5 putative                  384   7e-105   
ref|XP_008576346.1|  PREDICTED: protein RRP5 homolog isoform X3         383   8e-105   
ref|XP_006983383.1|  PREDICTED: protein RRP5 homolog                    384   1e-104   
ref|XP_005925072.1|  PREDICTED: protein RRP5 homolog                    383   1e-104   
ref|XP_004539010.1|  PREDICTED: protein RRP5 homolog                    383   1e-104   
ref|XP_004580287.1|  PREDICTED: protein RRP5 homolog                    383   2e-104   
ref|XP_007543257.1|  PREDICTED: protein RRP5 homolog                    382   3e-104   
ref|XP_006021352.1|  PREDICTED: protein RRP5 homolog                    380   8e-104   
ref|XP_009663895.1|  PREDICTED: protein RRP5 homolog isoform X3         379   1e-103   
gb|KIN04984.1|  hypothetical protein OIDMADRAFT_192583                  379   2e-103   
ref|XP_008407786.1|  PREDICTED: protein RRP5 homolog                    378   5e-103   
ref|XP_007740118.1|  hypothetical protein A1O5_01309                    378   5e-103   
dbj|BAG58043.1|  unnamed protein product                                372   8e-103   
ref|XP_006120929.1|  PREDICTED: LOW QUALITY PROTEIN: protein RRP5...    376   3e-102   
gb|EDL42026.1|  programmed cell death protein 11                        374   3e-102   
ref|XP_004322812.1|  PREDICTED: LOW QUALITY PROTEIN: protein RRP5...    374   1e-101   
ref|XP_008178042.1|  PREDICTED: protein RRP5 homolog                    374   2e-101   
ref|XP_004066290.1|  PREDICTED: protein RRP5 homolog                    371   7e-101   
ref|XP_001742789.1|  hypothetical protein                               370   7e-101   
gb|KFY48670.1|  hypothetical protein V495_01130                         370   2e-100   
ref|XP_010985430.1|  PREDICTED: protein RRP5 homolog                    367   5e-100   
ref|XP_003255151.1|  PREDICTED: protein RRP5 homolog                    368   7e-100   
gb|KHJ34359.1|  putative rrna biogenesis protein                        367   7e-100   
ref|XP_003066644.1|  S1 RNA binding domain containing protein           368   9e-100   
gb|KFX86754.1|  hypothetical protein V490_08870                         367   1e-99    
ref|XP_007288966.1|  rRNA biogenesis protein RRP5                       367   1e-99    
gb|KFZ08269.1|  hypothetical protein V502_09456                         365   4e-99    
gb|KFY07205.1|  hypothetical protein V492_07360                         364   9e-99    
gb|KFY96462.1|  hypothetical protein V500_02429                         364   1e-98    
ref|XP_008391606.1|  PREDICTED: uncharacterized protein LOC103453804    337   2e-98    
ref|XP_007873575.1|  hypothetical protein PNEG_01617                    361   3e-98    
gb|KFY46775.1|  hypothetical protein V494_00331                         363   3e-98    
ref|XP_005239097.1|  PREDICTED: protein RRP5 homolog                    357   4e-98    
gb|KFZ16501.1|  hypothetical protein V501_02182                         363   4e-98    
gb|EMP37610.1|  Protein RRP5 like protein                               364   5e-98    
gb|ESW97759.1|  rRNA biogenesis protein RRP5                            361   5e-98    
gb|KFY74368.1|  hypothetical protein V499_05594                         361   9e-98    
ref|XP_461694.2|  DEHA2G03410p                                          360   1e-97    
gb|KFY58354.1|  hypothetical protein V496_06184                         360   3e-97    
ref|XP_007801668.1|  hypothetical protein EPUS_07482                    359   4e-97    
emb|CCU76378.1|  rRNA biogenesis protein                                357   2e-96    
ref|XP_005566406.1|  PREDICTED: protein RRP5 homolog isoform X3         356   2e-96    
ref|XP_010871242.1|  PREDICTED: protein RRP5 homolog                    357   3e-96    
gb|ELR10630.1|  hypothetical protein GMDG_04899                         353   3e-95    
ref|XP_010732499.1|  PREDICTED: protein RRP5 homolog                    353   5e-95    
ref|XP_003972606.1|  PREDICTED: protein RRP5 homolog                    352   8e-95    
gb|ESZ98393.1|  hypothetical protein SBOR_1271                          350   2e-94    
gb|AAI26004.1|  LOC779090 protein                                       344   3e-93    
ref|XP_007479262.1|  PREDICTED: protein RRP5 homolog                    346   6e-93    
ref|NP_001122095.1|  programmed cell death 11                           345   9e-93    
ref|XP_010239254.1|  PREDICTED: LOW QUALITY PROTEIN: protein RRP5...    317   3e-92    
ref|XP_004915908.1|  PREDICTED: protein RRP5 homolog                    343   6e-92    
dbj|BAE36581.1|  unnamed protein product                                333   2e-91    
gb|EER45767.1|  U3 snoRNP-associated protein Rrp5                       338   1e-90    
ref|XP_001246553.1|  hypothetical protein CIMG_00324                    338   2e-90    
gb|EFW18380.1|  rRNA biogenesis protein RRP5                            336   7e-90    
dbj|BAG57188.1|  unnamed protein product                                320   4e-89    
gb|EMD41956.1|  hypothetical protein CERSUDRAFT_147388                  332   4e-89    
ref|XP_010758867.1|  hypothetical protein PADG_03443                    333   6e-89    
ref|XP_005160174.1|  PREDICTED: protein RRP5 homolog isoform X1         332   1e-88    
gb|KGY15985.1|  hypothetical protein PABG_11238                         332   2e-88    
ref|XP_002794361.1|  rRNA biogenesis protein RRP5                       331   3e-88    
gb|AAI17595.1|  Pdcd11 protein                                          328   4e-88    
ref|XP_005063211.1|  PREDICTED: protein RRP5 homolog                    328   1e-87    
gb|EDL94371.1|  programmed cell death protein 11 (predicted)            320   2e-87    
gb|EEQ91067.1|  rRNA biogenesis protein RRP5                            328   2e-87    
ref|XP_002629591.1|  rRNA biogenesis protein RRP5                       328   2e-87    
ref|NP_001082837.2|  protein RRP5 homolog                               328   3e-87    
ref|XP_004343024.1|  predicted protein                                  328   5e-87    
gb|EFW42804.2|  hypothetical protein CAOG_07936                         327   6e-87    
gb|EQL36161.1|  hypothetical protein BDFG_02402                         326   1e-86    
ref|XP_003064865.1|  predicted protein                                  323   1e-85    
ref|XP_007760981.1|  hypothetical protein A1O7_08802                    322   2e-85    
gb|KFY18394.1|  hypothetical protein V493_08660                         322   2e-85    
gb|KIJ21930.1|  hypothetical protein PAXINDRAFT_6058                    320   4e-85    
ref|XP_010157699.1|  PREDICTED: protein RRP5 homolog                    311   4e-85    
ref|XP_002169396.2|  PREDICTED: rRNA biogenesis protein RRP5-like       313   5e-85    
emb|CCF40910.1|  rRNA biogenesis protein RRP5                           316   7e-85    
emb|CDY67177.1|  BnaAnng23730D                                          290   9e-85    
ref|XP_006693139.1|  hypothetical protein CTHT_0026810                  319   1e-84    
ref|XP_003389387.1|  PREDICTED: protein RRP5 homolog                    318   3e-84    
ref|XP_006790926.1|  PREDICTED: protein RRP5 homolog                    317   3e-84    
ref|XP_003855051.1|  hypothetical protein MYCGRDRAFT_99211              317   4e-84    
ref|XP_003672526.1|  hypothetical protein NDAI_0K00920                  317   5e-84    
gb|AGO10941.1|  AaceriAFR566Cp                                          316   9e-84    
ref|XP_007674420.1|  hypothetical protein BAUCODRAFT_32189              316   1e-83    
ref|XP_005704580.1|  rRNA biogenesis protein rrp5                       316   1e-83    
ref|XP_002842909.1|  rRNA biogenesis protein RRP5                       315   3e-83    
gb|EPT04058.1|  hypothetical protein FOMPIDRAFT_1158141                 313   4e-83    
ref|XP_009008469.1|  PREDICTED: protein RRP5 homolog isoform X4         312   9e-83    
ref|XP_005850958.1|  hypothetical protein CHLNCDRAFT_19641              285   3e-82    
gb|EPY82602.1|  protein RRP5-like protein                               311   4e-82    
ref|XP_007378951.1|  U3 snoRNP-associated protein Rrp5                  310   5e-82    
gb|EXX54480.1|  Rrp5p                                                   307   4e-81    
ref|XP_007390713.1|  hypothetical protein PHACADRAFT_168722             306   5e-81    
gb|ESA19480.1|  hypothetical protein GLOINDRAFT_344092                  307   5e-81    
ref|XP_006681327.1|  hypothetical protein BATDEDRAFT_13567              306   8e-81    
gb|KIL71753.1|  hypothetical protein M378DRAFT_189127                   305   8e-81    
gb|KFH67310.1|  hypothetical protein MVEG_06044                         306   1e-80    
ref|XP_001702706.1|  RNA binding rRNA processing protein                302   3e-80    
gb|EFQ25150.1|  S1 RNA binding domain-containing protein                305   3e-80    
gb|KIK30329.1|  hypothetical protein PISMIDRAFT_645096                  303   5e-80    
emb|CDQ77761.1|  unnamed protein product                                301   7e-80    
ref|XP_007130626.1|  PREDICTED: protein RRP5 homolog isoform X3         302   1e-79    
ref|XP_007922512.1|  hypothetical protein MYCFIDRAFT_45277              303   2e-79    
ref|XP_009821187.1|  hypothetical protein H257_00285                    302   2e-79    
ref|XP_001631018.1|  predicted protein                                  301   3e-79    
ref|XP_008949278.1|  PREDICTED: protein RRP5 homolog                    301   6e-79    
ref|XP_002897878.1|  rRNA biogenesis protein rrp5                       296   2e-77    
ref|XP_006367754.1|  PREDICTED: protein RRP5 homolog                    267   4e-77    
dbj|BAB23064.2|  unnamed protein product                                268   2e-76    
gb|AAH55276.3|  Pdcd11 protein                                          267   5e-76    
emb|CDQ85272.1|  unnamed protein product                                291   7e-76    
ref|XP_007339627.1|  nucleic acid-binding protein                       289   1e-75    
gb|AAH38503.1|  Pdcd11 protein                                          268   4e-75    
ref|XP_009335886.1|  PREDICTED: protein RRP5 homolog                    260   5e-74    
ref|XP_001537857.1|  conserved hypothetical protein                     268   3e-73    
gb|AAI39595.1|  Pdcd11 protein                                          276   3e-73    
ref|XP_001621882.1|  hypothetical protein NEMVEDRAFT_v1g143331          257   7e-73    
dbj|GAM88985.1|  hypothetical protein ANO11243_070190                   281   8e-73    
dbj|GAA97773.1|  hypothetical protein E5Q_04452                         279   1e-72    
ref|XP_006815336.1|  PREDICTED: protein RRP5 homolog                    271   1e-72    
gb|EIE85010.1|  hypothetical protein RO3G_09720                         261   2e-72    
ref|XP_005834242.1|  hypothetical protein GUITHDRAFT_69529              257   2e-72    
ref|XP_002117420.1|  hypothetical protein TRIADDRAFT_61471              272   1e-71    
ref|XP_007417048.1|  hypothetical protein MELLADRAFT_22369              276   2e-71    
gb|KFP49786.1|  Protein RRP5                                            263   3e-71    
ref|XP_005239339.1|  PREDICTED: protein RRP5 homolog                    265   3e-71    
gb|KFP34471.1|  Protein RRP5                                            263   4e-71    
ref|XP_010153107.1|  PREDICTED: protein RRP5 homolog                    270   4e-71    
ref|XP_009052989.1|  hypothetical protein LOTGIDRAFT_144090             251   6e-71    
gb|KFQ88650.1|  Protein RRP5                                            262   8e-71    
gb|KFP98577.1|  Protein RRP5                                            262   8e-71    
gb|KFP15304.1|  Protein RRP5                                            262   9e-71    
gb|KGL90479.1|  Protein RRP5                                            262   1e-70    
gb|KFQ92227.1|  Protein RRP5                                            261   1e-70    
gb|KFZ57546.1|  Protein RRP5                                            261   1e-70    
gb|KFW76482.1|  Protein RRP5                                            261   1e-70    
gb|KFW70206.1|  Protein RRP5                                            261   2e-70    
gb|KFZ51108.1|  Protein RRP5                                            261   2e-70    
emb|CEJ03749.1|  hypothetical protein RMCBS344292_17727                 254   3e-70    
gb|KFM06586.1|  Protein RRP5                                            260   3e-70    
gb|EMC84384.1|  Protein RRP5 like protein                               259   5e-70    
emb|CEG75382.1|  hypothetical protein RMATCC62417_10433                 253   6e-70    
emb|CEJ03507.1|  hypothetical protein RMCBS344292_17489                 253   6e-70    
ref|XP_006756522.1|  PREDICTED: protein RRP5 homolog isoform X4         271   6e-70    
gb|KFV53011.1|  Protein RRP5                                            259   7e-70    
gb|KFV76050.1|  Protein RRP5                                            259   9e-70    
gb|KFW89317.1|  Protein RRP5                                            259   1e-69    
gb|KFQ38763.1|  Protein RRP5                                            258   1e-69    
ref|XP_010331662.1|  PREDICTED: protein RRP5 homolog                    271   1e-69    
ref|XP_009244052.1|  PREDICTED: LOW QUALITY PROTEIN: protein RRP5...    271   1e-69    
gb|KFP86282.1|  Protein RRP5                                            258   1e-69    
gb|KFP34919.1|  Protein RRP5                                            258   2e-69    
gb|KFV74675.1|  Protein RRP5                                            258   2e-69    
ref|XP_009973285.1|  PREDICTED: protein RRP5 homolog                    259   2e-69    
gb|KFM24726.1|  RRP5-like protein                                       249   5e-69    
ref|XP_009966679.1|  PREDICTED: LOW QUALITY PROTEIN: protein RRP5...    265   5e-69    
gb|KFP66703.1|  Protein RRP5                                            256   8e-69    
ref|XP_002173738.1|  U3 snoRNP-associated protein Rrp5                  267   2e-68    
ref|XP_006012482.1|  PREDICTED: protein RRP5 homolog                    256   3e-68    
ref|XP_005718821.1|  unnamed protein product                            266   3e-68    
ref|XP_001800560.1|  hypothetical protein SNOG_10281                    266   4e-68    
ref|XP_008025792.1|  hypothetical protein SETTUDRAFT_116319             265   6e-68    
gb|EPZ35774.1|  hypothetical protein O9G_003257                         264   1e-67    
gb|EPX71929.1|  U3 snoRNP-associated protein Rrp5                       263   3e-67    
gb|EPY49902.1|  U3 snoRNP-associated protein Rrp5                       260   2e-66    
gb|EPB82861.1|  hypothetical protein HMPREF1544_10377                   259   2e-66    
gb|KFO98257.1|  Protein RRP5                                            249   2e-66    
ref|XP_001742788.1|  hypothetical protein                               238   2e-66    
gb|EMD88002.1|  hypothetical protein COCHEDRAFT_1183202                 260   2e-66    
ref|XP_002117421.1|  hypothetical protein TRIADDRAFT_32523              238   4e-66    
gb|KFP74307.1|  Protein RRP5                                            248   4e-66    
emb|CCA68534.1|  related to RRP5-processing of pre-ribosomal RNA        258   7e-66    
ref|XP_009052990.1|  hypothetical protein LOTGIDRAFT_239331             254   5e-65    
ref|XP_001020230.1|  S1 RNA binding domain containing protein           252   8e-64    



>ref|XP_010317858.1| PREDICTED: protein RRP5 homolog [Solanum lycopersicum]
Length=1897

 Score =  2680 bits (6947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1386/1889 (73%), Positives = 1599/1889 (85%), Gaps = 25/1889 (1%)
 Frame = -2

Query  5746  SAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhklykKNQSVE  5567
             + P+QLE+EVPDFPRGGAS LS++ELDEVRAEVDAEFEAEDR LKK+K+    +K  + E
Sbjct  14    NGPIQLEEEVPDFPRGGASSLSRKELDEVRAEVDAEFEAEDRLLKKRKKQHKLQKTNT-E  72

Query  5566  DDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLAS  5387
             DDLGSLFG  I+GKLP+ ANRIT KNISPGMKLWGV++EVNEKDIVVSLPGGLRGLV AS
Sbjct  73    DDLGSLFGGGINGKLPRFANRITLKNISPGMKLWGVVSEVNEKDIVVSLPGGLRGLVRAS  132

Query  5386  EAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLALLH  5207
             EA  P  D+     EM +N LS ++H GQLVSCIVLHLDDDKKE GK KIWLSLRL+LLH
Sbjct  133   EALPPFVDDGAKLSEMDTNLLSSVYHAGQLVSCIVLHLDDDKKEVGKRKIWLSLRLSLLH  192

Query  5206  KNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVD-KMNTGQLVEGVV  5030
             KNLTLD +QEG+ILSAY+KS EDHGYI+HFGLPSFSGF+P  S++V+ K  +GQLV+GVV
Sbjct  193   KNLTLDIVQEGMILSAYVKSAEDHGYIIHFGLPSFSGFMPKESENVEVKNRSGQLVQGVV  252

Query  5029  KSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTY  4850
             K +DRT KVVYLSS PD ++K VTKDLKGISIDLLVPGMMVNASV S LENG+MLSFLTY
Sbjct  253   KRIDRTHKVVYLSSDPDVVSKCVTKDLKGISIDLLVPGMMVNASVRSTLENGIMLSFLTY  312

Query  4849  FTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSL  4670
             FTGT D+F+LQQ FP  +WK DYPQNKKVNARILFIDP+TRAVGL+LNPHLVH KAPP+L
Sbjct  313   FTGTADMFNLQQTFPSLNWKVDYPQNKKVNARILFIDPSTRAVGLTLNPHLVHNKAPPAL  372

Query  4669  VKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKVVR  4490
             +KVGDIF+Q+KVIR+D+ LGLLLEIPSSPVPTPAYV +SDV DKEVKK+EK+FK GK+VR
Sbjct  373   IKVGDIFDQSKVIRIDRSLGLLLEIPSSPVPTPAYVNVSDVADKEVKKLEKSFKEGKLVR  432

Query  4489  VRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGVKA  4310
             VRVLGFR LEGLATG LKTSAFEGSVFTHSDVKPGM+VKAKVI VDSFGAIVQFSSGVKA
Sbjct  433   VRVLGFRRLEGLATGVLKTSAFEGSVFTHSDVKPGMIVKAKVIAVDSFGAIVQFSSGVKA  492

Query  4309  LCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSYTDAT  4130
             LCPLRHMSEFEIVKPRKKFQVG+ELVFRVLGCKSKRIT+THKKTLVKSKL+IL SY DAT
Sbjct  493   LCPLRHMSEFEIVKPRKKFQVGAELVFRVLGCKSKRITITHKKTLVKSKLEILGSYADAT  552

Query  4129  EGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSSS  3950
             EGL THGWITKIE HGCFVRFYNGVQGFAPRSELGLDPG +ISSMYHVEQVVKCRV SS+
Sbjct  553   EGLTTHGWITKIENHGCFVRFYNGVQGFAPRSELGLDPGCEISSMYHVEQVVKCRVTSSN  612

Query  3949  PASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTVSTQH  3770
             P SR+I LSFT    R+  TE+VKPG VVSG+VE VTPD+IV++V + Q H KGTVS QH
Sbjct  613   PTSRRINLSFTRTSSRVFSTELVKPGNVVSGVVERVTPDAIVLDVTS-QGHFKGTVSPQH  671

Query  3769  LSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQISPHS  3590
             L+DH G A LMKS L+PGYEFDQLLVLD+EG NL+LSAK+SL+++AQQLPLDVNQ+  +S
Sbjct  672   LADHSGHAALMKSALRPGYEFDQLLVLDVEGSNLILSAKHSLVTSAQQLPLDVNQVHLNS  731

Query  3589  VVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVNGET  3410
             V+HGYVCN+I +G+F+R+LGRLTGFSPR+KATDDRR   SEV+ IGQSV TNI+DV+ ET
Sbjct  732   VLHGYVCNIIESGIFIRYLGRLTGFSPRNKATDDRRSSLSEVYQIGQSVRTNIIDVSSET  791

Query  3409  GRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGKVH  3230
              RITVSLKQS+C STDA+FIQEYFL+E KIAKLQS+DS  S L WV+ F +GS V+GKVH
Sbjct  792   SRITVSLKQSICCSTDASFIQEYFLVEEKIAKLQSVDSGSSDLRWVEQFNVGSTVKGKVH  851

Query  3229  EIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEFV  3050
             EIKEFGVVV+F+KYDDVFGFIS  QL G+ VETGS+I+ AV+DVS+IE LVDLSLKP FV
Sbjct  852   EIKEFGVVVSFQKYDDVFGFISHYQLSGLPVETGSSIRTAVLDVSRIERLVDLSLKPAFV  911

Query  3049  NGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGYASLN  2870
             N SK +T N + Q KKRK E  ++LEVNQ+VNAVVEIVKENYLV+S+P+ + ALGYAS  
Sbjct  912   NKSKKETTNGQAQ-KKRKMETLEELEVNQTVNAVVEIVKENYLVVSLPSYDNALGYASRA  970

Query  2869  DFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkknsSYD  2690
             D+NTQNLP K F NG+SVIAT+MALP  ST GRLLLLLK+ISE  E+S+SKR K+ S Y+
Sbjct  971   DYNTQNLPPKSFTNGESVIATVMALPSPSTSGRLLLLLKSISEAIETSNSKRAKRKSGYN  1030

Query  2689  VGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARIVSK  2510
             VGSLVQAEIT+I+P+ELRLKFGS FHGRVHITEA+DDN  E P ++FR GQTLTARI+SK
Sbjct  1031  VGSLVQAEITEIRPIELRLKFGSSFHGRVHITEASDDNYAEAPFSNFRFGQTLTARIISK  1090

Query  2509  DSRSEN-KRGYQWELSTKPSVLAG-DMDGPHESFNYSTGQLLSGYVFKVDSEWAWLTISR  2336
              + SE+ KRGYQWELS KPS L G D   P +  +YSTGQL+SG+V+KVD EWAWLTISR
Sbjct  1091  LNMSESVKRGYQWELSIKPSTLTGSDEIEPDKKISYSTGQLVSGFVYKVDKEWAWLTISR  1150

Query  2335  EVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTLLITPED--  2162
             +V+AQLYIL+SS+EPSEL EFQ+RF VG++ SGY+L  NKEKKL+R++ H LL+ PE   
Sbjct  1151  DVKAQLYILNSSSEPSELDEFQERFSVGRAFSGYVLRCNKEKKLVRIISHPLLVDPETAC  1210

Query  2161  -----TVPSSESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVS  1997
                  T  SSES   HIREGSVLGGRISKILPGVGGLLVQID HL+GKVHFTEL DP V+
Sbjct  1211  QGDGPTDHSSESVAFHIREGSVLGGRISKILPGVGGLLVQIDPHLYGKVHFTELTDPGVA  1270

Query  1996  DPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISEHDDVHSQNRRVQD  1817
             DPLSGY EGQFVKCKVL++  S KGT H+DLSLR        + +S H+D  +    V+ 
Sbjct  1271  DPLSGYHEGQFVKCKVLEIAQSGKGTVHIDLSLRSISHKTQKEKLSAHNDTVNFPVLVEK  1330

Query  1816  IKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGK  1637
             I+DL P+M VQ YVKNV+PKGCF++LSRKVDAK+LLSNL+DG++E+ EK FPVGKLV G+
Sbjct  1331  IEDLRPNMMVQAYVKNVSPKGCFVILSRKVDAKVLLSNLSDGYVENIEKGFPVGKLVIGR  1390

Query  1636  VVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTN  1457
             VVSVE LSKRVE+TLRTSS+    KSD DAL+N + G++ISG+IKR+E +GLFI+VD+TN
Sbjct  1391  VVSVEPLSKRVEITLRTSSAVGAPKSDKDALSNLTVGDVISGRIKRVEPYGLFITVDHTN  1450

Query  1456  LVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSYFRDDDGEDIQ  1277
             LVGLCHVSE+SDDH+DN+ SR+KAG  V  K+LKVDK+RHRISLGMKNSY   +D    +
Sbjct  1451  LVGLCHVSEISDDHVDNIDSRHKAGDRVTAKILKVDKERHRISLGMKNSYI--NDATSGE  1508

Query  1276  TTSRQSINSTDKGNSVFIGTQSTVFPESSDA---DIDVSVVNTTDNILTEVESRASIPPL  1106
             T +R S      G+++ IG QST  PESS     D+D   V+  D  L EVESRASIPPL
Sbjct  1509  TYARPSSGHAVNGDALPIGIQSTSSPESSSQGREDLDDESVDGKDLFLAEVESRASIPPL  1568

Query  1105  EVPLDDIENSDIDDAVNKNPDHTGGAD----TTDekdkkramkkakkerereiraaeerl  938
             EVPLDD EN D+ D VN+N   +GGA     T+D+K++K   KKAK+ RE+EIRAAEERL
Sbjct  1569  EVPLDDTENLDMGDVVNQN---SGGATTNFGTSDDKNQKHVAKKAKRLREQEIRAAEERL  1625

Query  937   leKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESE  758
             LEKDIPR+ DEFEKLVRSSPNSSFVWIKYMAF+LSL DVEKARSIAE+A+ TIN+REE E
Sbjct  1626  LEKDIPRDEDEFEKLVRSSPNSSFVWIKYMAFVLSLADVEKARSIAERALRTINVREELE  1685

Query  757   KLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELL  578
             KLNVWVA+FNLE EYGNPP+EAV KVFQRALQYCDPKKVHLALLG+YERTE +KL DELL
Sbjct  1686  KLNVWVAFFNLENEYGNPPEEAVAKVFQRALQYCDPKKVHLALLGMYERTEQHKLTDELL  1745

Query  577   EKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLCLPKHKHIKFITQTAILEFKCG  398
              KMVKKFKHSCK+WLRR QW LKQ QD  QS+VNRALL LP HKHI FITQTAILEFKCG
Sbjct  1746  NKMVKKFKHSCKVWLRRTQWLLKQKQDGVQSVVNRALLSLPAHKHINFITQTAILEFKCG  1805

Query  397   VADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLF  218
             V DRGRS+FE+ML+EYPKRTDLWSVYLDQEIR+G+ DVIRALFERAI+LS+PPKKMKFLF
Sbjct  1806  VPDRGRSLFEKMLREYPKRTDLWSVYLDQEIRLGNADVIRALFERAITLSLPPKKMKFLF  1865

Query  217   KKYLAYEKSVGDEERIESVKRKAMEYVES  131
             KKYL YEK  GD+ER+E VKRKAMEYVES
Sbjct  1866  KKYLEYEKMHGDDERMEVVKRKAMEYVES  1894



>ref|XP_009798479.1| PREDICTED: protein RRP5 homolog isoform X2 [Nicotiana sylvestris]
Length=1927

 Score =  2679 bits (6944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1408/1916 (73%), Positives = 1623/1916 (85%), Gaps = 32/1916 (2%)
 Frame = -2

Query  5818  IKNP--KNFKRKGKNNEAGNASFSGKSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVD  5645
             ++NP  K FK KGK    G+ S    + PLQLED+VPDFPRGG S LS+EELDEVRAEVD
Sbjct  21    VQNPSKKPFKAKGK----GDVS----TMPLQLEDDVPDFPRGGGSSLSREELDEVRAEVD  72

Query  5644  AEFEAEDR--ylkkkkqhklykKNQSVEDDLGSLFGHSISGKLPKSANRITPKNISPGMK  5471
             AEFEAE+R    K KKQ+K+ + +QS EDDLGSLFG  I+GKLP+ ANRIT KNISPGMK
Sbjct  73    AEFEAEERLLKKKGKKQNKVQRSSQSTEDDLGSLFGGGINGKLPRFANRITLKNISPGMK  132

Query  5470  LWGVIAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVS  5291
             LWGV++EVNEKDIVVSLPGGLRGLV ASEA  P   +     EM +N LS ++HVGQLVS
Sbjct  133   LWGVVSEVNEKDIVVSLPGGLRGLVRASEAVPPFVKDGAKMSEMNTNLLSSVYHVGQLVS  192

Query  5290  CIVLHLDDDKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGL  5111
             CIVLHLDDDKKEAGK K+WLSLRLALLHK+LTLD IQEG+ILSAY+KS EDHGY+LHFGL
Sbjct  193   CIVLHLDDDKKEAGKRKLWLSLRLALLHKSLTLDVIQEGMILSAYVKSMEDHGYMLHFGL  252

Query  5110  PSFSGFLPIHSQSVD---KMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGI  4940
             PSFSGF+P  ++S +   K  +GQLV+GVVKS+DRTRKVVYLSS PD ++K VTKDLKGI
Sbjct  253   PSFSGFMPKDNESANVEVKSRSGQLVQGVVKSIDRTRKVVYLSSDPDVVSKCVTKDLKGI  312

Query  4939  SIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVN  4760
             SIDLLVPGMMVNASV S+LENG+MLSFLTYFTGT D+F+LQQ FP   WK DYPQNKKVN
Sbjct  313   SIDLLVPGMMVNASVRSILENGIMLSFLTYFTGTADMFNLQQTFPSSGWKIDYPQNKKVN  372

Query  4759  ARILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPV  4580
             ARILFIDP+TRAVGL+LN HLVH KAPP+L+KVGDIF+Q+KVIR+D+GLGLLLEIPSSPV
Sbjct  373   ARILFIDPSTRAVGLTLNSHLVHNKAPPALIKVGDIFDQSKVIRIDRGLGLLLEIPSSPV  432

Query  4579  PTPAYVYISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHS  4400
             PTPAYV +SDV DKEVKK+EK+FK GKVVRVRVLGFR+LEGLATG LKTSAFEGSVFTHS
Sbjct  433   PTPAYVNVSDVADKEVKKLEKSFKEGKVVRVRVLGFRHLEGLATGVLKTSAFEGSVFTHS  492

Query  4399  DVKPGMVVKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVL  4220
             DVKPGMVVKAKVI VDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVG+ELVFR+L
Sbjct  493   DVKPGMVVKAKVIAVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGAELVFRIL  552

Query  4219  GCKSKRITVTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAP  4040
             GCKSKRITVTHKKTLVKSKL+IL SY DATEGLITHGWITKIE HGCFVRFYNGVQGFAP
Sbjct  553   GCKSKRITVTHKKTLVKSKLEILGSYADATEGLITHGWITKIENHGCFVRFYNGVQGFAP  612

Query  4039  RSELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVS  3860
             RSELGLDP  +ISSMYHVEQVVKCRV SS+PASR+I LS TT P R+S  E+VKPG +VS
Sbjct  613   RSELGLDPCCEISSMYHVEQVVKCRVTSSNPASRRINLSLTTTPSRVSSNELVKPGKIVS  672

Query  3859  GIVELVTPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIE  3680
             G+VE VT D++V++V   Q H KGT+S QHL+DH G A+LMKS L+PGYEFDQLLVLD+E
Sbjct  673   GVVERVTADAVVIDV-TAQGHFKGTISPQHLADHTGHAELMKSALRPGYEFDQLLVLDVE  731

Query  3679  GFNLVLSAKYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSK  3500
             G NL+LSAK+SL ++AQQLPLDV+Q+  +SV+HGY+CN+I +GVF+R+LGRLTGFSPR++
Sbjct  732   GCNLILSAKHSLATSAQQLPLDVSQVHLNSVLHGYICNIIESGVFIRYLGRLTGFSPRNR  791

Query  3499  ATDDRRYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKI  3320
             ATDDRR+  SEV+ IGQSV +N++DV+ ET RITVSLKQS CSSTDA+FI+EYFL+E KI
Sbjct  792   ATDDRRFSLSEVYQIGQSVRSNVVDVSSETNRITVSLKQSFCSSTDASFIEEYFLMEEKI  851

Query  3319  AKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGIN  3140
             AKLQ +DS  S L WV+ F LGS V+GKVHEIKEFGVVV+F+KYDDVFGFIS  QLGGI+
Sbjct  852   AKLQLVDSGSSDLRWVEEFNLGSTVKGKVHEIKEFGVVVSFQKYDDVFGFISHYQLGGIS  911

Query  3139  VETGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQS  2960
             VETGS+I+  V+DVSKIE LVDLSLKP FVN SK +T N++ Q KKRKREA  +LEVNQ+
Sbjct  912   VETGSSIRTTVLDVSKIERLVDLSLKPAFVNKSKKETTNNQAQ-KKRKREALGELEVNQT  970

Query  2959  VNAVVEIVKENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSST  2780
             VNAVVEIVKENYLV+S+P+ N  LGYAS  D+NTQNLP K F NG+SVIAT+MA+P  ST
Sbjct  971   VNAVVEIVKENYLVVSLPSYNNTLGYASRADYNTQNLPPKSFANGESVIATVMAIPPPST  1030

Query  2779  GGRLLLLLKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVH  2600
              GRLLLLLK+ISE  E+SSSKR KK SSY+ GSLVQAEIT+I+PLELRLKFGSGFHGRVH
Sbjct  1031  SGRLLLLLKSISEAIETSSSKRAKKKSSYNAGSLVQAEITEIRPLELRLKFGSGFHGRVH  1090

Query  2599  ITEATDDNTTEGPLNDFRIGQTLTARIVSKDSRSEN-KRGYQWELSTKPSVLAGDMD-GP  2426
             ITEA+DDN  E P ++FR GQTLTARI+SK + SE+ KRGYQWELS K S LAG  +  P
Sbjct  1091  ITEASDDNHAEAPFSNFRFGQTLTARIISKFNMSESIKRGYQWELSIKLSTLAGSGEIEP  1150

Query  2425  HESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKS  2246
              E FNYSTGQL++G+V+KVD+EWAWLTISR+V+AQL++LDSS+EPSEL EFQKRF++G+S
Sbjct  1151  VEEFNYSTGQLVTGFVYKVDNEWAWLTISRDVKAQLHVLDSSSEPSELDEFQKRFFIGRS  1210

Query  2245  VSGYILSANKEKKLLRLVPHTLLITPEDTV--------PSSESARCHIREGSVLGGRISK  2090
              SGY+LSANKEKKL+RL+   LL+  E +          SSE+   HIRE SVLGGRISK
Sbjct  1211  FSGYVLSANKEKKLVRLISRPLLVDLERSAHQKDGPMDHSSENMAFHIREDSVLGGRISK  1270

Query  2089  ILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHV  1910
             ILPGVGGLLVQID HL+GKVHFTEL DP V+DPLSGY EGQFVKCKVL+  HS KGT H+
Sbjct  1271  ILPGVGGLLVQIDPHLYGKVHFTELTDPGVADPLSGYHEGQFVKCKVLETTHSGKGTVHI  1330

Query  1909  DLSLRWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRK  1730
             DLSLR        Q ++ ++D  +    V+ I+DL P+M VQ YVKNVTPKGCF+MLSRK
Sbjct  1331  DLSLRSMSHRTQEQKLAVNNDTVNFPGLVEKIEDLRPNMVVQAYVKNVTPKGCFVMLSRK  1390

Query  1729  VDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDID  1550
             VDAK+LLSNL+DG++E+PEKEFPVGKLV GKVVSVE LSKRVEVTLRTSS+    KSD D
Sbjct  1391  VDAKVLLSNLSDGYVENPEKEFPVGKLVVGKVVSVELLSKRVEVTLRTSSAVGASKSDKD  1450

Query  1549  ALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvr  1370
             AL+N + G++ISG++KR+E +GLFI VDNTN+VGLCHVSE+SDDH++N+ SRYKAG  V 
Sbjct  1451  ALSNLTVGDVISGRVKRVEPYGLFILVDNTNMVGLCHVSEISDDHVNNIDSRYKAGDRVT  1510

Query  1369  vkvlkvdkdRHRISLGMKNSYFRDDDGEDIQTTSRQSINSTDKGNSVFIGTQSTVFPESS  1190
              K+LKVDK+R RISLGMKNSYF  +D    +T  R S     +GN++ IG +ST  PE S
Sbjct  1511  AKILKVDKERQRISLGMKNSYF--NDATSGETNIRHSSGYPVEGNALSIGIESTPSPERS  1568

Query  1189  DAD---IDVSVVNTTDNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTT  1019
               +   +D   V+ TD  L EVESRASIPPLEVPLDDIEN D DD VN++        T+
Sbjct  1569  SQERENLDGESVDATDPFLAEVESRASIPPLEVPLDDIENLDEDDIVNQDSGDASNLGTS  1628

Query  1018  DekdkkramkkakkerereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFM  839
             DEK+KK A KKAK+ RE+EIRAAEERLLEKDIPR+ DEFEKLVRSSPNSSFVWIKYMAF+
Sbjct  1629  DEKNKKLAAKKAKRLREQEIRAAEERLLEKDIPRDEDEFEKLVRSSPNSSFVWIKYMAFV  1688

Query  838   LSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQY  659
             LSL DVEKARSIAE+A+ TIN+REESEKLNVWVAYFNLE EYGNPPQEAV KVFQRALQY
Sbjct  1689  LSLADVEKARSIAERALRTINVREESEKLNVWVAYFNLENEYGNPPQEAVAKVFQRALQY  1748

Query  658   CDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIV  479
             CDPKKVHLALLG+YERTE + L DELL KMVKKFKHSCK+WLRR+QW LKQ+QD  QS+V
Sbjct  1749  CDPKKVHLALLGMYERTEQHTLSDELLNKMVKKFKHSCKVWLRRVQWLLKQSQDGVQSVV  1808

Query  478   NRALLCLPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRV  299
             NRALL L  HKHIKFI+QTAILEFKCGV DRGRS+FE+ML+EYPKRTDLWSVYLDQEIR+
Sbjct  1809  NRALLSLSPHKHIKFISQTAILEFKCGVPDRGRSLFEKMLREYPKRTDLWSVYLDQEIRL  1868

Query  298   GDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             GD DVIRALFERAI+LS+PPKKMKFLFKKYL YEK +GD +R+E+VKRKAMEYVES
Sbjct  1869  GDADVIRALFERAITLSLPPKKMKFLFKKYLEYEKMLGDVDRMEAVKRKAMEYVES  1924



>ref|XP_009798470.1| PREDICTED: protein RRP5 homolog isoform X1 [Nicotiana sylvestris]
Length=1934

 Score =  2677 bits (6940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1409/1923 (73%), Positives = 1624/1923 (84%), Gaps = 39/1923 (2%)
 Frame = -2

Query  5818  IKNP--KNFKRKGKNNEAGNASFSGKSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVD  5645
             ++NP  K FK KGK    G+ S    + PLQLED+VPDFPRGG S LS+EELDEVRAEVD
Sbjct  21    VQNPSKKPFKAKGK----GDVS----TMPLQLEDDVPDFPRGGGSSLSREELDEVRAEVD  72

Query  5644  AEFEAEDR--ylkkkkqhklykKNQSVEDDLGSLFGHSISGKLPKSANRITPKNISPGMK  5471
             AEFEAE+R    K KKQ+K+ + +QS EDDLGSLFG  I+GKLP+ ANRIT KNISPGMK
Sbjct  73    AEFEAEERLLKKKGKKQNKVQRSSQSTEDDLGSLFGGGINGKLPRFANRITLKNISPGMK  132

Query  5470  LWGVIAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVS  5291
             LWGV++EVNEKDIVVSLPGGLRGLV ASEA  P   +     EM +N LS ++HVGQLVS
Sbjct  133   LWGVVSEVNEKDIVVSLPGGLRGLVRASEAVPPFVKDGAKMSEMNTNLLSSVYHVGQLVS  192

Query  5290  CIVLHLDDDKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGL  5111
             CIVLHLDDDKKEAGK K+WLSLRLALLHK+LTLD IQEG+ILSAY+KS EDHGY+LHFGL
Sbjct  193   CIVLHLDDDKKEAGKRKLWLSLRLALLHKSLTLDVIQEGMILSAYVKSMEDHGYMLHFGL  252

Query  5110  PSFSGFLPIHSQSVD---KMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGI  4940
             PSFSGF+P  ++S +   K  +GQLV+GVVKS+DRTRKVVYLSS PD ++K VTKDLKGI
Sbjct  253   PSFSGFMPKDNESANVEVKSRSGQLVQGVVKSIDRTRKVVYLSSDPDVVSKCVTKDLKGI  312

Query  4939  SIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVN  4760
             SIDLLVPGMMVNASV S+LENG+MLSFLTYFTGT D+F+LQQ FP   WK DYPQNKKVN
Sbjct  313   SIDLLVPGMMVNASVRSILENGIMLSFLTYFTGTADMFNLQQTFPSSGWKIDYPQNKKVN  372

Query  4759  ARILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPV  4580
             ARILFIDP+TRAVGL+LN HLVH KAPP+L+KVGDIF+Q+KVIR+D+GLGLLLEIPSSPV
Sbjct  373   ARILFIDPSTRAVGLTLNSHLVHNKAPPALIKVGDIFDQSKVIRIDRGLGLLLEIPSSPV  432

Query  4579  PTPAYVYISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHS  4400
             PTPAYV +SDV DKEVKK+EK+FK GKVVRVRVLGFR+LEGLATG LKTSAFEGSVFTHS
Sbjct  433   PTPAYVNVSDVADKEVKKLEKSFKEGKVVRVRVLGFRHLEGLATGVLKTSAFEGSVFTHS  492

Query  4399  DVKPGMVVKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVL  4220
             DVKPGMVVKAKVI VDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVG+ELVFR+L
Sbjct  493   DVKPGMVVKAKVIAVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGAELVFRIL  552

Query  4219  GCKSKRITVTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAP  4040
             GCKSKRITVTHKKTLVKSKL+IL SY DATEGLITHGWITKIE HGCFVRFYNGVQGFAP
Sbjct  553   GCKSKRITVTHKKTLVKSKLEILGSYADATEGLITHGWITKIENHGCFVRFYNGVQGFAP  612

Query  4039  RSELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVS  3860
             RSELGLDP  +ISSMYHVEQVVKCRV SS+PASR+I LS TT P R+S  E+VKPG +VS
Sbjct  613   RSELGLDPCCEISSMYHVEQVVKCRVTSSNPASRRINLSLTTTPSRVSSNELVKPGKIVS  672

Query  3859  GIVELVTPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIE  3680
             G+VE VT D++V++V   Q H KGT+S QHL+DH G A+LMKS L+PGYEFDQLLVLD+E
Sbjct  673   GVVERVTADAVVIDV-TAQGHFKGTISPQHLADHTGHAELMKSALRPGYEFDQLLVLDVE  731

Query  3679  GFNLVLSAKYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSK  3500
             G NL+LSAK+SL ++AQQLPLDV+Q+  +SV+HGY+CN+I +GVF+R+LGRLTGFSPR++
Sbjct  732   GCNLILSAKHSLATSAQQLPLDVSQVHLNSVLHGYICNIIESGVFIRYLGRLTGFSPRNR  791

Query  3499  ATDDRRYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKI  3320
             ATDDRR+  SEV+ IGQSV +N++DV+ ET RITVSLKQS CSSTDA+FI+EYFL+E KI
Sbjct  792   ATDDRRFSLSEVYQIGQSVRSNVVDVSSETNRITVSLKQSFCSSTDASFIEEYFLMEEKI  851

Query  3319  AKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGIN  3140
             AKLQ +DS  S L WV+ F LGS V+GKVHEIKEFGVVV+F+KYDDVFGFIS  QLGGI+
Sbjct  852   AKLQLVDSGSSDLRWVEEFNLGSTVKGKVHEIKEFGVVVSFQKYDDVFGFISHYQLGGIS  911

Query  3139  VETGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQS  2960
             VETGS+I+  V+DVSKIE LVDLSLKP FVN SK +T N++ Q KKRKREA  +LEVNQ+
Sbjct  912   VETGSSIRTTVLDVSKIERLVDLSLKPAFVNKSKKETTNNQAQ-KKRKREALGELEVNQT  970

Query  2959  VNAVVEIVKENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSST  2780
             VNAVVEIVKENYLV+S+P+ N  LGYAS  D+NTQNLP K F NG+SVIAT+MA+P  ST
Sbjct  971   VNAVVEIVKENYLVVSLPSYNNTLGYASRADYNTQNLPPKSFANGESVIATVMAIPPPST  1030

Query  2779  GGRLLLLLKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVH  2600
              GRLLLLLK+ISE  E+SSSKR KK SSY+ GSLVQAEIT+I+PLELRLKFGSGFHGRVH
Sbjct  1031  SGRLLLLLKSISEAIETSSSKRAKKKSSYNAGSLVQAEITEIRPLELRLKFGSGFHGRVH  1090

Query  2599  ITEATDDNTTEGPLNDFRIGQTLTARIVSKDSRSEN-KRGYQWELSTKPSVLAGDMDG--  2429
             ITEA+DDN  E P ++FR GQTLTARI+SK + SE+ KRGYQWELS K S LAG+M    
Sbjct  1091  ITEASDDNHAEAPFSNFRFGQTLTARIISKFNMSESIKRGYQWELSIKLSTLAGEMITWP  1150

Query  2428  ------PHESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQK  2267
                   P E FNYSTGQL++G+V+KVD+EWAWLTISR+V+AQL++LDSS+EPSEL EFQK
Sbjct  1151  RSGEIEPVEEFNYSTGQLVTGFVYKVDNEWAWLTISRDVKAQLHVLDSSSEPSELDEFQK  1210

Query  2266  RFYVGKSVSGYILSANKEKKLLRLVPHTLLITPEDTV--------PSSESARCHIREGSV  2111
             RF++G+S SGY+LSANKEKKL+RL+   LL+  E +          SSE+   HIRE SV
Sbjct  1211  RFFIGRSFSGYVLSANKEKKLVRLISRPLLVDLERSAHQKDGPMDHSSENMAFHIREDSV  1270

Query  2110  LGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHS  1931
             LGGRISKILPGVGGLLVQID HL+GKVHFTEL DP V+DPLSGY EGQFVKCKVL+  HS
Sbjct  1271  LGGRISKILPGVGGLLVQIDPHLYGKVHFTELTDPGVADPLSGYHEGQFVKCKVLETTHS  1330

Query  1930  VKGTTHVDLSLRWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGC  1751
              KGT H+DLSLR        Q ++ ++D  +    V+ I+DL P+M VQ YVKNVTPKGC
Sbjct  1331  GKGTVHIDLSLRSMSHRTQEQKLAVNNDTVNFPGLVEKIEDLRPNMVVQAYVKNVTPKGC  1390

Query  1750  FIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSAT  1571
             F+MLSRKVDAK+LLSNL+DG++E+PEKEFPVGKLV GKVVSVE LSKRVEVTLRTSS+  
Sbjct  1391  FVMLSRKVDAKVLLSNLSDGYVENPEKEFPVGKLVVGKVVSVELLSKRVEVTLRTSSAVG  1450

Query  1570  PRKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRY  1391
               KSD DAL+N + G++ISG++KR+E +GLFI VDNTN+VGLCHVSE+SDDH++N+ SRY
Sbjct  1451  ASKSDKDALSNLTVGDVISGRVKRVEPYGLFILVDNTNMVGLCHVSEISDDHVNNIDSRY  1510

Query  1390  KAGQTvrvkvlkvdkdRHRISLGMKNSYFRDDDGEDIQTTSRQSINSTDKGNSVFIGTQS  1211
             KAG  V  K+LKVDK+R RISLGMKNSYF  +D    +T  R S     +GN++ IG +S
Sbjct  1511  KAGDRVTAKILKVDKERQRISLGMKNSYF--NDATSGETNIRHSSGYPVEGNALSIGIES  1568

Query  1210  TVFPESSDAD---IDVSVVNTTDNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDH  1040
             T  PE S  +   +D   V+ TD  L EVESRASIPPLEVPLDDIEN D DD VN++   
Sbjct  1569  TPSPERSSQERENLDGESVDATDPFLAEVESRASIPPLEVPLDDIENLDEDDIVNQDSGD  1628

Query  1039  TGGADTTDekdkkramkkakkerereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVW  860
                  T+DEK+KK A KKAK+ RE+EIRAAEERLLEKDIPR+ DEFEKLVRSSPNSSFVW
Sbjct  1629  ASNLGTSDEKNKKLAAKKAKRLREQEIRAAEERLLEKDIPRDEDEFEKLVRSSPNSSFVW  1688

Query  859   IKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKV  680
             IKYMAF+LSL DVEKARSIAE+A+ TIN+REESEKLNVWVAYFNLE EYGNPPQEAV KV
Sbjct  1689  IKYMAFVLSLADVEKARSIAERALRTINVREESEKLNVWVAYFNLENEYGNPPQEAVAKV  1748

Query  679   FQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQ  500
             FQRALQYCDPKKVHLALLG+YERTE + L DELL KMVKKFKHSCK+WLRR+QW LKQ+Q
Sbjct  1749  FQRALQYCDPKKVHLALLGMYERTEQHTLSDELLNKMVKKFKHSCKVWLRRVQWLLKQSQ  1808

Query  499   DNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVY  320
             D  QS+VNRALL L  HKHIKFI+QTAILEFKCGV DRGRS+FE+ML+EYPKRTDLWSVY
Sbjct  1809  DGVQSVVNRALLSLSPHKHIKFISQTAILEFKCGVPDRGRSLFEKMLREYPKRTDLWSVY  1868

Query  319   LDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEY  140
             LDQEIR+GD DVIRALFERAI+LS+PPKKMKFLFKKYL YEK +GD +R+E+VKRKAMEY
Sbjct  1869  LDQEIRLGDADVIRALFERAITLSLPPKKMKFLFKKYLEYEKMLGDVDRMEAVKRKAMEY  1928

Query  139   VES  131
             VES
Sbjct  1929  VES  1931



>ref|XP_010653854.1| PREDICTED: protein RRP5 homolog [Vitis vinifera]
Length=1904

 Score =  2541 bits (6585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1300/1914 (68%), Positives = 1568/1914 (82%), Gaps = 59/1914 (3%)
 Frame = -2

Query  5806  KNFKRKGKNNEAGNASFSGKSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAE  5627
             K FK + + NEA       +S  LQ+ED+VPDFPRGG SLLS++E D +RAEVDAEFEA 
Sbjct  25    KPFKPRMRQNEA----VPSESLALQMEDDVPDFPRGGGSLLSRQEHDAIRAEVDAEFEAG  80

Query  5626  DRylkkkkqhklykKNQ-SVEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAE  5450
             +R  KKK ++    K   ++EDD+GSLFG  I+GKLP+ AN+IT KNISPGMKLWGV+AE
Sbjct  81    ERKTKKKNKNAKKTKKNYALEDDMGSLFGDGITGKLPRFANKITLKNISPGMKLWGVVAE  140

Query  5449  VNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLD  5270
             VNEKD+ +SLPGGLRGLV ASEA DPL+ NE  + E    +L  +FH+GQLVSC+VL LD
Sbjct  141   VNEKDLGISLPGGLRGLVRASEAFDPLFSNEIKDAE--GIFLPRIFHIGQLVSCVVLQLD  198

Query  5269  DDKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFL  5090
             DDKKE GK +IWLSLRL+LLHK  TLDA+QEG++L+AY+KS EDHGYILHFGLPSF+GFL
Sbjct  199   DDKKEKGKRRIWLSLRLSLLHKGFTLDALQEGMVLTAYVKSIEDHGYILHFGLPSFTGFL  258

Query  5089  PIHSQSVD-KMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGM  4913
             P  SQ+ + ++NTGQ+++GV++S+D+  KVVYLSS PD I+K VTKDLKGISIDLL+PGM
Sbjct  259   PKSSQAENIEINTGQILQGVIRSIDKAHKVVYLSSDPDTISKCVTKDLKGISIDLLIPGM  318

Query  4912  MVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPA  4733
             MVNA V S  ENGVMLSFLTYFTGTVDIFHLQ  FP  +WKDDY QNKKVNARILFIDP+
Sbjct  319   MVNARVQSTFENGVMLSFLTYFTGTVDIFHLQTTFPSSNWKDDYNQNKKVNARILFIDPS  378

Query  4732  TRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYIS  4553
             TRAVGL+LNPHLV+ KAPP  VK GDI++ +KVIRVD+GLGLLLE+PS+P  TP YV + 
Sbjct  379   TRAVGLTLNPHLVNNKAPPCPVKTGDIYDHSKVIRVDRGLGLLLEVPSTPASTPTYVTLF  438

Query  4552  dvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVK  4373
             DV D+EV+KMEK +K G  VRVR+LGFRNLEGLA G+LK SAFEGSVFTHSDVKPGMVVK
Sbjct  439   DVADEEVRKMEKKYKEGSHVRVRILGFRNLEGLAMGTLKASAFEGSVFTHSDVKPGMVVK  498

Query  4372  AKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITV  4193
             AKVI VDSFGAIVQF SGVKALCPLRHMSEF+IVKPRKKF+VG+EL+FRVLGCKSKRITV
Sbjct  499   AKVIAVDSFGAIVQFPSGVKALCPLRHMSEFDIVKPRKKFKVGAELIFRVLGCKSKRITV  558

Query  4192  THKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPG  4013
             THKKTL+KSKL I+SSYTDATEGLITHGWITKIEKHGCF+RFYNGVQGFAP SELGL+PG
Sbjct  559   THKKTLLKSKLGIISSYTDATEGLITHGWITKIEKHGCFIRFYNGVQGFAPSSELGLEPG  618

Query  4012  SDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPD  3833
              + S MYHV QVVKCRV  S PASR+I LSF  +P R+SE +MVK G+VV G+V+ VTP 
Sbjct  619   CNTSLMYHVGQVVKCRVKGSVPASRRINLSFIIKPTRISEDDMVKLGSVVGGVVDRVTPH  678

Query  3832  SIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAK  3653
             +I+VNV + + +LKGT+ST+HL+DH+G A LMKS LKPGYEFDQLLVLD+EG N +LSAK
Sbjct  679   AIIVNV-SAKGYLKGTISTEHLADHQGHAALMKSTLKPGYEFDQLLVLDVEGNNFILSAK  737

Query  3652  YSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDT  3473
             YSLI++AQQLPLD+ QI P+SVVHGY+CN+I  G FVRFLGRLTGFSPR+K  DD+R   
Sbjct  738   YSLINSAQQLPLDLTQIHPNSVVHGYICNIIETGCFVRFLGRLTGFSPRNKVMDDQRAVP  797

Query  3472  SEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSA  3293
             SE F+IGQSV +NILDVN ETGRIT+SLKQS CSSTDA+FIQEYFLLE KIAKLQ  DS 
Sbjct  798   SEAFFIGQSVRSNILDVNSETGRITLSLKQSCCSSTDASFIQEYFLLEEKIAKLQLSDSE  857

Query  3292  DSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQA  3113
              S L W +GF +G+++EGK+H+ K+FGVV++FEKY+DVFGFI+  QL     E GST+QA
Sbjct  858   HSELKWAEGFNIGTVIEGKIHDAKDFGVVISFEKYNDVFGFITHYQL---TAERGSTVQA  914

Query  3112  AVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVK  2933
              V+DV+K E LVDLSLKPEF++  K  ++N +  KKKR+REA K+L+ +Q+VNA+VEIVK
Sbjct  915   VVLDVAKTERLVDLSLKPEFLDRHKEDSSNSQAGKKKRRREAYKELQPHQTVNAIVEIVK  974

Query  2932  ENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLK  2753
             ENYLVLS+P  NYA+GYAS++D+NTQ    KQF++GQSVIA++MALP  ST GRLLL+LK
Sbjct  975   ENYLVLSLPEYNYAIGYASVSDYNTQKFAQKQFLHGQSVIASVMALPSPSTVGRLLLVLK  1034

Query  2752  AISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNT  2573
             ++SE  E+SSSKR KK SSY+VGSLVQAEIT+IKPLELRLKFG GFHGRVHITE  D+N 
Sbjct  1035  SVSEATETSSSKRAKKKSSYNVGSLVQAEITEIKPLELRLKFGIGFHGRVHITEVCDENV  1094

Query  2572  TEGPLNDFRIGQTLTARIVSKDSRSENK-RGYQWELSTKPSVLAGDMDGPHE----SFNY  2408
              E P ++FRIGQT++ARIV+K ++SEN  + +QWELS KP +L G ++  ++     F  
Sbjct  1095  IENPFSNFRIGQTVSARIVAKANKSENNGKNHQWELSIKPEMLTGSIEVENKLVDAEFRI  1154

Query  2407  STGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYIL  2228
             STGQ ++GYV+KV++EW WLTISR ++AQL++LD+S EP+EL+EFQKRF VGK+VSGY+L
Sbjct  1155  STGQRVTGYVYKVENEWIWLTISRHIKAQLFLLDTSCEPNELQEFQKRFEVGKAVSGYVL  1214

Query  2227  SANKEKKLLRLVPH------------TLLITPEDTVPSSESARCHIREGSVLGGRISKIL  2084
             SANKEKKLLR+V H             L I  +   P  E+   HI +G  LGGRISKIL
Sbjct  1215  SANKEKKLLRMVLHQFSVSNGTLDGKVLNIDNQHCNPPIENLIPHIHKGDTLGGRISKIL  1274

Query  2083  PGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDL  1904
             PGVGGLLVQI  HL+GKVHFTEL+D WVSDPLSGY EGQFVKCKVL++GHS KGT HVDL
Sbjct  1275  PGVGGLLVQIGPHLYGKVHFTELKDSWVSDPLSGYHEGQFVKCKVLEIGHSEKGTVHVDL  1334

Query  1903  SLRWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVD  1724
             SL  +L+ M           HS N RV+ I +LH DM VQGYVKNVT KGCFI+LSRK+D
Sbjct  1335  SLWSSLNGM-----------HSPNSRVEKIDNLHSDMLVQGYVKNVTSKGCFILLSRKLD  1383

Query  1723  AKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDAL  1544
             A+ILL+NL+DG++E PE+EFP+GKLV+G+V+SVE LS+RVEVTL+TSS+ + +KS+++  
Sbjct  1384  ARILLANLSDGYVEKPEREFPIGKLVSGRVLSVEPLSRRVEVTLKTSSATSVQKSEVNDF  1443

Query  1543  NNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvk  1364
             ++   G+II G IKR+ES+GLFI++D+TN+VGLCH+SELSDDHI N++++YKAG+ V  K
Sbjct  1444  SSILVGDIIFGTIKRVESYGLFITIDDTNMVGLCHISELSDDHISNIETKYKAGERVAAK  1503

Query  1363  vlkvdkdRHRISLGMKNSYFRDDDGEDIQTTSRQSINSTDKGNSVFIGTQSTVFPESSDA  1184
             +LKVD++RHRISLGMKNSY                I  T + N     TQ + F E++  
Sbjct  1504  ILKVDEERHRISLGMKNSY----------------IKETTQNNGFVDDTQLSTFLENNSR  1547

Query  1183  DI---DVSVVNTTDNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDe  1013
             +I   DV   +    +L++VESRASI PLEV LDD+ +S++DDAV +N  +T   +T DE
Sbjct  1548  EIQNLDVEYEDEEYPVLSQVESRASILPLEVDLDDVNHSNLDDAVGQNHIYTNETNTIDE  1607

Query  1012  kdkkramkkakkerereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLS  833
             K K+RA KKAK+E+E+EIRAAEERL+  D+PR  DEFEKLVR SPNSSF+WIKYMA MLS
Sbjct  1608  KSKRRAKKKAKEEKEQEIRAAEERLMLNDVPRTADEFEKLVRGSPNSSFLWIKYMALMLS  1667

Query  832   LGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCD  653
             L D+EKARSIAE+A+ TINIREESEKLN+W+AYFNLE EYGNPP+EAV+KVFQRALQYCD
Sbjct  1668  LADIEKARSIAERALRTINIREESEKLNIWMAYFNLENEYGNPPEEAVVKVFQRALQYCD  1727

Query  652   PKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNR  473
             PKKVHLALLG+YERTE +KL DELLEKM KKFKHSCK+WLRR+Q  LKQ+QD  Q ++NR
Sbjct  1728  PKKVHLALLGMYERTEQHKLADELLEKMTKKFKHSCKVWLRRVQNVLKQHQDGVQPVINR  1787

Query  472   ALLCLPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGD  293
             ALLCLP+HKHIKFI+QTAILEFK GV DRGRSMFE ML+EYPKRTDLWSVYLDQEIR+GD
Sbjct  1788  ALLCLPRHKHIKFISQTAILEFKSGVPDRGRSMFEGMLREYPKRTDLWSVYLDQEIRLGD  1847

Query  292   MDVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             +D+IRALFERAI+LS+ P+KMKFLFKKYL YEKS GDEERIESVKRKAMEY  S
Sbjct  1848  IDIIRALFERAINLSLEPRKMKFLFKKYLEYEKSQGDEERIESVKRKAMEYANS  1901



>emb|CBI29966.3| unnamed protein product [Vitis vinifera]
Length=1862

 Score =  2496 bits (6470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1284/1902 (68%), Positives = 1547/1902 (81%), Gaps = 77/1902 (4%)
 Frame = -2

Query  5806  KNFKRKGKNNEAGNASFSGKSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAE  5627
             K FK + + NEA       +S  LQ+ED+VPDFPRGG SLLS++E D +RAEVDAEFEA 
Sbjct  25    KPFKPRMRQNEA----VPSESLALQMEDDVPDFPRGGGSLLSRQEHDAIRAEVDAEFEAG  80

Query  5626  DRylkkkkqhklykKNQ-SVEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAE  5450
             +R  KKK ++    K   ++EDD+GSLFG  I+GKLP+ AN+IT KNISPGMKLWGV+AE
Sbjct  81    ERKTKKKNKNAKKTKKNYALEDDMGSLFGDGITGKLPRFANKITLKNISPGMKLWGVVAE  140

Query  5449  VNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLD  5270
             VNEKD+ +SLPGGLRGLV ASEA DPL+ NE  + E    +L  +FH+GQLVSC+VL LD
Sbjct  141   VNEKDLGISLPGGLRGLVRASEAFDPLFSNEIKDAE--GIFLPRIFHIGQLVSCVVLQLD  198

Query  5269  DDKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFL  5090
             DDKKE GK +IWLSLRL+LLHK  TLDA+QEG++L+AY+KS EDHGYILHFGLPSF+GFL
Sbjct  199   DDKKEKGKRRIWLSLRLSLLHKGFTLDALQEGMVLTAYVKSIEDHGYILHFGLPSFTGFL  258

Query  5089  PIHSQSVD-KMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGM  4913
             P  SQ+ + ++NTGQ+++GV++S+D+  KVVYLSS PD I+K VTKDLKGISIDLL+PGM
Sbjct  259   PKSSQAENIEINTGQILQGVIRSIDKAHKVVYLSSDPDTISKCVTKDLKGISIDLLIPGM  318

Query  4912  MVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPA  4733
             MVNA V S  ENGVMLSFLTYFTGTVDIFHLQ  FP  +WKDDY QNKKVNARILFIDP+
Sbjct  319   MVNARVQSTFENGVMLSFLTYFTGTVDIFHLQTTFPSSNWKDDYNQNKKVNARILFIDPS  378

Query  4732  TRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYIS  4553
             TRAVGL+LNPHLV+ KAPP  VK GDI++ +KVIRVD+GLGLLLE+PS+P  TP YV + 
Sbjct  379   TRAVGLTLNPHLVNNKAPPCPVKTGDIYDHSKVIRVDRGLGLLLEVPSTPASTPTYVTLF  438

Query  4552  dvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVK  4373
             DV D+EV+KMEK +K G  VRVR+LGFRNLEGLA G+LK SAFEGSVFTHSDVKPGMVVK
Sbjct  439   DVADEEVRKMEKKYKEGSHVRVRILGFRNLEGLAMGTLKASAFEGSVFTHSDVKPGMVVK  498

Query  4372  AKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITV  4193
             AKVI VDSFGAIVQF SGVKALCPLRHMSEF+IVKPRKKF+VG+EL+FRVLGCKSKRITV
Sbjct  499   AKVIAVDSFGAIVQFPSGVKALCPLRHMSEFDIVKPRKKFKVGAELIFRVLGCKSKRITV  558

Query  4192  THKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPG  4013
             THKKTL+KSKL I+SSYTDATEGLITHGWITKIEKHGCF+RFYNGVQGFAP SELGL+PG
Sbjct  559   THKKTLLKSKLGIISSYTDATEGLITHGWITKIEKHGCFIRFYNGVQGFAPSSELGLEPG  618

Query  4012  SDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPD  3833
              + S MYHV QVVKCRV  S PASR+I LSF  +P R+SE +MVK G+VV G+V+ VTP 
Sbjct  619   CNTSLMYHVGQVVKCRVKGSVPASRRINLSFIIKPTRISEDDMVKLGSVVGGVVDRVTPH  678

Query  3832  SIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAK  3653
             +I+VNV + + +LKGT+ST+HL+DH+G A LMKS LKPGYEFDQLLVLD+EG N +LSAK
Sbjct  679   AIIVNV-SAKGYLKGTISTEHLADHQGHAALMKSTLKPGYEFDQLLVLDVEGNNFILSAK  737

Query  3652  YSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDT  3473
             YSLI++AQQLPLD+ QI P+SVVHGY+CN+I  G FVRFLGRLTGFSPR+K  DD+R   
Sbjct  738   YSLINSAQQLPLDLTQIHPNSVVHGYICNIIETGCFVRFLGRLTGFSPRNKVMDDQRAVP  797

Query  3472  SEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSA  3293
             SE F+IGQSV +NILDVN ETGRIT+SLKQS CSSTDA+FIQEYFLLE KIAKLQ  DS 
Sbjct  798   SEAFFIGQSVRSNILDVNSETGRITLSLKQSCCSSTDASFIQEYFLLEEKIAKLQLSDSE  857

Query  3292  DSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQA  3113
              S L W +GF +G+++EGK+H+ K+FGVV++FEKY+DVFGFI+  QL     E GST+QA
Sbjct  858   HSELKWAEGFNIGTVIEGKIHDAKDFGVVISFEKYNDVFGFITHYQL---TAERGSTVQA  914

Query  3112  AVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVK  2933
              V+DV+K E LVDLSLKPEF++  K  ++N +  KKKR+REA K+L+ +Q+VNA+VEIVK
Sbjct  915   VVLDVAKTERLVDLSLKPEFLDRHKEDSSNSQAGKKKRRREAYKELQPHQTVNAIVEIVK  974

Query  2932  ENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLK  2753
             ENYL  S  A                    KQF++GQSVIA++MALP  ST GRLLL+LK
Sbjct  975   ENYLASSFIA-------------------RKQFLHGQSVIASVMALPSPSTVGRLLLVLK  1015

Query  2752  AISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNT  2573
             ++SE  E+SSSKR KK SSY+VGSLVQAEIT+IKPLELRLKFG GFHGRVHITE  D+N 
Sbjct  1016  SVSEATETSSSKRAKKKSSYNVGSLVQAEITEIKPLELRLKFGIGFHGRVHITEVCDENV  1075

Query  2572  TEGPLNDFRIGQTLTARIVSKDSRSENK-RGYQWELSTKPSVLAGDMDGPHE----SFNY  2408
              E P ++FRIGQT++ARIV+K ++SEN  + +QWELS KP +L G ++  ++     F  
Sbjct  1076  IENPFSNFRIGQTVSARIVAKANKSENNGKNHQWELSIKPEMLTGSIEVENKLVDAEFRI  1135

Query  2407  STGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYIL  2228
             STGQ ++GYV+KV++EW WLTISR ++AQL++LD+S EP+EL+EFQKRF VGK+VSGY+L
Sbjct  1136  STGQRVTGYVYKVENEWIWLTISRHIKAQLFLLDTSCEPNELQEFQKRFEVGKAVSGYVL  1195

Query  2227  SANKEKKLLRLVPHTLLITPEDTVPSSESARCHIREGSVLGGRISKILPGVGGLLVQIDA  2048
             SANKEKKLLR+V H       + +P       HI +G  LGGRISKILPGVGGLLVQI  
Sbjct  1196  SANKEKKLLRMVLHQF----SNLIP-------HIHKGDTLGGRISKILPGVGGLLVQIGP  1244

Query  2047  HLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQ  1868
             HL+GKVHFTEL+D WVSDPLSGY EGQFVKCKVL++GHS KGT HVDLSL  +L+ M   
Sbjct  1245  HLYGKVHFTELKDSWVSDPLSGYHEGQFVKCKVLEIGHSEKGTVHVDLSLWSSLNGM---  1301

Query  1867  NISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGF  1688
                     HS N RV+ I +LH DM VQGYVKNVT KGCFI+LSRK+DA+ILL+NL+DG+
Sbjct  1302  --------HSPNSRVEKIDNLHSDMLVQGYVKNVTSKGCFILLSRKLDARILLANLSDGY  1353

Query  1687  IESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGK  1508
             +E PE+EFP+GKLV+G+V+SVE LS+RVEVTL+TSS+ + +KS+++  ++   G+II G 
Sbjct  1354  VEKPEREFPIGKLVSGRVLSVEPLSRRVEVTLKTSSATSVQKSEVNDFSSILVGDIIFGT  1413

Query  1507  IKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRIS  1328
             IKR+ES+GLFI++D+TN+VGLCH+SELSDDHI N++++YKAG+ V  K+LKVD++RHRIS
Sbjct  1414  IKRVESYGLFITIDDTNMVGLCHISELSDDHISNIETKYKAGERVAAKILKVDEERHRIS  1473

Query  1327  LGMKNSYFRDDDGEDIQTTSRQSINSTDKGNSVFIGTQSTVFPESSDADI---DVSVVNT  1157
             LGMKNSY                I  T + N     TQ + F E++  +I   DV   + 
Sbjct  1474  LGMKNSY----------------IKETTQNNGFVDDTQLSTFLENNSREIQNLDVEYEDE  1517

Query  1156  TDNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkramkkakk  977
                +L++VESRASI PLEV LDD+ +S++DDAV +N  +T   +T DEK K+RA KKAK+
Sbjct  1518  EYPVLSQVESRASILPLEVDLDDVNHSNLDDAVGQNHIYTNETNTIDEKSKRRAKKKAKE  1577

Query  976   erereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAE  797
             E+E+EIRAAEERL+  D+PR  DEFEKLVR SPNSSF+WIKYMA MLSL D+EKARSIAE
Sbjct  1578  EKEQEIRAAEERLMLNDVPRTADEFEKLVRGSPNSSFLWIKYMALMLSLADIEKARSIAE  1637

Query  796   KAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVY  617
             +A+ TINIREESEKLN+W+AYFNLE EYGNPP+EAV+KVFQRALQYCDPKKVHLALLG+Y
Sbjct  1638  RALRTINIREESEKLNIWMAYFNLENEYGNPPEEAVVKVFQRALQYCDPKKVHLALLGMY  1697

Query  616   ERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLCLPKHKHIK  437
             ERTE +KL DELLEKM KKFKHSCK+WLRR+Q  LKQ+QD  Q ++NRALLCLP+HKHIK
Sbjct  1698  ERTEQHKLADELLEKMTKKFKHSCKVWLRRVQNVLKQHQDGVQPVINRALLCLPRHKHIK  1757

Query  436   FITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAI  257
             FI+QTAILEFK GV DRGRSMFE ML+EYPKRTDLWSVYLDQEIR+GD+D+IRALFERAI
Sbjct  1758  FISQTAILEFKSGVPDRGRSMFEGMLREYPKRTDLWSVYLDQEIRLGDIDIIRALFERAI  1817

Query  256   SLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             +LS+ P+KMKFLFKKYL YEKS GDEERIESVKRKAMEY  S
Sbjct  1818  NLSLEPRKMKFLFKKYLEYEKSQGDEERIESVKRKAMEYANS  1859



>ref|XP_011078793.1| PREDICTED: LOW QUALITY PROTEIN: protein RRP5 homolog [Sesamum 
indicum]
Length=1913

 Score =  2487 bits (6447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1290/1898 (68%), Positives = 1558/1898 (82%), Gaps = 39/1898 (2%)
 Frame = -2

Query  5767  NASFSGKSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAEDRy-lkkkkqhkl  5591
             N + S    P+Q+ED+VPDFPRG  SLLS EE +EVRA  + E  A++R   K+KK+ + 
Sbjct  33    NRAVSSLQMPVQVEDDVPDFPRGRGSLLSGEEENEVRALAEKESRADERVLKKRKKEKRA  92

Query  5590  ykKNQSVEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGG  5411
               +NQS EDDLGSLFG  I GKLP+ AN+IT KN+S GMKLWGVIAEVNEKDIVVSLPGG
Sbjct  93    QNRNQSTEDDLGSLFGDGIIGKLPRFANKITLKNVSSGMKLWGVIAEVNEKDIVVSLPGG  152

Query  5410  LRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWL  5231
             LRGLV A +A DP+ D+E  + ++  ++LS ++H GQLVSCIVL ++DD+KE  K KIWL
Sbjct  153   LRGLVRACDAIDPILDDEV-KGDVDYSFLSRIYHEGQLVSCIVLQVEDDRKEIAKRKIWL  211

Query  5230  SLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDKM---  5060
             SLRL+LLHK+LTLD +QEG++LSAY KS EDHG++LHFGLPSF+GF+P HSQS  ++   
Sbjct  212   SLRLSLLHKSLTLDTVQEGMVLSAYAKSIEDHGFMLHFGLPSFTGFMPKHSQSEKRIIDV  271

Query  5059  NTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLE  4880
             + GQL++GVVK++DR RKVVYLSS  D +++ VTKDLKGISIDLLVPGMMVNA V S LE
Sbjct  272   SLGQLLQGVVKNIDRARKVVYLSSDLDMVSRCVTKDLKGISIDLLVPGMMVNAHVQSTLE  331

Query  4879  NGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPH  4700
             NG++LSFL YFTGTVD+F+L + FP  +WK+DY +N K NARILFIDP++RAVGL+LNPH
Sbjct  332   NGIILSFLAYFTGTVDVFNLDKTFPSSNWKNDYSKNMKFNARILFIDPSSRAVGLTLNPH  391

Query  4699  LVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkme  4520
             LV  KAP  LVK+GDIF+Q+KV+RVDKG GLLLEIP+ PVPTPAYV ++D+ DKE  K +
Sbjct  392   LVSNKAPSLLVKIGDIFDQSKVVRVDKGSGLLLEIPTLPVPTPAYVNVADIADKEAGKFD  451

Query  4519  KTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGA  4340
             K+FK G +VRVRVLG+R+LEGLATG LKTSAFEGSVFTHSDVKPGMVVKAKVI VDSFGA
Sbjct  452   KSFKEGSLVRVRVLGYRHLEGLATGILKTSAFEGSVFTHSDVKPGMVVKAKVIAVDSFGA  511

Query  4339  IVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKL  4160
             IVQF+SGVKALCPLRHMSEFEI KPRKKFQ G ELVFRVLGCKSKRITVTHKKTLVKSKL
Sbjct  512   IVQFASGVKALCPLRHMSEFEIAKPRKKFQNGVELVFRVLGCKSKRITVTHKKTLVKSKL  571

Query  4159  DILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQ  3980
              ILSSY DAT+GL+THGWITKIEKHGCFVRFYNGVQGFAPRSELGL PGSDI S+YHVEQ
Sbjct  572   QILSSYADATDGLVTHGWITKIEKHGCFVRFYNGVQGFAPRSELGLGPGSDIGSVYHVEQ  631

Query  3979  VVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQS  3800
             VVKCRVV   PAS +I LSF   P+  SE+E VKPG++VSG+VE VTP +IVV +N   S
Sbjct  632   VVKCRVVKCIPASHRINLSFNITPISTSESENVKPGSLVSGVVERVTPQTIVVEINTS-S  690

Query  3799  HLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLP  3620
             H+KGT+S +HL+DH GLA L+ S +KPGY FDQLLVLD+EG NLVL+AKYSL+ + +QLP
Sbjct  691   HMKGTISPEHLADHNGLAALLMSSIKPGYHFDQLLVLDVEGNNLVLTAKYSLVKSTEQLP  750

Query  3619  LDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVC  3440
              DV+QI  HSVVHGY+CN+I +G FVRF+GRLTGF+P++KATDDRR D SEVFY+GQSV 
Sbjct  751   ADVSQIRCHSVVHGYICNIIDSGCFVRFIGRLTGFAPKNKATDDRRSDLSEVFYVGQSVR  810

Query  3439  TNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFG  3260
             +N++DV+ +  RIT+SLKQSLCSSTDA+FIQEYFLLE KIA+LQ LDS   GL+W DGFG
Sbjct  811   SNVVDVSNDMSRITLSLKQSLCSSTDASFIQEYFLLEEKIARLQVLDSEFPGLSWTDGFG  870

Query  3259  LGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHL  3080
             + SI+EGKVHEIK+FGVV++FEKY+DV+GFIS  QL G NVE+ S I+AAV+DVSKIE L
Sbjct  871   IASIIEGKVHEIKDFGVVISFEKYNDVYGFISHYQLAGTNVESNSVIRAAVLDVSKIERL  930

Query  3079  VDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPAC  2900
             VDLSLKPEF+N SK +++  +T KKKR+REA K+LEVNQ+V+A VEIVKENYLVLS+PA 
Sbjct  931   VDLSLKPEFINRSKEESSIVQTPKKKRRREAHKELEVNQTVSATVEIVKENYLVLSLPAY  990

Query  2899  NYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEssss  2720
             N  +GYAS  D+NTQ LP  QF +GQSV AT+MALP  +TGGRLLLLL ++S+  E+S S
Sbjct  991   NLIIGYASATDYNTQKLPPTQFTHGQSVSATVMALPTPATGGRLLLLLTSLSDGVETSRS  1050

Query  2719  krgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIG  2540
             KR KKNSSY+VGSL+QAEIT+IKPLE+R+KFGSG HGR+H+TEATDDN+ E P +++RIG
Sbjct  1051  KRAKKNSSYNVGSLIQAEITEIKPLEVRVKFGSGLHGRIHVTEATDDNSAESPFSNYRIG  1110

Query  2539  QTLTARIVSKDSRSEN-KRGYQWELSTKPSVLAGDMDG---PHESFNYSTGQLLSGYVFK  2372
             QTL ARIV+K S+ EN K GY WELS KPS+L G  +      E FNYS GQ +SG+V++
Sbjct  1111  QTLAARIVAKRSKPENIKGGYGWELSVKPSLLKGSGEDEWLSSEGFNYSYGQRISGFVYR  1170

Query  2371  VDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLV  2192
             VD+EWAWLT+SR+V AQLYILDSS EP EL EFQKRFYVGK+++GY+++ NKEKKLLR++
Sbjct  1171  VDTEWAWLTVSRDVNAQLYILDSSCEPPELAEFQKRFYVGKTLTGYVINVNKEKKLLRII  1230

Query  2191  PHTLLITPEDTVP------SSESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKV  2030
              H     P D         ++     HI EGS +GGRISKILPGVGGL+VQID H +GKV
Sbjct  1231  LH----KPADGFAEIKENDTNHHLMSHIVEGSFVGGRISKILPGVGGLMVQIDPHHYGKV  1286

Query  2029  HFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISEHD  1850
             HFTEL+D WVS+PL+GY E QFVKCKVL++  +VK T HVDLSLR   D  ++  IS   
Sbjct  1287  HFTELKDSWVSNPLTGYQEEQFVKCKVLEINRAVKSTVHVDLSLRSAPDGSHDL-ISADS  1345

Query  1849  DVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEK  1670
              VH+  +R+  I DLHPDM V+GYVKN++ KGCFIMLSRK+DAKILL NL+D F+E+PE 
Sbjct  1346  GVHTSIKRLDKITDLHPDMVVRGYVKNISSKGCFIMLSRKMDAKILLCNLSDSFVENPEN  1405

Query  1669  EFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGKIKRIES  1490
             EFPVGKLV GKV+SVE LSKRVEVTL+TSS ++  KSD   LN    G+I+SGKIKR+ES
Sbjct  1406  EFPVGKLVIGKVLSVEPLSKRVEVTLKTSSESSKLKSDSTHLNQIVVGDIVSGKIKRVES  1465

Query  1489  FGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNS  1310
             +GLFI++D+TN+VGLCHVSELSDDHID++Q+ +KA    + KVLKVDKDR+R+SLGMK+S
Sbjct  1466  YGLFIAIDHTNVVGLCHVSELSDDHIDDLQTAFKA----KAKVLKVDKDRNRVSLGMKSS  1521

Query  1309  YFRDDDGEDIQTTSRQSIN-STDKGNSVFIGTQSTVFPESSDADIDVSVVNTTDN----I  1145
             Y +D+    ++T S  S++ S D  +SV +          S++    S+ N  D+    I
Sbjct  1522  YIKDEGV--LRTHSSHSLDFSIDANDSVVLADPMI---RQSNSVCMKSINNEPDSDYHPI  1576

Query  1144  LTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkramkkakkerer  965
             L + +SRA +PPLEVPLD++EN DI+  V  +  +   ADT ++K+K+RA KKA++ERE+
Sbjct  1577  LADTKSRALVPPLEVPLDEVENLDIEGDVGPDIINVTEADTIEDKNKRRAKKKAREEREQ  1636

Query  964   eiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVS  785
             EIR AEERLL KDIP+N D     +RSSPNSSF+WIKYMAFMLSL DVEKAR++AE+A+ 
Sbjct  1637  EIRTAEERLLGKDIPKNADX----IRSSPNSSFIWIKYMAFMLSLADVEKARTVAERALR  1692

Query  784   TINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTE  605
             TINIREESEKLN+WVAYFNLE EYGNPP+EAV KVFQRALQYCDPKKVHLALLG+YERTE
Sbjct  1693  TINIREESEKLNMWVAYFNLENEYGNPPEEAVTKVFQRALQYCDPKKVHLALLGMYERTE  1752

Query  604   HYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLCLPKHKHIKFITQ  425
              + L DELL+KM +KFKHSCK+WLRRIQ+ LKQN D  QS+VNRALL LP+HKHIKFI+Q
Sbjct  1753  QHILADELLDKMTRKFKHSCKVWLRRIQFLLKQNSDGVQSVVNRALLSLPRHKHIKFISQ  1812

Query  424   TAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSI  245
             TAILEFKCGV DRGRSMFE ML+EYPKRTDLWS+YLDQEIR+GD+D+IR LFERAISLS+
Sbjct  1813  TAILEFKCGVPDRGRSMFEGMLREYPKRTDLWSIYLDQEIRLGDVDLIRGLFERAISLSL  1872

Query  244   PPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             PPKKMKFLFKKYL YEKSVG+EERIESVK+KAMEYVE+
Sbjct  1873  PPKKMKFLFKKYLEYEKSVGEEERIESVKKKAMEYVEN  1910



>emb|CDP14292.1| unnamed protein product [Coffea canephora]
Length=1924

 Score =  2474 bits (6411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1281/1910 (67%), Positives = 1553/1910 (81%), Gaps = 48/1910 (3%)
 Frame = -2

Query  5791  KGKNNEAGNASFSGK----SAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAED  5624
             KG   E G+   S +    S  LQLED+VPDFPRGG S LSK+EL++VRAEVDAEFEAE+
Sbjct  37    KGTKTELGDPVLSHQQKQASLALQLEDDVPDFPRGGGSSLSKQELEDVRAEVDAEFEAEE  96

Query  5623  RylkkkkqhklykK--NQSVEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAE  5450
             R  KKK +     +  +QS EDD+GSLFG + +GKLP+ AN+IT KNISPGMKLWGVI+E
Sbjct  97    RVSKKKNKRAKRLEWRSQSAEDDMGSLFGDAFTGKLPRFANKITLKNISPGMKLWGVISE  156

Query  5449  VNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLD  5270
             VN+KD+VVSLPGGLRGLV ASEA DPL  N+  + + +SN+LS ++HVGQLVSCIV  +D
Sbjct  157   VNQKDVVVSLPGGLRGLVRASEAFDPL-PNDGVKGDKESNFLSSIYHVGQLVSCIVQQVD  215

Query  5269  DDKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFL  5090
             D+KKE GK +IWLSLRL+LLHK LT+D IQEG++LSAYIKS EDHGY L+FG  SF+GF+
Sbjct  216   DEKKETGKRRIWLSLRLSLLHKGLTMDIIQEGMVLSAYIKSIEDHGYTLNFGFGSFTGFM  275

Query  5089  PIHSQSVDK---MNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVP  4919
             P   QS  K   +  GQL++GVVKS+D+TRK++Y+SS  D ++K VTKDLKGISIDLLVP
Sbjct  276   PESRQSERKDTEVKVGQLIQGVVKSIDKTRKLLYMSSDSDMVSKCVTKDLKGISIDLLVP  335

Query  4918  GMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFID  4739
             GMMV+  V S LENG+MLSFLTYFTGTVDIF+L + FP  +WKD Y Q KKVNARILFID
Sbjct  336   GMMVDTRVRSSLENGIMLSFLTYFTGTVDIFNLSETFPSANWKDYYTQGKKVNARILFID  395

Query  4738  PATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVY  4559
             P TRAVGL+LNPHLVH +APP+LV+ GDIF+Q+K+IR+D+GLGLLLEIPSSPV TPAYV 
Sbjct  396   PTTRAVGLTLNPHLVHNRAPPTLVQTGDIFDQSKIIRIDRGLGLLLEIPSSPVATPAYVS  455

Query  4558  ISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMV  4379
             +SDV DKE+KK+EK FK G +VRVRVLG R+LEGLATG LK SAFEG+VFTHSDVKPGMV
Sbjct  456   VSDVADKEIKKLEKNFKEGSLVRVRVLGLRHLEGLATGILKASAFEGTVFTHSDVKPGMV  515

Query  4378  VKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRI  4199
             VKAKVI VDSFGAIVQ  SGVKALCPLRHMSEFEI KPRKKFQVG+ELVFRVLGCKSKRI
Sbjct  516   VKAKVIAVDSFGAIVQLGSGVKALCPLRHMSEFEITKPRKKFQVGAELVFRVLGCKSKRI  575

Query  4198  TVTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLD  4019
             TVTHKKTLVKSKL+ILSSY DA EGLITHGWIT IE HGCFVRFYNGVQGFAPRSELGLD
Sbjct  576   TVTHKKTLVKSKLEILSSYADAIEGLITHGWITNIENHGCFVRFYNGVQGFAPRSELGLD  635

Query  4018  PGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVT  3839
              G  I+SMYHVEQVVKCRV SS PASR+I LSFT +  R++E +M+  G++VSG+VE VT
Sbjct  636   LGCVINSMYHVEQVVKCRVTSSIPASRRINLSFTAKKTRIAEDDMMNLGSLVSGVVEQVT  695

Query  3838  PDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLS  3659
             P ++VV VN+ +SH+KGT+S +HLSDH GL  L+KSVLKPG++FD+LLVLDIEG NL+L+
Sbjct  696   PHAVVVCVNS-KSHIKGTISPEHLSDHLGLGALLKSVLKPGHQFDKLLVLDIEGSNLILT  754

Query  3658  AKYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRY  3479
             AKYSL+++A+ LPLD+ Q+ PHS+VHGYVCN+I  G FVRF+GRLTGF+P+ KA DDRR 
Sbjct  755   AKYSLVNSARDLPLDIKQVCPHSIVHGYVCNLIEAGCFVRFVGRLTGFAPKHKAVDDRRS  814

Query  3478  DTSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLD  3299
             D SEVF IGQSV  N++DVN ET RIT++LKQSLCSSTDA+FI+EYFLLE KI+KLQ L 
Sbjct  815   DVSEVFSIGQSVRCNVVDVNSETNRITLALKQSLCSSTDASFIREYFLLEDKISKLQLLG  874

Query  3298  SADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTI  3119
             S  S LNWVD F +GSI+EGKV+E KEFGVV++FEKY D+FGFIS  QL GI V+ G+T+
Sbjct  875   SESSELNWVDEFQVGSIIEGKVNEKKEFGVVISFEKYKDIFGFISQYQLDGIAVDFGTTV  934

Query  3118  QAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEI  2939
             QAAV+D+SK E L+DLSLKP+FV  SK + ++  + KKKR RE  K L++ Q+V+A VEI
Sbjct  935   QAAVLDISKSERLLDLSLKPQFVERSKREGSSVHSVKKKRGRETHKGLDLKQTVHAQVEI  994

Query  2938  VKENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLL  2759
             VKE+YL                  F T     K+F+ G+ V+AT+  LP  STGGRLLLL
Sbjct  995   VKEDYLA----------------SFRTSFPSYKEFLFGKIVVATVADLPSPSTGGRLLLL  1038

Query  2758  LKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDD  2579
             LK+++EV +SS+SKR K+ ++ DVGS+VQAEIT+IKPLELR+KFGSGFHGRVHITEATDD
Sbjct  1039  LKSMNEVMDSSTSKRAKRKANIDVGSVVQAEITEIKPLELRVKFGSGFHGRVHITEATDD  1098

Query  2578  NTTEGPLNDFRIGQTLTARIVSKDSRSENKRGYQWELSTKPSVLAGD---MDGPH-ESFN  2411
             N  E P N  R+GQT+ A IVSK +R+   R YQWELS K S+LAG     DG   E F+
Sbjct  1099  NLAEDPFNSLRVGQTVNAMIVSKCNRN---RSYQWELSLKHSLLAGAGEVEDGLLVEDFD  1155

Query  2410  YSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYI  2231
             Y  G  +SG+V+KVD EWAW+T+SR+VRAQLYILDS++EP+EL++F+K FY+G ++SGY+
Sbjct  1156  YPIGGRVSGFVYKVDKEWAWVTVSRDVRAQLYILDSASEPTELEKFEKHFYIGMALSGYV  1215

Query  2230  LSANKEKKLLRLVPHTLLITPE---------DTVPSSESARCHIREGSVLGGRISKILPG  2078
             + A+KEKKLLR+V H +L   +          T P + +  CHI  G  +GGRISKILPG
Sbjct  1216  IKADKEKKLLRIVLHPILTHVDSACSLSDDCSTSPLNGNKACHISVGGFVGGRISKILPG  1275

Query  2077  VGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSL  1898
             VGG+LVQID HL+GKVHFTEL   WVSDPL+GY EGQFVKCKVL++ HS KGT HVDLSL
Sbjct  1276  VGGVLVQIDQHLYGKVHFTELTKAWVSDPLAGYHEGQFVKCKVLEISHSFKGTVHVDLSL  1335

Query  1897  RWTLDTMNNQNISE-HDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDA  1721
             R T D M++   ++ +  ++S + RV++I+DL PD+ V+GYVKNV+ +GCFIM+SR VDA
Sbjct  1336  RLTSDDMDHGKFADLYPSMNSISPRVENIEDLKPDIVVKGYVKNVSSRGCFIMISRTVDA  1395

Query  1720  KILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALN  1541
             KILLSNL+DGF+E+PE EFPVGKLV G+V+SVE LSKRVEVTL+TS+S +  K D+++LN
Sbjct  1396  KILLSNLSDGFVENPETEFPVGKLVIGRVISVEPLSKRVEVTLKTSNSVSVSKLDVNSLN  1455

Query  1540  NFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkv  1361
               + G+ ISG++KRIES+GLF+++D+TNLVGLCHVSELSD+HIDN+++++KAG+ VR KV
Sbjct  1456  KLTVGDFISGRVKRIESYGLFVTIDDTNLVGLCHVSELSDEHIDNIETKHKAGEVVRAKV  1515

Query  1360  lkvdkdRHRISLGMKNSYFRDDDGEDIQTTSRQSINSTDKGNSVFIGTQSTVFPESSDAD  1181
             LKVDK+RHRI+LGMKNSYF  D  +  Q  S    NS  + N VF GT +  FP   D D
Sbjct  1516  LKVDKERHRIALGMKNSYFTGDTND--QKLSEHGTNSAIEENHVFEGTGAISFPGIDDFD  1573

Query  1180  IDVSVVNTTDNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkk  1001
             I     N   ++L ++ESRASI PL+VPLD+IENSD+D+ VN++ ++   AD  DEK KK
Sbjct  1574  IKSD--NEKLSVLGKLESRASIQPLDVPLDEIENSDVDNVVNQDHENPNAADIMDEKSKK  1631

Query  1000  ramkkakkerereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDV  821
             R  KKAK ERE+EI+AAEERLLEK IPRN DEFEKL+R+SPNSSFVWIKYMAFMLSL DV
Sbjct  1632  REKKKAKVEREQEIQAAEERLLEKGIPRNADEFEKLIRTSPNSSFVWIKYMAFMLSLADV  1691

Query  820   EKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKV  641
             EKARSIAE+A+ TINIREESEKLN+WVAYFNLE EYGNPP+EAV K+F RALQYCDPKK+
Sbjct  1692  EKARSIAERALRTINIREESEKLNIWVAYFNLENEYGNPPEEAVKKLFYRALQYCDPKKL  1751

Query  640   HLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLC  461
             +LALLG+YERTE +KL D+LL KM+KKFK SCK+WLRR+Q  L+QN D  QS +NRALLC
Sbjct  1752  YLALLGMYERTEQHKLADDLLGKMIKKFKSSCKVWLRRVQRLLQQNHDGIQSNINRALLC  1811

Query  460   LPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVI  281
             LP+HKHIKFI+QTAILEFKCGV DRGRS+FE ML+EYPKRTDLWS+YLDQEIR+GD+DVI
Sbjct  1812  LPRHKHIKFISQTAILEFKCGVPDRGRSLFEGMLREYPKRTDLWSIYLDQEIRLGDVDVI  1871

Query  280   RALFERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             R+LFERAISLS+PPKKMKFLF KYL YEKS+GDEER  +V+ KA EYVES
Sbjct  1872  RSLFERAISLSLPPKKMKFLFTKYLEYEKSLGDEERASTVREKAREYVES  1921



>ref|XP_007029112.1| RNA binding,RNA binding isoform 1 [Theobroma cacao]
 gb|EOY09614.1| RNA binding,RNA binding isoform 1 [Theobroma cacao]
Length=1824

 Score =  2472 bits (6406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1255/1836 (68%), Positives = 1517/1836 (83%), Gaps = 41/1836 (2%)
 Frame = -2

Query  5566  DDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLAS  5387
             DDLGSLFG  I+GKLP+ AN+IT KNISPGMKLWGV+AEVNEKD+V+SLPGGLRGLV A+
Sbjct  3     DDLGSLFGDGITGKLPRYANKITLKNISPGMKLWGVVAEVNEKDLVISLPGGLRGLVRAA  62

Query  5386  EAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLALLH  5207
             +A D +  NE    E   N+L+ +F  GQLVSCIVL LDDDKKE GK KIWLSLRL+LLH
Sbjct  63    DALDSVLSNEVENNE--GNFLTNIFCTGQLVSCIVLQLDDDKKETGKRKIWLSLRLSLLH  120

Query  5206  KNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIH-SQSVD-KMNTGQLVEGV  5033
             K+ TLDA+QEG++L+AY+KS EDHGYILHFGL SF GFLP    +S D K+ TGQ ++GV
Sbjct  121   KSFTLDAVQEGMVLTAYVKSIEDHGYILHFGLSSFMGFLPKDDEESRDIKVRTGQFLQGV  180

Query  5032  VKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLT  4853
             V+ +D+TRKVVYLSS PD ++K VTKDLKGISIDLL+PGM+VN SV S+LENGVMLSFLT
Sbjct  181   VRRIDKTRKVVYLSSNPDTVSKCVTKDLKGISIDLLIPGMLVNTSVRSILENGVMLSFLT  240

Query  4852  YFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPS  4673
             YFTGTVD+FHLQ  FP   WKDDY QNKK+NARILFIDP+TRAVGL+LNPHLVH KAPPS
Sbjct  241   YFTGTVDMFHLQNQFPTKDWKDDYNQNKKINARILFIDPSTRAVGLTLNPHLVHNKAPPS  300

Query  4672  LVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKVV  4493
              V +G+I++Q+KVIRVD+GLGLLL+IPS PV TPAYVYISDV ++EV+K+EK FK G  V
Sbjct  301   HVNIGEIYDQSKVIRVDRGLGLLLDIPSKPVSTPAYVYISDVAEEEVRKLEKKFKEGSQV  360

Query  4492  RVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGVK  4313
             RVR+ GFR+LEGLATG LK SAFEG VFTHSDVKPGMV++AKVI +DSF AIVQF  GVK
Sbjct  361   RVRIHGFRHLEGLATGILKASAFEGQVFTHSDVKPGMVIRAKVIALDSFSAIVQFPGGVK  420

Query  4312  ALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSYTDA  4133
             ALCP+RHMSEFEI KP KKF+VG+ELVFRVLGCKSKRITVTHKKTLVKSKL I+SSY DA
Sbjct  421   ALCPIRHMSEFEIAKPGKKFKVGAELVFRVLGCKSKRITVTHKKTLVKSKLGIISSYADA  480

Query  4132  TEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSS  3953
             TEG ITHGWITKIEKHGCFVRFYNGVQGFAPRSELGL PG D SSMYHV QV+KCRV SS
Sbjct  481   TEGFITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLGPGYDPSSMYHVGQVIKCRVTSS  540

Query  3952  SPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTVSTQ  3773
             +PASR+I LSF  +P+R+SE ++VK G++VSG+++ +TP ++V+ VN+ ++HLKGT+S +
Sbjct  541   NPASRRINLSFQMKPVRVSEDDLVKLGSIVSGLIDRLTPSAVVIQVNS-KAHLKGTISNE  599

Query  3772  HLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQISPH  3593
             HL+D+   A L+KSVLKPGY+FDQLLVLDIEG N++LSAKYSL S A+QLP D++QI P+
Sbjct  600   HLADNHESAALLKSVLKPGYKFDQLLVLDIEGNNILLSAKYSLTSLAEQLPSDISQIHPN  659

Query  3592  SVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVNGE  3413
             SVVHGYVCN+I  G FVRFLGRLTGFSPRSK+TDD + D S  FY+GQSV +NILDVN E
Sbjct  660   SVVHGYVCNLIETGCFVRFLGRLTGFSPRSKSTDDYKADLSGAFYVGQSVRSNILDVNSE  719

Query  3412  TGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGKV  3233
             T RIT+SLKQS CSSTDA+FIQE+FLLE KIAKLQS DS  S L WV+GF +GS++EGK+
Sbjct  720   TARITLSLKQSSCSSTDASFIQEFFLLEEKIAKLQSSDSDGSELKWVEGFNVGSVIEGKI  779

Query  3232  HEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEF  3053
              E K+ GVVV+F+KY+DV GF++  QLGG+ +ETGS +QAAV+DV+K E LVDLSLKPEF
Sbjct  780   GEAKDIGVVVSFDKYNDVLGFVTHYQLGGLTLETGSIVQAAVLDVAKAERLVDLSLKPEF  839

Query  3052  VNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGYASL  2873
             V+ S+ +++  + QKKKRKREA KDLEV+Q+VNAVVEIVKE+YLVL++P  NYA+GYAS 
Sbjct  840   VDKSQEESSKGQIQKKKRKREASKDLEVHQTVNAVVEIVKEHYLVLAIPEYNYAIGYASK  899

Query  2872  NDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkknsSY  2693
              D+NTQ  P KQFVNGQ VIAT+MALP  +T GRLLLLL +ISEV E+SSSKR KK SSY
Sbjct  900   ADYNTQKFPQKQFVNGQRVIATVMALPSPTTSGRLLLLLNSISEVTETSSSKRAKKKSSY  959

Query  2692  DVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARIVS  2513
              VGSLV AE+T+I PLELRLKFG GF GRVH+TE  DDN  E P  +F+IGQT+TAR+V 
Sbjct  960   SVGSLVSAEVTEIMPLELRLKFGIGFRGRVHVTEVNDDNVLENPFGNFKIGQTITARVVG  1019

Query  2512  KDSRSENKRGYQWELSTKPSVLAGD----MDGPHESFNYSTGQLLSGYVFKVDSEWAWLT  2345
             K     N++GY W+LS KP++LAG     ++  ++  N+S GQL++GYV+K+D+EWAWLT
Sbjct  1020  K----ANQKGYLWDLSIKPTMLAGTGETGVNSTNDECNFSAGQLVTGYVYKMDTEWAWLT  1075

Query  2344  ISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTL-----  2180
             ISR V+AQLYILDS+ EP+EL++FQ+RF VGK+VSG++L+ NK+KKLLRLV H L     
Sbjct  1076  ISRHVKAQLYILDSAREPNELQQFQERFKVGKAVSGHVLNVNKDKKLLRLVRHPLGALSI  1135

Query  2179  --------LITPEDTVPSSESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHF  2024
                          D   S ES   HI EG +LGGRISKILPGVGGLLVQI  H+FG+VHF
Sbjct  1136  RNVHGEDKRTGESDNNISGESVTTHIHEGDILGGRISKILPGVGGLLVQIGPHIFGRVHF  1195

Query  2023  TELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISE-HDD  1847
             TEL+D W SDPLSGY EGQFVKCKVL++ HSVKGT H+DLSLR +LD M   N SE   D
Sbjct  1196  TELKDTWESDPLSGYYEGQFVKCKVLEISHSVKGTIHIDLSLRLSLDGMLPNNPSELGSD  1255

Query  1846  VHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKE  1667
               S ++RV+ I+DL+P+M +QGYVKN  PKGCFI+LSRK+DAKILLSNL+DG+I+ P+KE
Sbjct  1256  EDSTSKRVEKIEDLYPNMAIQGYVKNTIPKGCFILLSRKLDAKILLSNLSDGYIDDPKKE  1315

Query  1666  FPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGKIKRIESF  1487
             FP+GKLV G+V++VE LSKRVEVTL+ S++    KS+I+  ++   G+I+SG+I+R+ES+
Sbjct  1316  FPIGKLVAGRVLAVEPLSKRVEVTLKKSNTNGTSKSEINDFSSLHVGDIVSGRIRRVESY  1375

Query  1486  GLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSY  1307
             GLF+++D+TN+VGLCHVSELSDDH+DN+Q++Y+AG+ V  K+LK+D++RHRISLGMKNSY
Sbjct  1376  GLFVTLDHTNMVGLCHVSELSDDHVDNIQTKYRAGEKVTAKILKLDEERHRISLGMKNSY  1435

Query  1306  FRDDDGEDIQTTSRQS----INSTDKGNSVFIGTQSTVFPESSDADIDVSVVNTTDNILT  1139
               DD   DIQ  S +     +  TD   S  + T ST+        + +   N   +I  
Sbjct  1436  LTDDI--DIQIPSNEESDEDVEETDDTRSRML-TDSTL-------GMAIEYENGASSICA  1485

Query  1138  EVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkramkkakkererei  959
             + ESRASIPPLEV LDDIE+SD+D  V++N  ++  A T DEK+K+RA KKAK++REREI
Sbjct  1486  QAESRASIPPLEVTLDDIEHSDMDILVSQNQANSNEAVTGDEKNKRRAKKKAKEDREREI  1545

Query  958   raaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTI  779
             RAAEER LE D+PR  DEFEKLVR+SPNSSFVWIKYMAFML+  D+EKAR+IAE+A+ TI
Sbjct  1546  RAAEERQLEMDVPRTADEFEKLVRNSPNSSFVWIKYMAFMLNSADIEKARAIAERALRTI  1605

Query  778   NIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHY  599
             NIREE+EKLN+WVAYFNLE +YGNPP+EAV K+FQRALQYCDPKKVHLALLG+YERTE +
Sbjct  1606  NIREENEKLNIWVAYFNLENQYGNPPEEAVQKIFQRALQYCDPKKVHLALLGMYERTEQH  1665

Query  598   KLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLCLPKHKHIKFITQTA  419
             KL DELL+KM +KFKHSCK+WLRR+Q  L Q QD  QS+VNRALLCLP+HKHIKFI+QTA
Sbjct  1666  KLADELLDKMTRKFKHSCKVWLRRVQMLLMQQQDGVQSVVNRALLCLPRHKHIKFISQTA  1725

Query  418   ILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPP  239
             ILEFK GV DRGRSMFE +L+EYPKRTDLWS+YLD EIR+GD DVIRALFERAISLS+PP
Sbjct  1726  ILEFKSGVPDRGRSMFEGILREYPKRTDLWSIYLDXEIRLGDEDVIRALFERAISLSLPP  1785

Query  238   KKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             KKMKFLFKKYL YEKS+GDEERI+SVK+KAM+YVES
Sbjct  1786  KKMKFLFKKYLDYEKSLGDEERIKSVKQKAMDYVES  1821



>ref|XP_006481689.1| PREDICTED: protein RRP5 homolog isoform X2 [Citrus sinensis]
Length=1923

 Score =  2457 bits (6369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1274/1894 (67%), Positives = 1555/1894 (82%), Gaps = 23/1894 (1%)
 Frame = -2

Query  5767  NASFSGKSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhkly  5588
             N +   +   L  +D+VP FPRGG   L++ E DE+ AEVDAEFEA +R L KK + K  
Sbjct  35    NDAVEAQDLALPPDDDVPVFPRGGGHSLTQRERDEIHAEVDAEFEAAERGLHKKNKKKKK  94

Query  5587  kKNQSVE--DDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPG  5414
              + ++ E  DDLGSLFG  ISGKLP+ AN+IT KNIS GMKLWGV+AEVNEKD+V+ LPG
Sbjct  95    TERKANETVDDLGSLFGDGISGKLPRYANKITLKNISAGMKLWGVVAEVNEKDLVICLPG  154

Query  5413  GLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIW  5234
             GLRGL  A++A DP+ DNE    E   N L  +FHVGQLVSCIVL LDDDKKE GK KIW
Sbjct  155   GLRGLARAADALDPILDNEIEANE--DNLLPTIFHVGQLVSCIVLQLDDDKKEIGKRKIW  212

Query  5233  LSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLP---IHSQSVDK  5063
             LSLRL+LL+K L+L+ +QEG++L+AY+KS EDHGYILHFGLPSF+GFLP   +   S   
Sbjct  213   LSLRLSLLYKGLSLETVQEGMVLTAYVKSIEDHGYILHFGLPSFTGFLPRNNLAENSGID  272

Query  5062  MNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVL  4883
             +  G L++GVV+S+DRTRKVVYLSS PD ++K VTKDLKGISIDLLVPGMMV A V S+L
Sbjct  273   VKPGLLLQGVVRSIDRTRKVVYLSSDPDTVSKCVTKDLKGISIDLLVPGMMVTARVQSIL  332

Query  4882  ENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNP  4703
             ENGVMLSFLTYFTGTVDIFHLQ  FP  +WK+DY Q+KKVNARILF+DP +RAVGL+LNP
Sbjct  333   ENGVMLSFLTYFTGTVDIFHLQNTFPTTNWKNDYNQHKKVNARILFVDPTSRAVGLTLNP  392

Query  4702  HLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkm  4523
             +L+H +APPS VKVGDI++Q+KV+RVD+GLGLLL+IPS+PV TPAYV ISDV ++EV+K+
Sbjct  393   YLLHNRAPPSHVKVGDIYDQSKVVRVDRGLGLLLDIPSTPVSTPAYVTISDVAEEEVRKL  452

Query  4522  eKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFG  4343
             EK +K G  VRVR+LGFR+LEGLATG LK SAFEG VFTHSDVKPGMVVK KVI VDSFG
Sbjct  453   EKKYKEGSYVRVRILGFRHLEGLATGILKASAFEGLVFTHSDVKPGMVVKGKVIAVDSFG  512

Query  4342  AIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSK  4163
             AIVQF  GVKALCPL HMSEFEIVKP KKF+VG+ELVFRVLG KSKRITVTHKKTLVKSK
Sbjct  513   AIVQFPGGVKALCPLPHMSEFEIVKPGKKFKVGAELVFRVLGVKSKRITVTHKKTLVKSK  572

Query  4162  LDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVE  3983
             L ILSSY +AT+GLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPG + SSMYHV 
Sbjct  573   LAILSSYAEATDGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGCEPSSMYHVG  632

Query  3982  QVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQ  3803
             QVVKCR++SS PASR+I LSF  +P R+SE ++VK G++VSG+V++VTP+++VV V   +
Sbjct  633   QVVKCRIMSSIPASRRINLSFMMKPTRVSEDDLVKLGSLVSGVVDVVTPNAVVVYV-IAK  691

Query  3802  SHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQL  3623
              + KGT+ T+HL+DH   A +MKSV+KPGYEFDQLLVLD E  NL+LSAKYSLI++AQQL
Sbjct  692   GYSKGTIPTEHLADHLEHATVMKSVIKPGYEFDQLLVLDNESSNLLLSAKYSLINSAQQL  751

Query  3622  PLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSV  3443
             P D + I P+SVVHGYVCN+I  G FVRFLGRLTGF+PRSKA D +R D S+ +Y+GQSV
Sbjct  752   PSDASHIHPNSVVHGYVCNIIETGCFVRFLGRLTGFAPRSKAVDGQRADLSKTYYVGQSV  811

Query  3442  CTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGF  3263
              +NILDVN ETGRIT+SLKQS CSSTDA+F+QEYFLLE KIA LQS     S L WV+GF
Sbjct  812   RSNILDVNSETGRITLSLKQSCCSSTDASFMQEYFLLEEKIAMLQSSKHNGSELKWVEGF  871

Query  3262  GLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEH  3083
              +GS++EGKVHE  +FGVVV+FE++ DV+GFI+  QL G  VE+GS IQAA++DV+K E 
Sbjct  872   IIGSVIEGKVHESNDFGVVVSFEEHSDVYGFITHHQLAGATVESGSVIQAAILDVAKAER  931

Query  3082  LVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPA  2903
             LVDLSLK  F++  +   +N + QKKKRKREA KDLEV+Q+VNA+VEIVKENYLVLS+P 
Sbjct  932   LVDLSLKTVFIDRFREANSNRQAQKKKRKREASKDLEVHQTVNAIVEIVKENYLVLSLPE  991

Query  2902  CNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsss  2723
              NY++GYAS++D+NTQ  P KQF+NGQSVIAT+MALP SST GRLLLLLKAISE  E+SS
Sbjct  992   YNYSIGYASVSDYNTQKFPQKQFLNGQSVIATVMALPSSSTAGRLLLLLKAISE-TETSS  1050

Query  2722  skrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDD--NTTEGPLNDF  2549
             SKR KK SSYDVGSLVQAEIT+IKPLELRLKFG GFHGR+HITE  DD  N  E   ++F
Sbjct  1051  SKRAKKKSSYDVGSLVQAEITEIKPLELRLKFGIGFHGRIHITEVNDDKSNVVENLFSNF  1110

Query  2548  RIGQTLTARIVSKDSRSENKRGYQWELSTKPSVLAGDMDGPH---ESFNYSTGQLLSGYV  2378
             +IGQT+TARI++K ++ + K+ + WELS KPS+L     G     E  + S GQ ++GYV
Sbjct  1111  KIGQTVTARIIAKSNKPDMKKSFLWELSIKPSMLTVSEIGSKLLFEECDVSIGQRVTGYV  1170

Query  2377  FKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLR  2198
             +KVD+EWA LTISR ++AQL+ILDS+ EPSEL+EFQ+RF++GK+V+G++LS NKEKKLLR
Sbjct  1171  YKVDNEWALLTISRHLKAQLFILDSAYEPSELQEFQRRFHIGKAVTGHVLSINKEKKLLR  1230

Query  2197  LV--PHTLLITPEDTVPSSESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHF  2024
             LV  P    I+ +    S+++ +  I EG ++GGRISKIL GVGGL+VQI  HL+G+VHF
Sbjct  1231  LVLRPFQDGISDKTVDISNDNMQTFIHEGDIVGGRISKILSGVGGLVVQIGPHLYGRVHF  1290

Query  2023  TELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISE-HDD  1847
             TEL++  VSDPLSGY EGQFVKCKVL++  +V+GT HV+LSLR +LD M++ N S+   D
Sbjct  1291  TELKNICVSDPLSGYDEGQFVKCKVLEISRTVRGTFHVELSLRSSLDGMSSTNSSDLSTD  1350

Query  1846  VHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKE  1667
             V +  + ++ I+DL P+M VQGYVKNVT KGCFIMLSRK+DAK+LLSNL+DG++ESPEKE
Sbjct  1351  VDTPGKHLEKIEDLSPNMIVQGYVKNVTSKGCFIMLSRKLDAKVLLSNLSDGYVESPEKE  1410

Query  1666  FPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGKIKRIESF  1487
             FP+GKLV G+V+SVE LSKRVEVTL+TS S T  +S+I+ L+N   G+I+ G+IKR+ES+
Sbjct  1411  FPIGKLVAGRVLSVEPLSKRVEVTLKTSDSRTASQSEINNLSNLHVGDIVIGQIKRVESY  1470

Query  1486  GLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSY  1307
             GLFI+++NTNLVGLCHVSELS+DH+DN+ + Y+AG+ V+VK+LKVDK++ RISLGMK+SY
Sbjct  1471  GLFITIENTNLVGLCHVSELSEDHVDNIGTIYRAGEKVKVKILKVDKEKRRISLGMKSSY  1530

Query  1306  FRDDDGEDIQTTSRQSINSTDKGNSVFIGTQSTVFPESSDA--DIDVSVVNTTDNILTEV  1133
             F+ +D +++Q +S +  +   +    +   +S++   SS A  D+D    +    +L ++
Sbjct  1531  FK-NDADNLQMSSEEESDEAIEEVGSY--NRSSLLENSSVAVQDMDTESEDGGSLVLAQI  1587

Query  1132  ESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkramkkakkerereira  953
             ESRAS+PPLEV LDD E  D+D+ +++N  HT  A T DEK+ + A KK K+ERE+EIRA
Sbjct  1588  ESRASVPPLEVNLDD-EQPDMDNGISQNQGHTDEAKTIDEKNNRHAKKKEKEEREQEIRA  1646

Query  952   aeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINI  773
             AEERLLEKD PR  DEFE+LVRSSPNSSFVWIKYMAFMLS+ DVEKARSIAE+A+ TINI
Sbjct  1647  AEERLLEKDAPRTPDEFERLVRSSPNSSFVWIKYMAFMLSMADVEKARSIAERALQTINI  1706

Query  772   REESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKL  593
             REE+EKLN+WVAYFNLE EYGNPP+EAV+KVFQRALQYCDPKKVHLALLG+YERTE  KL
Sbjct  1707  REENEKLNIWVAYFNLENEYGNPPEEAVVKVFQRALQYCDPKKVHLALLGLYERTEQNKL  1766

Query  592   GDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLCLPKHKHIKFITQTAIL  413
              DELL KM+KKFKHSCK+WLRR+Q  LKQ Q+  Q++V RALL LP+HKHIKFI+QTAIL
Sbjct  1767  ADELLYKMIKKFKHSCKVWLRRVQRLLKQQQEGVQAVVQRALLSLPRHKHIKFISQTAIL  1826

Query  412   EFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKK  233
             EFK GVADRGRSMFE +L EYPKRTDLWS+YLDQEIR+GD+D+IR LFERAISLS+PPKK
Sbjct  1827  EFKNGVADRGRSMFEGILSEYPKRTDLWSIYLDQEIRLGDVDLIRGLFERAISLSLPPKK  1886

Query  232   MKFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             MKFLFKKYL YEKS+G+EERIE VK+KAMEYVES
Sbjct  1887  MKFLFKKYLEYEKSLGEEERIEYVKQKAMEYVES  1920



>ref|XP_008241151.1| PREDICTED: protein RRP5 homolog [Prunus mume]
Length=1930

 Score =  2451 bits (6352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1268/1926 (66%), Positives = 1551/1926 (81%), Gaps = 39/1926 (2%)
 Frame = -2

Query  5815  KNPKNFKRKGKN----NEAGNASFSGKSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEV  5648
             ++P  F +  K     N+  N +   ++  LQLED+VPDFPRGG S L+++E DE+RAEV
Sbjct  15    RDPPKFNKSSKQPFKPNKDRNDTARSEAVALQLEDDVPDFPRGGGSALNRQERDEIRAEV  74

Query  5647  DAEFEAEDRylkkkkqhklykKNQSVEDDLGSLFGHSISGKLPKSANRITPKNISPGMKL  5468
             DAEFEAE+R +KK+K+  + KK+ S EDDLGSLFG  I+GKLPK AN+IT KNIS GMK+
Sbjct  75    DAEFEAEEREMKKRKKIGMQKKSLSSEDDLGSLFGDGITGKLPKYANKITMKNISAGMKV  134

Query  5467  WGVIAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSC  5288
             WGV+AEVNEKD+V+SLPGGLRGLV ASEA DP+ DNET  +    N L+ +FHVGQLVSC
Sbjct  135   WGVVAEVNEKDLVISLPGGLRGLVRASEALDPILDNETKAV--ADNLLASVFHVGQLVSC  192

Query  5287  IVLHLDDDKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLP  5108
             IVL LD+DKKE GK KIWLSLRL+LLHK  TLD++QEG++L+AY+KS EDHGYILHFGL 
Sbjct  193   IVLQLDEDKKEKGKRKIWLSLRLSLLHKGFTLDSVQEGMVLTAYVKSIEDHGYILHFGLS  252

Query  5107  SFSGFLPIHSQSVDK---MNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGIS  4937
             SF+GFLP +SQ+  K   +NTGQL++G V+S+D+ RKVVYLSS  + ++K VTKDLKGIS
Sbjct  253   SFTGFLPKNSQADSKEIQVNTGQLLQGAVRSIDKVRKVVYLSSDLETVSKCVTKDLKGIS  312

Query  4936  IDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNA  4757
             IDLLVPGM+VNA V+S LENGVMLSFLTYFTGTVDIFHLQ  +P  +WK+DY Q+KKVNA
Sbjct  313   IDLLVPGMLVNARVLSTLENGVMLSFLTYFTGTVDIFHLQNSYPTLNWKEDYNQHKKVNA  372

Query  4756  RILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVP  4577
             RILFIDP+TRAVGL+LNPHLV  KAPPS VK+GDI + +KV+RVD+GLGLLLEIPS+PV 
Sbjct  373   RILFIDPSTRAVGLTLNPHLVRNKAPPSPVKIGDICDGSKVVRVDRGLGLLLEIPSTPVS  432

Query  4576  TPAYVYISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSD  4397
             TPAYV I DV ++EV+K+EK FK G  VRVRVLGFR+LEGLATG LK SAFEG+VFTHSD
Sbjct  433   TPAYVSICDVAEEEVRKLEKKFKQGSHVRVRVLGFRHLEGLATGILKASAFEGTVFTHSD  492

Query  4396  VKPGMVVKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLG  4217
             VKPGMVVK K+I VDSFGAIVQF  GVKALCPL HMSEFEI KPRKKF++G+EL+FRVLG
Sbjct  493   VKPGMVVKGKIIAVDSFGAIVQFPGGVKALCPLNHMSEFEIAKPRKKFKIGAELLFRVLG  552

Query  4216  CKSKRITVTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPR  4037
             CKSKRITVTHKKTLVKS L I+SSY DA +GLITHGWI KIE+HGCF+ FYNGVQGFAPR
Sbjct  553   CKSKRITVTHKKTLVKSNLGIVSSYADAADGLITHGWIRKIEEHGCFIHFYNGVQGFAPR  612

Query  4036  SELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSG  3857
             SELGL+PGSD SSMYHV QVVKCRV++S+P SR+I LSF  RP R+SE +M K G +VSG
Sbjct  613   SELGLEPGSDPSSMYHVGQVVKCRVINSNPTSRRIKLSFIIRPPRVSEDDMAKLGCLVSG  672

Query  3856  IVELVTPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEG  3677
             +V+ VTP+++ V   NG+ +  GT+ T+HL+DH GLA LMKSVLKPGYEFDQLLVLDIEG
Sbjct  673   VVDRVTPNAVYV---NGKGYSMGTIFTEHLADHHGLAALMKSVLKPGYEFDQLLVLDIEG  729

Query  3676  FNLVLSAKYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKA  3497
              NL+LSAKYSLI++AQQLP +++QI P+SVVHGY+CN+I  G FVRFLGRLTGFSPR KA
Sbjct  730   NNLILSAKYSLINSAQQLPSELSQIHPNSVVHGYICNLIETGCFVRFLGRLTGFSPRHKA  789

Query  3496  TDDRRYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIA  3317
              DD + D SE +YIGQSV +NILDV+ ET RIT+SLKQS C+STDA+FIQEYF+LE KIA
Sbjct  790   MDDHKADLSEAYYIGQSVRSNILDVSSETSRITLSLKQSSCTSTDASFIQEYFILEEKIA  849

Query  3316  KLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINV  3137
             KLQ LDS +   NW +GF +GS+VEGKV E+K+ GVVV FEKY+DVFGFI+  QLGG NV
Sbjct  850   KLQLLDSKEPKSNWSEGFTIGSVVEGKVQEVKDIGVVVGFEKYNDVFGFITHYQLGGTNV  909

Query  3136  ETGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSV  2957
             ETGS IQA V+D++  EHLVDLSLK EF N  K +++N ++ KKKRKREA   LE +Q+V
Sbjct  910   ETGSIIQAVVLDIANAEHLVDLSLKQEFNNKLK-ESSNSQSHKKKRKREALDGLEEHQTV  968

Query  2956  NAVVEIVKENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTG  2777
             NA+VEIVKENYLVLS+P  NY +GYAS++D+NTQ  P +QF+NGQSV AT+MALP  +T 
Sbjct  969   NAIVEIVKENYLVLSIPKYNYTIGYASISDYNTQKFPQRQFLNGQSVNATVMALPSPTTA  1028

Query  2776  GRLLLLLKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHI  2597
             GRLL+LL ++SE AE+SSSKR KK  SY VGS+VQAEIT+IKPLELRLKFG GFHGRVHI
Sbjct  1029  GRLLMLLNSLSESAETSSSKREKKKCSYKVGSVVQAEITEIKPLELRLKFGIGFHGRVHI  1088

Query  2596  TEATDDNTTEGPLNDFRIGQTLTARIVSKDSRSE-NKRGYQWELSTKPSVLAGDMDGPH-  2423
             TE  D+   E P N+FRIGQT+TARIV+K + S  NK+ YQW+LS KP++L G  +    
Sbjct  1089  TEVNDE-LLEEPFNNFRIGQTVTARIVAKTNYSNSNKKSYQWDLSLKPTMLTGSCEIGEK  1147

Query  2422  ---ESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVG  2252
                E  ++STGQ ++GYV+KVD EW WLTISR VRAQL+ILDS+ EPSEL+EFQKRF++G
Sbjct  1148  IMTEDLDFSTGQCVTGYVYKVDGEWVWLTISRNVRAQLFILDSACEPSELQEFQKRFHLG  1207

Query  2251  KSVSGYILSANKEKKLLRLVPHTLLITPEDTVPS-------------SESARCHIREGSV  2111
              +VSGY+LS N+EKKLLRLV H L      TV               +E+   HIREGSV
Sbjct  1208  NAVSGYVLSVNREKKLLRLVVHPLFPVSGKTVDHEASKIEDPHNNILNENVTAHIREGSV  1267

Query  2110  LGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHS  1931
             +GGRI K LPGVGGL VQI  H++G+VH++EL D WV++PLSGY EGQFVKCKVL++  S
Sbjct  1268  VGGRIIKKLPGVGGLTVQIGPHMYGRVHYSELSDSWVTNPLSGYHEGQFVKCKVLELIRS  1327

Query  1930  VKGTTHVDLSLRWTLDTM-NNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKG  1754
             V+GT H+DLSLR +L  M    +   HDD H+  +RV+ I+DL+P+M VQGYVKN+TPKG
Sbjct  1328  VRGTYHIDLSLRSSLLGMLGPDSKGSHDDTHTHTKRVEKIEDLNPNMMVQGYVKNITPKG  1387

Query  1753  CFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSA  1574
             CFI LSRK+DAKIL+SNL+DG+++  EKEFPVGKLV G+V SVE LSKRVEVTL++  + 
Sbjct  1388  CFIFLSRKIDAKILVSNLSDGYVQDLEKEFPVGKLVIGRVSSVEPLSKRVEVTLKSLGAT  1447

Query  1573  TPRKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSR  1394
             +  +S  + L++   G+IISG++KR+E +GLFI++DNTN+VGLCHVSELS+D ++N++++
Sbjct  1448  SATQSGSNNLDSLHVGDIISGRVKRVERYGLFITIDNTNVVGLCHVSELSEDKVENIETK  1507

Query  1393  YKAGQTvrvkvlkvdkdRHRISLGMKNSYFRDDDGEDIQTTSRQSINSTDKGNSVFIGTQ  1214
             Y+ G+ V  KVLKVDKDRHRISLGMK+ Y  +++  D+QT+S Q  +     +    G+ 
Sbjct  1508  YRTGERVTAKVLKVDKDRHRISLGMKDVYIMENN--DLQTSSEQDPDEDIIESGRTDGSL  1565

Query  1213  STVFPESSD---ADIDVSVVNTTDNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPD  1043
             S +FP SS     ++DV   N     L + ESRAS+PPLEV LD+I+  + D+ V+++ +
Sbjct  1566  SAMFPGSSSFCTQNMDVEYENAEPQFLAQAESRASVPPLEVTLDEIDQFNGDNIVSQDQE  1625

Query  1042  HTGGADTTDekdkkramkkakkerereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFV  863
             H    DT +EK K+   KKAK+EREREIRAAEERLLEKDIPR  +E+EKLVRSSPNSS+V
Sbjct  1626  HP-DVDTVNEKKKRLTKKKAKEEREREIRAAEERLLEKDIPRTDEEYEKLVRSSPNSSYV  1684

Query  862   WIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMK  683
             WIKYM F+LS  +VEKARSIAE+A+ TIN REE+EKLN+WVAYFNLE +YG+PP+EAVMK
Sbjct  1685  WIKYMEFVLSTANVEKARSIAERALQTINFREENEKLNIWVAYFNLENKYGSPPEEAVMK  1744

Query  682   VFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQN  503
             VFQRA+QY DPKKVHLALLGVYERTE ++L DEL +KM+KKFK SCK+WLRR+Q  L Q 
Sbjct  1745  VFQRAVQYNDPKKVHLALLGVYERTEQHRLADELFDKMIKKFKKSCKVWLRRVQMLLTQQ  1804

Query  502   QDNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSV  323
             +D  Q +V++A   LPKHKHIKF +QTAILEFKCG  +RGRSMFE +L+  PKRTDLWSV
Sbjct  1805  RDGIQDVVSQAEKVLPKHKHIKFNSQTAILEFKCGNPERGRSMFENILRNNPKRTDLWSV  1864

Query  322   YLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAME  143
             YLDQEIR+GD D+I ALFERA SLS+P KKMKFLF KYL YEKS GDEE+IE VK+KAM+
Sbjct  1865  YLDQEIRLGDSDLIHALFERATSLSLPAKKMKFLFNKYLQYEKSHGDEEKIEYVKQKAMD  1924

Query  142   YVESLA  125
             YV S+A
Sbjct  1925  YVNSVA  1930



>ref|XP_006481688.1| PREDICTED: protein RRP5 homolog isoform X1 [Citrus sinensis]
Length=1934

 Score =  2450 bits (6349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1274/1905 (67%), Positives = 1555/1905 (82%), Gaps = 34/1905 (2%)
 Frame = -2

Query  5767  NASFSGKSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhkly  5588
             N +   +   L  +D+VP FPRGG   L++ E DE+ AEVDAEFEA +R L KK + K  
Sbjct  35    NDAVEAQDLALPPDDDVPVFPRGGGHSLTQRERDEIHAEVDAEFEAAERGLHKKNKKKKK  94

Query  5587  kKNQSVE--DDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPG  5414
              + ++ E  DDLGSLFG  ISGKLP+ AN+IT KNIS GMKLWGV+AEVNEKD+V+ LPG
Sbjct  95    TERKANETVDDLGSLFGDGISGKLPRYANKITLKNISAGMKLWGVVAEVNEKDLVICLPG  154

Query  5413  GLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIW  5234
             GLRGL  A++A DP+ DNE    E   N L  +FHVGQLVSCIVL LDDDKKE GK KIW
Sbjct  155   GLRGLARAADALDPILDNEIEANE--DNLLPTIFHVGQLVSCIVLQLDDDKKEIGKRKIW  212

Query  5233  LSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLP---IHSQSVDK  5063
             LSLRL+LL+K L+L+ +QEG++L+AY+KS EDHGYILHFGLPSF+GFLP   +   S   
Sbjct  213   LSLRLSLLYKGLSLETVQEGMVLTAYVKSIEDHGYILHFGLPSFTGFLPRNNLAENSGID  272

Query  5062  MNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVL  4883
             +  G L++GVV+S+DRTRKVVYLSS PD ++K VTKDLKGISIDLLVPGMMV A V S+L
Sbjct  273   VKPGLLLQGVVRSIDRTRKVVYLSSDPDTVSKCVTKDLKGISIDLLVPGMMVTARVQSIL  332

Query  4882  ENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNP  4703
             ENGVMLSFLTYFTGTVDIFHLQ  FP  +WK+DY Q+KKVNARILF+DP +RAVGL+LNP
Sbjct  333   ENGVMLSFLTYFTGTVDIFHLQNTFPTTNWKNDYNQHKKVNARILFVDPTSRAVGLTLNP  392

Query  4702  HLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkm  4523
             +L+H +APPS VKVGDI++Q+KV+RVD+GLGLLL+IPS+PV TPAYV ISDV ++EV+K+
Sbjct  393   YLLHNRAPPSHVKVGDIYDQSKVVRVDRGLGLLLDIPSTPVSTPAYVTISDVAEEEVRKL  452

Query  4522  eKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFG  4343
             EK +K G  VRVR+LGFR+LEGLATG LK SAFEG VFTHSDVKPGMVVK KVI VDSFG
Sbjct  453   EKKYKEGSYVRVRILGFRHLEGLATGILKASAFEGLVFTHSDVKPGMVVKGKVIAVDSFG  512

Query  4342  AIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSK  4163
             AIVQF  GVKALCPL HMSEFEIVKP KKF+VG+ELVFRVLG KSKRITVTHKKTLVKSK
Sbjct  513   AIVQFPGGVKALCPLPHMSEFEIVKPGKKFKVGAELVFRVLGVKSKRITVTHKKTLVKSK  572

Query  4162  LDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVE  3983
             L ILSSY +AT+GLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPG + SSMYHV 
Sbjct  573   LAILSSYAEATDGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGCEPSSMYHVG  632

Query  3982  QVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQ  3803
             QVVKCR++SS PASR+I LSF  +P R+SE ++VK G++VSG+V++VTP+++VV V   +
Sbjct  633   QVVKCRIMSSIPASRRINLSFMMKPTRVSEDDLVKLGSLVSGVVDVVTPNAVVVYV-IAK  691

Query  3802  SHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQL  3623
              + KGT+ T+HL+DH   A +MKSV+KPGYEFDQLLVLD E  NL+LSAKYSLI++AQQL
Sbjct  692   GYSKGTIPTEHLADHLEHATVMKSVIKPGYEFDQLLVLDNESSNLLLSAKYSLINSAQQL  751

Query  3622  PLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSV  3443
             P D + I P+SVVHGYVCN+I  G FVRFLGRLTGF+PRSKA D +R D S+ +Y+GQSV
Sbjct  752   PSDASHIHPNSVVHGYVCNIIETGCFVRFLGRLTGFAPRSKAVDGQRADLSKTYYVGQSV  811

Query  3442  CTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGF  3263
              +NILDVN ETGRIT+SLKQS CSSTDA+F+QEYFLLE KIA LQS     S L WV+GF
Sbjct  812   RSNILDVNSETGRITLSLKQSCCSSTDASFMQEYFLLEEKIAMLQSSKHNGSELKWVEGF  871

Query  3262  GLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEH  3083
              +GS++EGKVHE  +FGVVV+FE++ DV+GFI+  QL G  VE+GS IQAA++DV+K E 
Sbjct  872   IIGSVIEGKVHESNDFGVVVSFEEHSDVYGFITHHQLAGATVESGSVIQAAILDVAKAER  931

Query  3082  LVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPA  2903
             LVDLSLK  F++  +   +N + QKKKRKREA KDLEV+Q+VNA+VEIVKENYLVLS+P 
Sbjct  932   LVDLSLKTVFIDRFREANSNRQAQKKKRKREASKDLEVHQTVNAIVEIVKENYLVLSLPE  991

Query  2902  CNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsss  2723
              NY++GYAS++D+NTQ  P KQF+NGQSVIAT+MALP SST GRLLLLLKAISE  E+SS
Sbjct  992   YNYSIGYASVSDYNTQKFPQKQFLNGQSVIATVMALPSSSTAGRLLLLLKAISE-TETSS  1050

Query  2722  skrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDD--NTTEGPLNDF  2549
             SKR KK SSYDVGSLVQAEIT+IKPLELRLKFG GFHGR+HITE  DD  N  E   ++F
Sbjct  1051  SKRAKKKSSYDVGSLVQAEITEIKPLELRLKFGIGFHGRIHITEVNDDKSNVVENLFSNF  1110

Query  2548  RIGQTLTARIVSKDSRSENKRGYQWELSTKPSVLAGDMDGPH---ESFNYSTGQLLSGYV  2378
             +IGQT+TARI++K ++ + K+ + WELS KPS+L     G     E  + S GQ ++GYV
Sbjct  1111  KIGQTVTARIIAKSNKPDMKKSFLWELSIKPSMLTVSEIGSKLLFEECDVSIGQRVTGYV  1170

Query  2377  FKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLR  2198
             +KVD+EWA LTISR ++AQL+ILDS+ EPSEL+EFQ+RF++GK+V+G++LS NKEKKLLR
Sbjct  1171  YKVDNEWALLTISRHLKAQLFILDSAYEPSELQEFQRRFHIGKAVTGHVLSINKEKKLLR  1230

Query  2197  LV--PHTLLITPEDTVPSSESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHF  2024
             LV  P    I+ +    S+++ +  I EG ++GGRISKIL GVGGL+VQI  HL+G+VHF
Sbjct  1231  LVLRPFQDGISDKTVDISNDNMQTFIHEGDIVGGRISKILSGVGGLVVQIGPHLYGRVHF  1290

Query  2023  TELRDPWVS-----------DPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTM  1877
             TEL++  VS           DPLSGY EGQFVKCKVL++  +V+GT HV+LSLR +LD M
Sbjct  1291  TELKNICVSDPLSGYDEGQFDPLSGYDEGQFVKCKVLEISRTVRGTFHVELSLRSSLDGM  1350

Query  1876  NNQNISE-HDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNL  1700
             ++ N S+   DV +  + ++ I+DL P+M VQGYVKNVT KGCFIMLSRK+DAK+LLSNL
Sbjct  1351  SSTNSSDLSTDVDTPGKHLEKIEDLSPNMIVQGYVKNVTSKGCFIMLSRKLDAKVLLSNL  1410

Query  1699  ADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNI  1520
             +DG++ESPEKEFP+GKLV G+V+SVE LSKRVEVTL+TS S T  +S+I+ L+N   G+I
Sbjct  1411  SDGYVESPEKEFPIGKLVAGRVLSVEPLSKRVEVTLKTSDSRTASQSEINNLSNLHVGDI  1470

Query  1519  ISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdR  1340
             + G+IKR+ES+GLFI+++NTNLVGLCHVSELS+DH+DN+ + Y+AG+ V+VK+LKVDK++
Sbjct  1471  VIGQIKRVESYGLFITIENTNLVGLCHVSELSEDHVDNIGTIYRAGEKVKVKILKVDKEK  1530

Query  1339  HRISLGMKNSYFRDDDGEDIQTTSRQSINSTDKGNSVFIGTQSTVFPESSDA--DIDVSV  1166
              RISLGMK+SYF+ +D +++Q +S +  +   +    +   +S++   SS A  D+D   
Sbjct  1531  RRISLGMKSSYFK-NDADNLQMSSEEESDEAIEEVGSY--NRSSLLENSSVAVQDMDTES  1587

Query  1165  VNTTDNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkramkk  986
              +    +L ++ESRAS+PPLEV LDD E  D+D+ +++N  HT  A T DEK+ + A KK
Sbjct  1588  EDGGSLVLAQIESRASVPPLEVNLDD-EQPDMDNGISQNQGHTDEAKTIDEKNNRHAKKK  1646

Query  985   akkerereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARS  806
              K+ERE+EIRAAEERLLEKD PR  DEFE+LVRSSPNSSFVWIKYMAFMLS+ DVEKARS
Sbjct  1647  EKEEREQEIRAAEERLLEKDAPRTPDEFERLVRSSPNSSFVWIKYMAFMLSMADVEKARS  1706

Query  805   IAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALL  626
             IAE+A+ TINIREE+EKLN+WVAYFNLE EYGNPP+EAV+KVFQRALQYCDPKKVHLALL
Sbjct  1707  IAERALQTINIREENEKLNIWVAYFNLENEYGNPPEEAVVKVFQRALQYCDPKKVHLALL  1766

Query  625   GVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLCLPKHK  446
             G+YERTE  KL DELL KM+KKFKHSCK+WLRR+Q  LKQ Q+  Q++V RALL LP+HK
Sbjct  1767  GLYERTEQNKLADELLYKMIKKFKHSCKVWLRRVQRLLKQQQEGVQAVVQRALLSLPRHK  1826

Query  445   HIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFE  266
             HIKFI+QTAILEFK GVADRGRSMFE +L EYPKRTDLWS+YLDQEIR+GD+D+IR LFE
Sbjct  1827  HIKFISQTAILEFKNGVADRGRSMFEGILSEYPKRTDLWSIYLDQEIRLGDVDLIRGLFE  1886

Query  265   RAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             RAISLS+PPKKMKFLFKKYL YEKS+G+EERIE VK+KAMEYVES
Sbjct  1887  RAISLSLPPKKMKFLFKKYLEYEKSLGEEERIEYVKQKAMEYVES  1931



>ref|XP_010087548.1| Protein RRP5-like protein [Morus notabilis]
 gb|EXB29321.1| Protein RRP5-like protein [Morus notabilis]
Length=1916

 Score =  2436 bits (6314),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1275/1911 (67%), Positives = 1538/1911 (80%), Gaps = 37/1911 (2%)
 Frame = -2

Query  5815  KNPKNFKRKGKNNEAGNASFSGKSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEF  5636
             KNP   K+K + N+A  +    ++  LQLEDE P FPRGG S LS+ E DEVRAEVDAEF
Sbjct  24    KNPFKAKKKNEQNDAAKS----EAVALQLEDEEPAFPRGGGSSLSRRERDEVRAEVDAEF  79

Query  5635  EAEDRylkkkkqhklykKNQSVEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVI  5456
             EAE+R L+KKK+  L  +NQ+ +DDLGSLFG  I+GKLP+ AN+IT KNISPG+KLWGV+
Sbjct  80    EAEERGLRKKKRKSLKNRNQTEDDDLGSLFGGGITGKLPRYANKITLKNISPGIKLWGVV  139

Query  5455  AEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLH  5276
             AEVN+KD+V+SLPGGLRGLV A++A DP  DNE   +   +N LS +FHVGQLV+C+VL+
Sbjct  140   AEVNKKDLVISLPGGLRGLVRAADAVDPGLDNEVESI--ANNVLSSIFHVGQLVACVVLN  197

Query  5275  LDDDKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSG  5096
             LD+D +E+GK KIWLSLRL+LL+K LTLD+IQEG +L+AY+KS EDHGYILHFGLPSF+G
Sbjct  198   LDNDNRESGKRKIWLSLRLSLLYKGLTLDSIQEGTVLTAYVKSNEDHGYILHFGLPSFTG  257

Query  5095  FLPIHSQSVDKMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPG  4916
             FLP +SQS  K+NTG+L++G+VKS+DRTRKVVY+SS PD ++K+VTKD+KGIS DLL+PG
Sbjct  258   FLPKNSQSDIKINTGELLQGIVKSIDRTRKVVYMSSEPDTVSKHVTKDVKGISFDLLIPG  317

Query  4915  MMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDP  4736
             MMV+A V S LENGVMLSFLTYFTGTVD+FHLQ  FP  SW+DDY +NKKVNARILFIDP
Sbjct  318   MMVDARVQSTLENGVMLSFLTYFTGTVDMFHLQNSFPATSWRDDYNKNKKVNARILFIDP  377

Query  4735  ATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYI  4556
             ++RA+GL+LNPHLV  K+PPS VK+GDI+E +KVIRVD+GLGLLLEIPS PV TPAYV +
Sbjct  378   SSRAIGLTLNPHLVCNKSPPSHVKIGDIYENSKVIRVDRGLGLLLEIPSMPVSTPAYVSV  437

Query  4555  SdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVV  4376
             SDV + EV+K+EK FK G  +RVR+LG RNLEG+ATG+LK +AFEGSVFTHSD+ PGM+ 
Sbjct  438   SDVAEGEVRKLEKKFKEGSCIRVRILGLRNLEGVATGTLKANAFEGSVFTHSDITPGMIA  497

Query  4375  KAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRIT  4196
             +AKVI VDSFGAIVQF  GVKA CPLRHMSE EI K  KKF+VG+ELVFRVLG KSK IT
Sbjct  498   RAKVIAVDSFGAIVQFPGGVKAQCPLRHMSELEIPKAGKKFKVGAELVFRVLGGKSKMIT  557

Query  4195  VTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDP  4016
             VTHKKTLVKSKL I+SSYTDAT+GLITHGWITKIEKHGCFVRFYNGVQGFAPRSEL L+ 
Sbjct  558   VTHKKTLVKSKLPIISSYTDATDGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELELEA  617

Query  4015  GSD----ISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVE  3848
             G D     SS+YHV QV+KCR+VSS P SR+I LSF  +P R+ E +++  G VVSG+V+
Sbjct  618   GCDDDPIPSSIYHVGQVIKCRIVSSVPGSRRINLSFIIKPRRVLEDDVINLGGVVSGVVD  677

Query  3847  LVTPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNL  3668
              +TP  +VV V NG+ +LKGT++T+HL+DH+G A L+KSVLKPGYEFDQLLVLDIE  N 
Sbjct  678   RITPKGVVVYV-NGKKYLKGTITTEHLADHQGQAALLKSVLKPGYEFDQLLVLDIESNNF  736

Query  3667  VLSAKYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDD  3488
             + SAKYSLI +AQQLP +++QISP+SVVHGY+CN+I  G FVRFLG LTGFSPRSKA DD
Sbjct  737   IFSAKYSLIKSAQQLPSELSQISPNSVVHGYICNIIETGCFVRFLGHLTGFSPRSKAMDD  796

Query  3487  RRYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQ  3308
              + D SE FY+GQSV +NILDVN E  RIT+SLKQS CSSTDA+ +Q+YFLLE KIAKLQ
Sbjct  797   YKIDLSEAFYVGQSVRSNILDVNNEKARITLSLKQSSCSSTDASLMQDYFLLEEKIAKLQ  856

Query  3307  SLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETG  3128
             SLDS +S LNW  GF LG +VEG++ E K+ GVVV+F+KY+DV GFI+  QL G  VETG
Sbjct  857   SLDSCESELNWTKGFNLGRVVEGRIQETKDVGVVVSFDKYNDVLGFITHNQLAGTTVETG  916

Query  3127  STIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAV  2948
             S IQA V+DVS  EHLVDLSLK E + G   +++  +  KKKRK+EA K+LE++Q+VNAV
Sbjct  917   SVIQAVVLDVSITEHLVDLSLKTELI-GKFKESSRSQNDKKKRKKEASKNLELHQTVNAV  975

Query  2947  VEIVKENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRL  2768
             VE+VKENYLVLS+  CNYALGYAS  D+N+Q  P KQF+NGQSV+AT+MALP  ST GRL
Sbjct  976   VEMVKENYLVLSIHECNYALGYASKFDYNSQMSPQKQFLNGQSVMATVMALPSPSTMGRL  1035

Query  2767  LLLLKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEA  2588
             LLLL +I E   +SSSKR KK SSY +GSLVQAEIT+I+PLELRLKFG GFHGR+HITE 
Sbjct  1036  LLLLNSIGEPG-TSSSKRAKKKSSYTLGSLVQAEITEIRPLELRLKFGVGFHGRLHITEV  1094

Query  2587  TDDNTTEGPLNDFRIGQTLTARIVSKDSRSENK-RGYQWELSTKPSVLAG----DMDGPH  2423
              DDN  E P ++FR+GQT+TA+IV K + S++K + YQ++LS KPSVL G    + +   
Sbjct  1095  YDDNVLENPFSNFRVGQTVTAKIVGKINHSDSKQKSYQFDLSVKPSVLTGSSEIEDELAT  1154

Query  2422  ESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSV  2243
             E  ++STGQ +SGYV+KVDSEW WLTISR VRAQL+ILDSS +P+E  EFQKRF+VGK +
Sbjct  1155  EELDFSTGQRVSGYVYKVDSEWVWLTISRHVRAQLFILDSSCDPAEHTEFQKRFHVGKVI  1214

Query  2242  SGYILSANKEKKLLRL-------VPHTLLITPEDTVPSSESARCHIREGSVLGGRISKIL  2084
             +GYIL+ NK+KKLLRL       V H   ++  + +  SE+   HI EG +LGGRISKIL
Sbjct  1215  TGYILTVNKDKKLLRLVLRPVLSVSHK--VSDGEVLIPSENVTAHICEGCILGGRISKIL  1272

Query  2083  PGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDL  1904
              GVGGL VQI  H +G+VHF EL D WVSDPLSGY EGQFVKCKVL+V  SVKG   +DL
Sbjct  1273  LGVGGLTVQIGPHTYGRVHFAELTDSWVSDPLSGYHEGQFVKCKVLKVIQSVKGKFQIDL  1332

Query  1903  SLRWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVD  1724
             SLR +   M +Q+  E      Q + V+ I+DLHPDM VQGYVKNVTPKGCFI+LSRKVD
Sbjct  1333  SLRSSRVGMISQDAKEARKKEPQTKFVETIEDLHPDMAVQGYVKNVTPKGCFIVLSRKVD  1392

Query  1723  AKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDAL  1544
             AKILLSNL+DG++ +PEKEFP+GKLVTG+V+SVE LSKRV+VTL+T  ++  +KS+   L
Sbjct  1393  AKILLSNLSDGYVINPEKEFPIGKLVTGRVLSVEPLSKRVQVTLKTLGAS--KKSETSNL  1450

Query  1543  NNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvk  1364
             ++   G+ ISG+IKR+ESFGLFI++++TNLVGLCH SELSDD IDN++++Y+AG+ VR K
Sbjct  1451  SSLHVGDFISGRIKRVESFGLFITINDTNLVGLCHKSELSDDQIDNIEAKYRAGERVRAK  1510

Query  1363  vlkvdkdRHRISLGMKNSYFRDDDGEDIQTTSRQSINSTDKGNSVFIGTQSTVFPESSDA  1184
             +LKVD  R+RISLGMK+SY  DD+      T   S    D  N     T+    P   D 
Sbjct  1511  ILKVDPQRNRISLGMKDSYLLDDN-----DTEENSDQEADASNGFVNDTKLISLP---DN  1562

Query  1183  DIDVSVVNTTDNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdk  1004
             D+DV   N    IL + ESRAS+PPLEV LDD+   D+++ V++N +    A T DEK K
Sbjct  1563  DMDVECANLEIPILAQAESRASVPPLEVTLDDVYQEDVNNVVSRNEEPIDEATTLDEKTK  1622

Query  1003  kramkkakkerereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGD  824
             +R  KKAK+EREREIRAAEERLLEKDIPR T+EFEKLVR SPNSSFVWIKYM F +S+ D
Sbjct  1623  RRGKKKAKEEREREIRAAEERLLEKDIPRTTEEFEKLVRGSPNSSFVWIKYMDFAISMAD  1682

Query  823   VEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKK  644
             VEKARSIAE+A+ TINIREE+EKLN+WVAYFNLE +YGNPP+EAV K+FQRALQY DPKK
Sbjct  1683  VEKARSIAERALQTINIREENEKLNIWVAYFNLENKYGNPPEEAVQKIFQRALQYNDPKK  1742

Query  643   VHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALL  464
             VHLALLG+YERTE ++L DEL+E+M KKFK SCK+WLRR Q  L Q QD  Q IVNRALL
Sbjct  1743  VHLALLGMYERTEQHRLADELVERMTKKFKQSCKVWLRRTQRVLNQQQDGVQPIVNRALL  1802

Query  463   CLPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDV  284
              LPKHKHIKFI+QTAILEFKCGVA  GRSMFE +LKEYPKRTDLWS+YLDQEIR+GD+DV
Sbjct  1803  SLPKHKHIKFISQTAILEFKCGVAHMGRSMFEGILKEYPKRTDLWSIYLDQEIRLGDVDV  1862

Query  283   IRALFERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             IRALFERA  LS+P KKMKFLFKKYL YEKS+GDEERIE VK+KAM+YVES
Sbjct  1863  IRALFERATCLSLPAKKMKFLFKKYLEYEKSLGDEERIEYVKKKAMDYVES  1913



>gb|KDP21906.1| hypothetical protein JCGZ_03044 [Jatropha curcas]
Length=1928

 Score =  2406 bits (6236),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1255/1904 (66%), Positives = 1527/1904 (80%), Gaps = 39/1904 (2%)
 Frame = -2

Query  5767  NASFSGKSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhkly  5588
             N +   ++  LQLED+VPDFPRGG S LS+ E  E+RAE DAEFEAE+R    KK+ K  
Sbjct  36    NDTVPSEAISLQLEDDVPDFPRGGGSSLSQRERKEIRAEADAEFEAEERVSVMKKKGKKL  95

Query  5587  kKNQSVE-DDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGG  5411
             +  + +E DD GSLFG  ++GKLP+ AN+IT KNISPGMKLWG++AEVNEKD+V+SLPGG
Sbjct  96    QNKKHLETDDFGSLFGEGLTGKLPRFANKITLKNISPGMKLWGLVAEVNEKDLVISLPGG  155

Query  5410  LRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWL  5231
             LRGLV + +A DP+  +E  ++E     L  +F+ GQLVSC VL LDDDKK+ GK KIWL
Sbjct  156   LRGLVRSVDAVDPVLGDEIEDIERN---LPSIFYTGQLVSCTVLQLDDDKKDNGKRKIWL  212

Query  5230  SLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVD---KM  5060
             SLRL+LLHK  +LDAIQEG++L AY+KS EDHGYILHFGLPSF GFL  +SQ+ +   ++
Sbjct  213   SLRLSLLHKGFSLDAIQEGMVLMAYVKSVEDHGYILHFGLPSFMGFLAKNSQNENTNSEV  272

Query  5059  NTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLE  4880
              TGQL++G+V+ +D+TRKVVYLS+ PDA++K V KDLKGISIDLLVPGMMVNA V S LE
Sbjct  273   KTGQLLQGIVRRIDKTRKVVYLSADPDAVSKCVMKDLKGISIDLLVPGMMVNARVQSTLE  332

Query  4879  NGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPH  4700
             NG+ML+FLTYFTGTVDIFHLQ  FP  +WKDDY  NKKVNARILFIDP+TRAVGL+LN H
Sbjct  333   NGIMLAFLTYFTGTVDIFHLQNAFPTSNWKDDYNINKKVNARILFIDPSTRAVGLTLNQH  392

Query  4699  LVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkme  4520
             LV  + PP  VKVGDI+E AKV+RVDKG GLLLEIPS+ V TPA+V ISDV + EV+K+E
Sbjct  393   LVQNQTPPMPVKVGDIYESAKVVRVDKGSGLLLEIPSTSVTTPAFVSISDVAESEVRKLE  452

Query  4519  KTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGA  4340
             K FK G  VRVR+LGF++LEGLATG LK SAFEG VFTHSDVKPGMVV+AK+I VDSFGA
Sbjct  453   KKFKEGNKVRVRILGFKHLEGLATGILKASAFEGPVFTHSDVKPGMVVRAKIIAVDSFGA  512

Query  4339  IVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKL  4160
             IV+F  G+KALCPL HMSEFEI KPRKKF+VG+E++FRVLGCKSKRITVTHKKTLVKSKL
Sbjct  513   IVKFPGGLKALCPLSHMSEFEITKPRKKFKVGAEMLFRVLGCKSKRITVTHKKTLVKSKL  572

Query  4159  DILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQ  3980
              IL SY DAT+GLITHGWITKIEKHGCFV FYNGVQGFAPRSELGL+PG++  S+YHV Q
Sbjct  573   PILGSYADATDGLITHGWITKIEKHGCFVHFYNGVQGFAPRSELGLEPGAEAISVYHVGQ  632

Query  3979  VVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQS  3800
              VKCRV+SS PAS +I LSF  +P  + E E +K G+VV+G+VE VTPD+++V +   + 
Sbjct  633   AVKCRVLSSIPASHRISLSFIMKPTSVCEEEAIKLGSVVAGVVEKVTPDAVIVYI-KAKD  691

Query  3799  HLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLP  3620
             ++KGT+ T+HL+DH G A L+KS++KPGYEFDQLLVLDIE  NL+ SAKYSLI++A QLP
Sbjct  692   YMKGTILTEHLADHHGQAALLKSIVKPGYEFDQLLVLDIESNNLIFSAKYSLINSAHQLP  751

Query  3619  LDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVC  3440
              ++NQI P SVVHGY+CN+I +G FVRFLGRLTGFSPRSKA DD R   +E FYIGQSV 
Sbjct  752   SELNQIHPQSVVHGYICNLIESGCFVRFLGRLTGFSPRSKAMDDPRAQLAEAFYIGQSVR  811

Query  3439  TNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFG  3260
             +NI+DV+ ET RIT+SLKQS CSS+DA+F+Q YF LE KIA+LQSLDS    L WV+GF 
Sbjct  812   SNIIDVSSETNRITLSLKQSNCSSSDASFLQGYFCLEDKIAELQSLDSKGPDL-WVEGFN  870

Query  3259  LGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHL  3080
             +GS++E KV E KE GVVV+FEKY+DV GFI+  QLGG+ VETGST++AAVIDV+K +HL
Sbjct  871   IGSVIEAKVRESKEVGVVVSFEKYNDVLGFIAHHQLGGMKVETGSTVRAAVIDVAKRDHL  930

Query  3079  VDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPAC  2900
             VDLSLKPEF++ S  + + ++T KKKRK E+ + L V+Q+V AVVEIVKENYLVLS+P  
Sbjct  931   VDLSLKPEFLDKSIDKGSTNQTHKKKRKLES-RSLGVHQTVKAVVEIVKENYLVLSIPEH  989

Query  2899  NYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEssss  2720
             NYA+GYAS+ D+NTQ L  KQ++NGQSVIAT+MALP+ ST GRLLLLLK+ISE+ E+SSS
Sbjct  990   NYAIGYASVLDYNTQKLLPKQYLNGQSVIATVMALPNPSTSGRLLLLLKSISEITETSSS  1049

Query  2719  krgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIG  2540
             K+ KK SSYDVGSLVQAEITD KPLE+RLKFG GF GR+HITE  +D   E P  +FRIG
Sbjct  1050  KKAKKKSSYDVGSLVQAEITDKKPLEMRLKFGIGFRGRIHITEVNNDCVLEDPFANFRIG  1109

Query  2539  QTLTARIVSKDSRSENKRGYQWELSTKPSVLAGDMDGP-----HESFNYSTGQLLSGYVF  2375
             QT+TARIV+K S+ ENK+   WELS KP +L  D + P      E   +S+G+ ++GYV+
Sbjct  1110  QTVTARIVAKASKVENKKSNLWELSIKPKILT-DYNEPADKLVSEELEFSSGRCVTGYVY  1168

Query  2374  KVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRL  2195
             KVDSEWAWL ISR V AQL+ILDS+ EPSEL+EFQKRF VGK+VSG ILS NKEK LLRL
Sbjct  1169  KVDSEWAWLAISRHVNAQLFILDSAREPSELQEFQKRFLVGKAVSGNILSYNKEKSLLRL  1228

Query  2194  VPHTLLITPED----------TVPSSESARCHIREGSVLGGRISKILPGVGGLLVQIDAH  2045
             V   L  +  D           VP  ++A  HI EG V+GGRI+KILP +GGLLVQI  H
Sbjct  1229  VLRPLCDSTHDGKALNKDNVNNVP-RDTASVHIHEGDVIGGRIAKILPNIGGLLVQIGPH  1287

Query  2044  LFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQN  1865
             L G+VHFT+L+D WV DPLSGY EGQFVKCKVL++  SV+ T H+DLSLR++LD M  QN
Sbjct  1288  LHGRVHFTDLQDSWVPDPLSGYHEGQFVKCKVLEISRSVRNTIHIDLSLRFSLDGMAGQN  1347

Query  1864  ISE-HDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGF  1688
              ++    + +    V+ I+DLHP+  VQGYVKNVT KGCFIMLSRK+DAKILLSNL+D +
Sbjct  1348  SADLSKKLDTSTEHVEKIEDLHPNTIVQGYVKNVTTKGCFIMLSRKIDAKILLSNLSDEY  1407

Query  1687  IESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGK  1508
             IE+PEKEFP+GKLV G+V+SVE LSKRVEVTL+ SSS     S  +  +    G+II+G+
Sbjct  1408  IENPEKEFPIGKLVIGRVLSVEPLSKRVEVTLKKSSSRNAAISGPNDWSTLHVGDIIAGR  1467

Query  1507  IKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRIS  1328
             IKR+ES+GLFI++D+TNLVGLCHVSELS+DH+DN++++Y+AG+ V V++LKVD++RHR+S
Sbjct  1468  IKRVESYGLFITIDHTNLVGLCHVSELSEDHVDNIETKYRAGEKVTVRILKVDEERHRVS  1527

Query  1327  LGMKNSYFRDDDGEDI-----QTTSRQSINSTDKGNSVFIGTQSTVFPESSDADIDVSVV  1163
             LGMKN     D+G D+     +  S + I+  D  +    G++        +  +DV   
Sbjct  1528  LGMKNL----DNGNDMSRLPSKEESDEDISENDAADDS--GSKRHESSSLGNPSVDVEPE  1581

Query  1162  NTTDNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkramkka  983
             N    +  + ESRASIPPL+V LDD+E SD+DD + +N +    A+  DEK+ +R  KK+
Sbjct  1582  NDECPLPAQAESRASIPPLDVTLDDMELSDVDDVIKQNQEQIVEANVIDEKNNRREKKKS  1641

Query  982   kkerereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSI  803
             K++RE EIRAAEERLLEKDIPR  +EFEKLVRSSPNSSF+WIKYMAFML+L D+EKARSI
Sbjct  1642  KEQREEEIRAAEERLLEKDIPRTAEEFEKLVRSSPNSSFIWIKYMAFMLNLADIEKARSI  1701

Query  802   AEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLG  623
             AE+A+ TIN REE+EKLN+WVAYFNLE EYGNPP+EAV KVFQRALQYCDPKKVHLALLG
Sbjct  1702  AERALRTINFREENEKLNIWVAYFNLEKEYGNPPEEAVKKVFQRALQYCDPKKVHLALLG  1761

Query  622   VYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLCLPKHKH  443
             VYERTE +KL DELL++M+KKFKHSCKIWLRR+Q  LKQ QD  QS+V RA+L LP+ KH
Sbjct  1762  VYERTEQHKLADELLDRMLKKFKHSCKIWLRRVQRLLKQEQDGVQSVVQRAILSLPRRKH  1821

Query  442   IKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFER  263
             IKFI+QTAILEFKCGV DRGRSMFE +L+EYPKRTDLWSVYLDQEIR+GD++V R LFER
Sbjct  1822  IKFISQTAILEFKCGVPDRGRSMFEGILREYPKRTDLWSVYLDQEIRLGDVEVTRTLFER  1881

Query  262   AISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             AISLS+PPKKMKFLFKKYL YEKS+GDEERI SVK+KAMEYVE+
Sbjct  1882  AISLSLPPKKMKFLFKKYLEYEKSLGDEERINSVKQKAMEYVEN  1925



>ref|XP_006429952.1| hypothetical protein CICLE_v10013867mg [Citrus clementina]
 gb|ESR43192.1| hypothetical protein CICLE_v10013867mg [Citrus clementina]
Length=1935

 Score =  2394 bits (6203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1259/1938 (65%), Positives = 1549/1938 (80%), Gaps = 72/1938 (4%)
 Frame = -2

Query  5806  KNFKRKGKNNEAG-NASFSGKSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEA  5630
             K+ K++ KN++   N +   ++  L  +D+VP FPRGG   L++ E DE+ AEVDAEFEA
Sbjct  21    KSSKKQFKNSKKQINDAVEAQALALPPDDDVPVFPRGGGHSLTQRERDEIHAEVDAEFEA  80

Query  5629  EDR----ylkkkkqhklykKNQSVEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWG  5462
              +R      KKKK+    K N++V DDLGSLFG  ISGKLP+ AN+IT KNIS GMKLWG
Sbjct  81    VERGLHKKNKKKKKKTERKANETV-DDLGSLFGDGISGKLPRYANKITLKNISAGMKLWG  139

Query  5461  VIAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIV  5282
             V+AEVNEKD+V+ LPGGLRGL  A++A DP+ DNE    E   N L  +FHVGQLVSCIV
Sbjct  140   VVAEVNEKDLVICLPGGLRGLARAADALDPILDNEIEANE--DNLLPTIFHVGQLVSCIV  197

Query  5281  LHLDDDKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSF  5102
             L LDDDKKE GK KIWLSLRL+LL+K L+L+ +QEG++L+AY+KS EDHGYILHFGLPSF
Sbjct  198   LQLDDDKKEIGKRKIWLSLRLSLLYKGLSLETVQEGMVLTAYVKSIEDHGYILHFGLPSF  257

Query  5101  SG---------------------------------FLPIHSQSVDKMNTGQLVEGVVKSV  5021
             +G                                 F   +  S   +  G L++GVV+S+
Sbjct  258   TGIFNSLKKEKAKQEVKVSFRFSHLVVQLCSLKEEFRSFYENSGIDVKPGLLLQGVVRSI  317

Query  5020  DRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTG  4841
             DRTRKVVYLSS PD ++K VTKDLKGISIDLLVPGMMV+A V S+LENGVMLSFLTYFTG
Sbjct  318   DRTRKVVYLSSDPDTVSKCVTKDLKGISIDLLVPGMMVSARVQSILENGVMLSFLTYFTG  377

Query  4840  TVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSLVKV  4661
             TVDIFHLQ  FP  +WK+DY Q+KKVNARILF+DP +RAVGL+LNP+L+H +APPS VKV
Sbjct  378   TVDIFHLQNTFPTTNWKNDYNQHKKVNARILFVDPTSRAVGLTLNPYLLHNRAPPSHVKV  437

Query  4660  GDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKVVRVRV  4481
             GDI++Q+KV+RVD+GLGLLL+IPS+PV TPAYV ISDV ++EV+K+EK +K G  VRVR+
Sbjct  438   GDIYDQSKVVRVDRGLGLLLDIPSTPVSTPAYVTISDVAEEEVRKLEKKYKEGSCVRVRI  497

Query  4480  LGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGVKALCP  4301
             LGFR+LEGLATG LK SAFEG VFTHSDVKPGMVVK KVI VDSFGAIVQF  GVKALCP
Sbjct  498   LGFRHLEGLATGILKASAFEGLVFTHSDVKPGMVVKGKVIAVDSFGAIVQFPGGVKALCP  557

Query  4300  LRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSYTDATEGL  4121
             L HMSEFEIVKP KKF+VG+ELVFRVLG KSKRITVTHKKTLVKSKL ILSSY +AT+ L
Sbjct  558   LPHMSEFEIVKPGKKFKVGAELVFRVLGVKSKRITVTHKKTLVKSKLAILSSYAEATDRL  617

Query  4120  ITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSSSPAS  3941
             ITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPG + SSMYHV QVVKCR++SS PAS
Sbjct  618   ITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGCEPSSMYHVGQVVKCRIMSSIPAS  677

Query  3940  RQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTVSTQHLSD  3761
             R+I LSF  +P R+SE ++VK G++VSG+V++VTP+++VV V   + + KGT+ T+HL+D
Sbjct  678   RRINLSFMMKPTRVSEDDLVKLGSLVSGVVDVVTPNAVVVYV-IAKGYSKGTIPTEHLAD  736

Query  3760  HRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQISPHSVVH  3581
             H   A +MKSV+KPGYEFDQLLVLD E  NL+LSAKYSLI++AQQLP D + I P+SVVH
Sbjct  737   HLEHATMMKSVIKPGYEFDQLLVLDNESSNLLLSAKYSLINSAQQLPSDASHIHPNSVVH  796

Query  3580  GYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVNGETGRI  3401
             GYVCN+I  G FVRFLGRLTGF+PRSKA D +R D S+ +Y+GQSV +NILDVN ETGRI
Sbjct  797   GYVCNIIETGCFVRFLGRLTGFAPRSKAVDGQRADLSKTYYVGQSVRSNILDVNSETGRI  856

Query  3400  TVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIK  3221
             T+SLKQS CSSTDA+F+QEYFLLE KIA LQS +   S L WV+GF +GS++EGKVHE  
Sbjct  857   TLSLKQSCCSSTDASFMQEYFLLEEKIAMLQSSNHNGSELKWVEGFIIGSVIEGKVHESN  916

Query  3220  EFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEFVNGS  3041
             +FGVVV+FEK+ DV+GFI+  Q  G  VETGS IQA+++DV+K E LVDLSLK  F++  
Sbjct  917   DFGVVVSFEKHSDVYGFITHHQ-SGATVETGSVIQASILDVAKAERLVDLSLKTVFIDRF  975

Query  3040  KPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGYASLNDFN  2861
             +   +N + QKKKRKREA KDL V+Q+             VLS+P  NY++GYAS++D+N
Sbjct  976   REANSNRQAQKKKRKREASKDLGVHQT-------------VLSLPEYNYSIGYASVSDYN  1022

Query  2860  TQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkknsSYDVGS  2681
             TQ  P KQF+NGQSVIAT+MALP  ST GRLLLLLKAISE  E+SSSKR KK SSY VGS
Sbjct  1023  TQKFPQKQFLNGQSVIATVMALPSPSTAGRLLLLLKAISE-TETSSSKRAKKKSSYGVGS  1081

Query  2680  LVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARIVSKDSR  2501
             LVQAEIT+IKPLELRLKFG GFHGR+HITE+   N  E   ++F+IGQT+TARI++K ++
Sbjct  1082  LVQAEITEIKPLELRLKFGIGFHGRIHITES---NVVENLFSNFKIGQTVTARIIAKSNK  1138

Query  2500  SENKRGYQWELSTKPSVLAGDMDGPH---ESFNYSTGQLLSGYVFKVDSEWAWLTISREV  2330
              + K+ + WELS KPS+L     G     E  + S GQ ++GYV+KVD+EWA LTISR +
Sbjct  1139  PDMKKSFLWELSIKPSMLTVSEIGSKLLFEECDVSIGQRVTGYVYKVDNEWASLTISRHL  1198

Query  2329  RAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLV--PHTLLITPEDTV  2156
             +AQL+ILDS+ EPSEL++FQ+RF++GK+VSG++LS NKEKKLLRLV  P    I+ +   
Sbjct  1199  KAQLFILDSACEPSELQQFQRRFHIGKAVSGHVLSINKEKKLLRLVLRPFQDGISDKTVD  1258

Query  2155  PSSESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYC  1976
              S+++ +  I EG ++GGRISKIL GVGGL+VQI  HL+G+VHFTEL++  VSDPLSGY 
Sbjct  1259  ISNDNMQTFIHEGDIVGGRISKILSGVGGLVVQIGPHLYGRVHFTELKNICVSDPLSGYH  1318

Query  1975  EGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISE-HDDVHSQNRRVQDIKDLHP  1799
             EGQFVKCKVL++  +V+GT HV+LSLR +LD M++ N S+   DV +  + ++ I+DL P
Sbjct  1319  EGQFVKCKVLEISRTVRGTLHVELSLRSSLDGMSSTNSSDLSTDVDTPGKHLEKIEDLSP  1378

Query  1798  DMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVES  1619
             +M VQGYVKNVT KGCFIMLSRK+DAK+LLSNL+DG++ESPEKEFP+GKLV G+V+SVE 
Sbjct  1379  NMIVQGYVKNVTSKGCFIMLSRKLDAKVLLSNLSDGYVESPEKEFPIGKLVAGRVLSVEP  1438

Query  1618  LSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCH  1439
             LSKRVEVTL+TS S T  +S+I+ L+N   G+I+ G+IKR+ES+GLFI+++NTNLVGLCH
Sbjct  1439  LSKRVEVTLKTSDSRTASQSEINNLSNLHVGDIVIGQIKRVESYGLFITIENTNLVGLCH  1498

Query  1438  VSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSYFRDDDGEDIQTTSRQS  1259
             VSELS+DH+DN+++ Y+AG+ V+ K+LKVDK++ RISLGMK+SYF+ +D +++Q +S + 
Sbjct  1499  VSELSEDHVDNIETIYRAGEKVKAKILKVDKEKRRISLGMKSSYFK-NDADNLQMSSEEE  1557

Query  1258  INSTDKGNSVFIGTQSTVFPESSDA--DIDVSVVNTTDNILTEVESRASIPPLEVPLDDI  1085
              +   +    +   +S++   SS A  D+D+   +    +L ++ESRAS+PPLEV LDD 
Sbjct  1558  SDEAIEEVGSY--NRSSLLENSSVAVQDMDMESEDGGSLVLAQIESRASVPPLEVNLDD-  1614

Query  1084  ENSDIDDAVNKNPDHTGGADTTDekdkkramkkakkerereiraaeerlleKDIPRNTDE  905
             E  D+D+ +++N  HT  A T DEK+ + A KK K+ERE+EIRAAEERLLEKD PR  DE
Sbjct  1615  EQLDMDNGISQNQGHTDEAKTIDEKNNRHAKKKEKEEREQEIRAAEERLLEKDAPRTPDE  1674

Query  904   FEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNL  725
             FE+LVRSSPNSSFVWIKYMAFMLS+ DVEKARSIAE+A+ TINIREE+EKLN+WVAYFNL
Sbjct  1675  FERLVRSSPNSSFVWIKYMAFMLSMADVEKARSIAERALQTINIREENEKLNIWVAYFNL  1734

Query  724   EIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSC  545
             E EYGNPP+EAV+KVFQRALQYCDPKKVHLALLG+YERTE  KL DELL KM+KKFKHSC
Sbjct  1735  ENEYGNPPEEAVVKVFQRALQYCDPKKVHLALLGLYERTEQNKLADELLYKMIKKFKHSC  1794

Query  544   KIWLRRIQWALKQNQDNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVADRGRSMFER  365
             K+WLRR+Q  LKQ Q+  Q++V RALL LP+HKHIKFI+QTAILEFK GVADRGRSMFE 
Sbjct  1795  KVWLRRVQRLLKQQQEGVQAVVQRALLSLPRHKHIKFISQTAILEFKNGVADRGRSMFEG  1854

Query  364   MLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVG  185
             +L+EYPKRTDLWS+YLDQEIR+GD+D+IR LFERAISLS+PPKKMKFLFKKYL YEKS+G
Sbjct  1855  ILREYPKRTDLWSIYLDQEIRLGDVDLIRGLFERAISLSLPPKKMKFLFKKYLEYEKSLG  1914

Query  184   DEERIESVKRKAMEYVES  131
             +EERIE VK+KAMEYVES
Sbjct  1915  EEERIEYVKQKAMEYVES  1932



>ref|XP_007029113.1| RNA binding,RNA binding isoform 2 [Theobroma cacao]
 gb|EOY09615.1| RNA binding,RNA binding isoform 2 [Theobroma cacao]
Length=1790

 Score =  2393 bits (6202),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1229/1836 (67%), Positives = 1486/1836 (81%), Gaps = 75/1836 (4%)
 Frame = -2

Query  5566  DDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLAS  5387
             DDLGSLFG  I+GKLP+ AN+IT KNISPGMKLWGV+AEVNEKD+V+SLPGGLRGLV A+
Sbjct  3     DDLGSLFGDGITGKLPRYANKITLKNISPGMKLWGVVAEVNEKDLVISLPGGLRGLVRAA  62

Query  5386  EAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLALLH  5207
             +A D +  NE    E   N+L+ +F  GQLVSCIVL LDDDKKE GK KIWLSLRL+LLH
Sbjct  63    DALDSVLSNEVENNE--GNFLTNIFCTGQLVSCIVLQLDDDKKETGKRKIWLSLRLSLLH  120

Query  5206  KNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIH-SQSVD-KMNTGQLVEGV  5033
             K+ TLDA+QEG++L+AY+KS EDHGYILHFGL SF GFLP    +S D K+ TGQ ++GV
Sbjct  121   KSFTLDAVQEGMVLTAYVKSIEDHGYILHFGLSSFMGFLPKDDEESRDIKVRTGQFLQGV  180

Query  5032  VKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLT  4853
             V+ +D+TRKVVYLSS PD ++K VTKDLKGISIDLL+PGM+VN SV S+LENGVMLSFLT
Sbjct  181   VRRIDKTRKVVYLSSNPDTVSKCVTKDLKGISIDLLIPGMLVNTSVRSILENGVMLSFLT  240

Query  4852  YFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPS  4673
             YFTGTVD+FHLQ  FP   WKDDY QNKK+NARILFIDP+TRAVGL+LNPHLVH KAPPS
Sbjct  241   YFTGTVDMFHLQNQFPTKDWKDDYNQNKKINARILFIDPSTRAVGLTLNPHLVHNKAPPS  300

Query  4672  LVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKVV  4493
              V +G+I++Q+KVIRVD+GLGLLL+IPS PV TPAYVYISDV ++EV+K+EK FK G  V
Sbjct  301   HVNIGEIYDQSKVIRVDRGLGLLLDIPSKPVSTPAYVYISDVAEEEVRKLEKKFKEGSQV  360

Query  4492  RVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGVK  4313
             RVR+ GFR+LEGLATG LK SAFEG VFTHSDVKPGMV++AKVI +DSF AIVQF  GVK
Sbjct  361   RVRIHGFRHLEGLATGILKASAFEGQVFTHSDVKPGMVIRAKVIALDSFSAIVQFPGGVK  420

Query  4312  ALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSYTDA  4133
             ALCP+RHMSEFEI KP KKF+VG+ELVFRVLGCKSKRITVTHKKTLVKSKL I+SSY DA
Sbjct  421   ALCPIRHMSEFEIAKPGKKFKVGAELVFRVLGCKSKRITVTHKKTLVKSKLGIISSYADA  480

Query  4132  TEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSS  3953
             TEG ITHGWITKIEKHGCFVRFYNGVQGFAPRSELGL PG D SSMYHV QV+KCRV SS
Sbjct  481   TEGFITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLGPGYDPSSMYHVGQVIKCRVTSS  540

Query  3952  SPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTVSTQ  3773
             +PASR+I LSF  +P+R+SE ++VK G++VSG+++ +TP ++V+ VN+ ++HLKGT+S +
Sbjct  541   NPASRRINLSFQMKPVRVSEDDLVKLGSIVSGLIDRLTPSAVVIQVNS-KAHLKGTISNE  599

Query  3772  HLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQISPH  3593
             HL+D+   A L+KSVLKPGY+FDQLLVLDIEG N++LSAKYSL S A+QLP D++QI P+
Sbjct  600   HLADNHESAALLKSVLKPGYKFDQLLVLDIEGNNILLSAKYSLTSLAEQLPSDISQIHPN  659

Query  3592  SVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVNGE  3413
             SVVHGYVCN+I  G FVRFLGRLTGFSPRSK+TDD + D S  FY+GQSV +NILDVN E
Sbjct  660   SVVHGYVCNLIETGCFVRFLGRLTGFSPRSKSTDDYKADLSGAFYVGQSVRSNILDVNSE  719

Query  3412  TGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGKV  3233
             T RIT+SLKQS CSSTDA+FIQE+FLLE KIAKLQS DS  S L WV+GF +GS++EGK+
Sbjct  720   TARITLSLKQSSCSSTDASFIQEFFLLEEKIAKLQSSDSDGSELKWVEGFNVGSVIEGKI  779

Query  3232  HEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEF  3053
              E K+ GVVV+F+KY+DV GF++  QLGG+ +ETGS +QAAV+DV+K E LVDLSLKPEF
Sbjct  780   GEAKDIGVVVSFDKYNDVLGFVTHYQLGGLTLETGSIVQAAVLDVAKAERLVDLSLKPEF  839

Query  3052  VNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGYASL  2873
             V+ S+ +++  + QKKKRKREA KDLEV+Q+VNAVVEIVKE+YLVL++P  NYA+GYAS 
Sbjct  840   VDKSQEESSKGQIQKKKRKREASKDLEVHQTVNAVVEIVKEHYLVLAIPEYNYAIGYASK  899

Query  2872  NDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkknsSY  2693
              D+NTQ  P KQFVNGQ VIAT+MALP  +T GRLLLLL +ISEV E+SSSKR KK SSY
Sbjct  900   ADYNTQKFPQKQFVNGQRVIATVMALPSPTTSGRLLLLLNSISEVTETSSSKRAKKKSSY  959

Query  2692  DVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARIVS  2513
              VGSLV AE+T+I PLELRLKFG GF GRVH+TE  DDN  E P  +F+IGQT+TAR+V 
Sbjct  960   SVGSLVSAEVTEIMPLELRLKFGIGFRGRVHVTEVNDDNVLENPFGNFKIGQTITARVVG  1019

Query  2512  KDSRSENKRGYQWELSTKPSVLAGD----MDGPHESFNYSTGQLLSGYVFKVDSEWAWLT  2345
             K     N++GY W+LS KP++LAG     ++  ++  N+S GQL++GYV+K+D+EWAWLT
Sbjct  1020  K----ANQKGYLWDLSIKPTMLAGTGETGVNSTNDECNFSAGQLVTGYVYKMDTEWAWLT  1075

Query  2344  ISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTL-----  2180
             ISR V+AQLYILDS+ EP+EL++FQ+RF VGK+VSG++L+ NK+KKLLRLV H L     
Sbjct  1076  ISRHVKAQLYILDSAREPNELQQFQERFKVGKAVSGHVLNVNKDKKLLRLVRHPLGALSI  1135

Query  2179  --------LITPEDTVPSSESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHF  2024
                          D   S ES   HI EG +LGGRISKILPGVGGLLVQI  H+FG+VHF
Sbjct  1136  RNVHGEDKRTGESDNNISGESVTTHIHEGDILGGRISKILPGVGGLLVQIGPHIFGRVHF  1195

Query  2023  TELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISE-HDD  1847
             TEL+D W SDPLSGY EGQFVKCKVL++ HSVKGT H+DLSLR +LD M   N SE   D
Sbjct  1196  TELKDTWESDPLSGYYEGQFVKCKVLEISHSVKGTIHIDLSLRLSLDGMLPNNPSELGSD  1255

Query  1846  VHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKE  1667
               S ++RV+ I+DL+P+M +QGYVKN  PKGCFI+LSRK+DAKILLSNL+DG+I+ P+KE
Sbjct  1256  EDSTSKRVEKIEDLYPNMAIQGYVKNTIPKGCFILLSRKLDAKILLSNLSDGYIDDPKKE  1315

Query  1666  FPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGKIKRIESF  1487
             FP+GKLV G+V++VE LSKRVEVTL+ S++    KS+I+  ++   G+I+SG+I+R+ES+
Sbjct  1316  FPIGKLVAGRVLAVEPLSKRVEVTLKKSNTNGTSKSEINDFSSLHVGDIVSGRIRRVESY  1375

Query  1486  GLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSY  1307
             GLF+++D+TN+VGLCHVSELSDDH+DN+Q++Y+AG+ V  K+LK+D++RHRISLGMKNSY
Sbjct  1376  GLFVTLDHTNMVGLCHVSELSDDHVDNIQTKYRAGEKVTAKILKLDEERHRISLGMKNSY  1435

Query  1306  FRDDDGEDIQTTSRQS----INSTDKGNSVFIGTQSTVFPESSDADIDVSVVNTTDNILT  1139
               DD   DIQ  S +     +  TD   S  + T ST+        + +   N   +I  
Sbjct  1436  LTDDI--DIQIPSNEESDEDVEETDDTRSRML-TDSTL-------GMAIEYENGASSICA  1485

Query  1138  EVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkramkkakkererei  959
             + ESRASIPPLEV LDDIE+SD+D  V++N  ++  A T DEK+K+RA KKAK++REREI
Sbjct  1486  QAESRASIPPLEVTLDDIEHSDMDILVSQNQANSNEAVTGDEKNKRRAKKKAKEDREREI  1545

Query  958   raaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTI  779
             RAAEER LE D+PR  DEFEKLVR+SPNSSFVWIKYMAFML+  D+EKAR+IAE+A+ TI
Sbjct  1546  RAAEERQLEMDVPRTADEFEKLVRNSPNSSFVWIKYMAFMLNSADIEKARAIAERALRTI  1605

Query  778   NIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHY  599
             NIREE+EKLN+WVAYFNLE +YGNPP+EAV K+FQRALQYCDPKKV              
Sbjct  1606  NIREENEKLNIWVAYFNLENQYGNPPEEAVQKIFQRALQYCDPKKV--------------  1651

Query  598   KLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLCLPKHKHIKFITQTA  419
                                 WLRR+Q  L Q QD  QS+VNRALLCLP+HKHIKFI+QTA
Sbjct  1652  --------------------WLRRVQMLLMQQQDGVQSVVNRALLCLPRHKHIKFISQTA  1691

Query  418   ILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPP  239
             ILEFK GV DRGRSMFE +L+EYPKRTDLWS+YLD EIR+GD DVIRALFERAISLS+PP
Sbjct  1692  ILEFKSGVPDRGRSMFEGILREYPKRTDLWSIYLDXEIRLGDEDVIRALFERAISLSLPP  1751

Query  238   KKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             KKMKFLFKKYL YEKS+GDEERI+SVK+KAM+YVES
Sbjct  1752  KKMKFLFKKYLDYEKSLGDEERIKSVKQKAMDYVES  1787



>ref|XP_010257601.1| PREDICTED: protein RRP5 homolog [Nelumbo nucifera]
Length=1933

 Score =  2382 bits (6174),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1264/1923 (66%), Positives = 1549/1923 (81%), Gaps = 35/1923 (2%)
 Frame = -2

Query  5818  IKNPKNFKRKGKNNEAGNASFSGKSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAE  5639
             +K  KNFK+  K  +    +   +  PLQ++D+VPDFPRGG  +LS++E+DEVRAEVDAE
Sbjct  16    LKPHKNFKKDRKIKQKSEDTVVSEGLPLQIDDDVPDFPRGGGRVLSRQEIDEVRAEVDAE  75

Query  5638  FEAEDRylkkkkqhklykKNQSVEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGV  5459
             FE E+R  +KKK+ +  K + + E+DLGSLFG  I+GKLP+ ANR+T KN+SPG+KLWGV
Sbjct  76    FEVEERGSRKKKKQQQKK-SYATENDLGSLFGDGITGKLPRFANRVTLKNVSPGIKLWGV  134

Query  5458  IAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVL  5279
             IAEVN+KD+VVSLPGGLRGLV  +EA D + D +  + E  SN LS +F+VGQLVSCIVL
Sbjct  135   IAEVNQKDLVVSLPGGLRGLVRVNEASDLVSDGDIKDAE--SNLLSNIFYVGQLVSCIVL  192

Query  5278  HLDDDK-KEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSF  5102
              + DDK +E GK KIWLS+RL+LLHK LTLD IQEG++L+AY+KS EDHG+ILHFGL SF
Sbjct  193   QVSDDKVEEKGKRKIWLSVRLSLLHKGLTLDVIQEGMVLTAYVKSIEDHGFILHFGLSSF  252

Query  5101  SGFLPIHSQSVD---KMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISID  4931
             +GFLPI  ++     K+N+GQLV+GVV+S+D++RKVVYLSS  D ++K V KDLKGIS+D
Sbjct  253   TGFLPIKREADGGEIKLNSGQLVQGVVRSIDKSRKVVYLSSDTDVVSKCVIKDLKGISLD  312

Query  4930  LLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARI  4751
             LLVPGMMVNA V S LENG+MLSFLTYFTGTVDIFHLQ  FP  +WKDDY QNKKVNARI
Sbjct  313   LLVPGMMVNARVQSTLENGIMLSFLTYFTGTVDIFHLQNSFPATNWKDDYNQNKKVNARI  372

Query  4750  LFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTP  4571
             LFIDP++RAVGL++NPHL+  KAPP+ VK GDI++ ++V+RVD+GLGLLLEIPS PV TP
Sbjct  373   LFIDPSSRAVGLTMNPHLLCNKAPPANVKAGDIYDSSRVVRVDRGLGLLLEIPSIPVSTP  432

Query  4570  AYVYISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVK  4391
             AYV ISDV D EV+K+EK F+ G  VRVRVLGFR+LEGLA G LK SAFEGSVFTHSDVK
Sbjct  433   AYVSISDVADGEVRKLEKKFREGSQVRVRVLGFRHLEGLAMGILKASAFEGSVFTHSDVK  492

Query  4390  PGMVVKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCK  4211
             PGMVVKAKVI V+SFGAIVQFSSGVKALCPL HMSEF+I KP KKF+VG+ELVFRVLGCK
Sbjct  493   PGMVVKAKVIAVESFGAIVQFSSGVKALCPLPHMSEFDIAKPGKKFKVGAELVFRVLGCK  552

Query  4210  SKRITVTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSE  4031
             SKRITVTHKKTLVKSKL IL SY DAT+GLITHGWITKIEKHGCFVRFYNGVQGFAPRSE
Sbjct  553   SKRITVTHKKTLVKSKLGILGSYADATDGLITHGWITKIEKHGCFVRFYNGVQGFAPRSE  612

Query  4030  LGLDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIV  3851
             LGL+ G + +++YHV QVVKCRV+S+ PASR+I LSF   P R S  + V+ G++VSG+V
Sbjct  613   LGLELGCEAAAIYHVGQVVKCRVISAIPASRRINLSFILSP-RPSMGDSVELGSLVSGVV  671

Query  3850  ELVTPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFN  3671
             E +TP +++V+V +G+ +LKGTV T+HL+DH+G A LMKS+LKPGYEFD+LLVLDI+G N
Sbjct  672   ERLTPTAVIVHV-SGKGYLKGTVLTEHLADHQGQATLMKSILKPGYEFDELLVLDIDGSN  730

Query  3670  LVLSAKYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATD  3491
             LVLSAKYSLI++A+QLP+D+ Q+ PH +VHGY+CN+I  G FVRFLGRLTGF P++KATD
Sbjct  731   LVLSAKYSLINSAKQLPVDLMQVHPHLIVHGYICNIIEAGCFVRFLGRLTGFCPKNKATD  790

Query  3490  DRRYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKL  3311
             D R +  E FY+GQSV +NIL+V+ E GRIT+SLKQS C S DA+F+QEYF LE KIAKL
Sbjct  791   DGRANLFETFYVGQSVRSNILNVDIELGRITLSLKQSSCFSMDASFMQEYFTLEEKIAKL  850

Query  3310  QSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVET  3131
             Q  +S +   NWV  F  G+IVEG++HE KEFGVV++F+++ DVFGFI+  QL G N+E 
Sbjct  851   QMPESENFDSNWVKSFNTGTIVEGEIHETKEFGVVLSFKEHTDVFGFIAHYQLCGTNLEI  910

Query  3130  GSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNA  2951
             GST++A V+D+S  EHLVDLSLKPEF+ G + + +  +T KKKRKR A  DLEV+Q+VNA
Sbjct  911   GSTVRAVVLDISVAEHLVDLSLKPEFICGIEEEGSKSRTSKKKRKRVASADLEVHQTVNA  970

Query  2950  VVEIVKENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGR  2771
              +EIVKENYLVLS+P  +YA+GYAS  D+NTQ LP + FVNGQSV+AT+ AL    T GR
Sbjct  971   NIEIVKENYLVLSIPEYSYAIGYASTIDYNTQKLPQRSFVNGQSVVATVAALASPLTSGR  1030

Query  2770  LLLLLKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITE  2591
             LLLLLK++SE +E+SSSKR KK SSY VGSLV+AEITDIKPLELRLKFG GF GRVHITE
Sbjct  1031  LLLLLKSLSEASETSSSKRAKKKSSYKVGSLVEAEITDIKPLELRLKFGIGFRGRVHITE  1090

Query  2590  ATDDNTTEGPLNDFRIGQTLTARIVSKDSRSE-NKRGYQWELSTKPSVLAGDM---DGP-  2426
               D +  E P + F++GQ LTARIV+K ++SE N++  QWELS +P++L+G     DG  
Sbjct  1091  VNDHHFVEDPFSKFKVGQQLTARIVAKFNQSEKNRKACQWELSLRPTLLSGASELEDGVI  1150

Query  2425  HESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKS  2246
              + FN+S G+L +GYV KVD EW WLT+SR V+A L++LDSS EPSEL +FQKRFYVGK+
Sbjct  1151  TDDFNFSIGKLATGYVVKVDKEWVWLTVSRHVKAHLFLLDSSCEPSELIDFQKRFYVGKA  1210

Query  2245  VSGYILSANKEKKLLRLVPHTLLITPEDT-------------VPSSESARCHIREGSVLG  2105
             VSG++L+ NKEKKLLRL+PH L I    T             + S+E    HI EG VLG
Sbjct  1211  VSGHVLNINKEKKLLRLIPHPLSIVSNATLGNKITKKDDPESIISNEFVTEHIHEGDVLG  1270

Query  2104  GRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVK  1925
             GRI++ILPGVGGLLVQI  HL GKVHFTEL D W+S+PL  Y EGQFVKC+VL++  S K
Sbjct  1271  GRINRILPGVGGLLVQIGPHLHGKVHFTELADEWLSNPLLEYQEGQFVKCQVLEIIRSTK  1330

Query  1924  GTTHVDLSLRWT-LDTMNN-QNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGC  1751
             G  HVDLSLR T L+ + + +++  ++D++S   RV+ I+D+HP+M V+GYVKNVT KGC
Sbjct  1331  GLLHVDLSLRATSLEGIQSPKSVGLNNDLNSLISRVKRIEDIHPNMAVKGYVKNVTSKGC  1390

Query  1750  FIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSAT  1571
             FIMLSRK+DAKILLSNL+DGFIE+PE+EFPVGKLV+GKV+SVE LSKRVEVTLRT ++++
Sbjct  1391  FIMLSRKIDAKILLSNLSDGFIENPEEEFPVGKLVSGKVLSVEPLSKRVEVTLRTENTSS  1450

Query  1570  PRKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRY  1391
               K D+  L++   G++ISG+IKR+E++GLFI +D TNLVGLCHVSELSDDHIDN+ S+Y
Sbjct  1451  ASKIDMCDLSSLHVGDVISGRIKRVETYGLFIIIDPTNLVGLCHVSELSDDHIDNIGSKY  1510

Query  1390  KAGQTvrvkvlkvdkdRHRISLGMKNSYFRDDDGEDIQTTSRQSINSTDKGNSVFIGTQS  1211
             +AG+ V  K+LKVDK+R RISLGMKNSY  DD   D+     ++I+     N +      
Sbjct  1511  RAGERVMTKILKVDKERQRISLGMKNSYLSDDTSVDLLN---RNIDENKHENGLVDDPLV  1567

Query  1210  TVFPESSDA---DIDVSVVNTTDNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDH  1040
             ++  E S     D D    +    +L + ESRASI PL+V LDD++ SD+D+AVN+  +H
Sbjct  1568  SISQERSACGIQDSDPDYGSRECEVLAQAESRASILPLDVNLDDVDGSDLDNAVNRAEEH  1627

Query  1039  TGGADTTDekdkkramkkakkerereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVW  860
                  T  EK+K+RA +KAK+ERE EIRAAEERLLEKDIPR +DEFEKLVRSSPNSSFVW
Sbjct  1628  DNETATISEKNKRRAKRKAKEERELEIRAAEERLLEKDIPRTSDEFEKLVRSSPNSSFVW  1687

Query  859   IKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKV  680
             IKYMAF LS+ DVEKARSIAE+A+STINIREE+EKLN+WVAYFNLE EYG PPQEAVMK 
Sbjct  1688  IKYMAFALSVSDVEKARSIAERALSTINIREENEKLNIWVAYFNLENEYGEPPQEAVMKT  1747

Query  679   FQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQ  500
             F RALQYCDPKKVHLALL +YERTE Y L DELL KMVKKFKHSCK+WLRR+Q  LKQ +
Sbjct  1748  FHRALQYCDPKKVHLALLNMYERTEQYNLADELLNKMVKKFKHSCKVWLRRVQSLLKQGK  1807

Query  499   DNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVY  320
             D  QS+V+RALLCLPK+KHIKF++ TAILEFK GV DRGRS+FE +L+EYPKRTDLWS+Y
Sbjct  1808  DGVQSVVSRALLCLPKNKHIKFVSHTAILEFKFGVPDRGRSVFEEILREYPKRTDLWSIY  1867

Query  319   LDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEY  140
             LDQE+R+GD D+IRALFERA+SL +PPKKMKF+FKKYL YEKS G EER+E VKR A+EY
Sbjct  1868  LDQEVRLGDADIIRALFERAVSLRLPPKKMKFIFKKYLEYEKSCGHEERVEYVKRIAIEY  1927

Query  139   VES  131
             VE+
Sbjct  1928  VEN  1930



>ref|XP_011039519.1| PREDICTED: protein RRP5 homolog [Populus euphratica]
Length=1938

 Score =  2378 bits (6163),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1238/1927 (64%), Positives = 1522/1927 (79%), Gaps = 52/1927 (3%)
 Frame = -2

Query  5806  KNFKRKGKNNE---AGNASFSGKSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEF  5636
             K FK K   N+      A     S  LQLED+VPDFPRGG S LS+ E +E+RA+VD E 
Sbjct  26    KQFKAKQTKNKKSFTNEAVVKDASIALQLEDDVPDFPRGGKSSLSQREREEIRAQVDEEL  85

Query  5635  EAEDRylkkkkqhklykKNQSVE---DDLGSLFGHSISGKLPKSANRITPKNISPGMKLW  5465
             E E+R L KK +     +N+S +   DDLGSLFG  ++GKLP+ AN+IT +NISPGMKLW
Sbjct  86    EGEERRLNKKNKKGKKFQNKSGQLSGDDLGSLFGDVLTGKLPRFANKITMRNISPGMKLW  145

Query  5464  GVIAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCI  5285
             GV+ EVNEKD+V+SLPGGLRGLV + +A DP+ +++  + E     L  +FHVGQLVSCI
Sbjct  146   GVVTEVNEKDLVISLPGGLRGLVRSVDAVDPVLNDQIEDGE---GSLPRVFHVGQLVSCI  202

Query  5284  VLHLDDDKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPS  5105
             VL LDDDK +  K KIWLSLRL+LLH   +LDA++EG++L+AY+KS EDHG+ILHFGL S
Sbjct  203   VLKLDDDKNDNKKRKIWLSLRLSLLHNGFSLDAVKEGMVLTAYVKSIEDHGFILHFGLSS  262

Query  5104  FSGFLPIHSQSVD---KMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISI  4934
             F GF P +SQ+     ++ TGQ ++G+V  +D+ RKVVYLSS PD ++K VT+DLKGISI
Sbjct  263   FMGFFPKNSQAESWDSEVKTGQFLQGIVTRIDKIRKVVYLSSDPDTVSKCVTRDLKGISI  322

Query  4933  DLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNAR  4754
             DLL+PGMMV+A V S LENG+MLSFLTYFTGTVD+FHLQ  FP  +WKDDY +NKKVNAR
Sbjct  323   DLLIPGMMVDARVQSTLENGIMLSFLTYFTGTVDMFHLQNTFPTSNWKDDYAKNKKVNAR  382

Query  4753  ILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPT  4574
             ILFIDP+TRAVGL+LN HLVH  +PPS VKVGDI++ AKV+RVDKG+GLLLEIPS+P+PT
Sbjct  383   ILFIDPSTRAVGLTLNQHLVHNNSPPSSVKVGDIYDIAKVVRVDKGMGLLLEIPSTPLPT  442

Query  4573  PAYVYISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDV  4394
             PA+V +SDV + EV+K+EK FK G  VRVR+LG+R+LEGLATG LK SAFEGSVFTHSDV
Sbjct  443   PAFVNVSDVAEDEVRKLEKKFKEGSNVRVRILGYRHLEGLATGILKASAFEGSVFTHSDV  502

Query  4393  KPGMVVKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGC  4214
             KPGM  +AK+I VDSFGAIVQF  GVKALCPL+HMSEFEI KPRKKF+VG+EL FRVLGC
Sbjct  503   KPGMATRAKIIAVDSFGAIVQFPGGVKALCPLQHMSEFEIAKPRKKFKVGAELFFRVLGC  562

Query  4213  KSKRITVTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRS  4034
             KSKRITVTHKKTLVKSKL ILSSY+DAT+GLITHGWITKIEKHGCFV FYNGVQGFAPRS
Sbjct  563   KSKRITVTHKKTLVKSKLPILSSYSDATDGLITHGWITKIEKHGCFVHFYNGVQGFAPRS  622

Query  4033  ELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGI  3854
             ELGL+PG D  S Y V QVVKCRV+SS  ASR+I LSF  +P+R SE E +K G+VV+G+
Sbjct  623   ELGLEPGIDAISTYQVGQVVKCRVISSIAASRRINLSFIMKPLRFSEEEGIKMGSVVTGV  682

Query  3853  VELVTPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGF  3674
             ++ VT  S++V V N + +LKGT++T+HLSDH   A LMKSVLKPGYEFDQLLVLDIE  
Sbjct  683   IDKVTASSVIVYV-NAKDYLKGTIATEHLSDHHEHAALMKSVLKPGYEFDQLLVLDIESN  741

Query  3673  NLVLSAKYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKAT  3494
             NLVLSAKYSLI +A QLP D++QI P S+VHGY+CN+I  G FVRFLG LT FSPRSKA 
Sbjct  742   NLVLSAKYSLIKSASQLPSDLSQIRPQSIVHGYICNMIETGCFVRFLGNLTAFSPRSKAM  801

Query  3493  DDRRYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAK  3314
             DD+R   SE FYIGQSV +NILDVN ET RITVSLKQS CSSTDA F+QEYFL E+KIA 
Sbjct  802   DDQRSQLSEAFYIGQSVRSNILDVNNETSRITVSLKQSCCSSTDACFLQEYFLSENKIAD  861

Query  3313  LQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVE  3134
             LQS DS    L WV+GF +GS +EGK+ E KEFGVVV+FE+++DVFGF+S  QLGG  V+
Sbjct  862   LQSSDSNGRDLKWVEGFHIGSTIEGKIQESKEFGVVVSFEEHNDVFGFVSHHQLGGAMVK  921

Query  3133  TGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVN  2954
              G+ ++AAV+DV+K E LVDLSLK EF++ S+ +++   T KKKRK E  KDLEV+Q+VN
Sbjct  922   AGANVRAAVLDVAKTERLVDLSLKLEFLDKSRDKSSKSLTHKKKRKGEMSKDLEVHQTVN  981

Query  2953  AVVEIVKENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGG  2774
             AVVEIVKENYLVLS+P  N+A+GYAS++D+NTQ +  KQF+NGQSV AT+MALP  ST G
Sbjct  982   AVVEIVKENYLVLSIPEHNHAIGYASVSDYNTQKISHKQFLNGQSVSATVMALPTPSTAG  1041

Query  2773  RLLLLLKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHIT  2594
             RLLLLLK+ISEV E+SSSK+ K+ SS +VGSLVQAEIT+IKPLE+RLKFG GF GR+HIT
Sbjct  1042  RLLLLLKSISEVTETSSSKKAKRKSSCNVGSLVQAEITEIKPLEMRLKFGIGFRGRIHIT  1101

Query  2593  EATDDNTTEGPLNDFRIGQTLTARIVSKDSRSENKRGYQWELSTKP-----SVLAGDMDG  2429
             E +D    E P ++FR+GQT++ARI++K  +S+NK+   W+LS KP     S +  D   
Sbjct  1102  EVSDTCLLENPFSNFRVGQTVSARIIAKAGQSDNKKSQLWDLSIKPKMLEDSCMIEDKLV  1161

Query  2428  PHESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGK  2249
             P E + +S+GQ +SGYV+KVD EWAWLTISR ++A+L++LDS+ EPSEL+EFQKRFYVGK
Sbjct  1162  PKE-YEFSSGQHISGYVYKVDGEWAWLTISRHLKAKLFVLDSACEPSELQEFQKRFYVGK  1220

Query  2248  SVSGYILSANKEKKLLRLVPHTLLITPE---------DTVPSS---ESARCHIREGSVLG  2105
             +V+G++L+ NKEK  LRL       +           D + S+   ++   HIREG ++G
Sbjct  1221  AVTGHVLNYNKEKASLRLALRPFAASQTLVDGGAPIMDDLQSNAPWDNVTAHIREGDIVG  1280

Query  2104  GRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVK  1925
             GRISKILPGVGGLLVQ+  H+ G+VHFTEL+D WV DPLS Y EGQFVK KVL++ H VK
Sbjct  1281  GRISKILPGVGGLLVQLGPHIHGRVHFTELQDSWVPDPLSAYKEGQFVKSKVLEISHPVK  1340

Query  1924  GTTHVDLSLRWTLDTMNNQNISE-HDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCF  1748
             GT H+DLSLR +LD M  QN +E  ++  + ++RV  I+DL PDM VQGYVKNV+ KGCF
Sbjct  1341  GTIHIDLSLRLSLDGMLGQNSAEFSNNQDAPSKRVDKIEDLQPDMVVQGYVKNVSSKGCF  1400

Query  1747  IMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATP  1568
             I LSRK+DAKILLSNL++G+I+ PEK+FP+GKL+TG+V+SVE LSKR+EVTL++S+S   
Sbjct  1401  ISLSRKLDAKILLSNLSEGYIDDPEKQFPIGKLLTGRVLSVEHLSKRIEVTLKSSASNMS  1460

Query  1567  RKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYK  1388
             +  + D L+    G IISG+IKR+ES+GLFI++D+TNLVGLCHVS+L  DHI N++S+YK
Sbjct  1461  KSENSD-LSRLHVGEIISGRIKRVESYGLFIALDHTNLVGLCHVSQLL-DHIGNIESKYK  1518

Query  1387  AGQTvrvkvlkvdkdRHRISLGMKNSYFRDD-----DGEDIQTTSRQSINSTDKGNSVFI  1223
             AG+ V  K+LKVD++R RISLGMKN   RDD     +  D + +  +S++ ++       
Sbjct  1519  AGEKVTAKILKVDEERRRISLGMKNLDVRDDMNSSKEESDEEMSENESVDGSN-------  1571

Query  1222  GTQSTVFPESS---DADIDVSVVNTTDNILTEVESRASIPPLEVPLDDIENSDIDDAVNK  1052
               Q  + PESS     +IDV   N   +IL + ESRASIPPLEV LDD+E+S  DD   +
Sbjct  1572  -AQIKIIPESSLLGIHNIDVECQN-EHSILAQAESRASIPPLEVALDDMEHSLPDDVPFQ  1629

Query  1051  NPDHTGGADTTDekdkkramkkakkerereiraaeerlleKDIPRNTDEFEKLVRSSPNS  872
             N  H   ADT   K  K   KK KK  E+EI AAEER LE+D PR  DEFE ++RSSPN+
Sbjct  1630  NQGHIDEADTM-VKKNKLEKKKPKKLSEQEISAAEERRLEEDEPRTADEFEMVIRSSPNN  1688

Query  871   SFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEA  692
             SF+WI YM FMLSL D+EKARSIAE+A++TINIREE EKLN+WVAYFNLE EYGNPP++A
Sbjct  1689  SFLWIAYMRFMLSLADIEKARSIAERALNTINIREEDEKLNIWVAYFNLENEYGNPPEDA  1748

Query  691   VMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWAL  512
             V KVFQRALQYCDPKKVHLALL +Y++T   +L +ELL+KM+KKFKHSCK WL+R++W L
Sbjct  1749  VKKVFQRALQYCDPKKVHLALLKMYKKTNQNELAEELLDKMIKKFKHSCKFWLKRVKWLL  1808

Query  511   KQNQDNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDL  332
             KQ QD  QS+V RALLCLP+HKHIKFI+QTAI EFKCGVADRGR++FE +L+EYPKRTDL
Sbjct  1809  KQKQDGVQSVVQRALLCLPRHKHIKFISQTAIREFKCGVADRGRTLFEEILREYPKRTDL  1868

Query  331   WSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRK  152
             WSVYLDQEI++GD DVIRALFERAISLS+PPKKMKFLFKKYL YEKS GDE++IESVK+K
Sbjct  1869  WSVYLDQEIKLGDADVIRALFERAISLSLPPKKMKFLFKKYLEYEKSYGDEKQIESVKQK  1928

Query  151   AMEYVES  131
             AMEYV++
Sbjct  1929  AMEYVQN  1935



>ref|XP_007203056.1| hypothetical protein PRUPE_ppa000079mg [Prunus persica]
 gb|EMJ04255.1| hypothetical protein PRUPE_ppa000079mg [Prunus persica]
Length=1904

 Score =  2357 bits (6109),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1236/1912 (65%), Positives = 1521/1912 (80%), Gaps = 57/1912 (3%)
 Frame = -2

Query  5806  KNFKRKGKNNEAGNASFSGKSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAE  5627
             K+ K+  K N+  N +   ++  LQLED+VPDFPRGG S L+++E DE+RAEVDAEFEAE
Sbjct  22    KSSKKPFKPNKDRNDTARSEAVTLQLEDDVPDFPRGGGSALNRQERDEIRAEVDAEFEAE  81

Query  5626  DRylkkkkqhklykKNQSVEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEV  5447
             +R +KK+K+  + KK+ S EDD GSLFG  I+GKLPK AN+IT KNIS GMK+WGV+AEV
Sbjct  82    EREMKKRKKIGMQKKSLSSEDDFGSLFGDGITGKLPKYANKITMKNISAGMKVWGVVAEV  141

Query  5446  NEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDD  5267
             NEKD+V+SLPGGLRGLV ASEA DP+ DNET  +    N L+ +FHVGQLVSCIVL LD+
Sbjct  142   NEKDLVISLPGGLRGLVRASEALDPILDNETKAV--ADNLLASIFHVGQLVSCIVLQLDE  199

Query  5266  DKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLP  5087
             DKKE GK KIWLSLRL+LLHK  TLD++QEG++L+AY+KS EDHGYILHFGL SF+GFLP
Sbjct  200   DKKEKGKRKIWLSLRLSLLHKGFTLDSVQEGMVLTAYVKSIEDHGYILHFGLSSFTGFLP  259

Query  5086  IHSQSVDK---MNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPG  4916
              +S +  K   +NTGQL++G V+S+D+ RKVVYLSS  + ++K VTKDLKGISIDLLVPG
Sbjct  260   KNSPADSKEIQVNTGQLLQGAVRSIDKVRKVVYLSSDLETVSKCVTKDLKGISIDLLVPG  319

Query  4915  MMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDP  4736
             M+VNA V+S LENGVMLSFLTYFTGTVDIFHLQ  +P  +WK+DY Q+KKVNARILFIDP
Sbjct  320   MLVNARVLSTLENGVMLSFLTYFTGTVDIFHLQNSYPTLNWKEDYNQHKKVNARILFIDP  379

Query  4735  ATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYI  4556
             +TRAVGL+LNPHLV  KAPPS VK+GDI + +KV+RVD+GLGLLLEIPS+PV TPAYV I
Sbjct  380   STRAVGLTLNPHLVRNKAPPSPVKIGDICDGSKVVRVDRGLGLLLEIPSTPVSTPAYVSI  439

Query  4555  SdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVV  4376
              DV ++EV+K+EK FK G  VRVRVLGFR+LEGLATG LK SAFEG+VFTHSDVKPGMVV
Sbjct  440   CDVAEEEVRKLEKKFKQGSHVRVRVLGFRHLEGLATGILKASAFEGTVFTHSDVKPGMVV  499

Query  4375  KAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRIT  4196
             K K+I VDSFGAIVQF  GVKALCPL HMSEFEI KPRKKF++G+EL+FRVLGCKSKRIT
Sbjct  500   KGKIIAVDSFGAIVQFPGGVKALCPLNHMSEFEIAKPRKKFKIGAELLFRVLGCKSKRIT  559

Query  4195  VTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDP  4016
             VTHKKTLVKS L I+SSY DA +GLITHGWI KIE+HGCF+ FYNGVQGFAPRSELGL+P
Sbjct  560   VTHKKTLVKSNLGIVSSYADAADGLITHGWIRKIEEHGCFIHFYNGVQGFAPRSELGLEP  619

Query  4015  GSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTP  3836
             GSD SSMYHV QVVKCRV++S+P SR+I LSF  RP R+SE +M K G +VSG+V+ VTP
Sbjct  620   GSDPSSMYHVGQVVKCRVINSNPTSRRIKLSFIIRPPRVSEDDMAKLGCLVSGVVDRVTP  679

Query  3835  DSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSA  3656
             +++ V   NG+ +  GT+ T+HL+DH GLA LMKSVLKPGYEFD+LLVLDIEG NL+LSA
Sbjct  680   NAVYV---NGKGYSMGTIFTEHLADHHGLAALMKSVLKPGYEFDRLLVLDIEGNNLILSA  736

Query  3655  KYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYD  3476
             KYSLI++AQQLP +++QI P+SVVHGY+CN+I  G FVRFLGRLTGFSPR KA DD + D
Sbjct  737   KYSLINSAQQLPSELSQIHPNSVVHGYICNLIETGCFVRFLGRLTGFSPRHKAMDDHKAD  796

Query  3475  TSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDS  3296
              SE +YIGQSV +NILDV+ ET RIT+SLKQS C+STDA+FIQEYF+LE KIAKLQ LDS
Sbjct  797   LSEAYYIGQSVRSNILDVSSETSRITLSLKQSSCTSTDASFIQEYFILEEKIAKLQLLDS  856

Query  3295  ADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQ  3116
              +   NW +GF +GS+VEGKV E+K+ GVVV FEKY+DVFGFI+  Q  G NVETGS IQ
Sbjct  857   KEPKSNWSEGFTIGSVVEGKVQEVKDSGVVVGFEKYNDVFGFITHYQC-GTNVETGSIIQ  915

Query  3115  AAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIV  2936
             A V+D++  EHLVDLSLK EF N  K +++N +T KKKRKREA   LE +Q+        
Sbjct  916   AVVLDIANAEHLVDLSLKQEFNNKLK-ESSNSQTHKKKRKREASDGLEEHQT--------  966

Query  2935  KENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLL  2756
                  VLS+P  NYA+GYAS++D+NTQ  P +Q++NGQSV AT+MALP  +T GRLL+LL
Sbjct  967   -----VLSIPKYNYAIGYASISDYNTQKFPQRQYLNGQSVNATVMALPSPTTAGRLLMLL  1021

Query  2755  KAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDN  2576
              ++SE AE+SSSKR KK SSY VGS+VQAEIT+IKPLELRLKFG GFHGRVHITE  D+ 
Sbjct  1022  NSLSESAETSSSKRAKKKSSYKVGSVVQAEITEIKPLELRLKFGIGFHGRVHITEVNDE-  1080

Query  2575  TTEGPLNDFRIGQTLTARIVSKDSRSE-NKRGYQWELSTKPSVLAGDMDGPH----ESFN  2411
               E P N+FRIGQT+TARIV+K + S  NK+ YQW+LS KP++L G  +       E  +
Sbjct  1081  LLEEPFNNFRIGQTVTARIVAKTNYSNSNKKSYQWDLSLKPTMLIGSCEIGEKIMTEDLD  1140

Query  2410  YSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYI  2231
             +STGQ ++GYV+KVD EW WLTISR VRAQL+ILDS+ EPSEL+EFQKRF++G +VSGY+
Sbjct  1141  FSTGQCVTGYVYKVDGEWVWLTISRNVRAQLFILDSACEPSELQEFQKRFHLGNAVSGYV  1200

Query  2230  LSANKEKKLLRLVPHTL--------------LITPEDTVPSSESARCHIREGSVLGGRIS  2093
             LS NKEKKLLRLV H L              +  P + +  +E+   HIREGSV+GGRI 
Sbjct  1201  LSVNKEKKLLRLVLHPLFPISGKIVDHEVSKMEDPHNNI-LNENVTAHIREGSVVGGRII  1259

Query  2092  KILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTH  1913
             K LPGVGGL VQI  H++G+VH++EL D WV++PLSGY EGQFVKCKVL++  SV+GT H
Sbjct  1260  KELPGVGGLTVQIGPHMYGRVHYSELSDSWVTNPLSGYHEGQFVKCKVLELIRSVRGTYH  1319

Query  1912  VDLSLRWTLDTMNNQNI-SEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLS  1736
             +DLSLR +L  M   +    HDD H+  +RV+ I+DL+P+M VQGYVKN+TPKGCFI LS
Sbjct  1320  IDLSLRSSLVGMLGPDCKGSHDDTHAHTKRVEKIEDLNPNMMVQGYVKNITPKGCFIFLS  1379

Query  1735  RKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSD  1556
             RK+DAKIL+SNL+DG+++  EKEFPVGKLV G+V SVE LSKRVEVTL++  + +  +S 
Sbjct  1380  RKIDAKILVSNLSDGYVQDLEKEFPVGKLVIGRVSSVEPLSKRVEVTLKSLGATSATQSG  1439

Query  1555  IDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQT  1376
              + L++   G+IISG++KR+E +GLFI++DNTN+VGLCHVSELS+D ++N++++Y+ G+ 
Sbjct  1440  SNNLDSLHVGDIISGRVKRVERYGLFITIDNTNVVGLCHVSELSEDKVENIETKYRTGER  1499

Query  1375  vrvkvlkvdkdRHRISLGMKNSYFRDDDGEDIQTTSRQSINSTDKGNSVFIGTQSTVFPE  1196
             V  KVLKVDKDRHRISLGMK+ Y  +++  D+QT+S Q  +     N +  G+ S +FP 
Sbjct  1500  VTAKVLKVDKDRHRISLGMKDVYIMENN--DLQTSSEQDPDEDIIENGITDGSLSAMFPG  1557

Query  1195  SSD---ADIDVSVVNTTDNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGAD  1025
             SS     ++DV   N     L + ESRAS+PPLEV LDDIE  + D+ V+++ +H    D
Sbjct  1558  SSSFCTQNMDVEYENAEPQFLAQAESRASVPPLEVTLDDIEQFNGDNIVSQDQEHP-DVD  1616

Query  1024  TTDekdkkramkkakkerereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMA  845
             T +EK K+   KKAK+EREREIRAAEERLLEKDIPR  +E+EKLVRSSPNSS+VWIKYM 
Sbjct  1617  TVNEKKKQLTKKKAKEEREREIRAAEERLLEKDIPRTDEEYEKLVRSSPNSSYVWIKYME  1676

Query  844   FMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRAL  665
             F+LS  +VEKARSIAE+A+ TIN REE+EKLN+WVAYFNLE +YG+PP+EAVMKVFQRA+
Sbjct  1677  FVLSTANVEKARSIAERALRTINFREENEKLNIWVAYFNLENKYGSPPEEAVMKVFQRAV  1736

Query  664   QYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQS  485
             QY DPKKVHLALLGVYERTE ++L DEL +KM+KKFK SCK+WLRR+Q  L Q +D  Q 
Sbjct  1737  QYNDPKKVHLALLGVYERTEQHRLADELFDKMIKKFKKSCKVWLRRVQMLLTQQRDGIQD  1796

Query  484   IVNRALLCLPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEI  305
             +V++A   LPKHKHIKFI+QTAILEFKCG  +RGRSMFE +L+  PKRTDLWSVYLDQEI
Sbjct  1797  VVSQAEKVLPKHKHIKFISQTAILEFKCGNPERGRSMFENILRNNPKRTDLWSVYLDQEI  1856

Query  304   RVGDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKA  149
             R+GD D+I ALFERA SLS+P KKMK      ++Y  S+     +  +KR++
Sbjct  1857  RLGDGDLIHALFERATSLSLPAKKMK------VSYSISICSMRSLMVMKRRS  1902



>gb|EYU20674.1| hypothetical protein MIMGU_mgv1a000093mg [Erythranthe guttata]
Length=1829

 Score =  2356 bits (6106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1218/1833 (66%), Positives = 1492/1833 (81%), Gaps = 29/1833 (2%)
 Frame = -2

Query  5575  SVEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLV  5396
             S EDDLGSLFG  I GKLP+ AN+IT KN+SPGMKLWGVIAEVNEKDIVVSLPGGLRGLV
Sbjct  5     SPEDDLGSLFGDGIKGKLPRFANKITLKNVSPGMKLWGVIAEVNEKDIVVSLPGGLRGLV  64

Query  5395  LASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLA  5216
              A +A DP++ +E  + ++++++LS ++H GQLVSCIVL +DDD+KE  K KIWLSLRL+
Sbjct  65    RACDAFDPVFGDEV-KGDLENSFLSRIYHEGQLVSCIVLQVDDDRKEITKRKIWLSLRLS  123

Query  5215  LLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQS-VDKMNTGQLVE  5039
              LH++LTLDAIQEG++LSAY+KS EDHG+ILHFGL +F GF+P H+QS + K+  GQ ++
Sbjct  124   SLHRSLTLDAIQEGMVLSAYVKSIEDHGFILHFGLSAFEGFMPKHNQSEMRKIEVGQFLQ  183

Query  5038  GVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSF  4859
             G VKSV+R RKVV+LSS PD +++ VTK++KGISIDLLVPGMMVNA V S LENGVM SF
Sbjct  184   GTVKSVERARKVVHLSSDPDMVSRSVTKEVKGISIDLLVPGMMVNARVQSTLENGVMFSF  243

Query  4858  LTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAP  4679
             LTYFTGTVD+F+L ++F   +WK+DY +N K NARILFIDP++RAVGL+LNPHLV+ KAP
Sbjct  244   LTYFTGTVDLFNLDKMFSSSTWKNDYSKNMKFNARILFIDPSSRAVGLTLNPHLVNNKAP  303

Query  4678  PSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGK  4499
             PSLVKVGDIF+Q+KV+RVDKG GLLL+IP+ PVPTPAYV +SD+ DKEV K++K+FK G 
Sbjct  304   PSLVKVGDIFDQSKVVRVDKGSGLLLQIPTLPVPTPAYVNVSDIADKEVGKLDKSFKEGS  363

Query  4498  VVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSG  4319
             +VR RVLG+R+LEGLATG LKTSAFEG VFTHSDVKPGMVVKAKVI VDSFG+IVQF+SG
Sbjct  364   LVRARVLGYRHLEGLATGILKTSAFEGLVFTHSDVKPGMVVKAKVIAVDSFGSIVQFASG  423

Query  4318  VKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSYT  4139
             VKALCPLRHMSEFEI KPRKKF+ G ELVFRVLGCKSKRITVTHKKTLVKSKL+ILSS+ 
Sbjct  424   VKALCPLRHMSEFEIAKPRKKFKAGVELVFRVLGCKSKRITVTHKKTLVKSKLEILSSFA  483

Query  4138  DATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVV  3959
             DAT+GL+THGWITKIEKHGCFVRFYNGVQGFAPRSELGL   SDI SMYHVEQVVKCRVV
Sbjct  484   DATDGLVTHGWITKIEKHGCFVRFYNGVQGFAPRSELGLGQASDIHSMYHVEQVVKCRVV  543

Query  3958  SSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTVS  3779
                P+S +I LSF   P R SE E VKPG++VSG+V   TP++++V++N   S +KGT+S
Sbjct  544   KCIPSSHRISLSFNITPTRASEDENVKPGSLVSGLVVRTTPETVIVDIN-ASSGMKGTIS  602

Query  3778  TQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQIS  3599
              +HL+D++GLA  + S++KPG+ FD+LLVLDIEG N+VL+AKYSL+++ QQLP+DV+Q+S
Sbjct  603   LEHLADNQGLAASLISLIKPGHHFDELLVLDIEGNNIVLTAKYSLVNSTQQLPIDVSQLS  662

Query  3598  PHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVN  3419
              HSVVHGY+CN+I  G FVRF+GRLTGF+P+SKA DDRR D SEVFY+GQSV +NI+DV+
Sbjct  663   CHSVVHGYICNIIETGCFVRFIGRLTGFAPKSKAIDDRRSDLSEVFYVGQSVRSNIVDVS  722

Query  3418  GETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEG  3239
              + GRIT+SLKQSLC STDA FIQEYFLLE KIAKLQ LD   S L WVD F + +I+EG
Sbjct  723   SDVGRITLSLKQSLCCSTDAAFIQEYFLLEEKIAKLQGLDREGSELRWVDAFSICNIIEG  782

Query  3238  KVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKP  3059
             KVHEIK+ GVV++FE+Y+DVFGFIS  QL G +++  S IQAAV+DVSKI+ +VDLSLKP
Sbjct  783   KVHEIKDHGVVISFEEYNDVFGFISHHQLAGTSMKKNSAIQAAVLDVSKIDRVVDLSLKP  842

Query  3058  EFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGYA  2879
             EF+N SK +++  K  KKKRKRE  KDLEVNQ VNA+VEIVKENYLVLSVP  N+ +GYA
Sbjct  843   EFINRSKKESSTIKALKKKRKRE-HKDLEVNQIVNAIVEIVKENYLVLSVPDYNFTIGYA  901

Query  2878  SLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkkns  2699
             SL D+NTQ LP KQF +GQSV AT+MALP  +T G+LLLLLK + +  ++SSSKR +K S
Sbjct  902   SLTDYNTQKLPHKQFTHGQSVSATVMALPAPATCGKLLLLLKHLGDGVDTSSSKRARKKS  961

Query  2698  SYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARI  2519
             SYDVGSL+QAEIT+IKPLEL++KFGSGF+GR+HITE TDDN+ E P +D+RIGQTL +RI
Sbjct  962   SYDVGSLIQAEITEIKPLELKVKFGSGFYGRIHITEVTDDNSAESPFSDYRIGQTLASRI  1021

Query  2518  VSKDSRSEN-KRGYQWELSTKPSVLAG----DMDGPHESFNYSTGQLLSGYVFKVDSEWA  2354
             VSK S+++N K G+  ELS KPS+L G    D   P E FNY+ GQ +SGYV+KVDS+WA
Sbjct  1022  VSKGSKTKNMKGGHGCELSIKPSLLKGSGEPDEGLPSEEFNYTYGQRVSGYVYKVDSDWA  1081

Query  2353  WLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTLLI  2174
             WLTISR+V AQLYILDSS EP EL EFQ R  VGK++SG+I++ NKEKKLLRLV H    
Sbjct  1082  WLTISRDVNAQLYILDSSCEPCELAEFQNRLRVGKALSGHIITVNKEKKLLRLVMHA---  1138

Query  2173  TPEDTV------PSSESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTELR  2012
              P D         S     CH+ EGS +GGRISKILPG+GGLLVQID H +GKVHFTEL 
Sbjct  1139  -PADACGELNEKNSDRRLTCHLVEGSTVGGRISKILPGIGGLLVQIDQHQYGKVHFTELT  1197

Query  2011  DPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISE-HDDVHSQ  1835
             D WVS+PLSGY EGQFVKCKVL++   V G  HVDLSLR   D   +   +E +  +H+ 
Sbjct  1198  DSWVSNPLSGYQEGQFVKCKVLEITRGVMGVVHVDLSLRSASDASRDLGSTELNGGMHTS  1257

Query  1834  NRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVG  1655
              + V  I DLHPDM VQGYVKNV+ KGCFIMLSRK+DA+IL+S L+D F+E+PE EFP+G
Sbjct  1258  IQHVDKITDLHPDMVVQGYVKNVSSKGCFIMLSRKIDARILISKLSDNFVENPENEFPIG  1317

Query  1654  KLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGKIKRIESFGLFI  1475
             KLV GKV+SVE LSKRVEVTLRTSS+    KS  + +++ S G+IISG+IKRI+ +GLFI
Sbjct  1318  KLVVGKVLSVEPLSKRVEVTLRTSSALKEPKSGNNPVDHISVGDIISGRIKRIQPYGLFI  1377

Query  1474  SVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSYFRDD  1295
             S+D+TN VGLCHVSELSDDHI+++++++KAG+ V  KVL VDK+R+RISLG+KNSYF+D 
Sbjct  1378  SIDHTNAVGLCHVSELSDDHIEDLETQFKAGEKVTAKVLTVDKERNRISLGLKNSYFKD-  1436

Query  1294  DGEDIQTTSRQSINSTDKGNSVFIGTQSTVFPESSDADIDVSVVNTTDN----ILTEVES  1127
               E++QT+  QS +S    N   +  + TV  + + A + ++  N +DN    IL + ES
Sbjct  1437  --EEVQTSPGQSHDSAIGINDTIMLDEPTVTSQRNSASMQMTN-NESDNGHQPILADAES  1493

Query  1126  RASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTT-Dekdkkramkkakkerereiraa  950
             RA +PPLEVPLDD+E SDI+  V +       ADTT  EK K+ A +KA++ERE+EIRAA
Sbjct  1494  RALVPPLEVPLDDMETSDIEGDVGQTLVPVTNADTTAGEKKKRGAKRKAREEREQEIRAA  1553

Query  949   eerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIR  770
             EER LEKD+PR TDEFEKL++SSPN+S+ WIKYMAFMLSL D+EKARSIAE A+  I+ +
Sbjct  1554  EERQLEKDVPRTTDEFEKLIKSSPNNSYPWIKYMAFMLSLADIEKARSIAELALKRISSQ  1613

Query  769   EESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLG  590
             EESEKLN+WVAY NLE EYGNPP+EAV K+F RALQ+CD KKVHLALL +YERTE +KL 
Sbjct  1614  EESEKLNIWVAYLNLENEYGNPPEEAVKKIFVRALQHCDSKKVHLALLEMYERTEQHKLA  1673

Query  589   DELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLCLPKHKHIKFITQTAILE  410
             DELL KMV+   +SCK+WLRRIQ  + +  D  Q +V  A+  LPKHKHIKF+++TAILE
Sbjct  1674  DELLGKMVRNLGNSCKVWLRRIQSLVNRKSDGVQPVVTDAVKRLPKHKHIKFLSKTAILE  1733

Query  409   FKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKM  230
             FKCGV DRGR++FE +L+++PKRTDLWS+YLDQEI++G+ D+IRALFERAISLS+P KKM
Sbjct  1734  FKCGVPDRGRTLFESILRQHPKRTDLWSIYLDQEIKLGEADMIRALFERAISLSLPLKKM  1793

Query  229   KFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             KFLF KYLAYEKS GDE+RIESVK KA+EY E+
Sbjct  1794  KFLFNKYLAYEKSTGDEKRIESVKAKAIEYAEN  1826



>gb|KHF99545.1| Protein RRP5 [Gossypium arboreum]
Length=1870

 Score =  2349 bits (6087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1234/1926 (64%), Positives = 1499/1926 (78%), Gaps = 114/1926 (6%)
 Frame = -2

Query  5791  KGKNNEAGNASFSGK--------SAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEF  5636
             K K N+A    F  K        +  LQLED+VPDFPRGG S LSK E DE+RAEVDAEF
Sbjct  17    KRKFNKASKKQFKTKKDGAVKSEAVALQLEDDVPDFPRGGGSSLSKHERDEIRAEVDAEF  76

Query  5635  EAEDRylkkkkqhklykKNQSVEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVI  5456
             EAE+   KK K+ K  KK Q++ DDLGSLFG  I+GKLP+ AN+IT KNISPGMKLWGV+
Sbjct  77    EAEELASKKNKRKKSQKKIQAMPDDLGSLFGDGITGKLPRYANKITLKNISPGMKLWGVV  136

Query  5455  AEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLH  5276
             AEVNEKD+V+SLPGG                            L GL   G  +  +V  
Sbjct  137   AEVNEKDLVISLPGG----------------------------LRGLVRAGDALDPVV--  166

Query  5275  LDDDKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSG  5096
                +K E                            +L+ Y+ S EDHGY+LHFGL SF+G
Sbjct  167   --SNKVE----------------------------VLTGYVISIEDHGYMLHFGLSSFTG  196

Query  5095  FLPI--HSQSVD-KMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLL  4925
             FL    H++S D ++ TGQ ++GV+KS+D+TRKVV LSS PD ++K VTKDLKGISIDLL
Sbjct  197   FLRKDGHAESKDVEVRTGQFLQGVIKSIDKTRKVVNLSSDPDTVSKCVTKDLKGISIDLL  256

Query  4924  VPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILF  4745
             +PGM++NASV S LENG+MLSFLTYFTGTVD  HLQ  FP  +WKDDY QNKKVNARILF
Sbjct  257   IPGMLINASVRSTLENGIMLSFLTYFTGTVDTCHLQNKFPNKNWKDDYNQNKKVNARILF  316

Query  4744  IDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAY  4565
             IDP+TRAVGL+LNPHLVH KAPP  V +GDIF+Q+KV+RVD+G GLLLEIPS PV TPAY
Sbjct  317   IDPSTRAVGLTLNPHLVHNKAPPLHVNIGDIFDQSKVVRVDRGFGLLLEIPSKPVSTPAY  376

Query  4564  VYISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPG  4385
             V +SDV ++EV+K+EK FK G  VRVR+LGFR+LEGLATG LK SAFEG VFTHSDVKPG
Sbjct  377   VNVSDVAEEEVRKLEKKFKEGTQVRVRILGFRHLEGLATGILKASAFEGPVFTHSDVKPG  436

Query  4384  MVVKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSK  4205
             MVVKAKV ++DSFGAIVQF  GVKALCP RH+SEFEI KP KKF+VG+ELVFRVLGCKSK
Sbjct  437   MVVKAKVTSLDSFGAIVQFPGGVKALCPTRHLSEFEIAKPGKKFKVGAELVFRVLGCKSK  496

Query  4204  RITVTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELG  4025
             RITVT+KKTLVKSKL I+SSY +ATEGL+THGWITKIEKHG FVRFYNGVQGFAPRSELG
Sbjct  497   RITVTYKKTLVKSKLGIISSYAEATEGLVTHGWITKIEKHGFFVRFYNGVQGFAPRSELG  556

Query  4024  LDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVEL  3845
             L PG D +SMYHV QVVKCRV  SSPASR I LS   RP+R+SE +MVK G++VSG+VE 
Sbjct  557   LGPGDDPNSMYHVGQVVKCRVTGSSPASRHINLSLQMRPVRISEDDMVKLGSIVSGVVEG  616

Query  3844  VTPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLV  3665
             +TP ++V+NVN+ ++HLKG +S +HL+DH   A L+KS+LKPGY+FDQLLVLDIEG N+V
Sbjct  617   LTPSAVVINVNS-KAHLKGMISNEHLADHHERAALLKSILKPGYKFDQLLVLDIEGNNIV  675

Query  3664  LSAKYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDR  3485
             LSAK+SLIS+A+QLP D +QI P++VVHGYVCN+I  G FVRFLGRLTGFSPRSKA DD 
Sbjct  676   LSAKFSLISSAEQLPSDNSQIRPNTVVHGYVCNLIETGCFVRFLGRLTGFSPRSKAMDDH  735

Query  3484  RYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQS  3305
             + D S  FYIGQSV  NI+DVN ET RIT+SLKQS CSSTDATFIQEYF+LE KIA+LQS
Sbjct  736   KADLSGAFYIGQSVRCNIVDVNSETARITLSLKQSCCSSTDATFIQEYFILEEKIARLQS  795

Query  3304  LDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGS  3125
             L S  S L W++GF +GS++E K+ E K+ GVVV+F+KY+DV GFI+  QLGG+++ETGS
Sbjct  796   LGSDGSELKWIEGFNIGSVIEAKIGEAKDIGVVVSFDKYNDVLGFITHSQLGGLSLETGS  855

Query  3124  TIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVV  2945
              +QAAV+DV K E LVDLSLKPEFV  S+  ++  +  KKKRKREA K LE++Q+VNAVV
Sbjct  856   VVQAAVLDVDKAERLVDLSLKPEFVEKSQEGSSKSQPHKKKRKREASKALELHQTVNAVV  915

Query  2944  EIVKENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLL  2765
             EIVKE+YLV+++P  N+A+GYAS+ D+NTQ LP KQF+NGQ VIAT+MALP   T GRLL
Sbjct  916   EIVKEHYLVIAIPEYNHAIGYASIADYNTQKLPQKQFLNGQRVIATVMALPSPETSGRLL  975

Query  2764  LLLKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEAT  2585
             LLL +I EV E+S SKR KK SSY+VGSLV AE+T+I PLELRLKFG GF GRVHITE  
Sbjct  976   LLLNSIGEVTETSCSKRAKKKSSYNVGSLVPAEVTEIMPLELRLKFGIGFCGRVHITEVN  1035

Query  2584  DDNTTEGPLNDFRIGQTLTARIVSKDSRSENKRGYQWELSTKPSVL--AGDM--DGPHES  2417
             D+N  E P  +F++GQT+TARIV K     N++G+ W+LS KP++L  AG++      E 
Sbjct  1036  DNNVLEKPFGNFKVGQTITARIVGK----PNQKGHLWDLSIKPAMLADAGEIGVKTALEE  1091

Query  2416  FNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSG  2237
             F++STGQL++GYV+KVDSEWAWLTISR V+A+L+ILD+  EP+EL++FQ+RF VGK VSG
Sbjct  1092  FDFSTGQLVTGYVYKVDSEWAWLTISRHVKARLFILDTGCEPNELQQFQERFKVGKPVSG  1151

Query  2236  YILSANKEKKLLRLVPHTLLITPEDTVP-------------SSESARCHIREGSVLGGRI  2096
             +IL+ NK+KKLL++V H L       V              S ES   HI EG +LGGRI
Sbjct  1152  HILNVNKDKKLLQIVRHPLGALSTRNVGDEDKRKGESGNNISDESVTAHIHEGDILGGRI  1211

Query  2095  SKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTT  1916
             SKILPG+GGL+VQI  + +G+VHFTEL+D W SDPLSGY EGQFVKCKVL+V HS KGT 
Sbjct  1212  SKILPGIGGLVVQIGPNNYGRVHFTELKDAWESDPLSGYHEGQFVKCKVLEVSHSTKGTI  1271

Query  1915  HVDLSLRWTLDTMNNQNISE-HDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIML  1739
             H+DLSLR +LD +  +N  E   DV S ++R + ++DL+P+M VQGYVKNV PKGCFIML
Sbjct  1272  HIDLSLRLSLDGLIPKNPLELASDVDSTSKRAEKVEDLYPNMAVQGYVKNVIPKGCFIML  1331

Query  1738  SRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKS  1559
             SRKVDAKIL+SNL++G++  P+KEFP+GKLV+G+V++VE LSKRVEVTL+ S +    KS
Sbjct  1332  SRKVDAKILMSNLSNGYVNDPKKEFPIGKLVSGRVLAVEPLSKRVEVTLKNSDTKGTSKS  1391

Query  1558  DIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQ  1379
             +I+  +    G+I+SG+I+R+ES+GLFI++D+TN+VGLCH SELSDDHI+N+Q+ Y AG+
Sbjct  1392  EINDFSRLHVGDIVSGRIRRVESYGLFITLDHTNMVGLCHFSELSDDHIENIQTNYAAGE  1451

Query  1378  TvrvkvlkvdkdRHRISLGMKNSYFRDD----------DGEDIQTTSRQSINSTDKGNSV  1229
              V+ K+LK+D++RHRISLGMKNSYF DD            EDI+ T     ++ D+  S+
Sbjct  1452  KVKAKILKLDEERHRISLGMKNSYFTDDIDFQITEQEESDEDIEETGVADDDADDEARSI  1511

Query  1228  FIGTQSTVFPESSDADIDVSVVNTTDNILTEVESRASIPPLEVPLDDIENSDIDDAVNKN  1049
              + T ST         +D+   +   ++L + ESRASIPPL+V LDDIE+SD+++ +++N
Sbjct  1512  LL-TDST--------GMDIEYGSGVSDVLAQAESRASIPPLDVTLDDIEHSDMENFISQN  1562

Query  1048  PDHTGGADTTDekdkkramkkakkerereiraaeerlleKDIPRNTDEFEKLVRSSPNSS  869
              ++       DEK K+RA KKAK+EREREIRAAEER LEKDIPR TDEFEKLVRSSPNSS
Sbjct  1563  QENN-EVTAVDEKSKRRAKKKAKEEREREIRAAEERQLEKDIPRTTDEFEKLVRSSPNSS  1621

Query  868   FVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAV  689
             FVWIKYMAFML+  D+EKAR+IAE+A+ TINIREE+EKLN+WVAYFNLE +YGNPP+EAV
Sbjct  1622  FVWIKYMAFMLNSADIEKARAIAERALRTINIREETEKLNIWVAYFNLENQYGNPPEEAV  1681

Query  688   MKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALK  509
              KVFQRALQYCDPKKVH ALLG+YERTE +KL +ELL+KM KKFKHSCK+WLRR+Q  L 
Sbjct  1682  QKVFQRALQYCDPKKVHFALLGMYERTEQHKLAEELLDKMSKKFKHSCKLWLRRVQMLLM  1741

Query  508   QNQDNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLW  329
             Q QD  Q +VNRALLCLP HKH+KFI+Q AILEFK GV DRGRSMFE +L+EYPKRTDLW
Sbjct  1742  QQQDRVQPVVNRALLCLPHHKHVKFISQAAILEFKSGVPDRGRSMFEGVLREYPKRTDLW  1801

Query  328   SVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKA  149
             S+YLDQEIR+GD DVIRALFERAISLS+PPKKMKFLFKKYL YEKS GDE RIESVKRKA
Sbjct  1802  SIYLDQEIRLGDEDVIRALFERAISLSLPPKKMKFLFKKYLNYEKSCGDEARIESVKRKA  1861

Query  148   MEYVES  131
             M+YVES
Sbjct  1862  MDYVES  1867



>ref|XP_010058493.1| PREDICTED: protein RRP5 homolog [Eucalyptus grandis]
 gb|KCW90365.1| hypothetical protein EUGRSUZ_A02507 [Eucalyptus grandis]
Length=1925

 Score =  2297 bits (5952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1214/1910 (64%), Positives = 1505/1910 (79%), Gaps = 29/1910 (2%)
 Frame = -2

Query  5806  KNFKRKGKNNEAGNASFSGKSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAE  5627
             K FK K    EA       K   LQLED+VPDFPRGG SLLS++E +E+ AEVD++F+A+
Sbjct  24    KPFKAKKNPGEAARQ----KPVALQLEDDVPDFPRGGGSLLSRKEREEIHAEVDSQFDAD  79

Query  5626  DRylkkkkqhklykKNQSVEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEV  5447
              R LKKKK  K+ K+  + EDDLGSLFG  ++GKLP+ ANRIT KNI+PGMKLWGVI+EV
Sbjct  80    GRELKKKKTRKMQKRGPTSEDDLGSLFGDGMTGKLPRFANRITLKNIAPGMKLWGVISEV  139

Query  5446  NEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDD  5267
             NEKD+VVSLPGGLRGLV ASEA DP+ D ET E E  +N LS +F +G LVSC+V+ +DD
Sbjct  140   NEKDLVVSLPGGLRGLVRASEAIDPVLDGETKESE--NNSLSSVFSIGHLVSCVVMQVDD  197

Query  5266  DKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLP  5087
             DKKE  K KIWLSLRL+L+ K  TL+AIQEG++LSAY++S EDHGYILH+G PSF+GFLP
Sbjct  198   DKKEKAKRKIWLSLRLSLVQKGFTLEAIQEGMVLSAYVRSVEDHGYILHYGSPSFTGFLP  257

Query  5086  IHSQSVDK---MNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPG  4916
               S+   +   +  G+L++GVVKS+D+ RKVVYL+   D ++K+VTKD+KGISIDLLVPG
Sbjct  258   KASEDESRGPELKVGKLLQGVVKSIDKGRKVVYLNPDLDMVSKFVTKDVKGISIDLLVPG  317

Query  4915  MMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDP  4736
             MMVNA V S +ENGVMLSFLTYF+GTVD+FHL+   P  SW D Y +NKKVNARILF+DP
Sbjct  318   MMVNARVQSTIENGVMLSFLTYFSGTVDMFHLESALPTKSWMDSYTKNKKVNARILFVDP  377

Query  4735  ATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYI  4556
              +RA+GL++NP+L+  KAPP    VGDI++ AK++RVD+GLG+LLEIPS+P  T AYV +
Sbjct  378   FSRAIGLTMNPYLIQNKAPPLHASVGDIYDNAKIVRVDRGLGILLEIPSTPQSTSAYVNV  437

Query  4555  SdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVV  4376
             SD+ + E  K+ K FK G  VRVR+ G R LEGLA G LK +AFEGSVFTHSDVKPGMVV
Sbjct  438   SDITEGEGHKLGKKFKEGTCVRVRIFGTRRLEGLAVGVLKATAFEGSVFTHSDVKPGMVV  497

Query  4375  KAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRIT  4196
             +AKV+ VDSFGAIVQFS GVKALCPL HMSEFEI KPRKKF+VG+ELVFRVLGCKSKRIT
Sbjct  498   RAKVLVVDSFGAIVQFSGGVKALCPLPHMSEFEIAKPRKKFKVGAELVFRVLGCKSKRIT  557

Query  4195  VTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDP  4016
             VTHKKTLVKSKL I+SSY+DATEGLITHGWITKIEKHGCFVRFYNGVQGFAPR ELGL+P
Sbjct  558   VTHKKTLVKSKLTIISSYSDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRHELGLEP  617

Query  4015  GSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTP  3836
             GSD  SMYHV QVVKCRV  S PA+R+I LSF  +P ++SE +MVK G++VSG+VE V+P
Sbjct  618   GSDPGSMYHVGQVVKCRVTGSVPAARRINLSFLMKPAKISEDDMVKLGSLVSGVVEAVSP  677

Query  3835  DSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSA  3656
               IV+ V   +  LKGT+  +HL+DH   A LMKSVLKPGYE+ QLLVLDIEG  L+LSA
Sbjct  678   HGIVIYV-KAKIFLKGTIPIEHLADHHEHAMLMKSVLKPGYEYQQLLVLDIEGNTLLLSA  736

Query  3655  KYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYD  3476
             K SLI+ A  LP D++Q+  +S+VHGY+CN+I  G FVRFLGRLTGFSPR KA D +R  
Sbjct  737   KSSLINAAADLPSDLHQVHTNSIVHGYICNIIETGCFVRFLGRLTGFSPRKKAMDVQRAT  796

Query  3475  TSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDS  3296
               E F+IGQSV +NILDV+ ETGRITVSLKQS CSSTDA+ IQEY+  E KIAKLQS   
Sbjct  797   PLEAFFIGQSVRSNILDVDNETGRITVSLKQSCCSSTDASLIQEYYFSEDKIAKLQSPTL  856

Query  3295  ADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQ  3116
             + + L WV+ F +GSIVEGK+ E K++GVVV+F+ Y DV GFI+  QLGG + E GS +Q
Sbjct  857   SGTELKWVERFKIGSIVEGKIQEKKDYGVVVSFDDYADVLGFITHYQLGGSSAEVGSVVQ  916

Query  3115  AAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIV  2936
             A V+DV+K+  LVDLSLK  FV+    ++A + ++KKKRKREA+K+ E+NQ+V AVVEIV
Sbjct  917   AVVLDVAKVGQLVDLSLKQVFVDKVNNESATNHSEKKKRKREAKKNAELNQTVTAVVEIV  976

Query  2935  KENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLL  2756
             KENYLVL++P CNYA+G+A + D+NTQ  P +QF NG+SV AT++ALP  +T GRLLLLL
Sbjct  977   KENYLVLAIPECNYAVGHALIYDYNTQKAPQRQFSNGESVTATVVALPTPATMGRLLLLL  1036

Query  2755  KAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDN  2576
              ++++++ +SSSK+ +K S+++VGSLVQAEIT IKPLE+RLKFG   HGRVHITE  DDN
Sbjct  1037  NSVADLSTTSSSKKARKISNFNVGSLVQAEITGIKPLEMRLKFGVRLHGRVHITEVGDDN  1096

Query  2575  TTEGPLNDFRIGQTLTARIVSKDSRSENKRGYQWELSTKPSVLAGDM----DGPHESFNY  2408
               + P  +F++GQ L+ARIV K + S  K+  QWELS KPS+L+       D   E FN+
Sbjct  1097  FVDNPFKNFKVGQKLSARIVVK-ADSSKKQNNQWELSIKPSLLSDACVIGEDFASEDFNF  1155

Query  2407  STGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYIL  2228
             +TGQ +SGYV+KVDSEWAW++I++ V+AQL++LDS+ E SEL+ FQ RF VGK  SGY+L
Sbjct  1156  TTGQHVSGYVYKVDSEWAWISITQHVKAQLFVLDSACESSELQNFQNRFPVGKVFSGYVL  1215

Query  2227  SANKEKKLLRLVPHTLLITPEDTVP----SSES-----ARCHIREGSVLGGRISKILPGV  2075
             S N EKKLLRLVP        D       SSE         H+ EG +LGGRISKI PGV
Sbjct  1216  STNNEKKLLRLVPCPFSKGNHDEQQKIDDSSEQKLKDDVTAHMHEGDILGGRISKIFPGV  1275

Query  2074  GGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLR  1895
             GGL+VQ+   ++G+VH+TE+ D WVS+PLSG+ EGQFVKCKV+++  + +G+ HVDLSLR
Sbjct  1276  GGLVVQLGPSVYGRVHYTEITDSWVSEPLSGHHEGQFVKCKVIEISRTAQGSVHVDLSLR  1335

Query  1894  WTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKI  1715
              +LD M  Q   +  D +   + V+ I++LHP+M VQGYVKN+TPKGCFIMLSRK+DAKI
Sbjct  1336  ASLDGMGVQGTEDLPDRNGNCKCVEKIEELHPNMVVQGYVKNITPKGCFIMLSRKLDAKI  1395

Query  1714  LLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNF  1535
             L+SNL+DG++++ E+EFPVGKLV G+V+SVE+LSKRVEVTLRTS++A   KS ID+L++ 
Sbjct  1396  LVSNLSDGYVKNLEQEFPVGKLVEGRVLSVETLSKRVEVTLRTSNAANDEKSRIDSLSSL  1455

Query  1534  SAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlk  1355
               G+I+SG+I+R+E +GLFI+++ TNLVGLCH+SE+SDD +DN++S++KAG+ VRVK+LK
Sbjct  1456  QIGSIVSGRIRRVEPYGLFITINQTNLVGLCHISEVSDDPVDNIESKFKAGEEVRVKILK  1515

Query  1354  vdkdRHRISLGMKNSYFRDDDGEDIQTTSRQSINSTDKGNSVFIGTQSTVFPESSDADID  1175
             VD++R RISLGMKNSYF   +G  I   S +  +   + N     T+  +   SS     
Sbjct  1516  VDEERRRISLGMKNSYFTSVNG--IHVPSDEESDELIRENGYGDETKQMLLSSSSHGIQH  1573

Query  1174  VSVVNTT--DNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkk  1001
             +   N +  D  L + ESRASIPPLEV LD+IE+ D D+ +     H G      EK+ K
Sbjct  1574  MISDNESEEDAALAQAESRASIPPLEVTLDEIEHLDEDNMIIPEEGH-GDEVKKVEKNTK  1632

Query  1000  ramkkakkerereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDV  821
              A KK K+EREREIRAAEERLLEKDIPR  DEFE+LVRSSPNSSFVWIKYMAFMLSL D+
Sbjct  1633  GAKKKEKEEREREIRAAEERLLEKDIPRTADEFERLVRSSPNSSFVWIKYMAFMLSLADI  1692

Query  820   EKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKV  641
             EKARSIAE+A+ TIN+REE+EKLN+WVAYFNLE EYGNPP+E+V+KVFQRALQYCDPKKV
Sbjct  1693  EKARSIAERALRTINVREENEKLNIWVAYFNLENEYGNPPEESVLKVFQRALQYCDPKKV  1752

Query  640   HLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLC  461
             HLALL +YERTE  K+ D+LLEKMV+KFKHSCK+WLRR+QW LKQ+ +  Q IVNRALL 
Sbjct  1753  HLALLAMYERTEQNKMVDDLLEKMVRKFKHSCKVWLRRVQWLLKQHNEGVQPIVNRALLS  1812

Query  460   LPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVI  281
             LP HKHIKFI+QTAILEFKCGV DRGRS+FE +L++YPKRTDLWS+YLDQE+++GD DVI
Sbjct  1813  LPHHKHIKFISQTAILEFKCGVPDRGRSLFEGILRQYPKRTDLWSIYLDQEMKLGDTDVI  1872

Query  280   RALFERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             RALFERAISLS+P KK+KFLFKKYLA+EK++GDEERIE VK KAMEY ES
Sbjct  1873  RALFERAISLSLPLKKIKFLFKKYLAFEKTLGDEERIEYVKNKAMEYAES  1922



>ref|XP_006575179.1| PREDICTED: protein RRP5 homolog isoform X1 [Glycine max]
Length=1914

 Score =  2284 bits (5920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1196/1918 (62%), Positives = 1502/1918 (78%), Gaps = 69/1918 (4%)
 Frame = -2

Query  5791  KGKNNEAGNASFSGKSAPL--QLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAED--  5624
             K K  E  +A  + KS  L  QLEDEVPDFPRGG      E   + R++ D EF AED  
Sbjct  32    KPKKREQNDAVVAAKSEALSLQLEDEVPDFPRGG------EFSAKGRSDYD-EFSAEDPS  84

Query  5623  -RylkkkkqhklykKNQSVEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEV  5447
              +  KKKK      K+    DD GSL G  I+GKLP+  NRIT KNI+PGMKLWGV+AEV
Sbjct  85    RKTRKKKKGRSASSKSNEGADDWGSLSGDGITGKLPRRVNRITLKNITPGMKLWGVVAEV  144

Query  5446  NEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDD  5267
             NEKD+VVSLPGGLRGLV AS+A DP++D++   +E+   +LSG+F VGQLVSC+VL LDD
Sbjct  145   NEKDLVVSLPGGLRGLVHASDAVDPIFDDK---IEVGEIFLSGVFCVGQLVSCVVLRLDD  201

Query  5266  DKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLP  5087
             DKKE G  KIWLSLRL+LLHKN  LD +QEG++L+AY+KS EDHGYILHFGLPSF GFLP
Sbjct  202   DKKEKGSRKIWLSLRLSLLHKNYNLDVVQEGMVLAAYVKSIEDHGYILHFGLPSFLGFLP  261

Query  5086  IHSQSVD---KMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPG  4916
              +S +     ++  G+L++G+V+++D+ RKVVYLSS PD ++K VTKDL+G+SIDLLVPG
Sbjct  262   KNSSAEGWGGEVKIGKLLQGLVRTIDKVRKVVYLSSDPDTMSKSVTKDLRGLSIDLLVPG  321

Query  4915  MMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDP  4736
             M+VNA V S+LENGVMLSFLTYFTGTVD+FHLQ ++P  +WKD   +++KV +RILFIDP
Sbjct  322   MLVNARVKSILENGVMLSFLTYFTGTVDLFHLQNIYPGTNWKDKCSESQKVVSRILFIDP  381

Query  4735  ATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYI  4556
             ++RAVGL+LNPHLV  +APPS VK+GDI++ +KV+RVD+GLGLLLE+PS P PTPA+V I
Sbjct  382   SSRAVGLTLNPHLVQNRAPPSHVKIGDIYDNSKVVRVDRGLGLLLEVPSIPEPTPAFVSI  441

Query  4555  SdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVV  4376
             SD+ ++EV+K+EK +K G  VRVR+LG R LEG+ATG LK SA E  VFTHSDVKPGMVV
Sbjct  442   SDIAEEEVQKLEKKYKEGNRVRVRILGLRYLEGIATGVLKASALEEEVFTHSDVKPGMVV  501

Query  4375  KAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRIT  4196
             KAK+++VDSFGAIVQ   GVKALCPLRHMSE EI KP KKF+VG+ELVFRVLGCKSKR+T
Sbjct  502   KAKILSVDSFGAIVQIPGGVKALCPLRHMSELEISKPGKKFKVGAELVFRVLGCKSKRVT  561

Query  4195  VTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDP  4016
             VTHKKTLVKSKL I+SSY DAT+GLITHGWITKIE HGCFVRFYNGVQGFAPRSELGL+P
Sbjct  562   VTHKKTLVKSKLGIISSYADATDGLITHGWITKIEVHGCFVRFYNGVQGFAPRSELGLEP  621

Query  4015  GSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTP  3836
             G+D  ++Y+V QVVKCRV+S  PASR+I LSF  +P R+SE +MV  G++VSG+V+ +T 
Sbjct  622   GADPGTVYNVGQVVKCRVISCIPASRRINLSFIIKPTRVSEDDMVTLGSLVSGVVDRITS  681

Query  3835  DSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSA  3656
             +++VV V N     +GT+S +HL+DH G A LM S LKPGY FDQLLVLD++G NL+LSA
Sbjct  682   NAVVVYV-NASGFSRGTISMEHLADHHGQAILMHSRLKPGYNFDQLLVLDVKGNNLILSA  740

Query  3655  KYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYD  3476
             K SLI  AQQ+P D+NQI P+SVVHGY+CN+I +G FVRFLG LTGF+PR+KA DD++ +
Sbjct  741   KSSLIKHAQQIPADINQIHPNSVVHGYICNLIESGCFVRFLGHLTGFAPRNKAADDQKSN  800

Query  3475  TSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDS  3296
               E +YIGQSV +NI +V+ ETGR+T+SLKQ+ CSSTDA+FIQ+YFL++ KIAKLQ   S
Sbjct  801   ILEAYYIGQSVRSNISNVSSETGRVTLSLKQTACSSTDASFIQDYFLMDDKIAKLQYWGS  860

Query  3295  ADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQ  3116
               S   W +GF +G + +GKV ++++ G+ ++FEK++DVFGFI+  QL G  +E+GS ++
Sbjct  861   GASDSKWDEGFNIGMVAKGKVKDVEDVGLAISFEKHNDVFGFIANYQLAGTILESGSVVE  920

Query  3115  AAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIV  2936
             A V+DV+K + LV+L+LKPEF+N SK +++   T KKKR+REA KDL ++Q+VNAVVEIV
Sbjct  921   ALVLDVAKADKLVELTLKPEFINRSK-ESSTSHTNKKKRRREASKDLVLHQTVNAVVEIV  979

Query  2935  KENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLL  2756
             KENYLVLS+P  +Y +GYAS++D+N Q  P KQ+ NGQSV+AT+MALP   T GRLLLL 
Sbjct  980   KENYLVLSIPENDYTIGYASVSDYNAQRFPHKQYQNGQSVVATVMALPSPETSGRLLLL-  1038

Query  2755  KAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDN  2576
                +EV  +SSSKR KK SSY VG+LV+AEITDIK LEL+LKFG G HGR+HITE  + +
Sbjct  1039  --PNEVNGTSSSKRTKKKSSYKVGTLVEAEITDIKTLELKLKFGFGLHGRIHITEVQNGS  1096

Query  2575  TTEGPLNDFRIGQTLTARIVSKDSRSE-NKRGYQWELSTKPSVLAG--DMDGPHESFNYS  2405
               E P + +++GQT+TARIV+K + S+ N++G QWELS +  ++ G  D+D   E+  + 
Sbjct  1097  VLENPFSCYKVGQTVTARIVAKPNESDGNRKGSQWELSVRSEMVTGSSDIDDVSENLEFK  1156

Query  2404  TGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILS  2225
              GQ ++GYV+KV+SEW WLTISR VRAQLYILDS+ EPSEL++FQ R++VG+ VSG++LS
Sbjct  1157  IGQCVAGYVYKVESEWIWLTISRNVRAQLYILDSAIEPSELEDFQNRYHVGQPVSGHVLS  1216

Query  2224  ANKEKKLLRLVPHTLLITPEDTVPSSESARCHI-----------REGSVLGGRISKILPG  2078
              N EKKLLRLV     + P  T+P   S   HI            EG +LGGR+SKILP 
Sbjct  1217  VNMEKKLLRLV-----VRPFSTLPCGTSEEPHINVVDKGLTAHFHEGDILGGRVSKILPS  1271

Query  2077  VGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSL  1898
             VGGLLVQ+    +GKVHFTEL D  V DPLSGY EGQFVKC VL+V H+VKGT HVDLSL
Sbjct  1272  VGGLLVQVGPRTYGKVHFTELADTLVPDPLSGYHEGQFVKCVVLEVSHTVKGTIHVDLSL  1331

Query  1897  RWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAK  1718
             R +     N  +S+   V++ ++ V+ I+DLHPDM V+GY+KNVTPKGCFIMLSRK+DAK
Sbjct  1332  RSS-----NVKLSQDSAVNANSKCVEKIEDLHPDMIVKGYIKNVTPKGCFIMLSRKIDAK  1386

Query  1717  ILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNN  1538
             ILLSNL++ +++  EKEFP+GKLV G+V+SVE LS RVEVTL+TS+     KS+I  L+ 
Sbjct  1387  ILLSNLSEQYVQELEKEFPIGKLVIGRVISVEPLSNRVEVTLKTSTDPNIPKSEIIDLSK  1446

Query  1537  FSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvl  1358
             F  G++ISG+IKR+ESFGLFI++DNTN+VGLCHVSE+SD+ I+N+++ Y+AG+ V  ++L
Sbjct  1447  FHVGDVISGRIKRVESFGLFIAIDNTNMVGLCHVSEISDNRIENIEANYRAGERVNARIL  1506

Query  1357  kvdkdRHRISLGMKNSYFRD---------DDGEDIQTTSRQSINSTDKGNSVFIGTQSTV  1205
             KVD++RHRISLGMKNSY RD         ++ ++  T   +SI S    NS  +GT    
Sbjct  1507  KVDEERHRISLGMKNSYMRDETMLQIPSEEESDEPITDGMKSITSM---NSSLLGT----  1559

Query  1204  FPESSDADIDVSVVNTTDNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGAD  1025
                   ++IDV        IL++V+ RA IPPL+VPLDD +  D+++  +++ +H    D
Sbjct  1560  ------SNIDVEDEINQFPILSQVQQRADIPPLDVPLDDFDQFDVNNTNSQSEEHANEED  1613

Query  1024  TTDekdkkramkkakkerereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMA  845
               +EK K+R  KKAK+ERE++IRAAEERLLE D+PR  DEFEKL+RSSPNSSF WIKYM 
Sbjct  1614  IVNEKHKRREKKKAKEEREKQIRAAEERLLEDDVPRTADEFEKLIRSSPNSSFTWIKYMD  1673

Query  844   FMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRAL  665
             FM+S+ DVEKARSIAE+A+ TINIREE+EKLN+W AYFNLE +YGNP +EAVMKVFQRAL
Sbjct  1674  FMVSMVDVEKARSIAERALRTINIREENEKLNIWKAYFNLENKYGNPREEAVMKVFQRAL  1733

Query  664   QYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQS  485
             QY DPKKV+LALLG+YERTE + L DELL KM KKFKHSCK+WLRRIQ  LKQNQD  Q 
Sbjct  1734  QYNDPKKVYLALLGMYERTEQHNLADELLNKMTKKFKHSCKVWLRRIQSLLKQNQDGIQP  1793

Query  484   IVNRALLCLPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEI  305
             +++RA L LPKHKHIKF +QTAILEFK GV DRGRSMFE++L+EYPKRTDLWSVYLDQEI
Sbjct  1794  VIDRASLSLPKHKHIKFFSQTAILEFKVGVLDRGRSMFEKILREYPKRTDLWSVYLDQEI  1853

Query  304   RVGDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             +  D D+IRALFERA+SLS+PPKKMKFLFKKYL YEKS GDEERIESVKRKAMEYVES
Sbjct  1854  QHKDKDIIRALFERAVSLSLPPKKMKFLFKKYLYYEKSQGDEERIESVKRKAMEYVES  1911



>ref|XP_004303371.1| PREDICTED: protein RRP5 homolog [Fragaria vesca subsp. vesca]
Length=1866

 Score =  2280 bits (5908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1197/1896 (63%), Positives = 1492/1896 (79%), Gaps = 62/1896 (3%)
 Frame = -2

Query  5737  LQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhklykKNQ---SVE  5567
             LQLED+VPDFPRGG S L+++E DE+RAEVDAEFEAE+R LKK  +    K  +   + E
Sbjct  3     LQLEDDVPDFPRGGGSSLNRKERDEIRAEVDAEFEAEERELKKGGKKNKRKMPKESLAHE  62

Query  5566  DDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLAS  5387
             DD+GSLFG  I+GKLP+ AN+IT KNISPGMK+WGV+AEVNEKD+VVSLPGGLRGLV AS
Sbjct  63    DDMGSLFGDGITGKLPRYANKITMKNISPGMKVWGVVAEVNEKDLVVSLPGGLRGLVRAS  122

Query  5386  EAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLALLH  5207
             +A DP+ D+ET  +    + L  +F VGQLVSCIVL LD+DKKE GK KIWLSLRL+LLH
Sbjct  123   DAFDPILDDETEAL--ADSVLPSVFRVGQLVSCIVLQLDEDKKEKGKRKIWLSLRLSLLH  180

Query  5206  KNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDK---MNTGQLVEG  5036
             K  +LD++QEG++L+AY+KS EDHGYILHFGL SF+GFLP +SQ+ +K   +++GQL++ 
Sbjct  181   KGFSLDSVQEGMVLTAYVKSIEDHGYILHFGLSSFTGFLPKNSQAGNKEVQVSSGQLLQA  240

Query  5035  VVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFL  4856
              V+ VD+ RKVV++SS P+ ++  VTKDLKGISIDLLVPGMMVNA V+S LENGVMLSFL
Sbjct  241   AVRRVDKIRKVVHMSSDPEIMSMCVTKDLKGISIDLLVPGMMVNARVLSTLENGVMLSFL  300

Query  4855  TYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPP  4676
             TYFTGTVDI+HLQ  +P  +WK+DY QNKK+NARILF+DP+TRAVGL+LNPHLV  KAPP
Sbjct  301   TYFTGTVDIYHLQNSYPTTNWKEDYNQNKKLNARILFVDPSTRAVGLTLNPHLVRNKAPP  360

Query  4675  SLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKV  4496
             S VK+GDI++ +KV+RVD+GLGLLLEIPS+ + TPAYV                FK G  
Sbjct  361   SHVKIGDIYDDSKVVRVDRGLGLLLEIPSTQISTPAYV--------------SKFKEGTR  406

Query  4495  VRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGV  4316
             VRVR+LGFR+LEGLATG LK SAFEGSVFTHSDVKPGMVV+ K+I VDSFGAIVQF  GV
Sbjct  407   VRVRILGFRHLEGLATGILKASAFEGSVFTHSDVKPGMVVRGKIIAVDSFGAIVQFPGGV  466

Query  4315  KALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSYTD  4136
             KALCPL HMSEFEI KPRKKF++G+ELVFRVLGCKSKRITVTHKKTLVKSKL ILSSY D
Sbjct  467   KALCPLTHMSEFEIAKPRKKFKIGAELVFRVLGCKSKRITVTHKKTLVKSKLGILSSYAD  526

Query  4135  ATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVS  3956
             A +GLITHGWI KIE+ GCF+ FYNGVQGF+PRSELGL+PGS  S+MYHV QVVKCRV+ 
Sbjct  527   AADGLITHGWIRKIEERGCFIHFYNGVQGFSPRSELGLEPGSGPSTMYHVGQVVKCRVIG  586

Query  3955  SSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTVST  3776
             S+ +            +R+SE +MVK G++VSG+V+ VTP++++V VN  + +  GT+ T
Sbjct  587   SNYSL-----------VRVSEDDMVKLGSLVSGVVDRVTPNAVMVYVN-AKGYSMGTIFT  634

Query  3775  QHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQISP  3596
              HL+DH GLA LMKSVLKPGYEFDQLLVLD EG NL+LSAK SL+++A  LP +V+Q+ P
Sbjct  635   DHLADHHGLATLMKSVLKPGYEFDQLLVLDTEGNNLILSAKPSLLNSAPNLPSEVSQVHP  694

Query  3595  HSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVNG  3416
             ++VVHGY+CN+I  G FVRFLGR+TGFSPR KA DD + D SE +YIGQSV + ILDVN 
Sbjct  695   NTVVHGYICNLIDTGCFVRFLGRVTGFSPRHKAMDDYKGDLSEAYYIGQSVRSTILDVNS  754

Query  3415  ETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGK  3236
             ETGRIT+SLKQS CSSTDA+FIQEYF+ E KIAKLQ L+S +S  NW +GF +GS+VEGK
Sbjct  755   ETGRITLSLKQSSCSSTDASFIQEYFVSEDKIAKLQILNSKESRSNWSEGFTIGSVVEGK  814

Query  3235  VHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPE  3056
             V E K+ GVVV+FEKY DVFGFI+  QL G  VETGS ++A V+DV+K EHLVDLSLKPE
Sbjct  815   VQEAKDIGVVVSFEKYSDVFGFITHYQLAGTTVETGSIVRAVVLDVAKAEHLVDLSLKPE  874

Query  3055  FVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGYAS  2876
             F+   K +++  +T KKKR+RE   D E++++VNAVVEIVKENYLVLS+P  NY +GYAS
Sbjct  875   FITNLKQESSKSQTHKKKRRREVSDDPELHETVNAVVEIVKENYLVLSIPKYNYVVGYAS  934

Query  2875  LNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkknsS  2696
             ++D+NTQ  P KQF+NGQSV AT+MALP  +T GRLLLL+ ++SE A+SSSSKR KK SS
Sbjct  935   VSDYNTQKFPQKQFLNGQSVSATVMALPSPTTAGRLLLLVNSLSESADSSSSKRAKKKSS  994

Query  2695  YDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARIV  2516
             Y VGS+VQAEIT+IKPLELRLKFG GFHGRV ITE  DD   E P N+FRIGQT+TA I+
Sbjct  995   YKVGSVVQAEITEIKPLELRLKFGIGFHGRVRITEVNDD-VLEDPFNNFRIGQTVTAIII  1053

Query  2515  SKDSRSENKRGYQWELSTKPSVLAG--DMDGP--HESFNYSTGQLLSGYVFKVDSEWAWL  2348
             +K +   NK+ +QW+LS KPS+L G  +++G   +E  N+S G+ ++GYV KVD+EW WL
Sbjct  1054  AKTNSDNNKKSFQWDLSLKPSLLTGSCEIEGSVMNEDLNFSIGKHVTGYVCKVDAEWVWL  1113

Query  2347  TISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTLL---  2177
             TISR VRAQ++ILDS+ EPSEL+EFQKRF+VG +VSG++LS +KEKKLLRLV +      
Sbjct  1114  TISRNVRAQIFILDSACEPSELQEFQKRFHVGNAVSGHVLSVSKEKKLLRLVSYPFSPVS  1173

Query  2176  -------ITPEDTVPSSESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTE  2018
                    +T  D   S  +A  HIREG V+ GRI K LPGVGGL VQI  H++G+VH++E
Sbjct  1174  NKTVDHEVTKMDANVSMLNATAHIREGCVVAGRIIKKLPGVGGLTVQIGPHMYGRVHYSE  1233

Query  2017  LRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTL--DTMNNQNISEHDDV  1844
             L D WVS+PLSGY EGQFVKCKVL+   S +GT H +LSLR TL      + N+ ++D +
Sbjct  1234  LSDSWVSNPLSGYEEGQFVKCKVLECSRSGQGTFHFELSLRSTLVGTPCQDSNVPDNDTL  1293

Query  1843  HSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEF  1664
              +   RV+ I DL P+M VQGYVKNV+ KGCFI+LSRK+DA+IL+SNL+DG+++ PEKEF
Sbjct  1294  -THMERVEKIDDLKPNMVVQGYVKNVSSKGCFILLSRKLDARILVSNLSDGYVDDPEKEF  1352

Query  1663  PVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGKIKRIESFG  1484
             PVGKLVTG+V SVE LSKRVEVTL++ S+++  +S  + L++   G+IISG++KR+ES+G
Sbjct  1353  PVGKLVTGRVSSVEPLSKRVEVTLKSLSASSLSQSAKNNLDSLQVGDIISGRVKRLESYG  1412

Query  1483  LFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSYF  1304
             +FI++DNTN+VGLCHVSELS+D  +N +S+Y+ G+ V  KVLKVDK+RHR+SLGMK+ Y 
Sbjct  1413  IFITIDNTNVVGLCHVSELSEDKKENFESKYRTGERVTAKVLKVDKERHRVSLGMKDLYI  1472

Query  1303  RDDDGEDIQTTSRQSINSTDKGNSVFIGTQS--TVFPESS---DADIDVSVVNTTDNILT  1139
              ++     QT  +Q ++   +  ++   ++S   + P  S   D ++++   N     L 
Sbjct  1473  MENSD---QTPPKQDLDEPIRKTALVDDSRSVTVMCPVDSLLGDQNMEIDHENAEFQFLA  1529

Query  1138  EVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkramkkakkererei  959
             + ESRA IPPLEV LDD +    D  V+++ +     +T D+K KK   KKA+ EREREI
Sbjct  1530  QAESRAFIPPLEVTLDDSDQG--DGTVSQDRELPEVDNTVDDKKKKLTKKKARDEREREI  1587

Query  958   raaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTI  779
             RAAEERLLEKDIPR  +EFEKLVRSSPNSS+VWIKYM F+LS+ DVEKARSIA++A+ TI
Sbjct  1588  RAAEERLLEKDIPRTDEEFEKLVRSSPNSSYVWIKYMEFVLSMADVEKARSIAKRALETI  1647

Query  778   NIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHY  599
             N REE+EKLNVWVAYFNLE +YG+PP+EAVMKVF+ AL Y DPKKVHLALLGV+ER+E +
Sbjct  1648  NFREENEKLNVWVAYFNLESKYGSPPEEAVMKVFKEALLYNDPKKVHLALLGVFERSELH  1707

Query  598   KLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLCLPKHKHIKFITQTA  419
             KL DEL + M+K+FK SCK+WLRR+Q  L Q QD  Q  ++RA   LPKHKHIKF++QTA
Sbjct  1708  KLADELADNMIKRFKKSCKVWLRRVQRLLVQQQDGVQDFISRAEKILPKHKHIKFLSQTA  1767

Query  418   ILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPP  239
             ILEFKCG  +RGRS+FE +L++ PKRTDLWSVYLDQEIR+GD D+IRALFERA SLS+P 
Sbjct  1768  ILEFKCGNPERGRSLFENILRQNPKRTDLWSVYLDQEIRLGDTDLIRALFERATSLSLPA  1827

Query  238   KKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             KKMKFLFKKYL YE+  G+E+R   VK+KAM YVE+
Sbjct  1828  KKMKFLFKKYLDYEERHGNEDRANYVKQKAMSYVEN  1863



>ref|XP_006575180.1| PREDICTED: protein RRP5 homolog isoform X2 [Glycine max]
Length=1910

 Score =  2278 bits (5904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1196/1918 (62%), Positives = 1499/1918 (78%), Gaps = 73/1918 (4%)
 Frame = -2

Query  5791  KGKNNEAGNASFSGKSAPL--QLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAED--  5624
             K K  E  +A  + KS  L  QLEDEVPDFPRGG      E   + R++ D EF AED  
Sbjct  32    KPKKREQNDAVVAAKSEALSLQLEDEVPDFPRGG------EFSAKGRSDYD-EFSAEDPS  84

Query  5623  -RylkkkkqhklykKNQSVEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEV  5447
              +  KKKK      K+    DD GSL G  I+GKLP+  NRIT KNI+PGMKLWGV+AEV
Sbjct  85    RKTRKKKKGRSASSKSNEGADDWGSLSGDGITGKLPRRVNRITLKNITPGMKLWGVVAEV  144

Query  5446  NEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDD  5267
             NEKD+VVSLPGGLRGLV AS+A DP++D++   +E+   +LSG+F VGQLVSC+VL LDD
Sbjct  145   NEKDLVVSLPGGLRGLVHASDAVDPIFDDK---IEVGEIFLSGVFCVGQLVSCVVLRLDD  201

Query  5266  DKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLP  5087
             DKKE G  KIWLSLRL+LLHKN  LD +QEG++L+AY+KS EDHGYILHFGLPSF GFLP
Sbjct  202   DKKEKGSRKIWLSLRLSLLHKNYNLDVVQEGMVLAAYVKSIEDHGYILHFGLPSFLGFLP  261

Query  5086  IHSQSVD---KMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPG  4916
              +S +     ++  G+L++G+V+++D+ RKVVYLSS PD ++K VTKDL+G+SIDLLVPG
Sbjct  262   KNSSAEGWGGEVKIGKLLQGLVRTIDKVRKVVYLSSDPDTMSKSVTKDLRGLSIDLLVPG  321

Query  4915  MMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDP  4736
             M+VNA V S+LENGVMLSFLTYFTGTVD+FHLQ ++P  +WKD   +++KV +RILFIDP
Sbjct  322   MLVNARVKSILENGVMLSFLTYFTGTVDLFHLQNIYPGTNWKDKCSESQKVVSRILFIDP  381

Query  4735  ATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYI  4556
             ++RAVGL+LNPHLV  +APPS VK+GDI++ +KV+RVD+GLGLLLE+PS P PTPA+V I
Sbjct  382   SSRAVGLTLNPHLVQNRAPPSHVKIGDIYDNSKVVRVDRGLGLLLEVPSIPEPTPAFVSI  441

Query  4555  SdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVV  4376
             SD+ ++EV+K+EK +K G  VRVR+LG R LEG+ATG LK SA E  VFTHSDVKPGMVV
Sbjct  442   SDIAEEEVQKLEKKYKEGNRVRVRILGLRYLEGIATGVLKASALEEEVFTHSDVKPGMVV  501

Query  4375  KAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRIT  4196
             KAK+++VDSFGAIVQ   GVKALCPLRHMSE EI KP KKF+VG+ELVFRVLGCKSKR+T
Sbjct  502   KAKILSVDSFGAIVQIPGGVKALCPLRHMSELEISKPGKKFKVGAELVFRVLGCKSKRVT  561

Query  4195  VTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDP  4016
             VTHKKTLVKSKL I+SSY DAT+GLITHGWITKIE HGCFVRFYNGVQGFAPRSELGL+P
Sbjct  562   VTHKKTLVKSKLGIISSYADATDGLITHGWITKIEVHGCFVRFYNGVQGFAPRSELGLEP  621

Query  4015  GSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTP  3836
             G+D  ++Y+V QVVKCRV+S  PASR+I LSF  +P R+SE +MV  G++VSG+V+ +T 
Sbjct  622   GADPGTVYNVGQVVKCRVISCIPASRRINLSFIIKPTRVSEDDMVTLGSLVSGVVDRITS  681

Query  3835  DSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSA  3656
             +++VV V N     +GT+S +HL+DH G A LM S LKPGY FDQLLVLD++G NL+LSA
Sbjct  682   NAVVVYV-NASGFSRGTISMEHLADHHGQAILMHSRLKPGYNFDQLLVLDVKGNNLILSA  740

Query  3655  KYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYD  3476
             K SLI  AQQ+P D+NQI P+SVVHGY+CN+I +G FVRFLG LTGF+PR+KA DD++ +
Sbjct  741   KSSLIKHAQQIPADINQIHPNSVVHGYICNLIESGCFVRFLGHLTGFAPRNKAADDQKSN  800

Query  3475  TSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDS  3296
               E +YIGQSV +NI +V+ ETGR+T+SLKQ+ CSSTDA+FIQ+YFL++ KIAKLQ   S
Sbjct  801   ILEAYYIGQSVRSNISNVSSETGRVTLSLKQTACSSTDASFIQDYFLMDDKIAKLQYWGS  860

Query  3295  ADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQ  3116
               S   W +GF +G + +GKV ++++ G+ ++FEK++DVFGFI+  QL G  +E+GS ++
Sbjct  861   GASDSKWDEGFNIGMVAKGKVKDVEDVGLAISFEKHNDVFGFIANYQLAGTILESGSVVE  920

Query  3115  AAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIV  2936
             A V+DV+K + LV+L+LKPEF+N SK +++   T KKKR+REA KDL ++Q+VNAVVEIV
Sbjct  921   ALVLDVAKADKLVELTLKPEFINRSK-ESSTSHTNKKKRRREASKDLVLHQTVNAVVEIV  979

Query  2935  KENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLL  2756
             KENYLVLS+P  +Y +GYAS++D+N Q  P KQ+ NGQSV+AT+MALP   T GRLLLL 
Sbjct  980   KENYLVLSIPENDYTIGYASVSDYNAQRFPHKQYQNGQSVVATVMALPSPETSGRLLLL-  1038

Query  2755  KAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDN  2576
                +EV  +SSSKR KK SSY VG+LV+AEITDIK LEL+LKFG G HGR+HITE  + +
Sbjct  1039  --PNEVNGTSSSKRTKKKSSYKVGTLVEAEITDIKTLELKLKFGFGLHGRIHITEVQNGS  1096

Query  2575  TTEGPLNDFRIGQTLTARIVSKDSRSE-NKRGYQWELSTKPSVLAG--DMDGPHESFNYS  2405
               E P + +++GQT+TARIV+K + S+ N++G QWELS +  ++ G  D+D   E+  + 
Sbjct  1097  VLENPFSCYKVGQTVTARIVAKPNESDGNRKGSQWELSVRSEMVTGSSDIDDVSENLEFK  1156

Query  2404  TGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILS  2225
              GQ ++GYV+KV+SEW WLTISR VRAQLYILDS+ EPSEL++FQ R++VG+ VSG++LS
Sbjct  1157  IGQCVAGYVYKVESEWIWLTISRNVRAQLYILDSAIEPSELEDFQNRYHVGQPVSGHVLS  1216

Query  2224  ANKEKKLLRLVPHTLLITPEDTVPSSESARCHI-----------REGSVLGGRISKILPG  2078
              N EKKLLRLV     + P  T+P   S   HI            EG +LGGR+SKILP 
Sbjct  1217  VNMEKKLLRLV-----VRPFSTLPCGTSEEPHINVVDKGLTAHFHEGDILGGRVSKILPS  1271

Query  2077  VGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSL  1898
             VGGLLVQ+    +GKVHFTEL D  V DPLSGY EGQFVKC VL+V H+VKGT HVDLSL
Sbjct  1272  VGGLLVQVGPRTYGKVHFTELADTLVPDPLSGYHEGQFVKCVVLEVSHTVKGTIHVDLSL  1331

Query  1897  RWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAK  1718
             R +     N  +S+   V    + V+ I+DLHPDM V+GY+KNVTPKGCFIMLSRK+DAK
Sbjct  1332  RSS-----NVKLSQDSAV----KCVEKIEDLHPDMIVKGYIKNVTPKGCFIMLSRKIDAK  1382

Query  1717  ILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNN  1538
             ILLSNL++ +++  EKEFP+GKLV G+V+SVE LS RVEVTL+TS+     KS+I  L+ 
Sbjct  1383  ILLSNLSEQYVQELEKEFPIGKLVIGRVISVEPLSNRVEVTLKTSTDPNIPKSEIIDLSK  1442

Query  1537  FSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvl  1358
             F  G++ISG+IKR+ESFGLFI++DNTN+VGLCHVSE+SD+ I+N+++ Y+AG+ V  ++L
Sbjct  1443  FHVGDVISGRIKRVESFGLFIAIDNTNMVGLCHVSEISDNRIENIEANYRAGERVNARIL  1502

Query  1357  kvdkdRHRISLGMKNSYFRD---------DDGEDIQTTSRQSINSTDKGNSVFIGTQSTV  1205
             KVD++RHRISLGMKNSY RD         ++ ++  T   +SI S    NS  +GT    
Sbjct  1503  KVDEERHRISLGMKNSYMRDETMLQIPSEEESDEPITDGMKSITSM---NSSLLGT----  1555

Query  1204  FPESSDADIDVSVVNTTDNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGAD  1025
                   ++IDV        IL++V+ RA IPPL+VPLDD +  D+++  +++ +H    D
Sbjct  1556  ------SNIDVEDEINQFPILSQVQQRADIPPLDVPLDDFDQFDVNNTNSQSEEHANEED  1609

Query  1024  TTDekdkkramkkakkerereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMA  845
               +EK K+R  KKAK+ERE++IRAAEERLLE D+PR  DEFEKL+RSSPNSSF WIKYM 
Sbjct  1610  IVNEKHKRREKKKAKEEREKQIRAAEERLLEDDVPRTADEFEKLIRSSPNSSFTWIKYMD  1669

Query  844   FMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRAL  665
             FM+S+ DVEKARSIAE+A+ TINIREE+EKLN+W AYFNLE +YGNP +EAVMKVFQRAL
Sbjct  1670  FMVSMVDVEKARSIAERALRTINIREENEKLNIWKAYFNLENKYGNPREEAVMKVFQRAL  1729

Query  664   QYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQS  485
             QY DPKKV+LALLG+YERTE + L DELL KM KKFKHSCK+WLRRIQ  LKQNQD  Q 
Sbjct  1730  QYNDPKKVYLALLGMYERTEQHNLADELLNKMTKKFKHSCKVWLRRIQSLLKQNQDGIQP  1789

Query  484   IVNRALLCLPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEI  305
             +++RA L LPKHKHIKF +QTAILEFK GV DRGRSMFE++L+EYPKRTDLWSVYLDQEI
Sbjct  1790  VIDRASLSLPKHKHIKFFSQTAILEFKVGVLDRGRSMFEKILREYPKRTDLWSVYLDQEI  1849

Query  304   RVGDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             +  D D+IRALFERA+SLS+PPKKMKFLFKKYL YEKS GDEERIESVKRKAMEYVES
Sbjct  1850  QHKDKDIIRALFERAVSLSLPPKKMKFLFKKYLYYEKSQGDEERIESVKRKAMEYVES  1907



>ref|XP_010557958.1| PREDICTED: protein RRP5 homolog isoform X2 [Tarenaya hassleriana]
Length=1928

 Score =  2278 bits (5903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1178/1895 (62%), Positives = 1484/1895 (78%), Gaps = 32/1895 (2%)
 Frame = -2

Query  5749  KSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhklykKNQSV  5570
             ++  LQLEDE+PDFPRGG   LS++E +++RAEVD EF+ ++   KK K+ K+ KKN + 
Sbjct  41    EAVALQLEDEIPDFPRGGNISLSRKEREKIRAEVDVEFDVDEHVSKKTKRGKVKKKNPAD  100

Query  5569  EDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLA  5390
              DDLGSLFG  ISGKLP+ AN+IT KNIS GMKLWGV+AEVNEKD+++SLPGGLRGLV A
Sbjct  101   ADDLGSLFGGGISGKLPRYANKITNKNISRGMKLWGVVAEVNEKDLIISLPGGLRGLVRA  160

Query  5389  SEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLALL  5210
              EA D   D E  + E   N+L  +F+VGQLV CIVL LDDDKKE GK KIWLS+RL+LL
Sbjct  161   KEALD-FSDYEIKDDE--GNHLRAIFNVGQLVPCIVLQLDDDKKETGKRKIWLSMRLSLL  217

Query  5209  HKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDK---MNTGQLVE  5039
             HK  +LD+IQ+G++LSA +KS EDHGYILHFGLPS SGFLP  SQ   +      GQL++
Sbjct  218   HKGFSLDSIQDGMVLSANVKSIEDHGYILHFGLPSISGFLPKRSQDGSREIEAKIGQLMQ  277

Query  5038  GVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSF  4859
              VV  VDR  K V L   PDA+AK  TKDL+G+SIDLL+PGMMVNA V SVLENG+ML+F
Sbjct  278   CVVTKVDRDLKNVRLCCDPDAVAKCATKDLRGMSIDLLMPGMMVNARVQSVLENGIMLAF  337

Query  4858  LTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAP  4679
             LTYFTGTVD+FHLQ      +WKD+Y Q+KKVNARILFIDP+TRAVGL+LNPHLV  K P
Sbjct  338   LTYFTGTVDLFHLQNPLCNKNWKDEYNQHKKVNARILFIDPSTRAVGLTLNPHLVRNKPP  397

Query  4678  PSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGK  4499
             P  V  G IF+QAKV+R+D+G GLLLEIPS+PV +PAYV  SDV + EVK +EK FK G 
Sbjct  398   PLHVASGGIFDQAKVVRIDRGSGLLLEIPSTPVSSPAYVSASDVAEDEVKNLEKKFKEGS  457

Query  4498  VVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSG  4319
              VRVR+LG + LEG+A G+LKTSAFEG  F HSDVKPGMV+K K+I+VD+FGAIVQF  G
Sbjct  458   CVRVRILGLKQLEGIAIGTLKTSAFEGPAFIHSDVKPGMVMKGKIISVDTFGAIVQFPGG  517

Query  4318  VKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSYT  4139
             +KA+CPLRHMSEFEI KPRKKF+VG+EL FR LGCKSKRITVTHKKTLVKSKL IL+SY 
Sbjct  518   LKAMCPLRHMSEFEIAKPRKKFKVGAELTFRALGCKSKRITVTHKKTLVKSKLPILTSYA  577

Query  4138  DATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVV  3959
             DATEGL+THGWITKIEKHGCFVRFYNGV GFAPR ELGLDPGSD  S++HV +VVKCRV 
Sbjct  578   DATEGLVTHGWITKIEKHGCFVRFYNGVHGFAPRFELGLDPGSDPDSVFHVGEVVKCRVT  637

Query  3958  SSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTVS  3779
             S+  ASR+I LSF  +P  +SE + +K G++VSG+V+ + P +++V V + + +LKGT+S
Sbjct  638   SAVHASRRINLSFEIKPASVSEDDSIKLGSIVSGVVDTIAPHAVIVCVKS-KGYLKGTIS  696

Query  3778  TQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQIS  3599
              +HL+DH   A LMKSV++PGYEF +LLVLDIEG NLVLS+K+SL+ +A+++P + +Q+ 
Sbjct  697   IEHLADHHEHAKLMKSVVRPGYEFKKLLVLDIEGKNLVLSSKHSLLKSAEEIPSNASQLQ  756

Query  3598  PHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVN  3419
             P+SV+HGY+CN+I +G F+RFLGRLTGF+PRSKA D+ +   SE FYIGQSV  NI+D+N
Sbjct  757   PNSVIHGYICNLIESGCFIRFLGRLTGFAPRSKAMDETKGGLSEAFYIGQSVRANIIDIN  816

Query  3418  GETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEG  3239
              E GRIT+SLKQS CSS DA+FIQEYFL++ KIA LQS D+  +   WV+ F +GS+V+G
Sbjct  817   QEEGRITLSLKQSSCSSVDASFIQEYFLMDEKIANLQSSDTIGTEFGWVEQFTIGSLVKG  876

Query  3238  KVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKP  3059
                E  + GVVV FE +DDV G +    LGG  VE GS +QA V+D S+ E LVDLSL+ 
Sbjct  877   TAQEKNDLGVVVKFENFDDVLGCVPHYHLGGAAVECGSVLQAVVLDFSRAERLVDLSLRS  936

Query  3058  EFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGYA  2879
             +F   S  + ++ +  KKKRKR   K+LE++Q VNAVVE+VKE+YLVLS+P  +Y +GYA
Sbjct  937   DFTTNSAKEASSIQL-KKKRKRGISKELELHQRVNAVVEMVKEHYLVLSIPEYDYTIGYA  995

Query  2878  SLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkkns  2699
             S++D+NTQN P ++F  GQSV+A+++ALP+  + GRLLLLL +++E +E+S SK+ KK S
Sbjct  996   SVSDYNTQNFPTRRFSTGQSVVASVVALPNPLSSGRLLLLLDSVTEASETSRSKKAKKKS  1055

Query  2698  SYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARI  2519
             +Y+VGS+++AEIT+IKPLELR+ FGS   GR+HITE  D NT E P  +F++GQ+L+ARI
Sbjct  1056  NYEVGSVIRAEITEIKPLELRVNFGSDLQGRIHITEVNDINTCEEPFANFKVGQSLSARI  1115

Query  2518  VSKDSRSENKRGYQWELSTKPSVL--AGDMDGP--HESFNYSTGQLLSGYVFKVDSEWAW  2351
             V+K  RS  KRGY WELS KP++L  +GD++    +E  ++S GQ +SGYV+KVD EW W
Sbjct  1116  VAKPCRSNTKRGYLWELSIKPALLRDSGDLNDMQINEQLDFSAGQSVSGYVYKVDVEWVW  1175

Query  2350  LTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTLLIT  2171
             L +SR V+A+LYILD++ EP ELKEFQ+RF+ GK+VSGY+LS NKEKK LRLV   +L  
Sbjct  1176  LAVSRNVKARLYILDTTCEPHELKEFQRRFHPGKAVSGYVLSYNKEKKSLRLVQRPVLDA  1235

Query  2170  PEDTVPS-------------SESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKV  2030
              + TV +              E A  +I EG +LGGRISKILPGVGGL+VQI  H +GKV
Sbjct  1236  SQCTVENGSGKLDALGSNIHGEDASLYIYEGDILGGRISKILPGVGGLVVQIGPHTYGKV  1295

Query  2029  HFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISEH-  1853
             HFTEL+D WVSDPL  YCEGQFVKCKV+++ HSVKGT H+DLSLR +LD M +   SE  
Sbjct  1296  HFTELKDSWVSDPLDDYCEGQFVKCKVIEISHSVKGTLHIDLSLRTSLDGMGSGQDSEAL  1355

Query  1852  DDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPE  1673
             +++ S  RR++ I DL PDM VQGYVKN+  KGCFI+LSRK++AKILLSNL+D F+E PE
Sbjct  1356  NNIDSACRRIERIDDLSPDMVVQGYVKNIMAKGCFIVLSRKLEAKILLSNLSDEFVEKPE  1415

Query  1672  KEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGKIKRIE  1493
             KEFP+GK V G+V++VE L+KR+EV+L+++++   RKS++     FS G+ ISG+IKR+E
Sbjct  1416  KEFPIGKPVIGRVLTVEPLTKRIEVSLKSANAGRARKSEVYDFTKFSIGDRISGRIKRVE  1475

Query  1492  SFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKN  1313
              +GLFI +D TN+VGLCH SELSD+ +DN+Q+ YKAG+ V VK+LK+D+++H ISLGMK+
Sbjct  1476  PYGLFIVLDQTNMVGLCHKSELSDERVDNIQATYKAGERVTVKILKLDQEKHHISLGMKS  1535

Query  1312  SYFRDDDGEDIQTTSRQSINSTDKGNSVFIGTQSTVFPESSDADIDVSVVNTTDNILTEV  1133
             SYF  DD + +Q  S +              T S     S++   ++++ N T  +L++V
Sbjct  1536  SYFASDDDDKMQPASSEMPGKASMQCDDISDTDSEA---SAEIREEITIENGTSMVLSQV  1592

Query  1132  ESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkramkkakkerereira  953
             ESRAS+PPLEV LD+IE  D   AV+++       D  DEK+K+RA KKAK+ERE+EI+A
Sbjct  1593  ESRASVPPLEVDLDEIEQYDF--AVDQSKVQQEEEDKKDEKNKRRAKKKAKEEREKEIQA  1650

Query  952   aeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINI  773
             AEERLLEK +P + D+FEKLVRSSP+SSF+WIKYMAF LSL DVEKARSIAE+A+ TINI
Sbjct  1651  AEERLLEKSVPASADDFEKLVRSSPSSSFIWIKYMAFTLSLADVEKARSIAERALRTINI  1710

Query  772   REESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKL  593
             REE EKLNVWVAYFNLE E+GNPPQ+AV KVF+RALQYCD KKV+LALLG+Y+RTE  +L
Sbjct  1711  REEEEKLNVWVAYFNLENEHGNPPQDAVKKVFERALQYCDQKKVYLALLGMYDRTEQNEL  1770

Query  592   GDELLE-KMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLCLPKHKHIKFITQTAI  416
              DELL+ KM+KKFKHSCK+WLR++Q  LK N +  QS+V RAL CLP+HKHIKFI+QTAI
Sbjct  1771  ADELLDKKMIKKFKHSCKVWLRKVQQLLKGNGEGIQSLVTRALECLPRHKHIKFISQTAI  1830

Query  415   LEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPK  236
              EFKCGV DRGRS+FE +L+EYPKRTDLWSVYLDQEIR+GD+DV R+LFERAISLS+PPK
Sbjct  1831  REFKCGVPDRGRSLFEGVLREYPKRTDLWSVYLDQEIRLGDVDVTRSLFERAISLSLPPK  1890

Query  235   KMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             KMKFLFKKYL YEKS+GD+ER E VKRKAMEYVES
Sbjct  1891  KMKFLFKKYLEYEKSLGDDERAEDVKRKAMEYVES  1925



>ref|XP_010557957.1| PREDICTED: protein RRP5 homolog isoform X1 [Tarenaya hassleriana]
Length=1937

 Score =  2274 bits (5892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1177/1903 (62%), Positives = 1484/1903 (78%), Gaps = 39/1903 (2%)
 Frame = -2

Query  5749  KSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhklykKNQSV  5570
             ++  LQLEDE+PDFPRGG   LS++E +++RAEVD EF+ ++   KK K+ K+ KKN + 
Sbjct  41    EAVALQLEDEIPDFPRGGNISLSRKEREKIRAEVDVEFDVDEHVSKKTKRGKVKKKNPAD  100

Query  5569  EDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLA  5390
              DDLGSLFG  ISGKLP+ AN+IT KNIS GMKLWGV+AEVNEKD+++SLPGGLRGLV A
Sbjct  101   ADDLGSLFGGGISGKLPRYANKITNKNISRGMKLWGVVAEVNEKDLIISLPGGLRGLVRA  160

Query  5389  SEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLALL  5210
              EA D   D E  + E   N+L  +F+VGQLV CIVL LDDDKKE GK KIWLS+RL+LL
Sbjct  161   KEALD-FSDYEIKDDE--GNHLRAIFNVGQLVPCIVLQLDDDKKETGKRKIWLSMRLSLL  217

Query  5209  HKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDK---MNTGQLVE  5039
             HK  +LD+IQ+G++LSA +KS EDHGYILHFGLPS SGFLP  SQ   +      GQL++
Sbjct  218   HKGFSLDSIQDGMVLSANVKSIEDHGYILHFGLPSISGFLPKRSQDGSREIEAKIGQLMQ  277

Query  5038  GVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSF  4859
              VV  VDR  K V L   PDA+AK  TKDL+G+SIDLL+PGMMVNA V SVLENG+ML+F
Sbjct  278   CVVTKVDRDLKNVRLCCDPDAVAKCATKDLRGMSIDLLMPGMMVNARVQSVLENGIMLAF  337

Query  4858  LTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAP  4679
             LTYFTGTVD+FHLQ      +WKD+Y Q+KKVNARILFIDP+TRAVGL+LNPHLV  K P
Sbjct  338   LTYFTGTVDLFHLQNPLCNKNWKDEYNQHKKVNARILFIDPSTRAVGLTLNPHLVRNKPP  397

Query  4678  PSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGK  4499
             P  V  G IF+QAKV+R+D+G GLLLEIPS+PV +PAYV  SDV + EVK +EK FK G 
Sbjct  398   PLHVASGGIFDQAKVVRIDRGSGLLLEIPSTPVSSPAYVSASDVAEDEVKNLEKKFKEGS  457

Query  4498  VVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSG  4319
              VRVR+LG + LEG+A G+LKTSAFEG  F HSDVKPGMV+K K+I+VD+FGAIVQF  G
Sbjct  458   CVRVRILGLKQLEGIAIGTLKTSAFEGPAFIHSDVKPGMVMKGKIISVDTFGAIVQFPGG  517

Query  4318  VKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSYT  4139
             +KA+CPLRHMSEFEI KPRKKF+VG+EL FR LGCKSKRITVTHKKTLVKSKL IL+SY 
Sbjct  518   LKAMCPLRHMSEFEIAKPRKKFKVGAELTFRALGCKSKRITVTHKKTLVKSKLPILTSYA  577

Query  4138  DATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVV  3959
             DATEGL+THGWITKIEKHGCFVRFYNGV GFAPR ELGLDPGSD  S++HV +VVKCRV 
Sbjct  578   DATEGLVTHGWITKIEKHGCFVRFYNGVHGFAPRFELGLDPGSDPDSVFHVGEVVKCRVT  637

Query  3958  SSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTVS  3779
             S+  ASR+I LSF  +P  +SE + +K G++VSG+V+ + P +++V V + + +LKGT+S
Sbjct  638   SAVHASRRINLSFEIKPASVSEDDSIKLGSIVSGVVDTIAPHAVIVCVKS-KGYLKGTIS  696

Query  3778  TQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQIS  3599
              +HL+DH   A LMKSV++PGYEF +LLVLDIEG NLVLS+K+SL+ +A+++P + +Q+ 
Sbjct  697   IEHLADHHEHAKLMKSVVRPGYEFKKLLVLDIEGKNLVLSSKHSLLKSAEEIPSNASQLQ  756

Query  3598  PHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVN  3419
             P+SV+HGY+CN+I +G F+RFLGRLTGF+PRSKA D+ +   SE FYIGQSV  NI+D+N
Sbjct  757   PNSVIHGYICNLIESGCFIRFLGRLTGFAPRSKAMDETKGGLSEAFYIGQSVRANIIDIN  816

Query  3418  GETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEG  3239
              E GRIT+SLKQS CSS DA+FIQEYFL++ KIA LQS D+  +   WV+ F +GS+V+G
Sbjct  817   QEEGRITLSLKQSSCSSVDASFIQEYFLMDEKIANLQSSDTIGTEFGWVEQFTIGSLVKG  876

Query  3238  KVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKP  3059
                E  + GVVV FE +DDV G +    LGG  VE GS +QA V+D S+ E LVDLSL+ 
Sbjct  877   TAQEKNDLGVVVKFENFDDVLGCVPHYHLGGAAVECGSVLQAVVLDFSRAERLVDLSLRS  936

Query  3058  EFVNGSKPQTANDKTQK--------KKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPA  2903
             +F   S  + ++ + +K         KRKR   K+LE++Q VNAVVE+VKE+YLVLS+P 
Sbjct  937   DFTTNSAKEASSIQLKKVSLERYIPAKRKRGISKELELHQRVNAVVEMVKEHYLVLSIPE  996

Query  2902  CNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsss  2723
              +Y +GYAS++D+NTQN P ++F  GQSV+A+++ALP+  + GRLLLLL +++E +E+S 
Sbjct  997   YDYTIGYASVSDYNTQNFPTRRFSTGQSVVASVVALPNPLSSGRLLLLLDSVTEASETSR  1056

Query  2722  skrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRI  2543
             SK+ KK S+Y+VGS+++AEIT+IKPLELR+ FGS   GR+HITE  D NT E P  +F++
Sbjct  1057  SKKAKKKSNYEVGSVIRAEITEIKPLELRVNFGSDLQGRIHITEVNDINTCEEPFANFKV  1116

Query  2542  GQTLTARIVSKDSRSENKRGYQWELSTKPSVL--AGDMDGP--HESFNYSTGQLLSGYVF  2375
             GQ+L+ARIV+K  RS  KRGY WELS KP++L  +GD++    +E  ++S GQ +SGYV+
Sbjct  1117  GQSLSARIVAKPCRSNTKRGYLWELSIKPALLRDSGDLNDMQINEQLDFSAGQSVSGYVY  1176

Query  2374  KVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRL  2195
             KVD EW WL +SR V+A+LYILD++ EP ELKEFQ+RF+ GK+VSGY+LS NKEKK LRL
Sbjct  1177  KVDVEWVWLAVSRNVKARLYILDTTCEPHELKEFQRRFHPGKAVSGYVLSYNKEKKSLRL  1236

Query  2194  VPHTLLITPEDTVPS-------------SESARCHIREGSVLGGRISKILPGVGGLLVQI  2054
             V   +L   + TV +              E A  +I EG +LGGRISKILPGVGGL+VQI
Sbjct  1237  VQRPVLDASQCTVENGSGKLDALGSNIHGEDASLYIYEGDILGGRISKILPGVGGLVVQI  1296

Query  2053  DAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMN  1874
               H +GKVHFTEL+D WVSDPL  YCEGQFVKCKV+++ HSVKGT H+DLSLR +LD M 
Sbjct  1297  GPHTYGKVHFTELKDSWVSDPLDDYCEGQFVKCKVIEISHSVKGTLHIDLSLRTSLDGMG  1356

Query  1873  NQNISEH-DDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLA  1697
             +   SE  +++ S  RR++ I DL PDM VQGYVKN+  KGCFI+LSRK++AKILLSNL+
Sbjct  1357  SGQDSEALNNIDSACRRIERIDDLSPDMVVQGYVKNIMAKGCFIVLSRKLEAKILLSNLS  1416

Query  1696  DGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNII  1517
             D F+E PEKEFP+GK V G+V++VE L+KR+EV+L+++++   RKS++     FS G+ I
Sbjct  1417  DEFVEKPEKEFPIGKPVIGRVLTVEPLTKRIEVSLKSANAGRARKSEVYDFTKFSIGDRI  1476

Query  1516  SGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRH  1337
             SG+IKR+E +GLFI +D TN+VGLCH SELSD+ +DN+Q+ YKAG+ V VK+LK+D+++H
Sbjct  1477  SGRIKRVEPYGLFIVLDQTNMVGLCHKSELSDERVDNIQATYKAGERVTVKILKLDQEKH  1536

Query  1336  RISLGMKNSYFRDDDGEDIQTTSRQSINSTDKGNSVFIGTQSTVFPESSDADIDVSVVNT  1157
              ISLGMK+SYF  DD + +Q  S +              T S     S++   ++++ N 
Sbjct  1537  HISLGMKSSYFASDDDDKMQPASSEMPGKASMQCDDISDTDSEA---SAEIREEITIENG  1593

Query  1156  TDNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkramkkakk  977
             T  +L++VESRAS+PPLEV LD+IE  D   AV+++       D  DEK+K+RA KKAK+
Sbjct  1594  TSMVLSQVESRASVPPLEVDLDEIEQYDF--AVDQSKVQQEEEDKKDEKNKRRAKKKAKE  1651

Query  976   erereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAE  797
             ERE+EI+AAEERLLEK +P + D+FEKLVRSSP+SSF+WIKYMAF LSL DVEKARSIAE
Sbjct  1652  EREKEIQAAEERLLEKSVPASADDFEKLVRSSPSSSFIWIKYMAFTLSLADVEKARSIAE  1711

Query  796   KAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVY  617
             +A+ TINIREE EKLNVWVAYFNLE E+GNPPQ+AV KVF+RALQYCD KKV+LALLG+Y
Sbjct  1712  RALRTINIREEEEKLNVWVAYFNLENEHGNPPQDAVKKVFERALQYCDQKKVYLALLGMY  1771

Query  616   ERTEHYKLGDELLE-KMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLCLPKHKHI  440
             +RTE  +L DELL+ KM+KKFKHSCK+WLR++Q  LK N +  QS+V RAL CLP+HKHI
Sbjct  1772  DRTEQNELADELLDKKMIKKFKHSCKVWLRKVQQLLKGNGEGIQSLVTRALECLPRHKHI  1831

Query  439   KFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERA  260
             KFI+QTAI EFKCGV DRGRS+FE +L+EYPKRTDLWSVYLDQEIR+GD+DV R+LFERA
Sbjct  1832  KFISQTAIREFKCGVPDRGRSLFEGVLREYPKRTDLWSVYLDQEIRLGDVDVTRSLFERA  1891

Query  259   ISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             ISLS+PPKKMKFLFKKYL YEKS+GD+ER E VKRKAMEYVES
Sbjct  1892  ISLSLPPKKMKFLFKKYLEYEKSLGDDERAEDVKRKAMEYVES  1934



>ref|XP_006587176.1| PREDICTED: protein RRP5 homolog isoform X2 [Glycine max]
Length=1910

 Score =  2256 bits (5847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1166/1907 (61%), Positives = 1480/1907 (78%), Gaps = 38/1907 (2%)
 Frame = -2

Query  5806  KNFKRKGKNNEAGNASFSGKSAPLQLEDEVPDFPRGGA-SLLSKEELDEVRAEVDAEFEA  5630
             K FK K +      A+   ++  L LEDEVPDFPRGG  S   + + DE  AE     + 
Sbjct  26    KIFKPKKREQNIAVAAAKSEALSLPLEDEVPDFPRGGEFSAKGRNDYDEFGAE-----DP  80

Query  5629  EDRylkkkkqhklykKNQSVEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAE  5450
               +  KKKK      K+    DD GSL G+ I+GKLP+  N+IT +NI+PGMKLWGV+AE
Sbjct  81    SKKTRKKKKGKNASGKSNEAADDWGSLSGNGITGKLPRRVNKITLRNITPGMKLWGVVAE  140

Query  5449  VNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLD  5270
             VNEKD+VVSLPGGLRGLV AS+A DP++D++   +E+   +LSG+F VGQLVSC+VL LD
Sbjct  141   VNEKDLVVSLPGGLRGLVHASDAVDPIFDDK---IEVGEIFLSGVFCVGQLVSCVVLRLD  197

Query  5269  DDKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFL  5090
             DDKKE G  KIWLSLRL+LLHKN  LD +QEG++L+AY+KS EDHGYILHFGLP F GFL
Sbjct  198   DDKKEKGSRKIWLSLRLSLLHKNYNLDVVQEGMVLAAYVKSIEDHGYILHFGLPFFMGFL  257

Query  5089  PIHSQSV--DKMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPG  4916
             P +S +    ++  G+L++G+V+S+D+ RKVVYLSS PD I K VTKDL+G+SIDLLVPG
Sbjct  258   PKNSSAGWGGEVKIGKLLQGLVRSIDKVRKVVYLSSDPDTITKSVTKDLRGLSIDLLVPG  317

Query  4915  MMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDP  4736
             M+VNA V S+LENGVMLSFLTYFTGTVD+FHLQ ++P  +WKD   +++KV +RILFIDP
Sbjct  318   MLVNACVKSILENGVMLSFLTYFTGTVDLFHLQNIYPGKNWKDKCSESQKVVSRILFIDP  377

Query  4735  ATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYI  4556
             ++RAVGL+LNPHLV  +APPS VK+GDI++ +KV+RVD+GLGLLLE+PS P PTPA+V I
Sbjct  378   SSRAVGLTLNPHLVQNRAPPSHVKIGDIYDNSKVVRVDRGLGLLLEVPSIPEPTPAFVSI  437

Query  4555  SdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVV  4376
             SD+ ++  K  +  +K G  VRVR+LG R LEG+ATG LK SA E  VFTHSDVKPGMVV
Sbjct  438   SDIAEEIPKLEK-KYKEGNHVRVRILGLRYLEGIATGVLKASALEEEVFTHSDVKPGMVV  496

Query  4375  KAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRIT  4196
             KAK+++VDSFGAIVQ   GVKALCPLRHMSE EI KP KKF+VG+ELVFRVLGCKSKR+T
Sbjct  497   KAKILSVDSFGAIVQIPGGVKALCPLRHMSELEISKPGKKFKVGAELVFRVLGCKSKRVT  556

Query  4195  VTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDP  4016
             VTHKKTLVKSKL I+SSY DAT+GLITHGWITKIE HGCFVRFYNGVQGFAPRSELGL+P
Sbjct  557   VTHKKTLVKSKLGIISSYADATDGLITHGWITKIEVHGCFVRFYNGVQGFAPRSELGLEP  616

Query  4015  GSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTP  3836
             G+D  ++Y+V Q VKCRV+S  PASR+I LSF  +P  +SE +MV  G++VSG V+ +T 
Sbjct  617   GADPGTVYNVGQAVKCRVISCIPASRRINLSFIIKPTSVSEDDMVTLGSLVSGAVDRITS  676

Query  3835  DSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSA  3656
             +++VV VN      +GT+S +HL+DH G A LM SVLKPGY FDQLLVLD++G NL+LSA
Sbjct  677   NAVVVYVN-ASGFSRGTISMEHLADHHGQAILMHSVLKPGYNFDQLLVLDVKGNNLILSA  735

Query  3655  KYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYD  3476
             K SLI  AQQ+P D+NQI P+SVVHGY+CN+I +G FVRFLG LTGF+PR+KA DD++ +
Sbjct  736   KSSLIKHAQQIPADINQIHPNSVVHGYICNLIESGCFVRFLGHLTGFAPRNKAADDQKSN  795

Query  3475  TSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDS  3296
               E +YIGQSV +NI +V+ ETGR+T+SLKQ+ CSSTDA+FIQ+YFL++ KIA+L+   S
Sbjct  796   ILEAYYIGQSVRSNISNVSSETGRVTLSLKQTACSSTDASFIQDYFLMDDKIARLEYCGS  855

Query  3295  ADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQ  3116
               S   W +GF +G + +GKV  +++ G+V++FE Y+DVFGFI+  QL G  +E+GS ++
Sbjct  856   GASDTKWDEGFNIGMVAKGKVKAVEDVGLVISFEHYNDVFGFIANYQLAGTILESGSIVE  915

Query  3115  AAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIV  2936
             A V+DV K + LV+L+LKPEF+N SK +++  +T KKKR+REA KDL ++Q+VNAVVEIV
Sbjct  916   ALVLDVGKADKLVELTLKPEFINRSK-ESSISRTNKKKRRREASKDLVLHQTVNAVVEIV  974

Query  2935  KENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLL  2756
             KENYLVLS+P  +Y +GYAS++D+N Q  P KQ+ NGQSV+AT+MALP   T GRLLLL+
Sbjct  975   KENYLVLSIPENDYTIGYASVSDYNAQRFPHKQYQNGQSVVATVMALPSPETSGRLLLLV  1034

Query  2755  KAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDN  2576
               ++E + SS   + K +    VG+LV+AEITDIK LEL+LKFG G +GR+HITE    N
Sbjct  1035  DVVNETSSSSKRTKKKSSYK--VGTLVEAEITDIKTLELKLKFGFGLYGRIHITEVYYGN  1092

Query  2575  TTEGPLNDFRIGQTLTARIVSKDSRSE-NKRGYQWELSTKPSVLAG--DMDGPHESFNYS  2405
               E P + +++GQT+TARIV+K + S+ N++G QWELS +P ++ G  D+D   E+  + 
Sbjct  1093  VLENPFSSYKVGQTVTARIVAKPNESDGNRKGSQWELSVRPEMVTGSSDIDDVSENLEFK  1152

Query  2404  TGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILS  2225
              GQ ++GYV+KV+SEW WLTISR VRAQLYILDS+ EPSEL++FQ R++VG+ VSG+ILS
Sbjct  1153  IGQCVAGYVYKVESEWVWLTISRNVRAQLYILDSATEPSELEDFQNRYHVGQPVSGHILS  1212

Query  2224  ANKEKKLLRLV--PHTLLITPEDTVPSS----ESARCHIREGSVLGGRISKILPGVGGLL  2063
              N EKKLLRLV  P + L       P +    +    ++ EG +LGGR+SKILPGVGGLL
Sbjct  1213  VNMEKKLLRLVVRPFSTLSCGTSEEPLTNVVDKDLTAYVHEGDILGGRVSKILPGVGGLL  1272

Query  2062  VQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLD  1883
             VQ+    +GKVHFTEL D WV DPLSGY E QFVKC VL+V H+VKGT HVDLSL     
Sbjct  1273  VQVGPRTYGKVHFTELADTWVPDPLSGYHEEQFVKCIVLEVSHTVKGTIHVDLSL-----  1327

Query  1882  TMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSN  1703
               +N  +S+   V++ ++ V+ I+DLHPDM V+GY+KNVT KGCFIMLSRK+DAKILLSN
Sbjct  1328  GSSNVKLSQDSAVNANSKCVEKIEDLHPDMIVKGYIKNVTSKGCFIMLSRKIDAKILLSN  1387

Query  1702  LADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGN  1523
             L++ +++ PEKEFPVGKLV G+V SVE LS RVEVTL+ S++    KS+I  L+ F  G+
Sbjct  1388  LSEQYVQEPEKEFPVGKLVIGRVTSVEPLSNRVEVTLKMSTAPNIPKSEIIDLSKFHVGD  1447

Query  1522  IISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkd  1343
             ++SG+IKR+ESFGLFI++DNTN+VGLCH+SE+SD+ I+N+++ Y+AG+ V+ ++LKVD++
Sbjct  1448  VVSGRIKRVESFGLFIAIDNTNMVGLCHISEISDNRIENIEANYRAGERVKARILKVDEE  1507

Query  1342  RHRISLGMKNSYFRDDDGEDI-QTTSRQ-SINSTDKGNSVFIGTQSTVFPESSDADIDVS  1169
             RHRISLGMKNSY R   GE + Q  S++ S      G        S++F  S   +IDV 
Sbjct  1508  RHRISLGMKNSYMR---GETVLQIPSKEESDEPIVDGMKSITSMNSSLFGTS---NIDVE  1561

Query  1168  VVNTTDNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkramk  989
                    IL++ + RA IPPL+V LDD +  D ++A +++ +H    D  +EK K+R  K
Sbjct  1562  DEINQFPILSQAQERADIPPLDVALDDFDQFDANNANSQSEEHANEEDIVNEKHKRREKK  1621

Query  988   kakkerereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKAR  809
             KAK+ERE++IRAAEERLLE D+PR  DEFE+L+RSSPNSSF WIKYM FM+S+ DVEKAR
Sbjct  1622  KAKEEREKQIRAAEERLLEDDVPRTADEFERLIRSSPNSSFTWIKYMDFMVSMADVEKAR  1681

Query  808   SIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLAL  629
             SIAE+A+ TINIREE+EKLN+W AYFNLE +YGNP +EAVMKVFQRALQY DPKKV+LAL
Sbjct  1682  SIAERALRTINIREENEKLNIWKAYFNLENKYGNPREEAVMKVFQRALQYNDPKKVYLAL  1741

Query  628   LGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLCLPKH  449
             LG+YERTE + L DELL KM KKFKHSCK+WLRRIQ  LKQN+D  Q +++RA L LPKH
Sbjct  1742  LGMYERTEQHNLADELLNKMTKKFKHSCKVWLRRIQSLLKQNKDGIQPVIDRASLSLPKH  1801

Query  448   KHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALF  269
             KHIKF +QTAILEFK G  DRGRSMFE++L+EYPKRTDLWSVYLDQEI+  D D+I ALF
Sbjct  1802  KHIKFFSQTAILEFKVGFPDRGRSMFEKILREYPKRTDLWSVYLDQEIQHKDEDIIHALF  1861

Query  268   ERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVESL  128
             ERA+SLS+PPKKMKFLFKKYL YE S GD+ERIESVKRKA+EYVESL
Sbjct  1862  ERAVSLSLPPKKMKFLFKKYLDYEMSQGDQERIESVKRKAIEYVESL  1908



>ref|XP_006587175.1| PREDICTED: protein RRP5 homolog isoform X1 [Glycine max]
Length=1911

 Score =  2256 bits (5846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1166/1908 (61%), Positives = 1480/1908 (78%), Gaps = 39/1908 (2%)
 Frame = -2

Query  5806  KNFKRKGKNNEAGNASFSGKSAPLQLEDEVPDFPRGGA-SLLSKEELDEVRAEVDAEFEA  5630
             K FK K +      A+   ++  L LEDEVPDFPRGG  S   + + DE  AE     + 
Sbjct  26    KIFKPKKREQNIAVAAAKSEALSLPLEDEVPDFPRGGEFSAKGRNDYDEFGAE-----DP  80

Query  5629  EDRylkkkkqhklykKNQSVEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAE  5450
               +  KKKK      K+    DD GSL G+ I+GKLP+  N+IT +NI+PGMKLWGV+AE
Sbjct  81    SKKTRKKKKGKNASGKSNEAADDWGSLSGNGITGKLPRRVNKITLRNITPGMKLWGVVAE  140

Query  5449  VNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLD  5270
             VNEKD+VVSLPGGLRGLV AS+A DP++D++   +E+   +LSG+F VGQLVSC+VL LD
Sbjct  141   VNEKDLVVSLPGGLRGLVHASDAVDPIFDDK---IEVGEIFLSGVFCVGQLVSCVVLRLD  197

Query  5269  DDKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFL  5090
             DDKKE G  KIWLSLRL+LLHKN  LD +QEG++L+AY+KS EDHGYILHFGLP F GFL
Sbjct  198   DDKKEKGSRKIWLSLRLSLLHKNYNLDVVQEGMVLAAYVKSIEDHGYILHFGLPFFMGFL  257

Query  5089  PIHSQSVD---KMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVP  4919
             P +S +     ++  G+L++G+V+S+D+ RKVVYLSS PD I K VTKDL+G+SIDLLVP
Sbjct  258   PKNSSAEGWGGEVKIGKLLQGLVRSIDKVRKVVYLSSDPDTITKSVTKDLRGLSIDLLVP  317

Query  4918  GMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFID  4739
             GM+VNA V S+LENGVMLSFLTYFTGTVD+FHLQ ++P  +WKD   +++KV +RILFID
Sbjct  318   GMLVNACVKSILENGVMLSFLTYFTGTVDLFHLQNIYPGKNWKDKCSESQKVVSRILFID  377

Query  4738  PATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVY  4559
             P++RAVGL+LNPHLV  +APPS VK+GDI++ +KV+RVD+GLGLLLE+PS P PTPA+V 
Sbjct  378   PSSRAVGLTLNPHLVQNRAPPSHVKIGDIYDNSKVVRVDRGLGLLLEVPSIPEPTPAFVS  437

Query  4558  ISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMV  4379
             ISD+ ++  K  +  +K G  VRVR+LG R LEG+ATG LK SA E  VFTHSDVKPGMV
Sbjct  438   ISDIAEEIPKLEK-KYKEGNHVRVRILGLRYLEGIATGVLKASALEEEVFTHSDVKPGMV  496

Query  4378  VKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRI  4199
             VKAK+++VDSFGAIVQ   GVKALCPLRHMSE EI KP KKF+VG+ELVFRVLGCKSKR+
Sbjct  497   VKAKILSVDSFGAIVQIPGGVKALCPLRHMSELEISKPGKKFKVGAELVFRVLGCKSKRV  556

Query  4198  TVTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLD  4019
             TVTHKKTLVKSKL I+SSY DAT+GLITHGWITKIE HGCFVRFYNGVQGFAPRSELGL+
Sbjct  557   TVTHKKTLVKSKLGIISSYADATDGLITHGWITKIEVHGCFVRFYNGVQGFAPRSELGLE  616

Query  4018  PGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVT  3839
             PG+D  ++Y+V Q VKCRV+S  PASR+I LSF  +P  +SE +MV  G++VSG V+ +T
Sbjct  617   PGADPGTVYNVGQAVKCRVISCIPASRRINLSFIIKPTSVSEDDMVTLGSLVSGAVDRIT  676

Query  3838  PDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLS  3659
              +++VV VN      +GT+S +HL+DH G A LM SVLKPGY FDQLLVLD++G NL+LS
Sbjct  677   SNAVVVYVN-ASGFSRGTISMEHLADHHGQAILMHSVLKPGYNFDQLLVLDVKGNNLILS  735

Query  3658  AKYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRY  3479
             AK SLI  AQQ+P D+NQI P+SVVHGY+CN+I +G FVRFLG LTGF+PR+KA DD++ 
Sbjct  736   AKSSLIKHAQQIPADINQIHPNSVVHGYICNLIESGCFVRFLGHLTGFAPRNKAADDQKS  795

Query  3478  DTSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLD  3299
             +  E +YIGQSV +NI +V+ ETGR+T+SLKQ+ CSSTDA+FIQ+YFL++ KIA+L+   
Sbjct  796   NILEAYYIGQSVRSNISNVSSETGRVTLSLKQTACSSTDASFIQDYFLMDDKIARLEYCG  855

Query  3298  SADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTI  3119
             S  S   W +GF +G + +GKV  +++ G+V++FE Y+DVFGFI+  QL G  +E+GS +
Sbjct  856   SGASDTKWDEGFNIGMVAKGKVKAVEDVGLVISFEHYNDVFGFIANYQLAGTILESGSIV  915

Query  3118  QAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEI  2939
             +A V+DV K + LV+L+LKPEF+N SK +++  +T KKKR+REA KDL ++Q+VNAVVEI
Sbjct  916   EALVLDVGKADKLVELTLKPEFINRSK-ESSISRTNKKKRRREASKDLVLHQTVNAVVEI  974

Query  2938  VKENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLL  2759
             VKENYLVLS+P  +Y +GYAS++D+N Q  P KQ+ NGQSV+AT+MALP   T GRLLLL
Sbjct  975   VKENYLVLSIPENDYTIGYASVSDYNAQRFPHKQYQNGQSVVATVMALPSPETSGRLLLL  1034

Query  2758  LKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDD  2579
             +  ++E + SS   + K +    VG+LV+AEITDIK LEL+LKFG G +GR+HITE    
Sbjct  1035  VDVVNETSSSSKRTKKKSSYK--VGTLVEAEITDIKTLELKLKFGFGLYGRIHITEVYYG  1092

Query  2578  NTTEGPLNDFRIGQTLTARIVSKDSRSE-NKRGYQWELSTKPSVLAG--DMDGPHESFNY  2408
             N  E P + +++GQT+TARIV+K + S+ N++G QWELS +P ++ G  D+D   E+  +
Sbjct  1093  NVLENPFSSYKVGQTVTARIVAKPNESDGNRKGSQWELSVRPEMVTGSSDIDDVSENLEF  1152

Query  2407  STGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYIL  2228
               GQ ++GYV+KV+SEW WLTISR VRAQLYILDS+ EPSEL++FQ R++VG+ VSG+IL
Sbjct  1153  KIGQCVAGYVYKVESEWVWLTISRNVRAQLYILDSATEPSELEDFQNRYHVGQPVSGHIL  1212

Query  2227  SANKEKKLLRLV--PHTLLITPEDTVPSS----ESARCHIREGSVLGGRISKILPGVGGL  2066
             S N EKKLLRLV  P + L       P +    +    ++ EG +LGGR+SKILPGVGGL
Sbjct  1213  SVNMEKKLLRLVVRPFSTLSCGTSEEPLTNVVDKDLTAYVHEGDILGGRVSKILPGVGGL  1272

Query  2065  LVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTL  1886
             LVQ+    +GKVHFTEL D WV DPLSGY E QFVKC VL+V H+VKGT HVDLSL    
Sbjct  1273  LVQVGPRTYGKVHFTELADTWVPDPLSGYHEEQFVKCIVLEVSHTVKGTIHVDLSL----  1328

Query  1885  DTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLS  1706
                +N  +S+   V++ ++ V+ I+DLHPDM V+GY+KNVT KGCFIMLSRK+DAKILLS
Sbjct  1329  -GSSNVKLSQDSAVNANSKCVEKIEDLHPDMIVKGYIKNVTSKGCFIMLSRKIDAKILLS  1387

Query  1705  NLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAG  1526
             NL++ +++ PEKEFPVGKLV G+V SVE LS RVEVTL+ S++    KS+I  L+ F  G
Sbjct  1388  NLSEQYVQEPEKEFPVGKLVIGRVTSVEPLSNRVEVTLKMSTAPNIPKSEIIDLSKFHVG  1447

Query  1525  NIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdk  1346
             +++SG+IKR+ESFGLFI++DNTN+VGLCH+SE+SD+ I+N+++ Y+AG+ V+ ++LKVD+
Sbjct  1448  DVVSGRIKRVESFGLFIAIDNTNMVGLCHISEISDNRIENIEANYRAGERVKARILKVDE  1507

Query  1345  dRHRISLGMKNSYFRDDDGEDI-QTTSRQ-SINSTDKGNSVFIGTQSTVFPESSDADIDV  1172
             +RHRISLGMKNSY R   GE + Q  S++ S      G        S++F  S   +IDV
Sbjct  1508  ERHRISLGMKNSYMR---GETVLQIPSKEESDEPIVDGMKSITSMNSSLFGTS---NIDV  1561

Query  1171  SVVNTTDNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkram  992
                     IL++ + RA IPPL+V LDD +  D ++A +++ +H    D  +EK K+R  
Sbjct  1562  EDEINQFPILSQAQERADIPPLDVALDDFDQFDANNANSQSEEHANEEDIVNEKHKRREK  1621

Query  991   kkakkerereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKA  812
             KKAK+ERE++IRAAEERLLE D+PR  DEFE+L+RSSPNSSF WIKYM FM+S+ DVEKA
Sbjct  1622  KKAKEEREKQIRAAEERLLEDDVPRTADEFERLIRSSPNSSFTWIKYMDFMVSMADVEKA  1681

Query  811   RSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLA  632
             RSIAE+A+ TINIREE+EKLN+W AYFNLE +YGNP +EAVMKVFQRALQY DPKKV+LA
Sbjct  1682  RSIAERALRTINIREENEKLNIWKAYFNLENKYGNPREEAVMKVFQRALQYNDPKKVYLA  1741

Query  631   LLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLCLPK  452
             LLG+YERTE + L DELL KM KKFKHSCK+WLRRIQ  LKQN+D  Q +++RA L LPK
Sbjct  1742  LLGMYERTEQHNLADELLNKMTKKFKHSCKVWLRRIQSLLKQNKDGIQPVIDRASLSLPK  1801

Query  451   HKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRAL  272
             HKHIKF +QTAILEFK G  DRGRSMFE++L+EYPKRTDLWSVYLDQEI+  D D+I AL
Sbjct  1802  HKHIKFFSQTAILEFKVGFPDRGRSMFEKILREYPKRTDLWSVYLDQEIQHKDEDIIHAL  1861

Query  271   FERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVESL  128
             FERA+SLS+PPKKMKFLFKKYL YE S GD+ERIESVKRKA+EYVESL
Sbjct  1862  FERAVSLSLPPKKMKFLFKKYLDYEMSQGDQERIESVKRKAIEYVESL  1909



>ref|XP_002322744.2| hypothetical protein POPTR_0016s06250g [Populus trichocarpa]
 gb|EEF04505.2| hypothetical protein POPTR_0016s06250g [Populus trichocarpa]
Length=1856

 Score =  2250 bits (5830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1188/1928 (62%), Positives = 1451/1928 (75%), Gaps = 136/1928 (7%)
 Frame = -2

Query  5806  KNFKRKGKNNE---AGNASFSGKSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEF  5636
             K FK K   N+   + +A     S  LQLED+VPDFPRGG S LS+ E +E+RA+VD EF
Sbjct  26    KQFKAKQTKNKKSFSNDAVVKDASIALQLEDDVPDFPRGGKSSLSQREREEIRAQVDEEF  85

Query  5635  EAEDRylkkkkqhklykKNQSVE---DDLGSLFGHSISGKLPKSANRITPKNISPGMKLW  5465
             E E+R L KK +     +N+S +   DDLGSLFG  ++GKLP+ AN+IT KNISPGMKLW
Sbjct  86    EGEERRLNKKNKKGKKFQNKSSQLSGDDLGSLFGDVLTGKLPRFANKITMKNISPGMKLW  145

Query  5464  GVIAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCI  5285
             GV+ EVNEKD+V+SLPGGLRGLV + +A DP+    T+++E+ + Y+  +   G      
Sbjct  146   GVVTEVNEKDLVISLPGGLRGLVRSVDAVDPVL---TDQIEVLTAYVKSIEDHG-----F  197

Query  5284  VLHLDDDKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPS  5105
             +LH                                                     GL S
Sbjct  198   ILHF----------------------------------------------------GLSS  205

Query  5104  FSGFLPIHSQSVDK---MNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISI  4934
             F GFLP +SQ+  +   + TGQ ++G+V  +D+TRKVVYLSS PD ++K VTKDLKGISI
Sbjct  206   FMGFLPKNSQAESRDSEVKTGQFLQGIVTKIDKTRKVVYLSSDPDTVSKCVTKDLKGISI  265

Query  4933  DLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNAR  4754
             DLL+PGMMV+A V S LENG+MLSFLTYFTGTVD+FHLQ  FP  +WKDDY +NKKV+AR
Sbjct  266   DLLIPGMMVDARVQSTLENGIMLSFLTYFTGTVDMFHLQNTFPTSNWKDDYAKNKKVSAR  325

Query  4753  ILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPT  4574
             ILFIDP+TRAVGL+LN HLVH  +PPS VKVGDI++ AKV+RVDKG+GLLLEIPS+P+PT
Sbjct  326   ILFIDPSTRAVGLTLNQHLVHNNSPPSSVKVGDIYDIAKVVRVDKGMGLLLEIPSTPLPT  385

Query  4573  PAYVYISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDV  4394
             PA+V                FK G  VRVR+LG+R+LEGLATG LK SAFEGSVFTHSDV
Sbjct  386   PAFV---------------NFKEGSNVRVRILGYRHLEGLATGILKASAFEGSVFTHSDV  430

Query  4393  KPGMVVKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGC  4214
             KPGM  +AK+I VDSFGAIVQF  GVKALCPLRHMSEFEIVKPRKKF+VG+EL FRVLGC
Sbjct  431   KPGMATRAKIIAVDSFGAIVQFPGGVKALCPLRHMSEFEIVKPRKKFKVGAELFFRVLGC  490

Query  4213  KSKRITVTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRS  4034
             KSKRITVTHKKTLVKSKL ILSSY+DAT+GLITHGWITKIEK GCFV FYNGVQGFAPRS
Sbjct  491   KSKRITVTHKKTLVKSKLPILSSYSDATDGLITHGWITKIEKPGCFVHFYNGVQGFAPRS  550

Query  4033  ELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGI  3854
             ELGL+PGSD  S Y V QVVKCRV+SS  ASR+I L            + +K G+VV+G+
Sbjct  551   ELGLEPGSDAISTYQVGQVVKCRVISSIAASRRINLK-----------DGIKMGSVVTGV  599

Query  3853  VELVTPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGF  3674
             ++ VT  S++V V N + +LKGT++T+HLSDH   A LMKSVLKPGYEFDQLLVLDIE  
Sbjct  600   IDKVTASSVIVYV-NAKDYLKGTIATEHLSDHHEHAALMKSVLKPGYEFDQLLVLDIESN  658

Query  3673  NLVLSAKYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKAT  3494
             NL LSAKYSLI +A QLP D++QI P S+VHGY+CN+I  G FVRFLG LT FSPRSKA 
Sbjct  659   NLALSAKYSLIKSASQLPSDLSQIRPQSIVHGYICNMIETGCFVRFLGNLTAFSPRSKAM  718

Query  3493  DDRRYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAK  3314
             DD+R   SE FYIGQSV +NILDVN ET RITVSLKQS CSSTDA F+QEYFL E+KIA 
Sbjct  719   DDQRSQLSEAFYIGQSVRSNILDVNNETSRITVSLKQSCCSSTDACFLQEYFLSENKIAD  778

Query  3313  LQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVE  3134
             LQS DS    L WV+GF +GS +EGK+ E KEFGVVV+FEK++DVFGF+S  QLGG  V+
Sbjct  779   LQSSDSKGRDLKWVEGFHIGSTIEGKIQESKEFGVVVSFEKHNDVFGFVSHHQLGGAMVK  838

Query  3133  TGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVN  2954
              G+ ++AAV+DV+K E LVDLSLK EF++ S+ +++N  T KKKRK E  KDLEV+Q+VN
Sbjct  839   AGANVRAAVLDVAKTERLVDLSLKLEFLDKSRDKSSNSLTHKKKRKGEMSKDLEVHQTVN  898

Query  2953  AVVEIVKENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGG  2774
             AVVEIVKENYLVLS+P  NYA+GYAS++D+NTQ +  KQF+NGQSV AT+MALP  ST G
Sbjct  899   AVVEIVKENYLVLSIPEHNYAIGYASVSDYNTQKISQKQFLNGQSVSATVMALPTPSTAG  958

Query  2773  RLLLLLKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHIT  2594
             RLLLLLK+ISEV E+SSSK+ K+ SS +VGSLVQAEIT+IKPLE+RLKFG GF GR+HIT
Sbjct  959   RLLLLLKSISEVTETSSSKKAKRKSSCNVGSLVQAEITEIKPLEMRLKFGIGFRGRIHIT  1018

Query  2593  EATDDNTTEGPLNDFRIGQTLTARIVSKDSRSENKRGYQWELSTKP-----SVLAGDMDG  2429
             E  D    E P ++FR+GQT++ARI++K  +S+NK+   W+LS KP     S +  D   
Sbjct  1019  EVNDTCLLENPFSNFRVGQTVSARIIAKAGQSDNKKSQLWDLSIKPKMLEDSCMIEDKLV  1078

Query  2428  PHESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGK  2249
             P E + +S+GQ +SGYV+KVD EWAWLTISR ++A+L++LDS+ EPSEL+EFQKRFYVGK
Sbjct  1079  PKE-YEFSSGQHVSGYVYKVDGEWAWLTISRHLKAKLFVLDSACEPSELQEFQKRFYVGK  1137

Query  2248  SVSGYILSANKEKKLLRLVPHTLLIT------------------PEDTVPSSESARCHIR  2123
             +V+G++L+ NKEK  LRL  H    +                  P D V +      HIR
Sbjct  1138  AVTGHVLNYNKEKASLRLALHPFAASQTLVDGGAPIMDDLQGNAPWDNVTA------HIR  1191

Query  2122  EGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQ  1943
             EG ++GGRISKILPGVGGLLVQ+  H+ G+VHFTEL+D WV DPLS Y EGQFVK KVL+
Sbjct  1192  EGDIVGGRISKILPGVGGLLVQLGPHIHGRVHFTELQDSWVPDPLSAYKEGQFVKSKVLE  1251

Query  1942  VGHSVKGTTHVDLSLRWTLDTMNNQNISE-HDDVHSQNRRVQDIKDLHPDMTVQGYVKNV  1766
             + H VKGT H+DLSLR +L+ M  QN +E  ++  + ++ V  I+DL PDM VQGYVKNV
Sbjct  1252  ISHPVKGTIHIDLSLRLSLNGMLGQNSAEFSNNQDAPSKHVDKIEDLQPDMVVQGYVKNV  1311

Query  1765  TPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRT  1586
             + KGCFI LSRK+DAKILLSNL++G+I+ PEKEFP+GKL+TG+V+SVE LSKR+EVTL+ 
Sbjct  1312  SSKGCFISLSRKLDAKILLSNLSEGYIDDPEKEFPIGKLLTGRVLSVEHLSKRIEVTLKK  1371

Query  1585  SSSATPRKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDN  1406
             S  +   KS+   L+    G IISG+IKR+ES+GLFI++D+TNLVGLCHVS+L  DHI N
Sbjct  1372  SGVSNASKSENSDLSRLHVGEIISGRIKRVESYGLFIALDHTNLVGLCHVSQLL-DHIGN  1430

Query  1405  VQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSYFRDDDGEDIQTTSRQSINSTDKGNSVF  1226
             ++S+YKAG+ V  K+LKVD++R RISLGMKN   RDD     + +  +   +    +S  
Sbjct  1431  IESKYKAGEKVTAKILKVDEERRRISLGMKNLDVRDDMNSSKEESDEEKSENESMDDS--  1488

Query  1225  IGTQSTVFPESS---DADIDVSVVNTTDNILTEVESRASIPPLEVPLDDIENSDIDDAVN  1055
                Q  + PESS     +IDV   N   +IL + ESRASIPPLEV LDD E+S  DD + 
Sbjct  1489  -NAQIKIIPESSLLGIHNIDVECQNER-SILAQAESRASIPPLEVALDDTEHSHPDDVLL  1546

Query  1054  KNPDHTGGADTTDekdkkramkkakkerereiraaeerlleKDIPRNTDEFEKLVRSSPN  875
             +N  H   ADT   K  K+  KK KK  E+EI AAEER LE+D PR  DEFE ++RSSPN
Sbjct  1547  QNQGHIDEADTM-VKKNKQEKKKPKKLSEQEISAAEERRLEEDEPRTADEFEMVIRSSPN  1605

Query  874   SSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQE  695
             +SF+WI YM FMLSL D+EKARSIAE+A++TINIREE EKLN+WVAYFNLE EYGNPP++
Sbjct  1606  NSFLWIAYMRFMLSLADIEKARSIAERALNTINIREEDEKLNIWVAYFNLENEYGNPPED  1665

Query  694   AVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWA  515
             AV KVFQRALQYCDPKKVHLALL +Y++T   KL +ELL+KM+KKFKHSCK WL+R++W 
Sbjct  1666  AVKKVFQRALQYCDPKKVHLALLKMYKKTNQNKLAEELLDKMIKKFKHSCKFWLKRVKWL  1725

Query  514   LKQNQDNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTD  335
             LKQ QD  QS+V RALLCLP+HKHIKFI+QTAI EFKCGVADRGR++FE +L+EYPKRTD
Sbjct  1726  LKQKQDGVQSVVQRALLCLPRHKHIKFISQTAIREFKCGVADRGRTLFEEILREYPKRTD  1785

Query  334   LWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKR  155
             LWSVYLDQEI++GD+DVIR+LFERAISLS+PPKKMKFLFKKYL YEKS GDE++IESVK+
Sbjct  1786  LWSVYLDQEIKLGDVDVIRSLFERAISLSLPPKKMKFLFKKYLEYEKSYGDEKQIESVKQ  1845

Query  154   KAMEYVES  131
             KAMEYV++
Sbjct  1846  KAMEYVQN  1853



>ref|XP_006587177.1| PREDICTED: protein RRP5 homolog isoform X3 [Glycine max]
Length=1907

 Score =  2248 bits (5826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1166/1908 (61%), Positives = 1476/1908 (77%), Gaps = 43/1908 (2%)
 Frame = -2

Query  5806  KNFKRKGKNNEAGNASFSGKSAPLQLEDEVPDFPRGGA-SLLSKEELDEVRAEVDAEFEA  5630
             K FK K +      A+   ++  L LEDEVPDFPRGG  S   + + DE  AE     + 
Sbjct  26    KIFKPKKREQNIAVAAAKSEALSLPLEDEVPDFPRGGEFSAKGRNDYDEFGAE-----DP  80

Query  5629  EDRylkkkkqhklykKNQSVEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAE  5450
               +  KKKK      K+    DD GSL G+ I+GKLP+  N+IT +NI+PGMKLWGV+AE
Sbjct  81    SKKTRKKKKGKNASGKSNEAADDWGSLSGNGITGKLPRRVNKITLRNITPGMKLWGVVAE  140

Query  5449  VNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLD  5270
             VNEKD+VVSLPGGLRGLV AS+A DP++D++   +E+   +LSG+F VGQLVSC+VL LD
Sbjct  141   VNEKDLVVSLPGGLRGLVHASDAVDPIFDDK---IEVGEIFLSGVFCVGQLVSCVVLRLD  197

Query  5269  DDKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFL  5090
             DDKKE G  KIWLSLRL+LLHKN  LD +QEG++L+AY+KS EDHGYILHFGLP F GFL
Sbjct  198   DDKKEKGSRKIWLSLRLSLLHKNYNLDVVQEGMVLAAYVKSIEDHGYILHFGLPFFMGFL  257

Query  5089  PIHSQSVD---KMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVP  4919
             P +S +     ++  G+L++G+V+S+D+ RKVVYLSS PD I K VTKDL+G+SIDLLVP
Sbjct  258   PKNSSAEGWGGEVKIGKLLQGLVRSIDKVRKVVYLSSDPDTITKSVTKDLRGLSIDLLVP  317

Query  4918  GMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFID  4739
             GM+VNA V S+LENGVMLSFLTYFTGTVD+FHLQ ++P  +WKD   +++KV +RILFID
Sbjct  318   GMLVNACVKSILENGVMLSFLTYFTGTVDLFHLQNIYPGKNWKDKCSESQKVVSRILFID  377

Query  4738  PATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVY  4559
             P++RAVGL+LNPHLV  +APPS VK+GDI++ +KV+RVD+GLGLLLE+PS P PTPA+V 
Sbjct  378   PSSRAVGLTLNPHLVQNRAPPSHVKIGDIYDNSKVVRVDRGLGLLLEVPSIPEPTPAFVS  437

Query  4558  ISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMV  4379
             ISD+ ++  K  +  +K G  VRVR+LG R LEG+ATG LK SA E  VFTHSDVKPGMV
Sbjct  438   ISDIAEEIPKLEK-KYKEGNHVRVRILGLRYLEGIATGVLKASALEEEVFTHSDVKPGMV  496

Query  4378  VKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRI  4199
             VKAK+++VDSFGAIVQ   GVKALCPLRHMSE EI KP KKF+VG+ELVFRVLGCKSKR+
Sbjct  497   VKAKILSVDSFGAIVQIPGGVKALCPLRHMSELEISKPGKKFKVGAELVFRVLGCKSKRV  556

Query  4198  TVTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLD  4019
             TVTHKKTLVKSKL I+SSY DAT+GLITHGWITKIE HGCFVRFYNGVQGFAPRSELGL+
Sbjct  557   TVTHKKTLVKSKLGIISSYADATDGLITHGWITKIEVHGCFVRFYNGVQGFAPRSELGLE  616

Query  4018  PGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVT  3839
             PG+D  ++Y+V Q VKCRV+S  PASR+I LSF  +P  +SE +MV  G++VSG V+ +T
Sbjct  617   PGADPGTVYNVGQAVKCRVISCIPASRRINLSFIIKPTSVSEDDMVTLGSLVSGAVDRIT  676

Query  3838  PDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLS  3659
              +++VV VN      +GT+S +HL+DH G A LM SVLKPGY FDQLLVLD++G NL+LS
Sbjct  677   SNAVVVYVN-ASGFSRGTISMEHLADHHGQAILMHSVLKPGYNFDQLLVLDVKGNNLILS  735

Query  3658  AKYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRY  3479
             AK SLI  AQQ+P D+NQI P+SVVHGY+CN+I +G FVRFLG LTGF+PR+KA DD++ 
Sbjct  736   AKSSLIKHAQQIPADINQIHPNSVVHGYICNLIESGCFVRFLGHLTGFAPRNKAADDQKS  795

Query  3478  DTSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLD  3299
             +  E +YIGQSV +NI +V+ ETGR+T+SLKQ+ CSSTDA+FIQ+YFL++ KIA+L+   
Sbjct  796   NILEAYYIGQSVRSNISNVSSETGRVTLSLKQTACSSTDASFIQDYFLMDDKIARLEYCG  855

Query  3298  SADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTI  3119
             S  S   W +GF +G + +GKV  +++ G+V++FE Y+DVFGFI+  QL G  +E+GS +
Sbjct  856   SGASDTKWDEGFNIGMVAKGKVKAVEDVGLVISFEHYNDVFGFIANYQLAGTILESGSIV  915

Query  3118  QAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEI  2939
             +A V+DV K + LV+L+LKPEF+N SK +++  +T KKKR+REA KDL ++Q+VNAVVEI
Sbjct  916   EALVLDVGKADKLVELTLKPEFINRSK-ESSISRTNKKKRRREASKDLVLHQTVNAVVEI  974

Query  2938  VKENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLL  2759
             VKENYLVLS+P  +Y +GYAS++D+N Q  P KQ+ NGQSV+AT+MALP   T GRLLLL
Sbjct  975   VKENYLVLSIPENDYTIGYASVSDYNAQRFPHKQYQNGQSVVATVMALPSPETSGRLLLL  1034

Query  2758  LKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDD  2579
             +  ++E + SS   + K +    VG+LV+AEITDIK LEL+LKFG G +GR+HITE    
Sbjct  1035  VDVVNETSSSSKRTKKKSSYK--VGTLVEAEITDIKTLELKLKFGFGLYGRIHITEVYYG  1092

Query  2578  NTTEGPLNDFRIGQTLTARIVSKDSRSE-NKRGYQWELSTKPSVLAG--DMDGPHESFNY  2408
             N  E P + +++GQT+TARIV+K + S+ N++G QWELS +P ++ G  D+D   E+  +
Sbjct  1093  NVLENPFSSYKVGQTVTARIVAKPNESDGNRKGSQWELSVRPEMVTGSSDIDDVSENLEF  1152

Query  2407  STGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYIL  2228
               GQ ++GYV+KV+SEW WLTISR VRAQLYILDS+ EPSEL++FQ R++VG+ VSG+IL
Sbjct  1153  KIGQCVAGYVYKVESEWVWLTISRNVRAQLYILDSATEPSELEDFQNRYHVGQPVSGHIL  1212

Query  2227  SANKEKKLLRLV--PHTLLITPEDTVPSS----ESARCHIREGSVLGGRISKILPGVGGL  2066
             S N EKKLLRLV  P + L       P +    +    ++ EG +LGGR+SKILPGVGGL
Sbjct  1213  SVNMEKKLLRLVVRPFSTLSCGTSEEPLTNVVDKDLTAYVHEGDILGGRVSKILPGVGGL  1272

Query  2065  LVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTL  1886
             LVQ+    +GKVHFTEL D WV DPLSGY E QFVKC VL+V H+VKGT HVDLSL    
Sbjct  1273  LVQVGPRTYGKVHFTELADTWVPDPLSGYHEEQFVKCIVLEVSHTVKGTIHVDLSL----  1328

Query  1885  DTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLS  1706
                 + N+    D  S  + V+ I+DLHPDM V+GY+KNVT KGCFIMLSRK+DAKILLS
Sbjct  1329  ---GSSNVKLSQD--SAVKCVEKIEDLHPDMIVKGYIKNVTSKGCFIMLSRKIDAKILLS  1383

Query  1705  NLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAG  1526
             NL++ +++ PEKEFPVGKLV G+V SVE LS RVEVTL+ S++    KS+I  L+ F  G
Sbjct  1384  NLSEQYVQEPEKEFPVGKLVIGRVTSVEPLSNRVEVTLKMSTAPNIPKSEIIDLSKFHVG  1443

Query  1525  NIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdk  1346
             +++SG+IKR+ESFGLFI++DNTN+VGLCH+SE+SD+ I+N+++ Y+AG+ V+ ++LKVD+
Sbjct  1444  DVVSGRIKRVESFGLFIAIDNTNMVGLCHISEISDNRIENIEANYRAGERVKARILKVDE  1503

Query  1345  dRHRISLGMKNSYFRDDDGEDI-QTTSRQ-SINSTDKGNSVFIGTQSTVFPESSDADIDV  1172
             +RHRISLGMKNSY R   GE + Q  S++ S      G        S++F  S   +IDV
Sbjct  1504  ERHRISLGMKNSYMR---GETVLQIPSKEESDEPIVDGMKSITSMNSSLFGTS---NIDV  1557

Query  1171  SVVNTTDNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkram  992
                     IL++ + RA IPPL+V LDD +  D ++A +++ +H    D  +EK K+R  
Sbjct  1558  EDEINQFPILSQAQERADIPPLDVALDDFDQFDANNANSQSEEHANEEDIVNEKHKRREK  1617

Query  991   kkakkerereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKA  812
             KKAK+ERE++IRAAEERLLE D+PR  DEFE+L+RSSPNSSF WIKYM FM+S+ DVEKA
Sbjct  1618  KKAKEEREKQIRAAEERLLEDDVPRTADEFERLIRSSPNSSFTWIKYMDFMVSMADVEKA  1677

Query  811   RSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLA  632
             RSIAE+A+ TINIREE+EKLN+W AYFNLE +YGNP +EAVMKVFQRALQY DPKKV+LA
Sbjct  1678  RSIAERALRTINIREENEKLNIWKAYFNLENKYGNPREEAVMKVFQRALQYNDPKKVYLA  1737

Query  631   LLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLCLPK  452
             LLG+YERTE + L DELL KM KKFKHSCK+WLRRIQ  LKQN+D  Q +++RA L LPK
Sbjct  1738  LLGMYERTEQHNLADELLNKMTKKFKHSCKVWLRRIQSLLKQNKDGIQPVIDRASLSLPK  1797

Query  451   HKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRAL  272
             HKHIKF +QTAILEFK G  DRGRSMFE++L+EYPKRTDLWSVYLDQEI+  D D+I AL
Sbjct  1798  HKHIKFFSQTAILEFKVGFPDRGRSMFEKILREYPKRTDLWSVYLDQEIQHKDEDIIHAL  1857

Query  271   FERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVESL  128
             FERA+SLS+PPKKMKFLFKKYL YE S GD+ERIESVKRKA+EYVESL
Sbjct  1858  FERAVSLSLPPKKMKFLFKKYLDYEMSQGDQERIESVKRKAIEYVESL  1905



>ref|XP_004514152.1| PREDICTED: protein RRP5 homolog [Cicer arietinum]
Length=1907

 Score =  2219 bits (5751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1164/1900 (61%), Positives = 1454/1900 (77%), Gaps = 46/1900 (2%)
 Frame = -2

Query  5776  EAGNASFSGKSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqh  5597
             E  +A    KS  LQLEDEVPDFPRGG   L +   D        +F  EDR  K  K  
Sbjct  33    EQNDAVVKSKSLALQLEDEVPDFPRGGEFSLKRSSNDH------EKFGDEDRTKKVWKTK  86

Query  5596  kl-------ykKNQSVEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEK  5438
             K          K+   E + GSL G  I+GKLP+  NRIT KNI+PGMKLWGV+ EVN K
Sbjct  87    KKGKNVVGKSDKSDDFESEWGSLSGDGITGKLPRRVNRITLKNIAPGMKLWGVVGEVNNK  146

Query  5437  DIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKK  5258
             D+V+SLPGGLRG+V AS+A DP++  +T   E+  ++LSG F VGQLVSCIVL LDDDKK
Sbjct  147   DLVISLPGGLRGIVNASDALDPIFGKKT---EVGESFLSGAFCVGQLVSCIVLRLDDDKK  203

Query  5257  EAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHS  5078
             E G  KIWLSLRL+LLHKN  LD IQEG++L+AY+KS EDHGYILHFGLPSF+GFLP   
Sbjct  204   EKGTRKIWLSLRLSLLHKNFNLDVIQEGMVLAAYVKSIEDHGYILHFGLPSFTGFLPKEG  263

Query  5077  QSVDKMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNAS  4898
              +  ++  G+ V+G+VKS+D+ RKVVY+SS  D ++K VTKDLKG+SIDLLVPGMMVNA 
Sbjct  264   LA-GEVRIGKHVQGLVKSIDKVRKVVYMSSGSDTLSKSVTKDLKGMSIDLLVPGMMVNAR  322

Query  4897  VMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVG  4718
             V S+LENGVMLSFLTYFTGTVD+FHLQ  +   +W D Y +++K+ ARILFIDP++RAVG
Sbjct  323   VKSILENGVMLSFLTYFTGTVDLFHLQNTYSAANWTDKYVESQKIIARILFIDPSSRAVG  382

Query  4717  LSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddk  4538
             L+LNPHLV  +APPS VK+GDI++ +KV+RVDKG GLLLE+PS P  TPA+V ISD+ + 
Sbjct  383   LTLNPHLVQNRAPPSHVKIGDIYDNSKVVRVDKGSGLLLEVPSIPESTPAFVSISDIAEG  442

Query  4537  evkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVIT  4358
             E+KK+EK +K G  VRVR+LG R+LEGLATG LK SA E +VFTHSDVKPGMVVKAK+++
Sbjct  443   EIKKLEKKYKEGNHVRVRILGLRHLEGLATGVLKASALEEAVFTHSDVKPGMVVKAKILS  502

Query  4357  VDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKT  4178
             VDSFGAIVQ   GVKALCPLRHMSE EI KP KKFQVG+ELVFRVLG KSKR+TVTHKKT
Sbjct  503   VDSFGAIVQIPGGVKALCPLRHMSELEIAKPGKKFQVGAELVFRVLGFKSKRVTVTHKKT  562

Query  4177  LVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISS  3998
             LVKSKL I+SS+ D T+GLITHGWITKIE HGCFVRFYNGVQGFAPRSELGL+PG+D  +
Sbjct  563   LVKSKLGIISSFADVTDGLITHGWITKIEDHGCFVRFYNGVQGFAPRSELGLEPGADPGA  622

Query  3997  MYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVN  3818
             +Y+V QVVKCRV+SS PASR+I LSF  +P R+SE ++V  G++VSGIV+ VT +++VV+
Sbjct  623   VYNVGQVVKCRVISSIPASRRINLSFIIKPTRVSEDDVVTLGSIVSGIVDRVTSNAVVVS  682

Query  3817  VNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLIS  3638
             +N+     +GT+S +HL+DH G A  +K+VLKPG+ FDQLLVLD  G N++LSAK SLI 
Sbjct  683   INS-SGFSRGTISMEHLADHHGQATFLKTVLKPGFNFDQLLVLDFRGNNIILSAKSSLIK  741

Query  3637  TAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFY  3458
              AQQ+P D+ Q+ P+SVVHGY+CN+I  G FVRFLG+LTGFSPR+KA DD++ +  E +Y
Sbjct  742   YAQQIPADIIQMHPNSVVHGYICNIIETGCFVRFLGQLTGFSPRNKAADDQKTNILEAYY  801

Query  3457  IGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLN  3278
             IGQSV  N+ +++ ETGR+TVSLKQ+ CSS DA+FIQ+YFL++ KIAKLQ    + S   
Sbjct  802   IGQSVRCNVSNISSETGRVTVSLKQTSCSSADASFIQDYFLMDEKIAKLQYTSPSASDSK  861

Query  3277  WVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDV  3098
             W + F +G++ +G+V ++K+ G+VV FEKY+DVFGFI+  QLGG  VE GS ++A V+DV
Sbjct  862   WDENFNIGTVAKGRVEDVKDVGIVVCFEKYNDVFGFITNYQLGGTVVEKGSVVEAFVLDV  921

Query  3097  SKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLV  2918
             ++ E LVDL+LKPEF+N S  +++   T+KKKR+REA  DL ++Q+VNAVVEIVKE+YLV
Sbjct  922   ARAERLVDLTLKPEFINRSGERSSITHTKKKKRQREALNDLVLHQTVNAVVEIVKESYLV  981

Query  2917  LSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEV  2738
             +S+P  NY +GYA  +D+NTQ  P KQFV GQSV+AT+MALP   T GRLLLLL   +EV
Sbjct  982   VSIPENNYTIGYAPSSDYNTQGFPRKQFVTGQSVVATVMALPSPETSGRLLLLL---NEV  1038

Query  2737  AEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPL  2558
               +SSSKR KK SSY VGSLV+AEIT+IK  EL+LKFG G HGRVHITE  D N  E P 
Sbjct  1039  NGTSSSKRTKKKSSYQVGSLVEAEITEIKTFELKLKFGFGLHGRVHITEVHDANVMENPF  1098

Query  2557  NDFRIGQTLTARIVSKDSRSENKRGYQ-WELSTKPSVLAGDM---DGPHESFNYSTGQLL  2390
             + ++IGQT+ ARIV+K + +++KR    WELS +P ++ G     D   E  ++ TGQ +
Sbjct  1099  SGYKIGQTVKARIVAKPNEADSKRNTSGWELSVRPELITGSSDIGDNISEKLDFKTGQQV  1158

Query  2389  SGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEK  2210
             +GYV+KV+SEW WL +SR VRA L+I DSS EP+EL++FQ R++VGK +SG++LS N EK
Sbjct  1159  AGYVYKVESEWVWLAVSRNVRAHLHIFDSSTEPNELRDFQNRYHVGKPISGHVLSINLEK  1218

Query  2209  KLLRLVPHTLLITPEDTVPS-----SESARCHIREGSVLGGRISKILPGVGGLLVQIDAH  2045
             KLLRLV       P  T+       ++    +I +G +LGGRISK L GVGGLLVQI  +
Sbjct  1219  KLLRLVLRPFSAIPVRTIEPQINVVNKDLTAYIHKGDILGGRISKKLLGVGGLLVQIGPY  1278

Query  2044  LFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQN  1865
              FGKVHFTEL D WV DPLSGY EGQFVKC VL+V  +V+GT HVDLSLR +       +
Sbjct  1279  TFGKVHFTELTDKWVPDPLSGYDEGQFVKCVVLEVSDTVRGTVHVDLSLRSSNVIPLQGS  1338

Query  1864  ISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFI  1685
                H + H++++RV+ I+DLHPDM V+GYVK V+PKGCF++LSRK++A++LLSNL+D ++
Sbjct  1339  ADVHSNAHAKDKRVEKIEDLHPDMVVKGYVKVVSPKGCFVLLSRKIEARVLLSNLSDQYV  1398

Query  1684  ESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGKI  1505
                EKEFPVGKLV G+VVSVE LS RVEVTL+TS+ ++  KS+I  +  F  G++ISG+I
Sbjct  1399  TDLEKEFPVGKLVIGRVVSVEPLSNRVEVTLKTSTVSSTSKSEISDMGKFQVGDVISGRI  1458

Query  1504  KRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISL  1325
             KR+ESFGLF+++DNTN VGLCH+SELSD+HI+N++++Y AG+ V   +LKVD++RHRISL
Sbjct  1459  KRVESFGLFVAIDNTNTVGLCHISELSDNHIENIEAKYGAGEKVNAIILKVDEERHRISL  1518

Query  1324  GMKNSYFRDDDGEDIQTTSRQ--SINSTDKGNSVFIGTQSTVFPESSDADIDVSVVNTTD  1151
             GMKNSY R   GE +  T  +  SI     G              +S  ++ V       
Sbjct  1519  GMKNSYLR---GETVVQTPLEEGSIEPIADG-----------MKSTSSTNMIVECETDQF  1564

Query  1150  NILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkramkkakker  971
              IL++ E RA IPPL+V LDD +  D+++    + +         EK K+R  KKAK+ER
Sbjct  1565  PILSQAEERAYIPPLDVALDDFDQYDVNNTNINSKELKNEEGALLEKLKRREKKKAKEER  1624

Query  970   ereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKA  791
             E++IR AEERLLE+D+PR  DEFEKLVRSSPNSSF WIKYM FM+SL DVEKARSIAE+A
Sbjct  1625  EKQIRDAEERLLEEDVPRTADEFEKLVRSSPNSSFNWIKYMDFMISLADVEKARSIAERA  1684

Query  790   VSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYER  611
             + TINIREE+EKLN+W AYFNLE +YGNP +EAVMKVFQRALQY DPKKVH+ALLG+YER
Sbjct  1685  LRTINIREENEKLNIWKAYFNLENKYGNPREEAVMKVFQRALQYNDPKKVHIALLGMYER  1744

Query  610   TEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLCLPKHKHIKFI  431
             TE + L DELL KM KKFKHSCK+WLRR+Q  L Q QD  Q +VNRALL LP+ KHIKFI
Sbjct  1745  TEQHSLADELLNKMTKKFKHSCKVWLRRVQSLLLQKQDAVQPVVNRALLSLPRRKHIKFI  1804

Query  430   TQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISL  251
             +QTAILEFK GV DRGRS+FE +L+EYPKRTDLWSVYLDQEI + D D+IRALFERAISL
Sbjct  1805  SQTAILEFKTGVPDRGRSLFEGILREYPKRTDLWSVYLDQEIHLKDEDLIRALFERAISL  1864

Query  250   SIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             S+PPKKMKFLFKKYL YEKS GDE+RIE+VKRKAMEYVES
Sbjct  1865  SLPPKKMKFLFKKYLDYEKSQGDEDRIEAVKRKAMEYVES  1904



>gb|KHN00023.1| Protein RRP5 like [Glycine soja]
Length=1892

 Score =  2217 bits (5746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1172/1924 (61%), Positives = 1475/1924 (77%), Gaps = 103/1924 (5%)
 Frame = -2

Query  5791  KGKNNEAGNASFSGKSAPL--QLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAED--  5624
             K K  E  +A  + KS  L  QLEDEVPDFPRGG      E   + R++ D EF AED  
Sbjct  32    KPKKREQNDAVVAAKSEALSLQLEDEVPDFPRGG------EFSAKGRSDYD-EFSAEDPS  84

Query  5623  -RylkkkkqhklykKNQSVEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEV  5447
              +  KKKK      K+    DD GSL G  I+GKLP+  NRIT KNI+PGMKLWGV+AEV
Sbjct  85    RKTRKKKKGRSASSKSNEGADDWGSLSGDGITGKLPRRVNRITLKNITPGMKLWGVVAEV  144

Query  5446  NEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDD  5267
             NEKD+VVSLPGGLRGLV AS+A DP++D++   +E+   +LSG+F VGQLVSC+VL LDD
Sbjct  145   NEKDLVVSLPGGLRGLVHASDAVDPIFDDK---IEVGEIFLSGVFCVGQLVSCVVLRLDD  201

Query  5266  DKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLP  5087
             DKKE G  KIWLSLRL+LLHKN  LD +QEG++L+AY+KS EDHGYILHFGLPSF GFLP
Sbjct  202   DKKEKGSRKIWLSLRLSLLHKNYNLDVVQEGMVLAAYVKSIEDHGYILHFGLPSFLGFLP  261

Query  5086  IHSQSVD---KMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPG  4916
              +S +     ++  G+L++G+V+++D+ RKVVYLSS PD ++K VTKDL+G+SIDLLVPG
Sbjct  262   KNSSAEGWGGEVKIGKLLQGLVRTIDKVRKVVYLSSDPDTMSKSVTKDLRGLSIDLLVPG  321

Query  4915  MMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDP  4736
             M+VNA V S+LENGVMLSFLTYFTGTVD+FHLQ ++P  +WKD   +++KV +RILFIDP
Sbjct  322   MLVNARVKSILENGVMLSFLTYFTGTVDLFHLQNIYPGTNWKDKCSESQKVVSRILFIDP  381

Query  4735  ATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYI  4556
             ++RAVGL+LNPHLV  +APPS VK+GDI++ +KV+RVD+GLGLLLE+PS P PTPA+V I
Sbjct  382   SSRAVGLTLNPHLVQNRAPPSHVKIGDIYDNSKVVRVDRGLGLLLEVPSIPEPTPAFVSI  441

Query  4555  SdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVV  4376
             SD+ ++EV+K+EK +  G  VRVR+LG R LEG+ATG LK SA E  VFTHSDVKPGMVV
Sbjct  442   SDIAEEEVQKLEKKYNEGNRVRVRILGLRYLEGIATGVLKASALEEEVFTHSDVKPGMVV  501

Query  4375  KAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRIT  4196
             KAK+++VDSFGAIVQ   GVKALCPLRHMSE EI KP KKF+VG+ELVFRVLGCKSKR+T
Sbjct  502   KAKILSVDSFGAIVQIPGGVKALCPLRHMSELEISKPGKKFKVGAELVFRVLGCKSKRVT  561

Query  4195  VTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPR------S  4034
             VTHKKTLVKSKL I+SSY DAT+GLITHGWITKIE HGCFVRFYNGVQGFAPR      S
Sbjct  562   VTHKKTLVKSKLGIISSYADATDGLITHGWITKIEVHGCFVRFYNGVQGFAPRQVSIYLS  621

Query  4033  ELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGI  3854
             ELGL+PG+D  ++Y+V QVVKCRV+S  PASR+I LSF  +P R+SE +MV  G++VSG+
Sbjct  622   ELGLEPGADPGTVYNVGQVVKCRVISCIPASRRINLSFIIKPTRVSEDDMVTLGSLVSGV  681

Query  3853  VELVTPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGF  3674
             V+ +T +++VV V N     +GT+S +HL+DH G A LM S LKPGY FDQLLVLD++G 
Sbjct  682   VDRITSNAVVVYV-NASGFSRGTISMEHLADHHGQAILMHSRLKPGYNFDQLLVLDVKGN  740

Query  3673  NLVLSAKYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKAT  3494
             NL+LSAK SLI  AQQ+P D+NQI P+SVVHGY+CN+I +G FVRFLG LTGF+PR+KA 
Sbjct  741   NLILSAKSSLIKHAQQIPADINQIHPNSVVHGYICNLIESGCFVRFLGHLTGFAPRNKAA  800

Query  3493  DDRRYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAK  3314
             DD++ +  E +YIGQSV +NI +V+ ETGR+T+SLKQ+ CSSTDA+FIQ+YFL++ KIAK
Sbjct  801   DDQKSNILEAYYIGQSVRSNISNVSSETGRVTLSLKQTACSSTDASFIQDYFLMDDKIAK  860

Query  3313  LQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVE  3134
             LQ   S  S   W +GF +G + +GKV ++++ G+ ++FEK++DVFGFI+  QL G  +E
Sbjct  861   LQYWGSGASDSKWDEGFNIGMVAKGKVKDVEDVGLAISFEKHNDVFGFIANYQLAGTILE  920

Query  3133  TGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVN  2954
             +GS ++A V+DV+K + LV+L+LKPEF+N SK +++   T KK                 
Sbjct  921   SGSVVEALVLDVAKADKLVELTLKPEFINRSK-ESSTSHTNKK-----------------  962

Query  2953  AVVEIVKENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGG  2774
                        VLS+P  +Y +GYAS++D+N Q  P KQ+ NGQSV+AT+MALP   T G
Sbjct  963   -----------VLSIPENDYTIGYASVSDYNAQRFPHKQYQNGQSVVATVMALPSPETSG  1011

Query  2773  RLLLLLKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHIT  2594
             RLLLL    +EV  +SSSKR KK SSY VG+LV+AEITDIK LEL+LKFG G HGR+HIT
Sbjct  1012  RLLLL---PNEVNGTSSSKRTKKKSSYKVGTLVEAEITDIKTLELKLKFGFGLHGRIHIT  1068

Query  2593  EATDDNTTEGPLNDFRIGQTLTARIVSKDSRSE-NKRGYQWELSTKPSVLAG--DMDGPH  2423
             E  + +  E P + +++GQT+TARIV+K + S+ N++G QWELS +  ++ G  D+D   
Sbjct  1069  EVQNGSVLENPFSCYKVGQTVTARIVAKPNESDGNRKGSQWELSVRSEMVTGSSDIDDVS  1128

Query  2422  ESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSV  2243
             E+  +  G+ ++GYV+KV+SEW WLTISR VRAQLYILDS+ EPSEL++FQ R++VG+ V
Sbjct  1129  ENLEFKIGRCVAGYVYKVESEWIWLTISRNVRAQLYILDSAIEPSELEDFQNRYHVGQPV  1188

Query  2242  SGYILSANKEKKLLRLVPHTLLITPEDTVPSSESARCHI-----------REGSVLGGRI  2096
             SG++LS N EKKLLRLV     + P  T+P   S   HI            EG +LGGR+
Sbjct  1189  SGHVLSVNMEKKLLRLV-----VRPFSTLPCGTSEEPHINVVDKGLTAHFHEGDILGGRV  1243

Query  2095  SKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTT  1916
             SKILP VGGLLVQ+    +GKVHFTEL D  V DPLSGY EGQFVKC VL+V H+VKGT 
Sbjct  1244  SKILPSVGGLLVQVGPRTYGKVHFTELADTLVPDPLSGYHEGQFVKCVVLEVSHTVKGTI  1303

Query  1915  HVDLSLRWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLS  1736
             HVDLSLR +     N  +S+   V++ ++ V+ I+DLHPDM V+GY+KNVTPKGCFIMLS
Sbjct  1304  HVDLSLRSS-----NVKLSQDSAVNANSKCVEKIEDLHPDMIVKGYIKNVTPKGCFIMLS  1358

Query  1735  RKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSD  1556
             RK+DAKILLSNL++ +++  EKEFP+GKLV G+V+SVE LS RVEVTL+TS+     KS+
Sbjct  1359  RKIDAKILLSNLSEQYVQELEKEFPIGKLVIGRVISVEPLSNRVEVTLKTSTDPNIPKSE  1418

Query  1555  IDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQT  1376
             I  L+ F  G++ISG+IKR+ESFGLFI++DNTN+VGLCHVSE+SD+ I+N+++ Y+AG+ 
Sbjct  1419  IIDLSKFHVGDVISGRIKRVESFGLFIAIDNTNMVGLCHVSEISDNRIENIEANYRAGER  1478

Query  1375  vrvkvlkvdkdRHRISLGMKNSYFRD---------DDGEDIQTTSRQSINSTDKGNSVFI  1223
             V  ++LKVD++RHRISLGMKNSY RD         ++ ++  T   +SI S    NS  +
Sbjct  1479  VNARILKVDEERHRISLGMKNSYMRDETMLQIPSEEESDEPITDGMKSITSM---NSSLL  1535

Query  1222  GTQSTVFPESSDADIDVSVVNTTDNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPD  1043
             GT          ++IDV        IL++V+ RA IPPL+VPLDD +  D+++  +++ +
Sbjct  1536  GT----------SNIDVEDEINQFPILSQVQQRADIPPLDVPLDDFDQFDVNNTNSQSEE  1585

Query  1042  HTGGADTTDekdkkramkkakkerereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFV  863
             H    D  +EK K+R  KKAK+ERE++IRAAEERLLE D+PR  DEFEKL+RSSPNSSF 
Sbjct  1586  HANEEDIVNEKHKRREKKKAKEEREKQIRAAEERLLEDDVPRTADEFEKLIRSSPNSSFT  1645

Query  862   WIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMK  683
             WIKYM FM+S+ DVEKARSIAE+A+ TINIREE+EKLN+W AYFNLE +YGNP +EAVMK
Sbjct  1646  WIKYMDFMVSMVDVEKARSIAERALRTINIREENEKLNIWKAYFNLENKYGNPREEAVMK  1705

Query  682   VFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQN  503
             VFQRALQY DPKKV+LALLG+YERTE + L DELL KM KKFKHSCK+WLRRIQ  LKQN
Sbjct  1706  VFQRALQYNDPKKVYLALLGMYERTEQHNLADELLNKMTKKFKHSCKVWLRRIQSLLKQN  1765

Query  502   QDNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSV  323
             QD  Q +++RA L LPKHKHIKF +QTAILEFK GV DRGRSMFE++L+EYPKRTDLWSV
Sbjct  1766  QDGIQPVIDRASLSLPKHKHIKFFSQTAILEFKVGVLDRGRSMFEKILREYPKRTDLWSV  1825

Query  322   YLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAME  143
             YLDQEI+  D D+IRALFERA+SLS+PPKKMKFLFKKYL YEKS GDEERIESVKRKAME
Sbjct  1826  YLDQEIQHKDKDIIRALFERAVSLSLPPKKMKFLFKKYLYYEKSQGDEERIESVKRKAME  1885

Query  142   YVES  131
             YVES
Sbjct  1886  YVES  1889



>gb|KGN54856.1| hypothetical protein Csa_4G553660 [Cucumis sativus]
Length=1922

 Score =  2217 bits (5744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1166/1922 (61%), Positives = 1478/1922 (77%), Gaps = 48/1922 (2%)
 Frame = -2

Query  5806  KNFKRKGKNNEAGNASFSGKSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAE  5627
             K+ KR   + +  + +   ++  LQ+ED+VPDFPRGG   +S+ + ++VRAE D EF+ +
Sbjct  16    KHSKRPFNSKKKMSETAKPETVSLQIEDDVPDFPRGGGGYMSQNKGEKVRAEGDKEFQND  75

Query  5626  DRylkkkkqhklykKNQSVEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEV  5447
             D      K+ K  +K+ S  DDL SL  + + G LPK AN+IT KNI+P MK WGV+AEV
Sbjct  76    D-LKMTTKRGKKRRKHPSNGDDLESLLNNGVVGNLPKYANKITLKNINPRMKFWGVVAEV  134

Query  5446  NEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDD  5267
             N+KD+V+SLPGGLRGLV A+EA DP+ + E  + E   + L  +FHVGQLV C+VL +DD
Sbjct  135   NKKDLVISLPGGLRGLVSAAEAFDPILEKEVEDTE--HDLLPVMFHVGQLVPCVVLKVDD  192

Query  5266  DKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLP  5087
             DKKE+GK KIWLSLRL++L+K+ TLD +QEG++L++Y+KS EDHGYILHFGL SF+GFLP
Sbjct  193   DKKESGKRKIWLSLRLSILYKDFTLDLLQEGMVLTSYVKSIEDHGYILHFGLTSFTGFLP  252

Query  5086  I---HSQSVDKMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPG  4916
                   QS ++++ GQL++ VV+S+D+TRKVVY SS  D ++  V KDLKGISIDLL+PG
Sbjct  253   KTKQSDQSENEVHVGQLLQCVVRSIDKTRKVVYFSSDQDIVSSSVAKDLKGISIDLLIPG  312

Query  4915  MMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDP  4736
             MMV+A V S LENG++LSFLTYF GTVD+FHLQ  F   +WKD Y QN K+NARILFIDP
Sbjct  313   MMVSARVQSTLENGILLSFLTYFNGTVDMFHLQNSFHSSNWKDFYNQNMKMNARILFIDP  372

Query  4735  ATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYI  4556
             +TRAVGL+L PHLV  KA P  V++GDI++ AKV+RVD+G GLLLE+PSSP  TP +V +
Sbjct  373   STRAVGLTLIPHLVRNKAAPPHVRIGDIYDSAKVVRVDRGFGLLLEVPSSPESTPTFVSV  432

Query  4555  SdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVV  4376
             SD+ ++ VKK+ K FK G  VRVR+LGFR+LEGLA G+LK SAFEG VF++SDVKPG ++
Sbjct  433   SDMAEEVVKKIGKKFKEGSRVRVRILGFRHLEGLAIGTLKASAFEGPVFSYSDVKPGTLI  492

Query  4375  KAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRIT  4196
             +AKVI VD FGAIVQF  G+KALCPL HMSEFEI KPRKKF+VG+EL+FRVLGCKSKRIT
Sbjct  493   RAKVIVVDDFGAIVQFPGGLKALCPLSHMSEFEIAKPRKKFKVGAELIFRVLGCKSKRIT  552

Query  4195  VTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDP  4016
             VTHKKTLVKSKL++LSSY DAT GL+THGWITKIEKHGCFVRFYNGVQGFAPR ELG++P
Sbjct  553   VTHKKTLVKSKLEVLSSYADATAGLVTHGWITKIEKHGCFVRFYNGVQGFAPRFELGIEP  612

Query  4015  GSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTP  3836
             GSD SS YH+ QV+KCR+ SS+ +S++I LSF  +P R+SE   V+ G +V+G+V+ +T 
Sbjct  613   GSDPSSTYHIGQVIKCRITSSTHSSKRISLSFVMKPARVSEDTKVELGCIVTGVVDEITE  672

Query  3835  DSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSA  3656
               + + +N    + +G +ST+HLSDH+  A  +KSVLKPGY+FDQLLVL IEG +L+LSA
Sbjct  673   THVTLYINR-TDYSRGRISTEHLSDHQAHASSIKSVLKPGYQFDQLLVLAIEGESLILSA  731

Query  3655  KYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYD  3476
             K SLI  A  LP D + ++P+S++HG++CN+I  G FVRFLGRLTGFSPR+KA  D++ D
Sbjct  732   KQSLIKLAHMLPSDSSHVNPYSIIHGFICNIIEAGCFVRFLGRLTGFSPRNKAMQDQKLD  791

Query  3475  TSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDS  3296
               E +YIGQSV +N++DV+GETGRIT+SLKQS C STDA+FIQE+F  E KIAKLQSLD 
Sbjct  792   LRETYYIGQSVRSNVVDVSGETGRITLSLKQSTCFSTDASFIQEFFSTEEKIAKLQSLDE  851

Query  3295  ADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQ  3116
             +    NW + F +GS+VEG+V E+K+ GV ++FEKY DVFGFI+   L G  VETGSTIQ
Sbjct  852   S----NWAEEFAIGSVVEGEVQEVKDIGVTISFEKYHDVFGFIALHGLSGSIVETGSTIQ  907

Query  3115  AAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIV  2936
             AAV+DVSK E LVDLSLKPE V+  K  +++ +T +KKRK EA KDLE+NQ+V+ VVE V
Sbjct  908   AAVLDVSKTERLVDLSLKPELVDKWKGGSSSRQTNRKKRKAEAPKDLEMNQTVHTVVEAV  967

Query  2935  KENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLL  2756
             KENYLVLS+P   +A+GYAS  D+NTQ L  K F  GQSV+AT++ALP  ST GRLLLLL
Sbjct  968   KENYLVLSLPEFGHAIGYASTYDYNTQRLHQKHFTVGQSVVATVVALPCPSTFGRLLLLL  1027

Query  2755  KAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEA--TD  2582
             K+ISE   +  SKR +KNSS +VGSLV AEI D++PLE+RLKFG G  GR+H+TE   T 
Sbjct  1028  KSISEAIVTPGSKRSRKNSSCEVGSLVHAEIIDVQPLEMRLKFGVGLRGRIHVTEVSNTP  1087

Query  2581  DNTTEGPLNDFRIGQTLTARIVSKDSRSENK-RGYQWELSTKPSVL----AGDMDGPHES  2417
             D  +E P ++FR+GQT+ ARIV++ + S +K +GY WELS KP VL    A   +  +E 
Sbjct  1088  DEASEAPFSNFRVGQTVVARIVAEANHSASKGKGYLWELSVKPEVLKDFSAVGGEIVNED  1147

Query  2416  FNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSG  2237
               +S GQ ++ YV  V+ +WAWL ++R V AQL+ILDSS+EPSEL+EF K FYVGK+VSG
Sbjct  1148  LGFSIGQRVTAYVSNVNGDWAWLAVTRRVSAQLFILDSSSEPSELQEFSKHFYVGKAVSG  1207

Query  2236  YILSANKEKKLLRLVPHTLLITPE----------DTVPSSESAR--CHIREGSVLGGRIS  2093
             YI +   EKK+LRLV H L                 +P+    +  CH+ EG ++GGRIS
Sbjct  1208  YISNIIGEKKILRLVLHHLSAISSGKSDEENSKISNLPTDVCKKVICHLNEGDIVGGRIS  1267

Query  2092  KILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTH  1913
             KILPGVGGLLVQI  HLFG+VH+TEL D  V DPLSGY EGQFVKCKV+++ H+VKGTTH
Sbjct  1268  KILPGVGGLLVQIGPHLFGRVHYTELTDCLVPDPLSGYKEGQFVKCKVIEITHAVKGTTH  1327

Query  1912  VDLSLRWTLDTMNNQNI--SEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIML  1739
             +DLSLR +   +  +NI  S H+++ S   +++DI   H  M VQGYVKN++PKGCFIML
Sbjct  1328  IDLSLRSSAGILCQKNIECSNHENIASGRVKIEDI---HAHMEVQGYVKNISPKGCFIML  1384

Query  1738  SRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKS  1559
             SR ++AKILLSNL+DG+I++PEKEFP GKLV G+++SVE LSKRVEVTL++ +     + 
Sbjct  1385  SRGLEAKILLSNLSDGYIDNPEKEFPTGKLVRGRILSVEPLSKRVEVTLKSVTETGALRG  1444

Query  1558  DIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQ  1379
               + L +FSAG+IISG+IKR+ESFGLFIS+DNT++VGLCHVSE+SDD +++++ RY AG 
Sbjct  1445  SNNDLRSFSAGDIISGRIKRVESFGLFISIDNTDVVGLCHVSEVSDDPVESLEFRYHAGD  1504

Query  1378  TvrvkvlkvdkdRHRISLGMKNSYFRDDDGEDIQTTSRQSINSTDKGNSVFIG-TQSTVF  1202
             TV+ KVLKVD+ RHRI+LGMK SY   +  E       +  ++ D  N  FIG T+ ++ 
Sbjct  1505  TVKAKVLKVDEKRHRIALGMKRSYI-GERSELCTNMEEEHEDAADGDN--FIGETRLSMD  1561

Query  1201  PESSDADIDVSVVNTTDNILTE-----VESRASIPPLEVPLDDIENSDIDDAVNKNPDHT  1037
             P+SS +     + +  DNI  E      ESRA +P LEV LDDI+ +D+    ++N + T
Sbjct  1562  PDSS-STKFKDMDDDFDNIEPEQPLRLAESRALVPSLEVTLDDIDETDMVTLQSENKELT  1620

Query  1036  GGADTTDekdkkramkkakkerereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWI  857
              G D+ + K+ +R  KKAK+ERE E+RAAEERLL+ + P   DEFEKLVRSSPNSSFVWI
Sbjct  1621  SGTDSKE-KNDRREKKKAKEEREMEVRAAEERLLQNNSPTTVDEFEKLVRSSPNSSFVWI  1679

Query  856   KYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVF  677
             KYM F  +  DVEKARSIAE+A+ TINIREE+EKLNVW+AYFNLE EYGNP ++AV K+F
Sbjct  1680  KYMDFFKA--DVEKARSIAERALRTINIREENEKLNVWLAYFNLENEYGNPKEDAVTKIF  1737

Query  676   QRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQD  497
             QRALQ  DPKKVHLALLG+YERT    L DELL+KM+K+FKHSCK+WLRR++   K+ Q 
Sbjct  1738  QRALQCNDPKKVHLALLGMYERTNQDNLADELLDKMIKRFKHSCKVWLRRMESLFKKKQV  1797

Query  496   NSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYL  317
               QSIVNRALLCLPK KHIK+I+QTAILEFKCGVADRGRSMFE +L+EYPKRTDLWS+YL
Sbjct  1798  EIQSIVNRALLCLPKRKHIKYISQTAILEFKCGVADRGRSMFEGILREYPKRTDLWSIYL  1857

Query  316   DQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYV  137
             DQEIR+GD D+IRALFERAISLS+ PKKMKFLFKKYL YEKSVGDEERIESVK+KA+EYV
Sbjct  1858  DQEIRLGDKDMIRALFERAISLSLAPKKMKFLFKKYLEYEKSVGDEERIESVKQKALEYV  1917

Query  136   ES  131
             E+
Sbjct  1918  EN  1919



>ref|XP_008442208.1| PREDICTED: LOW QUALITY PROTEIN: protein RRP5 homolog [Cucumis 
melo]
Length=1918

 Score =  2212 bits (5731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1145/1901 (60%), Positives = 1452/1901 (76%), Gaps = 47/1901 (2%)
 Frame = -2

Query  5749  KSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhklykKNQSV  5570
             ++  LQ+ED+VPDFPRGG   +S+ + ++VRA+ D EF+ +D     KK+ K  +K+ S 
Sbjct  34    ETVSLQIEDDVPDFPRGGGGYISQNKGEKVRAQGDKEFQNDD-XADDKKRGKKRRKHPSN  92

Query  5569  EDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLA  5390
              DDL SL  + + G LPK AN+IT KNI+P MK WGV+AEVN+KD+V+SLPGGLRGLV A
Sbjct  93    GDDLESLLNNGVVGNLPKYANKITLKNINPRMKFWGVVAEVNKKDLVISLPGGLRGLVSA  152

Query  5389  SEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLALL  5210
             ++A DP+  NE  + E   + L  +FHVGQLV C+VL +DDDKKE+GK KIWLSLRL++L
Sbjct  153   ADAFDPILQNEIEDTE--HDLLPVMFHVGQLVPCVVLQVDDDKKESGKRKIWLSLRLSIL  210

Query  5209  HKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPI---HSQSVDKMNTGQLVE  5039
             +K+ TLD +QEG++L++Y+KS EDHGYILHFGL SF+GFLP      QS ++++ GQL++
Sbjct  211   YKDFTLDLLQEGMVLTSYVKSIEDHGYILHFGLTSFTGFLPKTKQSDQSGNEVHVGQLLQ  270

Query  5038  GVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSF  4859
              VV+S+D+TRKVVY SS  D ++  V KDLKGISIDLL+PGMMV+A V S LENG++LSF
Sbjct  271   CVVRSIDKTRKVVYFSSDQDIVSSSVAKDLKGISIDLLIPGMMVSARVQSTLENGILLSF  330

Query  4858  LTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAP  4679
             LTYF GTVD+FHLQ  F   +WKD Y QN K+NARILFIDP+TRAVGL+L PHLV  KA 
Sbjct  331   LTYFNGTVDMFHLQNSFHSSNWKDSYNQNMKMNARILFIDPSTRAVGLTLIPHLVRNKAA  390

Query  4678  PSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGK  4499
             P  V++GDI++ AKV+RVD+G GLLLE+ SSP  TP +V +SD+ ++ VKK+ K FK G 
Sbjct  391   PPHVRIGDIYDSAKVVRVDRGSGLLLEVASSPESTPTFVSVSDMAEEVVKKIGKKFKEGS  450

Query  4498  VVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSG  4319
              VRVR+LGFR+LEG A G+LK SAFEG VF++SDVKPG +++AKVI VD FGAIVQF  G
Sbjct  451   RVRVRILGFRHLEGFAIGTLKASAFEGPVFSYSDVKPGTLIRAKVIVVDDFGAIVQFPGG  510

Query  4318  VKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSYT  4139
             +KALCPL HMSEFEI KPRKKF+VG+EL+FRVLGCKSKRITVTHKKTLVKSKL++LSSY 
Sbjct  511   LKALCPLSHMSEFEIAKPRKKFKVGAELIFRVLGCKSKRITVTHKKTLVKSKLEVLSSYA  570

Query  4138  DATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVV  3959
             DAT GL+THGWITKIEKHGCFVRFYNGVQGFAPR ELG++PGSD SS YH+ QV+KCR+ 
Sbjct  571   DATAGLVTHGWITKIEKHGCFVRFYNGVQGFAPRFELGIEPGSDPSSTYHIGQVIKCRIT  630

Query  3958  SSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTVS  3779
             SS+P+S++I LSF  +P R+SE   V  G +V+G+V+ +T   + + +N    + +G +S
Sbjct  631   SSTPSSKRISLSFVMKPARVSEDTKVDLGCIVTGVVDEITETHVTLYINR-TGYSRGRIS  689

Query  3778  TQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQIS  3599
             T+HLSDH+  A LMK+VLKPGY+FDQLLVLDIEG +L+LSAK SLI  A  LP D + + 
Sbjct  690   TEHLSDHQAHASLMKAVLKPGYQFDQLLVLDIEGESLILSAKQSLIKLAHMLPSDSSHVH  749

Query  3598  PHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVN  3419
             P S++HG++CN+I  G FVRFLGRLTGFSPR+KA +D++ D  E +YIGQSV + I+DV+
Sbjct  750   PDSIIHGFICNIIEVGCFVRFLGRLTGFSPRNKAMEDQKLDLREAYYIGQSVRSKIVDVS  809

Query  3418  GETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEG  3239
             GETGRIT+SLKQS C STDA+FIQE+F  E KIAKLQSLD +    NW +GF +GS+VEG
Sbjct  810   GETGRITLSLKQSTCFSTDASFIQEFFSTEEKIAKLQSLDES----NWAEGFAIGSVVEG  865

Query  3238  KVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKP  3059
             +V E+K+ GV ++FEKY DVFGFI+   L G  VETGSTIQAAV+DVSK E LVDLSLKP
Sbjct  866   EVQEVKDIGVTISFEKYHDVFGFIALHGLSGSTVETGSTIQAAVLDVSKTERLVDLSLKP  925

Query  3058  EFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGYA  2879
             E V     ++++ +T +KKR  EA   LE+NQ+V+ VVE VKENYLVLS+P   YA+GYA
Sbjct  926   ELVGKWMGKSSSRQTNRKKRMAEALTHLEMNQAVHTVVEAVKENYLVLSLPEFGYAIGYA  985

Query  2878  SLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkkns  2699
             S+ D+NTQ +  KQF  GQSV+AT++ALP  ST GRLLLLLK+ISE   +  SKR +KNS
Sbjct  986   SMYDYNTQRIHQKQFTVGQSVVATVVALPCPSTFGRLLLLLKSISETIVTPGSKRSRKNS  1045

Query  2698  SYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEA--TDDNTTEGPLNDFRIGQTLTA  2525
             S +VGSLV AEI D++PLE+RLKFG G  GR+H+TE   T D  +E P ++FR+GQT+ A
Sbjct  1046  SCEVGSLVHAEIIDVQPLEMRLKFGVGLRGRIHVTEVSNTPDEASEAPFSNFRVGQTVVA  1105

Query  2524  RIVSKDSRSENKRGYQWELSTKPSVLAGDMDG-----PHESFNYSTGQLLSGYVFKVDSE  2360
             R+V  D  +   +GY WELS KP VL  D  G      +E   +S GQ ++ YV  V+ +
Sbjct  1106  RVV--DHSANKGKGYLWELSVKPEVLK-DFSGVGGEIVNEDLGFSIGQRVTAYVSNVNGD  1162

Query  2359  WAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTL  2180
             WAWL ++R+V AQL+ILDSS+EP EL+EF KRFYVG++VSGYI +   EKK+LRLV H L
Sbjct  1163  WAWLAVTRQVTAQLFILDSSSEPIELQEFSKRFYVGRAVSGYISNIIGEKKILRLVLHHL  1222

Query  2179  LITPE----------DTVPSSESAR--CHIREGSVLGGRISKILPGVGGLLVQIDAHLFG  2036
                P             +P+    +  CH+ EG ++GGRISKILPGVGGLLVQI  HLFG
Sbjct  1223  SAIPSGKSDQENLKISNLPTDVCKKIICHLNEGDIVGGRISKILPGVGGLLVQIGPHLFG  1282

Query  2035  KVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISE  1856
             +VH+TEL D  V DPL GY EGQFVKCKV+++ H+VKGTTH+DLSLR +   +  +N+  
Sbjct  1283  RVHYTELTDHLVPDPLCGYKEGQFVKCKVIEITHAVKGTTHIDLSLRSSAGILCQKNVEC  1342

Query  1855  HDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESP  1676
             ++  +  + RV+ I+D+H  M VQGYVKNV+PKGCFI+LSR ++AKILLSNL+DG+I++P
Sbjct  1343  NNHENIASGRVK-IEDIHSHMEVQGYVKNVSPKGCFILLSRGLEAKILLSNLSDGYIDNP  1401

Query  1675  EKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGKIKRI  1496
             EKEFP GKLV G+++SVE LSKRVEVTL++ +     +   + L +FSAG+IISG+IKR+
Sbjct  1402  EKEFPTGKLVRGRILSVEPLSKRVEVTLKSVTETGGLRESNNDLRSFSAGDIISGRIKRV  1461

Query  1495  ESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMK  1316
             ESFGLFIS+DNT++VGLCH+SE+SD+ I+N+  RY AG TV+ KVLKVD+ RHRI+LGMK
Sbjct  1462  ESFGLFISIDNTDVVGLCHISEVSDNSIENLDFRYHAGDTVKAKVLKVDEKRHRIALGMK  1521

Query  1315  NSYFRDDDGEDIQTTSRQSINSTDKGNSVFIG-TQSTVFPESS-----DADIDVSVVNTT  1154
              SY    +  ++ T   +       G+S FIG  + ++ P+SS     D D D + V   
Sbjct  1522  RSYI--GERSELCTNMEEEHEDAADGDS-FIGEARLSMDPDSSSTKFKDMDDDFNNVE-P  1577

Query  1153  DNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkramkkakke  974
             +  L   ESRA +P LEV LDDI+ +D+    ++N + T G D+ ++ D++   K  ++ 
Sbjct  1578  EQPLRLAESRALVPSLEVTLDDIDETDMVTLQSENKELTSGKDSKEKNDRREKKKAKEER  1637

Query  973   rereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEK  794
              +    A E  L     P   DEFEKLVRSSPNSSFVWIKYM F  +  D EKARSIAE+
Sbjct  1638  EKEVRAAEERLLQNSS-PTTVDEFEKLVRSSPNSSFVWIKYMDFFKA--DAEKARSIAER  1694

Query  793   AVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYE  614
             A+ TINIREE+EKLNVW+AYFNLE EYGNP ++AV K+FQRALQ  DPKKVHLALLG+YE
Sbjct  1695  ALRTINIREENEKLNVWLAYFNLENEYGNPKEDAVTKIFQRALQCNDPKKVHLALLGMYE  1754

Query  613   RTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLCLPKHKHIKF  434
             RT+  KL DELL+KM+K+FKHSCK+WLRR++  LK+ QD  QSIVNRALLCLPK KHIKF
Sbjct  1755  RTKQDKLADELLDKMIKRFKHSCKVWLRRMENLLKKKQDEIQSIVNRALLCLPKRKHIKF  1814

Query  433   ITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAIS  254
             I+QTAILEFKCGVADRGRSMFE +L+EYPKRTDLWS+YLDQEIR+GD D+IRALFERA S
Sbjct  1815  ISQTAILEFKCGVADRGRSMFEGILREYPKRTDLWSIYLDQEIRLGDKDMIRALFERATS  1874

Query  253   LSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             LS+ PKKMKFLFKKYL +EKS GDEERIESVK+KA+EYVE+
Sbjct  1875  LSLAPKKMKFLFKKYLEFEKSAGDEERIESVKQKALEYVEN  1915



>ref|XP_010696324.1| PREDICTED: protein RRP5 homolog [Beta vulgaris subsp. vulgaris]
Length=1896

 Score =  2191 bits (5676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1164/1915 (61%), Positives = 1462/1915 (76%), Gaps = 46/1915 (2%)
 Frame = -2

Query  5806  KNFKRKGKNNEAGNASFSGKSAP-----LQLEDEVPDFPRGGASLLSKEELDEVRAEVDA  5642
             KN KRK +       S +G +AP     LQ +D+VPDFPRGG S LS+EE DE+RA VD 
Sbjct  6     KNLKRKSREQRQNKPSKAGDTAPTQALPLQSDDDVPDFPRGGGSKLSREERDEIRAGVDE  65

Query  5641  EFEAEDRylkkkkqhklykKN-QSVEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLW  5465
             EF+A+ R  KKKK  K +K + +S +D+LGSLFG  ISGKLP+ AN+IT KN+SPGMKLW
Sbjct  66    EFDAKRRDTKKKKTGKGFKGSRKSNDDELGSLFGEGISGKLPRFANKITLKNLSPGMKLW  125

Query  5464  GVIAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCI  5285
             GVIAEVNEKD+ VSLPGGLRGLV ASEA +    +   ++E   + LS L+HVGQLVSC+
Sbjct  126   GVIAEVNEKDLAVSLPGGLRGLVRASEAVESALADNIKDLE--GHVLSALYHVGQLVSCV  183

Query  5284  VLHLDDDKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPS  5105
             VL +DDDKKE+GK ++WLSLRL+LLHK+ +LDA+QEG++L+A +KS EDHGYIL+FG+PS
Sbjct  184   VLQVDDDKKESGKRRVWLSLRLSLLHKSYSLDAVQEGMVLTANVKSIEDHGYILNFGVPS  243

Query  5104  FSGFLPIHSQSVD---KMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISI  4934
             F+GFLP  S+      K+ TGQLV+GVVKS+D+ RKVVYLSS  D ++K V KDLKGIS+
Sbjct  244   FTGFLPKKSEEDAMEFKLITGQLVQGVVKSIDKVRKVVYLSSDRDIVSKCVLKDLKGISL  303

Query  4933  DLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNAR  4754
             DLLVPGMMVNA + + LENG+MLSFLTYFTGTVD FHLQ  FP   WK  Y +NKKVNAR
Sbjct  304   DLLVPGMMVNARIQTTLENGIMLSFLTYFTGTVDKFHLQNAFPASDWKKQYEKNKKVNAR  363

Query  4753  ILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPT  4574
             ILFIDP++RAVGL++NPHL+  KAPP L+K+G+I+E +K+IRVDK  GLLLEIPS   PT
Sbjct  364   ILFIDPSSRAVGLTMNPHLLLNKAPPLLIKIGEIYEHSKIIRVDKDWGLLLEIPSPQAPT  423

Query  4573  PAYVYISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDV  4394
             PAYV ISDV D++  K+EK F+ G  VRVR+LGFR+L+GLA G +K SAFEG+VFTH+DV
Sbjct  424   PAYVTISDVADEDGIKLEKKFREGNDVRVRILGFRHLDGLAMGVMKASAFEGAVFTHADV  483

Query  4393  KPGMVVKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGC  4214
             KPGM+VKAKVI V S  AIVQF SGVKA CPLRHMSEFEI KPRKKF+VG+EL+FRVLGC
Sbjct  484   KPGMIVKAKVIAVKSQDAIVQFHSGVKASCPLRHMSEFEIEKPRKKFKVGAELIFRVLGC  543

Query  4213  KSKRITVTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRS  4034
             KSKRITVTHKKTLVKSKL ILSSY DATEGL+THGWI KI+  GC VRFYNGVQGFAPRS
Sbjct  544   KSKRITVTHKKTLVKSKLSILSSYADATEGLVTHGWIMKIDNRGCTVRFYNGVQGFAPRS  603

Query  4033  ELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGI  3854
             ELGL+PG D SS YHV+QVVKCRV S    S  I LSF   P +LSE +MVK G+VVSG+
Sbjct  604   ELGLEPGCDTSSRYHVDQVVKCRVTS---VSHGINLSFIISPTKLSEDDMVKLGSVVSGV  660

Query  3853  VELVTPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGF  3674
             VELV PD + ++VN  + ++KGT+ T+HL+DH+  +  MKSVLKPG+E  +LLVLDIEG 
Sbjct  661   VELVMPDVVFLHVNV-KGNMKGTIYTEHLADHQAQSAQMKSVLKPGHELSELLVLDIEGN  719

Query  3673  NLVLSAKYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKAT  3494
             NL+LSAKYSLI    QLP D+ Q++ +SV++GYVCN+I NG FVRFLGRLTGFSPR KA 
Sbjct  720   NLILSAKYSLIHAVPQLPADITQVTLNSVINGYVCNLIENGCFVRFLGRLTGFSPRKKAL  779

Query  3493  DDRRYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAK  3314
             DDR  + S++F++GQSV  NI ++N E+GR+T+SL+QS CSSTDA+F+Q YFL E KIA+
Sbjct  780   DDRNTNLSDIFFVGQSVRCNIAEINNESGRLTLSLRQSSCSSTDASFLQSYFLTEEKIAE  839

Query  3313  LQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVE  3134
             L   D   S  +W +   +G +VEG++ E KEFGVV++FEKY DVFGFI+  QL G   E
Sbjct  840   LHMSDLRSSKFSWPENLNIGCVVEGRISEAKEFGVVISFEKYTDVFGFITQYQLRGKTPE  899

Query  3133  TGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVN  2954
             +GST++A ++DV+K E LVDLSL+PEFV  S+   A+  T  KK+++   K+L+V+++V 
Sbjct  900   SGSTVRAVILDVAKSERLVDLSLRPEFVEKSEGD-ASKSTISKKKRKRELKELKVHETVT  958

Query  2953  AVVEIVKENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGG  2774
             AVVEIVKE YLV+S+P  N+ +GYA+  D+N Q L  KQF +GQ V+ATIMALP  ST G
Sbjct  959   AVVEIVKEGYLVVSLPEHNFTIGYAAATDYNLQRLQRKQFSSGQRVVATIMALPSDSTAG  1018

Query  2773  RLLLLLKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHIT  2594
             RLLLLL++ ++V E+SSSK+ KK S YD+GS V AEITDIKPLELRLKFG G+ GRVHIT
Sbjct  1019  RLLLLLESSNQVVETSSSKKAKKKSEYDIGSQVHAEITDIKPLELRLKFGIGYRGRVHIT  1078

Query  2593  EATDDNTTEGPLNDFRIGQTLTARIVSKDSRSEN-KRGYQWELSTKPSVLAGDMDGPH--  2423
             E  D+N  E P + +++GQTLTARIV+   + EN K+G  WELS KPS ++G        
Sbjct  1079  EVHDENVVEDPFSVYKVGQTLTARIVANCVKPENTKKGSLWELSIKPSTVSGSSLTKDVQ  1138

Query  2422  --ESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGK  2249
               E+F++S GQ +SGYV+KVD EW WL +SR+V+A+L+ILDS+ EP +L+ FQKRF VG 
Sbjct  1139  IAEAFDFSVGQHISGYVYKVDKEWVWLAVSRQVKAKLFILDSACEPGDLENFQKRFRVGA  1198

Query  2248  SVSGYILSANKEKKLLRLVPHTLLITP-------EDTVPSSESARCHIREGSVLGGRISK  2090
             ++SGYILS N+EK  LRLV H    T        ++   S E    H++ G V GGR+ +
Sbjct  1199  TLSGYILSMNREKMSLRLVMHPFSATSNGLFGGLKNCYTSDEKEVHHLQSGGVRGGRVWR  1258

Query  2089  ILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHV  1910
             ILPGVGG+LVQ+  +L+GKVH+TEL D WVSDPLSGY EGQFVKCK+L V +S  G  H+
Sbjct  1259  ILPGVGGMLVQVGPYLYGKVHYTELTDSWVSDPLSGYHEGQFVKCKILDVNNSANGNVHI  1318

Query  1909  DLSLRWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRK  1730
             DLSLR   D +            +++ R+Q I+DL  DM V GYVK++TPKGCFI+LSR 
Sbjct  1319  DLSLRSFEDAVIGD---------TRSSRIQKIEDLELDMVVNGYVKSITPKGCFILLSRH  1369

Query  1729  VDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDID  1550
             +DAKI LSNL+DG++E P KEFPVGKLV GKV+SVE LS RVEVTL+  S ++  +S++ 
Sbjct  1370  IDAKIKLSNLSDGYVEDPMKEFPVGKLVKGKVLSVEPLSGRVEVTLKVDSKSS--RSELS  1427

Query  1549  ALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvr  1370
              L   S G+++ G IKR+  FGLFI +DNTNL GLCHVSE+SDDH+DN+   ++ G  V 
Sbjct  1428  DLGCLSVGDVVKGSIKRVVPFGLFIVIDNTNLNGLCHVSEISDDHVDNLDDHFRPGGRVT  1487

Query  1369  vkvlkvdkdRHRISLGMKNSYFRDDDGEDIQTTSRQSINSTDKGNSVFIGTQSTVFPESS  1190
              KVLKVD ++HRISLGMK+SYF D+ G +        ++S D  +   +       P+ +
Sbjct  1488  AKVLKVDTEKHRISLGMKSSYFEDELGNN---HGMMEVDSVD--DPTIVAQAKADMPQIT  1542

Query  1189  DADIDVSVVNTTDNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDek  1010
              +D      +   + L +VESRAS+PPLEV LDD E+ ++    +K      G+   DEK
Sbjct  1543  HSDFLFE--HEEGSALVQVESRASVPPLEVTLDDNEDDEVFALPDKKEIIVNGSSAIDEK  1600

Query  1009  dkkramkkakkerereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSL  830
             +K++A KKAK+E+E+EI AAE+RLLE+DIPR TDEFEK+VRSSPNSSFVWIKYM FMLS+
Sbjct  1601  NKRQAKKKAKEEKEQEIMAAEQRLLERDIPRTTDEFEKVVRSSPNSSFVWIKYMQFMLSM  1660

Query  829   GDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDP  650
              DVE ARS+AE+A+ TINI  ++EKLNVWVAY NLE +YGNP +EAV K+FQRALQYCD 
Sbjct  1661  ADVEGARSVAERALKTINITCDNEKLNVWVAYLNLENQYGNPSEEAVAKLFQRALQYCDH  1720

Query  649   KKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRA  470
              K+HL LLG+YERTE +KL DELL+KMVKKFK SC++WLRRIQW LKQ  D    ++NRA
Sbjct  1721  LKLHLELLGLYERTEQHKLADELLDKMVKKFKQSCEVWLRRIQWLLKQKPDEVDKMMNRA  1780

Query  469   LLCLPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDM  290
             LL LPKH+ ++F++Q AILEFK GV D+GRS+FE+ML+EYPKR DLWSVYLDQEIR+GD+
Sbjct  1781  LLSLPKHEVVQFLSQVAILEFKNGVPDKGRSIFEKMLREYPKRRDLWSVYLDQEIRLGDV  1840

Query  289   DVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVESLA  125
             D IRALFERA S+S+P KKMKFLFKKYL +EKS+GDE+RI+ V +KA EYVE+ A
Sbjct  1841  DFIRALFERATSMSVPAKKMKFLFKKYLNFEKSLGDEKRIQYVIQKAREYVETAA  1895



>gb|KEH41780.1| pre-rRNA processing protein Rrp5 [Medicago truncatula]
Length=1911

 Score =  2191 bits (5676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1153/1906 (60%), Positives = 1466/1906 (77%), Gaps = 53/1906 (3%)
 Frame = -2

Query  5773  AGNASFSGKSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhk  5594
             +G+     +S  +QLEDEVPDFPRGG   + +   D      D +  ++  +  KKK  K
Sbjct  31    SGDVVKKSESLAMQLEDEVPDFPRGGEFKVKRSRDDYDNFGDDDD--SKKAWKTKKKGKK  88

Query  5593  lykKNQSVEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPG  5414
             ++KK+   E D G L G  I+GKLP+  NR+T KNI+PGMKLWGV+AEVN KD+VVSLPG
Sbjct  89    VFKKSDEAESDWGLLSGAGITGKLPRYVNRVTLKNIAPGMKLWGVVAEVNNKDLVVSLPG  148

Query  5413  GLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIW  5234
             GLRG+V AS+A DP++D++T   E+  ++LS +F VG+LVSCIVL LDDDKKE G  K+W
Sbjct  149   GLRGIVNASDALDPIFDDKT---EVGESFLSSVFCVGKLVSCIVLRLDDDKKEKGHRKVW  205

Query  5233  LSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDKMNT  5054
             LSLRL+LLHKN  LD +QEG++L+AY+KS EDHG+ILHFGLPSF+GFLP    +  ++  
Sbjct  206   LSLRLSLLHKNFNLDVVQEGMVLAAYVKSIEDHGFILHFGLPSFTGFLPKEGWN-GEVRI  264

Query  5053  GQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENG  4874
             GQ V+G+VKS+D+ RKVVY SS  D ++K VTKDLKG+SIDLLVPGMMVNA V SVLENG
Sbjct  265   GQHVQGLVKSIDKVRKVVYFSSDSDTMSKSVTKDLKGMSIDLLVPGMMVNARVKSVLENG  324

Query  4873  VMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLV  4694
             V+LSFLTYFTGTVD FHLQ ++P  +WKD Y +++KV  RILFIDP++RAVGL+LNPHLV
Sbjct  325   VLLSFLTYFTGTVDQFHLQNIYPATNWKDKYIESQKVVCRILFIDPSSRAVGLTLNPHLV  384

Query  4693  HKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKT  4514
               +APPS VK+GDI++ +KV+RVDKG GLLLE+PS P  TPA+V ISD+ ++E++K+EK 
Sbjct  385   QNRAPPSYVKIGDIYDNSKVVRVDKGSGLLLEVPSIPESTPAFVSISDIAEEEIQKLEKK  444

Query  4513  FKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIV  4334
             +K G  VRVR+LG R+LEGLATG LK SA E +VFTHSDVKPGMVVKAK+++VDSFGAIV
Sbjct  445   YKEGNHVRVRILGLRHLEGLATGVLKASALEEAVFTHSDVKPGMVVKAKILSVDSFGAIV  504

Query  4333  QFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDI  4154
             Q   GVKALCPLRHMSE EI KP KKF+VG+ELVFRVLGCKSKR+TVTHKKTLVKSKL+I
Sbjct  505   QIPGGVKALCPLRHMSELEIAKPGKKFKVGAELVFRVLGCKSKRVTVTHKKTLVKSKLEI  564

Query  4153  LSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVV  3974
             +SS+ D T+GLITHGWITKIE HGCFVRFYNGVQGFAPRSELGL+PG D  ++Y+V QVV
Sbjct  565   ISSFVDVTDGLITHGWITKIEDHGCFVRFYNGVQGFAPRSELGLEPGGDPGAVYNVGQVV  624

Query  3973  KCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHL  3794
             KCRVVSS PAS++I LSF  +P R+SE +MV  G++VSGIV+ VT +++VV + +     
Sbjct  625   KCRVVSSIPASKRINLSFIIKPTRVSEDDMVTLGSIVSGIVDRVTSNAVVVYIKS-SGFS  683

Query  3793  KGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLD  3614
             +GT+S +HL+DH G A LMKSVLKPGY FD+LLVLD +G N++LSAK SL+  AQQ+P D
Sbjct  684   RGTISMEHLADHHGQATLMKSVLKPGYNFDKLLVLDFKGNNMILSAKSSLVKYAQQIPAD  743

Query  3613  VNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTN  3434
             ++Q+ P+SVV G++CN+I  G FVRFLG+ TGFSPR+KA DD++ +  E +YIGQSV  N
Sbjct  744   ISQMHPNSVVQGFICNLIETGCFVRFLGQFTGFSPRNKAADDQKTNILEAYYIGQSVRCN  803

Query  3433  ILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLG  3254
             I ++NGETGR+TVSLKQ+ C S DA+FIQ+YF ++ KIAKLQ  +S+ S L W + F +G
Sbjct  804   ISNINGETGRVTVSLKQTSCCSADASFIQDYFHMDEKIAKLQYTNSSASDLKWEERFNIG  863

Query  3253  SIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVD  3074
             ++ EG+V ++K+ G+VV FEKY+DVFGFI+  QLGG  VE GS ++A V+DV+K E LVD
Sbjct  864   TVAEGRVEDVKDVGIVVCFEKYNDVFGFITNYQLGGTVVEKGSAVEAFVLDVAKAERLVD  923

Query  3073  LSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNY  2894
             L+LKPEF+N SK +++   T+KKKR+REA KDL + Q+V AVVEIVKE+YLV+S+P  NY
Sbjct  924   LTLKPEFINISK-ESSISHTKKKKRQREALKDLVLRQTVTAVVEIVKESYLVVSIPENNY  982

Query  2893  ALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskr  2714
              +GY  L+D+NTQ  P KQF+NGQSV+AT+ ALP   T GRLLLLL       E  +S  
Sbjct  983   TIGYVQLSDYNTQRFPRKQFLNGQSVVATVTALPSPETSGRLLLLLN------EVRASSS  1036

Query  2713  gkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQT  2534
              +  SSY VGSLV+AEIT+IK  EL+LKFG G HGRVHITE  D N  E P + ++IGQT
Sbjct  1037  KRTKSSYKVGSLVEAEITEIKAFELKLKFGFGLHGRVHITEVHDANLPENPFSGYKIGQT  1096

Query  2533  LTARIVSKDSRSENKR-GYQWELSTKPSVLAGD---MDGPHESFNYSTGQLLSGYVFKVD  2366
             +TARIVSK +  ++ R G +WELS +P ++ G     D   E  ++  GQ ++GYV+KV+
Sbjct  1097  VTARIVSKPNEKDSSRNGSRWELSVRPEMVTGSSDIRDNISEKLDFKIGQCVAGYVYKVE  1156

Query  2365  SEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLV--  2192
             SEW WL +SR V+AQL+ILDSS EP+EL++FQ R++VGK VSG++LS N EKKLLRLV  
Sbjct  1157  SEWVWLAVSRNVKAQLHILDSSTEPNELEDFQNRYHVGKPVSGHVLSINLEKKLLRLVLR  1216

Query  2191  PHTLLITPEDTVPS----SESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHF  2024
             P + L    +  P     ++    +I EG  LGGRISKILPGVGGLLVQI  H++GKVHF
Sbjct  1217  PFSTLPFRPNEEPQINAVNKDLTAYIHEGDSLGGRISKILPGVGGLLVQIGPHIYGKVHF  1276

Query  2023  TELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISE-HDD  1847
             TEL D WV DPLSGY +GQFVKC VL+V ++V+GT HVDLSLR + + M  Q+ ++ H +
Sbjct  1277  TELTDKWVPDPLSGYHDGQFVKCVVLEVSNTVRGTIHVDLSLRSS-NVMPLQDSADVHSN  1335

Query  1846  VHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKE  1667
              H+ ++ V+ I+DLHPDM V+GYVK V+ KGCFI+LSRK++A+ILLSNL+D F+    KE
Sbjct  1336  GHANDKCVEKIEDLHPDMVVKGYVKTVSSKGCFILLSRKIEARILLSNLSDQFVTDLVKE  1395

Query  1666  FPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGKIKRIESF  1487
             FPVGKLV G+VVSVE LS RVEVTL+TS+ ++  KS I  L  F  G++ISG IKR+E F
Sbjct  1396  FPVGKLVIGRVVSVEPLSNRVEVTLKTSTVSSSSKSVISDLGKFHVGDVISGSIKRVEPF  1455

Query  1486  GLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSY  1307
             GLFI++DNTN+VGLCHVSE+SD+HIDN+++++ AG+ V   VLKVD++RHRISLGMK+SY
Sbjct  1456  GLFIAIDNTNVVGLCHVSEISDNHIDNIEAKFGAGEKVNAIVLKVDEERHRISLGMKDSY  1515

Query  1306  FR---------DDDGEDIQTTSRQSINSTDKGNSVFIGTQSTVFPESSDADIDVSVVNTT  1154
              R         D+  ++      +SI+ST   +S  +G           +++D+      
Sbjct  1516  MRGETVLQIPLDEGSDEPIADGMKSISST---SSRLLGP----------SNMDIEYETDQ  1562

Query  1153  DNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkramkkakke  974
               IL++ E RA IPPL+V LDD +  D+++  + + +      + +EK K+R  KKAK+E
Sbjct  1563  FRILSQAEERAYIPPLDVALDDFDQFDVNNTNSYSEEAANEEGSLNEKQKRREKKKAKEE  1622

Query  973   rereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEK  794
             RE++I AAEERLLE+D+PR+ DEFEKLVR+SPNSSF WIKYM FM+SL DVEKARSIAE+
Sbjct  1623  REKQISAAEERLLEEDVPRSADEFEKLVRTSPNSSFNWIKYMDFMISLADVEKARSIAER  1682

Query  793   AVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYE  614
             A+ TIN REE+EKLN+W AYFNLE +YG+P +EA+ +VF RALQY D KKV+LALLG+YE
Sbjct  1683  ALKTINFREENEKLNIWKAYFNLENKYGDPKEEAIKQVFGRALQYHDHKKVYLALLGMYE  1742

Query  613   RTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLCLPKH-----  449
             RTE + L DELL +M KKFKHSCK+WLRR+Q  L Q +D  Q +VN AL  L  H     
Sbjct  1743  RTEQHSLADELLNEMTKKFKHSCKVWLRRVQSLLLQKKDAVQPVVNDALNALRGHKQYKD  1802

Query  448   KHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALF  269
             KHIKFI+QTAILEFK GV DRGRS+FE +L++YPKRTDLWSVYLDQEI++ D D+IRALF
Sbjct  1803  KHIKFISQTAILEFKIGVPDRGRSLFEGILRDYPKRTDLWSVYLDQEIQLKDKDLIRALF  1862

Query  268   ERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             ERAISLS+PPKKMKFLFKKYL YEKS GDEERIESVKRKAMEYVES
Sbjct  1863  ERAISLSLPPKKMKFLFKKYLDYEKSQGDEERIESVKRKAMEYVES  1908



>gb|KFK38561.1| hypothetical protein AALP_AA3G129700 [Arabis alpina]
Length=1912

 Score =  2184 bits (5658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1156/1897 (61%), Positives = 1457/1897 (77%), Gaps = 48/1897 (3%)
 Frame = -2

Query  5749  KSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhklykKNQSV  5570
             +S  +QLE EVPDFPRGG + LSK+E +++  EVDAEF+AE+R  KK K  K  K+  S 
Sbjct  37    RSEAMQLE-EVPDFPRGGGTSLSKQEREKIYEEVDAEFDAEERVSKKSKGGKSKKRITSD  95

Query  5569  EDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLA  5390
              DDLG LFG  ++GK P+ AN+IT KNISP MKL GVI EVN+KDIVVSLPGGLRGLV A
Sbjct  96    VDDLGLLFGGGLTGKRPRYANKITIKNISPEMKLLGVITEVNQKDIVVSLPGGLRGLVRA  155

Query  5389  SEAHD----PLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLR  5222
             SEA D     + D+E NE+      L  +F VGQLV CIVL +DDDKKEAGK KIWLSLR
Sbjct  156   SEASDFEDIGIEDDE-NEL------LGDIFSVGQLVPCIVLQVDDDKKEAGKRKIWLSLR  208

Query  5221  LALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDK--MNTGQ  5048
             L+LLHK  +LD+ Q G++ +A +KS EDHGYILHFGLPS +GF+ I +    +    TGQ
Sbjct  209   LSLLHKGFSLDSFQLGMVFTANVKSVEDHGYILHFGLPSVTGFIEISNDGNQESGKKTGQ  268

Query  5047  LVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVM  4868
             L++GVV  +DR RK+V+LSS PD++AK VTKDL G+S DLL+PGMMVNA V SVLENG++
Sbjct  269   LIQGVVTKIDRERKIVHLSSDPDSVAKCVTKDLNGMSFDLLIPGMMVNARVQSVLENGIL  328

Query  4867  LSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHK  4688
             L FLTYF GTVD+FHLQ      SWKD+Y QNK VNARI+F+DP++RAVGL+LNPHLV  
Sbjct  329   LDFLTYFNGTVDLFHLQNPLSNKSWKDEYNQNKTVNARIMFMDPSSRAVGLTLNPHLVSN  388

Query  4687  KAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFK  4508
             KAPP  V  G IF++AKV+RVDK  GLLLE+PS P  TPAYV   D    EVKK+E  FK
Sbjct  389   KAPPLHVSSGGIFDEAKVVRVDKS-GLLLELPSKPASTPAYVSTYDFAGDEVKKLETKFK  447

Query  4507  PGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQF  4328
              G  +RVRVLG + +EGLA G+LK SAFEG VFTHSDVKPGMV KA VI+VD+FGAIVQF
Sbjct  448   EGNRIRVRVLGLKQMEGLAIGTLKASAFEGPVFTHSDVKPGMVTKATVISVDTFGAIVQF  507

Query  4327  SSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILS  4148
               G+KA+CPLRHMSEFEI+KPRKKF+VG+ELVFRVLGCKSKRITVT+KKTLVKSKL ILS
Sbjct  508   PGGLKAMCPLRHMSEFEIMKPRKKFKVGAELVFRVLGCKSKRITVTYKKTLVKSKLPILS  567

Query  4147  SYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKC  3968
             SYTDA+EGL+THGWITKIEK+GCFVRFYNGVQGF PR +LGL+PGSD +S++HV +VVKC
Sbjct  568   SYTDASEGLVTHGWITKIEKNGCFVRFYNGVQGFVPRFDLGLEPGSDPNSVFHVGEVVKC  627

Query  3967  RVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKG  3788
             RV S+   SR+I LSF  +   +SE + +K G++VSG+++ ++P +++V V + +  LKG
Sbjct  628   RVTSAYHGSRKINLSFMIKQSSVSEDDSIKLGSIVSGVIDSISPQAVIVRVKS-KGVLKG  686

Query  3787  TVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVN  3608
             T+S +HL+DH   A LMKS L+PGYE D+LLVLDIEG NL LS+K+SL+  A++LP +++
Sbjct  687   TISAEHLADHHEQAKLMKSHLRPGYELDKLLVLDIEGNNLALSSKFSLVKLAEELPSELS  746

Query  3607  QISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNIL  3428
             Q+ P+SVVHGYVCN+I NG FVRFLGRLTGF+PRSKA D+ R D SE F++GQSV  NI 
Sbjct  747   QLQPNSVVHGYVCNLIENGCFVRFLGRLTGFAPRSKAIDEPRADLSESFFVGQSVRANIA  806

Query  3427  DVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSI  3248
             DVN E  RIT+SLKQS C+S DA+F+QEYFL + KI+ LQS D  +S  +WV+   +GS+
Sbjct  807   DVNQEKSRITLSLKQSSCASVDASFVQEYFLTDEKISNLQSSDITESECSWVEKLSIGSL  866

Query  3247  VEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLS  3068
             ++G + E+ E GV+V F+  ++V GFI    +GG  +E GS + A V+D+S+ E LVDLS
Sbjct  867   IKGTIQELNELGVMVNFDNINNVLGFIPQYHMGGATLEHGSVVHAVVLDLSREERLVDLS  926

Query  3067  LKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYAL  2888
             L+PE +N S  + +N ++ KKKRKR+  K+LEV+Q V AVVEIVKE YLVLS+P   Y +
Sbjct  927   LRPELINKSTKEVSNSQS-KKKRKRDISKELEVHQRVTAVVEIVKEQYLVLSIPEHGYTI  985

Query  2887  GYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgk  2708
             GYAS++D+NTQ LPVKQF  GQSV+A++ AL    T GRLLLLL ++S V+E+S +KR K
Sbjct  986   GYASVSDYNTQKLPVKQFSTGQSVVASVEALQSPLTSGRLLLLLDSVSGVSETSRTKRAK  1045

Query  2707  knsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLT  2528
             K SS +VGS+VQAEIT+IKP ELR+ FG GF GR+HITE  D +T E P   FR+GQ+++
Sbjct  1046  KKSSCEVGSVVQAEITEIKPFELRVNFGHGFRGRIHITEVDDGSTNEEPFAKFRVGQSMS  1105

Query  2527  ARIVSKDSRSENKRGYQWELSTKPSVLA-----GDMDGPHESFNYSTGQLLSGYVFKVDS  2363
             AR+V+K   ++ K+   WELS KP+ L       DM    E   +  GQ +SGY++KVD 
Sbjct  1106  ARVVAKPCNTDVKKSQLWELSVKPATLRDSSELNDMQ-LGEELEFVAGQCVSGYIYKVDK  1164

Query  2362  EWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHT  2183
             EW WL ISR V A+++ILD++ E  EL+EF++RF +GK+VSGY+L+ NKEKK LRLV   
Sbjct  1165  EWVWLAISRNVTARIFILDTALEARELEEFERRFPIGKAVSGYVLTYNKEKKTLRLVQRQ  1224

Query  2182  LLITPE----------DTVPSS--ESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLF  2039
             LL++ +          D V S+  + A   I EG +LGGRISKILPGVGGL VQI  ++F
Sbjct  1225  LLVSSKTIANGGDNKTDKVDSTVDDDATLFIHEGDILGGRISKILPGVGGLRVQIGPYVF  1284

Query  2038  GKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNI-  1862
             G+VHFTE+ D WVS+PL G+ EGQFVKCKVL+V  S KGT  ++LSLR +LD M++  + 
Sbjct  1285  GRVHFTEINDSWVSNPLDGFREGQFVKCKVLEVSSSSKGTVQIELSLRASLDGMSSGYLL  1344

Query  1861  SEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIE  1682
              E ++  +  +R + I+DL P+  VQGYVKN   KGCFI LSR +DAK+LLSNL D FI+
Sbjct  1345  EEFNNNDNICKRYERIEDLSPNTGVQGYVKNTMSKGCFITLSRTLDAKVLLSNLCDTFIK  1404

Query  1681  SPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGKIK  1502
              PEKEFPVGKLVTG+V++VE LSKR+EVTL+T +++   KS+   L  F  G++ISGKI+
Sbjct  1405  DPEKEFPVGKLVTGRVLNVEPLSKRIEVTLKTVNASGQTKSEAFDLKKFQVGDMISGKIR  1464

Query  1501  RIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLG  1322
             R+E +GLFI++D T +VGLCH SELSDD I +VQ+ YKAG+ V  K+LK+D+++ RISLG
Sbjct  1465  RVELYGLFIAIDQTGMVGLCHKSELSDDRIKDVQAIYKAGENVTAKILKLDEEKQRISLG  1524

Query  1321  MKNSYFRDDDGEDIQTTSRQSINSTDKGNSVFIGTQSTVFPESSDADIDVSVVNTTDNIL  1142
             MKNSYF +  G+D++  S    N  D   S+        F E+S      + +     +L
Sbjct  1525  MKNSYFIN--GDDVKPKSPSEKN--DDEASMECDNNDFSFQETSGERPSGASL-----VL  1575

Query  1141  TEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkramkkakkerere  962
             ++VESRASI PLEV L+DIE SD+D+  N N +   GAD  DEK K+R  +K K+ERE +
Sbjct  1576  SQVESRASIRPLEVDLEDIEESDLDN--NHNHEKLHGADK-DEKSKRREKQKDKEEREIK  1632

Query  961   iraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVST  782
             I+AAE RLLE   P N DEFEKLVRSSPNSSFVWIKYMAFMLSL D+EKARSIAE+A+ T
Sbjct  1633  IQAAEGRLLENHAPENADEFEKLVRSSPNSSFVWIKYMAFMLSLADIEKARSIAERALRT  1692

Query  781   INIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEH  602
             INIREE EKLN+WVAYFNLE E+G+PP+EAV KVF+RALQYCD KKV+LALLGVYERTE 
Sbjct  1693  INIREEEEKLNIWVAYFNLENEHGSPPEEAVKKVFERALQYCDKKKVYLALLGVYERTEQ  1752

Query  601   YKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLCLPKHKHIKFITQT  422
             YKL D+LL++M+KKFK SCK+WLR++Q +LKQN+++ QSIVNRALLCLP+HKHIKFI+QT
Sbjct  1753  YKLADKLLDEMIKKFKQSCKVWLRKVQSSLKQNEEDIQSIVNRALLCLPRHKHIKFISQT  1812

Query  421   AILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIP  242
             AILEFKCGVA+RGRS+FE +L+EYPKRTDLWSVYLDQEIR+G++DVIR+LFERAISLS+P
Sbjct  1813  AILEFKCGVAERGRSLFEGVLREYPKRTDLWSVYLDQEIRLGEVDVIRSLFERAISLSLP  1872

Query  241   PKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             PKKMKFLFKKYL YEKSV DEER+E VK++AMEY +S
Sbjct  1873  PKKMKFLFKKYLEYEKSVDDEERVEYVKQRAMEYADS  1909



>ref|XP_006407387.1| hypothetical protein EUTSA_v10019877mg [Eutrema salsugineum]
 gb|ESQ48840.1| hypothetical protein EUTSA_v10019877mg [Eutrema salsugineum]
Length=1926

 Score =  2183 bits (5656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1147/1899 (60%), Positives = 1454/1899 (77%), Gaps = 40/1899 (2%)
 Frame = -2

Query  5749  KSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhklykKNQSV  5570
             K+  +QLE EVPDFPRGG + LS++E +++  EVDAEF+A++R  K+ K  K  K+  + 
Sbjct  39    KAVAMQLE-EVPDFPRGGGTSLSQKEREKIYEEVDAEFDADERVSKRNKGLKPKKRTPTD  97

Query  5569  EDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLA  5390
              D+LGSLF  + +GK P+ AN+IT KNISPGMKL GV+ EVN+KDIV+SLPGGLRGLV A
Sbjct  98    VDELGSLFDGAFTGKRPRYANKITIKNISPGMKLLGVVTEVNQKDIVISLPGGLRGLVRA  157

Query  5389  SEAHDPL-WDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLAL  5213
             SEA D   +  E +E E+    L   F VGQLV CIVL LDDDKKEAGK KIWLSLRL+L
Sbjct  158   SEALDFTDFGTEDDENEL----LQDRFSVGQLVPCIVLQLDDDKKEAGKRKIWLSLRLSL  213

Query  5212  LHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDKMNTGQLVEGV  5033
             LHK  +LD+ Q G++++A +KS EDHGYILHFGLPS +GF+ I +    ++ TGQL++GV
Sbjct  214   LHKGFSLDSFQPGMVVAANVKSVEDHGYILHFGLPSITGFIKISNDGSQELKTGQLIQGV  273

Query  5032  VKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLT  4853
             V ++D  RK+V LSS PD++AK VTKDL G+S DLL+PGMMVNA V SVLENG++L FL 
Sbjct  274   VTNIDGERKIVRLSSDPDSVAKCVTKDLNGMSFDLLIPGMMVNARVQSVLENGILLGFLM  333

Query  4852  YFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPS  4673
             YFTGTVD+FHLQ      SWKD+Y Q K VNARILFIDP+TRAVGL+LNPHLV  KAPP 
Sbjct  334   YFTGTVDLFHLQNPMCNKSWKDEYNQTKMVNARILFIDPSTRAVGLTLNPHLVGNKAPPM  393

Query  4672  LVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKVV  4493
              V  GDIF++AKV+RVDK  GLLLE+PS PV TPAYV   DV + EVKK+EK FK G  +
Sbjct  394   HVSSGDIFDEAKVVRVDKS-GLLLELPSKPVSTPAYVSTYDVAEDEVKKLEKKFKEGNRI  452

Query  4492  RVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGVK  4313
             RVR+LG + LEGL  G+LK SAFEG VFTHSDVKPG+V KAK+I+VD+FGAIVQF  G+K
Sbjct  453   RVRILGLKQLEGLGIGTLKESAFEGPVFTHSDVKPGLVTKAKLISVDTFGAIVQFPGGLK  512

Query  4312  ALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSYTDA  4133
             A+CPLRHMSEFE+ KPRKKF+VG+EL+FRVLGCKSKRITVT+KKTLVKSKL ILSSY DA
Sbjct  513   AMCPLRHMSEFEVTKPRKKFKVGAELIFRVLGCKSKRITVTYKKTLVKSKLPILSSYADA  572

Query  4132  TEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSS  3953
             TEGL+THGWITKIEKHGCFVRFYNGVQGF PR ELG++PGSD +S++HV +VVKCRV S+
Sbjct  573   TEGLVTHGWITKIEKHGCFVRFYNGVQGFVPRFELGVEPGSDPNSVFHVGEVVKCRVTSA  632

Query  3952  SPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTVSTQ  3773
                +R+I LSF  +P  +SE + +K G+VVSG+++ +TP +++V V + +  LKGT+S +
Sbjct  633   VHGTRKINLSFMIKPTSVSEDDSIKLGSVVSGVIDSITPQAVIVRVKS-KGFLKGTLSAE  691

Query  3772  HLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQISPH  3593
             HL+DH   A L+ S+L+PGYE D+LLV+DIEG NL LS+KYSLI  A++LP D +Q+ P+
Sbjct  692   HLADHHEQAKLLISLLRPGYELDKLLVIDIEGNNLALSSKYSLIKLAEELPSDFSQLQPN  751

Query  3592  SVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVNGE  3413
             SVVHGYVCN+I NG FVRFLGRLTGF+PRSKA D+ R D SE F++GQSV  NI+DVN E
Sbjct  752   SVVHGYVCNLIENGCFVRFLGRLTGFAPRSKAIDEPRADLSESFFVGQSVRANIVDVNPE  811

Query  3412  TGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGKV  3233
               R+T+SLKQS C+S DA+F+QEYFL++ KI+ LQS D ++S  +WV+ F +GS+++G +
Sbjct  812   KSRVTLSLKQSSCASVDASFVQEYFLMDEKISDLQSSDISESECSWVEKFSIGSLIKGTI  871

Query  3232  HEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEF  3053
              E  + G+VV F+   +V GFI    LGG  +E GS +QA V+D+S+ E LVDLSL+PE 
Sbjct  872   QEQNDLGLVVNFDNITNVLGFIPQHHLGGATLEHGSIVQALVLDISRAERLVDLSLRPEL  931

Query  3052  VNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGYASL  2873
             +N S  + +N ++ KKKRKR+  K+LEV+Q V+AVVEIVKE YLVLS+P   YA+GYAS+
Sbjct  932   INNSTREVSNSQS-KKKRKRDISKELEVHQRVSAVVEIVKEQYLVLSIPEHGYAIGYASV  990

Query  2872  NDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkknsSY  2693
             +D+NTQ LPVKQF  GQSV+AT+ AL +  T GRLLLLL ++S ++E+S SKR KK SS 
Sbjct  991   SDYNTQKLPVKQFSTGQSVVATVEALQNPLTSGRLLLLLDSVSGISETSRSKRAKKKSSC  1050

Query  2692  DVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARIVS  2513
             +VGS+V AEIT+IKP E+R+ F   F GR+HITE  D   +E P   FRIGQ+++AR+V+
Sbjct  1051  EVGSVVHAEITEIKPFEVRVNFAQSFRGRIHITEVNDATISEEPFAKFRIGQSISARVVA  1110

Query  2512  KDSRSENKRGYQWELSTKPSVLAGDMD-----GPHESFNYSTGQLLSGYVFKVDSEWAWL  2348
             K   ++ K+   WELS KP+ L  D          E   +  G+ +SGYV+KVD EW WL
Sbjct  1111  KPCHTDIKKSQLWELSVKPATLRVDSSELNDIQVREQLEFVAGERVSGYVYKVDKEWVWL  1170

Query  2347  TISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTLLITP  2168
              ISR V A+++ILD++ E  EL+EF++RF +GK VSGY+L+ NKEKK LRLV   LL T 
Sbjct  1171  AISRNVTARIFILDTACEARELEEFERRFPIGKVVSGYVLTYNKEKKTLRLVQRPLLDTH  1230

Query  2167  E-------------DTVPSSESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVH  2027
             +             D+    + A   I EG +LGGRIS+ILP VGGL VQI  ++FG+VH
Sbjct  1231  KSIANGGGSKTDELDSTIPGDDATLFIHEGDILGGRISRILPCVGGLRVQIGPYVFGRVH  1290

Query  2026  FTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISEHDD  1847
             FTEL D WV +PL G  EGQFVKCKVL++ +S KGT  ++LSLR +LD M + +++E   
Sbjct  1291  FTELNDSWVCNPLDGLHEGQFVKCKVLEISNSSKGTLQIELSLRASLDGMGSNHLAE---  1347

Query  1846  VHSQN----RRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIES  1679
               S N    +R++ I+DL PDM +QGYVKN   KGCFIMLSR +DAK+LLSNL+D F++ 
Sbjct  1348  ASSNNVNVCKRIERIEDLSPDMGIQGYVKNTMSKGCFIMLSRTLDAKVLLSNLSDTFVKD  1407

Query  1678  PEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGKIKR  1499
             PEKEFPVGKLVTG+V++VE LSKRVEVTL+T +    +KS+   L  F  G+IISG+IKR
Sbjct  1408  PEKEFPVGKLVTGRVLNVEPLSKRVEVTLKTVNGGGQQKSESYDLKKFQVGDIISGRIKR  1467

Query  1498  IESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGM  1319
             +E +GLFI +D T +VGLCH S+LSDD I++VQ+RYKAG++V  K+LK+D+++ RISLGM
Sbjct  1468  VEPYGLFIEIDQTGMVGLCHKSQLSDDRIEDVQARYKAGESVTAKILKLDEEKRRISLGM  1527

Query  1318  KNSYFRDDDGEDIQTTSRQSINSTDKGNSVFIGTQSTVFPESSDADIDVSVV---NTTDN  1148
             K+SY  + D  + Q  S ++ N           ++S V     D     +     N T  
Sbjct  1528  KSSYLMNGDDVEAQPPSEENANEGSMECDPINDSKSRVLAAVGDFGFQETTGERHNGTSL  1587

Query  1147  ILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkramkkakkere  968
             +L +VESRASIPPLEV LDDIE SD D+  N+N +   GA+  DEK K+R  +K K+ERE
Sbjct  1588  VLAQVESRASIPPLEVDLDDIEESDFDN--NQNQEKLQGANK-DEKSKRREKQKDKEERE  1644

Query  967   reiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAV  788
             ++I+AAE RLLE   P + DEFEKLVRSSPNSSFVWIKYMAF+LSL D+EKARSIAE+A+
Sbjct  1645  KQIQAAEGRLLENHAPESADEFEKLVRSSPNSSFVWIKYMAFVLSLADIEKARSIAERAL  1704

Query  787   STINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERT  608
              TINIREE EKLN+WVAYFNLE E+G+PP+EAV KVF+RA QYCDPKKV+LALLGVYERT
Sbjct  1705  RTINIREEEEKLNIWVAYFNLENEHGSPPEEAVKKVFERARQYCDPKKVYLALLGVYERT  1764

Query  607   EHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLCLPKHKHIKFIT  428
             E YKL D+LL++M+KKFK SCK+WLR++Q  LKQ ++  QS+VNRALLCLP+HKHIKFI+
Sbjct  1765  EQYKLADKLLDEMIKKFKQSCKVWLRKVQSYLKQKEEGIQSVVNRALLCLPRHKHIKFIS  1824

Query  427   QTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLS  248
             QTAILEFKCGVADRGRS+FE +L+EYPKRTDLWSVYLDQEIR+G++DVIR+LFERAISLS
Sbjct  1825  QTAILEFKCGVADRGRSLFEGVLREYPKRTDLWSVYLDQEIRLGEVDVIRSLFERAISLS  1884

Query  247   IPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             +PPKKMKFLFKK+L YEK  GDEER+E VK++AMEY +S
Sbjct  1885  LPPKKMKFLFKKFLEYEKCAGDEERVEYVKQRAMEYADS  1923



>ref|XP_008789163.1| PREDICTED: protein RRP5 homolog [Phoenix dactylifera]
Length=1922

 Score =  2182 bits (5654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1156/1917 (60%), Positives = 1455/1917 (76%), Gaps = 37/1917 (2%)
 Frame = -2

Query  5815  KNPKNFKRKGKNNEAGNASFSGKSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEF  5636
             K  K+FK+  K      A  S   + L ++D+ PDFPRGG S+L++EE+ E RAE + EF
Sbjct  20    KPHKSFKKPRKEKTRPPAP-SELPSSLLVQDDDPDFPRGGTSVLTREEIAEARAEAEEEF  78

Query  5635  --EAEDRylkkkkqhklykKNQSVEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWG  5462
               E++     KKK+       ++V DD GSLFG+ ++GKLP+ ANRI+ KNISP MKL G
Sbjct  79    VRESKKSKGGKKKKGTKKSLAEAV-DDFGSLFGNGVTGKLPRFANRISLKNISPRMKLLG  137

Query  5461  VIAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIV  5282
             V+ EVN KD+V+ LPGGLRG V A E  D + D+     + +SN L  +FHVGQLVSCIV
Sbjct  138   VVVEVNPKDLVIGLPGGLRGYVRAEEVSDIIIDD--GNKDSKSNLLCSIFHVGQLVSCIV  195

Query  5281  LHLDDDKKEA-GKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPS  5105
             + +D DKK+  G  +IWLSLRL+LLHK LTLDA+Q+G++L+A IKS EDHGYIL+FG+ S
Sbjct  196   VRVDVDKKDGKGNRRIWLSLRLSLLHKGLTLDAVQDGMVLTAQIKSIEDHGYILYFGVSS  255

Query  5104  FSGFLPIHSQSVDKMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLL  4925
             F+GFLP   Q  D   +GQL++ VVKS+D+ R V  ++S  D ++K   KDLKG+SIDLL
Sbjct  256   FTGFLPKSEQDGDLFISGQLLQCVVKSIDKARAVAIVTSDADLVSKSAMKDLKGLSIDLL  315

Query  4924  VPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILF  4745
             VPGMMVNA V S LENG+MLSFLTYFTGTVDIFHLQ  F   +WKDDY QNKKVNARILF
Sbjct  316   VPGMMVNARVHSTLENGIMLSFLTYFTGTVDIFHLQNSFSRATWKDDYKQNKKVNARILF  375

Query  4744  IDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAY  4565
             IDP+TRAVGL+LNP++V  KAPP++V+ G+I++ + ++RVD+G+G LLE+PSSPVP PAY
Sbjct  376   IDPSTRAVGLTLNPYIVQNKAPPAIVRTGEIYDNSLILRVDRGIGFLLEVPSSPVPLPAY  435

Query  4564  VYISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPG  4385
             V ISDV D++V K+EK FK G  VRVRVLG R+L+GLA G+LK SAFEGSVFTHSDVKPG
Sbjct  436   VSISDVSDEKVTKLEKKFKEGDYVRVRVLGMRHLDGLAMGTLKASAFEGSVFTHSDVKPG  495

Query  4384  MVVKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSK  4205
             M+VKAKV  V++FGAI+QF  GVKALCPL+HMSE +I+KP KKF+VG+EL+FRVLGCKSK
Sbjct  496   MLVKAKVTAVENFGAIIQFFGGVKALCPLQHMSELDILKPPKKFKVGAELLFRVLGCKSK  555

Query  4204  RITVTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELG  4025
             RITVTHKKTLVKSKL + +SY DATEGLI HGWI KI KHGCFVRFY GVQGFA RSELG
Sbjct  556   RITVTHKKTLVKSKLPVFASYADATEGLIVHGWIAKIAKHGCFVRFYGGVQGFAQRSELG  615

Query  4024  LDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVEL  3845
             L+PG +  + YHV QVVKCRV+SS+PASR+I +SF   P R+SE ++ K G++VSG+VE 
Sbjct  616   LEPGIEADAAYHVGQVVKCRVISSAPASRRINISFVISPKRISEDDIAKLGSIVSGVVER  675

Query  3844  VTPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLV  3665
             +TP +++++VN G ++LKGT+  +HL+DH+G A L+KS+L+PGY+FDQLLVLD EG NL+
Sbjct  676   LTPAAVIIHVN-GNAYLKGTLFDEHLADHQGQAVLLKSLLRPGYQFDQLLVLDTEGQNLI  734

Query  3664  LSAKYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDR  3485
             LSAKYSLI+ A+++P D++QI P SVV+GYVCN+I NG FVRFLGRLTGFSP+ K TD +
Sbjct  735   LSAKYSLINYAKEIPSDLSQIHPLSVVNGYVCNIIENGCFVRFLGRLTGFSPKDKVTDQQ  794

Query  3484  RYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQS  3305
               + S+ FY+GQSV +++L VNGETGRI +SLKQSLCSS+D +F+Q YFLLE KIA L  
Sbjct  795   IDNLSDAFYVGQSVRSHVLTVNGETGRIKLSLKQSLCSSSDVSFVQGYFLLEEKIAALHI  854

Query  3304  LDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGS  3125
              D+ +   +W   F +GS+VEG++ +IKEFGVVV F    DV GF+   QLGGINVE GS
Sbjct  855   SDANNPDSSWTRSFSIGSLVEGEIQDIKEFGVVVNFIDNGDVVGFVPHHQLGGINVEVGS  914

Query  3124  TIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVV  2945
              I+A V+D++K + LVDLSLK E V  +    A     KKKR+R    DL+++Q+VNAVV
Sbjct  915   VIKALVLDIAKSDGLVDLSLKSELVTSACVDGA-----KKKRRRSTSTDLQLHQTVNAVV  969

Query  2944  EIVKENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLL  2765
             EIVKENYLVLS+P  NYA+GYAS+ D+N Q LP K F+NGQSV+ T+ ALP S   GRLL
Sbjct  970   EIVKENYLVLSIPEYNYAIGYASMTDYNMQKLPHKHFLNGQSVLVTVGALPSSCPSGRLL  1029

Query  2764  LLLKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEAT  2585
             LLLK+  EV+E+S SKR KK SSY VGSLV AEI DIKPLEL LKFG+GFHGR+HITE  
Sbjct  1030  LLLKSTREVSETSRSKRAKKMSSYTVGSLVAAEIIDIKPLELILKFGTGFHGRIHITEVF  1089

Query  2584  DDN-TTEGPLNDFRIGQTLTARIVSKDSRS-ENKRGYQWELSTKPSVLAGDMDG--PHES  2417
             D+N   E P + F+IGQ L ARIV+K  +S ++ +GY+WELS +PS+L G+       E 
Sbjct  1090  DNNHDMENPFSKFKIGQLLDARIVAKPEQSGKSGKGYRWELSVRPSLLTGESTKIPTAEE  1149

Query  2416  FNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSG  2237
             FN+S G ++ GYV KVD EW WLT+SR V A ++ LDSS EP EL+EFQ+R+ VG++V G
Sbjct  1150  FNFSVGSIVKGYVVKVDGEWVWLTVSRYVMAHIFFLDSSCEPGELQEFQQRYSVGQAVKG  1209

Query  2236  YILSANKEKKLLRL------------VPHTLL-ITPEDTVPSSESARCHIREGSVLGGRI  2096
              I+SANKEKKLLRL            V H ++ +  ++   S+ +   HI +G+++GG++
Sbjct  1210  KIVSANKEKKLLRLTSCLSSFVSESSVDHEIVKVDIQENRVSNVNCAEHILQGNIVGGKV  1269

Query  2095  SKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTT  1916
              +ILPGV GLLVQI  HLFGK H+TEL D WV+ PLSGY EGQFVKCK+L++  S +GT 
Sbjct  1270  KRILPGVSGLLVQIGPHLFGKAHYTELVDAWVAQPLSGYHEGQFVKCKILEITRSSEGTA  1329

Query  1915  HVDLSLRWTLDTMNNQNISEHDD-VHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIML  1739
             HVDLSLR +L  + + N +  D+ +++  +R + I+DLHP+M VQGYVK+VT KGCFIML
Sbjct  1330  HVDLSLRSSLQDIQSVNSTALDNNLNTHIKRFEKIEDLHPNMDVQGYVKSVTSKGCFIML  1389

Query  1738  SRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKS  1559
             SR +DA+ILLSNL+DG+IE+PEKEFP GKLV G+V+SV+  SKRVEVTL+T       KS
Sbjct  1390  SRMIDARILLSNLSDGYIENPEKEFPAGKLVHGRVLSVDPASKRVEVTLKTDMKTEVAKS  1449

Query  1558  DIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQ  1379
             D     N    +IISG+I+R E +GLFI++DNTN+VGLCH SELSD+ IDN+++RYKAG 
Sbjct  1450  DPGVFCNLHVSDIISGQIRRTEPYGLFIAIDNTNVVGLCHKSELSDEPIDNIETRYKAGD  1509

Query  1378  TvrvkvlkvdkdRHRISLGMKNSYFRDDDGEDIQTTSRQSINSTDKGNSVFIGTQSTVFP  1199
              V   VLKVD++RHRISLGMK SYF   +  D+   S    +      ++    Q+   P
Sbjct  1510  RVVATVLKVDEERHRISLGMKKSYF--GNASDVHIISNHGTDDDSVDGTLLALQQNDDLP  1567

Query  1198  ESSDADIDVSVVNTTDNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTT  1019
                         N    +L + E+RAS+ PL+V + D  +    D V  + +     D  
Sbjct  1568  HIEKM---FGCDNEDPAVLKQAETRASVLPLQV-VLDDSDGSDLDNVTVSQEIVNVTDMA  1623

Query  1018  DekdkkramkkakkerereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFM  839
              +K  +R  KKAK+ERE EI A+EER L+KDIP+  DE+EKLVRSSPNSSFVWIKYMAFM
Sbjct  1624  AKKSARRMKKKAKEERELEISASEERNLQKDIPKTADEYEKLVRSSPNSSFVWIKYMAFM  1683

Query  838   LSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQY  659
             LSL DVEKARSIAE+A+ TINIREE EKLN+WVAYFNLE EYG+PP+EAV K FQRALQY
Sbjct  1684  LSLADVEKARSIAERALRTINIREEGEKLNIWVAYFNLENEYGSPPEEAVKKTFQRALQY  1743

Query  658   CDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIV  479
             CDPKK+HLALLG+YERTE +KL DELLE+M KKFK+SCK+WL  +Q  +KQ +D  Q IV
Sbjct  1744  CDPKKLHLALLGMYERTEQHKLADELLERMTKKFKNSCKVWLHCVQSFMKQRKDGIQPIV  1803

Query  478   NRALLCLPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRV  299
             NRALL LP +KHIKFI+QTAILEFKCGV DRGRSMFE +L+EYPKRTDLWS+YLDQEIR+
Sbjct  1804  NRALLSLPHNKHIKFISQTAILEFKCGVPDRGRSMFEGILREYPKRTDLWSIYLDQEIRL  1863

Query  298   GDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVESL  128
             GD++VIRALFERA SLS+PPKKMKFLFKKYL YEK+ GD++RIE VK +A+EYVESL
Sbjct  1864  GDVEVIRALFERATSLSLPPKKMKFLFKKYLEYEKARGDDDRIEHVKNRALEYVESL  1920



>ref|XP_007145812.1| hypothetical protein PHAVU_007G270000g [Phaseolus vulgaris]
 gb|ESW17806.1| hypothetical protein PHAVU_007G270000g [Phaseolus vulgaris]
Length=1906

 Score =  2180 bits (5649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1136/1892 (60%), Positives = 1462/1892 (77%), Gaps = 39/1892 (2%)
 Frame = -2

Query  5764  ASFSGKSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhklyk  5585
             A+   +  PLQLEDEVPDFPRGG      E     R + D EF  E+   K KK  +   
Sbjct  37    AATKSEKLPLQLEDEVPDFPRGG------EVFANPRNDYD-EFGGENHSRKTKKNKRRKA  89

Query  5584  KNQSVE--DDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGG  5411
               +S E  DD GSL G  I+GKLP+  N+IT KNI+PGMKLWGV+AEVNEKD+VVSLPGG
Sbjct  90    LIKSNEAVDDWGSLSGEGITGKLPRRVNKITLKNITPGMKLWGVVAEVNEKDLVVSLPGG  149

Query  5410  LRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWL  5231
             LRGLV +++A DP++D+    +E+  N+L+G+F+VGQLVSC+VL LDDD KE G+ KIWL
Sbjct  150   LRGLVHSADAVDPIFDDA---IEVGENFLTGVFNVGQLVSCVVLRLDDDNKERGRRKIWL  206

Query  5230  SLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVD---KM  5060
             SLRL+LLHKN  LD +QEG++L+AY+ S EDHGYILHFG+ SF GFLP  S +     ++
Sbjct  207   SLRLSLLHKNYNLDVVQEGMVLAAYVNSIEDHGYILHFGVSSFMGFLPKDSSTEGPGGEV  266

Query  5059  NTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLE  4880
               G+L++G+V+S+D+ RKVVYLSS PD I+K +TKDL+G+SIDLLVPGMMVNA V S+LE
Sbjct  267   KIGKLLQGLVRSIDKVRKVVYLSSDPDTISKSLTKDLRGLSIDLLVPGMMVNARVKSILE  326

Query  4879  NGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPH  4700
             NGVMLSFLTYFTGTVD+FHLQ ++P  +WKD Y ++ KV +R+LFIDP++R+VGL+LNP+
Sbjct  327   NGVMLSFLTYFTGTVDLFHLQNIYPGTNWKDKYSESLKVVSRVLFIDPSSRSVGLTLNPY  386

Query  4699  LVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkme  4520
             LV  +APPS VK+GDI++ +KV+RVDKG GLLLE+PS P PTPA+V ISD+ ++E++K+E
Sbjct  387   LVLNRAPPSNVKIGDIYDDSKVVRVDKGSGLLLEVPSIPEPTPAFVSISDIAEEEIQKLE  446

Query  4519  KTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGA  4340
             K FK G  VRVR+LG R LEG+ATG LK SA E  VFTHSDVKPGMV+KAK+++VDSFGA
Sbjct  447   KKFKEGNHVRVRILGLRYLEGIATGVLKASALEEEVFTHSDVKPGMVLKAKILSVDSFGA  506

Query  4339  IVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKL  4160
             IVQ   GVKALCPLRHMSE EI KP KKF+VG+EL+FRVLGCKSKR+TVTHKKTLVKSKL
Sbjct  507   IVQIPGGVKALCPLRHMSELEISKPGKKFKVGAELIFRVLGCKSKRVTVTHKKTLVKSKL  566

Query  4159  DILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQ  3980
              I+SSY DAT+GLITHGWITKIE +GCFVRFYNGV G+APR ELGL+PG+D  ++Y+V Q
Sbjct  567   GIISSYVDATDGLITHGWITKIEVNGCFVRFYNGVHGYAPRFELGLEPGADPGTVYNVGQ  626

Query  3979  VVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQS  3800
             VVKCRV+SS PASR+I+LSF  +  R+SE  MV  G++VSG+V+ +T  +IVV V N  S
Sbjct  627   VVKCRVISSIPASRRIILSFMIKASRVSEDVMVTLGSLVSGVVDRITSVNIVVRV-NASS  685

Query  3799  HLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLP  3620
                GT+S +HL+DH G A LM  +LKPGY+FDQLLVLD++G NL+LSAK SL+  AQQ+P
Sbjct  686   FSGGTISMEHLADHHGQAILMNKLLKPGYKFDQLLVLDVKGSNLILSAKSSLVKHAQQIP  745

Query  3619  LDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVC  3440
              D+NQI P+SVV+GY+CN+I +G FVRFLG LTGF+PR+KA +D++ +  E +YIGQSV 
Sbjct  746   SDINQIQPNSVVNGYICNIIESGCFVRFLGHLTGFAPRNKAVEDQKANILEAYYIGQSVR  805

Query  3439  TNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFG  3260
             +NI +V+ ETGR+T+SLKQ  CSSTDA+FIQEYFL++ KIA +Q+LDS  S L W++GF 
Sbjct  806   SNISNVSSETGRVTLSLKQIDCSSTDASFIQEYFLMDEKIANIQNLDSGASDLKWLEGFN  865

Query  3259  LGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHL  3080
             +G++ +GKV ++ + G+V++FE+++DVFGFI+  QL G  +E+GS ++A V+DV+K E L
Sbjct  866   IGAVAKGKVKDVADVGLVLSFEEHNDVFGFITNYQLAGTVLESGSEVEALVLDVAKAERL  925

Query  3079  VDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPAC  2900
             VDL+LKPEF N SK +++  +T KKKR+RE  K+L ++Q+V AVVEIVKENY+V+S+P  
Sbjct  926   VDLTLKPEFFNSSK-ESSRSRTDKKKRRREPSKELVLHQTVKAVVEIVKENYMVVSIPEN  984

Query  2899  NYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEssss  2720
             +Y +GYAS++D+NTQ  P K + NGQSV AT+MALP   T GRLLLLL  ++E A S  S
Sbjct  985   DYLVGYASISDYNTQRFPHK-YQNGQSVTATVMALPSPETSGRLLLLLNEVNETASSKRS  1043

Query  2719  krgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIG  2540
             K+        VG+LV+AEITDI   EL++KFG G HGR+HITE  + N  + P + ++IG
Sbjct  1044  KKSSYK----VGTLVEAEITDINMFELKVKFGFGRHGRIHITEVHNGNDLKNPFSSYKIG  1099

Query  2539  QTLTARIVSK-DSRSENKRGYQWELSTKPSVLAG--DMDGPHESFNYSTGQLLSGYVFKV  2369
             QT+TARIV+K ++R+ N +G QWELS +P ++ G  D+D    +F +  GQ ++GYV+KV
Sbjct  1100  QTVTARIVAKPNARNGNWKGSQWELSVRPEMVTGSSDIDDVSGNFEFIIGQCVAGYVYKV  1159

Query  2368  DSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLV-  2192
             + EW  LTISR VRAQ+YIL S+ EPSEL+ FQKRF+VG+ VSG++LS N EK +L+LV 
Sbjct  1160  EREWVSLTISRNVRAQIYILYSATEPSELEGFQKRFHVGQHVSGHVLSFNSEKTVLQLVL  1219

Query  2191  -PHTLLITPEDTVPS----SESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVH  2027
              P   L    +  P      +    ++ EG +LGGR+SKI PGVGGL VQ+    +GKVH
Sbjct  1220  CPFLNLTCRTNEEPQYNVVDKDLTAYVHEGDILGGRVSKIFPGVGGLRVQVGPRTYGKVH  1279

Query  2026  FTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISEHDD  1847
             FTE+ D WV DPLSGY EGQFVKC VL++ H+VKG+ HV+LSLR +   ++  ++     
Sbjct  1280  FTEIADSWVPDPLSGYHEGQFVKCVVLEIIHTVKGSIHVELSLRSSSVKLSQDSVDVQSI  1339

Query  1846  VHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKE  1667
             V + ++RV+ I+DLH  M V+GY+K VTPKGCFI LSRK+DAKILLSNL++ ++E  EKE
Sbjct  1340  VDANDKRVEKIEDLHLGMIVKGYIKTVTPKGCFIFLSRKIDAKILLSNLSNQYVEELEKE  1399

Query  1666  FPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGKIKRIESF  1487
             FP+GKLVTG+V+SVE LS RVEVTL+TS      KSDI   +    G+IISG IKR+ESF
Sbjct  1400  FPIGKLVTGRVISVEPLSSRVEVTLKTSPVLHTSKSDIIDFSKLHVGDIISGSIKRVESF  1459

Query  1486  GLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSY  1307
             GLFI++DNTN+VGLCHVSE+ D+ I+N+++ YK G  V  K+LKVD++RHRISLGMK+S+
Sbjct  1460  GLFIAIDNTNMVGLCHVSEIYDNQIENIEANYKPGDRVNAKILKVDEERHRISLGMKSSH  1519

Query  1306  FRDDDGEDIQTTSRQSINSTDKGNSVFIGTQSTVFPESSDADIDVSVVNTTDNILTEVES  1127
              RD     +Q  S+  +   D   S+   T +  F ++S+ D++  +      IL+  E 
Sbjct  1520  MRDRTL--LQIASKDEL-FEDVMKSI---TSTHSFLKTSNLDVEDEINQFP--ILSRAED  1571

Query  1126  RASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkramkkakkerereiraae  947
             R  IPPL+V LDD +  D+++A + + ++        EK K+   KKAK+ERE++IRAAE
Sbjct  1572  RGDIPPLDVSLDDFDQIDVNNANSHSEENANEEVIIKEKHKRHEKKKAKEEREKQIRAAE  1631

Query  946   erlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIRE  767
             ERLLE+DIPR  DEFEKL+RSSPNSSF+WI YM FM+S+  VEKARSIAE+A+ TINIRE
Sbjct  1632  ERLLEEDIPRTADEFEKLIRSSPNSSFIWINYMDFMISMAAVEKARSIAERALMTINIRE  1691

Query  766   ESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGD  587
             E+EKLN+W AYFNLE +YGNP +EAVMKVFQRALQY DPKKV+LALLG++ERTE + L D
Sbjct  1692  ENEKLNIWKAYFNLENKYGNPREEAVMKVFQRALQYNDPKKVYLALLGMFERTEQHNLAD  1751

Query  586   ELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLCLPKHKHIKFITQTAILEF  407
             +LL KM KKFKHSCK+WLRRIQ  L QNQD  Q +++RA L LPKHKHIKF +QTAILEF
Sbjct  1752  DLLNKMTKKFKHSCKVWLRRIQSLLNQNQDEIQPLIDRASLSLPKHKHIKFFSQTAILEF  1811

Query  406   KCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMK  227
             K GV DRGRS+FE++L+EYPKRTDLWSVYLDQEI+  D D+IRALFERA+SLS+PPKKMK
Sbjct  1812  KAGVPDRGRSLFEKILREYPKRTDLWSVYLDQEIQHKDEDIIRALFERAVSLSLPPKKMK  1871

Query  226   FLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             FLFKKYL YEKS GD+ERIESVKRKAMEYVE+
Sbjct  1872  FLFKKYLDYEKSQGDDERIESVKRKAMEYVET  1903



>ref|XP_004144698.1| PREDICTED: protein RRP5 homolog [Cucumis sativus]
Length=1898

 Score =  2179 bits (5647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1156/1925 (60%), Positives = 1457/1925 (76%), Gaps = 82/1925 (4%)
 Frame = -2

Query  5806  KNFKRKGKNNEAGNASFSGKSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAE  5627
             K F  K K +E        ++  LQ+ED+VPDFPRGG   +S+ + ++VRAE D EF+ +
Sbjct  20    KPFNSKKKTSETAKP----ETVSLQIEDDVPDFPRGGGGYMSQNKGEKVRAEGDKEFQND  75

Query  5626  DRylkkkkqhklykKNQSVEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEV  5447
             D      K+ K  +K+ S  DDL SL  + + G LPK AN+IT KNI+P MK WGV+AEV
Sbjct  76    D-LKMTTKRGKKRRKHPSNGDDLESLLNNGVVGNLPKYANKITLKNINPRMKFWGVVAEV  134

Query  5446  NEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDD  5267
             N+KD+V+SLPGGLRGLV A+EA DP+ + E  + E   + L  +FHVGQLV C+VL +DD
Sbjct  135   NKKDLVISLPGGLRGLVSAAEAFDPILEKEVEDTE--HDLLPVMFHVGQLVPCVVLKVDD  192

Query  5266  DKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLP  5087
             DKKE+GK KIWLSLRL++L+K+ TLD +QEG++L++Y+KS EDHGYILHFGL SF+GFLP
Sbjct  193   DKKESGKRKIWLSLRLSMLYKDFTLDLLQEGMVLTSYVKSIEDHGYILHFGLTSFTGFLP  252

Query  5086  IHSQSVDK--MNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGM  4913
                QS  K  ++ GQL++ VV+S+D+TRKVVY SS  D ++  V KDLKGISIDLL+PGM
Sbjct  253   KTKQSGKKSLLHVGQLLQCVVRSIDKTRKVVYFSSDQDIVSSSVAKDLKGISIDLLIPGM  312

Query  4912  MVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPA  4733
             MV+A V S LENG++LSFLTYF GTVD+FHLQ  F   +WKD Y QN K+NARILFIDP+
Sbjct  313   MVSARVQSTLENGILLSFLTYFNGTVDMFHLQNSFHSSNWKDFYNQNMKMNARILFIDPS  372

Query  4732  TRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYIS  4553
             TRAVGL+L PHLV  KA P  V++GDI++ AKV+RVD+G GLLLE+PSSP  TP +V   
Sbjct  373   TRAVGLTLIPHLVRNKAAPPHVRIGDIYDSAKVVRVDRGFGLLLEVPSSPESTPTFV---  429

Query  4552  dvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVK  4373
                         +FK G  VRVR+LGFR+LEGLA G+LK SAFEG VF++SDVKPG +++
Sbjct  430   ------------SFKEGSRVRVRILGFRHLEGLAIGTLKASAFEGPVFSYSDVKPGTLIR  477

Query  4372  AKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITV  4193
             AKVI VD FGAIVQF  G+KALCPL HMSEFEI KPRKKF+VG+EL+FRVLGCKSKRITV
Sbjct  478   AKVIVVDDFGAIVQFPGGLKALCPLSHMSEFEIAKPRKKFKVGAELIFRVLGCKSKRITV  537

Query  4192  THKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPG  4013
             THKKTLVKSKL++LSSY DAT GL+THGWITKIEKHGCFVRFYNGVQGFAPR ELG++PG
Sbjct  538   THKKTLVKSKLEVLSSYADATAGLVTHGWITKIEKHGCFVRFYNGVQGFAPRFELGIEPG  597

Query  4012  SDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPD  3833
             SD SS YH+ QV+KCR+ SS+ +S++I  S  T+         V+ G +V+G+V+ +T  
Sbjct  598   SDPSSTYHIGQVIKCRITSSTHSSKRI--SLNTK---------VELGCIVTGVVDEITET  646

Query  3832  SIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAK  3653
              + + +N    + +G +ST+HLSDH+  A  +KSVLKPGY+FDQLLVL IEG +L+LSAK
Sbjct  647   HVTLYINR-TDYSRGRISTEHLSDHQAHASSIKSVLKPGYQFDQLLVLAIEGESLILSAK  705

Query  3652  YSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDT  3473
              SLI  A  LP D + ++P+S++HG++CN+I  G FVRFLGRLTGFSPR+KA  D++   
Sbjct  706   QSLIKLAHMLPSDSSHVNPYSIIHGFICNIIEAGCFVRFLGRLTGFSPRNKAMQDQKLYL  765

Query  3472  SEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSA  3293
              E +YIGQSV +N++DV+GETGRIT+SLKQS C STDA+FIQE+F  E KIAKLQSLD +
Sbjct  766   RETYYIGQSVRSNVVDVSGETGRITLSLKQSTCFSTDASFIQEFFSTEEKIAKLQSLDES  825

Query  3292  DSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQA  3113
                 NW + F +GS+VEG+V E+K+ GV ++FEKY DVFGFI+   L G  VETGSTIQA
Sbjct  826   ----NWAEEFAIGSVVEGEVQEVKDIGVTISFEKYHDVFGFIALHGLSGSIVETGSTIQA  881

Query  3112  AVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVK  2933
             AV+DVSK E LVDLSLKPE V+     +++ +T +KKRK EA KDLE+NQ+V+ VVE VK
Sbjct  882   AVLDVSKTERLVDLSLKPELVD-KWGGSSSRQTNRKKRKAEAPKDLEMNQTVHTVVEAVK  940

Query  2932  ENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLK  2753
             ENYLVLS+P   +A+GYAS  D+NTQ L  K F  GQSV+AT++ALP  ST GRLLLLLK
Sbjct  941   ENYLVLSLPEFGHAIGYASTYDYNTQRLHQKHFTVGQSVVATVVALPCPSTFGRLLLLLK  1000

Query  2752  AISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITE------  2591
             +ISE   +  SKR +KNSS +VGSLV AEI D++PLE+RLKFG G  GR+H+TE      
Sbjct  1001  SISEAIVTPGSKRSRKNSSCEVGSLVHAEIIDVQPLEMRLKFGVGLRGRIHVTEFCAQVS  1060

Query  2590  ATDDNTTEGPLNDFRIGQTLTARIVSKDSRSENK-RGYQWELSTKPSVL----AGDMDGP  2426
              T D  +E P ++FR+GQT+ ARIV++ + S +K +GY WELS KP VL    A   +  
Sbjct  1061  NTPDEASEAPFSNFRVGQTVVARIVAEANHSASKGKGYLWELSVKPEVLKDFSAVGGEIV  1120

Query  2425  HESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKS  2246
             +E   +S GQ ++ YV  V+ +WAWL ++R V AQL+ILDSS+EPSEL+EF K FYVGK+
Sbjct  1121  NEDLGFSIGQRVTAYVSNVNGDWAWLAVTRRVSAQLFILDSSSEPSELQEFSKHFYVGKA  1180

Query  2245  VSGYILSANKEKKLLRLVPHTLLITPE----------DTVPSSESAR--CHIREGSVLGG  2102
             VSGYI +   EKK+LRLV H L                 +P+    +  CH+ EG ++GG
Sbjct  1181  VSGYISNIIGEKKILRLVLHHLSAISSGKSDEENSKISNLPTDVCKKVICHLNEGDIVGG  1240

Query  2101  RISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKG  1922
             RISKILPGVGGLLVQI  HLFG+VH+TEL D  V DPLSGY EGQFVKCKV+++ H+VKG
Sbjct  1241  RISKILPGVGGLLVQIGPHLFGRVHYTELTDCLVPDPLSGYKEGQFVKCKVIEITHAVKG  1300

Query  1921  TTHVDLSLRWTLDTMNNQNI--SEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCF  1748
             TTH+DLSLR +   +  +NI  S H+++ S   +++DI   H  M VQGYVKN++PKGCF
Sbjct  1301  TTHIDLSLRSSAGILCQKNIECSNHENIASGRVKIEDI---HAHMEVQGYVKNISPKGCF  1357

Query  1747  IMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATP  1568
             IMLSR ++AKILLSNL+DG+I++PEKEFP GKLV G+++SVE LSKRVEVTL++ +    
Sbjct  1358  IMLSRGLEAKILLSNLSDGYIDNPEKEFPTGKLVRGRILSVEPLSKRVEVTLKSVTETGA  1417

Query  1567  RKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYK  1388
              +   + L +FSAG+IISG+IKR+ESFGLFIS+DNT++VGLCHVSE+SDD +++++ RY 
Sbjct  1418  LRGSNNDLRSFSAGDIISGRIKRVESFGLFISIDNTDVVGLCHVSEVSDDPVESLEFRYH  1477

Query  1387  AGQTvrvkvlkvdkdRHRISLGMKNSYFRDDDGEDIQTTSRQSINSTDKGNSVFIG-TQS  1211
             AG TV+ KVLKVD+ RHRI+LGMK SY   +  E       +  ++ D  N  FIG T+ 
Sbjct  1478  AGDTVKAKVLKVDEKRHRIALGMKRSYI-GERSELCTNMEEEHEDAADGDN--FIGETRL  1534

Query  1210  TVFPESSDADIDVSVVNTTDNILTE-----VESRASIPPLEVPLDDIENSDIDDAVNKNP  1046
             ++ P+SS +     + +  DNI  E      ESRA +P LEV LDDI+ +D+    ++N 
Sbjct  1535  SMDPDSS-STKFKDMDDDFDNIEPEQPLRLAESRALVPSLEVTLDDIDETDMVTLQSENK  1593

Query  1045  DHTGGADTTDekdkkramkkakkerereiraaeerlleKDIPRNTDEFEKLVRSSPNSSF  866
             + T G D+ + K+ +R  KKAK+ERE E+RAAEERLL+ + P   DEFEKLVRSSPNSSF
Sbjct  1594  ELTSGTDSKE-KNDRREKKKAKEEREMEVRAAEERLLQNNSPTTVDEFEKLVRSSPNSSF  1652

Query  865   VWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVM  686
             VWIKYM F  +  DVEKARSIAE+A+ TINIREE+EKLNVW+AYFNLE EYGNP ++AV 
Sbjct  1653  VWIKYMDFFKA--DVEKARSIAERALRTINIREENEKLNVWLAYFNLENEYGNPKEDAVT  1710

Query  685   KVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQ  506
             K+FQRALQ  DPKKVHLALLG+YERT    L DELL+KM+K+FKHSCK+WLRR++   K+
Sbjct  1711  KIFQRALQCNDPKKVHLALLGMYERTNQDNLADELLDKMIKRFKHSCKVWLRRMESLFKK  1770

Query  505   NQDNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWS  326
              Q   QSIVNRALLCLPK KHIK+I+QTAILEFKCGVADRGRSMFE +L+EYPKRTDLWS
Sbjct  1771  KQVEIQSIVNRALLCLPKRKHIKYISQTAILEFKCGVADRGRSMFEGILREYPKRTDLWS  1830

Query  325   VYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAM  146
             +YLDQEIR+GD D+IRALFERAISLS+ PKKMKFLFKKYL YEKSVGDEERIESVK+KA+
Sbjct  1831  IYLDQEIRLGDKDMIRALFERAISLSLAPKKMKFLFKKYLEYEKSVGDEERIESVKQKAL  1890

Query  145   EYVES  131
             EYVE+
Sbjct  1891  EYVEN  1895



>ref|XP_010498340.1| PREDICTED: protein RRP5 homolog [Camelina sativa]
Length=1926

 Score =  2161 bits (5600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1140/1904 (60%), Positives = 1446/1904 (76%), Gaps = 53/1904 (3%)
 Frame = -2

Query  5743  APLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhklykKNQSVED  5564
             A LQLED VPDFPRGG S LS++E +++  EVDAEF+A++R  KK K  K  KK    + 
Sbjct  40    AALQLED-VPDFPRGGGSSLSRKEREKIYEEVDAEFDADERVSKKSKGGKPKKKKIPNDS  98

Query  5563  DLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLASE  5384
             D   L    ++GK P+ AN+IT KNISPGMKL G++ EVN+KDIV+SLPGGLRGLV ASE
Sbjct  99    DDLGLLFGGLTGKRPRYANKITTKNISPGMKLLGLVTEVNQKDIVISLPGGLRGLVRASE  158

Query  5383  AHD----PLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLA  5216
             A D     + D+E NE+      L  +F VGQLV CIVL LDDD KEAGK KIWLSLRL+
Sbjct  159   ASDFTDLGIEDDE-NEL------LEDIFSVGQLVPCIVLQLDDDTKEAGKRKIWLSLRLS  211

Query  5215  LLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDK--MNTGQLV  5042
             LLHK  + D+ Q G++ SA +KS EDHGYILHFGLPS +GF+ I      K  M TGQL+
Sbjct  212   LLHKGFSFDSFQLGMVFSANVKSVEDHGYILHFGLPSITGFIEICEDGNQKSGMKTGQLI  271

Query  5041  EGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLS  4862
             +GVV  +DR RK+V L+S PD++AK +TKDL G+S DLL+PGMM+NA V SVLENG++  
Sbjct  272   QGVVTKIDRERKIVRLNSDPDSVAKCLTKDLNGMSFDLLIPGMMINARVQSVLENGILFD  331

Query  4861  FLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKA  4682
             FLTYF GTVD+FHL+      SWKD+Y QNK VNARILFIDP++RAVGL+LNP+LV  KA
Sbjct  332   FLTYFNGTVDLFHLKNPLSNKSWKDEYSQNKTVNARILFIDPSSRAVGLTLNPYLVCNKA  391

Query  4681  PPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPG  4502
             PP  V  G IF++AKV+R+DK  GLLLE+PS P  TPAYV   D    EVKK+EK +K G
Sbjct  392   PPLHVSSGGIFDEAKVVRIDKS-GLLLELPSKPASTPAYVSTYDAAGDEVKKLEKKYKEG  450

Query  4501  KVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSS  4322
               +RVR+LG + +EGLA G+LK SAFEG VF+HSDVKPGMV KAKVI+VDSFGAIVQF  
Sbjct  451   NHIRVRILGLKQMEGLAIGTLKESAFEGPVFSHSDVKPGMVTKAKVISVDSFGAIVQFPG  510

Query  4321  GVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSY  4142
             G+KA+CPLRHMSEFE+ KPRKKF+VG+ELVFRVLGCKSKRITVT+KKTLVKSKL IL SY
Sbjct  511   GLKAMCPLRHMSEFEVTKPRKKFKVGAELVFRVLGCKSKRITVTYKKTLVKSKLPILGSY  570

Query  4141  TDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRV  3962
             TDATEGL+THGWITKIEKHGCFVRFYNGVQGF PR ELGL+PGSD  S++HV +VVKCRV
Sbjct  571   TDATEGLVTHGWITKIEKHGCFVRFYNGVQGFVPRFELGLEPGSDPDSVFHVGEVVKCRV  630

Query  3961  VSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTV  3782
              S++  SR+I LS   +P  +SE + +K G++VSGI++ +T  ++++ V + +  LKGT+
Sbjct  631   TSAAHGSRRITLSLMIKPASVSEDDSIKLGSIVSGIIDSITSQAVIIRVKS-KGVLKGTI  689

Query  3781  STQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQI  3602
             S + L+DH   A LMKS+L+PGYE D+LLVLDIEG NL LS+KYSLI  A++LP D NQ+
Sbjct  690   SAEQLADHHEQAQLMKSLLRPGYELDKLLVLDIEGNNLALSSKYSLIKLAEELPSDFNQL  749

Query  3601  SPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDV  3422
              P+SVVHGYVCN+I NG FVRFLGRLTGF+PRSKA D+ R D SE F++GQSV  NI+DV
Sbjct  750   QPNSVVHGYVCNLIENGCFVRFLGRLTGFAPRSKAIDEPRADLSESFFVGQSVRANIVDV  809

Query  3421  NGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVE  3242
             N E  RIT+SLKQS C+S DA+F+QEYF+++ KI+ LQS D   S  +WV+ F +G +++
Sbjct  810   NQEKSRITLSLKQSSCASVDASFVQEYFVMDEKISDLQSSDITKSECSWVEKFSIGGLMK  869

Query  3241  GKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLK  3062
             G + E  + GVVV FE  ++V GFI    +GG  +  GS + A V+D+S+ E LVDLSL+
Sbjct  870   GTIQEQNDLGVVVNFENINNVLGFIPQHHMGGATLVPGSVVNAVVLDLSRAERLVDLSLR  929

Query  3061  PEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGY  2882
             PE +N    + +N ++ KKKRKR   K+LEV+Q V+AVVEIVKE YLVLS+P  +Y +GY
Sbjct  930   PELINNLNKEVSNSQS-KKKRKRGISKELEVHQRVSAVVEIVKEQYLVLSIPEHDYTIGY  988

Query  2881  ASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkkn  2702
             AS++D+NTQ LPVKQF  GQSV+A++ AL + S+ GRLLLLL ++S  +E+S SK+ KK 
Sbjct  989   ASVSDYNTQKLPVKQFSTGQSVVASVEALQNPSSSGRLLLLLDSVSGTSETSRSKKAKKK  1048

Query  2701  sSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTAR  2522
             SS +VGS+V AEIT+IKP ELR+ FG  F GR+HITE  D +T+E P   FR+GQ+++AR
Sbjct  1049  SSCEVGSVVHAEITEIKPFELRVNFGHSFRGRIHITEVNDVSTSEEPFAKFRVGQSMSAR  1108

Query  2521  IVSKDSRSENKRGYQWELSTKPSVL--AGDMDGPHES--FNYSTGQLLSGYVFKVDSEWA  2354
             +V+K   ++ K+   WELS KP++L  + ++    ES    +S GQ +SGYV+KVD EW 
Sbjct  1109  VVAKPCHTDIKKSQLWELSVKPAMLRDSSELKDIQESEQLEFSAGQCVSGYVYKVDKEWV  1168

Query  2353  WLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTL--  2180
             WL ISR V A+L+ILD+++E  EL+EF++RF +GK+VSGY+L+ NKEKK LRLV   L  
Sbjct  1169  WLAISRNVTARLFILDTASEAHELEEFERRFPIGKAVSGYVLTYNKEKKSLRLVQRPLPD  1228

Query  2179  --------LITPEDTVPSS---ESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGK  2033
                     + +  D + SS   +     I EG +LGGRISKILPGVGG+ VQI  ++FG+
Sbjct  1229  IHKSIANGVGSKMDKLDSSIPGDDGTLFIHEGDILGGRISKILPGVGGIRVQIGPYVFGR  1288

Query  2032  VHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISEH  1853
             VHFTE+ D WV +PL G+ EGQFVKCKVL++  S KGT  ++LSLR +LD M++ ++SE 
Sbjct  1289  VHFTEINDSWVPNPLDGFREGQFVKCKVLEISSSSKGTWQIELSLRKSLDGMSSDHLSE-  1347

Query  1852  DDVHSQN--RRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIES  1679
             D  ++ N  +R + I+DL PDM VQGYVKN   KGCFI+LSR V+AK+LLSNL D F++ 
Sbjct  1348  DCSNNDNVCKRFERIEDLSPDMGVQGYVKNTMSKGCFIILSRTVEAKVLLSNLCDTFVKD  1407

Query  1678  PEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGKIKR  1499
             PEKEFPVGKLVTG+V++VE LSKR+EVTL+T ++    KS+   L     G++ISG+IKR
Sbjct  1408  PEKEFPVGKLVTGRVLNVEPLSKRIEVTLKTVNAGGQPKSESYDLKKLHVGDMISGRIKR  1467

Query  1498  IESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGM  1319
             +E +GLFI++  T + GLCH ++LSDD I N+Q+RYKAG++V  K+LK+D+++ RISL M
Sbjct  1468  VEPYGLFITIGQTGMDGLCHKTQLSDDVIKNMQARYKAGESVTAKILKLDEEKQRISLSM  1527

Query  1318  KNSYFRDDDGEDIQTTSRQSINST--------DKGNSVFIGTQSTVFPESSDADIDVSVV  1163
             K+SY    D  D Q  S ++ N T        D  + V      + F E+S         
Sbjct  1528  KSSYLISGDDVDAQPPSEENANKTSMECDPINDPNSEVLAAVGDSGFQETSGGK-----H  1582

Query  1162  NTTDNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkramkka  983
             + T  +L +VESRASIPPLEV LDDIE +DID+   +N     GAD  DEK K+R  +K 
Sbjct  1583  SGTSVVLAQVESRASIPPLEVDLDDIEETDIDNG--QNHGKLQGADK-DEKSKRREKQKV  1639

Query  982   kkerereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSI  803
             ++ERE++I+AAE RLLE   P + DEFEKLVRSSPNSSFVWIKYMAFMLSL D+EKARSI
Sbjct  1640  REEREKKIQAAEGRLLENHAPESADEFEKLVRSSPNSSFVWIKYMAFMLSLADIEKARSI  1699

Query  802   AEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLG  623
             AE+A+ TINIREE E+LN+WVAYFNLE E+G+PP+EAV KVF+RA QYCDPKKV+LALLG
Sbjct  1700  AERALKTINIREEEERLNIWVAYFNLENEHGSPPEEAVKKVFERARQYCDPKKVYLALLG  1759

Query  622   VYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLCLPKHKH  443
             VYERTE +KL D+LL++M+KKFK SCKIW R+IQ +LKQN++  QS+VNRALLCLP+HKH
Sbjct  1760  VYERTEQHKLADKLLDEMIKKFKQSCKIWSRKIQSSLKQNEEGIQSVVNRALLCLPRHKH  1819

Query  442   IKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFER  263
             IKFI+QTAILEFKCGVADRGRS+FE +L+EYPKRTDLWSVYLDQEIR+G++DVIR+LFER
Sbjct  1820  IKFISQTAILEFKCGVADRGRSLFEGVLREYPKRTDLWSVYLDQEIRLGEVDVIRSLFER  1879

Query  262   AISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             AISLS+PPKKMKFLFKKYL YEKSV DEER+E VK++AMEY +S
Sbjct  1880  AISLSLPPKKMKFLFKKYLEYEKSVCDEERVEYVKQRAMEYADS  1923



>ref|XP_010934562.1| PREDICTED: protein RRP5 homolog isoform X2 [Elaeis guineensis]
Length=1928

 Score =  2161 bits (5599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1154/1924 (60%), Positives = 1462/1924 (76%), Gaps = 47/1924 (2%)
 Frame = -2

Query  5815  KNPKNFKRKGKNNEAGNASFSGKSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEF  5636
             K  K FK+  K+     A  S   + L ++D+ PDFPRGGAS+L++EE+ E RAE + EF
Sbjct  20    KPHKTFKKPRKDKTRPPAP-SELPSSLLVQDDDPDFPRGGASVLTREEIAEARAEAEEEF  78

Query  5635  EAEDRylkkkkqhklykKNQS-VEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGV  5459
             E E +  K  +++K  +K+ +   DD GSLFG  ++GKLP+ ANRIT KNISP MKLWGV
Sbjct  79    ERESKKSKDTRKNKGAQKSLAEAVDDFGSLFGDGVTGKLPRFANRITLKNISPRMKLWGV  138

Query  5458  IAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVL  5279
             I EVN KD+V+ LPGGLRG V A E  D + D+   + E  SN L  +FHVGQLVSCIV+
Sbjct  139   IIEVNTKDLVIGLPGGLRGYVRAEEVSDIIIDDGNKDSE--SNLLCSIFHVGQLVSCIVV  196

Query  5278  HLDDDKKEA-GKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSF  5102
              +DDDKK+  G  +IWLSLRL+LL+K L LDA+Q+G++L+A IKS ED GYIL+FG+ SF
Sbjct  197   RVDDDKKDGKGNRRIWLSLRLSLLYKGLMLDAVQDGMVLTAQIKSIEDRGYILYFGVSSF  256

Query  5101  SGFLPIHSQSVDKMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLV  4922
             +GFLP   Q     ++GQ ++ VVKS+D+ R V  ++S  D ++K   KDLKG+SIDLLV
Sbjct  257   TGFLPKSEQDGGVFSSGQHLQCVVKSIDKARAVAIVNSDADLVSKSAMKDLKGLSIDLLV  316

Query  4921  PGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFI  4742
             PGMMVNA V S LENG+MLSFLTYFTGTVDIFHLQ  F   +WKD Y QNKKVNARILFI
Sbjct  317   PGMMVNARVHSTLENGIMLSFLTYFTGTVDIFHLQNSFSHATWKDHYNQNKKVNARILFI  376

Query  4741  DPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYV  4562
             DP+TRAVGL+LNP+LV  KAPPS+V+ G+I++ ++++RVD+G+GLLLE+PSSP+P+PA+V
Sbjct  377   DPSTRAVGLTLNPYLVQNKAPPSIVRTGEIYDNSRILRVDRGIGLLLEVPSSPIPSPAFV  436

Query  4561  YISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGM  4382
              ISDV D++V K+EK FK G  VRVRVLG R+L+GLA G+L+ SA EGSVFTHSDVKPGM
Sbjct  437   SISDVSDEKVTKLEKKFKEGDYVRVRVLGMRHLDGLAMGTLRASALEGSVFTHSDVKPGM  496

Query  4381  VVKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKR  4202
             +VKAKVI  ++FGAIVQFS GVKALCPL+HMSE +I+KP KKF+VGSEL FRVLGCKSKR
Sbjct  497   LVKAKVIAAENFGAIVQFSGGVKALCPLQHMSELDILKPPKKFKVGSELRFRVLGCKSKR  556

Query  4201  ITVTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGL  4022
             ITVT+KKTLVKS+L +L+SY DATEGLI HGWITKIEKHGCFVRFYNGV GFA RSELGL
Sbjct  557   ITVTYKKTLVKSRLPVLASYADATEGLIVHGWITKIEKHGCFVRFYNGVHGFAQRSELGL  616

Query  4021  DPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELV  3842
             +PGS+  + YHV Q VKCRV+SS+PASR+I +SF   P R SE ++ K G++VSG+VE +
Sbjct  617   EPGSEADAAYHVGQAVKCRVISSAPASRRISISFVISPKRSSENDVAKLGSIVSGVVERL  676

Query  3841  TPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVL  3662
             TP +++++VN G ++LKGT+  +HL+DH+G A L+KS+L+PGY+FDQLLVLD EG NL+L
Sbjct  677   TPAAVIIHVN-GNAYLKGTLFDEHLADHQGQAVLLKSLLRPGYQFDQLLVLDTEGQNLIL  735

Query  3661  SAKYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRR  3482
             SAKYSLI+ A+++P D++QI P SVV+GY+CN+I NG FVRFLGRLTGFSP+ K TD + 
Sbjct  736   SAKYSLINYAKEIPSDLSQIHPLSVVNGYICNIIENGCFVRFLGRLTGFSPKDKVTDQQI  795

Query  3481  YDTSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSL  3302
              +  + FY+GQSV +++L  NGETGR+ +SLKQSLCSS+D +FIQ YFLLE KIA LQ  
Sbjct  796   DNLLDAFYVGQSVRSHVLTFNGETGRLKLSLKQSLCSSSDVSFIQGYFLLEDKIAALQMS  855

Query  3301  DSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGST  3122
             D+ +S  +W   F +GS+VEG++ EIKEFGVVV+F  + DV GF++  Q GG+NVE GS 
Sbjct  856   DANNSDSSWTRSFSIGSLVEGEIQEIKEFGVVVSFRDHGDVVGFVTHHQSGGVNVEVGSV  915

Query  3121  IQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVE  2942
             ++A V+D++K + LVDLSLK E V  +    A     KKKR R    DL+++Q+VN VVE
Sbjct  916   VKALVLDIAKSDGLVDLSLKSELVTSACVDGA-----KKKRCRSTSTDLQLHQTVNGVVE  970

Query  2941  IVKENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLL  2762
             IVKENYLVLS+P  NYA+GYAS+ D+N Q LP K F+NGQSV+ T+  LP S + GRLLL
Sbjct  971   IVKENYLVLSIPEYNYAIGYASITDYNMQKLPRKHFLNGQSVLVTVGVLPSSCSSGRLLL  1030

Query  2761  LLKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATD  2582
             LLK+  +V+E+S SKR +K SSY VGSLV  EI DIKPLEL LKFG+GF GR+HITE  D
Sbjct  1031  LLKSAGDVSETSRSKRARKMSSYTVGSLVVGEIIDIKPLELILKFGTGFRGRIHITEVFD  1090

Query  2581  DN-TTEGPLNDFRIGQTLTARIVSKDSRS-ENKRGYQWELSTKPSVLAGD-MDGP-HESF  2414
             +N   E P + F+IGQ L ARIV+K  +S ++ +GYQWELS +PS+L G+ M  P  E F
Sbjct  1091  NNHAPENPFSKFKIGQLLDARIVAKLEQSGKSGKGYQWELSVRPSLLTGESMKIPTAEEF  1150

Query  2413  NYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGY  2234
             N+S G ++ GYV KVD EW WLT+SR V + +++LDSS EP EL+EFQ+R+ VG++V G 
Sbjct  1151  NFSVGSIVRGYVVKVDGEWVWLTVSRSVMSHIFVLDSSCEPGELQEFQQRYSVGQAVKGK  1210

Query  2233  ILSANKEKKLLRL------------VPHTLLIT--PEDTVPSSESARCHIREGSVLGGRI  2096
             I+S NKEKKLLRL            V H ++     E+ V + + A  HI  G ++GG++
Sbjct  1211  IISINKEKKLLRLASCPSSSVSGSSVDHEIVKVDIQENKVSNVDCAE-HIIRGDIVGGKV  1269

Query  2095  SKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTT  1916
              +ILPGV GLLVQI  HLFGK H+TEL D WV  PL GY EGQFVKCK+L++  S++GT 
Sbjct  1270  KRILPGVSGLLVQIGPHLFGKAHYTELIDTWVPQPLCGYHEGQFVKCKILEITRSLEGTL  1329

Query  1915  HVDLSLRWTLDTMNNQNISEHDD-VHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIML  1739
             HVDLSLR +L  + + + +  D+ +++  +R + I+DLHP+M VQGYVKNVT KGCFIML
Sbjct  1330  HVDLSLRSSLQDIQSVDSTVLDNNLNTHIQRFEKIEDLHPNMDVQGYVKNVTSKGCFIML  1389

Query  1738  SRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKS  1559
             SR +DA+ILLSNL+DG+IE+PEKEFP GKLV G+V+SV+  SKRVEVTL+T       KS
Sbjct  1390  SRMIDARILLSNLSDGYIENPEKEFPAGKLVHGRVLSVDPASKRVEVTLKTEMKTEVAKS  1449

Query  1558  DIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQ  1379
             D     N   G++ISG+I+RIE +GLFI++DNTN+VGLCH SELSD+ IDN+++RYKAG 
Sbjct  1450  DASVFCNLHVGDVISGQIRRIEPYGLFIAIDNTNVVGLCHKSELSDEPIDNIETRYKAGD  1509

Query  1378  TvrvkvlkvdkdRHRISLGMKNSYFRDDDGEDIQTTSRQS--------INSTDKGNSVFI  1223
              V  KVLKVD++RHRISLGMK SY    +  D    SR          I++ D  +++  
Sbjct  1510  RVVAKVLKVDEERHRISLGMKKSYI--GNASDAPIISRHGTADGSFDGISTVD--DTLLA  1565

Query  1222  GTQSTVFPESSDADIDVSVVNTTDNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPD  1043
               Q+   P    A+      N    +L   E+RAS+ PL+V + D  +    D V  + +
Sbjct  1566  LQQNDDLPH---AERMFGCDNEACAVLEPAETRASVLPLQV-VLDDSDGSDLDNVTVSQE  1621

Query  1042  HTGGADTTDekdkkramkkakkerereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFV  863
                  D   +K  +R  KKAK+ERE EI A+EER L+KDIP+  DEFEKLVRSSPNSSFV
Sbjct  1622  IVNLTDMAAKKSDRRTKKKAKEERELEISASEERNLQKDIPKTADEFEKLVRSSPNSSFV  1681

Query  862   WIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMK  683
             WIKYMAFMLSL DVEKARSIAE+A+ TINIREE EKLN+WVA FNLE EYG+PP+EAV K
Sbjct  1682  WIKYMAFMLSLADVEKARSIAERALRTINIREEGEKLNIWVACFNLENEYGSPPEEAVKK  1741

Query  682   VFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQN  503
              FQRALQYCDPKK++LALLG+YERTE +KL DELLE+M KKFK+SCK+WL  +Q  LKQ+
Sbjct  1742  TFQRALQYCDPKKLYLALLGMYERTEQHKLADELLERMTKKFKNSCKVWLHCVQSFLKQD  1801

Query  502   QDNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSV  323
             +D  QS+VNRALL L ++KHIKFI+QTAILEFK GV DRGRSMFE +L+EYPKRTDLWS+
Sbjct  1802  KDGIQSLVNRALLSLSRNKHIKFISQTAILEFKFGVPDRGRSMFEGILREYPKRTDLWSI  1861

Query  322   YLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAME  143
             YLDQEIR+GD++VIRALFERA  LS+PPKKMKFLFKKYL YEK+ GDE+RIE VK++A+E
Sbjct  1862  YLDQEIRLGDVEVIRALFERATFLSLPPKKMKFLFKKYLEYEKAHGDEDRIEHVKKRALE  1921

Query  142   YVES  131
             YVES
Sbjct  1922  YVES  1925



>ref|XP_010934559.1| PREDICTED: protein RRP5 homolog isoform X1 [Elaeis guineensis]
Length=1930

 Score =  2156 bits (5587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1154/1926 (60%), Positives = 1462/1926 (76%), Gaps = 49/1926 (3%)
 Frame = -2

Query  5815  KNPKNFKRKGKNNEAGNASFSGKSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEF  5636
             K  K FK+  K+     A  S   + L ++D+ PDFPRGGAS+L++EE+ E RAE + EF
Sbjct  20    KPHKTFKKPRKDKTRPPAP-SELPSSLLVQDDDPDFPRGGASVLTREEIAEARAEAEEEF  78

Query  5635  EAEDRylkkkkqhklykKNQS-VEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGV  5459
             E E +  K  +++K  +K+ +   DD GSLFG  ++GKLP+ ANRIT KNISP MKLWGV
Sbjct  79    ERESKKSKDTRKNKGAQKSLAEAVDDFGSLFGDGVTGKLPRFANRITLKNISPRMKLWGV  138

Query  5458  IAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVL  5279
             I EVN KD+V+ LPGGLRG V A E  D + D+   + E  SN L  +FHVGQLVSCIV+
Sbjct  139   IIEVNTKDLVIGLPGGLRGYVRAEEVSDIIIDDGNKDSE--SNLLCSIFHVGQLVSCIVV  196

Query  5278  HLDDDKKEA-GKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSF  5102
              +DDDKK+  G  +IWLSLRL+LL+K L LDA+Q+G++L+A IKS ED GYIL+FG+ SF
Sbjct  197   RVDDDKKDGKGNRRIWLSLRLSLLYKGLMLDAVQDGMVLTAQIKSIEDRGYILYFGVSSF  256

Query  5101  SGFLPIHSQSVDKMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLV  4922
             +GFLP   Q     ++GQ ++ VVKS+D+ R V  ++S  D ++K   KDLKG+SIDLLV
Sbjct  257   TGFLPKSEQDGGVFSSGQHLQCVVKSIDKARAVAIVNSDADLVSKSAMKDLKGLSIDLLV  316

Query  4921  PGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFI  4742
             PGMMVNA V S LENG+MLSFLTYFTGTVDIFHLQ  F   +WKD Y QNKKVNARILFI
Sbjct  317   PGMMVNARVHSTLENGIMLSFLTYFTGTVDIFHLQNSFSHATWKDHYNQNKKVNARILFI  376

Query  4741  DPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYV  4562
             DP+TRAVGL+LNP+LV  KAPPS+V+ G+I++ ++++RVD+G+GLLLE+PSSP+P+PA+V
Sbjct  377   DPSTRAVGLTLNPYLVQNKAPPSIVRTGEIYDNSRILRVDRGIGLLLEVPSSPIPSPAFV  436

Query  4561  YISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGM  4382
              ISDV D++V K+EK FK G  VRVRVLG R+L+GLA G+L+ SA EGSVFTHSDVKPGM
Sbjct  437   SISDVSDEKVTKLEKKFKEGDYVRVRVLGMRHLDGLAMGTLRASALEGSVFTHSDVKPGM  496

Query  4381  VVKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKR  4202
             +VKAKVI  ++FGAIVQFS GVKALCPL+HMSE +I+KP KKF+VGSEL FRVLGCKSKR
Sbjct  497   LVKAKVIAAENFGAIVQFSGGVKALCPLQHMSELDILKPPKKFKVGSELRFRVLGCKSKR  556

Query  4201  ITVTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGL  4022
             ITVT+KKTLVKS+L +L+SY DATEGLI HGWITKIEKHGCFVRFYNGV GFA RSELGL
Sbjct  557   ITVTYKKTLVKSRLPVLASYADATEGLIVHGWITKIEKHGCFVRFYNGVHGFAQRSELGL  616

Query  4021  DPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPM--RLSETEMVKPGTVVSGIVE  3848
             +PGS+  + YHV Q VKCRV+SS+PASR+I +SF   P   R SE ++ K G++VSG+VE
Sbjct  617   EPGSEADAAYHVGQAVKCRVISSAPASRRISISFVISPKSGRSSENDVAKLGSIVSGVVE  676

Query  3847  LVTPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNL  3668
              +TP +++++VN G ++LKGT+  +HL+DH+G A L+KS+L+PGY+FDQLLVLD EG NL
Sbjct  677   RLTPAAVIIHVN-GNAYLKGTLFDEHLADHQGQAVLLKSLLRPGYQFDQLLVLDTEGQNL  735

Query  3667  VLSAKYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDD  3488
             +LSAKYSLI+ A+++P D++QI P SVV+GY+CN+I NG FVRFLGRLTGFSP+ K TD 
Sbjct  736   ILSAKYSLINYAKEIPSDLSQIHPLSVVNGYICNIIENGCFVRFLGRLTGFSPKDKVTDQ  795

Query  3487  RRYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQ  3308
             +  +  + FY+GQSV +++L  NGETGR+ +SLKQSLCSS+D +FIQ YFLLE KIA LQ
Sbjct  796   QIDNLLDAFYVGQSVRSHVLTFNGETGRLKLSLKQSLCSSSDVSFIQGYFLLEDKIAALQ  855

Query  3307  SLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETG  3128
               D+ +S  +W   F +GS+VEG++ EIKEFGVVV+F  + DV GF++  Q GG+NVE G
Sbjct  856   MSDANNSDSSWTRSFSIGSLVEGEIQEIKEFGVVVSFRDHGDVVGFVTHHQSGGVNVEVG  915

Query  3127  STIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAV  2948
             S ++A V+D++K + LVDLSLK E V  +    A     KKKR R    DL+++Q+VN V
Sbjct  916   SVVKALVLDIAKSDGLVDLSLKSELVTSACVDGA-----KKKRCRSTSTDLQLHQTVNGV  970

Query  2947  VEIVKENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRL  2768
             VEIVKENYLVLS+P  NYA+GYAS+ D+N Q LP K F+NGQSV+ T+  LP S + GRL
Sbjct  971   VEIVKENYLVLSIPEYNYAIGYASITDYNMQKLPRKHFLNGQSVLVTVGVLPSSCSSGRL  1030

Query  2767  LLLLKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEA  2588
             LLLLK+  +V+E+S SKR +K SSY VGSLV  EI DIKPLEL LKFG+GF GR+HITE 
Sbjct  1031  LLLLKSAGDVSETSRSKRARKMSSYTVGSLVVGEIIDIKPLELILKFGTGFRGRIHITEV  1090

Query  2587  TDDN-TTEGPLNDFRIGQTLTARIVSKDSRS-ENKRGYQWELSTKPSVLAGD-MDGP-HE  2420
              D+N   E P + F+IGQ L ARIV+K  +S ++ +GYQWELS +PS+L G+ M  P  E
Sbjct  1091  FDNNHAPENPFSKFKIGQLLDARIVAKLEQSGKSGKGYQWELSVRPSLLTGESMKIPTAE  1150

Query  2419  SFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVS  2240
              FN+S G ++ GYV KVD EW WLT+SR V + +++LDSS EP EL+EFQ+R+ VG++V 
Sbjct  1151  EFNFSVGSIVRGYVVKVDGEWVWLTVSRSVMSHIFVLDSSCEPGELQEFQQRYSVGQAVK  1210

Query  2239  GYILSANKEKKLLRL------------VPHTLLIT--PEDTVPSSESARCHIREGSVLGG  2102
             G I+S NKEKKLLRL            V H ++     E+ V + + A  HI  G ++GG
Sbjct  1211  GKIISINKEKKLLRLASCPSSSVSGSSVDHEIVKVDIQENKVSNVDCAE-HIIRGDIVGG  1269

Query  2101  RISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKG  1922
             ++ +ILPGV GLLVQI  HLFGK H+TEL D WV  PL GY EGQFVKCK+L++  S++G
Sbjct  1270  KVKRILPGVSGLLVQIGPHLFGKAHYTELIDTWVPQPLCGYHEGQFVKCKILEITRSLEG  1329

Query  1921  TTHVDLSLRWTLDTMNNQNISEHDD-VHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFI  1745
             T HVDLSLR +L  + + + +  D+ +++  +R + I+DLHP+M VQGYVKNVT KGCFI
Sbjct  1330  TLHVDLSLRSSLQDIQSVDSTVLDNNLNTHIQRFEKIEDLHPNMDVQGYVKNVTSKGCFI  1389

Query  1744  MLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPR  1565
             MLSR +DA+ILLSNL+DG+IE+PEKEFP GKLV G+V+SV+  SKRVEVTL+T       
Sbjct  1390  MLSRMIDARILLSNLSDGYIENPEKEFPAGKLVHGRVLSVDPASKRVEVTLKTEMKTEVA  1449

Query  1564  KSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKA  1385
             KSD     N   G++ISG+I+RIE +GLFI++DNTN+VGLCH SELSD+ IDN+++RYKA
Sbjct  1450  KSDASVFCNLHVGDVISGQIRRIEPYGLFIAIDNTNVVGLCHKSELSDEPIDNIETRYKA  1509

Query  1384  GQTvrvkvlkvdkdRHRISLGMKNSYFRDDDGEDIQTTSRQS--------INSTDKGNSV  1229
             G  V  KVLKVD++RHRISLGMK SY    +  D    SR          I++ D  +++
Sbjct  1510  GDRVVAKVLKVDEERHRISLGMKKSYI--GNASDAPIISRHGTADGSFDGISTVD--DTL  1565

Query  1228  FIGTQSTVFPESSDADIDVSVVNTTDNILTEVESRASIPPLEVPLDDIENSDIDDAVNKN  1049
                 Q+   P    A+      N    +L   E+RAS+ PL+V + D  +    D V  +
Sbjct  1566  LALQQNDDLPH---AERMFGCDNEACAVLEPAETRASVLPLQV-VLDDSDGSDLDNVTVS  1621

Query  1048  PDHTGGADTTDekdkkramkkakkerereiraaeerlleKDIPRNTDEFEKLVRSSPNSS  869
              +     D   +K  +R  KKAK+ERE EI A+EER L+KDIP+  DEFEKLVRSSPNSS
Sbjct  1622  QEIVNLTDMAAKKSDRRTKKKAKEERELEISASEERNLQKDIPKTADEFEKLVRSSPNSS  1681

Query  868   FVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAV  689
             FVWIKYMAFMLSL DVEKARSIAE+A+ TINIREE EKLN+WVA FNLE EYG+PP+EAV
Sbjct  1682  FVWIKYMAFMLSLADVEKARSIAERALRTINIREEGEKLNIWVACFNLENEYGSPPEEAV  1741

Query  688   MKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALK  509
              K FQRALQYCDPKK++LALLG+YERTE +KL DELLE+M KKFK+SCK+WL  +Q  LK
Sbjct  1742  KKTFQRALQYCDPKKLYLALLGMYERTEQHKLADELLERMTKKFKNSCKVWLHCVQSFLK  1801

Query  508   QNQDNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLW  329
             Q++D  QS+VNRALL L ++KHIKFI+QTAILEFK GV DRGRSMFE +L+EYPKRTDLW
Sbjct  1802  QDKDGIQSLVNRALLSLSRNKHIKFISQTAILEFKFGVPDRGRSMFEGILREYPKRTDLW  1861

Query  328   SVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKA  149
             S+YLDQEIR+GD++VIRALFERA  LS+PPKKMKFLFKKYL YEK+ GDE+RIE VK++A
Sbjct  1862  SIYLDQEIRLGDVEVIRALFERATFLSLPPKKMKFLFKKYLEYEKAHGDEDRIEHVKKRA  1921

Query  148   MEYVES  131
             +EYVES
Sbjct  1922  LEYVES  1927



>emb|CDY01077.1| BnaC05g41230D [Brassica napus]
Length=1906

 Score =  2154 bits (5580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1136/1896 (60%), Positives = 1456/1896 (77%), Gaps = 54/1896 (3%)
 Frame = -2

Query  5749  KSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhk-lykKNQS  5573
             ++  LQLED VPDFPRGG + LSK E  ++  EVDAEFEAE+R  K+ K  K   K+N S
Sbjct  39    EAMALQLED-VPDFPRGGGTSLSKTERKKIYEEVDAEFEAEERVSKRSKGGKPKMKRNPS  97

Query  5572  VEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVL  5393
               D+LGSLF   ++GK P+ AN+IT KNISPGMKL GV+ EVN+KDIV+SLPGGLRGLV 
Sbjct  98    EVDELGSLFDGGLTGKRPRYANKITIKNISPGMKLLGVVTEVNQKDIVISLPGGLRGLVR  157

Query  5392  ASEAHD-PLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLA  5216
             ASEA D   +  E +E E+    L  +F VGQLV C VL LDDDKKEAGK KIWLSLRL+
Sbjct  158   ASEALDFTDFGTEDDENEL----LRDIFSVGQLVPCFVLQLDDDKKEAGKRKIWLSLRLS  213

Query  5215  LLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDKMNTGQLVEG  5036
             LLHK  +LD+ Q G++++A +KS EDHGYILHFGLPS +GF+        ++ TGQL++G
Sbjct  214   LLHKGFSLDSFQSGMVVTASVKSVEDHGYILHFGLPSITGFIKKSKDGNQELKTGQLIQG  273

Query  5035  VVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFL  4856
             VV ++D+ RK+V LS+ PD++AK VTKDL G+S DLL+PGMMVNA V SVLENG++L FL
Sbjct  274   VVTNIDKERKIVSLSADPDSVAKCVTKDLSGMSFDLLIPGMMVNARVQSVLENGILLGFL  333

Query  4855  TYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPP  4676
              YFTGTVD+FHLQ      SWKD+Y Q K VNARILF+DP+TRAVGL+LNPHLV  K PP
Sbjct  334   MYFTGTVDLFHLQNPMCNKSWKDEYTQTKMVNARILFMDPSTRAVGLTLNPHLVGNKVPP  393

Query  4675  SLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKV  4496
               V  GDIF++AKV+RVDK  GLLLE+PS PV TPAYV   D  + EVKK+EK FK G  
Sbjct  394   LHVSSGDIFDEAKVVRVDKS-GLLLELPSKPVSTPAYVSTYDAAEDEVKKLEKNFKEGNR  452

Query  4495  VRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGV  4316
             +RVR+LG +++EGLA G+LK SAFEG  F+HSDVKPGMV KAK+I+VD+FGAIVQF  G+
Sbjct  453   IRVRILGLKHMEGLAIGTLKESAFEGPAFSHSDVKPGMVTKAKIISVDTFGAIVQFPGGL  512

Query  4315  KALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSYTD  4136
             KA+CPL+HMSEFE+ KPRKKF+VG+EL+FRVLGCKSKRITVT KKTLVKSKL ILSSY D
Sbjct  513   KAMCPLQHMSEFEVTKPRKKFKVGAELIFRVLGCKSKRITVTCKKTLVKSKLPILSSYAD  572

Query  4135  ATEGLITHGWITKIEKHGCFVRFYNGVQGF-APRSELGLDPGSDISSMYHVEQVVKCRVV  3959
             ATEGL+THGWITKIEKHGCFVRFYNGVQGF A R ELGL+PGSD SS++HV +VVKCRV 
Sbjct  573   ATEGLVTHGWITKIEKHGCFVRFYNGVQGFVASRFELGLEPGSDPSSVFHVGEVVKCRVT  632

Query  3958  SSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTVS  3779
             S+   +R+I LSF  +P  +SE + +K G++VSG+++ +TP ++ V+V + +  LKGTVS
Sbjct  633   SAVHGTRRINLSFMIKPTSVSEDDSIKLGSIVSGVIDSITPQAVTVHVKS-KGLLKGTVS  691

Query  3778  TQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQIS  3599
              +HL+DH   A LM S+L+PG+E D+LL++DI+G NL LS+KYSLI   ++LP D++Q+ 
Sbjct  692   AEHLADHHDQAKLMISLLRPGFELDKLLIIDIDGNNLALSSKYSLIKLTEELPSDISQLQ  751

Query  3598  PHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVN  3419
             P+SVVHGYVCN+I NG FVRFLGRLTGF+PRSKA DD R D SE F++GQSV  NI+D+N
Sbjct  752   PNSVVHGYVCNLIENGCFVRFLGRLTGFAPRSKAIDDPRADLSESFFVGQSVRANIVDIN  811

Query  3418  GETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEG  3239
              E  RIT+SLKQS C+S DA+FIQEYFL + KI+ LQS D+ +S  +WV+ F +GS+V+G
Sbjct  812   QEKSRITLSLKQSSCASVDASFIQEYFLTDEKISDLQSSDNTESECSWVEKFSIGSLVKG  871

Query  3238  KVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKP  3059
              VHE  + G+VV F+  D+V GFI    LGG  +E GS ++A V+D+S+ E LVDLSL+P
Sbjct  872   TVHEQNDLGLVVNFDNIDNVLGFIPQYHLGGATLEHGSVVEAVVLDISRAERLVDLSLRP  931

Query  3058  EFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGYA  2879
             E +N S  + +N+++ KKKR+R   K+LEV+Q V+AVVEIVKE YL+LS+P   Y +GYA
Sbjct  932   ELINNSTKEVSNNQS-KKKRRRGISKELEVHQRVSAVVEIVKEQYLILSIPEHGYTIGYA  990

Query  2878  SLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkkns  2699
             S++D+NTQ LPVKQF  GQSV+A++ +L +S T GRLLLLL ++S ++++  SKR +  S
Sbjct  991   SISDYNTQKLPVKQFSAGQSVVASVESLQNSLTSGRLLLLLDSVSGISDTPHSKRTRNKS  1050

Query  2698  SYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARI  2519
             S  VGS+V AEIT+IKPLE+R+ FG  F GR+HITE  D +T+E P + FR+GQ+++AR+
Sbjct  1051  SCGVGSVVHAEITEIKPLEVRVNFGQSFRGRIHITEVDDVSTSEEPFSKFRVGQSVSARV  1110

Query  2518  VSKDSRSENKRGYQWELSTKPSVL--AGDMDGPH--ESFNYSTGQLLSGYVFKVDSEWAW  2351
             ++K   +  K+   WELS+KP++L  + +++G    E   +  G+ + GYV+KVD EW W
Sbjct  1111  IAKPWHTNIKKSL-WELSSKPAILRDSSELNGIQVREQLEFVNGERVRGYVYKVDKEWVW  1169

Query  2350  LTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTLLIT  2171
             LTISR V A ++ILD++ +  EL+EF++RF +GK+VSGY+L+ NKEKK  +LV   LL  
Sbjct  1170  LTISRNVTAGVFILDTACDAQELEEFERRFPIGKAVSGYVLTYNKEKKTAQLVQRPLLDI  1229

Query  2170  P--------------EDTVPSSESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGK  2033
                            ++++P  + A   I EG +LGGRISKILPGVGGL VQI  ++FG+
Sbjct  1230  QKSIANGGGCKTDNLDNSIP-GDDATLFIHEGDILGGRISKILPGVGGLRVQIGPNVFGR  1288

Query  2032  VHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISEH  1853
             VHFTE+ D WVS+PL G+ EGQFVKCKVL++ +S KGT  ++LSLR +LD M +  +SE 
Sbjct  1289  VHFTEINDSWVSNPLDGFHEGQFVKCKVLEISNSSKGTLQIELSLRTSLDGMTSDQLSEA  1348

Query  1852  DDVHSQ-NRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESP  1676
              + +    +R + I+DL PDM +QGYVKN   KGCFIMLSRK+DAK+LLSNL+D F++ P
Sbjct  1349  SNNNVNICKRFERIEDLSPDMAIQGYVKNTMSKGCFIMLSRKLDAKVLLSNLSDTFVKDP  1408

Query  1675  EKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGKIKRI  1496
             EKEFPVGKLVTG+V++VESLSKRVEVTL+  ++    KS+   L  F  G++ISG IKR+
Sbjct  1409  EKEFPVGKLVTGRVLNVESLSKRVEVTLKKGNAGGQPKSESYDLKQFHVGDVISGSIKRV  1468

Query  1495  ESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMK  1316
             E +GLFI++D T++VGLCH S+LSDD I++VQ+RY+AG++V  K+LK+D+++ RISLGMK
Sbjct  1469  EPYGLFITIDKTSMVGLCHKSQLSDDRIEDVQARYEAGESVTAKILKLDEEKQRISLGMK  1528

Query  1315  NSYFRDDDGEDIQTTSRQSINSTDKGNSVFIGTQSTVFPESSDAD-IDVSVVNTTDNILT  1139
             +SYF +DD    Q  S ++                    +S + D I+    + T  +L 
Sbjct  1529  SSYFMNDDDVKAQPPSEENAKE-----------------DSMECDPINDLKQSGTSLVLA  1571

Query  1138  EVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkramkkakkererei  959
             +VESRASIP LEV LDDIE +  D+  N   +   G D  DEK K+R  +K K+ERER+I
Sbjct  1572  QVESRASIPALEVNLDDIEEAGFDNDQN---EKLQGVD-KDEKSKRREKQKDKEERERKI  1627

Query  958   raaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTI  779
             +AAE RLLE   P + DEFEKLVRSSPNSSFVWIKYMAFMLSL D+EKARSIAE+A+ TI
Sbjct  1628  QAAEGRLLENHAPESADEFEKLVRSSPNSSFVWIKYMAFMLSLADIEKARSIAERALRTI  1687

Query  778   NIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHY  599
             NIREE EKLN+WVAYFNLE E+G+PP+EAV KVF+RA QYCDPKKV+ ALLGVYERTE Y
Sbjct  1688  NIREEDEKLNIWVAYFNLENEHGSPPEEAVKKVFERARQYCDPKKVYHALLGVYERTEQY  1747

Query  598   KLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLCLPKHKHIKFITQTA  419
             KL D+LL++MVKKFK SCK+WLR++Q  LKQ+ ++ QSIVNRALLCLP+HKHIKFI+QTA
Sbjct  1748  KLADKLLDEMVKKFKQSCKVWLRKVQSHLKQDVEDIQSIVNRALLCLPRHKHIKFISQTA  1807

Query  418   ILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPP  239
             ILEFKCG ADRGRS+FE +L+EYPKRTDLWSVYLDQEIR+G++DVIR+LFERAISLS+PP
Sbjct  1808  ILEFKCGNADRGRSLFEGVLREYPKRTDLWSVYLDQEIRLGEVDVIRSLFERAISLSLPP  1867

Query  238   KKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             KKMKFLFKK+L YEKS GDEER+E VK++AMEY +S
Sbjct  1868  KKMKFLFKKFLEYEKSAGDEERVEYVKQRAMEYADS  1903



>emb|CDY08474.1| BnaA05g27100D [Brassica napus]
Length=1904

 Score =  2149 bits (5567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1136/1893 (60%), Positives = 1459/1893 (77%), Gaps = 49/1893 (3%)
 Frame = -2

Query  5749  KSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhk-lykKNQS  5573
             ++  LQLED VPDFPRGG + LSK E  ++  EVDAEFEAE+R  K+ K  K   K+N S
Sbjct  38    EAMALQLED-VPDFPRGGGTSLSKTERKKIYEEVDAEFEAEERVSKRSKGGKPNKKRNPS  96

Query  5572  VEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVL  5393
               D+LGSLF   ++GK P+ AN+IT KNISPGMKL GV+ EVN+KDIV+SLPGGLRGLV 
Sbjct  97    EVDELGSLFDGGLTGKRPRYANKITIKNISPGMKLLGVVTEVNQKDIVISLPGGLRGLVR  156

Query  5392  ASEAHDPL-WDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLA  5216
             ASEA D   +  E +E E+    L  +F VGQLV C VL LDDDKKEAGK KIWLSLRL+
Sbjct  157   ASEALDFTDFGTEDDENEL----LRDIFSVGQLVPCFVLQLDDDKKEAGKRKIWLSLRLS  212

Query  5215  LLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDKMNTGQLVEG  5036
             LLHK  +LD+ Q G++++A +KS EDHGYILHFGLPS +GF+   +    ++ TGQL++G
Sbjct  213   LLHKGFSLDSFQPGMVVTASVKSVEDHGYILHFGLPSITGFIKKSNDGNQELKTGQLIQG  272

Query  5035  VVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFL  4856
             VV ++D+ RK+V LS+ PD++AK VTKDL G+S DLL+PGMMVNA V SVLENG++L FL
Sbjct  273   VVTNIDKERKIVSLSADPDSVAKSVTKDLSGMSFDLLIPGMMVNARVQSVLENGILLGFL  332

Query  4855  TYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPP  4676
              YFTGTVD+FHLQ      SWKD+Y Q K VNARILF+DP+TRAVGL+ NPHLV  KAPP
Sbjct  333   MYFTGTVDLFHLQNPMCNKSWKDEYTQTKMVNARILFMDPSTRAVGLTFNPHLVGNKAPP  392

Query  4675  SLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKV  4496
               V  GDIFE+AKV+RVDK  GLLLE+PS PV TPAYV   D  + EVKK+EK FK G  
Sbjct  393   LHVSSGDIFEEAKVVRVDKS-GLLLELPSKPVSTPAYVSTYDAAEDEVKKLEKNFKEGNR  451

Query  4495  VRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGV  4316
             +RVR+LG +++EGLA G+LK SAFEG  FTHSDVKPGMV KAK+I+VD+FGAIVQF  G+
Sbjct  452   IRVRILGLKHMEGLAIGTLKESAFEGPAFTHSDVKPGMVTKAKIISVDTFGAIVQFPGGL  511

Query  4315  KALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSYTD  4136
             KA+CPL+HMSEFE+ KPRKKF+VG+EL+FRVLGCKSKRITVT KKTLVKSKL ILSSY D
Sbjct  512   KAMCPLQHMSEFEVTKPRKKFKVGAELIFRVLGCKSKRITVTCKKTLVKSKLPILSSYAD  571

Query  4135  ATEGLITHGWITKIEKHGCFVRFYNGVQGF-APRSELGLDPGSDISSMYHVEQVVKCRVV  3959
             ATEGL+THGWITKIEKHGCFVRFYNGVQGF A R ELGL+PGSD SS++HV +VVKCRV 
Sbjct  572   ATEGLVTHGWITKIEKHGCFVRFYNGVQGFVASRFELGLEPGSDPSSVFHVGEVVKCRVT  631

Query  3958  SSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTVS  3779
             S+   +R+I LSF  +P  +SE + +K G++VSG+++ +TP ++ V+V + +  LKGTVS
Sbjct  632   SAVHGTRRINLSFMIKPTSVSEDDSIKLGSIVSGVIDSITPQAVTVHVKS-KGLLKGTVS  690

Query  3778  TQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQIS  3599
              +HL+DH   A LM S+L+PG+E D+LL++DI+G NL LS+KYSLI  A++LP D++Q+ 
Sbjct  691   AEHLADHHEQAKLMMSLLRPGFELDKLLIIDIDGNNLALSSKYSLIKLAEELPSDISQLQ  750

Query  3598  PHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVN  3419
             P+SVVHGYVCN+I NG FVRFLGRLTGF+PRSKA D+ R D SE F++GQSV  NI+D+N
Sbjct  751   PNSVVHGYVCNLIENGCFVRFLGRLTGFAPRSKAIDEPRADLSESFFVGQSVRANIVDIN  810

Query  3418  GETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEG  3239
              E  RIT+SLKQS C+S DA+FIQEYFL + KI+ LQS D  +S  +WV+ F +GS+V+G
Sbjct  811   QEKSRITLSLKQSSCASVDASFIQEYFLTDEKISDLQSSDITESECSWVEKFSIGSLVKG  870

Query  3238  KVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKP  3059
              VHE  E G+VV F+  D+V GFI    LGG  +E GS ++A V+D+S+ E LVDLSL+P
Sbjct  871   TVHEQNELGLVVNFDNIDNVLGFIPQYHLGGATLEHGSVVEAVVLDLSRAERLVDLSLRP  930

Query  3058  EFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGYA  2879
             E +N S  + +++++ KKKR+R   K+LEV+Q V+AVVEIVKE YL+LS+P   Y +GYA
Sbjct  931   ELINNSTKEVSSNQS-KKKRRRAISKELEVHQRVSAVVEIVKEQYLILSIPEHGYTIGYA  989

Query  2878  SLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkkns  2699
             S++D+NTQ LPVKQF  GQSV+A++ AL +S T GRLLLLL ++S ++++  SKR K  S
Sbjct  990   SISDYNTQKLPVKQFSAGQSVVASVEALQNSLTSGRLLLLLDSVSGISDTPHSKRTKNKS  1049

Query  2698  SYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARI  2519
             S  VGS+V AEIT+IKPLE+R+ FG  F GR+HITE  D +T+E P + FR+GQ+++AR+
Sbjct  1050  SCGVGSVVHAEITEIKPLEVRVNFGQSFKGRIHITEVDDVSTSEEPFSKFRVGQSVSARV  1109

Query  2518  VSKDSRSENKRGYQWELSTKPSVL--AGDMDGPH--ESFNYSTGQLLSGYVFKVDSEWAW  2351
             ++K   +  ++   WELS+KP++L  + +++G    E   + TG+ + GYV+KVD EW W
Sbjct  1110  IAKPWHTNIEKSL-WELSSKPAILRDSSELNGIQVREQLEFVTGERVRGYVYKVDKEWVW  1168

Query  2350  LTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVP-----H  2186
             LTISR V A ++ILD+  +  EL+EF +RF +GK+VSGY+L+ +KEKK  RL        
Sbjct  1169  LTISRNVTACVFILDTGCDAQELEEFDRRFPIGKAVSGYVLTYDKEKKTARLKSIANGGG  1228

Query  2185  TLLITPEDTVPSSESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLF-------GKVH  2027
                   + ++P  + A   I EG +LGGRISKILPGVGGL VQI +++F       G+VH
Sbjct  1229  CKTDNLDSSIPGVD-ATLFIHEGDILGGRISKILPGVGGLRVQIGSYVFGRVPYVVGRVH  1287

Query  2026  FTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISE-HD  1850
             FTE+ D WVS+PL G+ EGQFVKCKVL++ +S KGT  ++LSLR +LD M +  +SE  +
Sbjct  1288  FTEINDSWVSNPLDGFHEGQFVKCKVLEISNSSKGTVQIELSLRTSLDGMTSDQLSEASN  1347

Query  1849  DVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEK  1670
             D  +  +R + I+DL PDM +QGYVKN   KGCFIMLSRK+DAK+LLSNL+D F++ PEK
Sbjct  1348  DNVNICKRFERIEDLSPDMAIQGYVKNTMSKGCFIMLSRKLDAKVLLSNLSDTFVKDPEK  1407

Query  1669  EFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGKIKRIES  1490
             EFPVGKLVTG+V++VESLSKRVEVTL+  ++    KS+   L  F  G++ISG IKR+E 
Sbjct  1408  EFPVGKLVTGRVLNVESLSKRVEVTLKKGNAGGQPKSESYDLKQFHVGDVISGSIKRVEP  1467

Query  1489  FGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNS  1310
             +GLFI++DNT++VGLCH S+LSDD I++VQ+RY+AG++V  K+LK+D+++ RISLGMK+S
Sbjct  1468  YGLFITIDNTSMVGLCHKSQLSDDRIEDVQARYEAGESVTAKILKLDEEKQRISLGMKSS  1527

Query  1309  YFRDDDGEDIQTTSRQSINSTDKGNSVFIGTQSTVFPESSDADIDVSVVNTTDNILTEVE  1130
             YF +DD +  Q  S ++     K +S+             D +      + +  +L++VE
Sbjct  1528  YFMNDDDDKTQPPSDENA----KEDSM-----------ECDPETGYERHSGSSLVLSQVE  1572

Query  1129  SRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkramkkakkerereiraa  950
             SRASIP LEV +DDIE S  D+  N   +   G D  DEK K+R  +K K+ERER+I+AA
Sbjct  1573  SRASIPALEVNIDDIEESGFDNDQN---EKLQGVD-KDEKSKRREKQKDKEERERKIQAA  1628

Query  949   eerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIR  770
             E RLLE   P + DEFEKLVRSSPNSSFVWIKYMAFMLSL D+EKARSIAE+A+ TINIR
Sbjct  1629  EGRLLENHAPESADEFEKLVRSSPNSSFVWIKYMAFMLSLADIEKARSIAERALRTINIR  1688

Query  769   EESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLG  590
             EE EKLN+WVAYFNLE E+G+PP+EAV KVF+RA QYCDPKKV+ ALLGVYERTE YKL 
Sbjct  1689  EEDEKLNIWVAYFNLENEHGSPPEEAVKKVFERARQYCDPKKVYHALLGVYERTEQYKLA  1748

Query  589   DELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLCLPKHKHIKFITQTAILE  410
             D+LL++M+KKFK SCK+WLR++Q  LKQ++D+ QSIVNRALLCLP+HKHIKFI+QTAILE
Sbjct  1749  DKLLDEMIKKFKQSCKVWLRKVQSHLKQDEDDIQSIVNRALLCLPRHKHIKFISQTAILE  1808

Query  409   FKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKM  230
             FKCGVA+RGRS+FE +L+EYPKRTDLWSVYLDQEIR+G++DVIR+LFERAISLS+PPKKM
Sbjct  1809  FKCGVAERGRSLFEGVLREYPKRTDLWSVYLDQEIRLGEVDVIRSLFERAISLSLPPKKM  1868

Query  229   KFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             KFLFKK+L YEK+ GD+ER+E VK++AMEY +S
Sbjct  1869  KFLFKKFLEYEKTAGDDERVEYVKQRAMEYADS  1901



>ref|XP_009146661.1| PREDICTED: protein RRP5 homolog isoform X2 [Brassica rapa]
Length=1930

 Score =  2144 bits (5556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1139/1913 (60%), Positives = 1462/1913 (76%), Gaps = 63/1913 (3%)
 Frame = -2

Query  5749  KSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhk-lykKNQS  5573
             ++  LQLED VPDFPRGG + LSK E  ++  EVDAEFEAE+R  K+ K  K   K+N S
Sbjct  38    EAMALQLED-VPDFPRGGGTSLSKTERKKIYEEVDAEFEAEERVSKRSKGGKPNKKRNPS  96

Query  5572  VEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVL  5393
               D+LGSLF   ++GK P+ AN+IT KNISPGMKL GV+ EVN+KDIV+SLPGGLRGLV 
Sbjct  97    EVDELGSLFDGGLTGKRPRYANKITIKNISPGMKLLGVVTEVNQKDIVISLPGGLRGLVR  156

Query  5392  ASEAHDPL-WDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLA  5216
             ASEA D   +  E +E E+    L  +F VGQLV C VL LDDDKKEAGK KIWLSLRL+
Sbjct  157   ASEALDFTDFGTEDDENEL----LRDIFSVGQLVPCFVLQLDDDKKEAGKRKIWLSLRLS  212

Query  5215  LLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDKMNTGQLVEG  5036
             LLHK  +LD+ Q G++++A +KS EDHGYILHFGLPS +GF+   +    ++ TGQL++G
Sbjct  213   LLHKGFSLDSFQPGMVVTASVKSVEDHGYILHFGLPSITGFIKKSNDGNQELKTGQLIQG  272

Query  5035  VVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFL  4856
             VV ++D+ RK+V LS+ PD++AK VTKDL G+S DLL+PGMMVNA V SVLENG++L FL
Sbjct  273   VVTNIDKERKIVSLSADPDSVAKCVTKDLSGMSFDLLIPGMMVNARVQSVLENGILLGFL  332

Query  4855  TYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPP  4676
              YFTGTVD+FHLQ      SWKD+Y Q K VNARILF+DP+TRAVGL+LNPHLV  KAPP
Sbjct  333   MYFTGTVDLFHLQNPMCNKSWKDEYTQTKMVNARILFMDPSTRAVGLTLNPHLVGNKAPP  392

Query  4675  SLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKV  4496
               V  GDIF++AKV+RVDK  GLLLE+ S PV TPAYV   D  + EVKK+EK FK G  
Sbjct  393   LHVSSGDIFDEAKVVRVDKS-GLLLELLSKPVSTPAYVSTYDAAEDEVKKLEKNFKEGNR  451

Query  4495  VRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGV  4316
             +RVR+LG +++EGLA G+LK SAFEG  FTHSDVKPGMV KAK+I+VD+FGAIVQF  G+
Sbjct  452   IRVRILGLKHMEGLAIGTLKESAFEGPAFTHSDVKPGMVTKAKIISVDTFGAIVQFPGGL  511

Query  4315  KALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSYTD  4136
             KA+CPL+HMSEFE+ KPRKKF+VG+EL+FRVLGCKSKRITVT KKTLVKSKL ILSSY D
Sbjct  512   KAMCPLQHMSEFEVTKPRKKFKVGAELIFRVLGCKSKRITVTCKKTLVKSKLPILSSYAD  571

Query  4135  ATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVS  3956
             ATEGL+THGWITKIEKHGCFVRFYNGVQGF  R ELGL+PGSD SS++HV +VVKCRV S
Sbjct  572   ATEGLVTHGWITKIEKHGCFVRFYNGVQGFVARFELGLEPGSDPSSVFHVGEVVKCRVTS  631

Query  3955  SSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTVST  3776
             +   +R+I LSF  +P  +SE + +K G++VSG+++ +TP ++ V+V + +  LKGTVS 
Sbjct  632   AVHGTRRINLSFMIKPTSVSEDDSIKLGSIVSGVIDSITPQAVTVHVKS-KGLLKGTVSA  690

Query  3775  QHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQISP  3596
             +HL+DH   A LM S+L+PG+E D+LL++DI+G NL LS+KYSLI  A++LP D++Q+ P
Sbjct  691   EHLADHHEQAKLMMSLLRPGFELDKLLIIDIDGNNLALSSKYSLIKLAEELPSDISQLQP  750

Query  3595  HSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVNG  3416
             +SVVHGYVCN+I NG FVRFLGRLTGF+PRSKA D+ R D SE F++GQSV  NI+D+N 
Sbjct  751   NSVVHGYVCNLIENGCFVRFLGRLTGFAPRSKAIDEPRADLSESFFVGQSVRANIVDINQ  810

Query  3415  ETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGK  3236
             E  RIT+SLKQS C+S DA+FIQEYFL + KI+ LQS D  +S  +WV+ F +GS+V+G 
Sbjct  811   EKSRITLSLKQSSCASVDASFIQEYFLTDEKISDLQSSDITESECSWVEKFSIGSLVKGT  870

Query  3235  VHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPE  3056
             VHE  E G+VV F+  D+V GFI    LGG  +E GS ++A V+D+S+ E LVDLSL+PE
Sbjct  871   VHEQNELGLVVNFDNIDNVLGFIPQYHLGGATLEHGSVVEAVVLDLSRAERLVDLSLRPE  930

Query  3055  FVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGYAS  2876
              +N S  + +++++ KKKR+R   K+LEV+Q V+AVVEIVKE YL+LS+P   Y +GYAS
Sbjct  931   LINNSTKEVSSNQS-KKKRRRAISKELEVHQRVSAVVEIVKEQYLILSIPEHGYTIGYAS  989

Query  2875  LNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkknsS  2696
             ++D+NTQ LPVKQF  GQSV+A++ AL  S T GRLLLLL ++S ++++  SKR K  SS
Sbjct  990   ISDYNTQKLPVKQFSAGQSVVASVEALQKSLTSGRLLLLLDSVSGISDTPHSKRTKNKSS  1049

Query  2695  YDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARIV  2516
               VGS+V AEIT+IKPLE+R+ FG  F GR+HITE  D +T++ P +  R+GQ+++AR++
Sbjct  1050  CGVGSVVHAEITEIKPLEVRVNFGQSFRGRIHITEVDDVSTSDEPFSKLRVGQSVSARVI  1109

Query  2515  SKDSRSENKRGYQWELSTKPSVL--AGDMDGPH--ESFNYSTGQLLSGYVFKVDSEWAWL  2348
             +K   +  ++   WELS+KP++L  + +++G    E   + TG+ + GYV+KVD EW WL
Sbjct  1110  AKPWHTNIEKSL-WELSSKPAILRDSSELNGIQVREQLEFVTGERVRGYVYKVDKEWVWL  1168

Query  2347  TISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTLLITP  2168
             TISR V A ++ILD+  +  EL+EF++RF +GK+VSGY+L+ +KEKK  RLV   LL   
Sbjct  1169  TISRNVTACVFILDTGCDAQELEEFERRFPIGKAVSGYVLTYDKEKKTARLVQRPLLDIQ  1228

Query  2167  E----------DTVPSS---ESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLF----  2039
             +          D + SS     A   I EG +LGGRISKILPGVGGL VQI +++F    
Sbjct  1229  KSIANGGGCKTDNLDSSIPGVDATLFIHEGDILGGRISKILPGVGGLRVQIGSYVFGRVP  1288

Query  2038  ---GKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQ  1868
                G+VHFTE+ D WVS+PL G+ EGQFVKCKVL++ +S KGT  ++LSLR +LD M + 
Sbjct  1289  YVVGRVHFTEINDSWVSNPLDGFHEGQFVKCKVLEISNSSKGTLQIELSLRTSLDGMTSD  1348

Query  1867  NISE-HDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADG  1691
              +SE  +D  +  +R + I+ L PDM +QGYVKN   KGCFIMLSRK+DAK+LLSNL+D 
Sbjct  1349  QLSEASNDNVNICKRFERIEGLSPDMAIQGYVKNTMSKGCFIMLSRKLDAKVLLSNLSDT  1408

Query  1690  FIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISG  1511
             F++ PEKEFPVGKLVTG+V++VESLSKRVEVTL+  ++    KS+   L  F  G++ISG
Sbjct  1409  FVKDPEKEFPVGKLVTGRVLNVESLSKRVEVTLKKGNAGGQPKSESYDLKQFHVGDVISG  1468

Query  1510  KIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRI  1331
              IKR+E +GLFI++DNT++VGLCH S+LSDD I++VQ+RY+AG++V  K+LK+D+++ RI
Sbjct  1469  SIKRVEPYGLFITIDNTSMVGLCHKSQLSDDRIEDVQARYEAGESVTAKILKLDEEKQRI  1528

Query  1330  SLGMKNSYFRDDDGEDIQTTSRQS----------INSTDKGNSVFIGT---QSTVFPESS  1190
             SLGMK+SYF +DD +  Q  S ++          +N +  G    +G    Q T +    
Sbjct  1529  SLGMKSSYFMNDDDDKAQPPSDENAKEDSMECDPVNDSKSGVLAAVGDFGFQETGYERHR  1588

Query  1189  DADIDVSVVNTTDNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDek  1010
              + +          +L++VESRASIP LEV LDDIE S  D+  N   +   G D  DEK
Sbjct  1589  GSSL----------VLSQVESRASIPALEVNLDDIEESGFDNDQN---EKLQGVD-KDEK  1634

Query  1009  dkkramkkakkerereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSL  830
              K+R  +K K+ERER+I+AAE RLLE   P + DEFEKLVRSSPNSSFVWIKYMAFMLSL
Sbjct  1635  SKRREKQKDKEERERKIQAAEGRLLENHAPESADEFEKLVRSSPNSSFVWIKYMAFMLSL  1694

Query  829   GDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDP  650
              D+EKARSIAE+A+ TINIREE EKLN+WVAYFNLE E+G+PP+EAV KVF+RA QYCDP
Sbjct  1695  ADIEKARSIAERALRTINIREEDEKLNIWVAYFNLENEHGSPPEEAVKKVFERARQYCDP  1754

Query  649   KKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRA  470
             KKV+ ALLGVYERTE YKL D+LL++M+KKFK SCK+WLR++Q  LKQ++D+ QSIVNRA
Sbjct  1755  KKVYHALLGVYERTEQYKLADKLLDEMIKKFKQSCKVWLRKVQSHLKQDEDDIQSIVNRA  1814

Query  469   LLCLPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDM  290
             LLCLP+HKHIKFI+QTAILEFKCGVA+RGRS+FE +L+EYPKRTDLWSVYLDQEIR+G++
Sbjct  1815  LLCLPRHKHIKFISQTAILEFKCGVAERGRSLFEGVLREYPKRTDLWSVYLDQEIRLGEV  1874

Query  289   DVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             DVIR+LFERAISLS+PPKKMKFLFKK+L YEK+ GD+ER+E VK++AMEY +S
Sbjct  1875  DVIRSLFERAISLSLPPKKMKFLFKKFLEYEKTAGDDERVEYVKQRAMEYADS  1927



>ref|XP_009146660.1| PREDICTED: protein RRP5 homolog isoform X1 [Brassica rapa]
Length=1931

 Score =  2144 bits (5554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1139/1914 (60%), Positives = 1462/1914 (76%), Gaps = 64/1914 (3%)
 Frame = -2

Query  5749  KSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhk-lykKNQS  5573
             ++  LQLED VPDFPRGG + LSK E  ++  EVDAEFEAE+R  K+ K  K   K+N S
Sbjct  38    EAMALQLED-VPDFPRGGGTSLSKTERKKIYEEVDAEFEAEERVSKRSKGGKPNKKRNPS  96

Query  5572  VEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVL  5393
               D+LGSLF   ++GK P+ AN+IT KNISPGMKL GV+ EVN+KDIV+SLPGGLRGLV 
Sbjct  97    EVDELGSLFDGGLTGKRPRYANKITIKNISPGMKLLGVVTEVNQKDIVISLPGGLRGLVR  156

Query  5392  ASEAHDPL-WDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLA  5216
             ASEA D   +  E +E E+    L  +F VGQLV C VL LDDDKKEAGK KIWLSLRL+
Sbjct  157   ASEALDFTDFGTEDDENEL----LRDIFSVGQLVPCFVLQLDDDKKEAGKRKIWLSLRLS  212

Query  5215  LLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDKMNTGQLVEG  5036
             LLHK  +LD+ Q G++++A +KS EDHGYILHFGLPS +GF+   +    ++ TGQL++G
Sbjct  213   LLHKGFSLDSFQPGMVVTASVKSVEDHGYILHFGLPSITGFIKKSNDGNQELKTGQLIQG  272

Query  5035  VVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFL  4856
             VV ++D+ RK+V LS+ PD++AK VTKDL G+S DLL+PGMMVNA V SVLENG++L FL
Sbjct  273   VVTNIDKERKIVSLSADPDSVAKCVTKDLSGMSFDLLIPGMMVNARVQSVLENGILLGFL  332

Query  4855  TYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPP  4676
              YFTGTVD+FHLQ      SWKD+Y Q K VNARILF+DP+TRAVGL+LNPHLV  KAPP
Sbjct  333   MYFTGTVDLFHLQNPMCNKSWKDEYTQTKMVNARILFMDPSTRAVGLTLNPHLVGNKAPP  392

Query  4675  SLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKV  4496
               V  GDIF++AKV+RVDK  GLLLE+ S PV TPAYV   D  + EVKK+EK FK G  
Sbjct  393   LHVSSGDIFDEAKVVRVDKS-GLLLELLSKPVSTPAYVSTYDAAEDEVKKLEKNFKEGNR  451

Query  4495  VRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGV  4316
             +RVR+LG +++EGLA G+LK SAFEG  FTHSDVKPGMV KAK+I+VD+FGAIVQF  G+
Sbjct  452   IRVRILGLKHMEGLAIGTLKESAFEGPAFTHSDVKPGMVTKAKIISVDTFGAIVQFPGGL  511

Query  4315  KALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSYTD  4136
             KA+CPL+HMSEFE+ KPRKKF+VG+EL+FRVLGCKSKRITVT KKTLVKSKL ILSSY D
Sbjct  512   KAMCPLQHMSEFEVTKPRKKFKVGAELIFRVLGCKSKRITVTCKKTLVKSKLPILSSYAD  571

Query  4135  ATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVS  3956
             ATEGL+THGWITKIEKHGCFVRFYNGVQGF  R ELGL+PGSD SS++HV +VVKCRV S
Sbjct  572   ATEGLVTHGWITKIEKHGCFVRFYNGVQGFVARFELGLEPGSDPSSVFHVGEVVKCRVTS  631

Query  3955  SSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTVST  3776
             +   +R+I LSF  +P  +SE + +K G++VSG+++ +TP ++ V+V + +  LKGTVS 
Sbjct  632   AVHGTRRINLSFMIKPTSVSEDDSIKLGSIVSGVIDSITPQAVTVHVKS-KGLLKGTVSA  690

Query  3775  QHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQISP  3596
             +HL+DH   A LM S+L+PG+E D+LL++DI+G NL LS+KYSLI  A++LP D++Q+ P
Sbjct  691   EHLADHHEQAKLMMSLLRPGFELDKLLIIDIDGNNLALSSKYSLIKLAEELPSDISQLQP  750

Query  3595  HSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVNG  3416
             +SVVHGYVCN+I NG FVRFLGRLTGF+PRSKA D+ R D SE F++GQSV  NI+D+N 
Sbjct  751   NSVVHGYVCNLIENGCFVRFLGRLTGFAPRSKAIDEPRADLSESFFVGQSVRANIVDINQ  810

Query  3415  ETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGK  3236
             E  RIT+SLKQS C+S DA+FIQEYFL + KI+ LQS D  +S  +WV+ F +GS+V+G 
Sbjct  811   EKSRITLSLKQSSCASVDASFIQEYFLTDEKISDLQSSDITESECSWVEKFSIGSLVKGT  870

Query  3235  VHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPE  3056
             VHE  E G+VV F+  D+V GFI    LGG  +E GS ++A V+D+S+ E LVDLSL+PE
Sbjct  871   VHEQNELGLVVNFDNIDNVLGFIPQYHLGGATLEHGSVVEAVVLDLSRAERLVDLSLRPE  930

Query  3055  FVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGYAS  2876
              +N S  + +++++ KKKR+R   K+LEV+Q V+AVVEIVKE YL+LS+P   Y +GYAS
Sbjct  931   LINNSTKEVSSNQS-KKKRRRAISKELEVHQRVSAVVEIVKEQYLILSIPEHGYTIGYAS  989

Query  2875  LNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkknsS  2696
             ++D+NTQ LPVKQF  GQSV+A++ AL  S T GRLLLLL ++S ++++  SKR K  SS
Sbjct  990   ISDYNTQKLPVKQFSAGQSVVASVEALQKSLTSGRLLLLLDSVSGISDTPHSKRTKNKSS  1049

Query  2695  YDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARIV  2516
               VGS+V AEIT+IKPLE+R+ FG  F GR+HITE  D +T++ P +  R+GQ+++AR++
Sbjct  1050  CGVGSVVHAEITEIKPLEVRVNFGQSFRGRIHITEVDDVSTSDEPFSKLRVGQSVSARVI  1109

Query  2515  SKDSRSENKRGYQWELSTKPSVL---AGDMDGPH--ESFNYSTGQLLSGYVFKVDSEWAW  2351
             +K   +  ++   WELS+KP++L   + +++G    E   + TG+ + GYV+KVD EW W
Sbjct  1110  AKPWHTNIEKSL-WELSSKPAILRVDSSELNGIQVREQLEFVTGERVRGYVYKVDKEWVW  1168

Query  2350  LTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTLLIT  2171
             LTISR V A ++ILD+  +  EL+EF++RF +GK+VSGY+L+ +KEKK  RLV   LL  
Sbjct  1169  LTISRNVTACVFILDTGCDAQELEEFERRFPIGKAVSGYVLTYDKEKKTARLVQRPLLDI  1228

Query  2170  PE----------DTVPSS---ESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLF---  2039
              +          D + SS     A   I EG +LGGRISKILPGVGGL VQI +++F   
Sbjct  1229  QKSIANGGGCKTDNLDSSIPGVDATLFIHEGDILGGRISKILPGVGGLRVQIGSYVFGRV  1288

Query  2038  ----GKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNN  1871
                 G+VHFTE+ D WVS+PL G+ EGQFVKCKVL++ +S KGT  ++LSLR +LD M +
Sbjct  1289  PYVVGRVHFTEINDSWVSNPLDGFHEGQFVKCKVLEISNSSKGTLQIELSLRTSLDGMTS  1348

Query  1870  QNISE-HDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLAD  1694
               +SE  +D  +  +R + I+ L PDM +QGYVKN   KGCFIMLSRK+DAK+LLSNL+D
Sbjct  1349  DQLSEASNDNVNICKRFERIEGLSPDMAIQGYVKNTMSKGCFIMLSRKLDAKVLLSNLSD  1408

Query  1693  GFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIIS  1514
              F++ PEKEFPVGKLVTG+V++VESLSKRVEVTL+  ++    KS+   L  F  G++IS
Sbjct  1409  TFVKDPEKEFPVGKLVTGRVLNVESLSKRVEVTLKKGNAGGQPKSESYDLKQFHVGDVIS  1468

Query  1513  GKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHR  1334
             G IKR+E +GLFI++DNT++VGLCH S+LSDD I++VQ+RY+AG++V  K+LK+D+++ R
Sbjct  1469  GSIKRVEPYGLFITIDNTSMVGLCHKSQLSDDRIEDVQARYEAGESVTAKILKLDEEKQR  1528

Query  1333  ISLGMKNSYFRDDDGEDIQTTSRQS----------INSTDKGNSVFIGT---QSTVFPES  1193
             ISLGMK+SYF +DD +  Q  S ++          +N +  G    +G    Q T +   
Sbjct  1529  ISLGMKSSYFMNDDDDKAQPPSDENAKEDSMECDPVNDSKSGVLAAVGDFGFQETGYERH  1588

Query  1192  SDADIDVSVVNTTDNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDe  1013
               + +          +L++VESRASIP LEV LDDIE S  D+  N   +   G D  DE
Sbjct  1589  RGSSL----------VLSQVESRASIPALEVNLDDIEESGFDNDQN---EKLQGVD-KDE  1634

Query  1012  kdkkramkkakkerereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLS  833
             K K+R  +K K+ERER+I+AAE RLLE   P + DEFEKLVRSSPNSSFVWIKYMAFMLS
Sbjct  1635  KSKRREKQKDKEERERKIQAAEGRLLENHAPESADEFEKLVRSSPNSSFVWIKYMAFMLS  1694

Query  832   LGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCD  653
             L D+EKARSIAE+A+ TINIREE EKLN+WVAYFNLE E+G+PP+EAV KVF+RA QYCD
Sbjct  1695  LADIEKARSIAERALRTINIREEDEKLNIWVAYFNLENEHGSPPEEAVKKVFERARQYCD  1754

Query  652   PKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNR  473
             PKKV+ ALLGVYERTE YKL D+LL++M+KKFK SCK+WLR++Q  LKQ++D+ QSIVNR
Sbjct  1755  PKKVYHALLGVYERTEQYKLADKLLDEMIKKFKQSCKVWLRKVQSHLKQDEDDIQSIVNR  1814

Query  472   ALLCLPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGD  293
             ALLCLP+HKHIKFI+QTAILEFKCGVA+RGRS+FE +L+EYPKRTDLWSVYLDQEIR+G+
Sbjct  1815  ALLCLPRHKHIKFISQTAILEFKCGVAERGRSLFEGVLREYPKRTDLWSVYLDQEIRLGE  1874

Query  292   MDVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             +DVIR+LFERAISLS+PPKKMKFLFKK+L YEK+ GD+ER+E VK++AMEY +S
Sbjct  1875  VDVIRSLFERAISLSLPPKKMKFLFKKFLEYEKTAGDDERVEYVKQRAMEYADS  1928



>ref|XP_009121016.1| PREDICTED: protein RRP5 homolog [Brassica rapa]
Length=1905

 Score =  2124 bits (5503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1128/1911 (59%), Positives = 1446/1911 (76%), Gaps = 52/1911 (3%)
 Frame = -2

Query  5806  KNFKRKGKNNEAGNASFSGKSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAE  5627
             K FKR  K++ A       ++  LQLE EVPDFPRGG S LSK+E +++  EVDAEF+A 
Sbjct  25    KPFKRTKKDDVAARP----EAMALQLE-EVPDFPRGGGSSLSKKEREKIHEEVDAEFDAG  79

Query  5626  D-RylkkkkqhklykKNQSVEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAE  5450
             D R  K+ K  K  K+N S  D+LGSLF   ++GK P+ AN+IT KNIS GMKL GV+ E
Sbjct  80    DERVAKRSKGGKPKKRNTSDVDELGSLFDGGLTGKRPRYANKITIKNISAGMKLLGVVTE  139

Query  5449  VNEKDIVVSLPGGLRGLVLASEAHDPL-WDNETNEMEMQSNYLSGLFHVGQLVSCIVLHL  5273
             VN+KDIV+SLPGGLRGLV ASEA D   +  E +E E+    L  +F VGQLV CIVL L
Sbjct  140   VNQKDIVISLPGGLRGLVRASEALDFTDFGTEDDENEL----LRDIFSVGQLVPCIVLQL  195

Query  5272  DDDKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGF  5093
             DDDKKEAGK KIWLSLRL+LLHK  +LD+ Q G++++A +KS EDHGYIL FG+PS +GF
Sbjct  196   DDDKKEAGKRKIWLSLRLSLLHKGFSLDSFQPGMVVTANVKSVEDHGYILQFGMPSITGF  255

Query  5092  LPIHSQSVDKMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGM  4913
             +    +   ++ TGQL++GVV ++D+ RK+V LSS PD++AK VTKDL G+S DLL+PGM
Sbjct  256   IKKSHEGTRELKTGQLIQGVVTNIDKERKIVSLSSDPDSVAKCVTKDLSGMSFDLLIPGM  315

Query  4912  MVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPA  4733
             MVNA V S LENG++L FL YFTGTVD+FHLQ      SWKD+Y  +K VNARILFIDP+
Sbjct  316   MVNARVQSALENGLLLGFLMYFTGTVDLFHLQNPLCNKSWKDEYNPSKMVNARILFIDPS  375

Query  4732  TRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYIS  4553
             TRAVGL+LNPHLV  KAPP  V  GDIF++A V+RVDK  GLLLE+PS PV TPAYV   
Sbjct  376   TRAVGLTLNPHLVGNKAPPLHVSSGDIFDEANVVRVDKS-GLLLELPSKPVSTPAYVSTY  434

Query  4552  dvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVK  4373
             D  + EVKK+EK FK G  +RVRVLG + +EGLA G+LK SAFEG  FTHSDVKPGMV K
Sbjct  435   DAAEDEVKKLEKKFKEGSRIRVRVLGLKQIEGLAIGTLKESAFEGPAFTHSDVKPGMVTK  494

Query  4372  AKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITV  4193
              KVI+VD+FGAIVQF  G+KA+CPL+HMSEFE+ KPRKKF+VG+EL+FRVLGCKSKRITV
Sbjct  495   GKVISVDTFGAIVQFPGGLKAMCPLQHMSEFEVRKPRKKFKVGAELIFRVLGCKSKRITV  554

Query  4192  THKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPG  4013
             T KKTLVKSKL IL SY DATEGL+THGWITKIEK+GCFVRFYNGVQGF  R ELGL+PG
Sbjct  555   TCKKTLVKSKLPILCSYADATEGLVTHGWITKIEKNGCFVRFYNGVQGFVARFELGLEPG  614

Query  4012  SDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPD  3833
             SD +S++H+ +VVKCRV S+   +R+I L+           + +K G++VSG+++ +TP 
Sbjct  615   SDPASVFHIGEVVKCRVTSAVHGTRRINLN-----------DSIKLGSIVSGVIDSITPQ  663

Query  3832  SIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAK  3653
              +++ +      LKGT+  +HL+DH   A LM S+L+PG+E D+LLV+DIEG NL LS+K
Sbjct  664   GVILRLKG--KLLKGTIFAEHLADHHDQAKLMISLLRPGFELDKLLVIDIEGNNLALSSK  721

Query  3652  YSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDT  3473
             YSLI  A++LP D++Q+ P+SVVHGYVCN+I NG FVRFLGRLTGF+PRSKA D+ R D 
Sbjct  722   YSLIKFAEELPSDLSQLQPNSVVHGYVCNLIENGCFVRFLGRLTGFAPRSKAIDEPRADL  781

Query  3472  SEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSA  3293
             SE F++GQSV  NI+DVN E  R+T+SLKQS C+S DA+F+QEYFL + KI+ LQS D  
Sbjct  782   SESFFVGQSVRANIVDVNQEKSRVTLSLKQSSCASVDASFVQEYFLTDEKISNLQSSDIT  841

Query  3292  DSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQA  3113
             +S  +WV+ F +GS++ G V +  + G+VV F+  ++V GFI    LGG ++E GS +QA
Sbjct  842   ESECSWVEKFSIGSLIMGTVQDKNDLGLVVNFDNINNVLGFIPKYHLGGTSLENGSVVQA  901

Query  3112  AVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVK  2933
              V+D+S+ E LVDLSL+PE +N S  + +N +  KKKRKR   K+LEV+Q V+AVVEIVK
Sbjct  902   VVLDISRAERLVDLSLRPELINSSAKEVSN-RQSKKKRKRGISKELEVHQRVSAVVEIVK  960

Query  2932  ENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLK  2753
             E YL+LS+P  NY +GYA+++D+NTQ LPVKQF  GQSV+A++ AL +  T GRLLLLL 
Sbjct  961   EQYLILSIPEHNYTIGYAAVSDYNTQKLPVKQFTTGQSVVASVEALQNPLTSGRLLLLLD  1020

Query  2752  AISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNT  2573
             +    +  +SSKR KK ++ +VGS+VQAEIT+IKP E+R+ FG  F GR+HITE  D  T
Sbjct  1021  S-VSGSSETSSKRAKKKANCEVGSVVQAEITEIKPFEVRVNFGQSFRGRIHITEVNDVGT  1079

Query  2572  TEGPLNDFRIGQTLTARIVSKDSRSENKRGYQWELSTKPSVL--AGDMDGPHESFNYSTG  2399
              E P   FR+GQ+++AR+V+K   ++NK+   WELS KP++L  +G++    E   + +G
Sbjct  1080  NEEPFAKFRVGQSVSARVVAKPCHTDNKKSQLWELSVKPAILRDSGELTEVREQLEFVSG  1139

Query  2398  QLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSAN  2219
             + + GYV+KVD EW WL ISR V A+++ILD++ E  EL+EF+ RF +GK+VSGY+L+ N
Sbjct  1140  EPVCGYVYKVDKEWVWLAISRNVTARIFILDTACEARELEEFEGRFPIGKAVSGYVLTYN  1199

Query  2218  KEKKLLRLVPHTLLIT----------PEDTVPSS---ESARCHIREGSVLGGRISKILPG  2078
             KEKK +RLV   LL             +D + SS   + A   I EG +LGGRISKILPG
Sbjct  1200  KEKKTVRLVQRPLLNIQKSIGNDGGPKKDKLDSSIPGDDATLFIHEGDILGGRISKILPG  1259

Query  2077  VGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSL  1898
             VGGL VQI  ++FG+VHFTE+ D W+S+PL G  EGQFVKCKVL++ +S KGT  ++LSL
Sbjct  1260  VGGLRVQIGPYVFGRVHFTEINDSWLSNPLDGLHEGQFVKCKVLEISNSSKGTLQIELSL  1319

Query  1897  RWTLDTMNNQNISEHDDVHSQN--RRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVD  1724
             R +LD M++ +ISE     S N  +R + I+DL PDM ++GYVKN   KGCFIMLSR +D
Sbjct  1320  RTSLDGMSSDHISE---ASSNNVFKRFERIEDLSPDMGIEGYVKNTMSKGCFIMLSRTLD  1376

Query  1723  AKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDAL  1544
             AK+LLSNL+D F++ PE EFPVGKLVTG+V++VE LSKRVEVTL+  ++  P KS+   L
Sbjct  1377  AKVLLSNLSDTFVKDPENEFPVGKLVTGRVLNVEPLSKRVEVTLKKVNAGGPSKSESYDL  1436

Query  1543  NNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvk  1364
               F  G++ISG+IKR+E +GLFI +D T +VGLCH S+LSD+HI+++ +RY+AG++V  K
Sbjct  1437  KQFHVGDMISGRIKRVEPYGLFIEIDQTGMVGLCHKSQLSDNHIEDIHARYEAGESVTAK  1496

Query  1363  vlkvdkdRHRISLGMKNSYFRDDDGEDIQTTSRQSINSTDKGNSVFIGTQSTVFPESSDA  1184
             +LK+D++R RISLGMK+SYF + D +  Q  S ++ +           ++S V     D 
Sbjct  1497  ILKLDEERRRISLGMKSSYFVNGDDDTAQPRSEENADEASMECDPINDSKSGVLAAVGDF  1556

Query  1183  DIDVSVVNTTDNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdk  1004
                 +   T+  I  +VESRASI PLEV LDDIE +D+D   N+      GAD  DEK K
Sbjct  1557  GFQETNSGTSLAI-AQVESRASILPLEVDLDDIEEADLDKNQNQK---LQGADK-DEKSK  1611

Query  1003  kramkkakkerereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGD  824
             ++  +K K+ERE++I+AAE RLLE   P + DEFEK+VRSSPNSSFVWIKYMAFMLSL D
Sbjct  1612  RKEKQKDKEEREKKIQAAEGRLLENHAPESADEFEKMVRSSPNSSFVWIKYMAFMLSLAD  1671

Query  823   VEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKK  644
             +EKARSIAE+A+ TINIREE EKLN+WVAYFNLE E+G+PP+EAV KVF+RA QYCDPKK
Sbjct  1672  IEKARSIAERALRTINIREEEEKLNIWVAYFNLENEHGSPPEEAVKKVFERARQYCDPKK  1731

Query  643   VHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALL  464
             V+ ALLGVYERTE YKL D+LL++M+KKFK SCK+WLR+IQ  LKQ+++N QS+VNRALL
Sbjct  1732  VYNALLGVYERTEQYKLADKLLDEMIKKFKQSCKVWLRKIQSYLKQDEENIQSVVNRALL  1791

Query  463   CLPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDV  284
             CLP+HKHIKFI+QTAILEFKCGVADRGRS+FE +L+EYPKRTDLWSVYLDQEIR+G++DV
Sbjct  1792  CLPRHKHIKFISQTAILEFKCGVADRGRSLFEGVLREYPKRTDLWSVYLDQEIRLGEVDV  1851

Query  283   IRALFERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             IR+LFERAISLS+PPKKMKFLFKK+L YEK+ GDEER+E VK++AMEY +S
Sbjct  1852  IRSLFERAISLSLPPKKMKFLFKKFLEYEKAAGDEERVEYVKQRAMEYADS  1902



>ref|NP_187803.4| protein ribosomal RNA processing 5 [Arabidopsis thaliana]
 gb|AEE75131.1| protein ribosomal RNA processing 5 [Arabidopsis thaliana]
Length=1896

 Score =  2120 bits (5493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1135/1904 (60%), Positives = 1437/1904 (75%), Gaps = 80/1904 (4%)
 Frame = -2

Query  5749  KSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhklykKNQSV  5570
             ++  LQLED VPDFPRGG + LSK+E +++  EVDAEF+A++R  KK K  K  K+  S 
Sbjct  39    EAMALQLED-VPDFPRGGGTSLSKKEREKLYEEVDAEFDADERVSKKSKGGKSKKRIPSD  97

Query  5569  EDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLA  5390
              DDLG LFG  + GK P+ AN+IT KNISPGMKL GV+ EVN+KDIV+SLPGGLRGLV A
Sbjct  98    LDDLGLLFGGGLHGKRPRYANKITTKNISPGMKLLGVVTEVNQKDIVISLPGGLRGLVRA  157

Query  5389  SEAHDPLWDN--ETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLA  5216
             SE  D   D   E +E E+    L  +F VGQLV CIVL LDDDKKEAGK KIWLSLRL+
Sbjct  158   SEVSD-FTDRGIEDDENEL----LGDIFSVGQLVPCIVLELDDDKKEAGKRKIWLSLRLS  212

Query  5215  LLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDK--MNTGQLV  5042
             LLHK  + D+ Q G++ SA +KS EDHG ILHFGLPS +GF+ I      +  M TGQL+
Sbjct  213   LLHKGFSFDSFQLGMVFSANVKSIEDHGSILHFGLPSITGFIEISDDGNQESGMKTGQLI  272

Query  5041  EGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLS  4862
             +GVV  +DR RK+V+LSS PD++AK +TKDL G+S DLL+PGMMVNA V SVLENG++  
Sbjct  273   QGVVTKIDRDRKIVHLSSDPDSVAKCLTKDLSGMSFDLLIPGMMVNARVQSVLENGILFD  332

Query  4861  FLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKA  4682
             FLTYF GTVD+FHL+      SWKD+Y QNK VNARILFIDP++RAVGL+L+PH+V  KA
Sbjct  333   FLTYFNGTVDLFHLKNPLSNKSWKDEYNQNKTVNARILFIDPSSRAVGLTLSPHVVCNKA  392

Query  4681  PPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPG  4502
             PP  V  GDIF++AKV+R+DK  GLLLE+PS P PTPAYV               +FK G
Sbjct  393   PPLHVFSGDIFDEAKVVRIDKS-GLLLELPSKPTPTPAYV---------------SFKEG  436

Query  4501  KVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSS  4322
               +RVRVLG + +EGLA G+LK SAFEG VFTHSDVKPGMV KAKVI+VD+FGAIVQFS 
Sbjct  437   NHIRVRVLGLKQMEGLAVGTLKESAFEGPVFTHSDVKPGMVTKAKVISVDTFGAIVQFSG  496

Query  4321  GVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSY  4142
             G+KA+CPLRHMSEFE+ KPRKKF+VG+ELVFRVLGCKSKRITVT+KKTLVKSKL ILSSY
Sbjct  497   GLKAMCPLRHMSEFEVTKPRKKFKVGAELVFRVLGCKSKRITVTYKKTLVKSKLPILSSY  556

Query  4141  TDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRV  3962
             TDATEGL+THGWITKIEKHGCFVRFYNGVQGF PR ELGL+PGSD  S++HV +VVKCRV
Sbjct  557   TDATEGLVTHGWITKIEKHGCFVRFYNGVQGFVPRFELGLEPGSDPDSVFHVGEVVKCRV  616

Query  3961  VSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTV  3782
              S+   +++I L+           + +K G++VSGI++ +T  +++V V + +S +KGT+
Sbjct  617   TSAVHGTQRITLN-----------DSIKLGSIVSGIIDTITSQAVIVRVKS-KSVVKGTI  664

Query  3781  STQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQI  3602
             S +HL+DH   A L+ S+L+PGYE D+LLVLDIEG N+ LS+KYSLI  A++LP D NQ+
Sbjct  665   SAEHLADHHEQAKLIMSLLRPGYELDKLLVLDIEGNNMALSSKYSLIKLAEELPSDFNQL  724

Query  3601  SPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDV  3422
              P+SVVHGYVCN+I NG FVRFLGRLTGF+PRSKA DD + D SE F++GQSV  NI+DV
Sbjct  725   QPNSVVHGYVCNLIENGCFVRFLGRLTGFAPRSKAIDDPKADVSESFFVGQSVRANIVDV  784

Query  3421  NGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVE  3242
             N E  RIT+SLKQS C+S DA+F+QEYFL++ KI+ LQS D   S  +WV+ F +GS+++
Sbjct  785   NQEKSRITLSLKQSSCASVDASFVQEYFLMDEKISDLQSSDITKSDCSWVEKFSIGSLIK  844

Query  3241  GKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLK  3062
             G + E  + GVVV F+  ++V GFI    +GG  +  GS + A V+D+S+ E LVDLSL+
Sbjct  845   GTIQEQNDLGVVVNFDNINNVLGFIPQHHMGGATLVPGSVVNAVVLDISRAERLVDLSLR  904

Query  3061  PEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGY  2882
             PE +N    + +N  + KKKRKR   K+LEV+Q V+AVVEIVKE +LVLS+P   Y +GY
Sbjct  905   PELLNNLTKEVSN--SSKKKRKRGISKELEVHQRVSAVVEIVKEQHLVLSIPEHGYTIGY  962

Query  2881  ASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkkn  2702
             AS++D+NTQ LPVKQF  GQSV+A++ A+ +  T GRLLLLL ++S  +E+S SKR KK 
Sbjct  963   ASVSDYNTQKLPVKQFSTGQSVVASVKAVQNPLTSGRLLLLLDSVSGTSETSRSKRAKKK  1022

Query  2701  sSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEA--TDDNTTEGPLNDFRIGQTLT  2528
             SS +VGS+V AEIT+IKP ELR+ FG+ F GR+HITE    D +T++ P   FR+GQ+++
Sbjct  1023  SSCEVGSVVHAEITEIKPFELRVNFGNSFRGRIHITEVLVNDASTSDEPFAKFRVGQSIS  1082

Query  2527  ARIVSKDSRSENKRGYQWELSTKPSVL--AGDMDGPHES--FNYSTGQLLSGYVFKVDSE  2360
             AR+V+K   ++ K+   WELS KP++L  + + +   ES    ++ GQ + GYV+KVD E
Sbjct  1083  ARVVAKPCHTDIKKTQLWELSVKPAMLKDSSEFNDTQESEQLEFAAGQCVIGYVYKVDKE  1142

Query  2359  WAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTL  2180
             W WL +SR V A+++ILD+S +  EL+EF++RF +GK+VSGY+L+ NKEKK LRLV   L
Sbjct  1143  WVWLAVSRNVTARIFILDTSCKAHELEEFERRFPIGKAVSGYVLTYNKEKKTLRLVQRPL  1202

Query  2179  LIT--------------PEDTVPSSESARCHIREGSVLGGRISKILPGVGGLLVQIDAHL  2042
             L                P+ ++P  +     I EG +LGGRISKILPGVGGL VQ+  ++
Sbjct  1203  LFIHKSIANGGGSKTDKPDSSIPGDDDT-LFIHEGDILGGRISKILPGVGGLRVQLGPYV  1261

Query  2041  FGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNI  1862
             FG+VHFTE+ D WV DPL G+ EGQFVKCKVL++  S KGT  ++LSLR +LD M++ + 
Sbjct  1262  FGRVHFTEINDSWVPDPLDGFREGQFVKCKVLEISSSSKGTWQIELSLRTSLDGMSSADH  1321

Query  1861  SEHDDVHSQN--RRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGF  1688
                D  ++ N  +R + I+DL PDM VQGYVKN   KGCFI+LSR V+AK+ LSNL D F
Sbjct  1322  LSEDLKNNDNVCKRFERIEDLSPDMGVQGYVKNTMSKGCFIILSRTVEAKVRLSNLCDTF  1381

Query  1687  IESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGK  1508
             ++ PEKEFPVGKLVTG+V++VE LSKR+EVTL+T ++    KS+   L     G++ISG+
Sbjct  1382  VKEPEKEFPVGKLVTGRVLNVEPLSKRIEVTLKTVNAGGRPKSESYDLKKLHVGDMISGR  1441

Query  1507  IKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRIS  1328
             I+R+E FGLFI +D T +VGLCH+S+LSDD ++NVQ+RYKAG++VR K+LK+D+++ RIS
Sbjct  1442  IRRVEPFGLFIDIDQTGMVGLCHISQLSDDRMENVQARYKAGESVRAKILKLDEEKKRIS  1501

Query  1327  LGMKNSYFRDDDGEDIQ-----TTSRQSINSTDKGNSVFIGTQSTVFPESSDADIDVSVV  1163
             LGMK+SY  + D +  Q      TS +     D  + V        F E+S         
Sbjct  1502  LGMKSSYLMNGDDDKAQPLSEDNTSMECDPINDPKSEVLAAVDDFGFQETSGG-------  1554

Query  1162  NTTDNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkramkka  983
               T  +L +VESRASIPPLEV LDDIE +D D +  +N +   GA+  DEK K+R  +K 
Sbjct  1555  --TSLVLAQVESRASIPPLEVDLDDIEETDFDSS--QNQEKLLGANK-DEKSKRREKQKD  1609

Query  982   kkerereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSI  803
             K+ERE++I+AAE RLLE   P N DEFEKLVRSSPNSSFVWIKYMAFMLSL D+EKARSI
Sbjct  1610  KEEREKKIQAAEGRLLEHHAPENADEFEKLVRSSPNSSFVWIKYMAFMLSLADIEKARSI  1669

Query  802   AEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLG  623
             AE+A+ TINIREE EKLN+WVAYFNLE E+GNPP+E+V KVF+RA QYCDPKKV+LALLG
Sbjct  1670  AERALRTINIREEEEKLNIWVAYFNLENEHGNPPEESVKKVFERARQYCDPKKVYLALLG  1729

Query  622   VYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLCLPKHKH  443
             VYERTE YKL D+LL++M+KKFK SCKIWLR+IQ +LKQN++  QS+VNRALLCLP+HKH
Sbjct  1730  VYERTEQYKLADKLLDEMIKKFKQSCKIWLRKIQSSLKQNEEAIQSVVNRALLCLPRHKH  1789

Query  442   IKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFER  263
             IKFI+QTAILEFKCGVADRGRS+FE +L+EYPKRTDLWSVYLDQEIR+G+ DVIR+LFER
Sbjct  1790  IKFISQTAILEFKCGVADRGRSLFEGVLREYPKRTDLWSVYLDQEIRLGEDDVIRSLFER  1849

Query  262   AISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             AISLS+PPKKMKFLFKK+L YEKSVGDEER+E VK++AMEY  S
Sbjct  1850  AISLSLPPKKMKFLFKKFLEYEKSVGDEERVEYVKQRAMEYANS  1893



>ref|XP_010489787.1| PREDICTED: protein RRP5 homolog [Camelina sativa]
Length=1892

 Score =  2099 bits (5438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1118/1904 (59%), Positives = 1421/1904 (75%), Gaps = 87/1904 (5%)
 Frame = -2

Query  5743  APLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhklykKNQSVED  5564
             A LQLED VPDFPRGG S LS++E +++  EVDAEF+A++R  KK K  K  KK    + 
Sbjct  40    AALQLED-VPDFPRGGGSSLSRKEREKIYEEVDAEFDADERVSKKSKGGKSKKKKIPNDA  98

Query  5563  DLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLASE  5384
             D   L    ++GK P+ AN+IT KNISPGMKLWGV+ EVN+KDIV+SLPGGLRGLV ASE
Sbjct  99    DDLGLLFGGLTGKRPRYANKITTKNISPGMKLWGVVTEVNQKDIVISLPGGLRGLVRASE  158

Query  5383  AHD----PLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLA  5216
             A D     + D+E NE+      L  +F VGQLV CIVL LDDD KEAGK KIWLSLRL+
Sbjct  159   ASDFTDLGIEDDE-NEL------LGDIFSVGQLVPCIVLQLDDDTKEAGKRKIWLSLRLS  211

Query  5215  LLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDK--MNTGQLV  5042
             LLHK  + D+ Q G++ SA +KS EDHGYILHFGLPS +GF+ I      K  M TGQL+
Sbjct  212   LLHKGFSFDSFQLGMVFSANVKSVEDHGYILHFGLPSITGFIEICDDGNQKSGMKTGQLI  271

Query  5041  EGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLS  4862
             +GVV  +DR RK++ L+S PD++AK +TKDL G+                          
Sbjct  272   QGVVTKIDRERKIIRLNSDPDSVAKCLTKDLNGM--------------------------  305

Query  4861  FLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKA  4682
                     VD+FHL+      SWKD+Y QNK VNARILFIDP++RAVGL+LNPHLV  KA
Sbjct  306   --------VDLFHLKNPLSNKSWKDEYSQNKTVNARILFIDPSSRAVGLTLNPHLVCNKA  357

Query  4681  PPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPG  4502
             PP  V  G IF++AKV+R+DK  GLLLE+PS P  TPAYV   D    EVKK+EK +K G
Sbjct  358   PPLHVSSGGIFDEAKVVRIDKS-GLLLELPSKPASTPAYVSTYDAAGDEVKKLEKKYKEG  416

Query  4501  KVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSS  4322
               +RVR+LG + +EGLA G+LK SAFEG VF+HSDVKPGMV KAKVI+VDSFGAIVQF  
Sbjct  417   NHIRVRILGLKQMEGLAIGTLKESAFEGPVFSHSDVKPGMVTKAKVISVDSFGAIVQFPG  476

Query  4321  GVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSY  4142
             G+KA+CPLRHMSEFE+ KPRKKF+VG+ELVFRVLGCKSKRITVT+KKTLVKSKL IL SY
Sbjct  477   GLKAMCPLRHMSEFEVTKPRKKFKVGAELVFRVLGCKSKRITVTYKKTLVKSKLPILGSY  536

Query  4141  TDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRV  3962
             TDATEGL+THGWITKIEKHGCFVRFYNGVQGF PR ELGL+PGSD  S++HV +VVKCRV
Sbjct  537   TDATEGLVTHGWITKIEKHGCFVRFYNGVQGFVPRFELGLEPGSDPDSVFHVGEVVKCRV  596

Query  3961  VSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTV  3782
              S++  SR+I LS   +P  +SE + +K G++VSGI++ +T  +++V V + +  LKGT+
Sbjct  597   TSAAHGSRRITLSLMIKPASVSEDDSIKLGSIVSGIIDSITSQAVIVRVKS-KGVLKGTI  655

Query  3781  STQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQI  3602
             S +HL+DH   A LMKS+L+PGYE D+LLVLDI+G NL LS+KYSLI  A++LP + NQ+
Sbjct  656   SAEHLADHHEQAQLMKSLLRPGYELDKLLVLDIDGNNLALSSKYSLIKLAEELPSEFNQL  715

Query  3601  SPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDV  3422
              P+SVVHGYVCN+I NG FVRFLGRLTGF+PRSKA D+ R D SE F++GQSV  NI+DV
Sbjct  716   QPNSVVHGYVCNLIENGCFVRFLGRLTGFAPRSKAIDEPRADLSESFFVGQSVRANIVDV  775

Query  3421  NGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVE  3242
             N E  RIT+SLKQS C+S DA+F+QEYFL++ KI  LQS D   S  +WV+ F +GS+++
Sbjct  776   NQEKSRITLSLKQSSCASVDASFVQEYFLMDEKILDLQSSDITKSECSWVEKFSIGSLMK  835

Query  3241  GKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLK  3062
             G + E  + GVVV F+  ++V GFI    +GG  +  GS + A V+D+S+ E LVDLSL+
Sbjct  836   GTIQEQNDLGVVVNFKNINNVLGFIPQHHMGGATLVPGSVVTAVVLDLSRAERLVDLSLR  895

Query  3061  PEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGY  2882
             PE +N    + +N ++ KKKRKR   K+LEV+Q V+AVVEIVKE YLVLS+P  +Y +GY
Sbjct  896   PELINNLNKEVSNSQS-KKKRKRGISKELEVHQRVSAVVEIVKEQYLVLSIPEHDYTIGY  954

Query  2881  ASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkkn  2702
             AS++D+NTQ LPVKQF  GQSV+A++ A+ +  + GRLLLLL ++S  +E+S SK+ KK 
Sbjct  955   ASVSDYNTQKLPVKQFSTGQSVVASVEAVQNPLSSGRLLLLLDSVSGTSETSRSKKAKKK  1014

Query  2701  sSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTAR  2522
             SS +VGS+V AEIT+IKP ELR+ FG  F GR+HITE  D +T+E P   FR+GQ+++AR
Sbjct  1015  SSCEVGSVVHAEITEIKPFELRVNFGHSFRGRIHITEVNDVSTSEEPFAKFRVGQSVSAR  1074

Query  2521  IVSKDSRSENKRGYQWELSTKPSVL--AGDMDGPHES--FNYSTGQLLSGYVFKVDSEWA  2354
             +V+K   ++ K+   WELS KP++L  + ++ G  ES    +S GQ +SGYV+KVD EW 
Sbjct  1075  VVAKPCHTDIKKSQLWELSVKPAILRDSSELKGIQESEQLEFSAGQCVSGYVYKVDKEWV  1134

Query  2353  WLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTL--  2180
             WL ISR V A+L+ILD+++E  EL+EF++RF +GK+VSGY+L+ NKEKK LRLV   L  
Sbjct  1135  WLAISRNVTARLFILDTASEAHELEEFERRFPIGKAVSGYVLTYNKEKKTLRLVQRPLPD  1194

Query  2179  --------LITPEDTVPSS---ESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGK  2033
                     + +  D + SS   +     I EG +LGGRISKILPGVGG+ VQI  ++FG+
Sbjct  1195  IHKSIANGVGSKMDKLDSSIPCDDGTLFIHEGDILGGRISKILPGVGGIRVQIGPYVFGR  1254

Query  2032  VHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISEH  1853
             VHFTE+ D WV +PL G+ EGQFVKCKVL++  S KGT  ++LSLR +LD M++ ++SE 
Sbjct  1255  VHFTEINDSWVPNPLDGFREGQFVKCKVLEISSSSKGTWQIELSLRKSLDGMSSDHLSE-  1313

Query  1852  DDVHSQN--RRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIES  1679
             D  ++ N  +R   I+DL PDM VQGYVKN   KGCFI+LSR V+AK+LLSNL D F++ 
Sbjct  1314  DCSNNDNVCKRFARIEDLSPDMGVQGYVKNTMSKGCFIILSRTVEAKVLLSNLCDSFVKD  1373

Query  1678  PEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGKIKR  1499
             PEKEFPVGKLVTG+V++VE LSKR+EVTL+T ++    KS+   L     G++ISG+IKR
Sbjct  1374  PEKEFPVGKLVTGRVLNVEPLSKRIEVTLKTVNAGGQPKSESYDLKKLHVGDMISGRIKR  1433

Query  1498  IESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGM  1319
             +E +GLFI++  T + GLCH ++LSDD I+N+Q+RYKAG++V  K+LK+D+++ RISL M
Sbjct  1434  VEPYGLFITIGQTGMDGLCHKTQLSDDGIENIQARYKAGESVTAKILKLDEEKQRISLSM  1493

Query  1318  KNSYFRDDDGEDIQTTSRQSINST--------DKGNSVFIGTQSTVFPESSDADIDVSVV  1163
             K+SY    D  D Q  S ++ N T        D  + V +      F E+S         
Sbjct  1494  KSSYLMSGDDVDAQPPSEENANETSMECDPINDPKSGVLVAVSDFGFQETSAGK-----H  1548

Query  1162  NTTDNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkramkka  983
             + T  +L +VESRASIPPLEV LDDIE +DID+   +N     GAD  DEK K+R  +K 
Sbjct  1549  SGTSVVLAQVESRASIPPLEVDLDDIEETDIDNG--QNHGKLQGADK-DEKSKRREKQKD  1605

Query  982   kkerereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSI  803
             ++ERE++I+AAE RLLE   P + DEFEKLVRSSPNSSFVWIKYMAFMLSL D+EKARSI
Sbjct  1606  REEREKKIQAAEGRLLENHAPESADEFEKLVRSSPNSSFVWIKYMAFMLSLADIEKARSI  1665

Query  802   AEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLG  623
             AE+A+ TINIREE E+LN+WVAYFNLE E+G+PP+EAV KVF+RA QYCDP+KV+LALLG
Sbjct  1666  AERALRTINIREEEERLNIWVAYFNLENEHGSPPEEAVKKVFERARQYCDPQKVYLALLG  1725

Query  622   VYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLCLPKHKH  443
             VYERTE +KL D+LL++M+KKFK SCKIW R+IQ +LKQN++  QS+VNRALLCLP+HKH
Sbjct  1726  VYERTEQHKLADKLLDEMIKKFKQSCKIWSRKIQSSLKQNEEGIQSVVNRALLCLPRHKH  1785

Query  442   IKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFER  263
             IKFI+QTAILEFKCGVADRGRS+FE +L+EYPKRTDLWSVYLDQEIR+G++DVIR+LFER
Sbjct  1786  IKFISQTAILEFKCGVADRGRSLFEGVLREYPKRTDLWSVYLDQEIRLGEVDVIRSLFER  1845

Query  262   AISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             AISLS+PPKKMKFLFKKYL YEKSVGDEER+E VK++AMEY +S
Sbjct  1846  AISLSLPPKKMKFLFKKYLEYEKSVGDEERVEYVKQRAMEYADS  1889



>ref|XP_009407776.1| PREDICTED: protein RRP5 homolog [Musa acuminata subsp. malaccensis]
Length=1920

 Score =  2093 bits (5422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1105/1895 (58%), Positives = 1408/1895 (74%), Gaps = 52/1895 (3%)
 Frame = -2

Query  5737  LQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAED---RylkkkkqhklykKNQSVE  5567
             L +E + PDFPRGG SLLS++E  + RAE +A+FE E+   R  K K + K   K  S++
Sbjct  49    LLVEADDPDFPRGGGSLLSRQEQADARAEAEAQFEREESYSRKGKGKARKKKGLKGSSLD  108

Query  5566  --DDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVL  5393
               +DLGSLFG  I+GKLP+ ANRIT KNISP MKLWGVI EVN KD+V+SLPGGLRG V 
Sbjct  109   FDNDLGSLFGDGITGKLPRFANRITLKNISPRMKLWGVIVEVNRKDLVISLPGGLRGFVH  168

Query  5392  ASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEA-GKWKIWLSLRLA  5216
             A E  D    N   +   +  +LS +FHVGQLVSC+VL +DDDKK+  G  +IWLSLRL+
Sbjct  169   AEEVTDIPISN--GDKVSEGYFLSSIFHVGQLVSCVVLRVDDDKKDGKGNKRIWLSLRLS  226

Query  5215  LLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDKMNTGQLVEG  5036
             LLHK LTLDAIQ+G++L+A +KS EDHGYIL FG+ SF+GFLP + +  D++ TGQ+++ 
Sbjct  227   LLHKGLTLDAIQDGMVLNAQVKSVEDHGYILFFGVSSFTGFLPKNERDGDQIFTGQIMQC  286

Query  5035  VVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFL  4856
             VVK +D+ R VV++ S  D ++K++ KDLKG+SIDLLVPGMMVNA V S LENG+M+SFL
Sbjct  287   VVKDIDKARAVVHVDSDSDLVSKFIIKDLKGLSIDLLVPGMMVNARVRSTLENGIMVSFL  346

Query  4855  TYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPP  4676
             TYFTGTVDIFHL+  F   +WKD+Y QNKKVNARILFIDP+TRAVGL+LN +L+  KAPP
Sbjct  347   TYFTGTVDIFHLENTFHSGTWKDNYNQNKKVNARILFIDPSTRAVGLTLNKYLIDNKAPP  406

Query  4675  SLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKV  4496
             + V+ G+I++ ++++RVD+GLG LLEI SSP P+PAYV I D  D+ +K  +  FK G  
Sbjct  407   AYVQTGEIYDNSQILRVDRGLGFLLEICSSPAPSPAYVSIHDASDEVLKPEK-KFKEGDY  465

Query  4495  VRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGV  4316
             VRVR+LG R LEGLATG++K SAFEGSVFTHSDVKPGM+VK+KVI V++FGAIVQF SGV
Sbjct  466   VRVRILGMRYLEGLATGTMKASAFEGSVFTHSDVKPGMLVKSKVIAVENFGAIVQFPSGV  525

Query  4315  KALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSYTD  4136
             KALCPL HMSE EIVKP KKF VG+EL+FRVLGCKSKRITVT+KK+LVKSKLD+L+SY D
Sbjct  526   KALCPLPHMSELEIVKPPKKFMVGAELLFRVLGCKSKRITVTYKKSLVKSKLDVLASYGD  585

Query  4135  ATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVS  3956
             A EGL+THGWITKIEKHGCFVRFYNGV GFA RSELGL+PG++  S+YHV QVVKCR++S
Sbjct  586   AAEGLVTHGWITKIEKHGCFVRFYNGVHGFAHRSELGLEPGAEADSVYHVGQVVKCRIIS  645

Query  3955  SSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVN-NGQSHLKGTVS  3779
              + +SR+I +SF     R S+   VK G VVS +VE +TP +++V++  NG  +LKGT+ 
Sbjct  646   CATSSRRISVSFVISTKRTSDDGAVKMGCVVSSVVERLTPTAVIVSLTKNG--YLKGTIF  703

Query  3778  TQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQIS  3599
               HL+DH   A L++S+L+PGYEFDQL+VLD EG +L+LSAK+SLIS+A ++P D+ QI 
Sbjct  704   NDHLADHHAQATLLRSLLRPGYEFDQLVVLDSEGTSLILSAKHSLISSAMKIPSDLAQIH  763

Query  3598  PHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVN  3419
             P +VV+GY+CN+I +G FVRFLGRLTGF+P++ ATD+   +  + FYIGQ+V ++I++VN
Sbjct  764   PLTVVYGYICNIIESGCFVRFLGRLTGFAPKNMATDEMIDNILDAFYIGQTVRSHIINVN  823

Query  3418  GETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEG  3239
              E GR+ +SLKQSLC S+D +FI+ YFLLE KIA +Q  D  D  L+WV  F +GS+VEG
Sbjct  824   SEAGRVKLSLKQSLCLSSDVSFIKGYFLLEEKIAAIQMSDVKDFDLSWVKEFSIGSLVEG  883

Query  3238  KVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKP  3059
             ++ EIKE GVV+ F+ + DV GF++  QLG +NVE GS + A V+D++K++ LVDLSLKP
Sbjct  884   EIQEIKELGVVLGFKNHHDVVGFVAHHQLGCVNVELGSVVTALVLDIAKLDGLVDLSLKP  943

Query  3058  EFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGYA  2879
             E V      + + K  KKKR+R    DL++ Q+V AVVEIVKENYLVLSVP    A+GYA
Sbjct  944   ELVG-----SVSAKDTKKKRRRNISVDLKLYQTVKAVVEIVKENYLVLSVPEYKNAIGYA  998

Query  2878  SLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkkns  2699
             S  D+N Q LP K FVNGQSVIAT+  +   S+ GRLL +L ++++  E+ +S R K+ S
Sbjct  999   STTDYNIQKLPCKHFVNGQSVIATVGEI---SSSGRLLFILNSLTDGLETPNSTRAKRKS  1055

Query  2698  SYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDD-NTTEGPLNDFRIGQTLTAR  2522
             +Y VGSLV+AE+ DIKPLEL LKFG GF+GR+HITE  DD +  E P   FR+GQ L AR
Sbjct  1056  TYTVGSLVEAEVIDIKPLELILKFGFGFYGRIHITEVFDDRDLMENPFTKFRVGQLLNAR  1115

Query  2521  IVSKDSRSEN-KRGYQWELSTKPSVLAGDMDG----PHESFNYSTGQLLSGYVFKVDSEW  2357
             IV+K   S N  +  +WELS +PS++AG  +       E  N+S G+ + GYV KVDSEW
Sbjct  1116  IVAKGGHSGNGAKRSRWELSIRPSLMAGSEEAVTTCVSEELNFSVGENVRGYVVKVDSEW  1175

Query  2356  AWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRL-----V  2192
              WL++S  V A LYILDSS EP EL++FQ+ + VG++V G ILS NKEKKLLRL     V
Sbjct  1176  LWLSVSPSVVAHLYILDSSCEPHELQKFQQCYSVGQAVKGRILSINKEKKLLRLASCPSV  1235

Query  2191  PHTLLITPEDTVPSSESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTELR  2012
               T     +    S+ S       G ++GGRI KILP VGGLLVQI  HLFG+VH+TEL 
Sbjct  1236  DETGDKASQKIGASTVSDGQQFSSGDIVGGRIKKILPSVGGLLVQIGPHLFGRVHYTELV  1295

Query  2011  DPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISEHDDVHSQN  1832
             D WV  P+S Y EGQFVKCK+L++  S +G  HVDLSLR ++ T         +++ S +
Sbjct  1296  DEWVPHPISKYQEGQFVKCKILEISRSSEGILHVDLSLRVSVIT---------NELVSCS  1346

Query  1831  RRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGK  1652
             +R + I DLHPDM +QGYVKN+T KGCFI LSR +DA+IL+SNL+  +I+SPEKEFPVGK
Sbjct  1347  KRFEKIDDLHPDMNIQGYVKNITSKGCFISLSRMMDARILVSNLSYAYIDSPEKEFPVGK  1406

Query  1651  LVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGKIKRIESFGLFIS  1472
             LV  KV+SVE LS RVE TL+T + A   KS  D + N   G+I++G I+RIES+GLFI+
Sbjct  1407  LVHAKVLSVEPLSNRVEATLKTGNKAETIKSIADTIVNLHVGDIVTGHIRRIESYGLFIT  1466

Query  1471  VDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSYFRDDD  1292
             +D  N+VGLCH+SELSD+HIDN+++ Y  G+ V  K+LK+D++R RISLGMK SY  +  
Sbjct  1467  LDKANVVGLCHISELSDEHIDNIEASYATGEKVVSKILKIDEERQRISLGMKKSYIENAS  1526

Query  1291  GEDIQTTSRQSINSTDKGNSVFIGTQSTVFPESSDADIDVSVV------NTTDNILTEVE  1130
             G D Q+ +    +  D+ +S  +             D  +         N    ILT   
Sbjct  1527  GVD-QSHAINGSHDHDESDSASMDNMDNELLNLLHNDDLIKHQKMLGHDNAGSEILTPSG  1585

Query  1129  SRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdk--kramkkakkerereir  956
               AS+ PL+V L+D + SD+D+ V    D   GA+   +  K  +   KKAK E+E EI 
Sbjct  1586  RSASVLPLQVSLEDSDGSDLDNPVIAGQD---GANENKQAAKRDRCIKKKAKDEKELEII  1642

Query  955   aaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTIN  776
             AAEER L+ D+PR  DEFEKLVRSSPNSSFVWIKYMA+MLSL +VEKAR+IAE+A+ TIN
Sbjct  1643  AAEERRLQNDMPRTEDEFEKLVRSSPNSSFVWIKYMAYMLSLAEVEKARNIAERALRTIN  1702

Query  775   IREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYK  596
             I EE EKLN+WVAYFNLE E+G+PP+EAV K+FQRALQY DPKK+HLALLGVYER+E   
Sbjct  1703  INEEGEKLNIWVAYFNLENEHGSPPEEAVKKIFQRALQYSDPKKLHLALLGVYERSEQQN  1762

Query  595   LGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLCLPKHKHIKFITQTAI  416
             L +ELLE+M KKFKHSCK+W+  IQ  LK+++D  QSIVNRA++ LP+ KHIKFI+QTA+
Sbjct  1763  LAEELLERMTKKFKHSCKVWMHCIQSFLKKDEDGIQSIVNRAVISLPRKKHIKFISQTAL  1822

Query  415   LEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPK  236
             LEFK GV DRGRSM E +L+EYPKRTDLWS+YLDQEIR+GD +VIRALFERA  LS+PPK
Sbjct  1823  LEFKSGVPDRGRSMLESILREYPKRTDLWSIYLDQEIRLGDAEVIRALFERATCLSLPPK  1882

Query  235   KMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             KMKFLFKKYL YEK  GDE+ +E VKRKA+EYVES
Sbjct  1883  KMKFLFKKYLDYEKVHGDEDTVEHVKRKALEYVES  1917



>gb|KHN22182.1| rRNA biogenesis protein rrp5 [Glycine soja]
Length=1839

 Score =  2086 bits (5405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1103/1908 (58%), Positives = 1410/1908 (74%), Gaps = 111/1908 (6%)
 Frame = -2

Query  5806  KNFKRKGKNNEAGNASFSGKSAPLQLEDEVPDFPRGGA-SLLSKEELDEVRAEVDAEFEA  5630
             K FK K +      A+   ++  L LEDEVPDFPRGG  S   + + DE  AE     + 
Sbjct  26    KIFKPKKREQNIAVAAAKSEALSLPLEDEVPDFPRGGEFSAKGRNDYDEFGAE-----DP  80

Query  5629  EDRylkkkkqhklykKNQSVEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAE  5450
               +  KKKK      K+    DD GSL G+ I+GKLP+  N+IT +NI+PGMKLWGV+AE
Sbjct  81    SKKTRKKKKGKNASGKSNEAADDWGSLSGNGITGKLPRRVNKITLRNITPGMKLWGVVAE  140

Query  5449  VNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLD  5270
             VNEKD+VVSLPGGLRGLV AS+A DP++D++   +E+   +LSG+F VGQLVSC+VL LD
Sbjct  141   VNEKDLVVSLPGGLRGLVHASDAVDPIFDDK---IEVGEIFLSGVFCVGQLVSCVVLRLD  197

Query  5269  DDKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFL  5090
             DDKKE G  KIWLSLRL+LLHKN  LD +QEG++L+AY+KS EDHGYILHFGLP F GFL
Sbjct  198   DDKKEKGSRKIWLSLRLSLLHKNYNLDVVQEGMVLAAYVKSIEDHGYILHFGLPFFMGFL  257

Query  5089  PIHSQSVD---KMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVP  4919
             P +S +     ++  G+L++G+V+S+D+ RKVVYLSS PD I K VTKDL+G+SIDLLVP
Sbjct  258   PKNSSAEGWGGEVKIGKLLQGLVRSIDKVRKVVYLSSDPDTITKSVTKDLRGLSIDLLVP  317

Query  4918  GMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFID  4739
             GM+VNA V S+LENGVMLSFLTYFTGTVD+FHLQ ++P  +WKD   +++KV +RILFID
Sbjct  318   GMLVNACVKSILENGVMLSFLTYFTGTVDLFHLQNIYPGKNWKDKCSESQKVVSRILFID  377

Query  4738  PATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVY  4559
             P++RAVGL+LNPHLV  +APPS VK+GDI++ +KV+RVD+GLGLLLE+PS P PTPA+V 
Sbjct  378   PSSRAVGLTLNPHLVQNRAPPSHVKIGDIYDNSKVVRVDRGLGLLLEVPSIPEPTPAFVS  437

Query  4558  ISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMV  4379
             ISD+ ++  K  +  +K G  VRVR+LG R LEG+ATG LK SA E  VFTHSDVKPGMV
Sbjct  438   ISDIAEEIPKLEK-KYKEGNHVRVRILGLRYLEGIATGVLKASALEEEVFTHSDVKPGMV  496

Query  4378  VKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRI  4199
             VKAK+++VDSFGAIVQ   GVKALCPLRHMSE EI KP KKF+VG+ELVFRVLGCKSKR+
Sbjct  497   VKAKILSVDSFGAIVQIPGGVKALCPLRHMSELEISKPGKKFKVGAELVFRVLGCKSKRV  556

Query  4198  TVTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLD  4019
             TVTHKKTL                                             RSELGL+
Sbjct  557   TVTHKKTL--------------------------------------------SRSELGLE  572

Query  4018  PGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVT  3839
             PG+D  ++Y+V Q VKCRV+S  PASR+I LSF  +P  +SE +MV  G++VSG V+ +T
Sbjct  573   PGADPGTVYNVGQAVKCRVISCIPASRRINLSFIIKPTSVSEDDMVTLGSLVSGAVDRIT  632

Query  3838  PDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLS  3659
              +++VV VN      +GT+S +HL+DH G A LM SVLKPGY FDQLLVLD++G NL+LS
Sbjct  633   SNAVVVYVN-ASGFSRGTISMEHLADHHGQAILMHSVLKPGYNFDQLLVLDVKGNNLILS  691

Query  3658  AKYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRY  3479
             AK SLI  AQQ+P D+NQI P+SVVHGY+CN+I +G FVRFLG LTGF+PR+KA DD++ 
Sbjct  692   AKSSLIKHAQQIPADINQIHPNSVVHGYICNLIESGCFVRFLGHLTGFAPRNKAADDQKS  751

Query  3478  DTSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLD  3299
             +  E +YIGQSV +NI +V+ ETGR+T+SLKQ+ CSSTDA+FIQ+YFL++ KIA+L+   
Sbjct  752   NILEAYYIGQSVRSNISNVSSETGRVTLSLKQTACSSTDASFIQDYFLMDDKIARLEYCG  811

Query  3298  SADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTI  3119
             S  S   W +GF +G + +GKV  +++ G+V++FE Y+DVFGFI+  QL G  +E+GS +
Sbjct  812   SGASDTKWDEGFNIGMVAKGKVKAVEDVGLVISFEHYNDVFGFIANYQLAGTILESGSIV  871

Query  3118  QAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEI  2939
             +A V+DV K + LV+L+LKPEF+N SK +++  +T KK                      
Sbjct  872   EALVLDVGKADKLVELTLKPEFINRSK-ESSISRTNKK----------------------  908

Query  2938  VKENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLL  2759
                   VLS+P  +Y +GYAS++D+N Q  P KQ+ NGQSV+AT+MALP   T GRLLLL
Sbjct  909   ------VLSIPENDYTIGYASVSDYNAQRFPHKQYQNGQSVVATVMALPSPETSGRLLLL  962

Query  2758  LKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDD  2579
             +  ++E + SS   + K +    VG+LV+AEITDIK LEL+LKFG G +GR+HITE    
Sbjct  963   VDVVNETSSSSKRTKKKSSYK--VGTLVEAEITDIKTLELKLKFGFGLYGRIHITEVYYG  1020

Query  2578  NTTEGPLNDFRIGQTLTARIVSKDSRSE-NKRGYQWELSTKPSVLAG--DMDGPHESFNY  2408
             N  E P + +++GQT+TARIV+K + S+ N++G QWELS +  ++ G  D+D   E+  +
Sbjct  1021  NVLENPFSSYKVGQTVTARIVAKPNESDGNRKGSQWELSVRSEMVTGSSDIDDVSENLEF  1080

Query  2407  STGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYIL  2228
               GQ  +GYV+KV+SEW WLTISR VRAQLYILDS+ EPSEL++FQ R++VG+ VSG+IL
Sbjct  1081  KIGQCAAGYVYKVESEWVWLTISRNVRAQLYILDSATEPSELEDFQNRYHVGQPVSGHIL  1140

Query  2227  SANKEKKLLRLV--PHTLLITPEDTVPSS----ESARCHIREGSVLGGRISKILPGVGGL  2066
             S N EKKLLRLV  P + L       P +    +    ++ EG +LGGR+SKILPGVGGL
Sbjct  1141  SVNMEKKLLRLVVRPFSTLSCGTSEEPLTNVVDKDLTAYVHEGDILGGRVSKILPGVGGL  1200

Query  2065  LVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTL  1886
             LVQ+    +GKVHFTEL D WV DPLSGY E QFVKC VL+V H+VKGT HVDLSL    
Sbjct  1201  LVQVGPRTYGKVHFTELADTWVPDPLSGYHEEQFVKCIVLEVSHTVKGTIHVDLSL----  1256

Query  1885  DTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLS  1706
                +N  +S+   V++ ++ V+ I+DLHPDM V+GY+KNVT KGCFIMLSRK+DAKILLS
Sbjct  1257  -GSSNVKLSQDSAVNANSKCVEKIEDLHPDMIVKGYIKNVTSKGCFIMLSRKIDAKILLS  1315

Query  1705  NLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAG  1526
             NL++ +++ PEKEFPVGKLV G+V SVE LS RVEVTL+ S++    KS+I  L+ F  G
Sbjct  1316  NLSEQYVQEPEKEFPVGKLVIGRVTSVEPLSNRVEVTLKMSTAPNIPKSEIIDLSKFHVG  1375

Query  1525  NIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdk  1346
             +++SG+IKR+ESFGLFI++DNTN+VGLCH+SE+SD+ I+N+++ Y+AG+ V+ ++LKVD+
Sbjct  1376  DVVSGRIKRVESFGLFIAIDNTNMVGLCHISEISDNRIENIEANYRAGERVKARILKVDE  1435

Query  1345  dRHRISLGMKNSYFRDDDGEDI-QTTSRQ-SINSTDKGNSVFIGTQSTVFPESSDADIDV  1172
             +RHRISLGMKNSY R   GE + Q  S++ S      G        S++F  S   +IDV
Sbjct  1436  ERHRISLGMKNSYMR---GETVLQIPSKEESDEPIVDGMKSITSMNSSLFGTS---NIDV  1489

Query  1171  SVVNTTDNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkram  992
                     IL++ + RA IPPL+V LDD +  D ++A +++ +H    D  +EK K+R  
Sbjct  1490  EDEINQFPILSQAQERADIPPLDVALDDFDQFDANNANSQSEEHANEEDIVNEKHKRREK  1549

Query  991   kkakkerereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKA  812
             KKAK+ERE++IRAAEERLLE D+PR  DEFE+L+RSSPNSSF WIKYM FM+S+ DVEKA
Sbjct  1550  KKAKEEREKQIRAAEERLLEDDVPRTADEFERLIRSSPNSSFTWIKYMDFMVSMADVEKA  1609

Query  811   RSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLA  632
             RSIAE+A+ TINIREE+EKLN+W AYFNLE +YGNP +EAVMKVFQRALQY DPKKV+LA
Sbjct  1610  RSIAERALRTINIREENEKLNIWKAYFNLENKYGNPREEAVMKVFQRALQYNDPKKVYLA  1669

Query  631   LLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLCLPK  452
             LLG+YERTE + L DELL KM KKFKHSCK+WLRRIQ  LKQN+D  Q +++RA L LPK
Sbjct  1670  LLGMYERTEQHNLADELLNKMTKKFKHSCKVWLRRIQSLLKQNKDGIQPVIDRASLSLPK  1729

Query  451   HKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRAL  272
             HKHIKF +QTAILEFK G  DRGRSMFE++L+EYPKRTDLWSVYLDQEI+  D D+I AL
Sbjct  1730  HKHIKFFSQTAILEFKVGFPDRGRSMFEKILREYPKRTDLWSVYLDQEIQHKDEDIIHAL  1789

Query  271   FERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVESL  128
             FERA+SLS+PPKKMKFLFKKYL YE S GD+ERIESVKRKA+EYVESL
Sbjct  1790  FERAVSLSLPPKKMKFLFKKYLDYEMSQGDQERIESVKRKAIEYVESL  1837



>dbj|BAB03107.1| pre-rRNA processing protein RRP5 [Arabidopsis thaliana]
Length=1765

 Score =  2033 bits (5266),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1078/1811 (60%), Positives = 1364/1811 (75%), Gaps = 78/1811 (4%)
 Frame = -2

Query  5476  MKLWGVIAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDN--ETNEMEMQSNYLSGLFHVG  5303
             MKL GV+ EVN+KDIV+SLPGGLRGLV ASE  D   D   E +E E+    L  +F VG
Sbjct  1     MKLLGVVTEVNQKDIVISLPGGLRGLVRASEVSD-FTDRGIEDDENEL----LGDIFSVG  55

Query  5302  QLVSCIVLHLDDDKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYIL  5123
             QLV CIVL LDDDKKEAGK KIWLSLRL+LLHK  + D+ Q G++ SA +KS EDHG IL
Sbjct  56    QLVPCIVLELDDDKKEAGKRKIWLSLRLSLLHKGFSFDSFQLGMVFSANVKSIEDHGSIL  115

Query  5122  HFGLPSFSGFLPIHSQSVDK--MNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDL  4949
             HFGLPS +GF+ I      +  M TGQL++GVV  +DR RK+V+LSS PD++AK +TKDL
Sbjct  116   HFGLPSITGFIEISDDGNQESGMKTGQLIQGVVTKIDRDRKIVHLSSDPDSVAKCLTKDL  175

Query  4948  KGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNK  4769
              G+S DLL+PGMMVNA V SVLENG++  FLTYF GTVD+FHL+      SWKD+Y QNK
Sbjct  176   SGMSFDLLIPGMMVNARVQSVLENGILFDFLTYFNGTVDLFHLKNPLSNKSWKDEYNQNK  235

Query  4768  KVNARILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPS  4589
              VNARILFIDP++RAVGL+L+PH+V  KAPP  V  GDIF++AKV+R+DK  GLLLE+PS
Sbjct  236   TVNARILFIDPSSRAVGLTLSPHVVCNKAPPLHVFSGDIFDEAKVVRIDKS-GLLLELPS  294

Query  4588  SPVPTPAYVYISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVF  4409
              P PTPAY Y  D    EV K+EK FK G  +RVRVLG + +EGLA G+LK SAFEG VF
Sbjct  295   KPTPTPAYTY--DAAGDEVTKLEKKFKEGNHIRVRVLGLKQMEGLAVGTLKESAFEGPVF  352

Query  4408  THSDVKPGMVVKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVF  4229
             THSDVKPGMV KAKVI+VD+FGAIVQFS G+KA+CPLRHMSEFE+ KPRKKF+VG+ELVF
Sbjct  353   THSDVKPGMVTKAKVISVDTFGAIVQFSGGLKAMCPLRHMSEFEVTKPRKKFKVGAELVF  412

Query  4228  RVLGCKSKRITVTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQG  4049
             RVLGCKSKRITVT+KKTLVKSKL ILSSYTDATEGL+THGWITKIEKHGCFVRFYNGVQG
Sbjct  413   RVLGCKSKRITVTYKKTLVKSKLPILSSYTDATEGLVTHGWITKIEKHGCFVRFYNGVQG  472

Query  4048  FAPRSELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGT  3869
             F PR ELGL+PGSD  S++HV +VVKCRV S+   +++I LSF  +P  +SE + +K G+
Sbjct  473   FVPRFELGLEPGSDPDSVFHVGEVVKCRVTSAVHGTQRITLSFMIKPSSVSEDDSIKLGS  532

Query  3868  VVSGIVELVTPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVL  3689
             +VSGI++ +T  +++V V + +S +KGT+S +HL+DH   A L+ S+L+PGYE D+LLVL
Sbjct  533   IVSGIIDTITSQAVIVRVKS-KSVVKGTISAEHLADHHEQAKLIMSLLRPGYELDKLLVL  591

Query  3688  DIEGFNLVLSAKYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSP  3509
             DIEG N+ LS+KYSLI  A++LP D NQ+ P+SVVHGYVCN+I NG FVRFLGRLTGF+P
Sbjct  592   DIEGNNMALSSKYSLIKLAEELPSDFNQLQPNSVVHGYVCNLIENGCFVRFLGRLTGFAP  651

Query  3508  RSKATDDRRYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLE  3329
             RSKA DD + D SE F++GQSV  NI+DVN E  RIT+SLKQS C+S DA+F+QEYFL++
Sbjct  652   RSKAIDDPKADVSESFFVGQSVRANIVDVNQEKSRITLSLKQSSCASVDASFVQEYFLMD  711

Query  3328  HKIAKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLG  3149
              KI+ LQS D   S  +WV+ F +GS+++G + E  + GVVV F+  ++V GFI    +G
Sbjct  712   EKISDLQSSDITKSDCSWVEKFSIGSLIKGTIQEQNDLGVVVNFDNINNVLGFIPQHHMG  771

Query  3148  GINVETGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEV  2969
             G  +  GS + A V+D+S+ E LVDLSL+PE +N    + +N  + KKKRKR   K+LEV
Sbjct  772   GATLVPGSVVNAVVLDISRAERLVDLSLRPELLNNLTKEVSN--SSKKKRKRGISKELEV  829

Query  2968  NQSVNAVVEIVKENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPD  2789
             +Q V+AVVEIVKE +LVLS+P   Y +GYAS++D+NTQ LPVKQF  GQSV+A++ A+ +
Sbjct  830   HQRVSAVVEIVKEQHLVLSIPEHGYTIGYASVSDYNTQKLPVKQFSTGQSVVASVKAVQN  889

Query  2788  SSTGGRLLLLLKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHG  2609
               T GRLLLLL ++S  +E+S SKR KK SS +VGS+V AE+ D                
Sbjct  890   PLTSGRLLLLLDSVSGTSETSRSKRAKKKSSCEVGSVVHAEVNDA---------------  934

Query  2608  RVHITEATDDNTTEGPLNDFRIGQTLTARIVSKDSRSENKRGYQWELSTKPSVL--AGDM  2435
                       +T++ P   FR+GQ+++AR+V+K   ++ K+   WELS KP++L  + + 
Sbjct  935   ----------STSDEPFAKFRVGQSISARVVAKPCHTDIKKTQLWELSVKPAMLKDSSEF  984

Query  2434  DGPHES--FNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRF  2261
             +   ES    ++ GQ + GYV+KVD EW WL +SR V A+++ILD+S +  EL+EF++RF
Sbjct  985   NDTQESEQLEFAAGQCVIGYVYKVDKEWVWLAVSRNVTARIFILDTSCKAHELEEFERRF  1044

Query  2260  YVGKSVSGYILSANKEKKLLRLVPHTLLIT--------------PEDTVPSSESARCHIR  2123
              +GK+VSGY+L+ NKEKK LRLV   LL                P+ ++P  +     I 
Sbjct  1045  PIGKAVSGYVLTYNKEKKTLRLVQRPLLFIHKSIANGGGSKTDKPDSSIPGDDDT-LFIH  1103

Query  2122  EGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQ  1943
             EG +LGGRISKILPGVGGL VQ+  ++FG+VHFTE+ D WV DPL G+ EGQFVKCKVL+
Sbjct  1104  EGDILGGRISKILPGVGGLRVQLGPYVFGRVHFTEINDSWVPDPLDGFREGQFVKCKVLE  1163

Query  1942  VGHSVKGTTHVDLSLRWTLDTMNNQNISEHDDVHSQN--RRVQDIKDLHPDMTVQGYVKN  1769
             +  S KGT  ++LSLR +LD M++ +    D  ++ N  +R + I+DL PDM VQGYVKN
Sbjct  1164  ISSSSKGTWQIELSLRTSLDGMSSADHLSEDLKNNDNVCKRFERIEDLSPDMGVQGYVKN  1223

Query  1768  VTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLR  1589
                KGCFI+LSR V+AK+ LSNL D F++ PEKEFPVGKLVTG+V++VE LSKR+EVTL+
Sbjct  1224  TMSKGCFIILSRTVEAKVRLSNLCDTFVKEPEKEFPVGKLVTGRVLNVEPLSKRIEVTLK  1283

Query  1588  TSSSATPRKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHID  1409
             T ++    KS+   L     G++ISG+I+R+E FGLFI +D T +VGLCH+S+LSDD ++
Sbjct  1284  TVNAGGRPKSESYDLKKLHVGDMISGRIRRVEPFGLFIDIDQTGMVGLCHISQLSDDRME  1343

Query  1408  NVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSYFRDDDGEDIQ-----TTSRQSINSTD  1244
             NVQ+RYKAG++VR K+LK+D+++ RISLGMK+SY  + D +  Q      TS +     D
Sbjct  1344  NVQARYKAGESVRAKILKLDEEKKRISLGMKSSYLMNGDDDKAQPLSEDNTSMECDPIND  1403

Query  1243  KGNSVFIGTQSTVFPESSDADIDVSVVNTTDNILTEVESRASIPPLEVPLDDIENSDIDD  1064
               + V        F E+S           T  +L +VESRASIPPLEV LDDIE +D D 
Sbjct  1404  PKSEVLAAVDDFGFQETSGG---------TSLVLAQVESRASIPPLEVDLDDIEETDFDS  1454

Query  1063  AVNKNPDHTGGADTTDekdkkramkkakkerereiraaeerlleKDIPRNTDEFEKLVRS  884
             +  +N +   GA+  DEK K+R  +K K+ERE++I+AAE RLLE   P N DEFEKLVRS
Sbjct  1455  S--QNQEKLLGANK-DEKSKRREKQKDKEEREKKIQAAEGRLLEHHAPENADEFEKLVRS  1511

Query  883   SPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNP  704
             SPNSSFVWIKYMAFMLSL D+EKARSIAE+A+ TINIREE EKLN+WVAYFNLE E+GNP
Sbjct  1512  SPNSSFVWIKYMAFMLSLADIEKARSIAERALRTINIREEEEKLNIWVAYFNLENEHGNP  1571

Query  703   PQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRI  524
             P+E+V KVF+RA QYCDPKKV+LALLGVYERTE YKL D+LL++M+KKFK SCKIWLR+I
Sbjct  1572  PEESVKKVFERARQYCDPKKVYLALLGVYERTEQYKLADKLLDEMIKKFKQSCKIWLRKI  1631

Query  523   QWALKQNQDNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPK  344
             Q +LKQN++  QS+VNRALLCLP+HKHIKFI+QTAILEFKCGVADRGRS+FE +L+EYPK
Sbjct  1632  QSSLKQNEEAIQSVVNRALLCLPRHKHIKFISQTAILEFKCGVADRGRSLFEGVLREYPK  1691

Query  343   RTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIES  164
             RTDLWSVYLDQEIR+G+ DVIR+LFERAISLS+PPKKMKFLFKK+L YEKSVGDEER+E 
Sbjct  1692  RTDLWSVYLDQEIRLGEDDVIRSLFERAISLSLPPKKMKFLFKKFLEYEKSVGDEERVEY  1751

Query  163   VKRKAMEYVES  131
             VK++AMEY  S
Sbjct  1752  VKQRAMEYANS  1762



>ref|XP_006858995.1| hypothetical protein AMTR_s00068p00137340 [Amborella trichopoda]
 gb|ERN20462.1| hypothetical protein AMTR_s00068p00137340 [Amborella trichopoda]
Length=1957

 Score =  2029 bits (5256),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1076/1932 (56%), Positives = 1405/1932 (73%), Gaps = 56/1932 (3%)
 Frame = -2

Query  5791  KGKNNEAGNASFSGKSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAEDRylk  5612
             K K  E G+A    K   +  +++VPDFPRGGAS+LS+ EL+E RA  DA+FE E R  K
Sbjct  34    KRKVEEVGHA----KPYSIFSQEDVPDFPRGGASVLSRSELEEARASADAQFEVEARVSK  89

Query  5611  kkkqhklykKNQSVEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDI  5432
             K K+ +    +   E+DLGSLFG   S  LP+ ANRITPKN+S GMK+WG+I+EVN KD+
Sbjct  90    KAKRPRKPFTS---EEDLGSLFGDGSSSTLPRFANRITPKNVSVGMKIWGIISEVNAKDL  146

Query  5431  VVSLPGGLRGLVLASEAHDPLWDNETNEMEM-------QSNYLSGLFHVGQLVSCIVLHL  5273
             +VSLPGGL+G V   EA D L+  +   +E        ++N L   F+VGQLV C+V+ +
Sbjct  147   LVSLPGGLKGFVKVEEASD-LFLEKGGSLEKTRGSSSKENNVLECNFYVGQLVPCVVIGV  205

Query  5272  -DDDKKEA-GKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFS  5099
               DDK+EA G  +IWLSLRL+LLHK L LD+I +G++L A ++S EDHGYILHFG+  F+
Sbjct  206   AHDDKREAKGSKRIWLSLRLSLLHKGLALDSIHDGMVLMACVRSVEDHGYILHFGISCFT  265

Query  5098  GFLPIHSQSVDK---MNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDL  4928
             GF+P  S+  D    MN G L++GVV SVDR R VV+LSS PD +A  + KD KG+SID+
Sbjct  266   GFMPRSSKIDDADAMMNRGHLLQGVVSSVDRVRGVVHLSSDPDLVANGLAKDPKGLSIDM  325

Query  4927  LVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARIL  4748
             LVPGMMVNA V S+LENG++LSFLTYFTGTVDIF++Q  FP  +WKDD+  + +V AR+L
Sbjct  326   LVPGMMVNARVQSMLENGILLSFLTYFTGTVDIFNMQIQFPSATWKDDFDHSMRVRARLL  385

Query  4747  FIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPA  4568
             FIDP TRAVGL+LNPHL+  KAPP  VK GDIFE ++V+RVD+  GLLLEIPSSP PTP 
Sbjct  386   FIDPTTRAVGLTLNPHLIRNKAPPVYVKAGDIFESSRVVRVDRRFGLLLEIPSSPDPTPG  445

Query  4567  YVYISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKP  4388
             YV I D  DKE  K+EK  K G  VR RVLG R LEGL   +LK SAFEGSVF HSDVKP
Sbjct  446   YVNIFDASDKEALKLEKKLKVGSNVRARVLGIRPLEGLVMCTLKASAFEGSVFAHSDVKP  505

Query  4387  GMVVKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKS  4208
             GM VK K+I V++FGAIVQFS+G+KALCPL+HMSEFE+VKP KKF+VG+EL FRVLGCKS
Sbjct  506   GMFVKGKIIAVETFGAIVQFSNGIKALCPLQHMSEFELVKPFKKFEVGAELTFRVLGCKS  565

Query  4207  KRITVTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSEL  4028
             KRITVTHKKTLVKSKL +LSSY +A  GLITHGWITKIEKHGCFVRFYNGVQGFA RSEL
Sbjct  566   KRITVTHKKTLVKSKLGVLSSYVNAAVGLITHGWITKIEKHGCFVRFYNGVQGFAHRSEL  625

Query  4027  GLDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETE-MVKPGTVVSGIV  3851
              LD GS++ S YHV QVVKCRV+++ P +R+I LSF   P R S T+  +K G+++SG+V
Sbjct  626   ALDLGSEVDSTYHVGQVVKCRVINAIPGARKINLSFVLSPKRASVTDHAIKCGSIISGVV  685

Query  3850  ELVTPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFN  3671
             E VT ++++V V    +++KG + T+HL+D+R  A+L+KS+L PGYEF +LLVLD++G +
Sbjct  686   EHVTANAVMVYVGT-NAYMKGKIITEHLADNRDQAELLKSLLTPGYEFKELLVLDMDGNH  744

Query  3670  LVLSAKYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATD  3491
             L LSAKYSL+ + +QLP D++Q+ P SV+HGYVCN+I  G FVR+LGRLTGF+P+ K  D
Sbjct  745   LFLSAKYSLVKSVEQLPSDIDQVVPQSVLHGYVCNLIETGCFVRYLGRLTGFAPKGKIVD  804

Query  3490  DRRYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKL  3311
             DR    S+V YIGQSV +++L+V+G+TGRI++SLKQS C ST+ + IQ YF++E +IAKL
Sbjct  805   DRTIGLSDVLYIGQSVRSHVLNVDGDTGRISLSLKQSSCFSTNVSLIQGYFVMEEQIAKL  864

Query  3310  QSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVET  3131
             QS+ S  S L W+    + S ++G++ EIK++GVVV   + D   GFI+  QLGG  V T
Sbjct  865   QSIRSKVSDLKWICSCKISSFIKGEIQEIKDYGVVVRLLQADPAVGFITPYQLGGTTVHT  924

Query  3130  GSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNA  2951
             GS ++A V+D+   E +VDLSL+ E + G K +        KKR+R+   +LE++Q+VNA
Sbjct  925   GSVVEALVLDIGMGEGIVDLSLREELLVGHKREGLEGSLSSKKRRRDECFNLELHQNVNA  984

Query  2950  VVEIVKENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGR  2771
             VVE+VKENYLVL++P   +A+GY+S +D+NT+ LP K FVNGQ ++ATI ALP++S  GR
Sbjct  985   VVEMVKENYLVLTLPEHGHAIGYSSTSDYNTKKLPHKFFVNGQRLVATIEALPEASGAGR  1044

Query  2770  LLLLLKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITE  2591
             LLLLLK +SEV  SSS KR  K S Y+VGSLV+AEIT I+PLE+RLKFG G HGR+HITE
Sbjct  1045  LLLLLKCLSEVVVSSSLKRALKKSGYNVGSLVEAEITGIRPLEMRLKFGKGLHGRIHITE  1104

Query  2590  ATDDNTTE-GPLNDFRIGQTLTARIVSKDSRSE-NKRGYQWELSTKPSVLAGD---MDGP  2426
               D    E  P +++RIG+ LTARI  K ++S+ + + + WELS KPS+LAG     DG 
Sbjct  1105  VYDAGHVELKPFSNYRIGEHLTARIFEKATKSDVSSKQHIWELSIKPSMLAGSAEVADG-  1163

Query  2425  H--ESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVG  2252
             H  E F+YS G++++ YV KVD+EW  L +S  +   +++LD+SAEPSEL+EF KRF VG
Sbjct  1164  HLVEDFDYSLGEMITCYVVKVDNEWLRLAVSCSIMGHMFVLDTSAEPSELEEFPKRFSVG  1223

Query  2251  KSVSGYILSANKEKKLLRLVPHTL------------LITPED--TVPSSESARCHIREGS  2114
             + +S +I+  ++ KK+LRL  H +            ++ P+D  +  S+E A   I EG 
Sbjct  1224  QGISCFIIGIDRGKKVLRLSLHAISAKHGARHDVDDIVQPDDIGSTSSNEKASEFIHEGD  1283

Query  2113  VLGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGH  1934
              LGGRISKILPGVGGL VQI  HL+GKVH+TE+ + +V +PLS Y EGQFV+C+VL V  
Sbjct  1284  FLGGRISKILPGVGGLHVQIGPHLYGKVHYTEVTEHFVPEPLSQYQEGQFVRCRVLNVDR  1343

Query  1933  SVKGTTHVDLSLRWTLDTMNNQNISE-HDDVHSQ--NRRVQDIKDLHPDMTVQGYVKNVT  1763
             + KG  HVDLSL WT         SE H+ +  +    RV+ I DLHP M ++GYVK++T
Sbjct  1344  TTKGNLHVDLSL-WTPSEGTQLVSSEGHESLQEKFSKVRVEKIADLHPMMDIEGYVKSIT  1402

Query  1762  PKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTS  1583
              KGCF+MLSR +DA+ILLSNL+D +IE PEKEFPVGKLV GKV+SVE LSKR++VTL++ 
Sbjct  1403  SKGCFVMLSRHLDARILLSNLSDRYIEDPEKEFPVGKLVHGKVISVEPLSKRIDVTLKSK  1462

Query  1582  SSATPRKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNV  1403
                    S +    +   G++ISG+I+R+ES+GLFI++D+TNLVGLCH+SELSD+H++++
Sbjct  1463  IGTGVSDSSVLDFESLHVGDVISGRIRRVESYGLFINIDHTNLVGLCHISELSDNHVEHI  1522

Query  1402  QSRYKAGQTvrvkvlkvdkdRHRISLGMKNSYFRDDDGEDIQTTS--RQSINSTDKGNSV  1229
              S+Y  GQ V+ KVLK+D++R+R+SLG+K SY      +         + IN     + +
Sbjct  1523  DSKYAVGQRVQAKVLKIDQERNRVSLGLKESYLGVKTNQIFTNFEMLEEVINGHGSSDDL  1582

Query  1228  FIGTQSTVFPESSDADIDVSVVNTTDN--ILTEVESRASIPPLEVPLDDIEN---SDIDD  1064
                T++  F  S      V   +   +  ILT+++SR S+ PLEV   D E+    D + 
Sbjct  1583  ETHTETDGFKNSPQDSARVRSFDMKSDFLILTDIKSRESVLPLEVDFGDTEDRYFGDAES  1642

Query  1063  AVNKNPDHTGGADTTDekdkkramkkakkerereiraaeerlleKDI-PRNTDEFEKLVR  887
                +N      AD++  + K R  KK  KE       A E  L  D+ P + D+FEK+VR
Sbjct  1643  GAKENSKEKKIADSSSTEKKSRRAKKKAKEEREMEIRAAEENLLDDLCPNSVDDFEKMVR  1702

Query  886   SSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGN  707
              SPNSS VWIKYM FMLSL DVE ARSIAE+A++ I+IREE+EKLNVWVAYFNLE  +G 
Sbjct  1703  GSPNSSLVWIKYMDFMLSLADVENARSIAERALNAIDIREEAEKLNVWVAYFNLENTHGK  1762

Query  706   PPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRR  527
             PP+EAV K+F+RALQYCDP+K+HLALLG+YERTE Y+L DELL KMVKKFK SC++WLRR
Sbjct  1763  PPEEAVRKIFERALQYCDPEKLHLALLGMYERTEQYQLADELLNKMVKKFKSSCEVWLRR  1822

Query  526   IQWALKQNQDNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYP  347
             ++  LKQ +D+ Q I+ R L  LP+H+HI+FI++TA+LEFKCG  +RGRS+FE +L+ +P
Sbjct  1823  VENLLKQGKDDVQDILRRGLQSLPRHQHIEFISKTALLEFKCGEPERGRSLFEELLRNHP  1882

Query  346   KRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIE  167
             KRTDLWSVYLDQEIR+GD ++IRALFERA  L++PPKKMKFLFKKYL YEKS GDE R+E
Sbjct  1883  KRTDLWSVYLDQEIRIGDSELIRALFERATCLTLPPKKMKFLFKKYLTYEKSHGDESRVE  1942

Query  166   SVKRKAMEYVES  131
              V +KAME+V S
Sbjct  1943  YVMKKAMEFVNS  1954



>gb|EPS59007.1| hypothetical protein M569_15804, partial [Genlisea aurea]
Length=1805

 Score =  2025 bits (5247),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1095/1830 (60%), Positives = 1382/1830 (76%), Gaps = 43/1830 (2%)
 Frame = -2

Query  5575  SVEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLV  5396
             S ++  G LFG  + GK+P+ AN+IT +N+S GMKLWG+IAE+NEKDI+VSLPGGLRGLV
Sbjct  1     SADNGSGHLFGDGVVGKMPRFANKITLRNLSTGMKLWGMIAELNEKDIIVSLPGGLRGLV  60

Query  5395  LASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLA  5216
              A +A DP  ++     +M SN+LS L+   QLV CIVL ++DD+K+A K KIWLSLRL+
Sbjct  61    RACDAVDPQIEDALRG-DMASNFLSKLYKEKQLVPCIVLQVEDDRKDASKVKIWLSLRLS  119

Query  5215  LLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVD---KMNTGQL  5045
             +L+K+LTLDA+QEG++L+AY +S EDHG +L+FG PSF+GF+    +S +   +++ GQ+
Sbjct  120   VLYKSLTLDAVQEGMVLNAYTQSLEDHGCVLYFGSPSFTGFMQKCERSYNCKTELSMGQI  179

Query  5044  VEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVML  4865
             ++GVV SVDR R+VV+L+S P+ I+K V  +    SID L PGMMVNA V ++L+NG+ML
Sbjct  180   IKGVVTSVDRARRVVHLNSDPEVISKVVDTEPNTFSIDTLSPGMMVNARVSAILDNGLML  239

Query  4864  SFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKK  4685
             SFL+YFTGTVDIF+L    P  SW++ Y  N KV +RILFID ATRA+GL+LNP LV   
Sbjct  240   SFLSYFTGTVDIFNLSNTIPSSSWRNGYSINMKVKSRILFIDSATRAIGLTLNPSLVGNM  299

Query  4684  APPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKP  4505
             AP SLVK+GDIF+++KV+RVDK  GLL+E+P+ P PTPA+V ++D  D+ V+ ++K+FK 
Sbjct  300   APKSLVKIGDIFDKSKVLRVDKAFGLLVELPTKP-PTPAFVSVTDAFDEAVENLDKSFKE  358

Query  4504  GKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFS  4325
             G VV +R+LG+R+LEGLA GSLK SA +G VF+HSDVKPGMVVKAK++ V S GAIVQFS
Sbjct  359   GSVVPIRILGYRHLEGLAIGSLKASALKGLVFSHSDVKPGMVVKAKILKVRSSGAIVQFS  418

Query  4324  SGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSS  4145
             SGVKA+CPLRHMSEFE  KP KKFQ G ELVFRVLGC+SKRI+VTHKKTLVKSKL ILSS
Sbjct  419   SGVKAICPLRHMSEFERAKPPKKFQAGVELVFRVLGCRSKRISVTHKKTLVKSKLGILSS  478

Query  4144  YTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCR  3965
             Y DAT+GL+THGWITKI+K+GCFVRFYNGV+GF  RSELGL P  DI S+YHVEQVVKCR
Sbjct  479   YADATDGLVTHGWITKIDKNGCFVRFYNGVEGFVSRSELGLGPDGDIGSLYHVEQVVKCR  538

Query  3964  VVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGT  3785
             VV    +SR I LSF     R S  E +KPGT VSG+   VT  + VV   NG S+ +G 
Sbjct  539   VVKYLRSSRTISLSFNVTQSRSSLVESMKPGTTVSGVCGHVT-STTVVVNVNGSSNTRGI  597

Query  3784  VSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQ  3605
             ++ +HL+DH G A L  + LKPGY FDQLLVL +EG NL+LSAK SL+ +AQQLP+DV +
Sbjct  598   ITLEHLADHHGHAKLFIASLKPGYLFDQLLVLGVEGKNLLLSAKTSLLLSAQQLPVDVTE  657

Query  3604  ISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILD  3425
             I   SV+HGY+CN+I +G F+RFLGRLTGF+PRSK T+DRR +  E+F +GQSV     D
Sbjct  658   IRCPSVMHGYICNIIESGCFIRFLGRLTGFAPRSKVTNDRRLNLCEIFRVGQSVRCIAHD  717

Query  3424  VNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIV  3245
             VN E+GRIT+SLKQSLC S+DA++ QEYF +E KIAK+Q+LD      +W   FG+ S+V
Sbjct  718   VNTESGRITLSLKQSLCCSSDASYAQEYFSMEAKIAKMQALDIESPECSWDANFGICSVV  777

Query  3244  EGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSL  3065
             EGKVHEIK+ G V++F+KY DV+GFIS  QL    +E  S ++AAV+DVSKI+ LVDLSL
Sbjct  778   EGKVHEIKDVGAVLSFDKYHDVYGFISHNQLPE-PLEVNSIVRAAVLDVSKIDRLVDLSL  836

Query  3064  KPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALG  2885
             KPEF+  S         + KKRK  A  ++EVNQ+V A+VEIVKENYLVLS+P    A+G
Sbjct  837   KPEFLT-SFEDGFTGGARSKKRKTNASMNVEVNQAVMAIVEIVKENYLVLSLPDHKSAIG  895

Query  2884  YASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkk  2705
             YA   D+NTQNLP KQFV+GQ V AT+++LP  ST  RLLL+L ++ +  E+  +KR KK
Sbjct  896   YAMRFDYNTQNLPHKQFVHGQRVQATVLSLPSPSTCWRLLLMLNSVGDDFETRRTKRTKK  955

Query  2704  nsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTA  2525
             N SYDVGS+VQ EIT I  LE+R+KF SG HGR+HITE TD N+ E P + + +G+TLTA
Sbjct  956   NHSYDVGSVVQVEITKINLLEVRVKFASGHHGRIHITETTDGNSAETPFSAYTVGETLTA  1015

Query  2524  RIVSKDSRSENKR-GYQWELSTKPSVLAGDM-----DGPHESFNYSTGQLLSGYVFKVDS  2363
              IVSK ++ EN   GY WELS KPS+L G +       P E  +Y  GQ +SGYV+KVDS
Sbjct  1016  VIVSKVNKRENGSGGYLWELSVKPSLLDGSVGVDKFTKPSEEIDYIYGQPVSGYVYKVDS  1075

Query  2362  EWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHT  2183
             EWAWL+ISR   A+L+ LDSS EPSEL EFQKRF VGK VSGY++S NKEKKLL    H 
Sbjct  1076  EWAWLSISRWATAKLFFLDSSCEPSELAEFQKRFSVGKLVSGYVVSVNKEKKLL----HL  1131

Query  2182  LLITPEDTVPSSESAR-----CHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTE  2018
              L  P+D    SE+        H+ EGS++GGRISKIL GVGGL+VQI +H +G V+F E
Sbjct  1132  ALNKPKDCSSESENFYQHQLFGHLAEGSIIGGRISKILSGVGGLVVQIASHHYGMVNFME  1191

Query  2017  LRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISEHDDVHS  1838
             L + W  +PLSGY EGQFVKC++L++  S KGT HVDLSLR    + N  +     DV+ 
Sbjct  1192  LTNSWDLNPLSGYQEGQFVKCEILEINRSAKGTVHVDLSLR--CPSCNVADAEHSSDVNI  1249

Query  1837  QNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPV  1658
               +R ++IKDL PDM V+GYVK+++ KGC+IMLSRK+DAKIL+ NL+D ++E+P  +FP+
Sbjct  1250  --KRPKEIKDLQPDMPVKGYVKSISTKGCYIMLSRKIDAKILICNLSDNYVENPAVDFPI  1307

Query  1657  GKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGKIKRIESFGLF  1478
             GKLV+G+V SVE LSKRVEVTLRTSS    R SD+ + ++ SAG IISG+IKR+ESFGLF
Sbjct  1308  GKLVSGRVRSVEPLSKRVEVTLRTSS--VDRGSDVISFDHVSAGTIISGRIKRVESFGLF  1365

Query  1477  ISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSYFRD  1298
             IS+DNTN+VGLCH+SE+SD + ++ ++ Y  GQ V  KVLKVDKDR+R+SLG+KNSY   
Sbjct  1366  ISIDNTNIVGLCHISEISDSYEEHPETNYAVGQIVSAKVLKVDKDRNRVSLGLKNSYMET  1425

Query  1297  DDGEDIQTTSRQSINSTDKGNSVFIGTQSTVFPESSDADIDVSVVNTTDNILTEVESRAS  1118
             D  E + T  +Q  +     N  F+  +S          ++ + V     I  E ESRA+
Sbjct  1426  D--EKLNTPMQQENDLAHFVNDSFLQVES----------MNGTSVYVPSPIPAEAESRAT  1473

Query  1117  IPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkramkkakkerereiraaeerl  938
             +PPLEVPLD+  N D  + ++       GA+   +KD+KR  K+A+ ERE EIRAAEE+L
Sbjct  1474  VPPLEVPLDEFANLD-SEVISDQRIEVAGAERNVDKDEKRVKKRARLEREIEIRAAEEKL  1532

Query  937   leKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESE  758
             LE+DIP+N +E+EKLVR+SPNSSF+WIKYMA MLSL DVEKARS+AE+A+ TIN REESE
Sbjct  1533  LEEDIPKNAEEYEKLVRNSPNSSFMWIKYMAHMLSLADVEKARSVAERALQTINFREESE  1592

Query  757   KLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELL  578
             KLN+WVAYFNLE EYGNPP+EAV KVFQRALQ CDPKKVHLALLG+YERTE Y+  + LL
Sbjct  1593  KLNIWVAYFNLENEYGNPPEEAVSKVFQRALQTCDPKKVHLALLGMYERTEQYESCEGLL  1652

Query  577   EKMVKKFKHSCKIWLRRIQWALK-QNQDNSQSIVNRALLCLPKHKHIKFITQTAILEFKC  401
             +KM +KFK S K+WLR+I + L   N D+ QS V+ ALL LP HKH+KFI+Q A+LEFK 
Sbjct  1653  DKMTRKFKRSSKVWLRKINFLLGINNSDSIQSTVSHALLSLPPHKHVKFISQAAVLEFKR  1712

Query  400   GVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFL  221
             GV DRGRS+FE +L+EYPKRTD+WS+YLDQEIR GD DVIRALFERAISL++P KKMKF 
Sbjct  1713  GVPDRGRSLFEGILREYPKRTDVWSIYLDQEIRNGDGDVIRALFERAISLTLPQKKMKFF  1772

Query  220   FKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             FKKYL YEKS GD+ER+ESVKRKAMEYVES
Sbjct  1773  FKKYLEYEKSAGDKERVESVKRKAMEYVES  1802



>ref|XP_010227625.1| PREDICTED: protein RRP5 homolog [Brachypodium distachyon]
Length=1906

 Score =  1955 bits (5065),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1040/1883 (55%), Positives = 1380/1883 (73%), Gaps = 45/1883 (2%)
 Frame = -2

Query  5746  SAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhklykKNQSVE  5567
             SA L   D+   FPRGG SLLS++E+ E R E DAEFE E+R   KK++  +       +
Sbjct  53    SAALFTADDDGAFPRGGRSLLSRDEMAEARTEADAEFEKEERRGAKKRKSNISI-GIDAD  111

Query  5566  DDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLAS  5387
             DDLG+LFG + +GKLP+ ANRIT KNISP MKLWGV+ EVN+KD++VSLPGG+RG V   
Sbjct  112   DDLGTLFGGATTGKLPRFANRITLKNISPNMKLWGVVIEVNQKDVIVSLPGGMRGFVRKD  171

Query  5386  EAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAG-KWKIWLSLRLALL  5210
             E  D       N  + +S+  + + HVGQLV C+VL +DDDKKE     ++WLSLRL L+
Sbjct  172   EVSDLALHG--NHKDSESSICAEVVHVGQLVPCVVLRVDDDKKEGKVNKRVWLSLRLTLI  229

Query  5209  HKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDKMNTGQLVEGVV  5030
             +K L+LD IQ+G++L+A +KS EDHGYIL+FG+ +FSGF+P   +   K+ +GQLV+ VV
Sbjct  230   YKGLSLDGIQDGMVLTAQVKSVEDHGYILYFGVSTFSGFMPKCDKETVKIESGQLVQCVV  289

Query  5029  KSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTY  4850
             K++D+ R +++LS   D ++K + KDLKG+SID L+PGMM+NA V +VLENGVMLSFLTY
Sbjct  290   KAIDKARAIIHLSCDEDLLSKSIIKDLKGLSIDHLIPGMMMNARVHTVLENGVMLSFLTY  349

Query  4849  FTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSL  4670
             FTGT DIF+L   FP  +WKDDY +NKKVNARILF+DP+TRAVGL+LN HL+  + PP  
Sbjct  350   FTGTADIFNLSNSFPSGNWKDDYSKNKKVNARILFVDPSTRAVGLTLNQHLLRFEVPPVN  409

Query  4669  VKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKVVR  4490
             VKVG+I+E+++V+R+DK  GL LEIP SP P+P +V I DV DK+VKK+EK FK G + R
Sbjct  410   VKVGEIYERSRVLRMDKRAGLFLEIP-SPTPSPGFVSIHDVSDKDVKKVEKKFKEGSITR  468

Query  4489  VRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGVKA  4310
             VRVLG R+LEG+A G+LK SAFEGSVFTH+DVKPGMVV+AKV+TV    AIVQF+ GVKA
Sbjct  469   VRVLGVRHLEGVALGTLKDSAFEGSVFTHADVKPGMVVRAKVVTVGPLEAIVQFAGGVKA  528

Query  4309  LCPLRHMSEFE-IVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSYTDA  4133
             LCPLRHMSE + +VKP KKF+VG+EL+FRVLGCKSKRITVT+KK+LVKSKL++L+SY DA
Sbjct  529   LCPLRHMSELDNVVKPPKKFKVGAELLFRVLGCKSKRITVTYKKSLVKSKLEVLASYADA  588

Query  4132  TEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSS  3953
               GL+THGWITKIEKHGCFVRFYNGV+GF  RSELGL+PG++  S+YHV QVVKCR+VS 
Sbjct  589   KIGLVTHGWITKIEKHGCFVRFYNGVKGFVSRSELGLEPGTEAGSVYHVGQVVKCRIVSV  648

Query  3952  SPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTVSTQ  3773
              PAS ++ +SF T   R+ + +  K GT+VS +VE +TP ++VV+VN      KG++  +
Sbjct  649   VPASMKLNVSFATSSNRIIQADTAKVGTIVSAVVERLTPAAVVVSVNGFS---KGSILDE  705

Query  3772  HLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQISPH  3593
             HL+DH G A  +K++LKPG+EF+QLLVLD EG NL+LSAK SLI++A  +P +++Q+   
Sbjct  706   HLADHHGQAAQLKNLLKPGHEFNQLLVLDTEGQNLILSAKQSLINSANDIPSEISQMQAG  765

Query  3592  SVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVNGE  3413
             +VVHGY+CN+I  G FVRFLG LTGFSP+ KA D      S  F++GQSV ++IL+VN E
Sbjct  766   AVVHGYICNIIEAGCFVRFLGHLTGFSPKDKAVDIPMEKLSAAFFVGQSVRSHILNVNAE  825

Query  3412  TGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGKV  3233
             + R+ +SL+QS+CSS D +F+Q YFLL+ KIA+++   S+ S  +W    G+GS+V+G+V
Sbjct  826   SARLKLSLQQSVCSSPDCSFMQGYFLLDQKIAEMKYSGSSTSH-DWKKSLGIGSLVKGEV  884

Query  3232  HEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEF  3053
               ++E+GV++ F+ + DV G I   QLGG  V+ GS+++  ++D+S  + +V+LSLKPE 
Sbjct  885   GAVEEYGVILNFKDHPDVVGLIEHHQLGGSTVKVGSSVKGLIVDLS--DGVVNLSLKPEL  942

Query  3052  VNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGYASL  2873
             +      + +   +KKKR R A  DLE+++ VNAVVEIVKE+Y+VLSVP  N+A+G+A L
Sbjct  943   IG-----SVSMDGKKKKRHRAAVLDLELHEEVNAVVEIVKESYVVLSVPEYNHAIGFAPL  997

Query  2872  NDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkknsSY  2693
              D+N+Q LP   + NGQ +   + ++P S   GRL+LL K   + +  SSS++ KK S  
Sbjct  998   MDYNSQLLPHHHYDNGQRITVVVGSIPSSDPSGRLILLPKTSGQGSGLSSSRKAKKLSD-  1056

Query  2692  DVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARIVS  2513
              VGSLV+AE+ DIKPLEL +KFG   HGR+HITE  +D+ +E P +  RIGQ + AR+V+
Sbjct  1057  KVGSLVEAEVIDIKPLELIVKFGVNHHGRIHITEVLEDDCSEHPFSKLRIGQKIHARVVA  1116

Query  2512  KDSRSENK-RGYQWELSTKPSVLAGD---MDGPHESFNYSTGQLLSGYVFKVDSEWAWLT  2345
             +   S N  R  +WELS +PSVL G+   ++      N+S   ++  YV KVD EW WLT
Sbjct  1117  QAEHSANSGRKLKWELSIRPSVLQGESKQLNALENKSNHSVNGIVRAYVVKVDREWVWLT  1176

Query  2344  ISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVP---HTLLI  2174
             +SR V A L+ILDSS EP ELKEFQ+R+ VG++V GYI+  N+EKKLLRL       +L 
Sbjct  1177  VSRNVTAHLFILDSSVEPIELKEFQQRYRVGQAVKGYIIGVNREKKLLRLKALDNQAMLK  1236

Query  2173  TPEDTVPSSESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSD  1994
               +DT     S   H +EG ++GGRI KILPGVGGLL+QI  HL G+VH+TE+ D WV +
Sbjct  1237  NIDDTQKPISSIAEHTKEGDIIGGRIQKILPGVGGLLIQIGPHLHGRVHYTEIVDSWVPE  1296

Query  1993  PLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWT-LDTMNNQNISEHDDVHSQNRRVQD  1817
             PLSG+ EGQFVKCKVL V    +G+  V+LSLR + L T ++ +    DD  +   R ++
Sbjct  1297  PLSGFHEGQFVKCKVLAVSRPSEGSVRVELSLRSSILCTSHDPSRKLVDDSATCTTRFEN  1356

Query  1816  IKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGK  1637
             + DL P   V+GYVKNV  KGCFIMLSR ++A+I+LSNL+D ++E+P+K+F VG LV G+
Sbjct  1357  VNDLSPGSEVKGYVKNVNAKGCFIMLSRMIEARIILSNLSDEYVENPQKDFSVGMLVHGR  1416

Query  1636  VVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTN  1457
             V+S E LS +VEV+LR  + +  +KSD  + ++   G+II G++KR+ES+GLF+++ ++ 
Sbjct  1417  VLSAEPLSGKVEVSLRKGTGSKSQKSDGISYSDLHVGDIIDGQVKRVESYGLFVTIQSSE  1476

Query  1456  LVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSYFRDDDGEDIQ  1277
             LVGLCHVSELSD+ + ++ S YKAG  V+ K+LK+D++R R+SLGMK SYF     + I 
Sbjct  1477  LVGLCHVSELSDEPVLDINSCYKAGDMVKAKILKIDEERRRVSLGMKKSYFVSGLTDGIN  1536

Query  1276  TTSRQSINSTDKGNSVFIGTQSTVFPESSDADIDVSVVNTTDNILTEVESRASIPPLEVP  1097
                          N V         PE S +D++ ++V      + E E RAS+ PL+V 
Sbjct  1537  DDDDDDERVPMDINHV---------PEMS-SDLNSALV------VPEPEPRASVLPLQVS  1580

Query  1096  LDDIENSDIDDAVNKNPDHTGGADTTDekdkkramkkakkerereiraaeerlleKDIPR  917
             LD+ E SD  D+ +K P    G  +  +K  KR  +KA+K+RE +I A EER L+KDIP+
Sbjct  1581  LDEYEGSD-QDSDDKGPKIANGTGSIVQKSDKRLKEKARKQRELDISALEERALQKDIPK  1639

Query  916   NTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVA  737
               DEFEKLVRSSPNSSFVWI YMAF+L L DVEKARS+AE+A+ TIN+REE EKLNVWVA
Sbjct  1640  TPDEFEKLVRSSPNSSFVWINYMAFLLDLADVEKARSVAERALRTINMREEEEKLNVWVA  1699

Query  736   YFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKF  557
             YFNLE EYG P ++AV K+FQRA+QYCDPKKVHLALLG+YERT+ ++L DEL ++M K+F
Sbjct  1700  YFNLENEYGCPREDAVKKIFQRAMQYCDPKKVHLALLGMYERTDQHELADELFDRMTKRF  1759

Query  556   KHSCKIWLRRIQWALKQNQDNS--QSIVNRALLCLPKHKHIKFITQTAILEFKCGVADRG  383
             K SCKIWLRRIQ++LKQ +D    +SI+NRALL LP+ K IKF++QTAILEFKCGV + G
Sbjct  1760  KTSCKIWLRRIQFSLKQGRDVEYIKSIINRALLSLPQSKRIKFLSQTAILEFKCGVPEEG  1819

Query  382   RSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYLA  203
             RS FE +L+EYPKRTDLWSVYLDQEIR+GD DVIRALF+R   LS+PPKKMKFLFKKYLA
Sbjct  1820  RSRFELILREYPKRTDLWSVYLDQEIRLGDTDVIRALFDRVTCLSLPPKKMKFLFKKYLA  1879

Query  202   YEKSVGDEERIESVKRKAMEYVE  134
             YEKS GD ER+E V +KA EY +
Sbjct  1880  YEKSQGDRERMELVMQKATEYAK  1902



>ref|XP_002884876.1| S1 RNA-binding domain-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH61135.1| S1 RNA-binding domain-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=1843

 Score =  1938 bits (5021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1018/1709 (60%), Positives = 1294/1709 (76%), Gaps = 66/1709 (4%)
 Frame = -2

Query  5170  ILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDK--MNTGQLVEGVVKSVDRTRKVVY  4997
             + SA +KS EDHGYILHFGLPS SGF+ I +    +  M TGQL++GVV  +DR RKVV+
Sbjct  169   VFSANVKSVEDHGYILHFGLPSISGFIEISNDGNQESVMKTGQLIQGVVTKIDRDRKVVH  228

Query  4996  LSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQ  4817
             LSS PD++AK +TKDL G+S DLL+PGMMVNA V SVLENG++  FLTYF GTVD+FHL+
Sbjct  229   LSSDPDSVAKCLTKDLNGMSFDLLIPGMMVNARVQSVLENGILFDFLTYFNGTVDLFHLK  288

Query  4816  QVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAK  4637
                   SWKD+Y QNK VNARILFIDP++RAVGL+LNPHLV  KAPP  V  GDIF++AK
Sbjct  289   NPLSNKSWKDEYNQNKMVNARILFIDPSSRAVGLTLNPHLVCNKAPPLHVFSGDIFDEAK  348

Query  4636  VIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEG  4457
             V+R+DK  GLLLE+PS PVP PAY+               +FK G  +RVR+LG + +EG
Sbjct  349   VVRIDKS-GLLLELPSKPVPNPAYI---------------SFKEGNHIRVRILGLKQMEG  392

Query  4456  LATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFE  4277
             LA G+LK SAFEG VFTHSDV+PGMV KAKVI+VD+FGAIVQF+ G+KA+CPLRHMSEFE
Sbjct  393   LAIGTLKESAFEGPVFTHSDVRPGMVTKAKVISVDTFGAIVQFAGGLKAMCPLRHMSEFE  452

Query  4276  IVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSYTDATEGLITHGWITK  4097
             ++KPRKKF+VG+ELVFRVLGCKSKRITVT+KKTLVKSKL ILSSYTDATEGL+THGWITK
Sbjct  453   VMKPRKKFKVGAELVFRVLGCKSKRITVTYKKTLVKSKLPILSSYTDATEGLVTHGWITK  512

Query  4096  IEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFT  3917
             IEKHGCFVRFYNGVQGF PR ELGL+PGSD  S++HV +VVKCRV S+   SR+I L+  
Sbjct  513   IEKHGCFVRFYNGVQGFVPRFELGLEPGSDPDSVFHVGEVVKCRVTSAVHGSRRITLN--  570

Query  3916  TRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLM  3737
                      + +K G++VSGIV+ +T  +++V V + +  LKGT+ST+HL+DH   A LM
Sbjct  571   ---------DSIKLGSIVSGIVDSITSQAVIVRVKS-KGVLKGTISTEHLADHHDQAKLM  620

Query  3736  KSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQISPHSVVHGYVCNVIG  3557
              S+L+PGYE D+LLVLDIEG NL LS+KYSLI  A++LP D NQ+ P+SVVHGYVCN+I 
Sbjct  621   MSLLRPGYELDKLLVLDIEGNNLSLSSKYSLIKLAEELPSDFNQLQPNSVVHGYVCNLIE  680

Query  3556  NGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQSL  3377
             NG FVRFLGRLTGF+PRSKA DD R D SE F++GQSV  NI+DVN E  RIT+SLKQS 
Sbjct  681   NGCFVRFLGRLTGFAPRSKAIDDPRADLSESFFVGQSVRANIVDVNQEKSRITLSLKQSS  740

Query  3376  CSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTF  3197
             C+S DA+F+QEYFL++ KI+ LQS D   S  +WV+ F +GS+++G + E  + GVVV F
Sbjct  741   CASVDASFVQEYFLMDEKISDLQSSDITKSEYSWVEKFSIGSLIKGTLQEQNDLGVVVNF  800

Query  3196  EKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDK  3017
             +  ++V GFI    +GG  +  GS + A V+D+S+ E LVDLSL+PE +N    + +N +
Sbjct  801   DNINNVLGFIPQHHMGGATMVPGSVVNAVVLDISRAERLVDLSLRPELINNLTKEVSNSQ  860

Query  3016  TQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGYASLNDFNTQNLPVKQ  2837
               KKKRKR   K+LEV+Q V+AVVEIVKE +LVLS+P   Y +GYASL+D+NTQ LPVKQ
Sbjct  861   L-KKKRKRGISKELEVHQRVSAVVEIVKEQHLVLSIPEHGYTVGYASLSDYNTQKLPVKQ  919

Query  2836  FVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkknsSYDVGSLVQAEITD  2657
             F  GQSV+A++ A+ +  T GRLLLLL ++S  +E+S SKR KK SS +VGS+V AEIT+
Sbjct  920   FSTGQSVVASVEAVQNPLTSGRLLLLLDSVSGTSETSRSKRAKKKSSCEVGSVVHAEITE  979

Query  2656  IKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARIVSKDSRSENKRGYQ  2477
             IKP ELR+ FG+ F GR+HITE  D +T++ P   FR+GQ+++AR+VSK   ++ K+   
Sbjct  980   IKPFELRVNFGNSFRGRIHITEVNDASTSDEPFAKFRVGQSMSARVVSKPCHTDIKKSQL  1039

Query  2476  WELSTKPSVL--AGDMDGPHES--FNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYIL  2309
             WELS KP++L  + +++   ES    +  GQ ++GYV+KVD EW WL ISR V A+++IL
Sbjct  1040  WELSVKPAMLRDSSELNDIQESEQLEFVAGQCVNGYVYKVDKEWVWLAISRNVTARIFIL  1099

Query  2308  DSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTLLITPE------------  2165
             D++ E  EL+EF++ F +GK+VSGY+L+ NKEK+ LRLV   LL   +            
Sbjct  1100  DTACEAHELEEFERHFPIGKAVSGYVLTYNKEKRTLRLVQRPLLDIHKSIANGGGSKTDK  1159

Query  2164  -DTVPSSESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPL  1988
              D     +     I EG +LGGRISKILPGVGGL VQI  ++FG+VHFTE+ D WV +PL
Sbjct  1160  LDISIPGDDGTLFIHEGDILGGRISKILPGVGGLRVQIGPYVFGRVHFTEINDLWVPNPL  1219

Query  1987  SGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISEHDDVHSQN--RRVQDI  1814
              G+ EGQFVKCKVL++  S KGT  ++LSLR +LD M++ +    D  ++ N  +R +  
Sbjct  1220  DGFREGQFVKCKVLEISSSSKGTWQIELSLRTSLDGMSSADHISEDLNNNDNVCKRFERF  1279

Query  1813  KDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKV  1634
             +DL  DM VQGYVKN   KGCFI+LSRKV+AK+ LSNL D F++ PEKEFPVGKLVTG+V
Sbjct  1280  EDLSLDMGVQGYVKNTMSKGCFIILSRKVEAKVKLSNLCDTFVKEPEKEFPVGKLVTGRV  1339

Query  1633  VSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNL  1454
             ++VE LSKR+EVTL+T ++    KS+   +     G++ISG+IKR+E +GLFI +D   +
Sbjct  1340  LNVEPLSKRIEVTLKTVNAGGQPKSESYDMKKLHVGDMISGRIKRVEPYGLFIDIDQIGM  1399

Query  1453  VGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSYFRDDDGEDIQT  1274
             VGLCH+++LSDD I+NVQ+RYKAG++V  K+LK+D+++ RISLGMK+SY  + D    Q 
Sbjct  1400  VGLCHITQLSDDRIENVQARYKAGESVSAKILKLDEEKRRISLGMKSSYLMNGDDVKAQP  1459

Query  1273  TSRQSINST--------DKGNSVFIGTQSTVFPESSDADIDVSVVNTTDNILTEVESRAS  1118
              S +  + T        D    V        F E+S      + +     +L +V+SRAS
Sbjct  1460  PSEEKADETSMECDPINDPNTEVLAAVGDFGFQETSGGRHSGASL-----VLAQVDSRAS  1514

Query  1117  IPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkramkkakkerereiraaeerl  938
             IPPLEV LDDIE  D D+  N+N +   GAD  DEK K+R  +K K+ERE++I+AAE RL
Sbjct  1515  IPPLEVDLDDIEEMDFDN--NQNQEKLLGADK-DEKSKRREKQKDKEEREKKIQAAEGRL  1571

Query  937   leKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESE  758
             LE   P + DEFEKLVRSSPNSSFVWIKYMAFMLSL D+EKARSIAE+A+ TINIREE E
Sbjct  1572  LEHHAPESADEFEKLVRSSPNSSFVWIKYMAFMLSLADIEKARSIAERALRTINIREEEE  1631

Query  757   KLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELL  578
             KLN+WVAYFNLE E+G+PP+EAV KVF+RA QYCDPKKV+LALLGVYERTE YKL D+LL
Sbjct  1632  KLNIWVAYFNLENEHGSPPEEAVKKVFERARQYCDPKKVYLALLGVYERTEQYKLVDKLL  1691

Query  577   EKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLCLPKHKHIKFITQTAILEFKCG  398
             ++MVKKFK SCKIWLR+IQ +L+QN++  QS+VNRALLCLP+HKHIKFI+QTAILEFKCG
Sbjct  1692  DEMVKKFKQSCKIWLRKIQSSLQQNEEGIQSVVNRALLCLPRHKHIKFISQTAILEFKCG  1751

Query  397   VADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLF  218
             VADRGRS+FE +L+EYPKRTDLWSVYLDQEIR+G++DVIR+LFERAISLS+PPKKMKFLF
Sbjct  1752  VADRGRSLFEGVLREYPKRTDLWSVYLDQEIRLGEVDVIRSLFERAISLSLPPKKMKFLF  1811

Query  217   KKYLAYEKSVGDEERIESVKRKAMEYVES  131
             KK+L YE+SVG+EER E VK++A+EY +S
Sbjct  1812  KKFLEYERSVGEEERAEYVKQRALEYAKS  1840


 Score =   133 bits (334),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 162/569 (28%), Positives = 263/569 (46%), Gaps = 86/569 (15%)
 Frame = -2

Query  5749  KSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhklykKNQSV  5570
             ++  LQL+D V DFPRGG + LSK+E +++  EVDAEF+A++R  KK K  K  K+  S 
Sbjct  39    EAMALQLDD-VLDFPRGGGTSLSKKEREKIYEEVDAEFDADERVSKKSKGGKSKKRIPSD  97

Query  5569  EDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLA  5390
              DDLG LFG     K P+ AN+IT KNISPGMKL GV+ EVN+KDIV+SLPGGLRGLV A
Sbjct  98    VDDLGLLFGGLNG-KRPRYANKITTKNISPGMKLLGVVIEVNQKDIVISLPGGLRGLVRA  156

Query  5389  SEAHD------PLWDNETNEMEMQSNYL-------SGLFHV------------GQLVSCI  5285
             SEA D       ++      +E     L       SG   +            GQL+  +
Sbjct  157   SEASDFTDLGIEVFSANVKSVEDHGYILHFGLPSISGFIEISNDGNQESVMKTGQLIQGV  216

Query  5284  VLHLDDDKKEAGKWKIWLSLRLALLH--KNLTLDAIQEGIILSAYIKSTEDHGYILHFGL  5111
             V  +D D+K         S+   L      ++ D +  G++++A ++S  ++G +  F L
Sbjct  217   VTKIDRDRKVVHLSSDPDSVAKCLTKDLNGMSFDLLIPGMMVNARVQSVLENGILFDF-L  275

Query  5110  PSFSGFL-------PIHSQS-VDKMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTK  4955
               F+G +       P+ ++S  D+ N  ++V   +  +D + + V L+  P  +      
Sbjct  276   TYFNGTVDLFHLKNPLSNKSWKDEYNQNKMVNARILFIDPSSRAVGLTLNPHLVCN----  331

Query  4954  DLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQ  4775
               K   + +    +   A V+ + ++G++L   +            +  P P++   + +
Sbjct  332   --KAPPLHVFSGDIFDEAKVVRIDKSGLLLELPS------------KPVPNPAYI-SFKE  376

Query  4774  NKKVNARILFIDPATRAVGLSL---------NPHLVHKKAPPSLVKVGDIFEQAKVIRVD  4622
                +  RIL +    +  GL++          P   H    P +V       +AKVI VD
Sbjct  377   GNHIRVRILGL---KQMEGLAIGTLKESAFEGPVFTHSDVRPGMVT------KAKVISVD  427

Query  4621  KGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGS  4442
                G +++         A   +  + + EV K  K FK G  +  RVLG ++     T +
Sbjct  428   T-FGAIVQFAGG---LKAMCPLRHMSEFEVMKPRKKFKVGAELVFRVLGCKSKR--ITVT  481

Query  4441  LKTSAFEGS---VFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIV  4271
              K +  +     + +++D   G+V    +  ++  G  V+F +GV+   P   +      
Sbjct  482   YKKTLVKSKLPILSSYTDATEGLVTHGWITKIEKHGCFVRFYNGVQGFVPRFELGLEPGS  541

Query  4270  KPRKKFQVGSELVFRVLGC--KSKRITVT  4190
              P   F VG  +  RV      S+RIT+ 
Sbjct  542   DPDSVFHVGEVVKCRVTSAVHGSRRITLN  570



>ref|XP_008652169.1| PREDICTED: protein RRP5 homolog isoform X2 [Zea mays]
Length=1902

 Score =  1937 bits (5018),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1029/1872 (55%), Positives = 1376/1872 (74%), Gaps = 54/1872 (3%)
 Frame = -2

Query  5713  DFPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhklykKNQ-SVEDDLGSLFGHS  5537
             DFPRGG SLLSK+E+ E RAE + +FE E +  K K++    + +   V+DDLG LFG +
Sbjct  66    DFPRGGHSLLSKDEMAEARAEAEQDFEREAKKGKGKRKRSGGESSGFGVDDDLGILFGGA  125

Query  5536  ISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNE  5357
              +GKLP+ ANRIT KNISP MKLWGV+ EVN+KDIV+SLPGG+RG V + +  D     +
Sbjct  126   TTGKLPRFANRITVKNISPNMKLWGVVIEVNQKDIVLSLPGGIRGFVRSEDVCDIAL--Q  183

Query  5356  TNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAG-KWKIWLSLRLALLHKNLTLDAIQ  5180
              N  +  +N  + + HVGQLV CIVL +DDD +E     ++WLSLRL+LL+K L LD +Q
Sbjct  184   ENRKDSGNNLCAEVVHVGQLVPCIVLRVDDDSREGKVNKRVWLSLRLSLLYKGLALDGLQ  243

Query  5179  EGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDKMNTGQLVEGVVKSVDRTRKVV  5000
             EG++L+A +KS EDHGYILHFG+ SFSGF+    + V K    QL++ VVK++D+TR +V
Sbjct  244   EGMVLTAQVKSIEDHGYILHFGVSSFSGFMQKDDKDV-KTERRQLMQCVVKAIDKTRAIV  302

Query  4999  YLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHL  4820
             +LSS  D ++K   KDLKG+SID L+PGMMVNA V S LENG+MLSFLTYF+GTVDIF+L
Sbjct  303   HLSSDEDLLSKSTIKDLKGLSIDHLIPGMMVNARVHSFLENGLMLSFLTYFSGTVDIFNL  362

Query  4819  QQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQA  4640
                FP  +WKDDY +NKKVNARILF+DP+TRAVGL+LN HL+H + PP  +K GDI++++
Sbjct  363   LNSFPSGNWKDDYSKNKKVNARILFVDPSTRAVGLTLNKHLLHLEVPPINLKAGDIYDKS  422

Query  4639  KVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKVVRVRVLGFRNLE  4460
             KV+RVDK  GL LEIPS P P+P ++ I DV DK+ K +E  FK G  +RVR+LG RNLE
Sbjct  423   KVLRVDKKAGLFLEIPS-PTPSPGFISIRDVSDKDAKNLE-KFKEGSSLRVRILGVRNLE  480

Query  4459  GLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGVKALCPLRHMSEF  4280
             G+A G++K SAFEGSVFTH DVKPGM+V+AKV TV+ FGAIVQFSSGVKALCPL HMSE 
Sbjct  481   GVAIGTIKDSAFEGSVFTHDDVKPGMLVRAKVATVEPFGAIVQFSSGVKALCPLPHMSEL  540

Query  4279  E-IVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSYTDATEGLITHGWI  4103
             E +VKP KKF+VG+EL+FRVLGCKSKR+TVT+KK+LVKSKLD+LSSY DA  GL+THGWI
Sbjct  541   EHVVKPPKKFKVGAELLFRVLGCKSKRVTVTYKKSLVKSKLDVLSSYADAKIGLVTHGWI  600

Query  4102  TKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLS  3923
             T IEKHGCFV+FYNGVQGF  RS+LGL+ G++  ++YHV QVVKCR+++  PASR++ +S
Sbjct  601   THIEKHGCFVKFYNGVQGFVSRSDLGLEAGTEAENVYHVGQVVKCRIINVIPASRKLNVS  660

Query  3922  FTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLAD  3743
             F     R++  +  K G++VSG+VE +TP ++VV+VN      KGT+  +HL+DH G A 
Sbjct  661   FVISHNRIAPIDTPKLGSIVSGVVERLTPAAVVVSVNGFS---KGTILNEHLADHHGQAA  717

Query  3742  LMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQISPHSVVHGYVCNV  3563
              +K+VLKPG+EF+QLLVLD EG NLVLSAK+SLI+ A  +P +++Q+ P  VVHGY+CN+
Sbjct  718   QLKNVLKPGHEFNQLLVLDTEGQNLVLSAKHSLINCANDIPSEISQMHPGVVVHGYICNI  777

Query  3562  IGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQ  3383
             I  G FVRFLG LTGFSP+ KA D      S+ FY+GQSV ++IL VN ET R+ ++L+Q
Sbjct  778   IEAGCFVRFLGHLTGFSPKDKAVDRWIEKLSDAFYVGQSVRSHILSVNAETARVKLALQQ  837

Query  3382  SLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVV  3203
             S+CSS D++FIQ YFLL+ KIA L+      S  +W   FG+GS+VE +V  I+E+G+++
Sbjct  838   SMCSSMDSSFIQGYFLLDQKIAALKY-----SSNDWARHFGIGSLVEAEVGAIEEYGIIL  892

Query  3202  TFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTAN  3023
              F+ + D  G I   QLGG +VE GS+++  V+D+S  + +V+LS+KPE ++     +  
Sbjct  893   NFKDHLDTVGLIEHHQLGGSSVEVGSSVKGLVLDLS--DGVVNLSVKPELID-----SVR  945

Query  3022  DKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGYASLNDFNTQNLPV  2843
                +KKKR+R    DLE+++ VNAVVEI+K++Y+VLS+P  NYA+G++ L D+N+Q LP 
Sbjct  946   IVGKKKKRQRAVVADLELHEEVNAVVEIIKDSYMVLSIPEYNYAIGFSPLMDYNSQLLPH  1005

Query  2842  KQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkknsSYDVGSLVQAEI  2663
               + NGQ +   +  +P S + GRL+LL KA ++ +  S SKR KK S Y +GSLV+AEI
Sbjct  1006  HHYDNGQRITVVVGNIPSSDSSGRLILLPKASAQYSSLSDSKRAKKKSGYKIGSLVEAEI  1065

Query  2662  TDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARIVSKDSRS-ENKR  2486
              DIKPLEL LKFG   HGR+HITE  ++++ E P ++ RIGQ LTARIVS+   S ++ +
Sbjct  1066  IDIKPLELLLKFGGNLHGRIHITEILEEDSAEHPFSELRIGQKLTARIVSEAEPSGKSGK  1125

Query  2485  GYQWELSTKPSVLAGDMDGPHESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILD  2306
              ++WELS +P ++ G+     +  N++T  ++  YV KVD EW WLT+SR V A L++LD
Sbjct  1126  KFKWELSIRPCIVNGEF--AQKEQNHTTNGIVRAYVVKVDKEWVWLTVSRNVMAHLFLLD  1183

Query  2305  SSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTLLITP---EDTVPSSESAR  2135
             SS+EPSELKEFQ+RF VG++V G ++S N+EK+LLRL       T    ++T     S  
Sbjct  1184  SSSEPSELKEFQQRFSVGQAVKGRVISVNQEKRLLRLKALDNQCTQPNIDETQEPKSSVF  1243

Query  2134  CHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKC  1955
                ++G ++GGR+ KILPGVGGL+VQI  HL G+VH+TE+ D WVS+PLSG+ EGQFVKC
Sbjct  1244  GQTKQGDIIGGRVQKILPGVGGLVVQIGPHLHGRVHYTEIVDSWVSEPLSGFHEGQFVKC  1303

Query  1954  KVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYV  1775
             KVL V  S +G+  VDLSLR + + + + N S  DD+ +   R++ IKDL P   ++GYV
Sbjct  1304  KVLSVSRSSEGSLRVDLSLRSS-NLIRDSNNSRLDDLETCTSRIEKIKDLLPGTEIKGYV  1362

Query  1774  KNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVT  1595
             KNV  KGCFIMLSR VDA+I LSNL+D ++E+P+K+FPVG LV G+++S +  S RVE +
Sbjct  1363  KNVNSKGCFIMLSRMVDARITLSNLSDEYVENPQKDFPVGMLVHGRILSTDPSSGRVEAS  1422

Query  1594  LRTSSSATPRKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDH  1415
             LR ++ +   K D  + ++   G+I+ G++KR+ESFGLF+++  + LVGLCHVSELSD+ 
Sbjct  1423  LRKTTGSKLEKLDDISYSDLHVGDIVDGQVKRVESFGLFVTIRRSELVGLCHVSELSDEP  1482

Query  1414  IDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSYFRDDDGEDIQTTSRQSINSTDKGN  1235
             + ++ S YKAG  V+ K+LK+D+ RHR+SLGMK SYF  D   D           T+   
Sbjct  1483  VVDINSCYKAGDMVKAKILKIDETRHRVSLGMKKSYFDSDLTAD-----------TNDDE  1531

Query  1234  SVFIGTQSTVFPESSDADIDVSVVNTTDNILTEVESRASIPPLEVPLDDIENSDIDDAV-  1058
             S  +    +V P+  +        +  + +  + E RAS+ PL+V LD+ E SD++D + 
Sbjct  1532  SALMDI--SVAPQMVE-------YHNRNLVHRKAEPRASVLPLQVSLDESEGSDLEDNIS  1582

Query  1057  NKNPDHTGGADTTDekdkkramkkakkerereiraaeerlleKDIPRNTDEFEKLVRSSP  878
             N   +   G +   +K  K+  K+A+K+RE EI A EER L++DIP+  D+FEKLVRSSP
Sbjct  1583  NTCLEIANGTEANAKKSDKQLKKEARKQRELEISAMEERALQEDIPQTPDDFEKLVRSSP  1642

Query  877   NSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQ  698
             NSSF+WIKYMA +L L DVEKAR++AE+A+ TI  REE EKLNVWVAYFNLE EYG+P +
Sbjct  1643  NSSFIWIKYMATLLDLADVEKARAVAERALKTIIPREEEEKLNVWVAYFNLENEYGSPRE  1702

Query  697   EAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQW  518
             +AV KVFQRALQYCDPKK+HLALL +YERTE Y+L DELL++M K+FK SCKIWL RIQ+
Sbjct  1703  DAVKKVFQRALQYCDPKKLHLALLAMYERTEQYELADELLDRMTKRFKTSCKIWLCRIQF  1762

Query  517   ALKQNQDNS--QSIVNRALLCLPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPK  344
             ALKQ +D    ++IVNRALL LP  K IKF++QTAILEFKCGV + GRS FE +L+EYPK
Sbjct  1763  ALKQGKDVEYIKAIVNRALLSLPHRKRIKFLSQTAILEFKCGVPEEGRSRFELILREYPK  1822

Query  343   RTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVG-DEERIE  167
             RTDLWSVYLDQEIR+GD++VIRALFER   L++PPKKM+FLFKKYL +EKS+G D ERI+
Sbjct  1823  RTDLWSVYLDQEIRLGDVEVIRALFERVTCLTLPPKKMQFLFKKYLNFEKSLGKDNERIQ  1882

Query  166   SVKRKAMEYVES  131
              V++KA+EYV+S
Sbjct  1883  LVQQKAIEYVQS  1894



>ref|XP_008652168.1| PREDICTED: protein RRP5 homolog isoform X1 [Zea mays]
Length=1903

 Score =  1937 bits (5017),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1028/1872 (55%), Positives = 1375/1872 (73%), Gaps = 53/1872 (3%)
 Frame = -2

Query  5713  DFPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhklykKNQ-SVEDDLGSLFGHS  5537
             DFPRGG SLLSK+E+ E RAE + +FE E +  K K++    + +   V+DDLG LFG +
Sbjct  66    DFPRGGHSLLSKDEMAEARAEAEQDFEREAKKGKGKRKRSGGESSGFGVDDDLGILFGGA  125

Query  5536  ISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNE  5357
              +GKLP+ ANRIT KNISP MKLWGV+ EVN+KDIV+SLPGG+RG V + +  D     +
Sbjct  126   TTGKLPRFANRITVKNISPNMKLWGVVIEVNQKDIVLSLPGGIRGFVRSEDVCDIAL--Q  183

Query  5356  TNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAG-KWKIWLSLRLALLHKNLTLDAIQ  5180
              N  +  +N  + + HVGQLV CIVL +DDD +E     ++WLSLRL+LL+K L LD +Q
Sbjct  184   ENRKDSGNNLCAEVVHVGQLVPCIVLRVDDDSREGKVNKRVWLSLRLSLLYKGLALDGLQ  243

Query  5179  EGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDKMNTGQLVEGVVKSVDRTRKVV  5000
             EG++L+A +KS EDHGYILHFG+ SFSGF+    +   K    QL++ VVK++D+TR +V
Sbjct  244   EGMVLTAQVKSIEDHGYILHFGVSSFSGFMQKDDKEDVKTERRQLMQCVVKAIDKTRAIV  303

Query  4999  YLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHL  4820
             +LSS  D ++K   KDLKG+SID L+PGMMVNA V S LENG+MLSFLTYF+GTVDIF+L
Sbjct  304   HLSSDEDLLSKSTIKDLKGLSIDHLIPGMMVNARVHSFLENGLMLSFLTYFSGTVDIFNL  363

Query  4819  QQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQA  4640
                FP  +WKDDY +NKKVNARILF+DP+TRAVGL+LN HL+H + PP  +K GDI++++
Sbjct  364   LNSFPSGNWKDDYSKNKKVNARILFVDPSTRAVGLTLNKHLLHLEVPPINLKAGDIYDKS  423

Query  4639  KVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKVVRVRVLGFRNLE  4460
             KV+RVDK  GL LEIPS P P+P ++ I DV DK+ K +E  FK G  +RVR+LG RNLE
Sbjct  424   KVLRVDKKAGLFLEIPS-PTPSPGFISIRDVSDKDAKNLE-KFKEGSSLRVRILGVRNLE  481

Query  4459  GLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGVKALCPLRHMSEF  4280
             G+A G++K SAFEGSVFTH DVKPGM+V+AKV TV+ FGAIVQFSSGVKALCPL HMSE 
Sbjct  482   GVAIGTIKDSAFEGSVFTHDDVKPGMLVRAKVATVEPFGAIVQFSSGVKALCPLPHMSEL  541

Query  4279  E-IVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSYTDATEGLITHGWI  4103
             E +VKP KKF+VG+EL+FRVLGCKSKR+TVT+KK+LVKSKLD+LSSY DA  GL+THGWI
Sbjct  542   EHVVKPPKKFKVGAELLFRVLGCKSKRVTVTYKKSLVKSKLDVLSSYADAKIGLVTHGWI  601

Query  4102  TKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLS  3923
             T IEKHGCFV+FYNGVQGF  RS+LGL+ G++  ++YHV QVVKCR+++  PASR++ +S
Sbjct  602   THIEKHGCFVKFYNGVQGFVSRSDLGLEAGTEAENVYHVGQVVKCRIINVIPASRKLNVS  661

Query  3922  FTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLAD  3743
             F     R++  +  K G++VSG+VE +TP ++VV+VN      KGT+  +HL+DH G A 
Sbjct  662   FVISHNRIAPIDTPKLGSIVSGVVERLTPAAVVVSVNGFS---KGTILNEHLADHHGQAA  718

Query  3742  LMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQISPHSVVHGYVCNV  3563
              +K+VLKPG+EF+QLLVLD EG NLVLSAK+SLI+ A  +P +++Q+ P  VVHGY+CN+
Sbjct  719   QLKNVLKPGHEFNQLLVLDTEGQNLVLSAKHSLINCANDIPSEISQMHPGVVVHGYICNI  778

Query  3562  IGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQ  3383
             I  G FVRFLG LTGFSP+ KA D      S+ FY+GQSV ++IL VN ET R+ ++L+Q
Sbjct  779   IEAGCFVRFLGHLTGFSPKDKAVDRWIEKLSDAFYVGQSVRSHILSVNAETARVKLALQQ  838

Query  3382  SLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVV  3203
             S+CSS D++FIQ YFLL+ KIA L+      S  +W   FG+GS+VE +V  I+E+G+++
Sbjct  839   SMCSSMDSSFIQGYFLLDQKIAALKY-----SSNDWARHFGIGSLVEAEVGAIEEYGIIL  893

Query  3202  TFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTAN  3023
              F+ + D  G I   QLGG +VE GS+++  V+D+S  + +V+LS+KPE ++     +  
Sbjct  894   NFKDHLDTVGLIEHHQLGGSSVEVGSSVKGLVLDLS--DGVVNLSVKPELID-----SVR  946

Query  3022  DKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGYASLNDFNTQNLPV  2843
                +KKKR+R    DLE+++ VNAVVEI+K++Y+VLS+P  NYA+G++ L D+N+Q LP 
Sbjct  947   IVGKKKKRQRAVVADLELHEEVNAVVEIIKDSYMVLSIPEYNYAIGFSPLMDYNSQLLPH  1006

Query  2842  KQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkknsSYDVGSLVQAEI  2663
               + NGQ +   +  +P S + GRL+LL KA ++ +  S SKR KK S Y +GSLV+AEI
Sbjct  1007  HHYDNGQRITVVVGNIPSSDSSGRLILLPKASAQYSSLSDSKRAKKKSGYKIGSLVEAEI  1066

Query  2662  TDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARIVSKDSRS-ENKR  2486
              DIKPLEL LKFG   HGR+HITE  ++++ E P ++ RIGQ LTARIVS+   S ++ +
Sbjct  1067  IDIKPLELLLKFGGNLHGRIHITEILEEDSAEHPFSELRIGQKLTARIVSEAEPSGKSGK  1126

Query  2485  GYQWELSTKPSVLAGDMDGPHESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILD  2306
              ++WELS +P ++ G+     +  N++T  ++  YV KVD EW WLT+SR V A L++LD
Sbjct  1127  KFKWELSIRPCIVNGEF--AQKEQNHTTNGIVRAYVVKVDKEWVWLTVSRNVMAHLFLLD  1184

Query  2305  SSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTLLITP---EDTVPSSESAR  2135
             SS+EPSELKEFQ+RF VG++V G ++S N+EK+LLRL       T    ++T     S  
Sbjct  1185  SSSEPSELKEFQQRFSVGQAVKGRVISVNQEKRLLRLKALDNQCTQPNIDETQEPKSSVF  1244

Query  2134  CHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKC  1955
                ++G ++GGR+ KILPGVGGL+VQI  HL G+VH+TE+ D WVS+PLSG+ EGQFVKC
Sbjct  1245  GQTKQGDIIGGRVQKILPGVGGLVVQIGPHLHGRVHYTEIVDSWVSEPLSGFHEGQFVKC  1304

Query  1954  KVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYV  1775
             KVL V  S +G+  VDLSLR + + + + N S  DD+ +   R++ IKDL P   ++GYV
Sbjct  1305  KVLSVSRSSEGSLRVDLSLRSS-NLIRDSNNSRLDDLETCTSRIEKIKDLLPGTEIKGYV  1363

Query  1774  KNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVT  1595
             KNV  KGCFIMLSR VDA+I LSNL+D ++E+P+K+FPVG LV G+++S +  S RVE +
Sbjct  1364  KNVNSKGCFIMLSRMVDARITLSNLSDEYVENPQKDFPVGMLVHGRILSTDPSSGRVEAS  1423

Query  1594  LRTSSSATPRKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDH  1415
             LR ++ +   K D  + ++   G+I+ G++KR+ESFGLF+++  + LVGLCHVSELSD+ 
Sbjct  1424  LRKTTGSKLEKLDDISYSDLHVGDIVDGQVKRVESFGLFVTIRRSELVGLCHVSELSDEP  1483

Query  1414  IDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSYFRDDDGEDIQTTSRQSINSTDKGN  1235
             + ++ S YKAG  V+ K+LK+D+ RHR+SLGMK SYF  D   D           T+   
Sbjct  1484  VVDINSCYKAGDMVKAKILKIDETRHRVSLGMKKSYFDSDLTAD-----------TNDDE  1532

Query  1234  SVFIGTQSTVFPESSDADIDVSVVNTTDNILTEVESRASIPPLEVPLDDIENSDIDDAV-  1058
             S  +    +V P+  +        +  + +  + E RAS+ PL+V LD+ E SD++D + 
Sbjct  1533  SALMDI--SVAPQMVE-------YHNRNLVHRKAEPRASVLPLQVSLDESEGSDLEDNIS  1583

Query  1057  NKNPDHTGGADTTDekdkkramkkakkerereiraaeerlleKDIPRNTDEFEKLVRSSP  878
             N   +   G +   +K  K+  K+A+K+RE EI A EER L++DIP+  D+FEKLVRSSP
Sbjct  1584  NTCLEIANGTEANAKKSDKQLKKEARKQRELEISAMEERALQEDIPQTPDDFEKLVRSSP  1643

Query  877   NSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQ  698
             NSSF+WIKYMA +L L DVEKAR++AE+A+ TI  REE EKLNVWVAYFNLE EYG+P +
Sbjct  1644  NSSFIWIKYMATLLDLADVEKARAVAERALKTIIPREEEEKLNVWVAYFNLENEYGSPRE  1703

Query  697   EAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQW  518
             +AV KVFQRALQYCDPKK+HLALL +YERTE Y+L DELL++M K+FK SCKIWL RIQ+
Sbjct  1704  DAVKKVFQRALQYCDPKKLHLALLAMYERTEQYELADELLDRMTKRFKTSCKIWLCRIQF  1763

Query  517   ALKQNQDNS--QSIVNRALLCLPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPK  344
             ALKQ +D    ++IVNRALL LP  K IKF++QTAILEFKCGV + GRS FE +L+EYPK
Sbjct  1764  ALKQGKDVEYIKAIVNRALLSLPHRKRIKFLSQTAILEFKCGVPEEGRSRFELILREYPK  1823

Query  343   RTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVG-DEERIE  167
             RTDLWSVYLDQEIR+GD++VIRALFER   L++PPKKM+FLFKKYL +EKS+G D ERI+
Sbjct  1824  RTDLWSVYLDQEIRLGDVEVIRALFERVTCLTLPPKKMQFLFKKYLNFEKSLGKDNERIQ  1883

Query  166   SVKRKAMEYVES  131
              V++KA+EYV+S
Sbjct  1884  LVQQKAIEYVQS  1895



>ref|XP_004955773.1| PREDICTED: protein RRP5 homolog [Setaria italica]
Length=1904

 Score =  1934 bits (5009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1035/1878 (55%), Positives = 1380/1878 (73%), Gaps = 62/1878 (3%)
 Frame = -2

Query  5713  DFPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhklykKNQSVEDDLGSLFGHSI  5534
             DFPRGG S LSK+E+ E RAE + +FE E     K+K+          +DDLG+LFG + 
Sbjct  64    DFPRGGRSFLSKDEVAEARAEAEEDFERE-GKKGKRKRKAGESSGFGADDDLGTLFGGAT  122

Query  5533  SGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNET  5354
             +GKLP+ ANRIT KN+SP MKLWGV+ EVN+KDIV+SLPGG+RG V + +  D       
Sbjct  123   TGKLPRFANRITLKNVSPNMKLWGVVIEVNQKDIVLSLPGGMRGFVRSEDVCDIAL--HE  180

Query  5353  NEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAG-KWKIWLSLRLALLHKNLTLDAIQE  5177
             N  + +++  + + HVGQLV CIVL +DDD+KE     ++WLSLRL+ L+K L+LDA+QE
Sbjct  181   NRKDSENSICAEVVHVGQLVPCIVLRVDDDRKEGKVNRRVWLSLRLSQLYKGLSLDALQE  240

Query  5176  GIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDKMNTGQLVEGVVKSVDRTRKVVY  4997
             G++L+A +KS EDHGYILHFG+PSFSGF+    +   K+   QL++ VVK++D+TR +V+
Sbjct  241   GMVLAAQVKSVEDHGYILHFGVPSFSGFMQKADKENVKIEPRQLIQCVVKAIDKTRAIVH  300

Query  4996  LSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQ  4817
             LSS  D ++K + KDLKG+SID L+PGMMVNA V SVLENGVMLSFLTYF+GTVDIF+L 
Sbjct  301   LSSDEDLVSKSIIKDLKGLSIDHLIPGMMVNARVHSVLENGVMLSFLTYFSGTVDIFNLS  360

Query  4816  QVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAK  4637
               FP  +WKD Y +NKKVNARILF+DP+TRAVGL+LN HL+H + PP  +K GDI++++K
Sbjct  361   NPFPSGNWKDGYSKNKKVNARILFVDPSTRAVGLTLNKHLLHLEVPPINLKAGDIYDKSK  420

Query  4636  VIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEG  4457
             V+R+DK  GL LEIPSS  P+P ++ I DV DK+VK +EK FK G  +RVR+LG RNLEG
Sbjct  421   VLRIDKKAGLFLEIPSS-TPSPGFISIHDVSDKDVKNLEKKFKEGSSLRVRILGVRNLEG  479

Query  4456  LATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFE  4277
             +A G++K SAFEGSVFTH DVKPGM+V+AKV+TV+ FGAIVQFSSGVKALCPL HMSE E
Sbjct  480   VAIGTVKDSAFEGSVFTHDDVKPGMLVRAKVVTVEPFGAIVQFSSGVKALCPLPHMSELE  539

Query  4276  -IVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSYTDATEGLITHGWIT  4100
              +VKP KKF+ G+EL+FRVLGCKSKR+TVT KK+LVKSKLD+L+SY DA  GL+THGWI 
Sbjct  540   HVVKPPKKFKAGAELLFRVLGCKSKRVTVTCKKSLVKSKLDVLASYADAKVGLVTHGWIA  599

Query  4099  KIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSF  3920
             KIEKHGCFV+FYNGVQGF  RSELGL+ G++  ++YHV QV+KCR++S  PASR+I +SF
Sbjct  600   KIEKHGCFVKFYNGVQGFVSRSELGLEAGTEAENVYHVGQVIKCRIISVLPASRRINVSF  659

Query  3919  TTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADL  3740
                  R+   ++ K G++VSG+VE +TP ++VV+VN      KGT+  +HL+DH G A  
Sbjct  660   VISHNRIIPADIAKLGSIVSGVVERLTPAAVVVSVNGFS---KGTILNEHLADHHGQAAQ  716

Query  3739  MKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQISPHSVVHGYVCNVI  3560
             +K++LKPG+EF+QLLVLDIEG NLVLSAK+SLI+++  +P ++ Q+ P ++VHGY+CN+I
Sbjct  717   LKNLLKPGHEFNQLLVLDIEGQNLVLSAKHSLINSSNDIPSEILQMHPGALVHGYICNII  776

Query  3559  GNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQS  3380
               G FVRFLG LTGFSP+ KA D R    S+ FY+GQSV ++IL VN ET R+ +SL+QS
Sbjct  777   EAGCFVRFLGHLTGFSPKDKAVDRRVEKLSDAFYVGQSVRSHILSVNAETARVKLSLQQS  836

Query  3379  LCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVT  3200
             +CSSTD++FIQ YFLL+ KI+ L+      S  +W   FG+GS+VEG+V  I+E+G+V+ 
Sbjct  837   MCSSTDSSFIQGYFLLDQKISALKY-----SSHDWAHAFGIGSLVEGEVGAIEEYGIVLN  891

Query  3199  FEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTAND  3020
             F  + DV G I   QL    +E GS+++  V+D+S  + +V+LSLKPE ++     +   
Sbjct  892   FNDHPDVVGLIEHHQLSDSTLEVGSSVKGLVLDLS--DGVVNLSLKPELIS-----SVRI  944

Query  3019  KTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGYASLNDFNTQNLPVK  2840
                KKKR+R    DLE+++ VNAVVEIVKE+Y+VLS+P  NYA+G+ASL D+N+Q L   
Sbjct  945   GGTKKKRQRPTVADLELHEEVNAVVEIVKESYVVLSIPEYNYAIGFASLMDYNSQLLATH  1004

Query  2839  QFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkknsSYDVGSLVQAEIT  2660
             ++ NGQ +   +  +P S   GRL+LL KA ++ +  S SKR KK S Y VGSLV+AEI 
Sbjct  1005  RYDNGQRITVVVGNIPSSDPSGRLILLPKASAQDSGLSGSKRAKKKSEYKVGSLVEAEII  1064

Query  2659  DIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARIVSKDSRS-ENKRG  2483
             DIKPLEL LKFG+  HGR+HITE  ++++ E P +  RIGQ LTARIV++   S +N + 
Sbjct  1065  DIKPLELILKFGANLHGRIHITEVLEEDSAERPFSKLRIGQKLTARIVAEAEPSGKNGKN  1124

Query  2482  YQWELSTKPSVLAGDMD---GPHESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYI  2312
             ++WELS +PS+L G+ +      E FN++T  ++ GYV +VD EW WLT+SR V A L+I
Sbjct  1125  FKWELSIRPSMLKGEFEESTAHKEEFNHTTNVVVCGYVVRVDKEWVWLTVSRNVMAHLFI  1184

Query  2311  LDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRL-------VPHTLLITPEDTVP  2153
             LDSS++PSELK+FQ+RF VG++V G ++S N+EK+LLR+         H +     D + 
Sbjct  1185  LDSSSDPSELKQFQQRFSVGQAVKGCVISVNREKRLLRVKALDNQCAQHNI-----DKIQ  1239

Query  2152  SSESARC-HIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYC  1976
              SES+     ++G V+GGR+ KILPGVGGL+VQI  HL G+VH+TE+ D WV+DPLSG+ 
Sbjct  1240  QSESSLVEQTKQGDVIGGRVQKILPGVGGLVVQIGPHLHGRVHYTEIVDSWVADPLSGFH  1299

Query  1975  EGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPD  1796
             EGQFVKCKVL V  S +G+  VDLSLR +    ++ N    D+  +   R++ I+DL P 
Sbjct  1300  EGQFVKCKVLSVSRSSEGSLRVDLSLRSSNIRTDSSNSRLFDEGATCIPRIEKIEDLLPG  1359

Query  1795  MTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESL  1616
               ++GYVKNV PKGCFIMLSR V+A+I LSNL+D ++E+P+K+FPVG LV G+V+S +  
Sbjct  1360  TEIKGYVKNVNPKGCFIMLSRMVEARITLSNLSDEYVENPQKDFPVGMLVHGRVLSTDPS  1419

Query  1615  SKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHV  1436
             S RVE +LR ++ +   K D    ++   G+II G++KR+ES+GLF+++ ++ LVGLCHV
Sbjct  1420  SGRVEASLRKNTGSKLEKPDDINYSDLHVGDIIDGQVKRVESYGLFVTIRSSELVGLCHV  1479

Query  1435  SELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSYFRDDDGEDIQTTSRQSI  1256
             SELSD+ + ++ SRYKAG  V+ K+LK+D+ RHR+SLGMK SYF  D G    T     I
Sbjct  1480  SELSDEPVLDINSRYKAGDMVKAKILKIDEKRHRVSLGMKKSYF--DCGLTAGTNDDDEI  1537

Query  1255  NSTDKGNSVFIGTQSTVFPESSDADIDVSVVNTTDNILTEVESRASIPPLEVPLDDIENS  1076
                D    + I +Q               V    + + +  E RAS+ PL+V LD+ E S
Sbjct  1538  APMD----ISIASQ---------------VAGYHNKVHSAAEPRASVLPLQVSLDESEGS  1578

Query  1075  DIDDAVNKNPDHTGGADTTDekdkkramkkakkerereiraaeerlleKDIPRNTDEFEK  896
             D++D  N+  +   G++   +K  KR  K+A+K+RE EI A EER L+ DIPR  D+FEK
Sbjct  1579  DLEDNSNEGHEIANGSEANAKKSDKRLKKEARKQRELEISALEERALQGDIPRTPDDFEK  1638

Query  895   LVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIE  716
             LVRSSPNSSFVWIKYMA +L L DVEKAR+IAE+A+ TI  REE E+LNVWVAYFNLE E
Sbjct  1639  LVRSSPNSSFVWIKYMACLLDLADVEKARAIAERALKTIIPREEEERLNVWVAYFNLENE  1698

Query  715   YGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIW  536
             YG+P ++AV KVFQRALQYCD KK+HLALL VYERTE Y+L DELL++M K+FK SCKIW
Sbjct  1699  YGSPREDAVKKVFQRALQYCDHKKLHLALLAVYERTEQYELADELLDRMTKRFKTSCKIW  1758

Query  535   LRRIQWALKQNQDNS--QSIVNRALLCLPKHKHIKFITQTAILEFKCGVADRGRSMFERM  362
             L RIQ+ALKQ +D    +++VNRALL LP+ K IKF+++TAILEFKCG  + GRS FE +
Sbjct  1759  LCRIQFALKQGKDVEYIKAVVNRALLSLPQRKRIKFLSKTAILEFKCGAPEEGRSRFELI  1818

Query  361   LKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVG-  185
             L+EYPKRTDLWSVYLDQEIR+GD+++IR LF++A  L++PPKKM+FLFKKYL +EKS+G 
Sbjct  1819  LREYPKRTDLWSVYLDQEIRLGDIEIIRGLFDKATCLTLPPKKMQFLFKKYLKFEKSLGE  1878

Query  184   DEERIESVKRKAMEYVES  131
             D ERI+ V++ AM+YV+S
Sbjct  1879  DNERIQHVQQIAMKYVQS  1896



>gb|EEE66766.1| hypothetical protein OsJ_23484 [Oryza sativa Japonica Group]
Length=1898

 Score =  1926 bits (4989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1041/1881 (55%), Positives = 1377/1881 (73%), Gaps = 70/1881 (4%)
 Frame = -2

Query  5710  FPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhklykKNQSVEDDLGSLFGHSIS  5531
             FPRGG SLLS++E+ E RAE DA+FE E     K+K+          +DDLGSLFG + +
Sbjct  64    FPRGGRSLLSRDEVAEARAEADADFERE-ERRGKRKRKGASSSGAGGDDDLGSLFGGATT  122

Query  5530  GKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNETN  5351
             GKLP+ ANR+T KNISP MKLWGV+ EVN+KDIVVSLPGG+RG V + E HD +   ET 
Sbjct  123   GKLPRFANRVTLKNISPNMKLWGVVIEVNQKDIVVSLPGGMRGFVRSEEVHD-ITSQETR  181

Query  5350  EMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAG-KWKIWLSLRLALLHKNLTLDAIQEG  5174
             + + + +  + + HVGQLV CIVL +DDD KE     ++WLSLRL+ ++K L+LDAIQ+G
Sbjct  182   K-DSEGSICADVVHVGQLVPCIVLRVDDDNKEGKVNKRVWLSLRLSRIYKGLSLDAIQDG  240

Query  5173  IILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDKMNTGQLVEGVVKSVDRTRKVVYL  4994
             ++L+A +KS EDHGYILHFG+ SFSGF+P   +   K+ +GQL++ VVK++D+ R++V+L
Sbjct  241   MVLTAQVKSIEDHGYILHFGVSSFSGFMPKADRESAKIESGQLIQCVVKAIDKAREIVHL  300

Query  4993  SSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQ  4814
             SS  D ++K + KDLKG+SID L+PGMMVNA V SVLENGVMLSFLTYFTGT DIF+L  
Sbjct  301   SSDEDLLSKSIIKDLKGLSIDHLIPGMMVNARVHSVLENGVMLSFLTYFTGTADIFNLSN  360

Query  4813  VFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKV  4634
              FP  SWKDDY +NKKVNARILF+DP+TRAVGL+LN  L+  K P   VK G+I+++A+V
Sbjct  361   SFPSGSWKDDYIKNKKVNARILFVDPSTRAVGLTLNQQLLRLKVPSINVKAGEIYDKARV  420

Query  4633  IRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGL  4454
             +R+DK  GL LEIP SP P+P +V I DV DK+VK +EK FK G + RVRVLG R+LEG+
Sbjct  421   LRMDKRAGLFLEIP-SPTPSPGFVSIHDVSDKDVKNVEKKFKEGSMARVRVLGVRHLEGV  479

Query  4453  ATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFE-  4277
             A G+LK SAFEGSVFTH+DVKPGMVV+AKV+TV+ FGAIVQFSSGVKALCPL HMSE E 
Sbjct  480   AIGTLKESAFEGSVFTHADVKPGMVVRAKVVTVEPFGAIVQFSSGVKALCPLPHMSELEH  539

Query  4276  IVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSYTDATEGLITHGWITK  4097
             +VKP KKF+VG EL FRVLGCKSKRITVT KK+LVKSKLD+L+SY DA  GL+THGWITK
Sbjct  540   VVKPPKKFKVGVELTFRVLGCKSKRITVTFKKSLVKSKLDVLASYADAKIGLLTHGWITK  599

Query  4096  IEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFT  3917
             IEKHGCFV+FYNGVQGF  RSELGL+PG++  ++YHV QVVKCRVVS  PASR+I ++F 
Sbjct  600   IEKHGCFVKFYNGVQGFVSRSELGLEPGTEAENVYHVGQVVKCRVVSVVPASRKINVTFL  659

Query  3916  TRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLM  3737
                 R+ + +  K G++VSG+VE +TP ++VV+VN      KG++  +HL+DHRG A  +
Sbjct  660   ISTNRVIQADTPKVGSIVSGVVERLTPAAVVVSVNG---FCKGSILNEHLADHRGQAAQL  716

Query  3736  KSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQISPHSVVHGYVCNVIG  3557
             K++LKPG+EF +LLVLD+EG NLVLSAK SLI+ A  +P +++Q+   SV HGYVCN+I 
Sbjct  717   KNLLKPGHEFSELLVLDVEGQNLVLSAKQSLINCASDIPSEISQMHAGSVFHGYVCNIIE  776

Query  3556  NGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQSL  3377
              G FVRFLG LTGFSP+ KA D      S  FY+GQSV ++IL+VN E+ R+ +SL+QS+
Sbjct  777   AGCFVRFLGHLTGFSPKDKAVDRSVEKLSNAFYVGQSVRSHILNVNAESARVKLSLQQSM  836

Query  3376  CSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTF  3197
             CSS D +F+Q YFLL+ KI +L+  D + S  +W++ F +G++VEG+V  I+E+GV++ F
Sbjct  837   CSSADCSFVQGYFLLDQKITELKYSDPSSSFHDWLNTFAIGNLVEGEVGAIEEYGVILNF  896

Query  3196  EKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDK  3017
             + + DV G I   QLG  +VE GS+++  VID+S  + +V++SLK E V     ++ +  
Sbjct  897   QSHPDVVGLIEHHQLGDSSVEVGSSVKGLVIDLS--DGVVNISLKSELV-----RSVSKV  949

Query  3016  TQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGYASLNDFNTQNLPVKQ  2837
              +KKKR R A  DLE+++ VNA+VEIVKE+++VLS+P  NYA+G+A L D+N+Q LP   
Sbjct  950   GKKKKRHRAAVMDLELHEEVNAIVEIVKESHVVLSIPEYNYAIGFAPLMDYNSQLLPCCN  1009

Query  2836  FVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkknsSYDVGSLVQAEITD  2657
             + NGQ +   + ++P S   GRLLLL KA  + +  SSSKR KK S + VGSLV+AEI D
Sbjct  1010  YENGQRITVVVGSMPSSGPTGRLLLLPKASGKNSSVSSSKRAKKKSDFKVGSLVEAEIID  1069

Query  2656  IKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARIVSKDSRS-ENKRGY  2480
             IKPLEL LKFGS  HGR+HITE  DD++ + P ++ +IG+++ ARIV++   S +  +  
Sbjct  1070  IKPLELLLKFGSNLHGRIHITEVFDDDSNDCPFSELQIGRSVQARIVAEAEHSGKGGKNS  1129

Query  2479  QWELSTKPSVLAG---DMDGPHESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYIL  2309
             +WELS +PS+L G   D   P     +S G ++  YV KVD EW WLT+SR+V A L+IL
Sbjct  1130  KWELSIRPSLLQGGLEDFTPPKAELRHSIGGIVHAYVVKVDREWIWLTVSRDVMAHLFIL  1189

Query  2308  DSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTLLITPEDTVPSSESARC-  2132
             DSSAEP EL++FQ+R+ VG++V G I+  N+EK+LLRL        PE+   + +     
Sbjct  1190  DSSAEPGELEKFQQRYSVGQAVKGRIIGVNREKRLLRLKALDSQSLPENIGETQKPLSAT  1249

Query  2131  --HIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVK  1958
               H ++G ++GGRI KILPGVGGL++QI  HL G+VH+TE+ D WV +P+SG+ EGQFVK
Sbjct  1250  VEHTKQGDIIGGRIQKILPGVGGLVIQIGPHLHGRVHYTEIVDSWVQEPISGFHEGQFVK  1309

Query  1957  CKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGY  1778
             CKVL V  S +G+  VDLSLR ++   +NQ+    DD   +  R + I DL P   V+GY
Sbjct  1310  CKVLDVSRSSEGSVRVDLSLRSSMCANSNQSRRLFDDSRIRTSRFEKINDLCPGTEVKGY  1369

Query  1777  VKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEV  1598
             VK+V  KGCFIM+SR ++A+I+LSNL+D ++E+P+ +FPVG LV G+V+S E  S +VEV
Sbjct  1370  VKSVNSKGCFIMVSRTIEARIILSNLSDEYVENPQNDFPVGLLVHGRVLSSEPQSGKVEV  1429

Query  1597  TLRTSSSATPRKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDD  1418
             +LR ++ +  +KSD  + ++   G+II+G++KR+ESFGLF+++  + LV LCHVSELSD+
Sbjct  1430  SLRKNTGSKSQKSDDISYSDLHVGDIIAGQVKRVESFGLFVTIQGSELVALCHVSELSDE  1489

Query  1417  HIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSYF--------RDDDGEDI--QTTS  1268
              + ++ S +KAG         +D++RHR+S+GMK SY          DD+ ++I  +  S
Sbjct  1490  PVLDIHSCHKAGDK-------IDEERHRVSIGMKKSYIGPDSTGDTSDDEDDEIVPEEIS  1542

Query  1267  RQSINSTDKGNSVFIGTQSTVFPESSDADIDVSVVNTTDNILTEVESRASIPPLEVPLDD  1088
             R  +   D+ +++                           +L + ESRAS+ PL+V LD+
Sbjct  1543  RNPVMGRDRNHAL---------------------------VLPKPESRASVLPLQVSLDE  1575

Query  1087  IENSDIDDAVNKNPDHTGGADTTDekdkkramkkakkerereiraaeerlleKDIPRNTD  908
              E SD ++  NK  +   G +  D+K  KR  +KA+K+RE EI A EER L++DIP+  D
Sbjct  1576  SEGSDQEND-NKGQEIANGTEVDDKKSNKRLKEKARKQRELEISALEERALQRDIPQTPD  1634

Query  907   EFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFN  728
             EFEKLVRSSPNSSFVWI YMAF+L L DV+KAR++AE+A+ TINIREE EKLNVWVAYFN
Sbjct  1635  EFEKLVRSSPNSSFVWINYMAFLLDLADVDKARAVAERALRTINIREEEEKLNVWVAYFN  1694

Query  727   LEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHS  548
             LE EYG+P ++AV K+FQRALQYCDPKKVHLALL +YERTE Y L DELL++M K+FK S
Sbjct  1695  LENEYGSPREDAVKKIFQRALQYCDPKKVHLALLAMYERTEQYTLADELLDRMTKRFKTS  1754

Query  547   CKIWLRRIQWALKQNQDNS--QSIVNRALLCLPKHKHIKFITQTAILEFKCGVADRGRSM  374
             CKIWLR IQ +LKQ++D    + IV RALL LP+ K  KF++QTAILEFKCGV + GRS 
Sbjct  1755  CKIWLRCIQLSLKQSKDVECIKLIVKRALLSLPQSKRRKFLSQTAILEFKCGVPEEGRSR  1814

Query  373   FERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEK  194
             FE +L+EYPKRTDLWSVYLDQEIR+GD ++IRALFER   LS+PPKKMKFLFKKYL YEK
Sbjct  1815  FELILREYPKRTDLWSVYLDQEIRLGDTEIIRALFERVTCLSLPPKKMKFLFKKYLEYEK  1874

Query  193   SVGDEERIESVKRKAMEYVES  131
             S GDEERIE VK+KA+EYV+S
Sbjct  1875  SQGDEERIEHVKQKALEYVQS  1895



>ref|XP_006296818.1| hypothetical protein CARUB_v10012800mg [Capsella rubella]
 gb|EOA29716.1| hypothetical protein CARUB_v10012800mg [Capsella rubella]
Length=1789

 Score =  1916 bits (4964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1032/1765 (58%), Positives = 1317/1765 (75%), Gaps = 45/1765 (3%)
 Frame = -2

Query  5749  KSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhklykKNQSV  5570
             ++  LQLED VPDFPRGG + LSK+E +++  EVDAEF+A++R  KK K  K  K+  S 
Sbjct  39    EAMALQLED-VPDFPRGGGTSLSKKEREKIYEEVDAEFDADERVSKKSKGGKPKKRTPSD  97

Query  5569  EDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLA  5390
              D+LG LFG     K P+ AN+IT KNI+PGMKL GV+ EVN+KDIV+SLPGGLRGLV A
Sbjct  98    ADELGLLFGGLTG-KRPRYANKITTKNIAPGMKLLGVVTEVNQKDIVISLPGGLRGLVRA  156

Query  5389  SEAHD----PLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLR  5222
             SEA D     + D+E NE+      L  +  VGQLV CIVL LDDDKKEAGK KIWLSLR
Sbjct  157   SEASDFTDLGIEDDE-NEL------LGDIISVGQLVPCIVLQLDDDKKEAGKRKIWLSLR  209

Query  5221  LALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSV--DKMNTGQ  5048
             L+LLHK  + D+ Q G++ SA +KS EDHGYILHFGLPS +GF+ I +       M TGQ
Sbjct  210   LSLLHKGFSFDSFQLGMVFSANVKSVEDHGYILHFGLPSITGFIEISNDGKLESGMKTGQ  269

Query  5047  LVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVM  4868
             L++GVV  +DR RK+V L+S P+++AK +TKDL G+S DLL+PGMMVNA V SVLENG++
Sbjct  270   LIQGVVTKIDRERKIVRLNSDPESVAKCLTKDLNGMSFDLLIPGMMVNARVQSVLENGIL  329

Query  4867  LSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHK  4688
               FLTYF GTVD+FHL+      SWKD+Y QNK VNARILFIDP++RAVGL+LNPHLV  
Sbjct  330   FDFLTYFNGTVDLFHLKNPLSNKSWKDEYNQNKTVNARILFIDPSSRAVGLTLNPHLVCN  389

Query  4687  KAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFK  4508
             KAPP  V  G IF++AKVIR+DK  GLLLE+PS+P  TPAYV   D    EVKK+EK FK
Sbjct  390   KAPPLHVSSGSIFDEAKVIRIDKS-GLLLELPSNPETTPAYVSTYDAAGDEVKKLEKKFK  448

Query  4507  PGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQF  4328
              G  +RVR+LG + ++GLA G+LK SAFEG VFTHSDVKPGMV KAK+I+VD+FGAIVQF
Sbjct  449   EGNHIRVRILGLKQMDGLAIGTLKESAFEGPVFTHSDVKPGMVTKAKIISVDTFGAIVQF  508

Query  4327  SSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILS  4148
               G+KA+CPLRHMSEFE+ KPRKKF+VG+ELVFRVLGCKSKRITVT+KK+LVKSKL ILS
Sbjct  509   PGGLKAMCPLRHMSEFEVTKPRKKFKVGAELVFRVLGCKSKRITVTYKKSLVKSKLPILS  568

Query  4147  SYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKC  3968
             SYTDATEGL+THGWITKIEKHGCFVRFYNGVQGF PR ELGL+PGSD  S++HV +VVKC
Sbjct  569   SYTDATEGLVTHGWITKIEKHGCFVRFYNGVQGFVPRFELGLEPGSDPDSVFHVGEVVKC  628

Query  3967  RVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKG  3788
             RV S    SR+I LS   +P  +SE + +K G++VSGI++ +T  +++V V + +  LKG
Sbjct  629   RVTSVVHGSRRITLSLMIKPASVSEDDSIKLGSIVSGIIDSITSQAVIVRVKS-KGVLKG  687

Query  3787  TVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVN  3608
             T++ +HL+DH   A LMKS+L+PGYE D+LLVLDIEG N+ LS+KYSLI  A++LP D N
Sbjct  688   TIAAEHLADHHEQAKLMKSLLRPGYELDKLLVLDIEGNNMALSSKYSLIKLAEELPSDFN  747

Query  3607  QISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNIL  3428
             Q+ P+SVVHGYVCN+I NG FVRFLGRLTGF+PRSKA D+ R D SE F++GQSV  NI+
Sbjct  748   QLQPNSVVHGYVCNLIENGCFVRFLGRLTGFAPRSKAIDEPRADLSESFFVGQSVRANIV  807

Query  3427  DVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSI  3248
             DVN E  RIT+SLKQS C+S DA+F+Q+YFL++ KI+ LQS D   +  +WV+ F +GS+
Sbjct  808   DVNQEKSRITLSLKQSSCASVDASFVQDYFLMDEKISDLQSSDITKNECSWVEKFSIGSL  867

Query  3247  VEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLS  3068
             ++G + E  + GVVV FE  ++V GFI    +GG  +  GS + A V+D+S+ E LVDLS
Sbjct  868   IKGTIKEQNDLGVVVNFENINNVLGFIPQHHMGGATLVPGSVVNALVLDLSRAERLVDLS  927

Query  3067  LKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYAL  2888
             L+PE +N    + +N ++ KKKRKR   K+LEV+Q VNAV+EIVKE YLVLS+P   Y +
Sbjct  928   LRPELINNLTKEVSNSQS-KKKRKRVISKELEVHQRVNAVIEIVKEQYLVLSIPEHGYTI  986

Query  2887  GYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgk  2708
             GYAS++D+NTQ LPVKQF  GQSV+A + A+ +  + GRLLLLL ++S  +E+S SKR K
Sbjct  987   GYASVSDYNTQKLPVKQFSTGQSVVAFVEAVQNPLSSGRLLLLLDSVSGTSETSRSKRAK  1046

Query  2707  knsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLT  2528
             K SS +VGS V AEIT+IKP ELR+ FG  F GR+HITE  D +T+E P   FR+GQ+++
Sbjct  1047  KKSSCEVGSAVHAEITEIKPFELRVNFGHSFRGRIHITEVNDASTSEDPFAKFRVGQSMS  1106

Query  2527  ARIVSKDSRSENKRGYQWELSTKPSVL--AGDMDGPHES--FNYSTGQLLSGYVFKVDSE  2360
             AR+V+K   ++ K+   WELS KP++L  + +++   ES    ++ GQ +SGYV+KVD E
Sbjct  1107  ARVVAKPCHTDIKKSQLWELSVKPAMLRDSSELNDIQESEQLEFAAGQCVSGYVYKVDKE  1166

Query  2359  WAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTL  2180
             W WL ISR V A+L+ILD++ E  EL++F++RF +GK+VSGY+L+ NKEKK LRLV   L
Sbjct  1167  WVWLAISRNVTARLFILDTACEAHELEKFERRFPIGKAVSGYVLTYNKEKKTLRLVQRPL  1226

Query  2179  LITPE----------DTVPSS---ESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLF  2039
             L T +          D + SS   +     I EG +LGGRISKILPG+GG+ VQI  ++F
Sbjct  1227  LDTHKSIGNGEGRKTDKLDSSIPDDDGTLFIHEGDILGGRISKILPGIGGIRVQIGPYVF  1286

Query  2038  GKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNIS  1859
             G+VHFTE+ D WV +PL G+ EGQFVKCKVL++  S KGT  ++LSLR +LD MN+ ++S
Sbjct  1287  GRVHFTEINDLWVPNPLDGFHEGQFVKCKVLEISRSSKGTWQIELSLRTSLDGMNSDHLS  1346

Query  1858  EHDDVHSQN--RRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFI  1685
             E D  +++N  +R Q I+DL PDM VQGYVKN   KGCFI+LSR V+AK+LLSNL D F+
Sbjct  1347  E-DCSNNENVCKRFQRIEDLSPDMGVQGYVKNTMSKGCFIILSRTVEAKVLLSNLCDTFV  1405

Query  1684  ESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGKI  1505
             + PEKEFPVGKLVTG+V+++E LSKR+EVTL+T ++    KS+   L     G+IISG+I
Sbjct  1406  KEPEKEFPVGKLVTGRVLNLEPLSKRIEVTLKTVNAGGHPKSESYDLTKLHVGDIISGRI  1465

Query  1504  KRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISL  1325
             KR+E +GLFI++D T + GLCH ++LSDD I+NVQ++YKAG+ V  K+LK+D+++ RISL
Sbjct  1466  KRVEPYGLFITIDQTGMDGLCHKTQLSDDRIENVQAKYKAGERVTAKILKLDEEQGRISL  1525

Query  1324  GMKNSYFRDDDGEDIQTTSRQSINSTDKGNSVFIGTQSTVFPESSD---ADIDVSVVNTT  1154
             GMK+SY    D E  Q  S  + N            +S V     D    +I     + T
Sbjct  1526  GMKSSYLTSGDVE-TQPPSENNANDASMECDSINDPKSEVLAAVGDFGFQEISGGRHSGT  1584

Query  1153  DNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkramkkakke  974
               +L +VESRASIP LEV LDDIE  DID+   +N +   G +  DEK K+R  +K ++E
Sbjct  1585  SVVLAQVESRASIPALEVDLDDIEEMDIDNG--QNQEKLQGVN-RDEKSKRREKQKDREE  1641

Query  973   rereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEK  794
             RE+ I+AAE RLLE   P + DEFEKLVRSSPNSSFVWIKYMAFMLSL D+EKARSIAE+
Sbjct  1642  REKRIQAAEGRLLENHAPESADEFEKLVRSSPNSSFVWIKYMAFMLSLADIEKARSIAER  1701

Query  793   AVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYE  614
             A+STINIREE EKLN+WVAYFNLE E+G+PP+EAV KVF+RA QYCDPKKV+LALLGVYE
Sbjct  1702  ALSTINIREEEEKLNIWVAYFNLENEHGSPPEEAVKKVFERARQYCDPKKVYLALLGVYE  1761

Query  613   RTEHYKLGDELLEKMVKKFKHSCKI  539
             RTE  KL D+LL++M+KKFK SCK+
Sbjct  1762  RTEQNKLADKLLDEMIKKFKQSCKV  1786



>ref|XP_002459519.1| hypothetical protein SORBIDRAFT_02g006000 [Sorghum bicolor]
 gb|EER96040.1| hypothetical protein SORBIDRAFT_02g006000 [Sorghum bicolor]
Length=1862

 Score =  1865 bits (4831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1009/1873 (54%), Positives = 1345/1873 (72%), Gaps = 96/1873 (5%)
 Frame = -2

Query  5713  DFPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhklykKNQ-SVEDDLGSLFGHS  5537
             DFPRGG SLLSK+E+ E RAE + +FE E +  K K++ +  + +    +DDLG+LFG +
Sbjct  66    DFPRGGRSLLSKDEMAEARAEAEQDFEREGKKGKGKRKRRGGESSGFGPDDDLGTLFGGA  125

Query  5536  ISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNE  5357
              +GKLP+ ANRIT KNISP MKLWGV+ EVN+KDIV+SLPGG+RG V + +  D     +
Sbjct  126   TTGKLPRYANRITVKNISPNMKLWGVVIEVNQKDIVLSLPGGIRGFVRSEDVCDIAL--Q  183

Query  5356  TNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLALLHKNLTLDAIQE  5177
              N  + +++  + + HVGQLV CIVL +DDDKKE                          
Sbjct  184   ENRKDSENSLCAKVVHVGQLVPCIVLRVDDDKKE--------------------------  217

Query  5176  GIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDKMNTGQLVEGVVKSVDRTRKVVY  4997
             G +L+A +KS EDHGYILHFG+ SFSGF+    +   K+   QL+  VVK++D+TR +V+
Sbjct  218   GKVLAAQVKSIEDHGYILHFGVSSFSGFMQKDDKENVKIERRQLMHCVVKAIDKTRAIVH  277

Query  4996  LSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQ  4817
             LSS  D + K + KDLKG+SID L+PGMMVNA V SVLENGVMLSFLTYF+GTVDIF+L 
Sbjct  278   LSSDEDLLCKSIIKDLKGLSIDHLIPGMMVNARVHSVLENGVMLSFLTYFSGTVDIFNLL  337

Query  4816  QVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAK  4637
               FP  +WKDDY +NKKVNARILF+DP+TRAVGL+LN HL+H + PP  +K GDI++++K
Sbjct  338   NSFPSGNWKDDYSKNKKVNARILFVDPSTRAVGLTLNKHLLHLEVPPINLKAGDIYDKSK  397

Query  4636  VIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEG  4457
             V+RVDK  GL LEIPS P P+P ++ I DV DK+ K +E  FK G  +RVR+LG RNLEG
Sbjct  398   VLRVDKKAGLFLEIPS-PTPSPGFISIHDVSDKDAKNLE-KFKEGSSLRVRILGVRNLEG  455

Query  4456  LATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFE  4277
             +A G++K SAFEGSVFTH DVKPGM+V+AKV TV+ FGAIVQFSSGVKALCPL HMSE E
Sbjct  456   VAIGTVKDSAFEGSVFTHDDVKPGMLVRAKVATVEPFGAIVQFSSGVKALCPLPHMSELE  515

Query  4276  -IVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSYTDATEGLITHGWIT  4100
              +VKP KKF+VG+EL+FRVLGCKSKR+TVT+KK+LVKSKLD+L+SY DA  GL+THGWIT
Sbjct  516   HVVKPPKKFKVGAELLFRVLGCKSKRVTVTYKKSLVKSKLDVLASYADAKIGLVTHGWIT  575

Query  4099  KIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSF  3920
             KIEKHGCFV+FYNGVQGF  RS+LGL+ G++  ++YHV QVVKCR+++  PASR++ +SF
Sbjct  576   KIEKHGCFVKFYNGVQGFVSRSDLGLEAGTEAENVYHVGQVVKCRIINVIPASRKLNVSF  635

Query  3919  TTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADL  3740
                  R+   +  K G++VSG+VE +TP ++VV+VN      KGT+  +HL+DH      
Sbjct  636   VISHNRVIPIDTPKLGSIVSGVVERLTPAAVVVSVNGFS---KGTILNEHLADHH-----  687

Query  3739  MKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQISPHSVVHGYVCNVI  3560
                              DIEG NLVLSAK+SLI+ A  +P +++Q+ P  VVHGY+CN+I
Sbjct  688   -----------------DIEGHNLVLSAKHSLINCANDIPSEISQMHPGVVVHGYICNII  730

Query  3559  GNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQS  3380
              +G FVRFLG LTGFSP+ KA D R    S+ FY+GQSV ++IL V  ET R+ +SL+QS
Sbjct  731   ESGCFVRFLGHLTGFSPKDKAVDRRIERLSDAFYVGQSVRSHILSVTAETARVKLSLQQS  790

Query  3379  LCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVT  3200
             +CSSTD++FIQ YFLL+ KIA L+      S  +W   FG+GS+VEG+V  I+E+G+++ 
Sbjct  791   MCSSTDSSFIQGYFLLDQKIAALKY-----SSNDWAHTFGIGSLVEGEVGAIEEYGIILN  845

Query  3199  FEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTAND  3020
             F+ + DV G I   QLGG +VE GS+++  V+D+S  + +V+LSLKPE +      +  +
Sbjct  846   FKDHLDVVGLIEHHQLGGSSVEVGSSVKGLVLDLS--DGVVNLSLKPELIG-----SVRN  898

Query  3019  KTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGYASLNDFNTQNLPVK  2840
               +KKKR+R A  DLE+++ VNAVVEI+K +YLVLS+P  NYA+G+A L D+N+Q LP  
Sbjct  899   VGKKKKRQRAAVADLELHEEVNAVVEIIKGSYLVLSIPEYNYAIGFAPLMDYNSQLLPHH  958

Query  2839  QFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkknsSYDVGSLVQAEIT  2660
              + NGQ +   +  +P S + GRL+LL KA ++ +  S SKR KK S Y +GSLV+AEI 
Sbjct  959   HYDNGQRITVVVGNIPSSDSSGRLILLPKASAQYSALSESKRAKKKSGYKIGSLVEAEII  1018

Query  2659  DIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARIVSKDSRS-ENKRG  2483
             DIKPLEL L+FG   HGR+HITE  + ++ E P +  RIGQ LTARIV++   S ++ + 
Sbjct  1019  DIKPLELLLQFGGNLHGRIHITEVPEKDSDEHPFSKLRIGQKLTARIVAEAEPSGKSGKN  1078

Query  2482  YQWELSTKPSVLAGDMD--GPHESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYIL  2309
             ++WELS +P ++ G+ D     +   ++T +++  YV KVD EW WLT+SR V A L++L
Sbjct  1079  FKWELSIRPCIVNGEFDELTAQKEQKHTTNEIVRAYVVKVDKEWVWLTVSRNVMAHLFVL  1138

Query  2308  DSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVP---HTLLITPEDTVPSSESA  2138
             DSS+EPSELKEFQ+RF  G++V G +++ N+EK+LLRL         +  ++   S  S 
Sbjct  1139  DSSSEPSELKEFQQRFSEGQAVKGRVINVNREKRLLRLKALDNQCTQLNIDEIQQSKSSV  1198

Query  2137  RCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVK  1958
                 ++G ++GGR+ KILPGVGGL+VQI  HL G+VH+TE+ D WV++PLSG+ EGQFVK
Sbjct  1199  FEQTKQGDIIGGRVQKILPGVGGLVVQIGPHLRGRVHYTEIVDSWVTEPLSGFHEGQFVK  1258

Query  1957  CKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGY  1778
             CKVL V  S +G+  VDLSLR +    ++ N    DD+ +   R++ IKDL P   ++GY
Sbjct  1259  CKVLSVSRSSEGSLRVDLSLRSSNLIRDSNNSGLVDDLATCTSRIEKIKDLLPGTEIKGY  1318

Query  1777  VKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEV  1598
             VKNV  KGCFIM+SR V+A+I LSNL+D ++E+P+K+FPVG LV G+V+S +  S RVE 
Sbjct  1319  VKNVNSKGCFIMISRMVEARITLSNLSDEYVENPQKDFPVGMLVHGRVLSTDPSSGRVEA  1378

Query  1597  TLRTSSSATPRKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDD  1418
             +LR ++ +   K D  + ++   G+II G++KR+ESFGLF+++  + LVGLCHVSELSD+
Sbjct  1379  SLRKTTGSKLEKLDDISYSDLHVGDIIDGQVKRVESFGLFVTIRRSELVGLCHVSELSDE  1438

Query  1417  HIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSYFRDDDGEDIQTTSRQSINSTDKG  1238
              + ++ S YKAG  V+ K+LK+D+ RHR+SLGMK SYF  D   D         N  +  
Sbjct  1439  PVVDINSCYKAGDMVKAKILKIDEKRHRVSLGMKKSYFDSDLTAD--------TNDDEDD  1490

Query  1237  NSVFIGTQSTVFPESSDADIDVSVVNTTDNILTEVESRASIPPLEVPLDDIENSDIDD-A  1061
              S  +    +V P+  +   + S+VN       + E  AS+PPL+V LD+ E SD++D  
Sbjct  1491  ESALMDI--SVAPQMVEYH-NRSLVN------RKAEPIASVPPLQVSLDESECSDLEDNN  1541

Query  1060  VNKNPDHTGGADTTDekdkkramkkakkerereiraaeerlleKDIPRNTDEFEKLVRSS  881
              NK P+   G +   +K+ K+  K+A+K+RE EI A EER L+ D+P+  D+FEKLVRSS
Sbjct  1542  NNKGPEIANGTEANAKKNDKQLKKEARKQRELEISAMEERALQGDVPQTPDDFEKLVRSS  1601

Query  880   PNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPP  701
             PNSSFVWIKYMA +L L DVEKAR++AE+A+ TI  REE EKLNVWVAYFNLE EYG+P 
Sbjct  1602  PNSSFVWIKYMATLLDLADVEKARAVAERALKTIIPREEEEKLNVWVAYFNLENEYGSPR  1661

Query  700   QEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQ  521
             ++AV KVFQRALQYCDPKK+HLALL +YERTE Y+L DELL++M K+FK SCKIWL RIQ
Sbjct  1662  EDAVKKVFQRALQYCDPKKLHLALLAMYERTEQYELADELLDRMTKRFKTSCKIWLCRIQ  1721

Query  520   WALKQNQDNS--QSIVNRALLCLPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYP  347
             +ALKQ +D +  +SIVNRALL LP  K IKF++QTAILEFKCGV + GRS FE +L+EYP
Sbjct  1722  FALKQGKDVACIKSIVNRALLSLPHRKRIKFLSQTAILEFKCGVPEEGRSRFELILREYP  1781

Query  346   KRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVG-DEERI  170
             KRTDLWSVYLDQEIR+GD++VIRALFER   L++PPKKM+FLFKKYL +EKS+G D ERI
Sbjct  1782  KRTDLWSVYLDQEIRLGDIEVIRALFERVTCLTLPPKKMQFLFKKYLNFEKSLGEDNERI  1841

Query  169   ESVKRKAMEYVES  131
             + V++KA+EYV+S
Sbjct  1842  QFVQQKAIEYVQS  1854



>ref|XP_009623835.1| PREDICTED: protein RRP5 homolog [Nicotiana tomentosiformis]
Length=1507

 Score =  1861 bits (4820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 969/1362 (71%), Positives = 1135/1362 (83%), Gaps = 17/1362 (1%)
 Frame = -2

Query  4177  LVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISS  3998
             LVKSKL+IL SY DATEGLI HGWITKIE HGCFVRFYNGVQGFAPRSELGLDP  +ISS
Sbjct  147   LVKSKLEILGSYADATEGLIIHGWITKIENHGCFVRFYNGVQGFAPRSELGLDPCCEISS  206

Query  3997  MYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVN  3818
             MYHVEQVVKCRV SS+PASR+I LS TT P R+S  E+VKPG VVSG+VE VT D++V++
Sbjct  207   MYHVEQVVKCRVTSSNPASRRINLSLTTTPSRVSSNELVKPGKVVSGVVERVTADAVVID  266

Query  3817  VNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLIS  3638
             V   Q H KGT+S QHL+DH G A+LMKS L+PGYEFDQLLVLD+EG NL+LSAK+SL +
Sbjct  267   VT-AQGHFKGTISPQHLADHTGHAELMKSALRPGYEFDQLLVLDVEGSNLILSAKHSLAT  325

Query  3637  TAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFY  3458
             +AQQLPLDV+Q+  +SV+HGY+CN+I +GVF+R+LGRLTGFSPR++ATDDRR   SEV+ 
Sbjct  326   SAQQLPLDVSQVHLNSVLHGYICNIIESGVFIRYLGRLTGFSPRNRATDDRRSSLSEVYQ  385

Query  3457  IGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLN  3278
             IGQSV +N++DV+ ET RITVSLKQS CSSTDA+FIQEYFL+E KIAKLQS+DS  S L 
Sbjct  386   IGQSVRSNVVDVSSETNRITVSLKQSSCSSTDASFIQEYFLVEEKIAKLQSVDSGSSDLR  445

Query  3277  WVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDV  3098
             WV+ F LGS V+GKVHEIKEFGVVV+F+KYDDVFGFIS  QLGGI+VETGS+I+  V+DV
Sbjct  446   WVEEFNLGSTVKGKVHEIKEFGVVVSFQKYDDVFGFISHYQLGGISVETGSSIRTTVLDV  505

Query  3097  SKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLV  2918
             SKIE LVDLSLKP FVN SK +T N++ QKK RKREA  +LEVNQ+VNAVVEIVKENYLV
Sbjct  506   SKIERLVDLSLKPAFVNKSKKETTNNQAQKK-RKREALGELEVNQTVNAVVEIVKENYLV  564

Query  2917  LSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEV  2738
             +S+P+ N  LGYAS  D+NTQNLP K F NG+SVIAT+MA P  ST GRLLLLLK+ISE 
Sbjct  565   VSLPSYNNTLGYASRADYNTQNLPPKSFANGESVIATVMATPSPSTSGRLLLLLKSISEA  624

Query  2737  AEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPL  2558
              E+SSSKR KK SSY+ GSLVQAEIT+I+PLELRLKFGSGFHGRVHITEA+DDN  E P 
Sbjct  625   IETSSSKRAKKKSSYNAGSLVQAEITEIRPLELRLKFGSGFHGRVHITEASDDNHAEAPF  684

Query  2557  NDFRIGQTLTARIVSKDSRSEN-KRGYQWELSTKPSVLAGDMD-GPHESFNYSTGQLLSG  2384
             ++FR GQTLTARI+SK + SE+ KRGYQWELS KPS LAG  +  P E FNYSTGQL++G
Sbjct  685   SNFRFGQTLTARIISKSNMSESIKRGYQWELSIKPSTLAGSGEIEPVEEFNYSTGQLVTG  744

Query  2383  YVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKL  2204
             +V+KVD+EWAWLTISR+V+AQL++LDSS+EP+EL EFQKRF +G+S SGY+LSANKEKKL
Sbjct  745   FVYKVDNEWAWLTISRDVKAQLHVLDSSSEPNELDEFQKRFSIGRSFSGYVLSANKEKKL  804

Query  2203  LRLVPHTLLITPEDTVP--------SSESARCHIREGSVLGGRISKILPGVGGLLVQIDA  2048
             +RL+   LL+  E +          SSE+   HIREGSVLGGRISKILPGVGGLLVQID 
Sbjct  805   VRLISRPLLVDLERSARQKDGPTDHSSENMAFHIREGSVLGGRISKILPGVGGLLVQIDP  864

Query  2047  HLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQ  1868
             HL+GKVHFTEL DP V+DPLSGY EGQFVKCKVL+  HS KGT H+DLSL+        Q
Sbjct  865   HLYGKVHFTELTDPGVADPLSGYHEGQFVKCKVLETTHSGKGTVHIDLSLQSLSHRTQEQ  924

Query  1867  NISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGF  1688
              ++ ++D  +    V+ I+DL P+M VQ YVKNVTPKGCF+MLSRKVDAK+LLSNL DG+
Sbjct  925   KLAVNNDTVNFPGLVEKIEDLRPNMAVQAYVKNVTPKGCFVMLSRKVDAKVLLSNLYDGY  984

Query  1687  IESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGK  1508
             +E+PEKEFPVGKLV GKVVSVE LSKRVEVTLRTSS+    KSD DAL+N + G++I+G+
Sbjct  985   VENPEKEFPVGKLVVGKVVSVEPLSKRVEVTLRTSSAGGASKSDKDALSNLTVGDVITGR  1044

Query  1507  IKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRIS  1328
             +KR+E +GLFI VD+TN+VGLCHVSE+SDDH++N+ SRYKAG     K+LKVDK+R RIS
Sbjct  1045  VKRVEPYGLFILVDHTNMVGLCHVSEISDDHVNNIDSRYKAGDRATAKILKVDKERQRIS  1104

Query  1327  LGMKNSYFRDDDGEDIQTTSRQSINSTDKGNSVFIGTQSTVFPESSDAD---IDVSVVNT  1157
             LGMKNSYF  +D    +T  R S     +GN++  G +ST  PE S  +   +D   V+ 
Sbjct  1105  LGMKNSYF--NDATSGETNIRHSSGCAVEGNALSRGIESTPSPERSSQERDNLDEESVDG  1162

Query  1156  TDNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkramkkakk  977
              D  L EVESRASIPPLEVPLDDIE  D+ D VN++        T+DEK+KK A KKAK+
Sbjct  1163  MDPFLAEVESRASIPPLEVPLDDIEKLDVGDVVNQDSGDASNLGTSDEKNKKLAAKKAKR  1222

Query  976   erereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAE  797
              RE+EIRAAEERLLEKDIPR+ DEFEKLVRSSPNSSFVWIKYMAF+LSL DVEKARSIAE
Sbjct  1223  LREQEIRAAEERLLEKDIPRDEDEFEKLVRSSPNSSFVWIKYMAFVLSLADVEKARSIAE  1282

Query  796   KAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVY  617
             +A+ TIN+REESEKLNVWVAYFNLE EYGNP QEAV KVFQRALQYCDPKKVHLALLG+Y
Sbjct  1283  RALRTINVREESEKLNVWVAYFNLENEYGNPSQEAVAKVFQRALQYCDPKKVHLALLGMY  1342

Query  616   ERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLCLPKHKHIK  437
             ERTE + L DELL KMVKKFKHSCK+WLRR+QW LKQ+QD  QS+VNRALL LP HKHIK
Sbjct  1343  ERTEQHTLSDELLNKMVKKFKHSCKVWLRRVQWLLKQSQDGVQSVVNRALLSLPPHKHIK  1402

Query  436   FITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAI  257
             FI+QTAILEFKCGV DRGRS+FE+ML+EYPKRTDLWSVYLDQEIR+GD +VIRALFERAI
Sbjct  1403  FISQTAILEFKCGVPDRGRSLFEKMLREYPKRTDLWSVYLDQEIRLGDAEVIRALFERAI  1462

Query  256   SLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             +LS+PPKKMKFLFKKYL YEK++GD++R+E+VKRKAMEYVES
Sbjct  1463  TLSLPPKKMKFLFKKYLEYEKTLGDDDRMEAVKRKAMEYVES  1504



>gb|EMS48920.1| rRNA biogenesis protein rrp5 [Triticum urartu]
Length=1851

 Score =  1844 bits (4777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 996/1872 (53%), Positives = 1315/1872 (70%), Gaps = 118/1872 (6%)
 Frame = -2

Query  5569  EDDLGSLFGHSISGKLPKSANRITPK-------------------------NISPGMKLW  5465
             +DDLG+LFG + +GKLP+ ANRIT K                         NISP MKLW
Sbjct  34    DDDLGTLFGGATTGKLPRFANRITLKVLNSLKLSLCRICFATLVLCTNHWLNISPSMKLW  93

Query  5464  GVIAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCI  5285
             GV+ EVN+KDI+VSLPGG+RG V   E  D       N  +   +  + + HVGQLV C+
Sbjct  94    GVVIEVNQKDIIVSLPGGMRGFVRTEEVSDIALHG--NSKDNDGSVCAEVVHVGQLVPCM  151

Query  5284  VLHLDDDKKEAGKWK-IWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLP  5108
             VL +DDDKKE    K +WLSLRL+ ++K L+LDAIQ+G++L+A +KS EDHGYIL+FG+ 
Sbjct  152   VLQVDDDKKEGKAHKRVWLSLRLSRMYKGLSLDAIQDGMVLTAQVKSVEDHGYILYFGVS  211

Query  5107  SFSGFLPIHSQSVDKMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDL  4928
             +FSGF+P   +  +K+ +GQL++ VVK +D+TR +++LSS  D I+K + KDLKG+SID 
Sbjct  212   TFSGFMPKAGKETEKIESGQLIQCVVKGIDKTRSIIHLSSDEDLISKSIIKDLKGLSIDH  271

Query  4927  LVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARIL  4748
             L+PGMM++A V SVLENGVMLSFLTYFTGT DIF+L   FP  +WKDDY +NKKVNARIL
Sbjct  272   LIPGMMMSARVHSVLENGVMLSFLTYFTGTADIFNLSSSFPSGNWKDDYSKNKKVNARIL  331

Query  4747  FIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPA  4568
             F+DP+TRAVGL+LN HL+    PP  VKVG+I+++++V+RVDK  GL LEIPS P P+P 
Sbjct  332   FVDPSTRAVGLTLNQHLLRLNVPPINVKVGEIYDKSRVLRVDKKAGLFLEIPS-PTPSPG  390

Query  4567  YVYISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLK----TSAFEGSVFTHS  4400
             +V I DV DK+VK +EK F+ G + RVRVLG R+LEG+A G+LK       F  +V+   
Sbjct  391   FVSIHDVSDKDVKNVEKKFREGSLTRVRVLGVRHLEGVALGTLKFPWCCLIFLATVY--K  448

Query  4399  DVKPGMVVKAKVITVDSFGAIV--------------------QFSSGVKALCPLRHMSEF  4280
              +   +++    I   S G I+                    QFSSGVKALCPL HMSE 
Sbjct  449   SLLYFLMINYDKIVCGSTGFIINVMARTVLLKVLFSLMLMSNQFSSGVKALCPLPHMSEL  508

Query  4279  E-IVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSYTDATEGLITHGWI  4103
             + IVKP KKF+ G+EL+FRVLGCKSKRITVT+KK+LVKSKL++L+SY DA  GL+THGWI
Sbjct  509   DNIVKPPKKFKAGAELLFRVLGCKSKRITVTYKKSLVKSKLEVLASYADAKIGLVTHGWI  568

Query  4102  TKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLS  3923
             TKIEKHGCFVRFYNGVQG    SELGL+PG +  S+YHV QVVKCR+VS  P SR++ +S
Sbjct  569   TKIEKHGCFVRFYNGVQG----SELGLEPGIEAESVYHVGQVVKCRIVSVVPTSRKLYVS  624

Query  3922  FTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLAD  3743
             FT    R+ + +  K GT+VSG+VE +TP +IVV+VN      KG++ T+ L+DH G A 
Sbjct  625   FTMSSNRVVQADTAKVGTIVSGVVERLTPATIVVSVNGFS---KGSILTEQLADHHGQAA  681

Query  3742  LMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQISPHSVVHGYVCNV  3563
              +K++LKPG+EF+QLLVLD EG NLVLSAK+SLI+TA  +P +++Q+   +VVHGY+CN+
Sbjct  682   QLKNMLKPGHEFNQLLVLDTEGQNLVLSAKHSLINTANDIPSEISQMQAGAVVHGYICNI  741

Query  3562  IGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQ  3383
             I  G FVRFLG LTGFSP+ KA D      S+VF +GQSV +++L+VN E+ R+ +SL+Q
Sbjct  742   IEAGCFVRFLGHLTGFSPKDKAVDRPIEKLSDVFCVGQSVRSHVLNVNAESARVKLSLQQ  801

Query  3382  SLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVV  3203
             S+CSS D +FIQ YFLL+ KIA L+   +  +  +WV  FG+GS+V+G+V  ++E+GV++
Sbjct  802   SMCSSPDCSFIQGYFLLDQKIAALK-YSAPSTSHDWVKYFGIGSLVKGEVGAVEEYGVIL  860

Query  3202  TFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTAN  3023
              F+ + DV G I   QLGG  V+ GS+++  V+D+S  + +V+LSLKPE V      + +
Sbjct  861   NFKDHPDVVGLIEHHQLGGSTVKVGSSVKGLVVDLS--DGVVNLSLKPELVG-----SVS  913

Query  3022  DKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGYASLNDFNTQNLPV  2843
                +KKKR R A  DLE+ + VNAVVEIVK++Y+VLSVP  N+A+G+A L D+N+Q LP 
Sbjct  914   KDEKKKKRHRAAVLDLELREEVNAVVEIVKDSYMVLSVPEYNHAIGFAPLMDYNSQLLPQ  973

Query  2842  KQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkknsSYDVGSLVQAEI  2663
               + NGQ +   + ++P S   GRL+LL K  +  +  SSSKR KK S Y VGSLV+AEI
Sbjct  974   HHYDNGQCINVVVGSIPSSDPSGRLILLPKGSAHDSNISSSKRAKKKSDYKVGSLVEAEI  1033

Query  2662  TDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARIVSKDSRS-ENKR  2486
              DIKPLE+ LKFG   HGR+HITE  +++ +E P +  +IGQ + ARIV++   S +  R
Sbjct  1034  IDIKPLEVILKFGVNLHGRIHITEVLEEDCSEHPFSKLKIGQKVHARIVAQAEHSAKTGR  1093

Query  2485  GYQWELSTKPSVLAGDMD---GPHESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLY  2315
               +WELS KPS+L  D++         N+S   ++  YV KVD+EW WLT+SR+V A L+
Sbjct  1094  NLKWELSIKPSLLKADLEESTASEAELNHSINDIIRAYVVKVDTEWVWLTVSRKVMAHLF  1153

Query  2314  ILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVP---HTLLITPEDTVPSSE  2144
             ILDSS EPSELKEFQ+ + VG++V G I+  N+EK+LLRL       +L   +DT  +  
Sbjct  1154  ILDSSVEPSELKEFQQCYSVGQAVKGRIIGVNREKRLLRLKAFDNQCMLENIDDTQKTVS  1213

Query  2143  SARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQF  1964
             S   H +EG ++GGRI +ILPGVGGL++QI  HL G+VH+TE+ D WV +PLSG  EGQF
Sbjct  1214  SIAEHTKEGDIIGGRIQRILPGVGGLVIQIGPHLHGRVHYTEIVDSWVPEPLSGIHEGQF  1273

Query  1963  VKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQ  1784
             VKCKVL V    +G+  VDLSLR            + D++ +   R + I DL P   V+
Sbjct  1274  VKCKVLAVSRQAEGSVRVDLSLRS----------RKLDNLTTCAPRFEKINDLCPGTEVK  1323

Query  1783  GYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRV  1604
             GYVKNV PKGCFIMLSR V+A+I+LSNL+D ++E+P+K+F VG LV G+V+S E LS +V
Sbjct  1324  GYVKNVNPKGCFIMLSRMVEARIILSNLSDEYVENPQKDFSVGMLVQGRVLSAEPLSGKV  1383

Query  1603  EVTLRTSSSATPRKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELS  1424
             EV+LR S+ +  +K D  + ++   G+I+ G++KR+ES+GLF+++ ++ LVGLCHVSELS
Sbjct  1384  EVSLRKSTGSKSQKLDDISYSDLHVGDIVDGQVKRVESYGLFVTIKSSELVGLCHVSELS  1443

Query  1423  DDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSYFRDDDGEDIQTTSRQSINSTD  1244
             D+ + ++ + YKAG         +D+DRHR+SLG+K SYF  D  +D      ++ N  D
Sbjct  1444  DEPVLDINACYKAGDI-------IDEDRHRVSLGLKESYFDSDLTDD------ENGNKND  1490

Query  1243  KGNSVFIGTQSTVFPESSDADIDVSVVNTTDNILTEVESRASIPPLEVPLDDIENSDIDD  1064
              G    +    +  P+ S         N+T  +L   E RAS+PPL+V LD+ E SD  +
Sbjct  1491  GGR---VPMDISRAPQMSGG------FNST-LVLPGREPRASVPPLQVALDEYEVSD-QE  1539

Query  1063  AVNKNPDHTGGADTTDekdkkramkkakkerereiraaeerlleKDIPRNTDEFEKLVRS  884
                K  +   G ++                RE EI A EER L+KDIP+  DEFEKLVRS
Sbjct  1540  GDQKAHEIANGNESN----WHPDSYTIFLPREIEISALEERALQKDIPQTPDEFEKLVRS  1595

Query  883   SPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNP  704
             SPNSSFVWIKYMAF+L L DVEKARS+AE+A+ TINIREE EKLNVWVAYFNLE EYG+P
Sbjct  1596  SPNSSFVWIKYMAFLLDLADVEKARSVAERALRTINIREEEEKLNVWVAYFNLENEYGSP  1655

Query  703   PQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRI  524
              ++AV K+FQRALQYCDPKKVHLALLG+YERT+  +L DEL ++M K+FK SCKIWLRRI
Sbjct  1656  REDAVKKIFQRALQYCDPKKVHLALLGMYERTKQNELADELFDRMTKRFKTSCKIWLRRI  1715

Query  523   QWALKQNQDNS--QSIVNRALLCLPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEY  350
             Q++L Q +D    +S+VNRALL LP+ K IKF+TQTAILEFKCGVA+ GRS FE +L+EY
Sbjct  1716  QFSLTQGKDVEYIKSVVNRALLSLPQSKRIKFLTQTAILEFKCGVAEEGRSRFELILREY  1775

Query  349   PKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVGDEERI  170
             PKRTD+WSVYLDQEIR+GD ++IRALF+R   LS+PPKKMKFLFKKYL YEK+ GDEERI
Sbjct  1776  PKRTDIWSVYLDQEIRLGDTEIIRALFDRVTCLSLPPKKMKFLFKKYLRYEKAQGDEERI  1835

Query  169   ESVKRKAMEYVE  134
             E VK+KAMEYVE
Sbjct  1836  EHVKQKAMEYVE  1847



>ref|XP_007029114.1| RNA binding,RNA binding isoform 3 [Theobroma cacao]
 gb|EOY09616.1| RNA binding,RNA binding isoform 3 [Theobroma cacao]
Length=1356

 Score =  1835 bits (4754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 922/1354 (68%), Positives = 1111/1354 (82%), Gaps = 28/1354 (2%)
 Frame = -2

Query  5566  DDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLAS  5387
             DDLGSLFG  I+GKLP+ AN+IT KNISPGMKLWGV+AEVNEKD+V+SLPGGLRGLV A+
Sbjct  3     DDLGSLFGDGITGKLPRYANKITLKNISPGMKLWGVVAEVNEKDLVISLPGGLRGLVRAA  62

Query  5386  EAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLALLH  5207
             +A D +  NE    E   N+L+ +F  GQLVSCIVL LDDDKKE GK KIWLSLRL+LLH
Sbjct  63    DALDSVLSNEVENNE--GNFLTNIFCTGQLVSCIVLQLDDDKKETGKRKIWLSLRLSLLH  120

Query  5206  KNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIH-SQSVD-KMNTGQLVEGV  5033
             K+ TLDA+QEG++L+AY+KS EDHGYILHFGL SF GFLP    +S D K+ TGQ ++GV
Sbjct  121   KSFTLDAVQEGMVLTAYVKSIEDHGYILHFGLSSFMGFLPKDDEESRDIKVRTGQFLQGV  180

Query  5032  VKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLT  4853
             V+ +D+TRKVVYLSS PD ++K VTKDLKGISIDLL+PGM+VN SV S+LENGVMLSFLT
Sbjct  181   VRRIDKTRKVVYLSSNPDTVSKCVTKDLKGISIDLLIPGMLVNTSVRSILENGVMLSFLT  240

Query  4852  YFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPS  4673
             YFTGTVD+FHLQ  FP   WKDDY QNKK+NARILFIDP+TRAVGL+LNPHLVH KAPPS
Sbjct  241   YFTGTVDMFHLQNQFPTKDWKDDYNQNKKINARILFIDPSTRAVGLTLNPHLVHNKAPPS  300

Query  4672  LVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKVV  4493
              V +G+I++Q+KVIRVD+GLGLLL+IPS PV TPAYVYISDV ++EV+K+EK FK G  V
Sbjct  301   HVNIGEIYDQSKVIRVDRGLGLLLDIPSKPVSTPAYVYISDVAEEEVRKLEKKFKEGSQV  360

Query  4492  RVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGVK  4313
             RVR+ GFR+LEGLATG LK SAFEG VFTHSDVKPGMV++AKVI +DSF AIVQF  GVK
Sbjct  361   RVRIHGFRHLEGLATGILKASAFEGQVFTHSDVKPGMVIRAKVIALDSFSAIVQFPGGVK  420

Query  4312  ALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSYTDA  4133
             ALCP+RHMSEFEI KP KKF+VG+ELVFRVLGCKSKRITVTHKKTLVKSKL I+SSY DA
Sbjct  421   ALCPIRHMSEFEIAKPGKKFKVGAELVFRVLGCKSKRITVTHKKTLVKSKLGIISSYADA  480

Query  4132  TEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSS  3953
             TEG ITHGWITKIEKHGCFVRFYNGVQGFAPRSELGL PG D SSMYHV QV+KCRV SS
Sbjct  481   TEGFITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLGPGYDPSSMYHVGQVIKCRVTSS  540

Query  3952  SPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTVSTQ  3773
             +PASR+I LSF  +P+R+SE ++VK G++VSG+++ +TP ++V+ VN+ ++HLKGT+S +
Sbjct  541   NPASRRINLSFQMKPVRVSEDDLVKLGSIVSGLIDRLTPSAVVIQVNS-KAHLKGTISNE  599

Query  3772  HLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQISPH  3593
             HL+D+   A L+KSVLKPGY+FDQLLVLDIEG N++LSAKYSL S A+QLP D++QI P+
Sbjct  600   HLADNHESAALLKSVLKPGYKFDQLLVLDIEGNNILLSAKYSLTSLAEQLPSDISQIHPN  659

Query  3592  SVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVNGE  3413
             SVVHGYVCN+I  G FVRFLGRLTGFSPRSK+TDD + D S  FY+GQSV +NILDVN E
Sbjct  660   SVVHGYVCNLIETGCFVRFLGRLTGFSPRSKSTDDYKADLSGAFYVGQSVRSNILDVNSE  719

Query  3412  TGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGKV  3233
             T RIT+SLKQS CSSTDA+FIQE+FLLE KIAKLQS DS  S L WV+GF +GS++EGK+
Sbjct  720   TARITLSLKQSSCSSTDASFIQEFFLLEEKIAKLQSSDSDGSELKWVEGFNVGSVIEGKI  779

Query  3232  HEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEF  3053
              E K+ GVVV+F+KY+DV GF++  QLGG+ +ETGS +QAAV+DV+K E LVDLSLKPEF
Sbjct  780   GEAKDIGVVVSFDKYNDVLGFVTHYQLGGLTLETGSIVQAAVLDVAKAERLVDLSLKPEF  839

Query  3052  VNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGYASL  2873
             V+ S+ +++  + QKKKRKREA KDLEV+Q+VNAVVEIVKE+YLVL++P  NYA+GYAS 
Sbjct  840   VDKSQEESSKGQIQKKKRKREASKDLEVHQTVNAVVEIVKEHYLVLAIPEYNYAIGYASK  899

Query  2872  NDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkknsSY  2693
              D+NTQ  P KQFVNGQ VIAT+MALP  +T GRLLLLL +ISEV E+SSSKR KK SSY
Sbjct  900   ADYNTQKFPQKQFVNGQRVIATVMALPSPTTSGRLLLLLNSISEVTETSSSKRAKKKSSY  959

Query  2692  DVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARIVS  2513
              VGSLV AE+T+I PLELRLKFG GF GRVH+TE  DDN  E P  +F+IGQT+TAR+V 
Sbjct  960   SVGSLVSAEVTEIMPLELRLKFGIGFRGRVHVTEVNDDNVLENPFGNFKIGQTITARVVG  1019

Query  2512  KDSRSENKRGYQWELSTKPSVLAGD----MDGPHESFNYSTGQLLSGYVFKVDSEWAWLT  2345
             K     N++GY W+LS KP++LAG     ++  ++  N+S GQL++GYV+K+D+EWAWLT
Sbjct  1020  K----ANQKGYLWDLSIKPTMLAGTGETGVNSTNDECNFSAGQLVTGYVYKMDTEWAWLT  1075

Query  2344  ISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTL-----  2180
             ISR V+AQLYILDS+ EP+EL++FQ+RF VGK+VSG++L+ NK+KKLLRLV H L     
Sbjct  1076  ISRHVKAQLYILDSAREPNELQQFQERFKVGKAVSGHVLNVNKDKKLLRLVRHPLGALSI  1135

Query  2179  --------LITPEDTVPSSESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHF  2024
                          D   S ES   HI EG +LGGRISKILPGVGGLLVQI  H+FG+VHF
Sbjct  1136  RNVHGEDKRTGESDNNISGESVTTHIHEGDILGGRISKILPGVGGLLVQIGPHIFGRVHF  1195

Query  2023  TELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISE-HDD  1847
             TEL+D W SDPLSGY EGQFVKCKVL++ HSVKGT H+DLSLR +LD M   N SE   D
Sbjct  1196  TELKDTWESDPLSGYYEGQFVKCKVLEISHSVKGTIHIDLSLRLSLDGMLPNNPSELGSD  1255

Query  1846  VHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKE  1667
               S ++RV+ I+DL+P+M +QGYVKN  PKGCFI+LSRK+DAKILLSNL+DG+I+ P+KE
Sbjct  1256  EDSTSKRVEKIEDLYPNMAIQGYVKNTIPKGCFILLSRKLDAKILLSNLSDGYIDDPKKE  1315

Query  1666  FPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPR  1565
             FP+GKLV G++    S S ++ +TL TS   T +
Sbjct  1316  FPIGKLVAGRLDCAMSQSFQM-ITLITSKLNTEQ  1348


 Score = 64.3 bits (155),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 92/444 (21%), Positives = 180/444 (41%), Gaps = 78/444 (18%)
 Frame = -2

Query  2686  GSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARIVSKD  2507
             G +++A++  +      ++F  G      I   ++    + P   F++G  L  R++   
Sbjct  396   GMVIRAKVIALDSFSAIVQFPGGVKALCPIRHMSEFEIAK-PGKKFKVGAELVFRVLGCK  454

Query  2506  SRSENKRGYQWELSTKPSVLAGDMDGPHESFNYSTGQLLSGYVFKVDSEWAWLTISREV-  2330
             S+       +  + +K  +++   D        + G +  G++ K++    ++     V 
Sbjct  455   SKRITVTHKKTLVKSKLGIISSYADA-------TEGFITHGWITKIEKHGCFVRFYNGVQ  507

Query  2329  ----RAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTLLITPED  2162
                 R++L  L    +PS +      ++VG+ +   + S+N   + + L   +  + P  
Sbjct  508   GFAPRSELG-LGPGYDPSSM------YHVGQVIKCRVTSSNPASRRINL---SFQMKP--  555

Query  2161  TVPSSESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPL--  1988
              V  SE     ++ GS++ G I ++ P    + V   AHL G +    L D   S  L  
Sbjct  556   -VRVSEDDL--VKLGSIVSGLIDRLTPSAVVIQVNSKAHLKGTISNEHLADNHESAALLK  612

Query  1987  ----SGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISEHDDVHSQNRRVQ  1820
                  GY   +F +  VL +  +     ++ LS +++L ++  Q  S             
Sbjct  613   SVLKPGY---KFDQLLVLDIEGN-----NILLSAKYSLTSLAEQLPS-------------  651

Query  1819  DIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTG  1640
             DI  +HP+  V GYV N+   GCF+    ++      S   D +       F VG+ V  
Sbjct  652   DISQIHPNSVVHGYVCNLIETGCFVRFLGRLTGFSPRSKSTDDYKADLSGAFYVGQSVRS  711

Query  1639  KVVSVESLSKRVEVTLRTSSSATP------------------RKSDIDA-----LNNFSA  1529
              ++ V S + R+ ++L+ SS ++                   + SD D      +  F+ 
Sbjct  712   NILDVNSETARITLSLKQSSCSSTDASFIQEFFLLEEKIAKLQSSDSDGSELKWVEGFNV  771

Query  1528  GNIISGKIKRIESFGLFISVDNTN  1457
             G++I GKI   +  G+ +S D  N
Sbjct  772   GSVIEGKIGEAKDIGVVVSFDKYN  795



>gb|EEC81702.1| hypothetical protein OsI_25303 [Oryza sativa Indica Group]
Length=1848

 Score =  1831 bits (4744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1010/1881 (54%), Positives = 1337/1881 (71%), Gaps = 120/1881 (6%)
 Frame = -2

Query  5710  FPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhklykKNQSVEDDLGSLFGHSIS  5531
             FPRGG SLLS++E+ E RAE DA+FE E     K+K+          +DDLGSLFG + +
Sbjct  64    FPRGGRSLLSRDEVAEARAEADADFERE-ERRGKRKRKGASSSGAGGDDDLGSLFGGATT  122

Query  5530  GKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNETN  5351
             GKLP+ ANR+T KNISP MKLWGV+ EVN+KDIVVSLPGG+RG V + E HD +   ET 
Sbjct  123   GKLPRFANRVTLKNISPNMKLWGVVIEVNQKDIVVSLPGGMRGFVRSEEVHD-ITSQETR  181

Query  5350  EMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAG-KWKIWLSLRLALLHKNLTLDAIQEG  5174
             + + + +  + + HVGQLV CIVL +DDD KE     ++WLSLRL+ ++K L+LDAIQ+G
Sbjct  182   K-DSEGSICADVVHVGQLVPCIVLRVDDDNKEGKVNKRVWLSLRLSRIYKGLSLDAIQDG  240

Query  5173  IILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDKMNTGQLVEGVVKSVDRTRKVVYL  4994
             ++L+A +KS EDHGYILHFG+ SFSGF+P   +   K+ +GQL++ VVK++D+ R++V+L
Sbjct  241   MVLTAQVKSIEDHGYILHFGVSSFSGFMPKADRESAKIESGQLIQCVVKAIDKAREIVHL  300

Query  4993  SSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQ  4814
             SS  D ++K + KDLKG+SID L+PGMMVNA V SVLENGVMLSFLTYFTGT DIF+L  
Sbjct  301   SSDEDLLSKSIIKDLKGLSIDHLIPGMMVNARVHSVLENGVMLSFLTYFTGTADIFNLSN  360

Query  4813  VFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKV  4634
              FP  SWKDDY +NKKVNARILF+DP+TRAVGL+LN  L+  K P   VK G+I+++A+V
Sbjct  361   SFPSGSWKDDYIKNKKVNARILFVDPSTRAVGLTLNQQLLRLKVPSINVKAGEIYDKARV  420

Query  4633  IRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGL  4454
             +R+DK  GL LEIP SP P+P +V I DV DK+VK +EK FK G + RVRVLG R+LEG+
Sbjct  421   LRMDKRAGLFLEIP-SPTPSPGFVSIHDVSDKDVKNVEKKFKEGSMARVRVLGVRHLEGV  479

Query  4453  ATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFE-  4277
             A G+LK SAFEGSVFTH+DVKPGMVV+AKV+TV+ FGAIVQFSSGVKALCPL HMSE E 
Sbjct  480   AIGTLKESAFEGSVFTHADVKPGMVVRAKVVTVEPFGAIVQFSSGVKALCPLPHMSELEH  539

Query  4276  IVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSYTDATEGLITHGWITK  4097
             +VKP KKF+VG EL FRVLGCKSKRITVT KK+LVKSKLD+L+SY DA  GL+THGWITK
Sbjct  540   VVKPPKKFKVGVELTFRVLGCKSKRITVTFKKSLVKSKLDVLASYADAKIGLLTHGWITK  599

Query  4096  IEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFT  3917
             IEKHGCFV+FYNGVQGF  RSELGL+PG++  ++YHV QVVKCRVVS  PASR+I ++F 
Sbjct  600   IEKHGCFVKFYNGVQGFVSRSELGLEPGTEAENVYHVGQVVKCRVVSVVPASRKINVTFL  659

Query  3916  TRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLM  3737
                 R+ + +  K G++VSG+VE +TP ++VV+VN      KG++  +HL+DHR      
Sbjct  660   ISTNRVIQADTPKVGSIVSGVVERLTPAAVVVSVNG---FCKGSILNEHLADHR------  710

Query  3736  KSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQISPHSVVHGYVCNVIG  3557
                             D+EG NLVLSAK SLI+ A  +P +++Q+   SV HGYVCN+I 
Sbjct  711   ----------------DVEGQNLVLSAKQSLINCASDIPSEISQMHAGSVFHGYVCNIIE  754

Query  3556  NGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQSL  3377
              G FVRFLG LTGFSP+ KA D      S  FY+GQSV ++IL+VN E+ R+ +SL+QS+
Sbjct  755   AGCFVRFLGHLTGFSPKDKAVDRSVEKLSNAFYVGQSVRSHILNVNAESARVKLSLQQSM  814

Query  3376  CSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTF  3197
             CSS D +F+Q YFLL+ KI +L+  D + S  +W++ F +G++VEG+V  I+E+GV++ F
Sbjct  815   CSSADCSFVQGYFLLDQKITELKYSDPSSSFHDWLNTFAIGNLVEGEVGAIEEYGVILNF  874

Query  3196  EKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDK  3017
             + + DV G I   QLG  +VE GS+++  VID+S  + +V++SLK E V     ++ +  
Sbjct  875   QSHPDVVGLIEHHQLGDSSVEVGSSVKGLVIDLS--DGVVNISLKSELV-----RSVSKV  927

Query  3016  TQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGYASLNDFNTQNLPVKQ  2837
              +KKKR R A  DLE+++ VNA+VEIVKE+++VLS+P  NYA+G+A L D+N+Q LP   
Sbjct  928   GKKKKRHRAAVMDLELHEEVNAIVEIVKESHVVLSIPEYNYAIGFAPLMDYNSQLLPCCN  987

Query  2836  FVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkknsSYDVGSLVQAEITD  2657
             + NGQ +   + ++P S   GRLLLL KA  + +  SSSKR KK S + VGSLV+AEI D
Sbjct  988   YENGQRITVVVGSMPSSGPTGRLLLLPKASGKNSSVSSSKRAKKKSDFKVGSLVEAEIID  1047

Query  2656  IKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARIVSKDSRS-ENKRGY  2480
             IKPLEL LKFGS  HGR+HITE  DD++ + P ++ +IG+++ ARIV++   S +  +  
Sbjct  1048  IKPLELLLKFGSNLHGRIHITEVFDDDSNDCPFSELQIGRSVQARIVAEAEHSGKGGKNS  1107

Query  2479  QWELSTKPSVLAG---DMDGPHESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYIL  2309
             +WELS +PS+L G   D   P     +S G ++  YV KVD EW WLT+SR+V A L+IL
Sbjct  1108  KWELSIRPSLLQGGLEDFTPPKAELRHSIGGIVHAYVVKVDREWIWLTVSRDVMAHLFIL  1167

Query  2308  DSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTLLITPEDTVPSSESARC-  2132
             DSSAEP EL++FQ+R+ VG++V G I+  N+EK+LLRL        PE+   + +     
Sbjct  1168  DSSAEPGELEKFQQRYSVGQAVKGRIIGVNREKRLLRLKALDSQSLPENIGETQKPLSAT  1227

Query  2131  --HIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVK  1958
               H ++G ++GGRI KILPGVGGL++QI  HL G+VH+TE+ D WV +P+SG+ EGQFVK
Sbjct  1228  VEHTKQGDIIGGRIQKILPGVGGLVIQIGPHLHGRVHYTEIVDSWVQEPISGFHEGQFVK  1287

Query  1957  CKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGY  1778
             CKVL V  S +G+  VDLSLR ++   +NQ+    DD   +  R + I DL P   V+GY
Sbjct  1288  CKVLDVSRSSEGSVRVDLSLRSSMCANSNQSRRLFDDSRIRTSRFEKINDLCPGTEVKGY  1347

Query  1777  VKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEV  1598
             VK+V  KGCFIM+SR ++A+I+LSNL+D ++E+P+ +FPVG LV G+V+S E  S +VEV
Sbjct  1348  VKSVNSKGCFIMVSRTIEARIILSNLSDEYVENPQNDFPVGLLVHGRVLSSEPQSGKVEV  1407

Query  1597  TLRTSSSATPRKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDD  1418
             +LR ++ +  +KSD  + ++   G+II+G++KR+ESFGLF+++  + LV LCHVSELSD+
Sbjct  1408  SLRKNTGSKSQKSDDISYSDLHVGDIIAGQVKRVESFGLFVTIQGSELVALCHVSELSDE  1467

Query  1417  HIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSYF--------RDDDGEDI--QTTS  1268
              + ++ S +KAG         +D++RHR+S+GMK SY          DD+ ++I  +  S
Sbjct  1468  PVLDIHSCHKAGDK-------IDEERHRVSIGMKKSYIGPDSTGDTSDDEDDEIVPEEIS  1520

Query  1267  RQSINSTDKGNSVFIGTQSTVFPESSDADIDVSVVNTTDNILTEVESRASIPPLEVPLDD  1088
             R  +   D+ +++                           +L + ESRAS+ PL+V LD+
Sbjct  1521  RNPVMGRDRNHAL---------------------------VLPKPESRASVLPLQVSLDE  1553

Query  1087  IENSDIDDAVNKNPDHTGGADTTDekdkkramkkakkerereiraaeerlleKDIPRNTD  908
              E SD ++  NK  +   GA+  D+K  KR  +KA+K+RE EI A EER L++DIP+  D
Sbjct  1554  SEGSDQEND-NKGQEIANGAEVDDKKSNKRLKEKARKQRELEISALEERALQRDIPQTPD  1612

Query  907   EFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFN  728
             EFEKLVRSSPNSSFVWI YMAF+L L DV+KAR++AE+A+ TINIREE EKLNVWVAYFN
Sbjct  1613  EFEKLVRSSPNSSFVWINYMAFLLDLADVDKARAVAERALRTINIREEEEKLNVWVAYFN  1672

Query  727   LEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHS  548
             LE EYG+P ++AV K+FQRALQYCDPKKVHLALL +YERTE Y L DELL++M K+FK S
Sbjct  1673  LENEYGSPREDAVKKIFQRALQYCDPKKVHLALLAMYERTEQYTLADELLDRMTKRFKTS  1732

Query  547   CKIWLRRIQWALKQNQDNS--QSIVNRALLCLPKHKHIKFITQTAILEFKCGVADRGRSM  374
             CKIWLR IQ +LKQ++D    + IV RALL LP+ K IKF++QTAILEFKCGV + GRS 
Sbjct  1733  CKIWLRCIQLSLKQSKDVECIKLIVKRALLSLPQSKRIKFLSQTAILEFKCGVPEEGRSR  1792

Query  373   FERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEK  194
             FE +L+EYPKRTDLWSVYLDQ                            FLFKKYL YEK
Sbjct  1793  FELILREYPKRTDLWSVYLDQ----------------------------FLFKKYLEYEK  1824

Query  193   SVGDEERIESVKRKAMEYVES  131
             S GDEERIE VK+KA+EYV+S
Sbjct  1825  SQGDEERIEHVKQKALEYVQS  1845



>ref|XP_006657541.1| PREDICTED: protein RRP5 homolog [Oryza brachyantha]
Length=1705

 Score =  1779 bits (4609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 935/1691 (55%), Positives = 1255/1691 (74%), Gaps = 42/1691 (2%)
 Frame = -2

Query  5170  ILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDKMNTGQLVEGVVKSVDRTRKVVYLS  4991
             +L+A +KS EDHGYILHFG+ SFSGF+P   +   K+ +GQL+   VK++D+TR +V+LS
Sbjct  43    VLTAQVKSVEDHGYILHFGVSSFSGFMPKADKENVKIGSGQLIHCAVKAIDKTRAIVHLS  102

Query  4990  SAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQV  4811
             S  D ++K + KDLKG+S+D L+PGMM+NA V +VL NG+MLSFLTYFTGT DIF+L   
Sbjct  103   SDEDLLSKSIIKDLKGLSVDNLIPGMMINARVHAVLGNGIMLSFLTYFTGTADIFNLSNS  162

Query  4810  FPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVI  4631
             FP  SWKDDY +NKKVNARILF+DP+TRAVGL+LN HL+  K PP  VKVG+I+++A+V+
Sbjct  163   FPSGSWKDDYIKNKKVNARILFVDPSTRAVGLTLNQHLIRLKVPPISVKVGEIYDKAQVL  222

Query  4630  RVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLA  4451
             R+DK  GL LEIP SP P+P +V I DV DK+VK +EK FK G + RVRV+G R+LEG+A
Sbjct  223   RMDKRAGLFLEIP-SPTPSPGFVSIHDVSDKDVKNVEKKFKEGSMARVRVIGVRHLEGVA  281

Query  4450  TGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFE-I  4274
              G+LK SAFEGSVFTH+DVKPGMVV+AKV+TV+ FGAIVQFSSGVKALCPL HMSE E +
Sbjct  282   IGTLKESAFEGSVFTHADVKPGMVVRAKVVTVEPFGAIVQFSSGVKALCPLPHMSELEHV  341

Query  4273  VKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSYTDATEGLITHGWITKI  4094
             VKP KKF+VG+EL+FRVLGCKSKR+TVT KK+LVKSKLD+L+SY DA  GL+THGWI+KI
Sbjct  342   VKPPKKFKVGAELIFRVLGCKSKRVTVTFKKSLVKSKLDVLASYADAKIGLLTHGWISKI  401

Query  4093  EKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTT  3914
             EKHGCFV+FYNGVQGF  RSEL L+PG++  S+YH+ QVVKCRVVS  PASR+I +SF  
Sbjct  402   EKHGCFVKFYNGVQGFVSRSELALEPGTEAESVYHIGQVVKCRVVSVVPASRKINVSFVI  461

Query  3913  RPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMK  3734
                R+ + +  K G++VSG+VE +TP +++V+VN  +   KG++  +HL+DHRG A  +K
Sbjct  462   STNRVIQADTSKVGSIVSGVVERLTPAAVIVSVNGFR---KGSILNEHLADHRGQAAQLK  518

Query  3733  SVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGN  3554
             ++LKPGYEF++LLVLDIEG NLVLSAK SLI  A  +P +++Q+   SVVHGYVCN+I  
Sbjct  519   NLLKPGYEFNELLVLDIEGQNLVLSAKNSLIKCASDIPSEISQMQAGSVVHGYVCNIIEA  578

Query  3553  GVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQSLC  3374
             G FVRFLG LTGFSP+ KA D      S  FY+GQSV  +IL+VN E+ R+ +SL+QS+C
Sbjct  579   GCFVRFLGHLTGFSPKDKAVDRSVEKLSNAFYVGQSVRGHILNVNAESARVKLSLQQSMC  638

Query  3373  SSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFE  3194
             SS D +F+Q YFLL+ KI +L+    + S  +W+  F +G++VEG+V  I+E+GV++ F+
Sbjct  639   SSPDCSFVQGYFLLDQKITELKHSGPSSSFHSWLKTFAIGNLVEGEVGAIEEYGVILNFK  698

Query  3193  KYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKT  3014
              + D+ G +   QLG  +VE GS+++  VID+S  + +V+LSLK E +     ++ N+  
Sbjct  699   SHPDIVGLLEHHQLGDSSVEVGSSVKGLVIDLS--DGVVNLSLKSELI-----RSVNNDG  751

Query  3013  QKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGYASLNDFNTQNLPVKQF  2834
             +KKKR + A  DLE+++ VNA+VE+VKE+Y VLS+P  NYA+G+A L D+N+Q LP   +
Sbjct  752   KKKKRHKAAVVDLELHEEVNAIVELVKESYAVLSIPEYNYAIGFAPLMDYNSQLLPCHNY  811

Query  2833  VNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkknsSYDVGSLVQAEITDI  2654
              NGQ +   + ++  S+  GRL+LL KA    +   SSKR K  S + VGSLV+AEI DI
Sbjct  812   ENGQRITVVVGSMASSNPTGRLILLSKASGHNSGVRSSKRAKNKSDFKVGSLVEAEIIDI  871

Query  2653  KPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARIVSKDSRS-ENKRGYQ  2477
             KPLEL LKFG   HGR+HITE  DD++T+ P +  RIGQT+ ARIV++   + ++ +  +
Sbjct  872   KPLELLLKFGFNLHGRIHITEVFDDDSTDCPFSKHRIGQTVQARIVAEAEHTGKSGKNSK  931

Query  2476  WELSTKPSVLAG---DMDGPHESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILD  2306
             WELS +PS+L G   D   P+    +S G ++  YV KVD EW WLT+SR+V A L++LD
Sbjct  932   WELSIRPSLLQGGLEDFAAPNAKLRHSIGDIVRAYVVKVDREWIWLTVSRDVMAHLFVLD  991

Query  2305  SSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRL----VPHTLLITPEDTVPSSESA  2138
             SSAEP+EL++FQ+ + VG++V G I+  N+EK+LLRL        L    E   P S + 
Sbjct  992   SSAEPAELEKFQQCYSVGQAVEGRIIGVNREKRLLRLKVLDSQSELENIDEKQKPVSATV  1051

Query  2137  RCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVK  1958
               H ++G ++GGRI K+LPGVGGL++QI  HL G+VH+TE+ D WV +P+SG+ EGQFVK
Sbjct  1052  E-HTKQGDIIGGRIQKVLPGVGGLVIQIGPHLHGRVHYTEIVDSWVPEPISGFHEGQFVK  1110

Query  1957  CKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGY  1778
             CKVL V  S +G+  VDLSLR ++   +NQ+    +D      R ++I ++ P   ++GY
Sbjct  1111  CKVLDVSRSSEGSVRVDLSLRSSMCENSNQS-RLFNDSEICTSRFENIVNMCPGTEIKGY  1169

Query  1777  VKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEV  1598
             VK+V  KGCFIM+SR ++A+I+LSNL+D ++E+P+ +FPVG LV G+V+S E  S +VEV
Sbjct  1170  VKSVNSKGCFIMVSRIIEARIILSNLSDEYVENPQNDFPVGLLVHGRVLSAEPQSGKVEV  1229

Query  1597  TLRTSSSATPRKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDD  1418
             +LR ++ +  +KSD  + +N   G+II+G++KR+ES+GLF+++  + LVGLCHVSELSD+
Sbjct  1230  SLRKNTGSKSQKSDDVSYSNLHVGDIIAGQVKRVESYGLFVTIQGSELVGLCHVSELSDE  1289

Query  1417  HIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSYFRDDDGEDIQTTSRQSINSTDKG  1238
              + ++ S +KAG  V+ K+LK+D+ RHR+SLGMK SY   D           ++++TD  
Sbjct  1290  PVVDIHSCHKAGDIVKAKILKIDEKRHRVSLGMKKSYIGSD----------STVDTTDDE  1339

Query  1237  NSVFIGTQSTVFPESSDADIDVSVVNTTDNILTEVESRASIPPLEVPLDDIENSDIDDAV  1058
             +   +    +  P  S  D++ ++V      L E ESRAS+ PL+V LDD E SD ++  
Sbjct  1340  DGEIVPMDISHNPAMS-IDLNHALV------LPETESRASVLPLQVSLDDSEASDQEND-  1391

Query  1057  NKNPDHTGGADTTDekdkkramkkakkerereiraaeerlleKDIPRNTDEFEKLVRSSP  878
             N+  + +   +  ++K  KR  +KA+ +RE EI A EER L++DIP+  DEFEKLVRSSP
Sbjct  1392  NEGQEISDRTEVDNKKSNKRLKEKARNQRELEISALEERTLQRDIPQTPDEFEKLVRSSP  1451

Query  877   NSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQ  698
             NSSFVWI YMAF+L L D++KAR++AE+A+ TINIREE EKLNVWVAYFNLE EYG+P +
Sbjct  1452  NSSFVWINYMAFLLDLADIDKARAVAERALRTINIREEEEKLNVWVAYFNLENEYGSPRE  1511

Query  697   EAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQW  518
             +AV K+FQRALQYCDPK+VHLALL +YERTE Y L DELL++M K+FK SCKIWLR IQ 
Sbjct  1512  DAVKKIFQRALQYCDPKRVHLALLSMYERTEQYTLADELLDRMTKRFKASCKIWLRCIQL  1571

Query  517   ALKQNQDNS--QSIVNRALLCLPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPK  344
             +LKQ++D    ++IV RALL LP+ K IKF++QTAILEFKCGV + GRS FE +L+EYPK
Sbjct  1572  SLKQSKDVEYIKTIVKRALLSLPQSKRIKFLSQTAILEFKCGVPEEGRSRFELILREYPK  1631

Query  343   RTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIES  164
             RTDLWSVYLDQEIR+GD D+IRALFER   LS+PPKKMKFLFKKYL YEKS GDEERIE 
Sbjct  1632  RTDLWSVYLDQEIRLGDTDMIRALFERVTCLSLPPKKMKFLFKKYLEYEKSQGDEERIEH  1691

Query  163   VKRKAMEYVES  131
             VK+KA+EYV+S
Sbjct  1692  VKQKALEYVQS  1702


 Score = 61.6 bits (148),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 59/217 (27%), Positives = 99/217 (46%), Gaps = 34/217 (16%)
 Frame = -2

Query  5476  MKLWGVIAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNE---------------ME  5342
             MKLWGV+ EVN+KDIVVSLPGG+RG V + E  D     ETN+               + 
Sbjct  1     MKLWGVVIEVNQKDIVVSLPGGMRGFVRSEEVRDTA-SQETNKVLTAQVKSVEDHGYILH  59

Query  5341  MQSNYLSGLF----------HVGQLVSCIVLHLDDDKK--EAGKWKIWLSLRLALLHKNL  5198
                +  SG              GQL+ C V  +D  +        +  LS  +    K L
Sbjct  60    FGVSSFSGFMPKADKENVKIGSGQLIHCAVKAIDKTRAIVHLSSDEDLLSKSIIKDLKGL  119

Query  5197  TLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDKMNTGQLVEGVVKSVD  5018
             ++D +  G++++A + +   +G +L F L  F+G   I + S +   +G   +  +K+  
Sbjct  120   SVDNLIPGMMINARVHAVLGNGIMLSF-LTYFTGTADIFNLS-NSFPSGSWKDDYIKNKK  177

Query  5017  RTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMV  4907
                +++++  +  A+   + + L    I L VP + V
Sbjct  178   VNARILFVDPSTRAVGLTLNQHL----IRLKVPPISV  210



>gb|KDO70795.1| hypothetical protein CISIN_1g0001731mg, partial [Citrus sinensis]
Length=1352

 Score =  1712 bits (4434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 880/1318 (67%), Positives = 1071/1318 (81%), Gaps = 19/1318 (1%)
 Frame = -2

Query  5767  NASFSGKSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAEDR----ylkkkkq  5600
             N +   +   L  +D+VP FPRGG   L++ E DE+ AEVDAEFEA +R      KKKK+
Sbjct  35    NDAVEAQDLALPPDDDVPVFPRGGGHSLTQRERDEIHAEVDAEFEAVERGLHKKNKKKKK  94

Query  5599  hklykKNQSVEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSL  5420
                 K N++V DDLGSLFG  ISGKLP+ AN+IT KNIS GMKLWGV+AEVNEKD+V+ L
Sbjct  95    KTERKANETV-DDLGSLFGDGISGKLPRYANKITLKNISAGMKLWGVVAEVNEKDLVICL  153

Query  5419  PGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWK  5240
             PGGLRGL  A++A DP+ DNE    E   N L  +FHVGQLVSCIVL LDDDKKE GK K
Sbjct  154   PGGLRGLARAADALDPILDNEIEANE--DNLLPTIFHVGQLVSCIVLQLDDDKKEIGKRK  211

Query  5239  IWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLP---IHSQSV  5069
             IWLSLRL+LL+K L+L+ +QEG++L+AY+KS EDHGYILHFGLPSF+GFLP   +   S 
Sbjct  212   IWLSLRLSLLYKGLSLETVQEGMVLTAYVKSIEDHGYILHFGLPSFTGFLPRNNLAENSG  271

Query  5068  DKMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMS  4889
               +  G L++GVV+S+DRTRKVVYLSS PD ++K VTKDLKGISIDLLVPGMMV+  V S
Sbjct  272   IDVKPGLLLQGVVRSIDRTRKVVYLSSDPDTVSKCVTKDLKGISIDLLVPGMMVSTRVQS  331

Query  4888  VLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSL  4709
             +LENGVMLSFLTYFTGTVDIFHLQ  FP  +WK+DY Q+KKVNARILF+DP +RAVGL+L
Sbjct  332   ILENGVMLSFLTYFTGTVDIFHLQNTFPTTNWKNDYNQHKKVNARILFVDPTSRAVGLTL  391

Query  4708  NPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevk  4529
             NP+L+H +APPS VKVGDI++Q+KV+RVD+GLGLLL+IPS+PV TPAYV ISDV ++EV+
Sbjct  392   NPYLLHNRAPPSHVKVGDIYDQSKVVRVDRGLGLLLDIPSTPVSTPAYVTISDVAEEEVR  451

Query  4528  kmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDS  4349
             K+EK +K G  VRVR+LGFR+LEGLATG LK SAFEG VFTHSDVKPGMVVK KVI VDS
Sbjct  452   KLEKKYKEGSCVRVRILGFRHLEGLATGILKASAFEGLVFTHSDVKPGMVVKGKVIAVDS  511

Query  4348  FGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVK  4169
             FGAIVQF  GVKALCPL HMSEFEIVKP KKF+VG+ELVFRVLG KSKRITVTHKKTLVK
Sbjct  512   FGAIVQFPGGVKALCPLPHMSEFEIVKPGKKFKVGAELVFRVLGVKSKRITVTHKKTLVK  571

Query  4168  SKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYH  3989
             SKL ILSSY +AT+ LITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPG + SSMYH
Sbjct  572   SKLAILSSYAEATDRLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGCEPSSMYH  631

Query  3988  VEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNN  3809
             V QVVKCR++SS PASR+I LSF  +P R+SE ++VK G++VSG+V++VTP+++VV V  
Sbjct  632   VGQVVKCRIMSSIPASRRINLSFMMKPTRVSEDDLVKLGSLVSGVVDVVTPNAVVVYV-I  690

Query  3808  GQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQ  3629
              + + KGT+ T+HL+DH   A +MKSV+KPGYEFDQLLVLD E  NL+LSAKYSLI++AQ
Sbjct  691   AKGYSKGTIPTEHLADHLEHATVMKSVIKPGYEFDQLLVLDNESSNLLLSAKYSLINSAQ  750

Query  3628  QLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQ  3449
             QLP D + I P+SVVHGYVCN+I  G FVRFLGRLTGF+PRSKA D +R D S+ +Y+GQ
Sbjct  751   QLPSDASHIHPNSVVHGYVCNIIETGCFVRFLGRLTGFAPRSKAVDGQRADLSKTYYVGQ  810

Query  3448  SVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVD  3269
             SV +NILDVN ETGRIT+SLKQS CSSTDA+F+QE+FLLE KIA LQS     S L WV+
Sbjct  811   SVRSNILDVNSETGRITLSLKQSCCSSTDASFMQEHFLLEEKIAMLQSSKHNGSELKWVE  870

Query  3268  GFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKI  3089
             GF +GS++EGKVHE  +FGVVV+FE++ DV+GFI+  QL G  VE+GS IQAA++DV+K 
Sbjct  871   GFIIGSVIEGKVHESNDFGVVVSFEEHSDVYGFITHHQLAGATVESGSVIQAAILDVAKA  930

Query  3088  EHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSV  2909
             E LVDLSLK  F++  +   +N + QKKKRKREA KDL V+Q+VNA+VEIVKENYLVLS+
Sbjct  931   ERLVDLSLKTVFIDRFREANSNRQAQKKKRKREASKDLGVHQTVNAIVEIVKENYLVLSL  990

Query  2908  PACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEs  2729
             P  N+++GYAS++D+NTQ  P KQF+NGQSVIAT+MALP SST GRLLLLLKAISE  E+
Sbjct  991   PEYNHSIGYASVSDYNTQKFPQKQFLNGQSVIATVMALPSSSTAGRLLLLLKAISE-TET  1049

Query  2728  ssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDD--NTTEGPLN  2555
             SSSKR KK SSYDVGSLVQAEIT+IKPLELRLKFG GFHGR+HITE  DD  N  E   +
Sbjct  1050  SSSKRAKKKSSYDVGSLVQAEITEIKPLELRLKFGIGFHGRIHITEVNDDKSNVVENLFS  1109

Query  2554  DFRIGQTLTARIVSKDSRSENKRGYQWELSTKPSVLAGDMDGPH---ESFNYSTGQLLSG  2384
             +F+IGQT+TARI++K ++ + K+ + WELS KPS+L     G     E  + S GQ ++G
Sbjct  1110  NFKIGQTVTARIIAKSNKPDMKKSFLWELSIKPSMLTVSEIGSKLLFEECDVSIGQRVTG  1169

Query  2383  YVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKL  2204
             YV+KVD+EWA LTISR ++AQL+ILDS+ EPSEL+EFQ+RF++GK+V+G++LS NKEKKL
Sbjct  1170  YVYKVDNEWALLTISRHLKAQLFILDSAYEPSELQEFQRRFHIGKAVTGHVLSINKEKKL  1229

Query  2203  LRLV--PHTLLITPEDTVPSSESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKV  2030
             LRLV  P    I+ +    S+++ +  I EG ++GGRISKIL GVGGL+VQI  HL+G+V
Sbjct  1230  LRLVLRPFQDGISDKTVDISNDNMQTFIHEGDIVGGRISKILSGVGGLVVQIGPHLYGRV  1289

Query  2029  HFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISE  1856
             HFTEL++  VSDPLSGY EGQFVKCKVL++  +V+GT HV+LSLR +LD M++ N S+
Sbjct  1290  HFTELKNICVSDPLSGYDEGQFVKCKVLEISRTVRGTFHVELSLRSSLDGMSSTNSSD  1347


 Score = 57.0 bits (136),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 81/315 (26%), Positives = 142/315 (45%), Gaps = 33/315 (10%)
 Frame = -2

Query  2272  QKRFYVGKSVSGYILSANKEKKLLRLVPHTLLITPEDTVPSSESARCHIRE-GSVLGGRI  2096
             QK+F  G+SV   +++        RL+     I+  +T  S  + +    + GS++   I
Sbjct  1012  QKQFLNGQSVIATVMALPSSSTAGRLLLLLKAISETETSSSKRAKKKSSYDVGSLVQAEI  1071

Query  2095  SKILPGVGGLLVQIDAHLFGKVHFTELRDP---WVSDPLSGYCEGQFVKCKVLQVGHS--  1931
             ++I P    L   I  H  G++H TE+ D     V +  S +  GQ V  +++   +   
Sbjct  1072  TEIKPLELRLKFGIGFH--GRIHITEVNDDKSNVVENLFSNFKIGQTVTARIIAKSNKPD  1129

Query  1930  VKGTTHVDLSLR---WTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTP  1760
             +K +   +LS++    T+  + ++ + E  DV    R             V GYV  V  
Sbjct  1130  MKKSFLWELSIKPSMLTVSEIGSKLLFEECDVSIGQR-------------VTGYVYKVDN  1176

Query  1759  KGCFIMLSRKVDAK--ILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRT  1586
             +   + +SR + A+  IL S      ++  ++ F +GK VTG V+S+    K + + LR 
Sbjct  1177  EWALLTISRHLKAQLFILDSAYEPSELQEFQRRFHIGKAVTGHVLSINKEKKLLRLVLRP  1236

Query  1585  SSSATPRKS-DI--DALNNF-SAGNIISGKIKRIES--FGLFISVDNTNLVGLCHVSELS  1424
                    K+ DI  D +  F   G+I+ G+I +I S   GL + +   +L G  H +EL 
Sbjct  1237  FQDGISDKTVDISNDNMQTFIHEGDIVGGRISKILSGVGGLVVQI-GPHLYGRVHFTELK  1295

Query  1423  DDHIDNVQSRYKAGQ  1379
             +  + +  S Y  GQ
Sbjct  1296  NICVSDPLSGYDEGQ  1310



>gb|KDO70796.1| hypothetical protein CISIN_1g0001731mg, partial [Citrus sinensis]
 gb|KDO70797.1| hypothetical protein CISIN_1g0001731mg, partial [Citrus sinensis]
 gb|KDO70798.1| hypothetical protein CISIN_1g0001731mg, partial [Citrus sinensis]
Length=1363

 Score =  1702 bits (4408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 880/1329 (66%), Positives = 1071/1329 (81%), Gaps = 30/1329 (2%)
 Frame = -2

Query  5767  NASFSGKSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAEDR----ylkkkkq  5600
             N +   +   L  +D+VP FPRGG   L++ E DE+ AEVDAEFEA +R      KKKK+
Sbjct  35    NDAVEAQDLALPPDDDVPVFPRGGGHSLTQRERDEIHAEVDAEFEAVERGLHKKNKKKKK  94

Query  5599  hklykKNQSVEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSL  5420
                 K N++V DDLGSLFG  ISGKLP+ AN+IT KNIS GMKLWGV+AEVNEKD+V+ L
Sbjct  95    KTERKANETV-DDLGSLFGDGISGKLPRYANKITLKNISAGMKLWGVVAEVNEKDLVICL  153

Query  5419  PGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWK  5240
             PGGLRGL  A++A DP+ DNE    E   N L  +FHVGQLVSCIVL LDDDKKE GK K
Sbjct  154   PGGLRGLARAADALDPILDNEIEANE--DNLLPTIFHVGQLVSCIVLQLDDDKKEIGKRK  211

Query  5239  IWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLP---IHSQSV  5069
             IWLSLRL+LL+K L+L+ +QEG++L+AY+KS EDHGYILHFGLPSF+GFLP   +   S 
Sbjct  212   IWLSLRLSLLYKGLSLETVQEGMVLTAYVKSIEDHGYILHFGLPSFTGFLPRNNLAENSG  271

Query  5068  DKMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMS  4889
               +  G L++GVV+S+DRTRKVVYLSS PD ++K VTKDLKGISIDLLVPGMMV+  V S
Sbjct  272   IDVKPGLLLQGVVRSIDRTRKVVYLSSDPDTVSKCVTKDLKGISIDLLVPGMMVSTRVQS  331

Query  4888  VLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSL  4709
             +LENGVMLSFLTYFTGTVDIFHLQ  FP  +WK+DY Q+KKVNARILF+DP +RAVGL+L
Sbjct  332   ILENGVMLSFLTYFTGTVDIFHLQNTFPTTNWKNDYNQHKKVNARILFVDPTSRAVGLTL  391

Query  4708  NPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevk  4529
             NP+L+H +APPS VKVGDI++Q+KV+RVD+GLGLLL+IPS+PV TPAYV ISDV ++EV+
Sbjct  392   NPYLLHNRAPPSHVKVGDIYDQSKVVRVDRGLGLLLDIPSTPVSTPAYVTISDVAEEEVR  451

Query  4528  kmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDS  4349
             K+EK +K G  VRVR+LGFR+LEGLATG LK SAFEG VFTHSDVKPGMVVK KVI VDS
Sbjct  452   KLEKKYKEGSCVRVRILGFRHLEGLATGILKASAFEGLVFTHSDVKPGMVVKGKVIAVDS  511

Query  4348  FGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVK  4169
             FGAIVQF  GVKALCPL HMSEFEIVKP KKF+VG+ELVFRVLG KSKRITVTHKKTLVK
Sbjct  512   FGAIVQFPGGVKALCPLPHMSEFEIVKPGKKFKVGAELVFRVLGVKSKRITVTHKKTLVK  571

Query  4168  SKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYH  3989
             SKL ILSSY +AT+ LITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPG + SSMYH
Sbjct  572   SKLAILSSYAEATDRLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGCEPSSMYH  631

Query  3988  VEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNN  3809
             V QVVKCR++SS PASR+I LSF  +P R+SE ++VK G++VSG+V++VTP+++VV V  
Sbjct  632   VGQVVKCRIMSSIPASRRINLSFMMKPTRVSEDDLVKLGSLVSGVVDVVTPNAVVVYV-I  690

Query  3808  GQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQ  3629
              + + KGT+ T+HL+DH   A +MKSV+KPGYEFDQLLVLD E  NL+LSAKYSLI++AQ
Sbjct  691   AKGYSKGTIPTEHLADHLEHATVMKSVIKPGYEFDQLLVLDNESSNLLLSAKYSLINSAQ  750

Query  3628  QLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQ  3449
             QLP D + I P+SVVHGYVCN+I  G FVRFLGRLTGF+PRSKA D +R D S+ +Y+GQ
Sbjct  751   QLPSDASHIHPNSVVHGYVCNIIETGCFVRFLGRLTGFAPRSKAVDGQRADLSKTYYVGQ  810

Query  3448  SVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVD  3269
             SV +NILDVN ETGRIT+SLKQS CSSTDA+F+QE+FLLE KIA LQS     S L WV+
Sbjct  811   SVRSNILDVNSETGRITLSLKQSCCSSTDASFMQEHFLLEEKIAMLQSSKHNGSELKWVE  870

Query  3268  GFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKI  3089
             GF +GS++EGKVHE  +FGVVV+FE++ DV+GFI+  QL G  VE+GS IQAA++DV+K 
Sbjct  871   GFIIGSVIEGKVHESNDFGVVVSFEEHSDVYGFITHHQLAGATVESGSVIQAAILDVAKA  930

Query  3088  EHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSV  2909
             E LVDLSLK  F++  +   +N + QKKKRKREA KDL V+Q+VNA+VEIVKENYLVLS+
Sbjct  931   ERLVDLSLKTVFIDRFREANSNRQAQKKKRKREASKDLGVHQTVNAIVEIVKENYLVLSL  990

Query  2908  PACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEs  2729
             P  N+++GYAS++D+NTQ  P KQF+NGQSVIAT+MALP SST GRLLLLLKAISE  E+
Sbjct  991   PEYNHSIGYASVSDYNTQKFPQKQFLNGQSVIATVMALPSSSTAGRLLLLLKAISE-TET  1049

Query  2728  ssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDD--NTTEGPLN  2555
             SSSKR KK SSYDVGSLVQAEIT+IKPLELRLKFG GFHGR+HITE  DD  N  E   +
Sbjct  1050  SSSKRAKKKSSYDVGSLVQAEITEIKPLELRLKFGIGFHGRIHITEVNDDKSNVVENLFS  1109

Query  2554  DFRIGQTLTARIVSKDSRSENKRGYQWELSTKPSVLAGDMDGPH---ESFNYSTGQLLSG  2384
             +F+IGQT+TARI++K ++ + K+ + WELS KPS+L     G     E  + S GQ ++G
Sbjct  1110  NFKIGQTVTARIIAKSNKPDMKKSFLWELSIKPSMLTVSEIGSKLLFEECDVSIGQRVTG  1169

Query  2383  YVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKL  2204
             YV+KVD+EWA LTISR ++AQL+ILDS+ EPSEL+EFQ+RF++GK+V+G++LS NKEKKL
Sbjct  1170  YVYKVDNEWALLTISRHLKAQLFILDSAYEPSELQEFQRRFHIGKAVTGHVLSINKEKKL  1229

Query  2203  LRLV--PHTLLITPEDTVPSSESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKV  2030
             LRLV  P    I+ +    S+++ +  I EG ++GGRISKIL GVGGL+VQI  HL+G+V
Sbjct  1230  LRLVLRPFQDGISDKTVDISNDNMQTFIHEGDIVGGRISKILSGVGGLVVQIGPHLYGRV  1289

Query  2029  HFTELRDPWVS-----------DPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLD  1883
             HFTEL++  VS           DPLSGY EGQFVKCKVL++  +V+GT HV+LSLR +LD
Sbjct  1290  HFTELKNICVSDPLSGYDEGQFDPLSGYDEGQFVKCKVLEISRTVRGTFHVELSLRSSLD  1349

Query  1882  TMNNQNISE  1856
              M++ N S+
Sbjct  1350  GMSSTNSSD  1358


 Score = 57.0 bits (136),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 81/315 (26%), Positives = 142/315 (45%), Gaps = 33/315 (10%)
 Frame = -2

Query  2272  QKRFYVGKSVSGYILSANKEKKLLRLVPHTLLITPEDTVPSSESARCHIRE-GSVLGGRI  2096
             QK+F  G+SV   +++        RL+     I+  +T  S  + +    + GS++   I
Sbjct  1012  QKQFLNGQSVIATVMALPSSSTAGRLLLLLKAISETETSSSKRAKKKSSYDVGSLVQAEI  1071

Query  2095  SKILPGVGGLLVQIDAHLFGKVHFTELRDP---WVSDPLSGYCEGQFVKCKVLQVGHS--  1931
             ++I P    L   I  H  G++H TE+ D     V +  S +  GQ V  +++   +   
Sbjct  1072  TEIKPLELRLKFGIGFH--GRIHITEVNDDKSNVVENLFSNFKIGQTVTARIIAKSNKPD  1129

Query  1930  VKGTTHVDLSLR---WTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTP  1760
             +K +   +LS++    T+  + ++ + E  DV    R             V GYV  V  
Sbjct  1130  MKKSFLWELSIKPSMLTVSEIGSKLLFEECDVSIGQR-------------VTGYVYKVDN  1176

Query  1759  KGCFIMLSRKVDAK--ILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRT  1586
             +   + +SR + A+  IL S      ++  ++ F +GK VTG V+S+    K + + LR 
Sbjct  1177  EWALLTISRHLKAQLFILDSAYEPSELQEFQRRFHIGKAVTGHVLSINKEKKLLRLVLRP  1236

Query  1585  SSSATPRKS-DI--DALNNF-SAGNIISGKIKRIES--FGLFISVDNTNLVGLCHVSELS  1424
                    K+ DI  D +  F   G+I+ G+I +I S   GL + +   +L G  H +EL 
Sbjct  1237  FQDGISDKTVDISNDNMQTFIHEGDIVGGRISKILSGVGGLVVQI-GPHLYGRVHFTELK  1295

Query  1423  DDHIDNVQSRYKAGQ  1379
             +  + +  S Y  GQ
Sbjct  1296  NICVSDPLSGYDEGQ  1310



>dbj|BAC79783.2| putative pre-rRNA processing protein RRP5 [Oryza sativa Japonica 
Group]
 dbj|BAD31015.1| putative pre-rRNA processing protein RRP5 [Oryza sativa Japonica 
Group]
Length=1668

 Score =  1701 bits (4405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 922/1700 (54%), Positives = 1221/1700 (72%), Gaps = 97/1700 (6%)
 Frame = -2

Query  5170  ILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDKMNTGQLVEGVVKSVDRTRKVVYLS  4991
             +L+A +KS EDHGYILHFG+ SFSGF+P   +   K+ +GQL++ VVK++D+ R++V+LS
Sbjct  43    VLTAQVKSIEDHGYILHFGVSSFSGFMPKADRESAKIESGQLIQCVVKAIDKAREIVHLS  102

Query  4990  SAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQV  4811
             S  D ++K + KDLKG+SID L+PGMMVNA V SVLENGVMLSFLTYFTGT DIF+L   
Sbjct  103   SDEDLLSKSIIKDLKGLSIDHLIPGMMVNARVHSVLENGVMLSFLTYFTGTADIFNLSNS  162

Query  4810  FPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVI  4631
             FP  SWKDDY +NKKVNARILF+DP+TRAVGL+LN  L+  K P   VK G+I+++A+V+
Sbjct  163   FPSGSWKDDYIKNKKVNARILFVDPSTRAVGLTLNQQLLRLKVPSINVKAGEIYDKARVL  222

Query  4630  RVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLA  4451
             R+DK  GL LEIPS P P+P +V I DV DK+VK +EK FK G + RVRVLG R+LEG+A
Sbjct  223   RMDKRAGLFLEIPS-PTPSPGFVSIHDVSDKDVKNVEKKFKEGSMARVRVLGVRHLEGVA  281

Query  4450  TGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFE-I  4274
              G+LK SAFEGSVFTH+DVKPGMV                FSSGVKALCPL HMSE E +
Sbjct  282   IGTLKESAFEGSVFTHADVKPGMV----------------FSSGVKALCPLPHMSELEHV  325

Query  4273  VKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSYTDATEGLITHGWITKI  4094
             VKP KKF+VG EL FRVLGCKSKRITVT KK+LVKSKLD+L+SY DA  GL+THGWITKI
Sbjct  326   VKPPKKFKVGVELTFRVLGCKSKRITVTFKKSLVKSKLDVLASYADAKIGLLTHGWITKI  385

Query  4093  EKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTT  3914
             EKHGCFV+FYNGVQGF  RSELGL+PG++  ++YHV QVVKCRVVS  PASR+I ++F  
Sbjct  386   EKHGCFVKFYNGVQGFVSRSELGLEPGTEAENVYHVGQVVKCRVVSVVPASRKINVTFLI  445

Query  3913  RPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMK  3734
                R+ + +  K G++VSG+VE +TP ++VV+VN      KG++  +HL+DHR       
Sbjct  446   STNRVIQADTPKVGSIVSGVVERLTPAAVVVSVNG---FCKGSILNEHLADHR-------  495

Query  3733  SVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGN  3554
                            D+EG NLVLSAK SLI+ A  +P +++Q+   SV HGYVCN+I  
Sbjct  496   ---------------DVEGQNLVLSAKQSLINCASDIPSEISQMHAGSVFHGYVCNIIEA  540

Query  3553  GVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQSLC  3374
             G FVRFLG LTGFSP+ KA D      S  FY+GQSV ++IL+VN E+ R+ +SL+QS+C
Sbjct  541   GCFVRFLGHLTGFSPKDKAVDRSVEKLSNAFYVGQSVRSHILNVNAESARVKLSLQQSMC  600

Query  3373  SSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFE  3194
             SS D +F+Q YFLL+ KI +L+  D + S  +W++ F +G++VEG+V  I+E+GV++ F+
Sbjct  601   SSADCSFVQGYFLLDQKITELKYSDPSSSFHDWLNTFAIGNLVEGEVGAIEEYGVILNFQ  660

Query  3193  KYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKT  3014
              + DV G I   QLG  +VE GS+++  VID+S  + +V++SLK E V     ++ +   
Sbjct  661   SHPDVVGLIEHHQLGDSSVEVGSSVKGLVIDLS--DGVVNISLKSELV-----RSVSKVG  713

Query  3013  QKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGYASLNDFNTQNLPVKQF  2834
             +KKKR R A  DLE+++ VNA+VEIVKE+++VLS+P  NYA+G+A L D+N+Q LP   +
Sbjct  714   KKKKRHRAAVMDLELHEEVNAIVEIVKESHVVLSIPEYNYAIGFAPLMDYNSQLLPCCNY  773

Query  2833  VNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkknsSYDVGSLVQAEITDI  2654
              NGQ +   + ++P S   GRLLLL KA  + +  SSSKR KK S + VGSLV+AEI DI
Sbjct  774   ENGQRITVVVGSMPSSGPTGRLLLLPKASGKNSSVSSSKRAKKKSDFKVGSLVEAEIIDI  833

Query  2653  KPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARIVSKDSRS-ENKRGYQ  2477
             KPLEL LKFGS  HGR+HITE  DD++ + P ++ +IG+++ ARIV++   S +  +  +
Sbjct  834   KPLELLLKFGSNLHGRIHITEVFDDDSNDCPFSELQIGRSVQARIVAEAEHSGKGGKNSK  893

Query  2476  WELSTKPSVLAG---DMDGPHESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILD  2306
             WELS +PS+L G   D   P     +S G ++  YV KVD EW WLT+SR+V A L+ILD
Sbjct  894   WELSIRPSLLQGGLEDFTPPKAELRHSIGGIVHAYVVKVDREWIWLTVSRDVMAHLFILD  953

Query  2305  SSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTLLITPEDTVPSSESARC--  2132
             SSAEP EL++FQ+R+ VG++V G I+  N+EK+LLRL        PE+   + +      
Sbjct  954   SSAEPGELEKFQQRYSVGQAVKGRIIGVNREKRLLRLKALDSQSLPENIGETQKPLSATV  1013

Query  2131  -HIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKC  1955
              H ++G ++GGRI KILPGVGGL++QI  HL G+VH+TE+ D WV +P+SG+ EGQFVKC
Sbjct  1014  EHTKQGDIIGGRIQKILPGVGGLVIQIGPHLHGRVHYTEIVDSWVQEPISGFHEGQFVKC  1073

Query  1954  KVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYV  1775
             KVL V  S +G+  VDLSLR ++   +NQ+    DD   +  R + I DL P   V+GYV
Sbjct  1074  KVLDVSRSSEGSVRVDLSLRSSMCANSNQSRRLFDDSRIRTSRFEKINDLCPGTEVKGYV  1133

Query  1774  KNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVT  1595
             K+V  KGCFIM+SR ++A+I+LSNL+D ++E+P+ +FPVG LV G+V+S E  S +VEV+
Sbjct  1134  KSVNSKGCFIMVSRTIEARIILSNLSDEYVENPQNDFPVGLLVHGRVLSSEPQSGKVEVS  1193

Query  1594  LRTSSSATPRKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDH  1415
             LR ++ +  +KSD  + ++   G+II+G++KR+ESFGLF+++  + LV LCHVSELSD+ 
Sbjct  1194  LRKNTGSKSQKSDDISYSDLHVGDIIAGQVKRVESFGLFVTIQGSELVALCHVSELSDEP  1253

Query  1414  IDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSYF--------RDDDGEDI--QTTSR  1265
             + ++ S +KAG  V+ K+LK+D++RHR+S+GMK SY          DD+ ++I  +  SR
Sbjct  1254  VLDIHSCHKAGDKVKAKILKIDEERHRVSIGMKKSYIGPDSTGDTSDDEDDEIVPEEISR  1313

Query  1264  QSINSTDKGNSVFIGTQSTVFPESSDADIDVSVVNTTDNILTEVESRASIPPLEVPLDDI  1085
               +   D+ +++                           +L + ESRAS+ PL+V LD+ 
Sbjct  1314  NPVMGRDRNHAL---------------------------VLPKPESRASVLPLQVSLDES  1346

Query  1084  ENSDIDDAVNKNPDHTGGADTTDekdkkramkkakkerereiraaeerlleKDIPRNTDE  905
             E SD ++  NK  +   G +  D+K  KR  +KA+K+RE EI A EER L++DIP+  DE
Sbjct  1347  EGSDQEND-NKGQEIANGTEVDDKKSNKRLKEKARKQRELEISALEERALQRDIPQTPDE  1405

Query  904   FEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNL  725
             FEKLVRSSPNSSFVWI YMAF+L L DV+KAR++AE+A+ TINIREE EKLNVWVAYFNL
Sbjct  1406  FEKLVRSSPNSSFVWINYMAFLLDLADVDKARAVAERALRTINIREEEEKLNVWVAYFNL  1465

Query  724   EIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSC  545
             E EYG+P ++AV K+FQRALQYCDPKKVHLALL +YERTE Y L DELL++M K+FK SC
Sbjct  1466  ENEYGSPREDAVKKIFQRALQYCDPKKVHLALLAMYERTEQYTLADELLDRMTKRFKTSC  1525

Query  544   KIWLRRIQWALKQNQDNS--QSIVNRALLCLPKHKHIKFITQTAILEFKCGVADRGRSMF  371
             KIWLR IQ +LKQ++D    + IV RALL LP+ K  KF++QTAILEFKCGV + GRS F
Sbjct  1526  KIWLRCIQLSLKQSKDVECIKLIVKRALLSLPQSKRRKFLSQTAILEFKCGVPEEGRSRF  1585

Query  370   ERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEKS  191
             E +L+EYPKRTDLWSVYLDQEIR+GD ++IRALFER   LS+PPKKMKFLFKKYL YEKS
Sbjct  1586  ELILREYPKRTDLWSVYLDQEIRLGDTEIIRALFERVTCLSLPPKKMKFLFKKYLEYEKS  1645

Query  190   VGDEERIESVKRKAMEYVES  131
              GDEERIE VK+KA+EYV+S
Sbjct  1646  QGDEERIEHVKQKALEYVQS  1665


 Score = 69.7 bits (169),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 59/219 (27%), Positives = 105/219 (48%), Gaps = 34/219 (16%)
 Frame = -2

Query  5476  MKLWGVIAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEM--------------  5339
             MKLWGV+ EVN+KDIVVSLPGG+RG V + E HD +   ET ++                
Sbjct  1     MKLWGVVIEVNQKDIVVSLPGGMRGFVRSEEVHD-ITSQETRKVLTAQVKSIEDHGYILH  59

Query  5338  -----------QSNYLSGLFHVGQLVSCIVLHLDDDKK--EAGKWKIWLSLRLALLHKNL  5198
                        +++  S     GQL+ C+V  +D  ++       +  LS  +    K L
Sbjct  60    FGVSSFSGFMPKADRESAKIESGQLIQCVVKAIDKAREIVHLSSDEDLLSKSIIKDLKGL  119

Query  5197  TLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDKMNTGQLVEGVVKSVD  5018
             ++D +  G++++A + S  ++G +L F L  F+G   I + S +   +G   +  +K+  
Sbjct  120   SIDHLIPGMMVNARVHSVLENGVMLSF-LTYFTGTADIFNLS-NSFPSGSWKDDYIKNKK  177

Query  5017  RTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNA  4901
                +++++  +  A+   + + L    + L VP + V A
Sbjct  178   VNARILFVDPSTRAVGLTLNQQL----LRLKVPSINVKA  212



>gb|KDO70799.1| hypothetical protein CISIN_1g0001731mg, partial [Citrus sinensis]
Length=1238

 Score =  1630 bits (4222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 831/1235 (67%), Positives = 1010/1235 (82%), Gaps = 25/1235 (2%)
 Frame = -2

Query  5497  PKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSG  5318
             P+NIS GMKLWGV+AEVNEKD+V+ LPGGLRGL  A++A DP+ DNE    E   N L  
Sbjct  3     PQNISAGMKLWGVVAEVNEKDLVICLPGGLRGLARAADALDPILDNEIEANE--DNLLPT  60

Query  5317  LFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTED  5138
             +FHVGQLVSCIVL LDDDKKE GK KIWLSLRL+LL+K L+L+ +QEG++L+AY+KS ED
Sbjct  61    IFHVGQLVSCIVLQLDDDKKEIGKRKIWLSLRLSLLYKGLSLETVQEGMVLTAYVKSIED  120

Query  5137  HGYILHFGLPSFSGFLP---IHSQSVDKMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAK  4967
             HGYILHFGLPSF+GFLP   +   S   +  G L++GVV+S+DRTRKVVYLSS PD ++K
Sbjct  121   HGYILHFGLPSFTGFLPRNNLAENSGIDVKPGLLLQGVVRSIDRTRKVVYLSSDPDTVSK  180

Query  4966  YVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKD  4787
              VTKDLKGISIDLLVPGMMV+  V S+LENGVMLSFLTYFTGTVDIFHLQ  FP  +WK+
Sbjct  181   CVTKDLKGISIDLLVPGMMVSTRVQSILENGVMLSFLTYFTGTVDIFHLQNTFPTTNWKN  240

Query  4786  DYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGL  4607
             DY Q+KKVNARILF+DP +RAVGL+LNP+L+H +APPS VKVGDI++Q+KV+RVD+GLGL
Sbjct  241   DYNQHKKVNARILFVDPTSRAVGLTLNPYLLHNRAPPSHVKVGDIYDQSKVVRVDRGLGL  300

Query  4606  LLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSA  4427
             LL+IPS+PV TPAYV ISDV ++EV+K+EK +K G  VRVR+LGFR+LEGLATG LK SA
Sbjct  301   LLDIPSTPVSTPAYVTISDVAEEEVRKLEKKYKEGSCVRVRILGFRHLEGLATGILKASA  360

Query  4426  FEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQV  4247
             FEG VFTHSDVKPGMVVK KVI VDSFGAIVQF  GVKALCPL HMSEFEIVKP KKF+V
Sbjct  361   FEGLVFTHSDVKPGMVVKGKVIAVDSFGAIVQFPGGVKALCPLPHMSEFEIVKPGKKFKV  420

Query  4246  GSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRF  4067
             G+ELVFRVLG KSKRITVTHKKTLVKSKL ILSSY +AT+ LITHGWITKIEKHGCFVRF
Sbjct  421   GAELVFRVLGVKSKRITVTHKKTLVKSKLAILSSYAEATDRLITHGWITKIEKHGCFVRF  480

Query  4066  YNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETE  3887
             YNGVQGFAPRSELGLDPG + SSMYHV QVVKCR++SS PASR+I LSF  +P R+SE +
Sbjct  481   YNGVQGFAPRSELGLDPGCEPSSMYHVGQVVKCRIMSSIPASRRINLSFMMKPTRVSEDD  540

Query  3886  MVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEF  3707
             +VK G++VSG+V++VTP+++VV V   + + KGT+ T+HL+DH   A +MKSV+KPGYEF
Sbjct  541   LVKLGSLVSGVVDVVTPNAVVVYV-IAKGYSKGTIPTEHLADHLEHATVMKSVIKPGYEF  599

Query  3706  DQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGR  3527
             DQLLVLD E  NL+LSAKYSLI++AQQLP D + I P+SVVHGYVCN+I  G FVRFLGR
Sbjct  600   DQLLVLDNESSNLLLSAKYSLINSAQQLPSDASHIHPNSVVHGYVCNIIETGCFVRFLGR  659

Query  3526  LTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQ  3347
             LTGF+PRSKA D +R D S+ +Y+GQSV +NILDVN ETGRIT+SLKQS CSSTDA+F+Q
Sbjct  660   LTGFAPRSKAVDGQRADLSKTYYVGQSVRSNILDVNSETGRITLSLKQSCCSSTDASFMQ  719

Query  3346  EYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFI  3167
             E+FLLE KIA LQS     S L WV+GF +GS++EGKVHE  +FGVVV+FE++ DV+GFI
Sbjct  720   EHFLLEEKIAMLQSSKHNGSELKWVEGFIIGSVIEGKVHESNDFGVVVSFEEHSDVYGFI  779

Query  3166  SGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREA  2987
             +  QL G  VE+GS IQAA++DV+K E LVDLSLK  F++  +   +N + QKKKRKREA
Sbjct  780   THHQLAGATVESGSVIQAAILDVAKAERLVDLSLKTVFIDRFREANSNRQAQKKKRKREA  839

Query  2986  QKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIAT  2807
              KDL V+Q+VNA+VEIVKENYLVLS+P  N+++GYAS++D+NTQ  P KQF+NGQSVIAT
Sbjct  840   SKDLGVHQTVNAIVEIVKENYLVLSLPEYNHSIGYASVSDYNTQKFPQKQFLNGQSVIAT  899

Query  2806  IMALPDSSTGGRLLLLLKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKF  2627
             +MALP SST GRLLLLLKAISE  E+SSSKR KK SSYDVGSLVQAEIT+IKPLELRLKF
Sbjct  900   VMALPSSSTAGRLLLLLKAISE-TETSSSKRAKKKSSYDVGSLVQAEITEIKPLELRLKF  958

Query  2626  GSGFHGRVHITEATDD--NTTEGPLNDFRIGQTLTARIVSKDSRSENKRGYQWELSTKPS  2453
             G GFHGR+HITE  DD  N  E   ++F+IGQT+TARI++K ++ + K+ + WELS KPS
Sbjct  959   GIGFHGRIHITEVNDDKSNVVENLFSNFKIGQTVTARIIAKSNKPDMKKSFLWELSIKPS  1018

Query  2452  VLAGDMDGPH---ESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSEL  2282
             +L     G     E  + S GQ ++GYV+KVD+EWA LTISR ++AQL+ILDS+ EPSEL
Sbjct  1019  MLTVSEIGSKLLFEECDVSIGQRVTGYVYKVDNEWALLTISRHLKAQLFILDSAYEPSEL  1078

Query  2281  KEFQKRFYVGKSVSGYILSANKEKKLLRLV--PHTLLITPEDTVPSSESARCHIREGSVL  2108
             +EFQ+RF++GK+V+G++LS NKEKKLLRLV  P    I+ +    S+++ +  I EG ++
Sbjct  1079  QEFQRRFHIGKAVTGHVLSINKEKKLLRLVLRPFQDGISDKTVDISNDNMQTFIHEGDIV  1138

Query  2107  GGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVS-----------DPLSGYCEGQFV  1961
             GGRISKIL GVGGL+VQI  HL+G+VHFTEL++  VS           DPLSGY EGQFV
Sbjct  1139  GGRISKILSGVGGLVVQIGPHLYGRVHFTELKNICVSDPLSGYDEGQFDPLSGYDEGQFV  1198

Query  1960  KCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISE  1856
             KCKVL++  +V+GT HV+LSLR +LD M++ N S+
Sbjct  1199  KCKVLEISRTVRGTFHVELSLRSSLDGMSSTNSSD  1233


 Score = 56.6 bits (135),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 81/315 (26%), Positives = 142/315 (45%), Gaps = 33/315 (10%)
 Frame = -2

Query  2272  QKRFYVGKSVSGYILSANKEKKLLRLVPHTLLITPEDTVPSSESARCHIRE-GSVLGGRI  2096
             QK+F  G+SV   +++        RL+     I+  +T  S  + +    + GS++   I
Sbjct  887   QKQFLNGQSVIATVMALPSSSTAGRLLLLLKAISETETSSSKRAKKKSSYDVGSLVQAEI  946

Query  2095  SKILPGVGGLLVQIDAHLFGKVHFTELRDP---WVSDPLSGYCEGQFVKCKVLQVGHS--  1931
             ++I P    L   I  H  G++H TE+ D     V +  S +  GQ V  +++   +   
Sbjct  947   TEIKPLELRLKFGIGFH--GRIHITEVNDDKSNVVENLFSNFKIGQTVTARIIAKSNKPD  1004

Query  1930  VKGTTHVDLSLR---WTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTP  1760
             +K +   +LS++    T+  + ++ + E  DV    R             V GYV  V  
Sbjct  1005  MKKSFLWELSIKPSMLTVSEIGSKLLFEECDVSIGQR-------------VTGYVYKVDN  1051

Query  1759  KGCFIMLSRKVDAK--ILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRT  1586
             +   + +SR + A+  IL S      ++  ++ F +GK VTG V+S+    K + + LR 
Sbjct  1052  EWALLTISRHLKAQLFILDSAYEPSELQEFQRRFHIGKAVTGHVLSINKEKKLLRLVLRP  1111

Query  1585  SSSATPRKS-DI--DALNNF-SAGNIISGKIKRIES--FGLFISVDNTNLVGLCHVSELS  1424
                    K+ DI  D +  F   G+I+ G+I +I S   GL + +   +L G  H +EL 
Sbjct  1112  FQDGISDKTVDISNDNMQTFIHEGDIVGGRISKILSGVGGLVVQI-GPHLYGRVHFTELK  1170

Query  1423  DDHIDNVQSRYKAGQ  1379
             +  + +  S Y  GQ
Sbjct  1171  NICVSDPLSGYDEGQ  1185



>gb|KDO70800.1| hypothetical protein CISIN_1g0001731mg, partial [Citrus sinensis]
Length=1229

 Score =  1620 bits (4194),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 826/1228 (67%), Positives = 1004/1228 (82%), Gaps = 25/1228 (2%)
 Frame = -2

Query  5476  MKLWGVIAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQL  5297
             MKLWGV+AEVNEKD+V+ LPGGLRGL  A++A DP+ DNE    E   N L  +FHVGQL
Sbjct  1     MKLWGVVAEVNEKDLVICLPGGLRGLARAADALDPILDNEIEANE--DNLLPTIFHVGQL  58

Query  5296  VSCIVLHLDDDKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHF  5117
             VSCIVL LDDDKKE GK KIWLSLRL+LL+K L+L+ +QEG++L+AY+KS EDHGYILHF
Sbjct  59    VSCIVLQLDDDKKEIGKRKIWLSLRLSLLYKGLSLETVQEGMVLTAYVKSIEDHGYILHF  118

Query  5116  GLPSFSGFLP---IHSQSVDKMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLK  4946
             GLPSF+GFLP   +   S   +  G L++GVV+S+DRTRKVVYLSS PD ++K VTKDLK
Sbjct  119   GLPSFTGFLPRNNLAENSGIDVKPGLLLQGVVRSIDRTRKVVYLSSDPDTVSKCVTKDLK  178

Query  4945  GISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKK  4766
             GISIDLLVPGMMV+  V S+LENGVMLSFLTYFTGTVDIFHLQ  FP  +WK+DY Q+KK
Sbjct  179   GISIDLLVPGMMVSTRVQSILENGVMLSFLTYFTGTVDIFHLQNTFPTTNWKNDYNQHKK  238

Query  4765  VNARILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSS  4586
             VNARILF+DP +RAVGL+LNP+L+H +APPS VKVGDI++Q+KV+RVD+GLGLLL+IPS+
Sbjct  239   VNARILFVDPTSRAVGLTLNPYLLHNRAPPSHVKVGDIYDQSKVVRVDRGLGLLLDIPST  298

Query  4585  PVPTPAYVYISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFT  4406
             PV TPAYV ISDV ++EV+K+EK +K G  VRVR+LGFR+LEGLATG LK SAFEG VFT
Sbjct  299   PVSTPAYVTISDVAEEEVRKLEKKYKEGSCVRVRILGFRHLEGLATGILKASAFEGLVFT  358

Query  4405  HSDVKPGMVVKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFR  4226
             HSDVKPGMVVK KVI VDSFGAIVQF  GVKALCPL HMSEFEIVKP KKF+VG+ELVFR
Sbjct  359   HSDVKPGMVVKGKVIAVDSFGAIVQFPGGVKALCPLPHMSEFEIVKPGKKFKVGAELVFR  418

Query  4225  VLGCKSKRITVTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGF  4046
             VLG KSKRITVTHKKTLVKSKL ILSSY +AT+ LITHGWITKIEKHGCFVRFYNGVQGF
Sbjct  419   VLGVKSKRITVTHKKTLVKSKLAILSSYAEATDRLITHGWITKIEKHGCFVRFYNGVQGF  478

Query  4045  APRSELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTV  3866
             APRSELGLDPG + SSMYHV QVVKCR++SS PASR+I LSF  +P R+SE ++VK G++
Sbjct  479   APRSELGLDPGCEPSSMYHVGQVVKCRIMSSIPASRRINLSFMMKPTRVSEDDLVKLGSL  538

Query  3865  VSGIVELVTPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLD  3686
             VSG+V++VTP+++VV V   + + KGT+ T+HL+DH   A +MKSV+KPGYEFDQLLVLD
Sbjct  539   VSGVVDVVTPNAVVVYV-IAKGYSKGTIPTEHLADHLEHATVMKSVIKPGYEFDQLLVLD  597

Query  3685  IEGFNLVLSAKYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPR  3506
              E  NL+LSAKYSLI++AQQLP D + I P+SVVHGYVCN+I  G FVRFLGRLTGF+PR
Sbjct  598   NESSNLLLSAKYSLINSAQQLPSDASHIHPNSVVHGYVCNIIETGCFVRFLGRLTGFAPR  657

Query  3505  SKATDDRRYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEH  3326
             SKA D +R D S+ +Y+GQSV +NILDVN ETGRIT+SLKQS CSSTDA+F+QE+FLLE 
Sbjct  658   SKAVDGQRADLSKTYYVGQSVRSNILDVNSETGRITLSLKQSCCSSTDASFMQEHFLLEE  717

Query  3325  KIAKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGG  3146
             KIA LQS     S L WV+GF +GS++EGKVHE  +FGVVV+FE++ DV+GFI+  QL G
Sbjct  718   KIAMLQSSKHNGSELKWVEGFIIGSVIEGKVHESNDFGVVVSFEEHSDVYGFITHHQLAG  777

Query  3145  INVETGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVN  2966
               VE+GS IQAA++DV+K E LVDLSLK  F++  +   +N + QKKKRKREA KDL V+
Sbjct  778   ATVESGSVIQAAILDVAKAERLVDLSLKTVFIDRFREANSNRQAQKKKRKREASKDLGVH  837

Query  2965  QSVNAVVEIVKENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDS  2786
             Q+VNA+VEIVKENYLVLS+P  N+++GYAS++D+NTQ  P KQF+NGQSVIAT+MALP S
Sbjct  838   QTVNAIVEIVKENYLVLSLPEYNHSIGYASVSDYNTQKFPQKQFLNGQSVIATVMALPSS  897

Query  2785  STGGRLLLLLKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGR  2606
             ST GRLLLLLKAISE  E+SSSKR KK SSYDVGSLVQAEIT+IKPLELRLKFG GFHGR
Sbjct  898   STAGRLLLLLKAISE-TETSSSKRAKKKSSYDVGSLVQAEITEIKPLELRLKFGIGFHGR  956

Query  2605  VHITEATDD--NTTEGPLNDFRIGQTLTARIVSKDSRSENKRGYQWELSTKPSVLAGDMD  2432
             +HITE  DD  N  E   ++F+IGQT+TARI++K ++ + K+ + WELS KPS+L     
Sbjct  957   IHITEVNDDKSNVVENLFSNFKIGQTVTARIIAKSNKPDMKKSFLWELSIKPSMLTVSEI  1016

Query  2431  GPH---ESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRF  2261
             G     E  + S GQ ++GYV+KVD+EWA LTISR ++AQL+ILDS+ EPSEL+EFQ+RF
Sbjct  1017  GSKLLFEECDVSIGQRVTGYVYKVDNEWALLTISRHLKAQLFILDSAYEPSELQEFQRRF  1076

Query  2260  YVGKSVSGYILSANKEKKLLRLV--PHTLLITPEDTVPSSESARCHIREGSVLGGRISKI  2087
             ++GK+V+G++LS NKEKKLLRLV  P    I+ +    S+++ +  I EG ++GGRISKI
Sbjct  1077  HIGKAVTGHVLSINKEKKLLRLVLRPFQDGISDKTVDISNDNMQTFIHEGDIVGGRISKI  1136

Query  2086  LPGVGGLLVQIDAHLFGKVHFTELRDPWVS-----------DPLSGYCEGQFVKCKVLQV  1940
             L GVGGL+VQI  HL+G+VHFTEL++  VS           DPLSGY EGQFVKCKVL++
Sbjct  1137  LSGVGGLVVQIGPHLYGRVHFTELKNICVSDPLSGYDEGQFDPLSGYDEGQFVKCKVLEI  1196

Query  1939  GHSVKGTTHVDLSLRWTLDTMNNQNISE  1856
               +V+GT HV+LSLR +LD M++ N S+
Sbjct  1197  SRTVRGTFHVELSLRSSLDGMSSTNSSD  1224


 Score = 57.0 bits (136),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 81/315 (26%), Positives = 142/315 (45%), Gaps = 33/315 (10%)
 Frame = -2

Query  2272  QKRFYVGKSVSGYILSANKEKKLLRLVPHTLLITPEDTVPSSESARCHIRE-GSVLGGRI  2096
             QK+F  G+SV   +++        RL+     I+  +T  S  + +    + GS++   I
Sbjct  878   QKQFLNGQSVIATVMALPSSSTAGRLLLLLKAISETETSSSKRAKKKSSYDVGSLVQAEI  937

Query  2095  SKILPGVGGLLVQIDAHLFGKVHFTELRDP---WVSDPLSGYCEGQFVKCKVLQVGHS--  1931
             ++I P    L   I  H  G++H TE+ D     V +  S +  GQ V  +++   +   
Sbjct  938   TEIKPLELRLKFGIGFH--GRIHITEVNDDKSNVVENLFSNFKIGQTVTARIIAKSNKPD  995

Query  1930  VKGTTHVDLSLR---WTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTP  1760
             +K +   +LS++    T+  + ++ + E  DV    R             V GYV  V  
Sbjct  996   MKKSFLWELSIKPSMLTVSEIGSKLLFEECDVSIGQR-------------VTGYVYKVDN  1042

Query  1759  KGCFIMLSRKVDAK--ILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRT  1586
             +   + +SR + A+  IL S      ++  ++ F +GK VTG V+S+    K + + LR 
Sbjct  1043  EWALLTISRHLKAQLFILDSAYEPSELQEFQRRFHIGKAVTGHVLSINKEKKLLRLVLRP  1102

Query  1585  SSSATPRKS-DI--DALNNF-SAGNIISGKIKRIES--FGLFISVDNTNLVGLCHVSELS  1424
                    K+ DI  D +  F   G+I+ G+I +I S   GL + +   +L G  H +EL 
Sbjct  1103  FQDGISDKTVDISNDNMQTFIHEGDIVGGRISKILSGVGGLVVQI-GPHLYGRVHFTELK  1161

Query  1423  DDHIDNVQSRYKAGQ  1379
             +  + +  S Y  GQ
Sbjct  1162  NICVSDPLSGYDEGQ  1176



>ref|XP_002531584.1| programmed cell death protein, putative [Ricinus communis]
 gb|EEF30787.1| programmed cell death protein, putative [Ricinus communis]
Length=1330

 Score =  1537 bits (3979),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 816/1349 (60%), Positives = 1018/1349 (75%), Gaps = 79/1349 (6%)
 Frame = -2

Query  4039  RSELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVS  3860
             RSELG++PG+D SSMYHV QVVKCRV+SS PASR+I LSFT +P R+ + E +K G+VV+
Sbjct  12    RSELGIEPGNDASSMYHVGQVVKCRVLSSLPASRRINLSFTMKPTRVPKEEALKLGSVVA  71

Query  3859  GIVELVTPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIE  3680
             G+VE VT ++++V VN+ + + +G +ST+HL+D    A L KSVLKPGYEFDQLLVLDIE
Sbjct  72    GVVEKVTSNAVIVYVNS-KGYTRGIISTEHLADRHEQAALFKSVLKPGYEFDQLLVLDIE  130

Query  3679  GFNLVLSAKYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSK  3500
               NLVLSAKYSL+++A QLP D+ +I P S+VHGY+CN+I  G FVRFLGRLTGFSP+SK
Sbjct  131   NNNLVLSAKYSLVNSAHQLPSDLTEIHPQSIVHGYICNLIDTGCFVRFLGRLTGFSPKSK  190

Query  3499  ATDDRRYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKI  3320
             A D+++   SE FYIGQSV +NI+DV+ ET RITVSLKQS CSSTDA+F+QEYFL+E K+
Sbjct  191   AMDNQKAQLSEAFYIGQSVRSNIIDVSSETNRITVSLKQSSCSSTDASFLQEYFLVEEKV  250

Query  3319  AKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGIN  3140
             A+LQS DS    L WV+GF +G++VE KV E KE G+VV+F+KY+DV GFI+  QLGG  
Sbjct  251   AELQSSDSKGPDLKWVEGFNIGTVVEAKVEESKEVGIVVSFDKYNDVLGFITHYQLGGTT  310

Query  3139  VETGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQS  2960
             VETGSTI+AAV+DV+K EHLVDLSLKPEF++    + +N +T KKKRKRE  K+LEV QS
Sbjct  311   VETGSTIRAAVLDVAKTEHLVDLSLKPEFLDKCTDEKSNSQTHKKKRKREVLKNLEVYQS  370

Query  2959  VNAVVEIVKENYL----------------------------VLSVPACNYALGYASLNDF  2864
             V AVVEIVKENY+                            VLS+P  NY +GYAS++D+
Sbjct  371   VTAVVEIVKENYMASALFFPLDDRCCTNSNVSSCSSVPLKQVLSIPEHNYIIGYASVSDY  430

Query  2863  NTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkknsSYDVG  2684
             N Q LP KQF+NGQSV+AT+MALP SST GRLLLLLK+ISE+ E+SS+K+ KK SSY +G
Sbjct  431   NIQKLPQKQFLNGQSVVATVMALPSSSTAGRLLLLLKSISEITETSSTKKAKKKSSYKIG  490

Query  2683  SLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARIVSKDS  2504
             SLVQAE+ D                         D   E P   F+IGQT+TARIV+K S
Sbjct  491   SLVQAEVND-------------------------DCFLEDPFTSFKIGQTVTARIVAKTS  525

Query  2503  RSENKRGYQWELSTKPSVLAGDMDGP----HESFNYSTGQLLSGYVFKVDSEWAWLTISR  2336
             +++  +   WELS KP VL    +       + F +S+G  ++GYV+KVDSEWAWLTISR
Sbjct  526   KAD--KNQLWELSIKPKVLTDFWESEDKLMSKEFEFSSGHRITGYVYKVDSEWAWLTISR  583

Query  2335  EVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTLL-------  2177
              ++AQL+ILDS+ EPSEL+EFQKRF+VGK+VSGY+LS NKEK LLRLV   L        
Sbjct  584   HLKAQLFILDSACEPSELQEFQKRFFVGKAVSGYVLSYNKEKTLLRLVQRPLCAVSCIHV  643

Query  2176  ----ITPEDTVPS--SESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTEL  2015
                 +   D       ++A  +I+EG ++GG+ISKIL GVGG+LVQI  H+ GKVH+TEL
Sbjct  644   NGEALNKNDAQNEVRRDNAAAYIQEGDIVGGKISKILSGVGGVLVQIGPHVHGKVHYTEL  703

Query  2014  RDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISEHDDVHSQ  1835
             ++ WV +PL GY EGQFVKCKVL++  S KGTTH+DLSLR++LD M +QN SE     + 
Sbjct  704   QESWVPNPLDGYREGQFVKCKVLEISRSDKGTTHIDLSLRFSLDGMLSQNSSELS--KNA  761

Query  1834  NRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVG  1655
             ++RV+ I DL P+  VQGYVKNV PKGCFI LSRK+DAKILLSNL+D F+ SPE+EFP+G
Sbjct  762   DQRVEKIDDLQPNTVVQGYVKNVAPKGCFIFLSRKIDAKILLSNLSDEFVVSPEEEFPIG  821

Query  1654  KLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGKIKRIESFGLFI  1475
             KLVTG+V+SVE LSKRVEVTL+ ++ +T  KS+++ L+  + G+  SG+IKR+E +GLFI
Sbjct  822   KLVTGRVLSVEPLSKRVEVTLKKNAKSTG-KSELNDLSRLNVGDTASGRIKRVEPYGLFI  880

Query  1474  SVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSYFRDD  1295
             ++D+TNLVGLCHVSELSDDH+D+V+++Y+AG+ V  ++LKVD +R RISLG+KN    + 
Sbjct  881   AIDHTNLVGLCHVSELSDDHVDSVETKYRAGEKVTARILKVDVERRRISLGIKN--LDNG  938

Query  1294  DGEDIQTTSRQSINSTDKGNSVFIGTQSTVFPESSDAD-IDVSVVNTTDNILTEVESRAS  1118
             +  DI  +  +S ++  +  +   G     +  S   + +D+   N    +L   ESRAS
Sbjct  939   NDTDILPSQEESSDAISENGTTDDGDSKPHYSSSPAIEGMDIESENEEHAVLAHAESRAS  998

Query  1117  IPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkramkkakkerereiraaeerl  938
             IPPL V LDD+E+SD+DD +++  +        DEKD ++A KK K+ERE+EIRAAEERL
Sbjct  999   IPPLNVTLDDVEHSDVDDTISQTQEQIDKTKIADEKDTRQAKKKVKEEREQEIRAAEERL  1058

Query  937   leKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESE  758
             LEKDIPR  DEFEKLV  SPN+SFVWIKYMAFML L D+EKARSIAE+A+ TIN REE+E
Sbjct  1059  LEKDIPRTADEFEKLVHGSPNNSFVWIKYMAFMLDLADIEKARSIAERALRTINFREENE  1118

Query  757   KLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELL  578
             KLNVWVAYFNLE EYGNPP+EAV  VFQRALQYCDPKKVHLALLGVYERTE +KL DELL
Sbjct  1119  KLNVWVAYFNLENEYGNPPEEAVKNVFQRALQYCDPKKVHLALLGVYERTEQHKLADELL  1178

Query  577   EKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLCLPKHKHIKFITQTAILEFKCG  398
             ++MVKKFK SCKIWLRR+Q  LKQ QD  QS V RALL LP+HKHIKFI+Q AILEFKCG
Sbjct  1179  DRMVKKFKISCKIWLRRVQRHLKQEQDGVQSTVKRALLSLPRHKHIKFISQAAILEFKCG  1238

Query  397   VADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLF  218
             V DRGRSMFE +L+EYPKRTDLWSVYLDQEIR+GD+DV R LFERA SLS+P KKM+FLF
Sbjct  1239  VPDRGRSMFEGILREYPKRTDLWSVYLDQEIRLGDVDVTRTLFERATSLSLPAKKMQFLF  1298

Query  217   KKYLAYEKSVGDEERIESVKRKAMEYVES  131
             KKYL YEKSVGDEE+IESVK+KAMEYVES
Sbjct  1299  KKYLEYEKSVGDEEQIESVKKKAMEYVES  1327


 Score = 57.0 bits (136),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 59/259 (23%), Positives = 112/259 (43%), Gaps = 18/259 (7%)
 Frame = -2

Query  4573  PAYVYISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDV  4394
             P  +Y S++  +        +  G+VV+ RVL   +L      +L  +     V     +
Sbjct  7     PKSLYRSELGIEPGNDASSMYHVGQVVKCRVLS--SLPASRRINLSFTMKPTRVPKEEAL  64

Query  4393  KPGMVVKAKVITVDSFGAIVQFSSG--VKALCPLRHMSEFE--------IVKPRKKFQVG  4244
             K G VV   V  V S   IV  +S    + +    H+++          ++KP  +F   
Sbjct  65    KLGSVVAGVVEKVTSNAVIVYVNSKGYTRGIISTEHLADRHEQAALFKSVLKPGYEFDQ-  123

Query  4243  SELVFRVLGCKSKRITVTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFY  4064
                   VL  ++  + ++ K +LV S   + S  T+     I HG+I  +   GCFVRF 
Sbjct  124   ----LLVLDIENNNLVLSAKYSLVNSAHQLPSDLTEIHPQSIVHGYICNLIDTGCFVRFL  179

Query  4063  NGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEM  3884
               + GF+P+S+   +  + +S  +++ Q V+  ++  S  + +I +S        ++   
Sbjct  180   GRLTGFSPKSKAMDNQKAQLSEAFYIGQSVRSNIIDVSSETNRITVSLKQSSCSSTDASF  239

Query  3883  VKPGTVV-SGIVELVTPDS  3830
             ++   +V   + EL + DS
Sbjct  240   LQEYFLVEEKVAELQSSDS  258



>gb|AAG51058.1|AC069473_20 rRNA biogenesis protein, putative, 3' partial; 75505-85642 [Arabidopsis 
thaliana]
Length=1396

 Score =  1518 bits (3929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 803/1394 (58%), Positives = 1026/1394 (74%), Gaps = 60/1394 (4%)
 Frame = -2

Query  5749  KSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhklykKNQSV  5570
             ++  LQLED VPDFPRGG + LSK+E +++  EVDAEF+A++R  KK K  K  K+  S 
Sbjct  39    EAMALQLED-VPDFPRGGGTSLSKKEREKLYEEVDAEFDADERVSKKSKGGKSKKRIPSD  97

Query  5569  EDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLA  5390
              DDLG LFG  + GK P+ AN+IT KNISPGMKL GV+ EVN+KDIV+SLPGGLRGLV A
Sbjct  98    LDDLGLLFGGGLHGKRPRYANKITTKNISPGMKLLGVVTEVNQKDIVISLPGGLRGLVRA  157

Query  5389  SEAHDPLWDN--ETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLA  5216
             SE  D   D   E +E E+    L  +F VGQLV CIVL LDDDKKEAGK KIWLSLRL+
Sbjct  158   SEVSD-FTDRGIEDDENEL----LGDIFSVGQLVPCIVLELDDDKKEAGKRKIWLSLRLS  212

Query  5215  LLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDK--MNTGQLV  5042
             LLHK  + D+ Q G++ SA +KS EDHG ILHFGLPS +GF+ I      +  M TGQL+
Sbjct  213   LLHKGFSFDSFQLGMVFSANVKSIEDHGSILHFGLPSITGFIEISDDGNQESGMKTGQLI  272

Query  5041  EGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLS  4862
             +GVV  +DR RK+V+LSS PD++AK +TKDL G+S DLL+PGMMVNA V SVLENG++  
Sbjct  273   QGVVTKIDRDRKIVHLSSDPDSVAKCLTKDLSGMSFDLLIPGMMVNARVQSVLENGILFD  332

Query  4861  FLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKA  4682
             FLTYF GTVD+FHL+      SWKD+Y QNK VNARILFIDP++RAVGL+L+PH+V  KA
Sbjct  333   FLTYFNGTVDLFHLKNPLSNKSWKDEYNQNKTVNARILFIDPSSRAVGLTLSPHVVCNKA  392

Query  4681  PPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPG  4502
             PP  V  GDIF++AKV+R+DK  GLLLE+PS P PTPAYV   D    EV K+EK FK G
Sbjct  393   PPLHVFSGDIFDEAKVVRIDKS-GLLLELPSKPTPTPAYVSTYDAAGDEVTKLEKKFKEG  451

Query  4501  KVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSS  4322
               +RVRVLG + +EGLA G+LK SAFEG VFTHSDVKPGMV KAKVI+VD+FGAIVQFS 
Sbjct  452   NHIRVRVLGLKQMEGLAVGTLKESAFEGPVFTHSDVKPGMVTKAKVISVDTFGAIVQFSG  511

Query  4321  GVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSY  4142
             G+KA+CPLRHMSEFE+ KPRKKF+VG+ELVFRVLGCKSKRITVT+KKTLVKSKL ILSSY
Sbjct  512   GLKAMCPLRHMSEFEVTKPRKKFKVGAELVFRVLGCKSKRITVTYKKTLVKSKLPILSSY  571

Query  4141  TDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRV  3962
             TDATEGL+THGWITKIEKHGCFVRFYNGVQGF PR ELGL+PGSD  S++HV +VVKCRV
Sbjct  572   TDATEGLVTHGWITKIEKHGCFVRFYNGVQGFVPRFELGLEPGSDPDSVFHVGEVVKCRV  631

Query  3961  VSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTV  3782
              S+   +++I LSF  +P  +SE + +K G++VSGI++ +T  +++V V + +S +KGT+
Sbjct  632   TSAVHGTQRITLSFMIKPSSVSEDDSIKLGSIVSGIIDTITSQAVIVRVKS-KSVVKGTI  690

Query  3781  STQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQI  3602
             S +HL+DH   A L+ S+L+PGYE D+LLVLDIEG N+ LS+KYSLI  A++LP D NQ+
Sbjct  691   SAEHLADHHEQAKLIMSLLRPGYELDKLLVLDIEGNNMALSSKYSLIKLAEELPSDFNQL  750

Query  3601  SPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDV  3422
              P+SVVHGYVCN+I NG FVRFLGRLTGF+PRSKA DD + D SE F++GQSV  NI+DV
Sbjct  751   QPNSVVHGYVCNLIENGCFVRFLGRLTGFAPRSKAIDDPKADVSESFFVGQSVRANIVDV  810

Query  3421  NGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVE  3242
             N E  RIT+SLKQS C+S DA+F+QEYFL++ KI+ LQS D   S  +WV+ F +GS+++
Sbjct  811   NQEKSRITLSLKQSSCASVDASFVQEYFLMDEKISDLQSSDITKSDCSWVEKFSIGSLIK  870

Query  3241  GKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLK  3062
             G + E  + GVVV F+  ++V GFI    +GG  +  GS + A V+D+S+ E LVDLSL+
Sbjct  871   GTIQEQNDLGVVVNFDNINNVLGFIPQHHMGGATLVPGSVVNAVVLDISRAERLVDLSLR  930

Query  3061  PEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGY  2882
             PE +N    + +N  + KKKRKR   K+LEV+Q V+AVVEIVKE +LVLS+P   Y +GY
Sbjct  931   PELLNNLTKEVSN--SSKKKRKRGISKELEVHQRVSAVVEIVKEQHLVLSIPEHGYTIGY  988

Query  2881  ASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkkn  2702
             AS++D+NTQ LPVKQF  GQSV+A++ A+ +  T GRLLLLL ++S  +E+S SKR KK 
Sbjct  989   ASVSDYNTQKLPVKQFSTGQSVVASVKAVQNPLTSGRLLLLLDSVSGTSETSRSKRAKKK  1048

Query  2701  sSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTAR  2522
             SS +VGS+V AE+ D                          +T++ P   FR+GQ+++AR
Sbjct  1049  SSCEVGSVVHAEVNDA-------------------------STSDEPFAKFRVGQSISAR  1083

Query  2521  IVSKDSRSENKRGYQWELSTKPSVL--AGDMDGPHES--FNYSTGQLLSGYVFKVDSEWA  2354
             +V+K   ++ K+   WELS KP++L  + + +   ES    ++ GQ + GYV+KVD EW 
Sbjct  1084  VVAKPCHTDIKKTQLWELSVKPAMLKDSSEFNDTQESEQLEFAAGQCVIGYVYKVDKEWV  1143

Query  2353  WLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTLLI  2174
             WL +SR V A+++ILD+S +  EL+EF++RF +GK+VSGY+L+ NKEKK LRLV   LL 
Sbjct  1144  WLAVSRNVTARIFILDTSCKAHELEEFERRFPIGKAVSGYVLTYNKEKKTLRLVQRPLLF  1203

Query  2173  --------------TPEDTVPSSESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFG  2036
                            P+ ++P  +     I EG +LGGRISKILPGVGGL VQ+  ++FG
Sbjct  1204  IHKSIANGGGSKTDKPDSSIPGDDDT-LFIHEGDILGGRISKILPGVGGLRVQLGPYVFG  1262

Query  2035  KVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISE  1856
             +VHFTE+ D WV DPL G+ EGQFVKCKVL++  S KGT  ++LSLR +LD M++ +   
Sbjct  1263  RVHFTEINDSWVPDPLDGFREGQFVKCKVLEISSSSKGTWQIELSLRTSLDGMSSADHLS  1322

Query  1855  HDDVHSQN--RRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIE  1682
              D  ++ N  +R + I+DL PDM VQGYVKN   KGCFI+LSR V+AK+ LSNL D F++
Sbjct  1323  EDLKNNDNVCKRFERIEDLSPDMGVQGYVKNTMSKGCFIILSRTVEAKVRLSNLCDTFVK  1382

Query  1681  SPEKEFPVGKLVTG  1640
              PEKEFPVGKLVTG
Sbjct  1383  EPEKEFPVGKLVTG  1396


 Score = 57.4 bits (137),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 87/435 (20%), Positives = 166/435 (38%), Gaps = 56/435 (13%)
 Frame = -2

Query  2686  GSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARIVSKD  2507
             G + +A++  +      ++F  G      +   ++   T+ P   F++G  L  R++   
Sbjct  490   GMVTKAKVISVDTFGAIVQFSGGLKAMCPLRHMSEFEVTK-PRKKFKVGAELVFRVLGCK  548

Query  2506  SRSENKRGYQWELSTKPSVLAGDMDGPHESFNYSTGQLLSGYVFKVDSEWAWLTISREVR  2327
             S+       +  + +K  +L+   D        + G +  G++ K++    ++     V+
Sbjct  549   SKRITVTYKKTLVKSKLPILSSYTDA-------TEGLVTHGWITKIEKHGCFVRFYNGVQ  601

Query  2326  AQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTLLITPEDTVPSS  2147
               +   +   EP    +    F+VG+ V   + SA    + + L   + +I P     SS
Sbjct  602   GFVPRFELGLEPGS--DPDSVFHVGEVVKCRVTSAVHGTQRITL---SFMIKP-----SS  651

Query  2146  ESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQ  1967
              S    I+ GS++ G I  I      + V+  + + G +    L D         + E  
Sbjct  652   VSEDDSIKLGSIVSGIIDTITSQAVIVRVKSKSVVKGTISAEHLAD---------HHEQA  702

Query  1966  FVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTV  1787
              +   +L+ G+       +D  L   ++  N    S++  +        D   L P+  V
Sbjct  703   KLIMSLLRPGY------ELDKLLVLDIEGNNMALSSKYSLIKLAEELPSDFNQLQPNSVV  756

Query  1786  QGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKR  1607
              GYV N+   GCF+    ++      S   D       + F VG+ V   +V V     R
Sbjct  757   HGYVCNLIENGCFVRFLGRLTGFAPRSKAIDDPKADVSESFFVGQSVRANIVDVNQEKSR  816

Query  1606  VEVTLRTSSSATP-----------------------RKSDIDALNNFSAGNIISGKIKRI  1496
             + ++L+ SS A+                         KSD   +  FS G++I G I+  
Sbjct  817   ITLSLKQSSCASVDASFVQEYFLMDEKISDLQSSDITKSDCSWVEKFSIGSLIKGTIQEQ  876

Query  1495  ESFGLFISVDNTNLV  1451
                G+ ++ DN N V
Sbjct  877   NDLGVVVNFDNINNV  891



>gb|KDO70801.1| hypothetical protein CISIN_1g0001731mg [Citrus sinensis]
Length=1152

 Score =  1491 bits (3861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 766/1118 (69%), Positives = 918/1118 (82%), Gaps = 14/1118 (1%)
 Frame = -2

Query  5767  NASFSGKSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAEDR----ylkkkkq  5600
             N +   +   L  +D+VP FPRGG   L++ E DE+ AEVDAEFEA +R      KKKK+
Sbjct  35    NDAVEAQDLALPPDDDVPVFPRGGGHSLTQRERDEIHAEVDAEFEAVERGLHKKNKKKKK  94

Query  5599  hklykKNQSVEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSL  5420
                 K N++V DDLGSLFG  ISGKLP+ AN+IT KNIS GMKLWGV+AEVNEKD+V+ L
Sbjct  95    KTERKANETV-DDLGSLFGDGISGKLPRYANKITLKNISAGMKLWGVVAEVNEKDLVICL  153

Query  5419  PGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWK  5240
             PGGLRGL  A++A DP+ DNE    E   N L  +FHVGQLVSCIVL LDDDKKE GK K
Sbjct  154   PGGLRGLARAADALDPILDNEIEANE--DNLLPTIFHVGQLVSCIVLQLDDDKKEIGKRK  211

Query  5239  IWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLP---IHSQSV  5069
             IWLSLRL+LL+K L+L+ +QEG++L+AY+KS EDHGYILHFGLPSF+GFLP   +   S 
Sbjct  212   IWLSLRLSLLYKGLSLETVQEGMVLTAYVKSIEDHGYILHFGLPSFTGFLPRNNLAENSG  271

Query  5068  DKMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMS  4889
               +  G L++GVV+S+DRTRKVVYLSS PD ++K VTKDLKGISIDLLVPGMMV+  V S
Sbjct  272   IDVKPGLLLQGVVRSIDRTRKVVYLSSDPDTVSKCVTKDLKGISIDLLVPGMMVSTRVQS  331

Query  4888  VLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSL  4709
             +LENGVMLSFLTYFTGTVDIFHLQ  FP  +WK+DY Q+KKVNARILF+DP +RAVGL+L
Sbjct  332   ILENGVMLSFLTYFTGTVDIFHLQNTFPTTNWKNDYNQHKKVNARILFVDPTSRAVGLTL  391

Query  4708  NPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevk  4529
             NP+L+H +APPS VKVGDI++Q+KV+RVD+GLGLLL+IPS+PV TPAYV ISDV ++EV+
Sbjct  392   NPYLLHNRAPPSHVKVGDIYDQSKVVRVDRGLGLLLDIPSTPVSTPAYVTISDVAEEEVR  451

Query  4528  kmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDS  4349
             K+EK +K G  VRVR+LGFR+LEGLATG LK SAFEG VFTHSDVKPGMVVK KVI VDS
Sbjct  452   KLEKKYKEGSCVRVRILGFRHLEGLATGILKASAFEGLVFTHSDVKPGMVVKGKVIAVDS  511

Query  4348  FGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVK  4169
             FGAIVQF  GVKALCPL HMSEFEIVKP KKF+VG+ELVFRVLG KSKRITVTHKKTLVK
Sbjct  512   FGAIVQFPGGVKALCPLPHMSEFEIVKPGKKFKVGAELVFRVLGVKSKRITVTHKKTLVK  571

Query  4168  SKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYH  3989
             SKL ILSSY +AT+ LITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPG + SSMYH
Sbjct  572   SKLAILSSYAEATDRLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGCEPSSMYH  631

Query  3988  VEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNN  3809
             V QVVKCR++SS PASR+I LSF  +P R+SE ++VK G++VSG+V++VTP+++VV V  
Sbjct  632   VGQVVKCRIMSSIPASRRINLSFMMKPTRVSEDDLVKLGSLVSGVVDVVTPNAVVVYV-I  690

Query  3808  GQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQ  3629
              + + KGT+ T+HL+DH   A +MKSV+KPGYEFDQLLVLD E  NL+LSAKYSLI++AQ
Sbjct  691   AKGYSKGTIPTEHLADHLEHATVMKSVIKPGYEFDQLLVLDNESSNLLLSAKYSLINSAQ  750

Query  3628  QLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQ  3449
             QLP D + I P+SVVHGYVCN+I  G FVRFLGRLTGF+PRSKA D +R D S+ +Y+GQ
Sbjct  751   QLPSDASHIHPNSVVHGYVCNIIETGCFVRFLGRLTGFAPRSKAVDGQRADLSKTYYVGQ  810

Query  3448  SVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVD  3269
             SV +NILDVN ETGRIT+SLKQS CSSTDA+F+QE+FLLE KIA LQS     S L WV+
Sbjct  811   SVRSNILDVNSETGRITLSLKQSCCSSTDASFMQEHFLLEEKIAMLQSSKHNGSELKWVE  870

Query  3268  GFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKI  3089
             GF +GS++EGKVHE  +FGVVV+FE++ DV+GFI+  QL G  VE+GS IQAA++DV+K 
Sbjct  871   GFIIGSVIEGKVHESNDFGVVVSFEEHSDVYGFITHHQLAGATVESGSVIQAAILDVAKA  930

Query  3088  EHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSV  2909
             E LVDLSLK  F++  +   +N + QKKKRKREA KDL V+Q+VNA+VEIVKENYLVLS+
Sbjct  931   ERLVDLSLKTVFIDRFREANSNRQAQKKKRKREASKDLGVHQTVNAIVEIVKENYLVLSL  990

Query  2908  PACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEs  2729
             P  N+++GYAS++D+NTQ  P KQF+NGQSVIAT+MALP SST GRLLLLLKAISE  E+
Sbjct  991   PEYNHSIGYASVSDYNTQKFPQKQFLNGQSVIATVMALPSSSTAGRLLLLLKAISE-TET  1049

Query  2728  ssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDD--NTTEGPLN  2555
             SSSKR KK SSYDVGSLVQAEIT+IKPLELRLKFG GFHGR+HITE  DD  N  E   +
Sbjct  1050  SSSKRAKKKSSYDVGSLVQAEITEIKPLELRLKFGIGFHGRIHITEVNDDKSNVVENLFS  1109

Query  2554  DFRIGQTLTARIVSKDSRSENKRGYQWELSTKPSVLAG  2441
             +F+IGQT+TARI++K ++ + K+ + WELS KPS+L G
Sbjct  1110  NFKIGQTVTARIIAKSNKPDMKKSFLWELSIKPSMLTG  1147



>ref|XP_004166831.1| PREDICTED: protein RRP5 homolog, partial [Cucumis sativus]
Length=1323

 Score =  1425 bits (3690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 775/1328 (58%), Positives = 990/1328 (75%), Gaps = 63/1328 (5%)
 Frame = -2

Query  4039  RSELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVS  3860
             R ELG++PGSD SS YH+ QV+KCR+ SS+ +S++I LSF  +P R+SE   V+ G +V+
Sbjct  31    RFELGIEPGSDPSSTYHIGQVIKCRITSSTHSSKRISLSFVMKPARVSEDTKVELGCIVT  90

Query  3859  GIVELVTPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIE  3680
             G+V+ +T   + + +N    + +G +ST+HLSDH+  A  +KSVLKPGY+FDQLLVL IE
Sbjct  91    GVVDEITETHVTLYINR-TDYSRGRISTEHLSDHQAHASSIKSVLKPGYQFDQLLVLAIE  149

Query  3679  GFNLVLSAKYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSK  3500
             G +L+LSAK SLI  A  LP D + ++P+S++HG++CN+I  G FVRFLGRLTGFSPR+K
Sbjct  150   GESLILSAKQSLIKLAHMLPSDSSHVNPYSIIHGFICNIIEAGCFVRFLGRLTGFSPRNK  209

Query  3499  ATDDRRYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKI  3320
             A  D++ D  E +YIGQSV +N++DV+GETGRIT+SLKQS C STDA+FIQE+F  E KI
Sbjct  210   AMQDQKLDLRETYYIGQSVRSNVVDVSGETGRITLSLKQSTCFSTDASFIQEFFSTEEKI  269

Query  3319  AKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGIN  3140
             AKLQSLD +    NW + F +GS+VEG+V E+K+ GV ++FEKY DVFGFI+   L G  
Sbjct  270   AKLQSLDES----NWAEEFAIGSVVEGEVQEVKDIGVTISFEKYHDVFGFIALHGLSGSI  325

Query  3139  VETGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQS  2960
             VETGSTIQAAV+DVSK E LVDLSLKPE V+  K  +++ +T +KKRK EA KDLE+NQ+
Sbjct  326   VETGSTIQAAVLDVSKTERLVDLSLKPELVDKWKGGSSSRQTNRKKRKAEAPKDLEMNQT  385

Query  2959  VNAVVEIVKENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSST  2780
             V+ VVE VKENYLVLS+P   +A+GYAS  D+NTQ L  K F  GQSV+AT++ALP  ST
Sbjct  386   VHTVVEAVKENYLVLSLPEFGHAIGYASTYDYNTQRLHQKHFTVGQSVVATVVALPCPST  445

Query  2779  GGRLLLLLKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVH  2600
              GRLLLLLK+ISE   +  SKR +KNSS +VGSLV AE+++                   
Sbjct  446   FGRLLLLLKSISEAIVTPGSKRSRKNSSCEVGSLVHAEVSN-------------------  486

Query  2599  ITEATDDNTTEGPLNDFRIGQTLTARIVSKDSRSENK-RGYQWELSTKPSVL----AGDM  2435
                 T D  +E P ++FR+GQT+ ARIV++ + S +K +GY WELS KP VL    A   
Sbjct  487   ----TPDEASEAPFSNFRVGQTVVARIVAEANHSASKVKGYLWELSVKPEVLKDFSAVGG  542

Query  2434  DGPHESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYV  2255
             +  +E   +S GQ ++ YV  V+ +WAWL ++R V AQL+ILDSS+EPSEL+EF K FYV
Sbjct  543   EIVNEDLGFSIGQRVTAYVSNVNGDWAWLAVTRRVSAQLFILDSSSEPSELQEFSKHFYV  602

Query  2254  GKSVSGYILSANKEKKLLRLVPHTLLITPE----------DTVPSSESAR--CHIREGSV  2111
             GK+VSGYI +   EKK+LRLV H L                 +P+    +  CH+ EG +
Sbjct  603   GKAVSGYISNIIGEKKILRLVLHHLSAISSGKSDQENSKISNLPTDVCKKVICHLNEGDI  662

Query  2110  LGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHS  1931
             +GGRISKILPGVGGLLVQI  HLFG+VH+TEL D  V DPLSGY EGQFVKCKV+++ H+
Sbjct  663   VGGRISKILPGVGGLLVQIGPHLFGRVHYTELTDCLVPDPLSGYKEGQFVKCKVIEITHA  722

Query  1930  VKGTTHVDLSLRWTLDTMNNQNI--SEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPK  1757
             VKGTTH+DLSLR +   +  +NI  S H+++ S   +++DI   H  M VQGYVKN++PK
Sbjct  723   VKGTTHIDLSLRSSAGILCQKNIECSNHENIASGRVKIEDI---HAHMEVQGYVKNISPK  779

Query  1756  GCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSS  1577
             GCFIMLSR ++AKILLSNL+DG+I++PEKEFP GKLV G+++SVE LSKRVEVTL++ + 
Sbjct  780   GCFIMLSRGLEAKILLSNLSDGYIDNPEKEFPTGKLVRGRILSVEPLSKRVEVTLKSVTE  839

Query  1576  ATPRKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQS  1397
                 +   + L +FSAG+IISG+IKR+ESFGLFIS+DNT++VGLCHVSE+SDD +++++ 
Sbjct  840   TGALRGSNNDLRSFSAGDIISGRIKRVESFGLFISIDNTDVVGLCHVSEVSDDPVESLEF  899

Query  1396  RYKAGQTvrvkvlkvdkdRHRISLGMKNSYFRDDDGEDIQTTSRQSINSTDKGNSVFIG-  1220
             RY AG TV+ KVLKVD+ RHRI+LGMK SY   +  E       +  ++ D  N  FIG 
Sbjct  900   RYHAGDTVKAKVLKVDEKRHRIALGMKRSYI-GERSELCTNMEEEHEDAADGDN--FIGE  956

Query  1219  TQSTVFPESSDADIDVSVVNTTDNILTE-----VESRASIPPLEVPLDDIENSDIDDAVN  1055
             T+ ++ P+SS +     + +  DNI  E      ESRA +P LEV LDDI+ +D+    +
Sbjct  957   TRLSMDPDSS-STKFKDMDDDFDNIEPEQPLRLAESRALVPSLEVTLDDIDETDMVTLQS  1015

Query  1054  KNPDHTGGADTTDekdkkramkkakkerereiraaeerlleKDIPRNTDEFEKLVRSSPN  875
             +N + T G D+ + K+ +R  KKAK+ERE E+RAAEERLL+ + P   DEFEKLVRSSPN
Sbjct  1016  ENKELTSGTDSKE-KNDRREKKKAKEEREMEVRAAEERLLQNNSPTTVDEFEKLVRSSPN  1074

Query  874   SSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQE  695
             SSFVWIKYM F  +  DVEKARSIAE+A+ TINIREE+EKLNVW+AYFNLE EYGNP ++
Sbjct  1075  SSFVWIKYMDFFKA--DVEKARSIAERALRTINIREENEKLNVWLAYFNLENEYGNPKED  1132

Query  694   AVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWA  515
             AV K+FQRALQ  DPKKVHLALLG+YERT    L DELL+KM+K+FKHSCK+WLRR++  
Sbjct  1133  AVTKIFQRALQCNDPKKVHLALLGMYERTNQDNLADELLDKMIKRFKHSCKVWLRRMESL  1192

Query  514   LKQNQDNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTD  335
              K+ Q   QSIVNRALLCLPK KHIK+I+QTAILEFKCGVADRGRSMFE +L+EYPKRTD
Sbjct  1193  FKKKQVEIQSIVNRALLCLPKRKHIKYISQTAILEFKCGVADRGRSMFEGILREYPKRTD  1252

Query  334   LWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKR  155
             LWS+YLDQEIR+GD D+IRALFERAISLS+ PKKMKFLFKKYL YEKSVGDEERIESVK+
Sbjct  1253  LWSIYLDQEIRLGDKDMIRALFERAISLSLAPKKMKFLFKKYLEYEKSVGDEERIESVKQ  1312

Query  154   KAMEYVES  131
             KA+EYVE+
Sbjct  1313  KALEYVEN  1320


 Score = 56.6 bits (135),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = -2

Query  4225  VLGCKSKRITVTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGF  4046
             VL  + + + ++ K++L+K    + S  +      I HG+I  I + GCFVRF   + GF
Sbjct  145   VLAIEGESLILSAKQSLIKLAHMLPSDSSHVNPYSIIHGFICNIIEAGCFVRFLGRLTGF  204

Query  4045  APRSELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSF  3920
             +PR++   D   D+   Y++ Q V+  VV  S  + +I LS 
Sbjct  205   SPRNKAMQDQKLDLRETYYIGQSVRSNVVDVSGETGRITLSL  246



>ref|XP_001768429.1| predicted protein [Physcomitrella patens]
 gb|EDQ66791.1| predicted protein [Physcomitrella patens]
Length=1785

 Score =  1346 bits (3484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 786/1834 (43%), Positives = 1131/1834 (62%), Gaps = 108/1834 (6%)
 Frame = -2

Query  5476  MKLWGVIAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQL  5297
             MK+WG +AE+N KD+V+SLPGGLRG VLA EA + +++NE          LS LF VGQL
Sbjct  1     MKIWGAVAEINNKDMVISLPGGLRGFVLAEEASE-VFENEVP-------LLSDLFSVGQL  52

Query  5296  VSCIV--LHLDDDKKEAGK-----------WKIWLSLRLALLHKNLTLDAIQEGIILSAY  5156
             V+C V  L L  +KK  GK            +I LSL+L  L+  L+++A+ EG  L+A 
Sbjct  53    VACTVRKLELTQEKKGRGKPEKEGKNEKRGRRIELSLKLGYLYDGLSIEAVYEGQALTAV  112

Query  5155  IKSTEDHGYILHFGLPSFSGFLPIHSQSVD---KMNTGQLVEGVVKSVDRTRKVVYLSSA  4985
             + S EDHGY+L FG+P+ SGFL +H   +D   K+ TGQLV+GVV SVD+ R  V L + 
Sbjct  113   VTSIEDHGYLLSFGVPAVSGFL-LHRNYLDGTSKLRTGQLVQGVVISVDKKRGAVGLKAD  171

Query  4984  PDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFP  4805
                I+  + K+  G++++LL PG MVNA V SVL+NG++LSFLTYFTGTVDIFHL+   P
Sbjct  172   LGLISSNMVKEFAGLTVELLTPGAMVNARVRSVLKNGLLLSFLTYFTGTVDIFHLEDPLP  231

Query  4804  PPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRV  4625
                W   Y +N+++ ARIL+IDP  + +GL+LNP L++   P   V VGD+F+ A V RV
Sbjct  232   GADWNTKYSENQRLKARILYIDPVAKTIGLTLNPQLLNNVLPSMSVDVGDVFKDAIVRRV  291

Query  4624  DKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATG  4445
             D  +G+LLE+P+         YIS V D+ + K+EK +  GK VR RV+G R ++ LA  
Sbjct  292   DATIGMLLELPTKENVVAG--YISSVSDEHIAKLEKKYTVGKKVRARVIGHRVMDALAIA  349

Query  4444  SLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKP  4265
             SLK S  +  + +H+DV+P M V   VI V+ +GA+VQ + GVKALCPL+HMSEF+   P
Sbjct  350   SLKESVVDQLLLSHADVQPAMNVTGTVIAVEPYGALVQLAEGVKALCPLQHMSEFQRSNP  409

Query  4264  RKKFQVGSELVFRVLGC--KSKRITVTHKKTLVKSKLDILSSYTDATEGLITHGWITKIE  4091
               KFQVGS+L FRVL C   +K+IT+THKKTL+ SKL  + SY  A EGL+THG+IT IE
Sbjct  410   SSKFQVGSKLKFRVLSCDHHAKKITLTHKKTLITSKLSPIVSYESAVEGLVTHGFITGIE  469

Query  4090  KHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTR  3911
               GCFV FYN V+G   +S LG++ G    +++ V Q +KCRV+ S PA+R++ LSF T 
Sbjct  470   DIGCFVSFYNDVKGLVHKSALGIEAGVKAENVFQVGQSIKCRVLRSDPAARRLSLSFITT  529

Query  3910  PMRLSETEMVKP----GTVVSGIVELVTPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLAD  3743
               R   +E        G VV+G V  V    I+VNV+     +KG ++  HLSD  G  +
Sbjct  530   SSRDDASEGAAGDELIGKVVAGTVHHVNDSVIIVNVSTPTGLVKGYLTFPHLSDTLGHIE  589

Query  3742  LMKSVLKPGYEFDQLLVLDI-EGFNLVLSAKYSLISTAQQLPLDVNQISPHSVVHGYVCN  3566
              +KSV K G++FD+LLVLD+ +   L++SAK SL+  A  LP D++Q+ P SV+ GYV N
Sbjct  590   QLKSVTKVGFQFDRLLVLDVTDKQKLIVSAKQSLLQAASSLPSDISQLQPQSVIPGYVAN  649

Query  3565  VIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVNGETGRITVSLK  3386
             +   G FVRFLGRLTG +   +  D+   D S  F +GQSV   +L+V  +TG+ ++ LK
Sbjct  650   ITDRGCFVRFLGRLTGLASVPQVADEFVSDPSNHFSVGQSVRAQVLEVYHDTGKFSLCLK  709

Query  3385  QSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVV  3206
             QS+C STD + IQ YFL E KI +     S  S L W     +G+   G+V EIK++GV+
Sbjct  710   QSVCFSTDVSLIQGYFLEEDKIVEA----SEASDLEWAKTLAIGACTGGEVQEIKDYGVI  765

Query  3205  VTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTA  3026
             V    Y DV GF++  QL G  VE G ++QA V+DV K + +VDL+++PE +  +K  + 
Sbjct  766   VKLPNYKDVVGFVTHYQL-GTPVEVGDSVQARVLDVVKADRIVDLTVRPELLQVNKHDST  824

Query  3025  NDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGYASLNDFNTQNLP  2846
               K + KKR       LE++Q V+AV+E+VK+ YLVLS+P    A+G+A+  D+N++   
Sbjct  825   KKKEKNKKRSHPVMA-LELHQKVSAVIELVKDAYLVLSLPEQGNAIGFAAAGDYNSRRQD  883

Query  2845  VKQ-FVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkknsSYD--VGSLV  2675
               Q +  GQ V+AT+  L D + G R+LLLL    +  E  +S   K     D  +G++V
Sbjct  884   SHQRYSPGQRVVATVEHLGDETNGNRMLLLLSNTGDSVEVKTSNTKKPRRELDKLIGAIV  943

Query  2674  QAEITDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARIVS----KD  2507
              AEI D            GF  +              PL+ F IGQ +  R+V     + 
Sbjct  944   DAEIID------------GFEEK-------------NPLSSFNIGQKVRCRVVQRVRLQK  978

Query  2506  SRSENKRGYQWELSTKPSVLAG-DMDGPHESF-NYSTGQLLSGYVFKVDSEWAWLTISRE  2333
             S    +R    ELS +PS L+G    G   S      GQ ++ YV +V  +WAWL+++  
Sbjct  979   SPGRKERTSVLELSLRPSQLSGYTRPGSLPSLEELVPGQCITAYVQEVKDDWAWLSVAPH  1038

Query  2332  VRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLL--------RLVPHTLL  2177
             +R +L+ILDSS +PSEL++F +RF VG  VS  + S + EK+ L        +L   +L 
Sbjct  1039  LRGRLFILDSSTDPSELEKFAERFTVGTPVSCCVKSVDYEKRTLDFIRRQPPQLQEKSLF  1098

Query  2176  ITP--EDTVPSSESARCH---IREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTELR  2012
               P  ED   SSE+       I++G  LGGR+ ++ PGVGG+ VQI    FG+VH T L 
Sbjct  1099  DVPPMEDADSSSENNTKQVFWIQKGDSLGGRVKQVNPGVGGISVQIAPSSFGRVHVTHLS  1158

Query  2011  DPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISEHDDVHSQN  1832
             D W  +P S + EGQFV+C VL V  +  G T +DL+LR +L  M   N+   D   ++ 
Sbjct  1159  DEWKDNPASAFKEGQFVRCVVLGVEKNPNGKTVIDLTLRKSLGGMVAANLQASDSATTRC  1218

Query  1831  RRVQDIKDLHP-DMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVG  1655
              + Q  + + P  + +QG+VK+ + KGCFI L+ +VDA +L  NL+  F++ P + FP G
Sbjct  1219  VKFQ-CRTIKPLCLVLQGFVKSTSKKGCFISLAPQVDAIVLTCNLSKAFVKDPAESFPPG  1277

Query  1654  KLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDI--DALNNFSAGNIISGKIKRIESFGL  1481
             KL+ G+++++++   RVE++L+TS       S +      +F  G ++ G IKRIE FG+
Sbjct  1278  KLIKGRIINIDADLGRVEMSLKTSGQKKELTSTLLGRRFGDFKEGEVVFGTIKRIEKFGI  1337

Query  1480  FISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSYFR  1301
             F++++ +++V +CH+SE++D +  ++   YK G  VR +VLKVD  + RISLG+K SYF 
Sbjct  1338  FVTIEQSSVVTMCHMSEVADHYFKDIDKHYKVGDRVRARVLKVDNTKQRISLGLKESYFS  1397

Query  1300  DDDGEDIQTTSRQSINSTDKGNSVFIGTQSTVFPESSDADIDVSVVNTTDNILTEVESRA  1121
             + +      T    +  T++ + +    + +   +  + +++ S    +D      E   
Sbjct  1398  NTETHVQPVTEEDDMKVTNEEDELVDDCEESEEDDVDEENLEDSKGTPSD------EGNL  1451

Query  1120  SIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkramkkakkerereiraaeer  941
             + PPLEV   D+E++++    +   +    ++   + +K+   +  ++       A E R
Sbjct  1452  NTPPLEV---DLEDTNV--VDDSEKEEDEESEDAKKLNKRAKKRLKQQREAEISAAEERR  1506

Query  940   lleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREES  761
             L     P   DEFE LVR+SPNSS VWIKYMAF+L L DV+KAR+IAE+A+ TIN REE 
Sbjct  1507  LKGDQAPETVDEFEALVRTSPNSSLVWIKYMAFLLQLADVDKARAIAERALQTINYREEM  1566

Query  760   EKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYE-----RTEHYK  596
             EKLNVW+AY NLE  YGNPP+EAV+ +F RALQY D KK++ ALLG+YE     +   Y 
Sbjct  1567  EKLNVWIAYLNLENVYGNPPKEAVLTLFNRALQYNDQKKLYFALLGIYENPRQPKGPQYD  1626

Query  595   LGDELLEKMVKKFKHSCKIWLRRIQWALKQNQ-DNSQSIVNRALLCLPKHKHIKFITQTA  419
             + D++++ M++KFK S K+WL++IQ  +++   D +   ++++LL LP+ KHIK I++ A
Sbjct  1627  MFDQMMKTMIRKFKSSAKVWLKQIQSLMERGMGDVAHKTLDQSLLSLPRRKHIKVISRAA  1686

Query  418   ILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPP  239
             +LE+K G  +R RS+FE +L+ YPKRTDLWSVYLDQEIRVG++ VIRA+FE+   L +PP
Sbjct  1687  LLEYKSGSVERARSIFEGILRNYPKRTDLWSVYLDQEIRVGEVPVIRAIFEKVTCLELPP  1746

Query  238   KKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYV  137
             +KMKFLFKKYL YEK+ GDEE+IE VKRKAMEYV
Sbjct  1747  RKMKFLFKKYLDYEKANGDEEQIEHVKRKAMEYV  1780



>ref|XP_008387226.1| PREDICTED: protein RRP5 homolog [Malus domestica]
Length=1029

 Score =  1345 bits (3482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 689/1013 (68%), Positives = 835/1013 (82%), Gaps = 10/1013 (1%)
 Frame = -2

Query  5806  KNFKRKGKNNEAGNASFSGKSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAE  5627
             K+ K+  K N+  N     ++  LQLED+VPDFPRGG S L+++E DE+RAEVDAEFEAE
Sbjct  22    KSSKKPFKPNKDQNDDVRSEAVALQLEDDVPDFPRGGGSALNRQERDEIRAEVDAEFEAE  81

Query  5626  DRylkkkkqhklykKNQSV-EDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAE  5450
             +R LKK+K+  + K + +  EDDLGSLFG  ISGKLPK AN+IT KNIS GMK+WGV++E
Sbjct  82    ERELKKRKKKGMQKNSVATKEDDLGSLFGDGISGKLPKYANKITMKNISAGMKVWGVVSE  141

Query  5449  VNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLD  5270
             VNEKD+V+SLPGGLRGLV ASEA DP+ D+E   +    + L  +FH GQLVSCIVL LD
Sbjct  142   VNEKDLVISLPGGLRGLVRASEAFDPILDDENKAV--ADSLLPSVFHTGQLVSCIVLKLD  199

Query  5269  DDKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFL  5090
             +DKKE GK KIWLSLRL+ L+K  TL+++QEG++L+AY+KS EDHGYILHFGL SF+GFL
Sbjct  200   EDKKEKGKRKIWLSLRLSSLYKGFTLESVQEGMVLTAYVKSIEDHGYILHFGLSSFTGFL  259

Query  5089  PIHSQSVDK---MNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVP  4919
             P  S+S  K   +  GQL++G VKSVD+ RKVVYLSS P+ ++K VTKDLKGISIDLLVP
Sbjct  260   PKKSESBTKEIQLKAGQLLQGAVKSVDKIRKVVYLSSDPETVSKCVTKDLKGISIDLLVP  319

Query  4918  GMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFID  4739
             GMMVNA V+S LENGVMLSFLTYFTGTVD+FHLQ   P  +WK++Y Q+KKVNARILFID
Sbjct  320   GMMVNARVLSTLENGVMLSFLTYFTGTVDLFHLQNSCPTINWKEEYNQHKKVNARILFID  379

Query  4738  PATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVY  4559
              +TRAVGL+LNPHLV  KAPPSLVK+GDI + +KV+RVDKGLGLLLEIPS+PV TPAYV 
Sbjct  380   XSTRAVGLTLNPHLVRNKAPPSLVKIGDICDDSKVVRVDKGLGLLLEIPSTPVSTPAYVS  439

Query  4558  ISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMV  4379
             ISDV +++ +K+EK FK G  VRVR+LGFR+LEGLATG+LK SA EG+VFTHSDVKPGMV
Sbjct  440   ISDVAEEDARKLEKKFKLGSRVRVRILGFRHLEGLATGTLKASAMEGTVFTHSDVKPGMV  499

Query  4378  VKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRI  4199
             V+ K+I VDSFGAIVQFS GVKALCPL HMSEFEI KP KKF++G+EL+FRVLGCKSKRI
Sbjct  500   VRGKIIAVDSFGAIVQFSGGVKALCPLTHMSEFEIAKPGKKFKIGAELLFRVLGCKSKRI  559

Query  4198  TVTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLD  4019
             TVTHKKTLVKSK  I+SSY +A +GLITHGWI KIE+HGCFV FYNGVQGFAPRSELGL+
Sbjct  560   TVTHKKTLVKSKHGIVSSYAEAADGLITHGWIRKIEEHGCFVHFYNGVQGFAPRSELGLE  619

Query  4018  PGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVT  3839
             PGSD SSMYHV QVVKCRV++S+P SR+I LSF  RP R+SE ++ K G +VSG+V+ VT
Sbjct  620   PGSDPSSMYHVGQVVKCRVINSNPTSRRIKLSFVIRPARVSEDDVAKLGCLVSGVVDRVT  679

Query  3838  PDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLS  3659
             P ++ V   NG+ +  GT+ T HLSDH GLA LM+SVLKPGYEFDQLLVLDIEG NL+LS
Sbjct  680   PSAVYV---NGKGYSMGTIFTDHLSDHHGLAALMRSVLKPGYEFDQLLVLDIEGNNLILS  736

Query  3658  AKYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRY  3479
             AKYSLI++ QQLP +++Q+ P+S+VHGY+CN+I  G FVRFLGRLTGFSPR KA DD + 
Sbjct  737   AKYSLINSLQQLPSELSQVHPNSLVHGYICNLIETGCFVRFLGRLTGFSPRHKAMDDPKX  796

Query  3478  DTSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLD  3299
             D SE ++IGQSV +NIL+V+ E+GRIT+SLKQS CSSTD +FIQEYF+LE KIA LQ L+
Sbjct  797   DLSETYFIGQSVRSNILNVSSESGRITLSLKQSSCSSTDVSFIQEYFMLEEKIATLQLLN  856

Query  3298  SADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTI  3119
             S +S  NW +GF +GS+ EGKV E+K+ GVVV FEKY+DVFGFI+  QLGG  VETGS++
Sbjct  857   SKESKSNWSEGFTIGSVXEGKVQEVKDVGVVVXFEKYNDVFGFITHYQLGGTVVETGSSV  916

Query  3118  QAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEI  2939
              A V+DV+K EHLVDLS+K EF N  K ++++ K+ KKKRK EA  DLEV+Q+VNA+VEI
Sbjct  917   HAVVLDVAKAEHLVDLSMKQEFTNKFK-ESSDKKSHKKKRKSEALDDLEVHQTVNAIVEI  975

Query  2938  VKENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSST  2780
             VKENYLVLS+P  NYA+GYAS++D+NTQ +P KQF+NGQSV AT+MALP   T
Sbjct  976   VKENYLVLSIPKYNYAVGYASISDYNTQKVPQKQFLNGQSVDATVMALPSPFT  1028



>emb|CDY47905.1| BnaAnng09370D [Brassica napus]
Length=1205

 Score =  1332 bits (3448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 708/1221 (58%), Positives = 926/1221 (76%), Gaps = 43/1221 (4%)
 Frame = -2

Query  3748  ADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQISPHSVVHGYVC  3569
             A LM S+L+PG+E D+LLV+DIEG NL LS+KYSLI  A++LP D++Q+ P+SVVHGYVC
Sbjct  10    AKLMISLLRPGFELDKLLVIDIEGNNLALSSKYSLIKFAEELPSDLSQLQPNSVVHGYVC  69

Query  3568  NVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVNGETGRITVSL  3389
             N+I NG FVRFLGRLTGF+PRSKA D+ R D SE F++GQSV  NI+DVN E  R+T+SL
Sbjct  70    NLIENGCFVRFLGRLTGFAPRSKAIDEPRADLSESFFVGQSVRANIVDVNQEKSRVTLSL  129

Query  3388  KQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGV  3209
             KQS C+S DA+F+QEYFL + KI+ LQS D  +S  +WV+ F +GS++ G V +  + G+
Sbjct  130   KQSSCASVDASFVQEYFLTDEKISNLQSSDITESECSWVEKFSIGSLIMGTVQDKNDLGL  189

Query  3208  VVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQT  3029
             VV F+  ++V GFI    LGG ++E GS +QA V+D+S+ E LVDLSL+PE +N S  + 
Sbjct  190   VVNFDNINNVLGFIPKYHLGGTSLENGSVVQAVVLDISRAERLVDLSLRPELINSSAKEV  249

Query  3028  ANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGYASLNDFNTQNL  2849
             +N +  KKKRKR   K+LEV+Q V+AVVEIVKE YL+LS+P  NY +GYA+++D+NTQ L
Sbjct  250   SN-RQSKKKRKRGISKELEVHQRVSAVVEIVKEQYLILSIPEHNYTIGYAAVSDYNTQKL  308

Query  2848  PVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkknsSYDVGSLVQA  2669
             PVKQF  GQSV+A++ AL +  T GRLLLLL ++S  +E+SS +  KK +  +VGS+VQA
Sbjct  309   PVKQFTTGQSVVASVEALQNPLTSGRLLLLLDSVSGSSETSSKRAKKKANC-EVGSVVQA  367

Query  2668  EITDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARIVSKDSRSENK  2489
             EIT+IKP E+R+ FG  F GR+HITE  D  T E P   FR+GQ+++AR+V+K   ++NK
Sbjct  368   EITEIKPFEVRVNFGQSFRGRIHITEVNDVGTNEEPFAKFRVGQSVSARVVAKPCHTDNK  427

Query  2488  RGYQWELSTKPSVL--AGDMDGPHESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLY  2315
             +   WELS KP++L  +G++    E   + +G+ + GYV+KVD EW WL ISR V A+++
Sbjct  428   KSQLWELSVKPAILRDSGELTEVREQLEFVSGEPVCGYVYKVDKEWVWLAISRNVTARIF  487

Query  2314  ILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTLLITPE----------  2165
             ILD++ E  EL+EF+ RF +GK+VSGY+L+ NKEKK +RLV   LL   +          
Sbjct  488   ILDTACEARELEEFEGRFPIGKAVSGYVLTYNKEKKTVRLVQRPLLNIQKSIGNDGGPKK  547

Query  2164  ---DTVPSSESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSD  1994
                D+   S+ A   I EG +LGGRISKILPGVGGL VQI  ++FG+VHFTE+ D WVS+
Sbjct  548   DKLDSSIPSDDATLFIHEGDILGGRISKILPGVGGLRVQIGPYVFGRVHFTEINDSWVSN  607

Query  1993  PLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISEHDDVHSQNRRVQDI  1814
             PL G  EGQFVKC VL++ +S KGT  ++LSLR +LD M++ ++SE +      +R + I
Sbjct  608   PLDGLHEGQFVKCMVLEISNSSKGTLQIELSLRTSLDGMSSDHLSEANVF----KRFERI  663

Query  1813  KDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKV  1634
             +DL PDM ++GYVKN   KGCFIMLSR +DAK+LLSNL+D F++ PE EFPVGKLVTG+V
Sbjct  664   EDLSPDMGIEGYVKNTMSKGCFIMLSRTLDAKVLLSNLSDTFVKDPENEFPVGKLVTGRV  723

Query  1633  VSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNL  1454
             ++VE LSKRVEVTL+  ++  P KS+   L  F  G++ISG+IKR+E++GLFI +D T +
Sbjct  724   LNVEPLSKRVEVTLKKVNAGGPSKSESYDLKQFHVGDMISGRIKRVEAYGLFIEIDQTGM  783

Query  1453  VGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSYFRDDDGEDIQT  1274
             VGLCH S+LSDDHI+++ +RY+AG++V  K+LK+D++R RISLGMK+SYF + D +  Q 
Sbjct  784   VGLCHKSQLSDDHIEDIHTRYEAGESVTAKILKLDEERRRISLGMKSSYFVNGDDDTAQP  843

Query  1273  TSRQSINSTDKGNSVFIGTQSTVFPESSDADIDVSVVNTTDNILTEVESRASIPPLEVPL  1094
              S ++ +                   S + D  ++  N T   + +VESRASI PLEV L
Sbjct  844   RSEENADEA-----------------SMECD-PINDSNGTSLAIAQVESRASILPLEVDL  885

Query  1093  DDIENSDIDDAVNKNPDHTGGADTTDekdkkramkkakkerereiraaeerlleKDIPRN  914
             DDIE +D+D   N+      GAD  DEK K+R  +K K+ERE++I+AAE RLLE   P +
Sbjct  886   DDIEEADLDKNQNQK---LQGADK-DEKSKRREKQKDKEEREKKIQAAEGRLLENHAPES  941

Query  913   TDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAY  734
              DEFEK+VRSSPNSSFVWIKYMAFMLSL D+EKARSIAE+A+ TINIREE EKLN+WVAY
Sbjct  942   ADEFEKMVRSSPNSSFVWIKYMAFMLSLADIEKARSIAERALRTINIREEEEKLNIWVAY  1001

Query  733   FNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFK  554
             FNLE E+G+PP+EAV KVF+RA QYCDPKKV+ ALLGVYERTE YKL D+LL++M+KKFK
Sbjct  1002  FNLENEHGSPPEEAVKKVFERARQYCDPKKVYNALLGVYERTEQYKLADKLLDEMIKKFK  1061

Query  553   HSCKIWLRRIQWALKQNQDNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVADRGRSM  374
              SCK+WLR+IQ  LKQ+++N QS+VNRALLCLP+HKHIKFI+QTAILEFKCGVADRGRS+
Sbjct  1062  QSCKVWLRKIQSYLKQDEENIQSVVNRALLCLPRHKHIKFISQTAILEFKCGVADRGRSL  1121

Query  373   FERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEK  194
             FE +L+EYPKRTDLWSVYLDQEIR+G++DVIR+LFERAISLS+PPKKMKFLFKK+L YEK
Sbjct  1122  FEGVLREYPKRTDLWSVYLDQEIRLGEVDVIRSLFERAISLSLPPKKMKFLFKKFLEYEK  1181

Query  193   SVGDEERIESVKRKAMEYVES  131
             S GDEER+E VK++AMEY +S
Sbjct  1182  SAGDEERVEYVKQRAMEYADS  1202


 Score = 62.4 bits (150),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/127 (27%), Positives = 66/127 (52%), Gaps = 3/127 (2%)
 Frame = -2

Query  4300  LRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSYTDATEGL  4121
             ++H ++  I   R  F++   LV  + G     + ++ K +L+K   ++ S  +      
Sbjct  6     IKHQAKLMISLLRPGFELDKLLVIDIEG---NNLALSSKYSLIKFAEELPSDLSQLQPNS  62

Query  4120  ITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSSSPAS  3941
             + HG++  + ++GCFVRF   + GFAPRS+   +P +D+S  + V Q V+  +V  +   
Sbjct  63    VVHGYVCNLIENGCFVRFLGRLTGFAPRSKAIDEPRADLSESFFVGQSVRANIVDVNQEK  122

Query  3940  RQIVLSF  3920
              ++ LS 
Sbjct  123   SRVTLSL  129



>ref|XP_002971843.1| hypothetical protein SELMODRAFT_451253 [Selaginella moellendorffii]
 gb|EFJ26760.1| hypothetical protein SELMODRAFT_451253 [Selaginella moellendorffii]
Length=1807

 Score =  1300 bits (3365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 777/1879 (41%), Positives = 1144/1879 (61%), Gaps = 109/1879 (6%)
 Frame = -2

Query  5710  FPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhklykKNQSVEDDLGSLFGHSIS  5531
             FPRGG   LS  E+ E RAE +AEF  E+  L KK + K  K  +  E++  +L    +S
Sbjct  20    FPRGGKQALSAAEIQEARAEAEAEFNRENENLGKKTKKKKRKVEEDPEEE--TLL---LS  74

Query  5530  GKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNETN  5351
             G   KS   +  + +  GM+LWG ++ +N+ D+ +SLP GL G V   EA      + ++
Sbjct  75    GNARKSVELLKFRKLCSGMRLWGAVSGINKTDLSISLPNGLHGFVKVDEAFPEYTPDLSD  134

Query  5350  EMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGK---WKIWLSLRLALLHKNLTLDAIQ  5180
             +       L  LFHVGQ VSC +L+L++ K +  K    +  LSL     ++ +T+D I 
Sbjct  135   DKGKCHLLLEELFHVGQYVSCTLLNLEETKGDGQKKQPRRAVLSLLPRHFNEGMTMDTIY  194

Query  5179  EGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDKMNTGQLVEGVVKSVDRTRKVV  5000
              G ++ + +KS EDHGY+L FGLP  SGFL       +K+  G++++  V ++D+ R V+
Sbjct  195   VGQLMISSVKSIEDHGYVLSFGLPEMSGFLLHKDHQGEKLRVGEIMQSCVSAIDKKRGVI  254

Query  4999  YLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHL  4820
              L++   + A    K+ + +S+  LVPG +VN  V +V+ NGV+LSFLTYFTG VDIFHL
Sbjct  255   NLTTMQLSSA---MKEHENLSLGTLVPGALVNGCVQAVMRNGVLLSFLTYFTGIVDIFHL  311

Query  4819  QQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKK-APPSLVKVGDIFEQ  4643
             Q V     W  DY + K+  ARI+FID  T+ + LSL  HLV  +   PSL + GD+ E 
Sbjct  312   QSVLSSKDWAQDYTEGKRFKARIIFIDARTKRIRLSLRSHLVDAEIVVPSLNR-GDVIEA  370

Query  4642  AKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKVVRVRVLGFRNL  4463
             A++ RVD  +GLLLE+P++P     YV  +DV D  V K+EK FK G+ V+ R++GFR +
Sbjct  371   ARIKRVDPAIGLLLELPATP-HVAGYVNHADVSDVNVDKLEKKFKDGQRVKARIIGFRLM  429

Query  4462  EGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGVKALCPLRHMSE  4283
             +G+AT +LK S  +G V    D+KPG +V   +  V++ GA+V    GVK LCP++HMSE
Sbjct  430   DGMATLTLKESMVKG-VVNKLDLKPGALVHGVITRVEACGALVSLG-GVKGLCPVQHMSE  487

Query  4282  FEIVKPRKKFQVGSELVFRVLGC--KSKRITVTHKKTLVKSKLDILSSYTDATEGLITHG  4109
             +  +KP  KF+VG ++ FRVL    + K++++T KK+LV SKL ++++Y DA +GL+THG
Sbjct  488   YNRLKPSSKFEVGKKMKFRVLQYDHEKKKLSLTFKKSLVSSKLPLITAYEDAVDGLVTHG  547

Query  4108  WITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQIV  3929
             WI  I   GCF+ FYN V+G   RSELG+ P + I + +HV QVVKCRV+ S  + R++ 
Sbjct  548   WIQGISNIGCFMEFYNHVKGLVHRSELGIGPDTPIEAAFHVGQVVKCRVLESDLSKRRLS  607

Query  3928  LSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTVSTQHLSDHRGL  3749
             LSF      +S    VKPG+VVS ++  +    I + VN+    +  T+S +HLSD    
Sbjct  608   LSFN-----MSLRPGVKPGSVVSAVITQMGSSQIELQVND---DIASTMSYEHLSDTPVH  659

Query  3748  ADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQISPHSVVHGYVC  3569
             A+ M+S+LKPG++FD+LLVL  E   LVL+AKYSLI  A+ LP  ++Q+SP +V+ GY+ 
Sbjct  660   AEQMRSLLKPGFKFDRLLVLGWEHSKLVLTAKYSLIDAAESLPSSIHQLSPMAVLPGYIS  719

Query  3568  NVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVNGETGRITVSL  3389
              +      V FL  +TG  P   A+D    D S+VF++GQSV   +L+V+ E  +  +SL
Sbjct  720   VIHDKYCLVSFLDDVTGLVPIGNASDGYLEDLSQVFFVGQSVRAQVLEVDSENEKFVLSL  779

Query  3388  KQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGV  3209
             KQS C STD + IQ YFL E  IAKL+       GL+W +   +G +VE  V E+K++G+
Sbjct  780   KQSACFSTDVSLIQGYFLEEELIAKLKE----KEGLDWGNKLQIGELVEADVQEVKDYGI  835

Query  3208  VVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQT  3029
             ++  +   DV GF +  Q     VE G+ ++A ++DV K + +VDLSL+ + +   K + 
Sbjct  836   ILNLKDNADVVGFATHYQ-SDSPVEVGAAVKACILDVVKTDGIVDLSLQKKMLKFKKTKA  894

Query  3028  ANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGYASLNDFNTQNL  2849
                              L+++Q V  VVE+VK+ YLVLS+P    ++G+AS  D+N + L
Sbjct  895   V----------------LQLHQRVEVVVELVKDEYLVLSLPKFGNSIGFASTRDYNIRVL  938

Query  2848  -PVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkknsSYDVGSLVQ  2672
              P   +  GQ   ATI +    S G R LLLL        + +          D+G++++
Sbjct  939   RPHDHYSPGQKFSATIYSFGSESVGERTLLLL--------ADTKPTFFTYVKNDIGAIIE  990

Query  2671  AEITDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARIVSKDSRSEN  2492
              +I +I  L + ++ G    G VHITE  D      PL  +  GQT+ A+I+SK  ++  
Sbjct  991   GQIQEISSLHMIIQAGINLRGNVHITEVVDHYEEGNPLRKYNAGQTVRAKILSK-RKTSR  1049

Query  2491  KRGYQ--WELSTKPSVLAGDMDGPHESFNYST---GQLLSGYVFKVDSEWAWLTISREVR  2327
             K G     +LS +PS L G+ D       + T   GQ + GYV +V   WAWL +S  +R
Sbjct  1050  KHGNAPTLDLSLRPSELTGN-DSARSVITFETVTIGQTVVGYVQEVKENWAWLVLSPHLR  1108

Query  2326  AQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTLLITPEDTVPSS  2147
              +L+ILDSS +PSEL+ FQ+RF VG +   +I S N EKK + L      + P+D     
Sbjct  1109  GRLFILDSSDDPSELERFQERFKVGDAFQCHIRSVNHEKKQVDLS-----LRPKDE----  1159

Query  2146  ESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQ  1967
                    ++G +LGGRI+++ PG GGL VQ+    FG+VH T L D W+ DP S + EG+
Sbjct  1160  -----DFKKGDLLGGRITRVRPGDGGLTVQVGWETFGRVHVTHLGDTWMDDPASLFTEGK  1214

Query  1966  FVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNN-QNISEHDDVHSQNRR--VQDIKDLHPD  1796
             FV+C+VL +  ++KGT  ++LSLR +L      +++  +  +  ++    V  + +L  D
Sbjct  1215  FVRCRVLDLKPTLKGTKALELSLRPSLGGYGGFESLPSYQTLERKSNACIVNSVSELQQD  1274

Query  1795  MTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESL  1616
             M VQG+VK+VT KGCF++LS  VDA+ILL NL+  F+++P + FP GKLV+G+++SV  L
Sbjct  1275  MQVQGFVKDVTEKGCFVILSPSVDARILLKNLSSSFVQNPAEMFPAGKLVSGRILSVRPL  1334

Query  1615  SKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHV  1436
             S  VE++L TS  ++  K+       F AG+I+SG+I+ IE+FG+F+++ ++++VGLCHV
Sbjct  1335  SGHVEMSLTTSQESSSWKT-------FCAGDIVSGRIRSIEAFGMFVALADSDVVGLCHV  1387

Query  1435  SELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSYFRDDDGEDIQTTSRQSI  1256
             SE+SDD I ++ + YK GQ V+VK+LKVD +  RISLGMK S+   DDG  ++T   + +
Sbjct  1388  SEVSDDFIQDLPTLYKVGQRVQVKILKVDAETKRISLGMKASFLTPDDG--LETMDEEPV  1445

Query  1255  NSTDKGNSVFIGTQSTVFPESSDADIDVSVVNTTDNILTEVESRAS-IPPLEVPLDDIEN  1079
                    +V + T      E    D+D           TE    A+ + PLEV L++   
Sbjct  1446  AEEPSTANVLMETDEK---EEDYLDLD-----------TEATPMATDVDPLEVNLEE---  1488

Query  1078  SDIDDAVNKNPDHTGGADTTDekdkkramkkakkerereiraaeerlleKDIPRNTDEFE  899
              D++D V    +    A+ + +K KK   +  ++       A E+ L +   P   D+FE
Sbjct  1489  -DVEDKVPVEDEKPPTAEESKKKTKKEKKRLKEQREAAVRAAEEKFLQKDQPPETEDDFE  1547

Query  898   KLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEI  719
             +LV +SPNSS+VWIKYMA+ L L D +KAR++A++A+ TIN REE EK+N+W AY NLE 
Sbjct  1548  RLVAASPNSSYVWIKYMAYWLRLADPDKARAVADRALETINYREEMEKMNIWTAYINLEN  1607

Query  718   EYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKI  539
              Y   P+EAV  +F+RA++YCDPKK+HL+LLGVYE T  +++ D L++ M +KFK S K+
Sbjct  1608  SYAPSPREAVSALFERAMKYCDPKKLHLSLLGVYESTNQHEMTDALMKSMTRKFKTSTKV  1667

Query  538   WLRRIQWALKQN-QDNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVADRGRSMFERM  362
             WLR +   L +   D ++    +A + LP+HKHIKFI++ AILEFK G  +R R +F+ +
Sbjct  1668  WLRHVSNLLGRGLSDKARKAFEQACVALPRHKHIKFISRAAILEFKSGSPERAREIFDGV  1727

Query  361   LKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVGD  182
             L+ YPK+TDLWSVYLDQEIR+GD  ++R LFERA  L +P KKMKFLFKKYL +EK  GD
Sbjct  1728  LRNYPKKTDLWSVYLDQEIRLGDTAIVRNLFERATCLDLPAKKMKFLFKKYLDFEKGQGD  1787

Query  181   EERIESVKRKAMEYVESLA  125
             E RIE VK KAME+VE+ A
Sbjct  1788  ETRIEHVKTKAMEFVEAKA  1806



>gb|EMT17935.1| rRNA biogenesis protein rrp5 [Aegilops tauschii]
Length=1959

 Score =  1217 bits (3150),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 708/1506 (47%), Positives = 975/1506 (65%), Gaps = 111/1506 (7%)
 Frame = -2

Query  4513  FKPGKVVRVRVLGFRNLEGLAT--GSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGA  4340
             FK G  +  RVLG ++     T   SL  S  E  + +++D K G+V    +  ++  G 
Sbjct  515   FKAGAELLFRVLGCKSKRITVTYKKSLVKSKLE-VLASYADAKIGLVTHGWITKIEKHGC  573

Query  4339  IVQFSSGVKALCPLRHMSEFEI---VKPRKKFQVGSELVFRVLGCKSKRI-TVTHKKTLV  4172
              V+F +GV+        SE  +   ++    + VG     +V+ C+   +  VT    +V
Sbjct  574   FVRFYNGVQG-------SELGLEPGIEAESVYHVG-----QVVKCRIFLVYMVTGNWAVV  621

Query  4171  KSKLDILSSYTDATEGLITHGWITKIEKHGCFVRF-YNGVQGFAP---------RSELGL  4022
                  +L     A    I   W +++   GC  R   + +   AP         + +L  
Sbjct  622   FILCQVLVQQPHAIPPCIN--W-SELSMRGCSARVTISHIPTLAPLITLSLIAQKKDLAQ  678

Query  4021  DPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMR-----------LSETEMVKP  3875
                 D  ++  V + V     +       I+L    + +            + + +  K 
Sbjct  679   KKWPDAFTLLAVVRTVLSDTSTYIGVFEPIILYLAHKVIAEAFAYMFFFVWVIQADTAKV  738

Query  3874  GTVVSGIVELVTPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLL  3695
             GT+VSG+VE +TP ++VV+VN      KG++  + L+DH G A  +K++LKPG+EF+QLL
Sbjct  739   GTIVSGVVERLTPATVVVSVNGFS---KGSILNEQLADHHGQAAQLKNLLKPGHEFNQLL  795

Query  3694  VLDIEGFNLVLSAKYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGF  3515
             VLD EG NLVLSAK+SLI+TA  +P +++Q+   +VVHGY+CN+I  G FVRFLG LTGF
Sbjct  796   VLDTEGQNLVLSAKHSLINTANDIPSEISQMQAGAVVHGYICNIIEAGCFVRFLGHLTGF  855

Query  3514  SPRSKATDDRRYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFL  3335
             SP+ KA D      S+VF +GQSV +++L+VN E+ R+ +SL+QS+CSS D +FIQ YFL
Sbjct  856   SPKDKAVDRPIEKLSDVFCVGQSVRSHVLNVNAESARVKLSLQQSMCSSPDCSFIQGYFL  915

Query  3334  LEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQ  3155
             L+ KIA L+    + S  +WV  FG+GS+V+G+V  I+E+GV++ F+ + DV G I   Q
Sbjct  916   LDQKIAALKYSGPSTSH-DWVKYFGIGSLVKGEVGAIEEYGVILNFKDHPDVVGLIEHHQ  974

Query  3154  LGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDL  2975
             LGG  V+ GS+++  V+D+S  + +V+LSLKPE V      + +   +KKKR R A  DL
Sbjct  975   LGGSTVKVGSSVKGLVVDLS--DGVVNLSLKPELVG-----SVSKDGKKKKRHRAAVLDL  1027

Query  2974  EVNQSVNAVVEIVKENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMAL  2795
             E+ + VNAVVEIVK++Y+VLSVP  N+A+G+A L D+N+Q LP   + NGQ +   + ++
Sbjct  1028  ELREEVNAVVEIVKDSYVVLSVPEYNHAIGFAPLMDYNSQLLPQHHYDNGQCITVVVGSI  1087

Query  2794  PDSSTGGRLLLLLKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGF  2615
             P S   GRL+LL K  ++ +  SSSKR KK S Y VGSLV+AEI DIKPLE+ LKFG   
Sbjct  1088  PSSDPSGRLILLPKGSAQDSNISSSKRAKKKSDYKVGSLVEAEIIDIKPLEVILKFGVNL  1147

Query  2614  HGRVHITEATDDNTTEGPLNDFRIGQTLTARIVSKDSRS-ENKRGYQWELSTKPSVLAGD  2438
             HGR+HITE  +++ +E P +  +IGQ + ARIV++   S +  R  +WELS KPS+L  D
Sbjct  1148  HGRIHITEVLEEDCSEHPFSKLKIGQKVHARIVAQAEHSAKTGRNLKWELSIKPSLLKAD  1207

Query  2437  MD---GPHESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQK  2267
             ++         N+S   ++  YV KVD+EW WLT+SR+V A L+ILDSS EPSELKEFQ+
Sbjct  1208  LEESTASEAELNHSINDIIRAYVVKVDAEWVWLTVSRKVMAHLFILDSSVEPSELKEFQQ  1267

Query  2266  RFYVGKSVSGYILSANKEKKLLRLVP---HTLLITPEDTVPSSESARCHIREGSVLGGRI  2096
             R+ VG++V G I+  N+EK+LLRL       +L   +DT  +  S   H +EG V+GGRI
Sbjct  1268  RYSVGQAVKGRIIGVNREKRLLRLKAFDNQCMLENIDDTQKTVSSIAEHTKEGDVIGGRI  1327

Query  2095  SKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTT  1916
              +ILPGVGGL++QI  HL G+VH+TE+ D WV +PLSG  EGQFVKCKVL V    +G+ 
Sbjct  1328  QRILPGVGGLVIQIGPHLHGRVHYTEIVDLWVPEPLSGIHEGQFVKCKVLAVSRQAEGSV  1387

Query  1915  HVDLSLRWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLS  1736
              VDLSLR            + DD  +   R + I DL P   V+GYVKNV PKGCFIMLS
Sbjct  1388  RVDLSLR----------SRKLDDSTTCAPRFEKINDLCPGTEVKGYVKNVNPKGCFIMLS  1437

Query  1735  RKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSD  1556
             R V+A+I+LSNL+D ++E+P+K+F VG LV G+V+S E LS +VEV+LR S+ +  +K D
Sbjct  1438  RMVEARIILSNLSDEYVENPQKDFSVGMLVQGRVLSAEPLSGKVEVSLRKSTGSKSQKLD  1497

Query  1555  IDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQT  1376
               + ++   G+I+ G++KR+ES+GLF+++ ++ LVGLCHVSELSD+ + ++ + YKAG  
Sbjct  1498  DVSYSDLHVGDIVDGQVKRVESYGLFVTIKSSELVGLCHVSELSDEPVLDINACYKAGDM  1557

Query  1375  vrvkvlkvdkdRHRISLGMKNSYFRDDDGEDIQTTSRQSINSTDKGNSVFIGTQSTVFPE  1196
                    +D+DRHR+SLG+K SYF  D  +D      ++ N  D G    +    +  P+
Sbjct  1558  -------IDEDRHRVSLGLKESYFDSDLTDD------ENGNENDGGR---VPMDISRAPQ  1601

Query  1195  SSDADIDVSVVNTTDNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTD  1016
              S         N+T  +L   E RAS+PPL+V LD+ E SD  +   K  +   G++   
Sbjct  1602  MSGG------FNST-LVLPGPEPRASVPPLQVALDEYEGSD-QEGDQKAHEIANGSEPN-  1652

Query  1015  ekdkkramkkakkerereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFML  836
                  R +      RE EI A EER L+KDIP+  DEFEKLVR+SPNSSFVWIKYMAF+L
Sbjct  1653  ---WHRRLLHHFFPREIEISALEERALQKDIPQTPDEFEKLVRTSPNSSFVWIKYMAFLL  1709

Query  835   SLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYC  656
              L DVEKARS+AE+A+ TINIREE EKLNVWVAYFNLE EYG+P ++AV K+FQRALQYC
Sbjct  1710  DLADVEKARSVAERALRTINIREEEEKLNVWVAYFNLENEYGSPREDAVKKIFQRALQYC  1769

Query  655   DPKKVHLALLGVYERTEHYKLGDELLEKMVKKFK----------HSCKIWLRRIQWALKQ  506
             DPKKVHLALLG+YERT+  +L DEL ++M K+FK           SCKIWLRRIQ++L Q
Sbjct  1770  DPKKVHLALLGMYERTKQNELADELFDRMTKRFKTSCKHIYDFQTSCKIWLRRIQFSLTQ  1829

Query  505   NQDNS--QSIVNRALLCLPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDL  332
              +D    +S+VNRALL LP++K IKF+TQTAILEFKCGVA+ GRS FE +L+EYPKRTD+
Sbjct  1830  GKDVEYIKSVVNRALLSLPQNKRIKFLTQTAILEFKCGVAEEGRSRFELILREYPKRTDI  1889

Query  331   WSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRK  152
             WSVYLDQEIR+GD ++IRALF+R   LS+PP+KMKFLFKKYL YEK+ GDEERI+ VK+K
Sbjct  1890  WSVYLDQEIRLGDTEIIRALFDRVTCLSLPPRKMKFLFKKYLRYEKAQGDEERIKHVKQK  1949

Query  151   AMEYVE  134
             AME+VE
Sbjct  1950  AMEFVE  1955


 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/618 (57%), Positives = 443/618 (72%), Gaps = 62/618 (10%)
 Frame = -2

Query  5701  GGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhklykKNQSVEDDLGSLFGHSISGKL  5522
             GG SLLS++E+ E R E + EFE E+R  KKK++  +       +DDLG+LFG + +GKL
Sbjct  15    GGRSLLSRDEMAEARTEAEVEFEKEERRGKKKRKANVSSGIDG-DDDLGTLFGGATTGKL  73

Query  5521  PKSANRITPK------------------------------------NISPGMKLWGVIAE  5450
             P+ ANRIT K                                    NISP MKLWGV+ E
Sbjct  74    PRFANRITLKVLNSLKLFLCRICFAALVLCTNQWLVPQPHQVDFYLNISPSMKLWGVVIE  133

Query  5449  VNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLD  5270
             VN+KDI+VSLPGG+RG V   E  D       N  + + +  + + HVGQLV C+VL +D
Sbjct  134   VNQKDIIVSLPGGMRGFVRTEEVSDIALHG--NSKDNEGSVCAEVVHVGQLVPCMVLQVD  191

Query  5269  DDKKEAGKWK-IWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGF  5093
             DDKKE    K +WLSLRL+ ++K L+LDAIQ+G++L+A +KS EDHGYIL+FG+ +FSGF
Sbjct  192   DDKKEGKAHKRVWLSLRLSRMYKGLSLDAIQDGMVLTAQVKSVEDHGYILYFGVSTFSGF  251

Query  5092  LPIHSQSVDKMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGM  4913
             +P   +   K+ +GQL++ VVK +D+ R +++LSS  D I+K + KDLKG+SID L+PGM
Sbjct  252   MPKAGKETVKIESGQLIQCVVKGIDKARSIIHLSSDEDLISKSIIKDLKGLSIDHLIPGM  311

Query  4912  MVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPA  4733
             M++A V SVLENGVMLSFLTYFTGT DIF+L   FP  +WKDDY +NKKVNARILF+DP+
Sbjct  312   MMSARVHSVLENGVMLSFLTYFTGTADIFNLSSSFPSGNWKDDYSKNKKVNARILFVDPS  371

Query  4732  TRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYIS  4553
             TRAVGL+LN HL+    PP  VKVG+I+++++V+RVDK  GL LEIP SP P+P +V I 
Sbjct  372   TRAVGLTLNQHLLRLNVPPINVKVGEIYDKSRVLRVDKKAGLFLEIP-SPTPSPGFVSIH  430

Query  4552  dvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVK  4373
             DV DK+VK +EK F+ G + RVRVLG R+LEG+A G+LK SAFEGSVFTH+DVKPGMV  
Sbjct  431   DVSDKDVKNVEKKFREGSLTRVRVLGVRHLEGVALGTLKDSAFEGSVFTHADVKPGMV--  488

Query  4372  AKVITVDSFGAIVQFSSGVKALCPLRHMSEFE-IVKPRKKFQVGSELVFRVLGCKSKRIT  4196
                           FSSGVKALCPL HMSE + IVKP KKF+ G+EL+FRVLGCKSKRIT
Sbjct  489   --------------FSSGVKALCPLPHMSELDNIVKPPKKFKAGAELLFRVLGCKSKRIT  534

Query  4195  VTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDP  4016
             VT+KK+LVKSKL++L+SY DA  GL+THGWITKIEKHGCFVRFYNGVQG    SELGL+P
Sbjct  535   VTYKKSLVKSKLEVLASYADAKIGLVTHGWITKIEKHGCFVRFYNGVQG----SELGLEP  590

Query  4015  GSDISSMYHVEQVVKCRV  3962
             G +  S+YHV QVVKCR+
Sbjct  591   GIEAESVYHVGQVVKCRI  608



>ref|XP_002972371.1| hypothetical protein SELMODRAFT_451250 [Selaginella moellendorffii]
 gb|EFJ26457.1| hypothetical protein SELMODRAFT_451250 [Selaginella moellendorffii]
Length=1634

 Score =  1179 bits (3051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 712/1807 (39%), Positives = 1041/1807 (58%), Gaps = 197/1807 (11%)
 Frame = -2

Query  5476  MKLWGVIAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQL  5297
             M+LWG ++ +N+ D+ +SLP GL                             G   + + 
Sbjct  1     MRLWGAVSGINKTDLSISLPNGLH----------------------------GFVKIDEA  32

Query  5296  VSCIVLHLDDDKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHF  5117
                    L DDK                              ++ + +KS EDHGY+L F
Sbjct  33    FPEYTPDLSDDK------------------------------LMISSVKSIEDHGYVLSF  62

Query  5116  GLPSFSGFLPIHSQSVDKMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGIS  4937
             GLP  SGFL       +K+  G++++  V ++D+ R V+ L++   + A    K+ + +S
Sbjct  63    GLPEMSGFLLHKDHQGEKLRVGEIMQSCVSAIDKKRGVINLTTMQLSSA---MKEHENLS  119

Query  4936  IDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNA  4757
             +  LVPG +VN  V +VL NGV+LSFLTYFTG VDIFHLQ V     W  DY + K+  A
Sbjct  120   LGTLVPGALVNGCVQAVLRNGVLLSFLTYFTGIVDIFHLQSVLSSKDWAQDYTEGKRFKA  179

Query  4756  RILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVP  4577
             RI+FID  T+ + LSL  HLV   A    +  GD+ E A++ RVD  +GLLLE+P++P  
Sbjct  180   RIIFIDARTKRIRLSLRSHLV--DAEIVSLNRGDVIEAARIKRVDPAIGLLLELPATP-H  236

Query  4576  TPAYVYISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSD  4397
                YV  +DV D +V K+EK FK G+ VR R++GFR ++ +AT +LK             
Sbjct  237   VAGYVNHADVSDVKVDKLEKKFKDGQRVRARIIGFRLMDRMATLTLK-------------  283

Query  4396  VKPGMVVKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLG  4217
               PG +V   +  V++ GA+V    GVK LCP++HMSE+  +KP  KF+VG ++ FRVL 
Sbjct  284   --PGALVHGVITRVEACGALVSLG-GVKGLCPVQHMSEYNRLKPSSKFEVGKKMKFRVLQ  340

Query  4216  C--KSKRITVTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFA  4043
                + K++++T KK+LV SKL ++++Y DA +GL+THGWI  I   GCF+ FYN V+G  
Sbjct  341   YDHEKKKLSLTFKKSLVSSKLPLITAYEDAVDGLVTHGWIQGISNIGCFMEFYNHVKGLV  400

Query  4042  PRSELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVV  3863
              RSELG+ P + I + +HV QVVKCRV+ S  + R++ LSF      +S    VKPG+VV
Sbjct  401   HRSELGIGPDTPIEAAFHVGQVVKCRVLESDLSKRRLRLSFN-----MSLRYNVKPGSVV  455

Query  3862  SGIVELVTPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDI  3683
             S ++  +    I + VN+    +  T+S +HLSD             PG E  +L     
Sbjct  456   SAVITQMGSSQIELQVND---DIASTMSYEHLSD------------TPGQEHSKL-----  495

Query  3682  EGFNLVLSAKYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRS  3503
                  VL+AKYSLI  A+ LP  ++Q+SP +V+ GY+  +      V FL  +TG  P  
Sbjct  496   -----VLTAKYSLIDAAESLPSSIHQLSPMAVLPGYISVIHDKYCLVSFLDNVTGLVPIG  550

Query  3502  KATDDRRYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHK  3323
              A+D    D S+VF++GQSV   +L+V+ E  +  +SLKQS C STD + IQ YFL E  
Sbjct  551   NASDGYLEDLSQVFFVGQSVRAQVLEVDSENEKFVLSLKQSACFSTDVSLIQGYFLEEEL  610

Query  3322  IAKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGI  3143
             IAKL+       GL+W +   +G +VE  V E+K++G+++  +   DV GF +  Q    
Sbjct  611   IAKLKE----KEGLDWGNKLQIGELVEADVQEVKDYGIILNLKDNADVVGFATHYQ-SNS  665

Query  3142  NVETGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQ  2963
              VE G+ ++A ++DV K + +VDLSL+   +   K +                  L+++Q
Sbjct  666   PVEVGAAVKACILDVVKTDGIVDLSLQKRMLKFKKTKAV----------------LQLHQ  709

Query  2962  SVNAVVEIVKENYLVLSVPACNYALGYASLNDFNTQNL-PVKQFVNGQSVIATIMALPDS  2786
              V  VVE+VK+ YLVLS+P    ++G+AS  D+N + L P   +  GQ   ATI +    
Sbjct  710   RVEVVVELVKDEYLVLSLPKFENSIGFASTRDYNIRVLRPHDHYSPGQKFSATIYSFGSE  769

Query  2785  STGGRLLLLLKAISEV----------AEsssskrgkknsSYDVGSLVQAEITDIKPLELR  2636
             S G R LLLL                A          + S+ +   +  +I +I  L + 
Sbjct  770   SVGERTLLLLADTKPTFFTYVKNDIGANHRRPGLFNLSGSFILILTILYQIQEISSLHMI  829

Query  2635  LKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARIVSKDSRSENKRGYQ--WELST  2462
             ++ G    G VHITE  D      PL  +  GQT+ A+I+SK  ++  K G     +LS 
Sbjct  830   IQAGISLRGNVHITEVVDQYEEGNPLRKYNAGQTVRAKILSK-RKTSRKHGNAPTLDLSL  888

Query  2461  KPSVLAGDMDGPHESFNYST---GQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEP  2291
             +PS L G+ D       + T   GQ + GYV +V   WAWL +S  +R +L+ILDSS +P
Sbjct  889   RPSELTGN-DSARSVITFETVTIGQTVVGYVQEVKESWAWLVLSPHLRGRLFILDSSDDP  947

Query  2290  SELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTLLITPEDTVPSSESARCHIREGSV  2111
             SEL+ FQ+RF VG +   +I S N EKK + L      + P+D            ++G +
Sbjct  948   SELERFQERFKVGDAFQCHIRSVNHEKKQVDLS-----LRPKDE---------DFKKGDL  993

Query  2110  LGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHS  1931
             LGGRI+++ PG GGL VQ+    FG+VH T L D W+ DP S + EG+FV+C+VL +  +
Sbjct  994   LGGRITRVRPGDGGLTVQVGWETFGRVHVTHLGDTWMDDPASLFTEGKFVRCRVLDLKPT  1053

Query  1930  VKGTTHVDLSLRWTLDTMNN-QNISEHDDVHSQNRR--VQDIKDLHPDMTVQGYVKNVTP  1760
             +KGT  ++LSLR +L      +++  +  +  ++    V  + +L  DM VQG+VK++T 
Sbjct  1054  LKGTKSLELSLRPSLGGHGGFESLPSYQTLERKSNACIVNSVSELQQDMQVQGFVKDLTE  1113

Query  1759  KGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSS  1580
             KGCF++LS  VDA+ILL NL+  F+++P + FP GKLV+G+++SV  LS  VE++L TS 
Sbjct  1114  KGCFVILSPSVDARILLKNLSSSFVQNPAEMFPAGKLVSGRILSVRPLSGHVEMSLTTSQ  1173

Query  1579  SATPRKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQ  1400
              ++  K+       F AG+I+SG+I+ IE+FG+F+++ +++ VGLCHVSE+SDD I ++ 
Sbjct  1174  ESSSWKT-------FCAGDIVSGRIRSIEAFGMFVALADSDGVGLCHVSEVSDDFIQDLP  1226

Query  1399  SRYKAGQTvrvkvlkvdkdRHRISLGMKNSYFRDDDGEDIQTTSRQSINSTDKGNSVFIG  1220
             + YK GQ V+VK+LKVD +  RISLGMK SY   DDG  ++T   + +       +V + 
Sbjct  1227  TLYKVGQRVQVKILKVDAETKRISLGMKASYLTPDDG--LETMDEEPVAEEPSTANVLME  1284

Query  1219  TQSTVFPESSDADIDVSVVNTTDNILTEVESRAS-IPPLEVPLDDIENSDIDDAVNKNPD  1043
             T      E    D+D           TE    A+ + PLEV L++    D++D V    +
Sbjct  1285  TDEK---EEDYLDLD-----------TEATPMATDVDPLEVNLEE----DVEDKVPVEDE  1326

Query  1042  HTGGADTTDekdkkramkkakkerereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFV  863
                 A+ + +K KK   +  ++       A E+ L +   P   D+FE+LV +SPNSS+V
Sbjct  1327  KPLTAEESKKKTKKEKKRLKEQREAAVRAAEEKFLQKDQPPETEDDFERLVAASPNSSYV  1386

Query  862   WIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMK  683
             WIKYMA+ L L D +KAR++A++A+ TIN REE EK+N+W AY NLE  Y   P+EAV  
Sbjct  1387  WIKYMAYWLRLADPDKARAVADRALETINYREEMEKMNIWTAYINLENSYAPSPREAVSA  1446

Query  682   VFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQN  503
             +F+RA++YCDPKK+HL+LLGVYE T  +++ D L++ M +KFK S K+WLR +   L + 
Sbjct  1447  LFERAMKYCDPKKLHLSLLGVYESTNQHEMTDALMKSMTRKFKTSTKVWLRHVSNLLGRG  1506

Query  502   -QDNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWS  326
               D ++    +A + LP+HKHIKFI++ AILEFK G  +R R +F+ +L+ YPK+TDLWS
Sbjct  1507  LSDKARKAFEQACVALPRHKHIKFISRAAILEFKSGSPERAREIFDGVLRNYPKKTDLWS  1566

Query  325   VYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAM  146
             VYLDQEIR+GD  ++R LFERA  L +P KKMKFLFKKYL +EK  GDE RIE VK KAM
Sbjct  1567  VYLDQEIRLGDTAIVRNLFERATCLDLPAKKMKFLFKKYLDFEKGQGDETRIEHVKTKAM  1626

Query  145   EYVESLA  125
             E+VE+ A
Sbjct  1627  EFVEAKA  1633



>gb|AAF23213.1|AC016795_26 putative pre-rRNA processing protein, 5' partial [Arabidopsis 
thaliana]
Length=1111

 Score =  1161 bits (3003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 641/1148 (56%), Positives = 835/1148 (73%), Gaps = 65/1148 (6%)
 Frame = -2

Query  3499  ATDDRRYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKI  3320
             A DD + D SE F++GQSV  NI+DVN E  RIT+SLKQS C+S DA+F+QEYFL++ KI
Sbjct  1     AIDDPKADVSESFFVGQSVRANIVDVNQEKSRITLSLKQSSCASVDASFVQEYFLMDEKI  60

Query  3319  AKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGIN  3140
             + LQS D   S  +WV+ F +GS+++G + E  + GVVV F+  ++V GFI    +GG  
Sbjct  61    SDLQSSDITKSDCSWVEKFSIGSLIKGTIQEQNDLGVVVNFDNINNVLGFIPQHHMGGAT  120

Query  3139  VETGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQS  2960
             +  GS + A V+D+S+ E LVDLSL+PE +N    + +N  + KKKRKR   K+LEV+Q 
Sbjct  121   LVPGSVVNAVVLDISRAERLVDLSLRPELLNNLTKEVSN--SSKKKRKRGISKELEVHQR  178

Query  2959  VNAVVEIVKENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSST  2780
             V+AVVEIVKE +LVLS+P   Y +GYAS++D+NTQ LPVKQF  GQSV+A++ A+ +  T
Sbjct  179   VSAVVEIVKEQHLVLSIPEHGYTIGYASVSDYNTQKLPVKQFSTGQSVVASVKAVQNPLT  238

Query  2779  GGRLLLLLKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVH  2600
              GRLLLLL ++S  +E+S SKR KK SS +VGS+V AE+ D                   
Sbjct  239   SGRLLLLLDSVSGTSETSRSKRAKKKSSCEVGSVVHAEVNDA------------------  280

Query  2599  ITEATDDNTTEGPLNDFRIGQTLTARIVSKDSRSENKRGYQWELSTKPSVL--AGDMDGP  2426
                    +T++ P   FR+GQ+++AR+V+K   ++ K+   WELS KP++L  + + +  
Sbjct  281   -------STSDEPFAKFRVGQSISARVVAKPCHTDIKKTQLWELSVKPAMLKDSSEFNDT  333

Query  2425  HES--FNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVG  2252
              ES    ++ GQ + GYV+KVD EW WL +SR V A+++ILD+S +  EL+EF++RF +G
Sbjct  334   QESEQLEFAAGQCVIGYVYKVDKEWVWLAVSRNVTARIFILDTSCKAHELEEFERRFPIG  393

Query  2251  KSVSGYILSANKEKKLLRLVPHTLLI--------------TPEDTVPSSESARCHIREGS  2114
             K+VSGY+L+ NKEKK LRLV   LL                P+ ++P  +     I EG 
Sbjct  394   KAVSGYVLTYNKEKKTLRLVQRPLLFIHKSIANGGGSKTDKPDSSIPGDDDT-LFIHEGD  452

Query  2113  VLGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGH  1934
             +LGGRISKILPGVGGL VQ+  ++FG+VHFTE+ D WV DPL G+ EGQFVKCKVL++  
Sbjct  453   ILGGRISKILPGVGGLRVQLGPYVFGRVHFTEINDSWVPDPLDGFREGQFVKCKVLEISS  512

Query  1933  SVKGTTHVDLSLRWTLDTMNNQNISEHDDVHSQN--RRVQDIKDLHPDMTVQGYVKNVTP  1760
             S KGT  ++LSLR +LD M++ +    D  ++ N  +R + I+DL PDM VQGYVKN   
Sbjct  513   SSKGTWQIELSLRTSLDGMSSADHLSEDLKNNDNVCKRFERIEDLSPDMGVQGYVKNTMS  572

Query  1759  KGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSS  1580
             KGCFI+LSR V+AK+ LSNL D F++ PEKEFPVGKLVTG+V++VE LSKR+EVTL+T +
Sbjct  573   KGCFIILSRTVEAKVRLSNLCDTFVKEPEKEFPVGKLVTGRVLNVEPLSKRIEVTLKTVN  632

Query  1579  SATPRKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQ  1400
             +    KS+   L     G++ISG+I+R+E FGLFI +D T +VGLCH+S+LSDD ++NVQ
Sbjct  633   AGGRPKSESYDLKKLHVGDMISGRIRRVEPFGLFIDIDQTGMVGLCHISQLSDDRMENVQ  692

Query  1399  SRYKAGQTvrvkvlkvdkdRHRISLGMKNSYFRDDDGEDIQ-----TTSRQSINSTDKGN  1235
             +RYKAG++VR K+LK+D+++ RISLGMK+SY  + D +  Q      TS +     D  +
Sbjct  693   ARYKAGESVRAKILKLDEEKKRISLGMKSSYLMNGDDDKAQPLSEDNTSMECDPINDPKS  752

Query  1234  SVFIGTQSTVFPESSDADIDVSVVNTTDNILTEVESRASIPPLEVPLDDIENSDIDDAVN  1055
              V        F E+S           T  +L +VESRASIPPLEV LDDIE +D D +  
Sbjct  753   EVLAAVDDFGFQETSGG---------TSLVLAQVESRASIPPLEVDLDDIEETDFDSS--  801

Query  1054  KNPDHTGGADTTDekdkkramkkakkerereiraaeerlleKDIPRNTDEFEKLVRSSPN  875
             +N +   GA+  DEK K+R  +K K+ERE++I+AAE RLLE   P N DEFEKLVRSSPN
Sbjct  802   QNQEKLLGANK-DEKSKRREKQKDKEEREKKIQAAEGRLLEHHAPENADEFEKLVRSSPN  860

Query  874   SSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQE  695
             SSFVWIKYMAFMLSL D+EKARSIAE+A+ TINIREE EKLN+WVAYFNLE E+GNPP+E
Sbjct  861   SSFVWIKYMAFMLSLADIEKARSIAERALRTINIREEEEKLNIWVAYFNLENEHGNPPEE  920

Query  694   AVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWA  515
             +V KVF+RA QYCDPKKV+LALLGVYERTE YKL D+LL++M+KKFK SCKIWLR+IQ +
Sbjct  921   SVKKVFERARQYCDPKKVYLALLGVYERTEQYKLADKLLDEMIKKFKQSCKIWLRKIQSS  980

Query  514   LKQNQDNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTD  335
             LKQN++  QS+VNRALLCLP+HKHIKFI+QTAILEFKCGVADRGRS+FE +L+EYPKRTD
Sbjct  981   LKQNEEAIQSVVNRALLCLPRHKHIKFISQTAILEFKCGVADRGRSLFEGVLREYPKRTD  1040

Query  334   LWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKR  155
             LWSVYLDQEIR+G+ DVIR+LFERAISLS+PPKKMKFLFKK+L YEKSVGDEER+E VK+
Sbjct  1041  LWSVYLDQEIRLGEDDVIRSLFERAISLSLPPKKMKFLFKKFLEYEKSVGDEERVEYVKQ  1100

Query  154   KAMEYVES  131
             +AMEY  S
Sbjct  1101  RAMEYANS  1108



>ref|XP_008350258.1| PREDICTED: LOW QUALITY PROTEIN: rRNA biogenesis protein rrp5-like 
[Malus domestica]
Length=1111

 Score =  1148 bits (2970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 667/1228 (54%), Positives = 841/1228 (68%), Gaps = 145/1228 (12%)
 Frame = -2

Query  3739  MKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSL-ISTAQQLPLDVNQISPHSVVHGYVCNV  3563
             M+SVLKPGYEFDQLLVLDIEG NL+LSAK  L +      P +++Q+ P+S+VHGY+CN+
Sbjct  1     MRSVLKPGYEFDQLLVLDIEGNNLILSAKIFLXLIHFSSXPSELSQVHPNSLVHGYICNL  60

Query  3562  IGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQ  3383
             I  G FVRFLGRLTGFSPR K                                       
Sbjct  61    IETGCFVRFLGRLTGFSPRHK---------------------------------------  81

Query  3382  SLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVV  3203
                         EYF+LE KIA LQ L+S +S  NW +GF +GS++EGKV E+K+ GVVV
Sbjct  82    ------------EYFMLEEKIATLQLLNSKESKSNWSEGFTIGSVLEGKVQEVKDVGVVV  129

Query  3202  TFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTAN  3023
             +FEKY+DVFGFI+  QLGG  VETGS++ A V+         D++     V+ S  Q   
Sbjct  130   SFEKYNDVFGFITHYQLGGTVVETGSSVHAVVL---------DVAKAEHLVDLSMKQEFT  180

Query  3022  DKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGYASLNDFNTQNLPV  2843
             +K ++   K+  +K                                             +
Sbjct  181   NKFKESSDKKSHKK---------------------------------------------I  195

Query  2842  KQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkknsSYDVGSLVQAEI  2663
               FV+     AT+MALP  +T GRLLLLLK+ISE   SSS +  KK+S   VGS+V+AEI
Sbjct  196   VVFVD-----ATVMALPSPTTTGRLLLLLKSISESETSSSKRAKKKSSYK-VGSMVEAEI  249

Query  2662  TDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARIVSKDSRSEN-KR  2486
             T+IKPLELRLKFG G HGRVHITE  D+   E P N+FRIGQT+ A+IV+K + S+N K+
Sbjct  250   TEIKPLELRLKFGIGXHGRVHITELNDE-FLEDPFNNFRIGQTVAAKIVAKTNYSDNNKK  308

Query  2485  GYQWELSTKPSVLAGDMDGPH----ESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQL  2318
              YQW+LS K ++L G  +       E  ++STGQ +SGYV+KVD EW WLTISR VRAQL
Sbjct  309   SYQWDLSLKSTMLXGSCEIGEKIITEDLDFSTGQCVSGYVYKVDGEWVWLTISRSVRAQL  368

Query  2317  YILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTLLITPEDTVPS----  2150
             +ILDS+ EPSELKEFQKRF++G +VSGY+LS N+EKKLLRLV H      + TV      
Sbjct  369   FILDSACEPSELKEFQKRFHLGNAVSGYVLSVNREKKLLRLVLHPFSPISDKTVDHGVPK  428

Query  2149  ---------SESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVS  1997
                      +E+   HIREG V+GGRI K L GV G+ VQI  HL+G+VH+TEL D W S
Sbjct  429   MDDSHINIMNENVTAHIREGRVIGGRIIKKLXGVSGMTVQIGPHLYGRVHYTELYDSWES  488

Query  1996  DPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTL-DTMNNQNISEHDDVHSQNRRVQ  1820
             DPLSGY EGQFVKCKVL++  SVKGT H+DLSLR +L   +    +   DD  SQ +RV+
Sbjct  489   DPLSGYHEGQFVKCKVLELIRSVKGTFHIDLSLRASLVGGLRPDFVEPQDDTXSQTKRVE  548

Query  1819  DIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTG  1640
              I+DL+P+M VQGYVKNV PKGCFI+LSRK+DAKIL+SNL+DG+++  EKEFPVGKLVTG
Sbjct  549   TIEDLNPNMVVQGYVKNVIPKGCFILLSRKLDAKILVSNLSDGYVQDLEKEFPVGKLVTG  608

Query  1639  KVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNT  1460
             +V SVE LSKRVEVTL+  ++++  +   D L++   G+IISG++KR+ES+GLFI++DNT
Sbjct  609   RVSSVEPLSKRVEVTLKXLNTSSVPQFGSDNLDSLRVGDIISGRVKRMESYGLFITIDNT  668

Query  1459  NLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSYFRDDDGEDI  1280
             NLVGLCHVSELS+D +DN++++YK G+ V  KVLKVDK+RHR+SLGMK+ Y  D+D  D+
Sbjct  669   NLVGLCHVSELSEDKLDNIETKYKTGERVTAKVLKVDKERHRVSLGMKDVYIMDND--DL  726

Query  1279  QTTSRQSINSTDKGNSVFIGTQSTVFPESSD---ADIDVSVVNTTDNILTEVESRASIPP  1109
             +T S Q  + T   N +   T S + PES+     D+DV   N     L + ESRA +PP
Sbjct  727   ETPSEQDPDETIVENVLTDVTMSDICPESNSFFTQDMDVDSKNAESQFLAQAESRAFVPP  786

Query  1108  LEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkramkkakkerereiraaeerlleK  929
             L+V LDDI+  D +D  + +       DT +EK  +   KKAK+EREREIR+AEERLL  
Sbjct  787   LDVTLDDIDQFDGEDKEHLD------VDTVNEKKMQPTKKKAKEEREREIRSAEERLLAN  840

Query  928   DIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEK--  755
             DIPR  +E+EKLVR+SPNSSFVWIKYM F+LS  +VEKARSIAE+A++TI + +E+EK  
Sbjct  841   DIPRTDEEYEKLVRTSPNSSFVWIKYMEFVLSASNVEKARSIAERALATIKLDKETEKEK  900

Query  754   LNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLE  575
             LNVWVAYFNLE +Y +PP+EAV KVFQRA+Q  D K VHLALLG+YERTE ++L DELL+
Sbjct  901   LNVWVAYFNLENKYXSPPEEAVKKVFQRAVQCNDSKTVHLALLGLYERTEQHRLADELLD  960

Query  574   KMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGV  395
             KM KKFK SCK+WLRR++  L + QD  Q +++RA   LPKHK IKF +QTAILEFKCG 
Sbjct  961   KMTKKFKTSCKVWLRRVKLLLTRQQDGIQDVLSRAEKVLPKHKLIKFNSQTAILEFKCGE  1020

Query  394   ADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFK  215
              +RGRSMFE +L+  PKRTDLWSVYLDQEIR+G+ D+I ALFERA SLS+P KKMKFLFK
Sbjct  1021  PERGRSMFENILRNNPKRTDLWSVYLDQEIRLGNSDLIHALFERATSLSLPAKKMKFLFK  1080

Query  214   KYLAYEKSVGDEERIESVKRKAMEYVES  131
             KYLAYEKS GDEE+IE VKRKAMEYVE+
Sbjct  1081  KYLAYEKSRGDEEKIEYVKRKAMEYVEN  1108



>tpg|DAA59938.1| TPA: hypothetical protein ZEAMMB73_957052, partial [Zea mays]
Length=1207

 Score =  1134 bits (2932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 602/1149 (52%), Positives = 809/1149 (70%), Gaps = 75/1149 (7%)
 Frame = -2

Query  5713  DFPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhklykKNQ-SVEDDLGSLFGHS  5537
             DFPRGG SLLSK+E+ E RAE + +FE E +  K K++    + +   V+DDLG LFG +
Sbjct  66    DFPRGGHSLLSKDEMAEARAEAEQDFEREAKKGKGKRKRSGGESSGFGVDDDLGILFGGA  125

Query  5536  ISGKLPKSANRITPK---------------------------------------------  5492
              +GKLP+ ANRIT K                                             
Sbjct  126   TTGKLPRFANRITVKVGDSEIKITAAEASRARSKIEWSSSGIEGLFWTVSVARIWYKLCT  185

Query  5491  -------NISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQS  5333
                    NISP MKLWGV+ EVN+KDIV+SLPGG+RG V + +  D     + N  +  +
Sbjct  186   SMHIKIKNISPNMKLWGVVIEVNQKDIVLSLPGGIRGFVRSEDVCDIAL--QENRKDSGN  243

Query  5332  NYLSGLFHVGQLVSCIVLHLDDDKKEAG-KWKIWLSLRLALLHKNLTLDAIQEGIILSAY  5156
             N  + + HVGQLV CIVL +DDD +E     ++WLSLRL+LL+K L LD +QEG++L+A 
Sbjct  244   NLCAEVVHVGQLVPCIVLRVDDDSREGKVNKRVWLSLRLSLLYKGLALDGLQEGMVLTAQ  303

Query  5155  IKSTEDHGYILHFGLPSFSGFLPIHSQSVDKMNTGQLVEGVVKSVDRTRKVVYLSSAPDA  4976
             +KS EDHGYILHFG+ SFSGF+    +   K    QL++ VVK++D+TR +V+LSS  D 
Sbjct  304   VKSIEDHGYILHFGVSSFSGFMQKDDKEDVKTERRQLMQCVVKAIDKTRAIVHLSSDEDL  363

Query  4975  IAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPS  4796
             ++K   KDLKG+SID L+PGMMVNA V S LENG+MLSFLTYF+GTVDIF+L   FP  +
Sbjct  364   LSKSTIKDLKGLSIDHLIPGMMVNARVHSFLENGLMLSFLTYFSGTVDIFNLLNSFPSGN  423

Query  4795  WKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKG  4616
             WKDDY +NKKVNARILF+DP+TRAVGL+LN HL+H + PP  +K GDI++++KV+RVDK 
Sbjct  424   WKDDYSKNKKVNARILFVDPSTRAVGLTLNKHLLHLEVPPINLKAGDIYDKSKVLRVDKK  483

Query  4615  LGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLK  4436
              GL LEIP SP P+P ++ I      +  K  + FK G  +RVR+LG RNLEG+A G++K
Sbjct  484   AGLFLEIP-SPTPSPGFISIR-DVSDKDAKNLEKFKEGSSLRVRILGVRNLEGVAIGTIK  541

Query  4435  TSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFE-IVKPRK  4259
              SAFEGSVFTH DVKPGM+V+AKV TV+ FGAIVQFSSGVKALCPL HMSE E +VKP K
Sbjct  542   DSAFEGSVFTHDDVKPGMLVRAKVATVEPFGAIVQFSSGVKALCPLPHMSELEHVVKPPK  601

Query  4258  KFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGC  4079
             KF+VG+EL+FRVLGCKSKR+TVT+KK+LVKSKLD+LSSY DA  GL+THGWIT IEKHGC
Sbjct  602   KFKVGAELLFRVLGCKSKRVTVTYKKSLVKSKLDVLSSYADAKIGLVTHGWITHIEKHGC  661

Query  4078  FVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRL  3899
             FV+FYNGVQGF  RS+LGL+ G++  ++YHV QVVKCR+++  PASR++ +SF     R+
Sbjct  662   FVKFYNGVQGFVSRSDLGLEAGTEAENVYHVGQVVKCRIINVIPASRKLNVSFVISHNRI  721

Query  3898  SETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKP  3719
             +  +  K G++VSG+VE +TP ++VV+VN      KGT+  +HL+DH G A  +K+VLKP
Sbjct  722   APIDTPKLGSIVSGVVERLTPAAVVVSVNGFS---KGTILNEHLADHHGQAAQLKNVLKP  778

Query  3718  GYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQISPHSVVHGYVCNVIGNGVFVR  3539
             G+EF+QLLVLD EG NLVLSAK+SLI+ A  +P +++Q+ P  VVHGY+CN+I  G FVR
Sbjct  779   GHEFNQLLVLDTEGQNLVLSAKHSLINCANDIPSEISQMHPGVVVHGYICNIIEAGCFVR  838

Query  3538  FLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDA  3359
             FLG LTGFSP+ KA D      S+ FY+GQSV ++IL VN ET R+ ++L+QS+CSS D+
Sbjct  839   FLGHLTGFSPKDKAVDRWIEKLSDAFYVGQSVRSHILSVNAETARVKLALQQSMCSSMDS  898

Query  3358  TFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDV  3179
             +FIQ YFLL+ KIA L+      S  +W   FG+GS+VE +V  I+E+G+++ F+ + D 
Sbjct  899   SFIQGYFLLDQKIAALKY-----SSNDWARHFGIGSLVEAEVGAIEEYGIILNFKDHLDT  953

Query  3178  FGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKR  2999
              G I   QLGG +VE GS+++  V+D+S  + +V+LS+KPE ++     +     +KKKR
Sbjct  954   VGLIEHHQLGGSSVEVGSSVKGLVLDLS--DGVVNLSVKPELID-----SVRIVGKKKKR  1006

Query  2998  KREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQS  2819
             +R    DLE+++ VNAVVEI+K++Y+VLS+P  NYA+G++ L D+N+Q LP   + NGQ 
Sbjct  1007  QRAVVADLELHEEVNAVVEIIKDSYMVLSIPEYNYAIGFSPLMDYNSQLLPHHHYDNGQR  1066

Query  2818  VIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLEL  2639
             +   +  +P S + GRL+LL KA ++ +  S SKR KK S Y +GSLV+AEI DIKPLEL
Sbjct  1067  ITVVVGNIPSSDSSGRLILLPKASAQYSSLSDSKRAKKKSGYKIGSLVEAEIIDIKPLEL  1126

Query  2638  RLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARIVSKDSRS-ENKRGYQWELST  2462
              LKFG   HGR+HITE  ++++ E P ++ RIGQ LTARIVS+   S ++ + ++WELS 
Sbjct  1127  LLKFGGNLHGRIHITEILEEDSAEHPFSELRIGQKLTARIVSEAEPSGKSGKKFKWELSI  1186

Query  2461  KPSVLAGDM  2435
             +P ++ G+ 
Sbjct  1187  RPCIVNGEF  1195


 Score = 79.0 bits (193),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 128/652 (20%), Positives = 261/652 (40%), Gaps = 102/652 (16%)
 Frame = -2

Query  3256  GSIVEGKVHEIKEFGVVVTFEKY----DDVFGFISGGQLGGI--NVETGSTIQAAVIDVS  3095
             G +V  +VH   E G++++F  Y     D+F  ++    G    +      + A ++ V 
Sbjct  383   GMMVNARVHSFLENGLMLSFLTYFSGTVDIFNLLNSFPSGNWKDDYSKNKKVNARILFVD  442

Query  3094  KIEHLVDLSLKPEFVNGSKPQT---ANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENY  2924
                  V L+L    ++   P     A D   K K                 V+ + K+  
Sbjct  443   PSTRAVGLTLNKHLLHLEVPPINLKAGDIYDKSK-----------------VLRVDKKAG  485

Query  2923  LVLSVPACNYALGYASLNDFNTQNLP-VKQFVNGQSVIATIMALPDSSTGGRLLLLLKAI  2747
             L L +P+   + G+ S+ D + ++   +++F  G S+   I+ + +        L   AI
Sbjct  486   LFLEIPSPTPSPGFISIRDVSDKDAKNLEKFKEGSSLRVRILGVRN--------LEGVAI  537

Query  2746  SEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNTTE  2567
               + +S+       +     G LV+A++  ++P    ++F SG      +   ++     
Sbjct  538   GTIKDSAFEGSVFTHDDVKPGMLVRAKVATVEPFGAIVQFSSGVKALCPLPHMSELEHVV  597

Query  2566  GPLNDFRIGQTLTARIVSKDSRSENKRGYQWELSTKPSVLAGDMDGPHESFNYSTGQLLS  2387
              P   F++G  L  R++   S+       +  ++ K S++   +D      +   G +  
Sbjct  598   KPPKKFKVGAELLFRVLGCKSK-------RVTVTYKKSLVKSKLDVLSSYADAKIGLVTH  650

Query  2386  GYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILS---ANK  2216
             G++  ++    ++     V+  +   D   E     E +  ++VG+ V   I++   A++
Sbjct  651   GWITHIEKHGCFVKFYNGVQGFVSRSDLGLEAG--TEAENVYHVGQVVKCRIINVIPASR  708

Query  2215  EKKLLRLVPHTLLITPEDTVPSSESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFG  2036
             +  +  ++ H   I P DT           + GS++ G + ++ P    ++V ++    G
Sbjct  709   KLNVSFVISHNR-IAPIDTP----------KLGSIVSGVVERLTPA--AVVVSVNGFSKG  755

Query  2035  KVHFTELRDPWVSDPLSGYCEGQFVKCK-VLQVGHSVKGTTHVDLSLRWTLDTMNNQNI-  1862
              +    L D            GQ  + K VL+ GH        + +    LDT   QN+ 
Sbjct  756   TILNEHLADH----------HGQAAQLKNVLKPGH--------EFNQLLVLDT-EGQNLV  796

Query  1861  --SEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGF  1688
               ++H  ++  N    +I  +HP + V GY+ N+   GCF+     +          D +
Sbjct  797   LSAKHSLINCANDIPSEISQMHPGVVVHGYICNIIEAGCFVRFLGHLTGFSPKDKAVDRW  856

Query  1687  IESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSS------------------ATPRK  1562
             IE     F VG+ V   ++SV + + RV++ L+ S                    A  + 
Sbjct  857   IEKLSDAFYVGQSVRSHILSVNAETARVKLALQQSMCSSMDSSFIQGYFLLDQKIAALKY  916

Query  1561  SDIDALNNFSAGNIISGKIKRIESFGLFISV-DNTNLVGLCHVSELSDDHID  1409
             S  D   +F  G+++  ++  IE +G+ ++  D+ + VGL    +L    ++
Sbjct  917   SSNDWARHFGIGSLVEAEVGAIEEYGIILNFKDHLDTVGLIEHHQLGGSSVE  968



>ref|XP_009631714.1| PREDICTED: protein RRP5 homolog [Nicotiana tomentosiformis]
Length=628

 Score =   839 bits (2167),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/556 (79%), Positives = 489/556 (88%), Gaps = 15/556 (3%)
 Frame = -2

Query  5818  IKNP--KNFKRKGKNNEAGNASFSGKSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVD  5645
             ++NP  K FK KGK    G+ S    + PLQLED+VPDFPRGG S LS+EELDEVRAEVD
Sbjct  21    VQNPSKKPFKAKGK----GDVS----TMPLQLEDDVPDFPRGGGSSLSREELDEVRAEVD  72

Query  5644  AEFEAEDRylkkk--kqhklykKNQSVEDDLGSLFGHSISGKLPKSANRITPKNISPGMK  5471
             AEFEAE+R LKKK  KQ+ + + NQS EDDLGSLFG  I+GKLP+ ANR+T KNISPGMK
Sbjct  73    AEFEAEERLLKKKGKKQNTVQRSNQSTEDDLGSLFGGGINGKLPRFANRVTLKNISPGMK  132

Query  5470  LWGVIAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVS  5291
             LWGV++EVNEKDIVVSLPGGLRGLV ASEA  P  ++     EM +N LS ++HVGQLVS
Sbjct  133   LWGVVSEVNEKDIVVSLPGGLRGLVRASEAVPPFVEDGAKLSEMNTNLLSIVYHVGQLVS  192

Query  5290  CIVLHLDDDKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGL  5111
             CIVLHLDDDKKEAGK KIWLSLRLALLHK+LTLD IQEG+ILSAY+KS EDHGYILHFGL
Sbjct  193   CIVLHLDDDKKEAGKRKIWLSLRLALLHKSLTLDVIQEGMILSAYVKSMEDHGYILHFGL  252

Query  5110  PSFSGFLPIHSQSVD---KMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGI  4940
             PSFSGF+P  +QS +   K+ +GQLV+GVVKS+DRTRKVVYLSS PD ++K VTKDLKGI
Sbjct  253   PSFSGFMPKDNQSANVEVKIRSGQLVQGVVKSIDRTRKVVYLSSDPDVVSKCVTKDLKGI  312

Query  4939  SIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVN  4760
             SIDLLVPGMMVNASV S+LENG+MLSFLTYFTGT D+F+LQQ FP  SWK DYPQNKKVN
Sbjct  313   SIDLLVPGMMVNASVRSILENGIMLSFLTYFTGTADMFNLQQTFPSSSWKIDYPQNKKVN  372

Query  4759  ARILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPV  4580
             ARILFIDP+TRAVGL+LN HLVH KAPP+L+K GDIF+Q+KVIR+D+GLGLLLEIPSSPV
Sbjct  373   ARILFIDPSTRAVGLTLNSHLVHNKAPPALIKAGDIFDQSKVIRIDRGLGLLLEIPSSPV  432

Query  4579  PTPAYVYISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHS  4400
             PTPAYV +SDV DKEVKK+EK+FK GKVVRVRVLGFR+LEGLATG LKTSAFEGSVFTHS
Sbjct  433   PTPAYVNVSDVADKEVKKLEKSFKEGKVVRVRVLGFRHLEGLATGVLKTSAFEGSVFTHS  492

Query  4399  DVKPGMVVKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVL  4220
             DVKPGMVVKAKVI VDSFGAIVQFSSGVKALCPLRHMSEFEI+KPRKKFQVG+ELVFR+L
Sbjct  493   DVKPGMVVKAKVIAVDSFGAIVQFSSGVKALCPLRHMSEFEIIKPRKKFQVGAELVFRIL  552

Query  4219  GCKSKRITVTHKKTLV  4172
             GCKSKRITVTHKKTLV
Sbjct  553   GCKSKRITVTHKKTLV  568



>ref|XP_010464942.1| PREDICTED: protein RRP5 homolog [Camelina sativa]
Length=739

 Score =   837 bits (2161),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/691 (63%), Positives = 533/691 (77%), Gaps = 16/691 (2%)
 Frame = -2

Query  5743  APLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhklykKNQSVED  5564
             A LQLED VPDFPRGG S LS++E +++  EVDAEF+A++R  KK K  K  KK    + 
Sbjct  41    AALQLED-VPDFPRGGGSSLSRKEREKIYEEVDAEFDADERVSKKSKGGKSKKKKIPNDA  99

Query  5563  DLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLASE  5384
             D   L    ++GK P+ AN+IT KNISPGMKL GV+ EVN+KDIV+SLPGGLRGLV ASE
Sbjct  100   DDLGLLFGGLTGKRPRYANKITTKNISPGMKLLGVVTEVNQKDIVISLPGGLRGLVRASE  159

Query  5383  AHD----PLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLA  5216
             A D     + D+E NE+      L  +F VGQLV CIVL LDDD KEAGK KIWLSLRL+
Sbjct  160   ASDFTDLGIEDDE-NEL------LGDIFSVGQLVPCIVLQLDDDTKEAGKRKIWLSLRLS  212

Query  5215  LLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDK--MNTGQLV  5042
             LLHK  + D+ Q G++ SA +KS EDHGYILHFGLPS +GF+ I      K  M TGQL+
Sbjct  213   LLHKGFSFDSFQLGMVFSANVKSVEDHGYILHFGLPSITGFIEICDDGNQKSRMKTGQLI  272

Query  5041  EGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLS  4862
             +GVV  +DR RK++ L+S PD++AK +TKDL G+S DLL+PGMM+NA V SVLENG++  
Sbjct  273   QGVVTKIDRERKIIRLNSDPDSVAKCLTKDLNGMSFDLLIPGMMINARVQSVLENGILFD  332

Query  4861  FLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKA  4682
             FLTYF GTVD+FHL+      SWKD+Y QNK VNARILFIDP++RAVGL+LNPHLV  KA
Sbjct  333   FLTYFNGTVDLFHLKNPLSNKSWKDEYSQNKTVNARILFIDPSSRAVGLTLNPHLVCNKA  392

Query  4681  PPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPG  4502
             PP  V  G IF++AKV+R+DK  GLLLE+PS P  TPAYV   D    EVKK+EK +K G
Sbjct  393   PPLHVSSGGIFDEAKVVRIDKS-GLLLELPSKPASTPAYVSTYDAAGDEVKKLEKKYKEG  451

Query  4501  KVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSS  4322
               +RVR+LG + +EGLA G+LK SAFEG VF+HSDVKPGMV KAKVI+VDSFGAIVQF  
Sbjct  452   NHIRVRILGLKQMEGLAIGTLKESAFEGPVFSHSDVKPGMVTKAKVISVDSFGAIVQFPG  511

Query  4321  GVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSY  4142
             G+KA+CPLRHMSEFE+ KPRKKF+VG+ELVFRVLGCKSKRITVT+KKTLVKSKL IL SY
Sbjct  512   GLKAMCPLRHMSEFEVTKPRKKFKVGAELVFRVLGCKSKRITVTYKKTLVKSKLPILGSY  571

Query  4141  TDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRV  3962
             TDATEGL+THGWITKIEKHGCFVRFYNGVQGF PR ELGL+PGSD  S++HV +VVKCRV
Sbjct  572   TDATEGLVTHGWITKIEKHGCFVRFYNGVQGFVPRFELGLEPGSDPDSVFHVGEVVKCRV  631

Query  3961  VSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTV  3782
              S++  SR+I LS   +P  +SE + +K G++VSGI++ +T  +++V V + +  LKGT+
Sbjct  632   TSAAHGSRRITLSLMIKPASVSEDDSIKLGSIVSGIIDSITSQAVIVRVKS-KGVLKGTI  690

Query  3781  STQHLSDHRGLADLMKSVLKPGYEFDQLLVL  3689
             S +HL+DH   A LMKS+L+PGYE D+LLVL
Sbjct  691   SAEHLADHHEQAKLMKSLLRPGYELDKLLVL  721



>emb|CDY69691.1| BnaCnng64810D, partial [Brassica napus]
Length=661

 Score =   778 bits (2008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/678 (62%), Positives = 533/678 (79%), Gaps = 26/678 (4%)
 Frame = -2

Query  2164  DTVPSSESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLS  1985
             D+   S+ A   I EG +LGGRISKILPGVGGL VQI  ++FG+VHFTE+ D WVS+PL 
Sbjct  7     DSSIPSDDATLFIHEGDILGGRISKILPGVGGLRVQIGPYVFGRVHFTEINDSWVSNPLD  66

Query  1984  GYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISEHDDVHSQNRRVQDIKDL  1805
             G  EGQFVKC VL++ +S KGT  ++LSLR +LD M++ ++SE +      +R + I+DL
Sbjct  67    GLHEGQFVKCMVLEISNSSKGTLQIELSLRTSLDGMSSDHLSEANVF----KRFERIEDL  122

Query  1804  HPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSV  1625
              PDM ++GYVKN   KGCFIMLSR +DAK+LLSNL+D F++ PE EFPVGKLVTG+V++V
Sbjct  123   SPDMGIEGYVKNTMSKGCFIMLSRTLDAKVLLSNLSDTFVKDPENEFPVGKLVTGRVLNV  182

Query  1624  ESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGL  1445
             E LSKRVEVTL+  ++  P KS+   L  F  G+IISG+IKR+E++GLFI +D T +VGL
Sbjct  183   EPLSKRVEVTLKKGNAGGPPKSEPYDLKQFHVGDIISGRIKRVEAYGLFIEIDQTGMVGL  242

Query  1444  CHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSYFRDDDGEDIQTTSR  1265
             CH S+LSDDHI+++ +RY+AG++V  K+LK+D++R RISLGMK+SYF + D +  Q  S 
Sbjct  243   CHKSQLSDDHIEDIHTRYEAGESVTAKILKLDEERRRISLGMKSSYFVNGDDDTAQPRSE  302

Query  1264  QSINSTDKGNSVFIGTQSTVFPESSDADIDVSVVNTTDNILTEVESRASIPPLEVPLDDI  1085
             ++ +                   S + D  ++  N T   + +VESRASI PLEV LDDI
Sbjct  303   ENADEA-----------------SMECD-PINDSNGTSLAIAQVESRASILPLEVDLDDI  344

Query  1084  ENSDIDDAVNKNPDHTGGADTTDekdkkramkkakkerereiraaeerlleKDIPRNTDE  905
             E +D+D   N+      GAD  DEK K++  +K K+ERE++I+AAE RLLE   P + DE
Sbjct  345   EEADLDKNQNQK---LQGADK-DEKSKRKEKQKDKEEREKKIQAAEGRLLENHAPESADE  400

Query  904   FEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNL  725
             FEK+VRSSPNSSFVWIKYMAFMLSL D+EKARSIAE+A+ TINIREE EKLN+WVAYFNL
Sbjct  401   FEKMVRSSPNSSFVWIKYMAFMLSLADIEKARSIAERALRTINIREEEEKLNIWVAYFNL  460

Query  724   EIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSC  545
             E E+G+PP+EAV KVF+RA QYCDPKKV+ ALLGVYERTE YKL D+LL++MVKKFK SC
Sbjct  461   ENEHGSPPEEAVKKVFERARQYCDPKKVYNALLGVYERTEQYKLADKLLDEMVKKFKQSC  520

Query  544   KIWLRRIQWALKQNQDNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVADRGRSMFER  365
             K+WLR+IQ  LKQ+++N QS+VNRALLCLP+HKHIKFI+QTAILEFKCGVADRGRS+FE 
Sbjct  521   KVWLRKIQSYLKQDEENIQSVVNRALLCLPRHKHIKFISQTAILEFKCGVADRGRSLFEG  580

Query  364   MLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVG  185
             +L+EYPKRTDLWSVYLDQEIR+G++DVIR+LFERAISLS+PPKKMKFLFKK+L YEKS G
Sbjct  581   VLREYPKRTDLWSVYLDQEIRLGEVDVIRSLFERAISLSLPPKKMKFLFKKFLEYEKSAG  640

Query  184   DEERIESVKRKAMEYVES  131
             DEER+E VK++AMEY +S
Sbjct  641   DEERVEYVKQRAMEYADS  658


 Score = 59.7 bits (143),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 71/264 (27%), Positives = 122/264 (46%), Gaps = 27/264 (10%)
 Frame = -2

Query  2686  GSLVQAEITDIKPL--ELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARIVS  2513
             G ++   I+ I P    LR++ G    GRVH TE  +D+    PL+    GQ +   ++ 
Sbjct  22    GDILGGRISKILPGVGGLRVQIGPYVFGRVHFTE-INDSWVSNPLDGLHEGQFVKCMVLE  80

Query  2512  KDSRSENKRGYQWELSTKPSVLAGDMDGPHESF---------NYSTGQLLSGYVFKVDSE  2360
               + S  K   Q ELS + S+     D   E+          + S    + GYV    S+
Sbjct  81    ISNSS--KGTLQIELSLRTSLDGMSSDHLSEANVFKRFERIEDLSPDMGIEGYVKNTMSK  138

Query  2359  WAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTL  2180
               ++ +SR + A+  +L S+   + +K+ +  F VGK V+G +L+    + L + V  TL
Sbjct  139   GCFIMLSRTLDAK--VLLSNLSDTFVKDPENEFPVGKLVTGRVLNV---EPLSKRVEVTL  193

Query  2179  LITPEDTVPSSES---ARCHIREGSVLGGRISKILPGVGGLLVQID-AHLFGKVHFTELR  2012
                     P SE     + H+  G ++ GRI ++     GL ++ID   + G  H ++L 
Sbjct  194   KKGNAGGPPKSEPYDLKQFHV--GDIISGRIKRV--EAYGLFIEIDQTGMVGLCHKSQLS  249

Query  2011  DPWVSDPLSGYCEGQFVKCKVLQV  1940
             D  + D  + Y  G+ V  K+L++
Sbjct  250   DDHIEDIHTRYEAGESVTAKILKL  273



>emb|CDY69738.1| BnaCnng65100D, partial [Brassica napus]
Length=664

 Score =   776 bits (2003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/680 (62%), Positives = 530/680 (78%), Gaps = 27/680 (4%)
 Frame = -2

Query  2164  DTVPSSESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLS  1985
             D+    + A   I EG +LGGRISKILPGVGGL VQI  ++FG+VHFTE+ D W+S+PL 
Sbjct  7     DSSIPGDDATLFIHEGDILGGRISKILPGVGGLRVQIGPYVFGRVHFTEINDSWLSNPLD  66

Query  1984  GYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISEHDDVHSQN--RRVQDIK  1811
             G  EGQFVKCKVL++ +S KGT  ++LSLR +LD M++ +ISE     S N  +R + I+
Sbjct  67    GLHEGQFVKCKVLEISNSSKGTLQIELSLRTSLDGMSSDHISE---ASSNNVFKRFERIE  123

Query  1810  DLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVV  1631
             DL PDM ++GYVKN   KGCFIMLSR +DAK+LLSNL+D F++ PE EFPVGKLVTG+V+
Sbjct  124   DLSPDMGIEGYVKNTMSKGCFIMLSRTLDAKVLLSNLSDTFVKDPENEFPVGKLVTGRVL  183

Query  1630  SVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLV  1451
             +VE LSKRVEVTL+  ++  P KS+   L  F  G++ISG+IKR+E +GLFI +D T +V
Sbjct  184   NVEPLSKRVEVTLKKVNAGGPSKSESYDLKQFHVGDMISGRIKRVEPYGLFIEIDQTGMV  243

Query  1450  GLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSYFRDDDGEDIQTT  1271
             GLCH S+LSD+HI+++ +RY+AG++V  K+LK+D++R RISLGMK+SYF + D +  Q  
Sbjct  244   GLCHKSQLSDNHIEDIHARYEAGESVTAKILKLDEERRRISLGMKSSYFVNGDDDTAQPR  303

Query  1270  SRQSINSTDKGNSVFIGTQSTVFPESSDADIDVSVVNTTDNILTEVESRASIPPLEVPLD  1091
             S ++ +          G+                  N T   + +VESRASI PLEV LD
Sbjct  304   SEENADEASMECDPINGS------------------NGTSLAIAQVESRASILPLEVDLD  345

Query  1090  DIENSDIDDAVNKNPDHTGGADTTDekdkkramkkakkerereiraaeerlleKDIPRNT  911
             DIE +D+D   N+      GAD  DEK K+R  +K K+ERE++I+AAE RLLE   P + 
Sbjct  346   DIEEADLDKNQNQK---LQGADK-DEKSKRREKQKDKEEREKKIQAAEGRLLENHAPESA  401

Query  910   DEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYF  731
             DEFEK+VRSSPNSSFVWIKYMAFMLSL D+EKARSIAE+A+ TINIREE EKLN+WVAYF
Sbjct  402   DEFEKMVRSSPNSSFVWIKYMAFMLSLADIEKARSIAERALRTINIREEEEKLNIWVAYF  461

Query  730   NLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKH  551
             NLE E+G+PP+EAV KVF+RA QYCDPKKV+ ALLGVYERTE YKL D+LL++M+KKFK 
Sbjct  462   NLENEHGSPPEEAVKKVFERARQYCDPKKVYNALLGVYERTEQYKLADKLLDEMIKKFKQ  521

Query  550   SCKIWLRRIQWALKQNQDNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVADRGRSMF  371
             SCK+WLR+IQ  LKQ+++N QS+VNRALLCLP+HKHIKFI+QTAILEFKCGVADRGRS+F
Sbjct  522   SCKVWLRKIQSYLKQDEENIQSVVNRALLCLPRHKHIKFISQTAILEFKCGVADRGRSLF  581

Query  370   ERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYLAYEKS  191
             E +L+EYPKRTDLWSVYLDQEIR+G++DVIR+LFERAISLS+PPKKMKFLFKK+L YEKS
Sbjct  582   EGVLREYPKRTDLWSVYLDQEIRLGEVDVIRSLFERAISLSLPPKKMKFLFKKFLEYEKS  641

Query  190   VGDEERIESVKRKAMEYVES  131
              GDEER+E VK++AMEY +S
Sbjct  642   AGDEERVEYVKQRAMEYADS  661


 Score = 61.2 bits (147),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 67/264 (25%), Positives = 121/264 (46%), Gaps = 24/264 (9%)
 Frame = -2

Query  2686  GSLVQAEITDIKPL--ELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARIVS  2513
             G ++   I+ I P    LR++ G    GRVH TE  +D+    PL+    GQ +  +++ 
Sbjct  22    GDILGGRISKILPGVGGLRVQIGPYVFGRVHFTE-INDSWLSNPLDGLHEGQFVKCKVLE  80

Query  2512  KDSRSENKRGYQWELSTKPSVLAGDMDGPHESF------------NYSTGQLLSGYVFKV  2369
               + S  K   Q ELS + S+     D   E+             + S    + GYV   
Sbjct  81    ISNSS--KGTLQIELSLRTSLDGMSSDHISEASSNNVFKRFERIEDLSPDMGIEGYVKNT  138

Query  2368  DSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVP  2189
              S+  ++ +SR + A+  +L S+   + +K+ +  F VGK V+G +L+     K + +  
Sbjct  139   MSKGCFIMLSRTLDAK--VLLSNLSDTFVKDPENEFPVGKLVTGRVLNVEPLSKRVEVTL  196

Query  2188  HTLLITPEDTVPSSESARCHIREGSVLGGRISKILPGVGGLLVQID-AHLFGKVHFTELR  2012
               +         S +  + H+  G ++ GRI ++ P   GL ++ID   + G  H ++L 
Sbjct  197   KKVNAGGPSKSESYDLKQFHV--GDMISGRIKRVEP--YGLFIEIDQTGMVGLCHKSQLS  252

Query  2011  DPWVSDPLSGYCEGQFVKCKVLQV  1940
             D  + D  + Y  G+ V  K+L++
Sbjct  253   DNHIEDIHARYEAGESVTAKILKL  276



>ref|XP_002531583.1| programmed cell death protein, putative [Ricinus communis]
 gb|EEF30786.1| programmed cell death protein, putative [Ricinus communis]
Length=607

 Score =   766 bits (1978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/584 (68%), Positives = 472/584 (81%), Gaps = 25/584 (4%)
 Frame = -2

Query  5767  NASFSGKSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhkly  5588
             N + + ++   QLED+ P+FPRGGAS LS+ E +E+RAEVDAEFE+E+R L   K+    
Sbjct  39    NDAVAPEAMAFQLEDDAPEFPRGGASSLSRREREEIRAEVDAEFESEERSLMMMKKKNKG  98

Query  5587  kK----NQSVEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSL  5420
             KK    + S  DDLGSLFG  ++GKLP+ AN IT KNISPGMK+WGV+AEVNEKD+V+SL
Sbjct  99    KKLQNKSHSEADDLGSLFGDGLTGKLPRFANNITFKNISPGMKVWGVVAEVNEKDLVISL  158

Query  5419  PGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWK  5240
             PGGLRGL  + +A DP++ +E  ++E     L  +F  GQLVSC VL LD+DKK++G  K
Sbjct  159   PGGLRGLARSVDALDPVFGDEIEDIE---GNLPSIFCTGQLVSCTVLQLDEDKKDSGTRK  215

Query  5239  IWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQ---SV  5069
             I LSLRL+LLHK  +LDAIQEG++L+AY+KS EDHGYILHFGLPSF+GFLP +SQ   S 
Sbjct  216   IRLSLRLSLLHKGFSLDAIQEGMVLTAYVKSIEDHGYILHFGLPSFTGFLPKNSQDESSS  275

Query  5068  DKMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMS  4889
              ++ TGQL++G+V+ VD+TRKVVYLSS P A++K V KDLKGISIDLLVPGMMVNA V S
Sbjct  276   AEVKTGQLLQGIVRRVDKTRKVVYLSSDPSAVSKCVVKDLKGISIDLLVPGMMVNARVQS  335

Query  4888  VLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSL  4709
              L NG+MLSFLTYF+GTVDIFHLQ  F   +W+DDY  NKKVNARILF+DP+TRAVGL+L
Sbjct  336   TLGNGIMLSFLTYFSGTVDIFHLQNTFSASNWRDDYNNNKKVNARILFVDPSTRAVGLTL  395

Query  4708  NPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevk  4529
             N HLVH  APP+ VKVGDI++ AKV+RVDK +GLLLEIPS+PV TPAYV           
Sbjct  396   NQHLVHNHAPPTHVKVGDIYDGAKVVRVDKSMGLLLEIPSAPVSTPAYV-----------  444

Query  4528  kmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDS  4349
                 ++K G  VRVR+LG+R+LEGLATG LK SAFEG VFTHSDVKPGMVV+AK+I VDS
Sbjct  445   ----SYKEGSKVRVRILGYRHLEGLATGILKASAFEGPVFTHSDVKPGMVVRAKIIAVDS  500

Query  4348  FGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVK  4169
             FGAIVQF  G+KALCPLRHMSEFEI KPRKKF+VG+EL+FRVLGCKSKRITVTHKKTLVK
Sbjct  501   FGAIVQFPGGLKALCPLRHMSEFEIAKPRKKFKVGAELLFRVLGCKSKRITVTHKKTLVK  560

Query  4168  SKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPR  4037
             SKL ILSSY +AT+GLITHGWITKIEKHGCFV FYNGVQGFAPR
Sbjct  561   SKLAILSSYAEATDGLITHGWITKIEKHGCFVHFYNGVQGFAPR  604



>emb|CDY47904.1| BnaAnng09360D [Brassica napus]
Length=1402

 Score =   786 bits (2029),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/867 (49%), Positives = 589/867 (68%), Gaps = 66/867 (8%)
 Frame = -2

Query  5305  GQLVSCIVLHLDDDKKEAGKWKIWLSLRLALLH--KNLTLDAIQEGIILSAYIKSTEDHG  5132
             GQL+  +V ++D ++K         S+   +      ++ D +  G++++A ++S  ++G
Sbjct  269   GQLIQGVVTNIDKERKIVSLSSDPDSVAKCVTKDLSGMSFDLLIPGMMVNARVQSALENG  328

Query  5131  YILHFGLPSFSGFL-------PIHSQS-VDKMNTGQLVEGVVKSVDRTRKVVYLSSAPDA  4976
              +L F L  F+G +       P+ ++S  D+ N  ++V   +  +D + + V L+  P  
Sbjct  329   LLLGF-LMYFTGTVDLFHLQNPLCNKSWKDEYNPTKMVNARILFIDPSTRAVGLTLNPHL  387

Query  4975  IAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSF-----------LTYFTGTVDI  4829
             +        K   + +    +   A+V+ V ++G++L              TY     ++
Sbjct  388   VGN------KAPPLHVSSGDIFDEANVVRVDKSGLLLELPSKPVSTPAYVSTYDAAEDEV  441

Query  4828  FHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIF  4649
               L++ F          +  ++  R+L +    +  GL++   L H       V  GDIF
Sbjct  442   KKLEKKFK---------EGSRIRVRVLGL---KQIEGLAIGT-LKH-------VSSGDIF  481

Query  4648  EQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKVVRVRVLGFR  4469
             E+AKV+RVDK  GLLLE+PS PV TPAYV                FK G  +RVR+LG +
Sbjct  482   EEAKVVRVDKS-GLLLELPSKPVSTPAYV--------------SNFKEGNRIRVRILGLK  526

Query  4468  NLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGVKALCPLRHM  4289
             ++EGLA G+LK SAFEG  FTHSDVKPGMV KAK+I+VD+FGAIVQF  G+KA+CPL+HM
Sbjct  527   HMEGLAIGTLKESAFEGPAFTHSDVKPGMVTKAKIISVDTFGAIVQFPGGLKAMCPLQHM  586

Query  4288  SEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILSSYTDATEGLITHG  4109
             SEFE+ KPRKKF+VG+EL+FRVLGCKSKRITVT KKTLVKSKL ILSSY DATEGL+THG
Sbjct  587   SEFEVTKPRKKFKVGAELIFRVLGCKSKRITVTCKKTLVKSKLPILSSYADATEGLVTHG  646

Query  4108  WITKIEKHGCFVRFYNGVQGF-APRSELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQI  3932
             WITKIEKHGCFVRFYNGVQGF A R ELGL+PGSD SS++HV +VVKCRV S+   +R+I
Sbjct  647   WITKIEKHGCFVRFYNGVQGFVASRFELGLEPGSDPSSVFHVGEVVKCRVTSAVHGTRRI  706

Query  3931  VLSFTTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHLKGTVSTQHLSDHRG  3752
              LSF  +P  +SE + +K G++VSG+++ +TP ++ V+V + +  LKGT+  +HL+DH  
Sbjct  707   NLSFMMKPTSVSEDDSIKLGSIVSGVIDSITPQAVTVHVKS-KGLLKGTIFAEHLADHHD  765

Query  3751  LADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQISPHSVVHGYV  3572
              A+LM S+L+PG+E D+LLV+DIEG NL LS+KYSLI  A++LP D++Q+ P+SVVHGYV
Sbjct  766   QANLMISLLRPGFELDKLLVIDIEGNNLALSSKYSLIKFAEELPSDLSQLQPNSVVHGYV  825

Query  3571  CNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVNGETGRITVS  3392
             CN+I NG FVRFLGRLTGF+PRSKA D+ R D SE F++GQSV  NI+DVN E  R+T+S
Sbjct  826   CNLIENGCFVRFLGRLTGFAPRSKAIDEPRADLSESFFVGQSVRANIVDVNQEKSRVTLS  885

Query  3391  LKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFG  3212
             LKQS C+S DA+F+QEYFL + KI+ LQS D  +S  +WV+ F +G +++G V +  + G
Sbjct  886   LKQSSCASVDASFVQEYFLTDEKISNLQSSDITESECSWVEKFSIGILIKGTVQDKNDLG  945

Query  3211  VVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQ  3032
             +VV F+  ++V GFI    LGG ++E GS +QA V+D+S+ E LVDLSL+PE +N S  +
Sbjct  946   LVVNFDNINNVLGFIPKYHLGGTSLENGSVVQAVVLDISRAERLVDLSLRPELINSSAKE  1005

Query  3031  TANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGYASLNDFNTQN  2852
              +N +  KKKRKR   K+LEV+Q V+AVVEIVKE YL+LS+P  NY +GYA+++D+NTQ 
Sbjct  1006  VSN-RQSKKKRKRGISKELEVHQRVSAVVEIVKEQYLILSIPEHNYTIGYAAVSDYNTQK  1064

Query  2851  LPVKQFVNGQSVIATIMALPDSSTGGR  2771
             LPVKQF  GQSV+A++ AL +  T G+
Sbjct  1065  LPVKQFSTGQSVVASVEALQNPLTVGQ  1091


 Score =   512 bits (1319),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 298/573 (52%), Positives = 387/573 (68%), Gaps = 33/573 (6%)
 Frame = -2

Query  5749  KSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAED-RylkkkkqhklykKNQS  5573
             ++  LQLE EVPDFPRGG + LSK+E +++  EVDAEF+A D R  K+ K  K  K+N S
Sbjct  40    EAMALQLE-EVPDFPRGGGTSLSKKEREKIHEEVDAEFDAGDERVAKRSKGGKPKKRNTS  98

Query  5572  VEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVL  5393
               D+LGSLF   ++GK P+ AN+IT KNIS GMKL GV+ EVN+KDIVVSLPGGLRGLV 
Sbjct  99    DVDELGSLFDGGLTGKRPRYANKITIKNISAGMKLLGVVTEVNQKDIVVSLPGGLRGLVR  158

Query  5392  ASEAHDPL-WDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLA  5216
             ASEA D   +  E +E E+    L  +F VGQLV CIVL LDDDKKEAGK KIWLSLRL+
Sbjct  159   ASEALDFTDFGTEDDENEL----LRDIFSVGQLVPCIVLQLDDDKKEAGKRKIWLSLRLS  214

Query  5215  LLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDKMNTGQLVEG  5036
             LLHK  +LD+ Q G++++A +KS EDHGYIL FG+PS +GF+    +   ++ TGQL++G
Sbjct  215   LLHKGFSLDSFQPGMVVTANVKSVEDHGYILQFGMPSITGFIKKSHEETRELKTGQLIQG  274

Query  5035  VVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFL  4856
             VV ++D+ RK+V LSS PD++AK VTKDL G+S DLL+PGMMVNA V S LENG++L FL
Sbjct  275   VVTNIDKERKIVSLSSDPDSVAKCVTKDLSGMSFDLLIPGMMVNARVQSALENGLLLGFL  334

Query  4855  TYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPP  4676
              YFTGTVD+FHLQ      SWKD+Y   K VNARILFIDP+TRAVGL+LNPHLV  KAPP
Sbjct  335   MYFTGTVDLFHLQNPLCNKSWKDEYNPTKMVNARILFIDPSTRAVGLTLNPHLVGNKAPP  394

Query  4675  SLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKV  4496
               V  GDIF++A V+RVDK  GLLLE+PS PV TPAYV   D  + EVKK+EK FK G  
Sbjct  395   LHVSSGDIFDEANVVRVDKS-GLLLELPSKPVSTPAYVSTYDAAEDEVKKLEKKFKEGSR  453

Query  4495  VRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGV  4316
             +RVRVLG + +EGLA G+LK  +  G +F           +AKV+ VD  G +++  S  
Sbjct  454   IRVRVLGLKQIEGLAIGTLKHVS-SGDIFE----------EAKVVRVDKSGLLLELPS--  500

Query  4315  KALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRITVTHKKTLVKSKLDILS-SYT  4139
             K +    ++S          F+ G+ +  R+LG   K +      TL +S  +  + +++
Sbjct  501   KPVSTPAYVS---------NFKEGNRIRVRILGL--KHMEGLAIGTLKESAFEGPAFTHS  549

Query  4138  DATEGLITHGWITKIEKHGCFVRFYNGVQGFAP  4040
             D   G++T   I  ++  G  V+F  G++   P
Sbjct  550   DVKPGMVTKAKIISVDTFGAIVQFPGGLKAMCP  582


 Score =   335 bits (860),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 165/328 (50%), Positives = 228/328 (70%), Gaps = 19/328 (6%)
 Frame = -2

Query  2575  TTEGPLNDFRIGQTLTARIVSKDSRSENKRGYQWELSTKPSVL--AGDMDGPHESFNYST  2402
             + E   N   +GQ+++AR+V+K   ++NK+   WELS KP++L  +G++    E   + +
Sbjct  1079  SVEALQNPLTVGQSVSARVVAKPCHTDNKKSQLWELSVKPAILRDSGELTEVREQLEFVS  1138

Query  2401  GQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSA  2222
             G+ + GYV+KVD EW WL ISR V A+++ILD++ E  EL+EF+ RF +GK+VSGY+L+ 
Sbjct  1139  GEPVCGYVYKVDKEWVWLAISRNVTARIFILDTACEARELEEFEGRFPIGKAVSGYVLTY  1198

Query  2221  NKEKKLLRLVPHTLLITPE-------------DTVPSSESARCHIREGSVLGGRISKILP  2081
             NKEKK +RLV   LL   +             D+   S+ A   I EG +LGGRISKILP
Sbjct  1199  NKEKKTVRLVQRPLLNIQKSIGNDGGPKKDKLDSSIPSDDATLFIHEGDILGGRISKILP  1258

Query  2080  GVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLS  1901
             GVGGL VQI  ++FG+VHFTE+ D WVS+PL G  EGQFVKC VL++ +S KGT  ++LS
Sbjct  1259  GVGGLRVQIGPYVFGRVHFTEINDSWVSNPLDGLHEGQFVKCMVLEISNSSKGTLQIELS  1318

Query  1900  LRWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDA  1721
             LR +LD M++ ++SE +      +R + I+DL PDM ++GYVKN   KGCFIMLSR +DA
Sbjct  1319  LRTSLDGMSSDHLSEANVF----KRFERIEDLSPDMGIEGYVKNTMSKGCFIMLSRTLDA  1374

Query  1720  KILLSNLADGFIESPEKEFPVGKLVTGK  1637
             K+LLSNL+D F++ PE EFPVGKLVTG+
Sbjct  1375  KVLLSNLSDTFVKDPENEFPVGKLVTGR  1402



>ref|XP_004161672.1| PREDICTED: LOW QUALITY PROTEIN: protein RRP5 homolog [Cucumis 
sativus]
Length=609

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/593 (62%), Positives = 461/593 (78%), Gaps = 21/593 (4%)
 Frame = -2

Query  5806  KNFKRKGKNNEAGNASFSGKSAPLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAE  5627
             K+ KR   + +  + +   ++  LQ+ED+VPDFPRGG   +S+ + ++VRAE D EF+ +
Sbjct  16    KHSKRPFNSKKKMSETAKPETVSLQIEDDVPDFPRGGGGYMSQNKGEKVRAEGDKEFQND  75

Query  5626  DRylkkkkqhklykKNQSVEDDLGSLFGHSISGKLPKSANRITPKNISPGMKLWGVIAEV  5447
             D      K+ K  +K+ S  DDL SL  + + G LPK AN+IT KNI+P MK WGV+AEV
Sbjct  76    D-LKMTTKRGKKRRKHPSNGDDLESLLNNGVVGNLPKYANKITLKNINPRMKFWGVVAEV  134

Query  5446  NEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGLFHVGQLVSCIVLHLDD  5267
             N+KD+V+SLPGGLRGLV A+EA DP+ + E  + E   + L  +FHVGQLV C+VL +DD
Sbjct  135   NKKDLVISLPGGLRGLVSAAEAFDPILEKEVEDTE--HDLLPVMFHVGQLVPCVVLKVDD  192

Query  5266  DKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLP  5087
             DKKE+GK KIWLSLRL++L+K+ TLD +QEG++L++Y+KS EDHGYILHFGL SF+GFLP
Sbjct  193   DKKESGKRKIWLSLRLSILYKDFTLDLLQEGMVLTSYVKSIEDHGYILHFGLTSFTGFLP  252

Query  5086  I---HSQSVDKMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPG  4916
                   QS ++++ GQL++ VV+S+D+TRKVVY SS  D ++  V KDLKGISIDLL+PG
Sbjct  253   KTKQSDQSENEVHVGQLLQCVVRSIDKTRKVVYFSSDQDIVSSSVAKDLKGISIDLLIPG  312

Query  4915  MMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDP  4736
             MMV+A V S LENG++LSFLTYF GTVD+FHLQ  F   +WKD Y QN K+NARILFIDP
Sbjct  313   MMVSARVQSTLENGILLSFLTYFNGTVDMFHLQNSFHSSNWKDFYNQNMKMNARILFIDP  372

Query  4735  ATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYI  4556
             +TRAVGL+L PHLV  KA P  +++GDI++ AKV+RVD+G GLLLE+PSSP  TP +V  
Sbjct  373   STRAVGLTLIPHLVRNKAAPPHLRIGDIYDSAKVVRVDRGFGLLLEVPSSPESTPTFV--  430

Query  4555  SdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVV  4376
                          +FK G  VRVR+LGFR+LEGLA G+LK SAFEG VF++SDVKPG ++
Sbjct  431   -------------SFKEGSRVRVRILGFRHLEGLAIGTLKASAFEGPVFSYSDVKPGTLI  477

Query  4375  KAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCKSKRIT  4196
             +AKVI VD FGAIVQF  G+KALCPL HMSEFEIVKPRKKF+VG+EL+FRVLGCKSKRIT
Sbjct  478   RAKVIVVDDFGAIVQFPGGLKALCPLSHMSEFEIVKPRKKFKVGAELIFRVLGCKSKRIT  537

Query  4195  VTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPR  4037
             VTHKKTLVKSKL++LSSY DAT GL+THGWITKI KHGCFVRFYNGVQGFAPR
Sbjct  538   VTHKKTLVKSKLEVLSSYADATAGLVTHGWITKIXKHGCFVRFYNGVQGFAPR  590



>gb|KDO70789.1| hypothetical protein CISIN_1g0001732mg, partial [Citrus sinensis]
 gb|KDO70790.1| hypothetical protein CISIN_1g0001732mg, partial [Citrus sinensis]
 gb|KDO70791.1| hypothetical protein CISIN_1g0001732mg, partial [Citrus sinensis]
 gb|KDO70792.1| hypothetical protein CISIN_1g0001732mg, partial [Citrus sinensis]
Length=572

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/569 (69%), Positives = 482/569 (85%), Gaps = 6/569 (1%)
 Frame = -2

Query  1831  RRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGK  1652
             + ++ I+DL P+M VQGYVKNVT KGCFIMLSRK+DAK+LLSNL+DG++ESPEKEFP+GK
Sbjct  5     KHLEKIEDLSPNMIVQGYVKNVTSKGCFIMLSRKLDAKVLLSNLSDGYVESPEKEFPIGK  64

Query  1651  LVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGKIKRIESFGLFIS  1472
             LV G+V+SVE LSKRVEVTL+TS S T  +S+I+ L+N   G+I+ G+IKR+ES+GLFI+
Sbjct  65    LVAGRVLSVEPLSKRVEVTLKTSDSRTASQSEINNLSNLHVGDIVIGQIKRVESYGLFIT  124

Query  1471  VDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSYFRDDD  1292
             ++NTNLVGLCHVSELS+DH+DN+++ Y+AG+ V+VK+LKVDK++ RISLGMK+SYF++D 
Sbjct  125   IENTNLVGLCHVSELSEDHVDNIETIYRAGEKVKVKILKVDKEKRRISLGMKSSYFKND-  183

Query  1291  GEDIQTTSRQSINSTDKGNSVFIGTQSTVFPESSDA--DIDVSVVNTTDNILTEVESRAS  1118
              +++Q +S +  +   +    +   +S++   SS A  D+D+   +    +L ++ESRAS
Sbjct  184   ADNLQMSSEEESDEAIEEVGSY--NRSSLLENSSVAVQDMDMESEDGGSLVLAQIESRAS  241

Query  1117  IPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkramkkakkerereiraaeerl  938
             +PPLEV LDD E  D+D+ +++N  HT  A T DEK+ + A KK K+ERE+EIRAAEERL
Sbjct  242   VPPLEVNLDD-EQPDMDNGISQNQGHTDEAKTIDEKNNRHAKKKEKEEREQEIRAAEERL  300

Query  937   leKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESE  758
             LEKD PR  DEFE+LVRSSPNSSFVWIKYMAFMLS+ DVEKARSIAE+A+ TINIREE+E
Sbjct  301   LEKDAPRTPDEFERLVRSSPNSSFVWIKYMAFMLSMADVEKARSIAERALQTINIREENE  360

Query  757   KLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELL  578
             KLN+WVAYFNLE EYGNPP+EAV+KVFQRALQYCDPKKVHLALLG+YERTE  KL DELL
Sbjct  361   KLNIWVAYFNLENEYGNPPEEAVVKVFQRALQYCDPKKVHLALLGLYERTEQNKLADELL  420

Query  577   EKMVKKFKHSCKIWLRRIQWALKQNQDNSQSIVNRALLCLPKHKHIKFITQTAILEFKCG  398
              KM+KKFKHSCK+WLRR+Q  LKQ Q+  Q++V RALL LP+HKHIKFI+QTAILEFK G
Sbjct  421   YKMIKKFKHSCKVWLRRVQRLLKQQQEGVQAVVQRALLSLPRHKHIKFISQTAILEFKNG  480

Query  397   VADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLF  218
             VADRGRSMFE +L EYPKRTDLWS+YLDQEIR+GD+D+IR LFERAISLS+PPKKMKFLF
Sbjct  481   VADRGRSMFEGILSEYPKRTDLWSIYLDQEIRLGDVDLIRGLFERAISLSLPPKKMKFLF  540

Query  217   KKYLAYEKSVGDEERIESVKRKAMEYVES  131
             KKYL YEKSVG+EERIE VK+KAMEYVES
Sbjct  541   KKYLEYEKSVGEEERIEYVKQKAMEYVES  569


 Score = 62.0 bits (149),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 49/169 (29%), Positives = 83/169 (49%), Gaps = 10/169 (6%)
 Frame = -2

Query  4399  DVKPGMVVKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVL  4220
             D+ P M+V+  V  V S G  +  S  + A   L ++S+  +  P K+F +G  +  RVL
Sbjct  12    DLSPNMIVQGYVKNVTSKGCFIMLSRKLDAKVLLSNLSDGYVESPEKEFPIGKLVAGRVL  71

Query  4219  GCK--SKRITVTHK----KTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYN-  4061
               +  SKR+ VT K    +T  +S+++ LS   +   G I  G I ++E +G F+   N 
Sbjct  72    SVEPLSKRVEVTLKTSDSRTASQSEINNLS---NLHVGDIVIGQIKRVESYGLFITIENT  128

Query  4060  GVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTT  3914
              + G    SEL  D   +I ++Y   + VK +++      R+I L   +
Sbjct  129   NLVGLCHVSELSEDHVDNIETIYRAGEKVKVKILKVDKEKRRISLGMKS  177



>ref|NP_001059139.1| Os07g0203300 [Oryza sativa Japonica Group]
 dbj|BAF21053.1| Os07g0203300, partial [Oryza sativa Japonica Group]
Length=689

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/713 (54%), Positives = 513/713 (72%), Gaps = 45/713 (6%)
 Frame = -2

Query  2221  NKEKKLLRLVPHTLLITPED----TVPSSESARCHIREGSVLGGRISKILPGVGGLLVQI  2054
             N+EK+LLRL        PE+      P S +   H ++G ++GGRI KILPGVGGL++QI
Sbjct  3     NREKRLLRLKALDSQSLPENIGETQKPLSATVE-HTKQGDIIGGRIQKILPGVGGLVIQI  61

Query  2053  DAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMN  1874
               HL G+VH+TE+ D WV +P+SG+ EGQFVKCKVL V  S +G+  VDLSLR ++   +
Sbjct  62    GPHLHGRVHYTEIVDSWVQEPISGFHEGQFVKCKVLDVSRSSEGSVRVDLSLRSSMCANS  121

Query  1873  NQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLAD  1694
             NQ+    DD   +  R + I DL P   V+GYVK+V  KGCFIM+SR ++A+I+LSNL+D
Sbjct  122   NQSRRLFDDSRIRTSRFEKINDLCPGTEVKGYVKSVNSKGCFIMVSRTIEARIILSNLSD  181

Query  1693  GFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIIS  1514
              ++E+P+ +FPVG LV G+V+S E  S +VEV+LR ++ +  +KSD  + ++   G+II+
Sbjct  182   EYVENPQNDFPVGLLVHGRVLSSEPQSGKVEVSLRKNTGSKSQKSDDISYSDLHVGDIIA  241

Query  1513  GKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHR  1334
             G++KR+ESFGLF+++  + LV LCHVSELSD+ + ++ S +KAG  V+ K+LK+D++RHR
Sbjct  242   GQVKRVESFGLFVTIQGSELVALCHVSELSDEPVLDIHSCHKAGDKVKAKILKIDEERHR  301

Query  1333  ISLGMKNSYF--------RDDDGEDI--QTTSRQSINSTDKGNSVFIGTQSTVFPESSDA  1184
             +S+GMK SY          DD+ ++I  +  SR  +   D+ +++               
Sbjct  302   VSIGMKKSYIGPDSTGDTSDDEDDEIVPEEISRNPVMGRDRNHAL---------------  346

Query  1183  DIDVSVVNTTDNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdk  1004
                         +L + ESRAS+ PL+V LD+ E SD ++  NK  +   G +  D+K  
Sbjct  347   ------------VLPKPESRASVLPLQVSLDESEGSDQEND-NKGQEIANGTEVDDKKSN  393

Query  1003  kramkkakkerereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGD  824
             KR  +KA+K+RE EI A EER L++DIP+  DEFEKLVRSSPNSSFVWI YMAF+L L D
Sbjct  394   KRLKEKARKQRELEISALEERALQRDIPQTPDEFEKLVRSSPNSSFVWINYMAFLLDLAD  453

Query  823   VEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKK  644
             V+KAR++AE+A+ TINIREE EKLNVWVAYFNLE EYG+P ++AV K+FQRALQYCDPKK
Sbjct  454   VDKARAVAERALRTINIREEEEKLNVWVAYFNLENEYGSPREDAVKKIFQRALQYCDPKK  513

Query  643   VHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNS--QSIVNRA  470
             VHLALL +YERTE Y L DELL++M K+FK SCKIWLR IQ +LKQ++D    + IV RA
Sbjct  514   VHLALLAMYERTEQYTLADELLDRMTKRFKTSCKIWLRCIQLSLKQSKDVECIKLIVKRA  573

Query  469   LLCLPKHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDM  290
             LL LP+ K  KF++QTAILEFKCGV + GRS FE +L+EYPKRTDLWSVYLDQEIR+GD 
Sbjct  574   LLSLPQSKRRKFLSQTAILEFKCGVPEEGRSRFELILREYPKRTDLWSVYLDQEIRLGDT  633

Query  289   DVIRALFERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             ++IRALFER   LS+PPKKMKFLFKKYL YEKS GDEERIE VK+KA+EYV+S
Sbjct  634   EIIRALFERVTCLSLPPKKMKFLFKKYLEYEKSQGDEERIEHVKQKALEYVQS  686


 Score = 56.6 bits (135),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 68/265 (26%), Positives = 114/265 (43%), Gaps = 25/265 (9%)
 Frame = -2

Query  2686  GSLVQAEITDIKPL--ELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARIVS  2513
             G ++   I  I P    L ++ G   HGRVH TE  D    E P++ F  GQ +  +++ 
Sbjct  40    GDIIGGRIQKILPGVGGLVIQIGPHLHGRVHYTEIVDSWVQE-PISGFHEGQFVKCKVLD  98

Query  2512  KDSRSENKRGYQWELSTKPSVLAGDMDGPH------------ESFN-YSTGQLLSGYVFK  2372
                 SE     + +LS + S+ A                   E  N    G  + GYV  
Sbjct  99    VSRSSEG--SVRVDLSLRSSMCANSNQSRRLFDDSRIRTSRFEKINDLCPGTEVKGYVKS  156

Query  2371  VDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLV  2192
             V+S+  ++ +SR + A++ + + S E  E    Q  F VG  V G +LS+  +   + + 
Sbjct  157   VNSKGCFIMVSRTIEARIILSNLSDEYVE--NPQNDFPVGLLVHGRVLSSEPQSGKVEVS  214

Query  2191  PHTLLITPEDTVPSSESARCHIREGSVLGGRISKILPGVGGLLVQID-AHLFGKVHFTEL  2015
                   T   +  S + +   +  G ++ G++ ++     GL V I  + L    H +EL
Sbjct  215   LRK--NTGSKSQKSDDISYSDLHVGDIIAGQVKRV--ESFGLFVTIQGSELVALCHVSEL  270

Query  2014  RDPWVSDPLSGYCEGQFVKCKVLQV  1940
              D  V D  S +  G  VK K+L++
Sbjct  271   SDEPVLDIHSCHKAGDKVKAKILKI  295



>ref|XP_005647924.1| hypothetical protein COCSUDRAFT_28807 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE23380.1| hypothetical protein COCSUDRAFT_28807 [Coccomyxa subellipsoidea 
C-169]
Length=1757

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/1455 (32%), Positives = 773/1455 (53%), Gaps = 121/1455 (8%)
 Frame = -2

Query  5494  KNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGL  5315
             +++S G K+WG +AE+  +++++SLP GL+G V A+E   PL  +  +        LS L
Sbjct  4     QSLSKGAKIWGTVAEITHRELIISLPHGLKGHVPAAEVMHPLAADVPS--------LSSL  55

Query  5314  FHVGQLVSCIVLHLDDDKK-----EAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIK  5150
             F  GQLV C ++ L D        +AG+ +I LSL +A ++  +   A+  G+ L A ++
Sbjct  56    FRAGQLVQCSIVDLQDGDSGVAGGKAGRKRIVLSLHVAKVNAGIGPAALIAGMQLPACVR  115

Query  5149  STEDHGYILHFGLPSFSGFLPIHSQSVDKMNTGQ---LVEGVVKSVDRT------RKVVY  4997
             S EDHG++L  G+   + FL     +  K  +G+   L+ G V  V  T      R +V+
Sbjct  116   SVEDHGFLLTTGVKGVTAFL--ERTNWLKACSGEARPLLPGAVLPVTVTAAARPGRPLVH  173

Query  4996  LSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQ  4817
             +S+ P ++AK   K+ +G++I  L+PGM+VNA V +VL +G+++SFLTYF GTVD FHL 
Sbjct  174   VSADPKSLAKGAVKEWEGLTIGSLLPGMLVNARVRNVLSDGLLVSFLTYFNGTVDCFHLS  233

Query  4816  QVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAK  4637
             Q  PP  W+  Y    +V ARI+++DP ++ V LSL PHLV   A P+L  +  +FE + 
Sbjct  234   QQPPPADWQKGYEAGARVRARIIYVDPVSKRVSLSLLPHLVAGSASPALPPINTLFEHSI  293

Query  4636  VIRVDKGLGLLLEIPS---SPVPTP----AYVYISdvddkevkkmeKTFKPGKVVRVRVL  4478
             V RVD  LGLLLE+ S   +P   P     Y +IS V +  ++K++K +K GK V  RV+
Sbjct  294   VRRVDNALGLLLELRSEDDAPAEQPNAPAGYAHISAVSESRIEKLDKVYKVGKKVAARVI  353

Query  4477  GFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGVKALCPL  4298
             G R ++GLA  +L+ +A      +++DV PG +V   V  V+ FG  V+ + G+KAL P 
Sbjct  354   GARPMDGLAVCTLREAAVRAGTISYADVAPGSIVSGTVENVEDFGLFVKLAPGIKALVPT  413

Query  4297  RHMSEFEIVKPRKKFQVGSELVFRVL--GCKSKRITVTHKKTLVKSKLDILSSYTDATE-  4127
              HMS+    K R KF+ G ++  RVL     +++IT++ KK LV  KL   +S+ +A + 
Sbjct  414   VHMSDSGSEKARAKFKEGQKVSGRVLEVDVAARKITLSLKKLLVGEKLPPFASWQEAAQP  473

Query  4126  GLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSSSP  3947
             G   HG++T ++++G FV F NGV+G AP  +LGL+P  D +  + + + VK RVVS   
Sbjct  474   GARAHGFVTGVQEYGVFVSFCNGVRGLAPTQQLGLEPNQDPAKQFPIGKTVKARVVSVDE  533

Query  3946  ASRQIVLSFTTRPMRLSETEM-------VKPGTVVSGIVELVTPDSIVVNVNNGQSHLKG  3788
               R++ LSF  +    +           ++PGT++    E V   S V+ +        G
Sbjct  534   ERRRLRLSFAPKTAADAAAAAGADPMGGLQPGTILRA-GEGVPGASPVLAL--------G  584

Query  3787  TVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLD-IEGFNLV-LSAKYSLISTAQQLPLD  3614
              +   HL+DH      +   L  G E   LL+L+ +E   ++ ++ K SL++ A QLP  
Sbjct  585   RLDAAHLADHPAAEAALSEALVDGSELGPLLILERLEKAGMLRVTRKASLLAAAAQLPAA  644

Query  3613  VNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTN  3434
             +  +   ++  GYV NV  + VFVRFLG LTG +  ++  D    D S  F  GQSV   
Sbjct  645   IEDVKEGTLASGYVANVTADAVFVRFLGSLTGRAGLAQLADQFVSDPSRHFTEGQSVRAA  704

Query  3433  ILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLG  3254
             ++ V+    R TV+LK SL  + DA + +  F       ++++ + +   +NW +   +G
Sbjct  705   VVTVDLAKQRFTVALKHSLTGAPDAAYARFLFADLETAERIRAAEPSTEQVNWAE-LAIG  763

Query  3253  SIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVD  3074
                 G VH++KE+GVV   + + DV    +  Q+ G    TG+ I+  ++DV+K + +VD
Sbjct  764   GRAAGAVHDVKEYGVVCDLDAHADVVALAAPEQVEG-EATTGTRIKGRILDVNKKDGIVD  822

Query  3073  LSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNY  2894
             L+LK   V G+  +      +    +   Q    V   V AVVE+VK++YLVLS+PA   
Sbjct  823   LTLKASLVAGAPKKATGKAAKAALPEAVCQ----VGAKVEAVVELVKDDYLVLSLPAQQQ  878

Query  2893  ALGYASLNDFN--TQNLPVKQFVNGQSVIATIMALPDSSTGGRLLLLLKAISEVAEssss  2720
              + +A+ +DFN  ++    +QF+ GQ + A ++       GGR ++ +  +S+   +   
Sbjct  879   TIAFAATSDFNLGSRAHNSRQFIPGQKISAVVVEQASPENGGRTIVHVPLVSDSPAAPRE  938

Query  2719  krgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIG  2540
             KR +K +    G++V A++T++      ++  SG H                      I 
Sbjct  939   KRERKPAKIPPGTIVAAKVTNMHATHAGVELESGAH----------------------IL  976

Query  2539  QTLTARIVSKDSRSENKRGYQWELSTKPSVLAGDMDGPHESF----NYSTGQLLSGYVFK  2372
               L A   +   R E +     ELS +PS++A +   P        +   GQ + GYV +
Sbjct  977   SILLA--YANLHRFEGRNHGLLELSLRPSLVAAEKGAPKPGMLSVDDLQEGQTVRGYVQE  1034

Query  2371  VDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLV  2192
                + AWL +S  +R +L+ LDS+ + ++L  F  RF VG+S+   ++  +K++  + L 
Sbjct  1035  TAPDCAWLVLSPALRGRLHALDSADDVTQLAAFGGRFTVGQSLRCRVVQVDKKRGQVDLS  1094

Query  2191  ---P--------HTLLITPEDTVPSSESARCHIREGSVLGGRISKILPGVGGLLVQIDAH  2045
                P        H    TP   + +  +ARC + E  +   +      G  G+ V +  H
Sbjct  1095  LREPGAASAKQWHVTQRTP-TPICAFANARCTMVEWQISSDKAIVACSGA-GVRVHLAGH  1152

Query  2044  LFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVG-------HSVKGTTHVDLSLRWTL  1886
               G V  T++ D +V + +     G FV+C+VL           + +GT      LR   
Sbjct  1153  ASGHVAMTDVHDGFVENAIESLKAGDFVRCRVLGRAEDKGAEKRTKEGTEIKRAGLREPF  1212

Query  1885  DTMNNQNISEHDDVHSQNRRVQDIKDLHP-DMTVQGYVKNVTPKGCFIMLSRKVDAKILL  1709
                +N+   E+      N   Q   +L      V+GYVK V+  G F+ L+R ++A++ L
Sbjct  1213  --ASNRCEQENFPASMSNSGTQGFDELLSFGQQVRGYVKGVSSAGAFVALARDMEARVKL  1270

Query  1708  SNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSA  1529
             +NLADG++E P+  FP GKLV G++++ E    R+E++L++   AT        L +F+ 
Sbjct  1271  NNLADGYVEDPKTAFPQGKLVRGRILATE--HNRIELSLKSKGWAT--------LEDFTE  1320

Query  1528  GNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvd  1349
             G ++ G+++R E FG+FI +D++ + G+ H+SE++D+ +D++ S +K GQ VR KVL VD
Sbjct  1321  GQVVRGRVRRAEKFGVFIRIDDSAVTGMAHISEVADERVDDLPSMFKPGQGVRAKVLSVD  1380

Query  1348  kdRHRISLGMKNSYF  1304
              +  R+SLG+K SYF
Sbjct  1381  AETQRLSLGLKPSYF  1395


 Score =   301 bits (771),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 139/265 (52%), Positives = 195/265 (74%), Gaps = 1/265 (0%)
 Frame = -2

Query  922   PRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVW  743
             P +  +FE+LV  SP+SS+VWI+YMAF + +G+++KAR +A++A+ TIN REE EKLNVW
Sbjct  1488  PESEVDFERLVLESPSSSYVWIRYMAFHMGVGEIDKARGVADRALKTINFREEREKLNVW  1547

Query  742   VAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVK  563
             VA+ NLE  +G+PP EA+MK+FQ+AL + D KK++LALL + ER+   +L  + L  M +
Sbjct  1548  VAWLNLENLHGSPPDEALMKLFQKALPHTDQKKLYLALLTILERSARDELTQQTLRTMTR  1607

Query  562   KFKHSCKIWLRRIQWALKQNQDN-SQSIVNRALLCLPKHKHIKFITQTAILEFKCGVADR  386
             K+  S K+WLR   + L +N  N ++  ++RA+  LP  KHIK ++Q A++EFK G  +R
Sbjct  1608  KYWASAKVWLRAYGYDLGRNDGNAARRALDRAIGALPARKHIKVLSQAALMEFKEGDPER  1667

Query  385   GRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYL  206
             GR +FE +L+ YPKR DLWS+YLDQEIR GD    R+LFERA  LS+PPKKMKFLFK++L
Sbjct  1668  GRGVFEGILRNYPKRLDLWSIYLDQEIRAGDRQRARSLFERATHLSLPPKKMKFLFKRFL  1727

Query  205   AYEKSVGDEERIESVKRKAMEYVES  131
              +EK+ GD   +E VK+ A EYVE+
Sbjct  1728  DFEKTHGDAAGVEHVKQAAKEYVEA  1752



>ref|XP_010468130.1| PREDICTED: protein RRP5 homolog [Camelina sativa]
Length=1262

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/651 (56%), Positives = 473/651 (73%), Gaps = 32/651 (5%)
 Frame = -2

Query  2422  ESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSV  2243
             E   +S GQ +SGYV+KVD EW WL ISR V A+L+ILD+++E  EL+EF++RF VGK+V
Sbjct  618   EQLEFSAGQCVSGYVYKVDKEWVWLAISRNVTARLFILDTASEAHELEEFERRFPVGKAV  677

Query  2242  SGYILSANKEKKLLRLVPHTL----------LITPEDTVPSS---ESARCHIREGSVLGG  2102
             SGY+L+ NKEKK LRLV   L          + +  D + SS   +     I EG +LGG
Sbjct  678   SGYVLTYNKEKKTLRLVQRPLPDIHKSIANGVGSKMDNLDSSIPGDDGTLFIHEGDILGG  737

Query  2101  RISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKG  1922
             RISKILPGVGG+ VQI  ++FG+VHFTE+ D WV +PL G+ EGQFVKCKVL++  S KG
Sbjct  738   RISKILPGVGGIRVQIGPYVFGRVHFTEINDSWVPNPLDGFREGQFVKCKVLEISSSSKG  797

Query  1921  TTHVDLSLRWTLDTMNNQNISEHDDVHSQN--RRVQDIKDLHPDMTVQGYVKNVTPKGCF  1748
             T  ++LSLR +LD M++ ++SE D  ++ N  +R +  +DL PDM VQGYVKN   KGCF
Sbjct  798   TWQIELSLRKSLDGMSSDHLSE-DCSNNDNVCKRFERSEDLSPDMGVQGYVKNTMSKGCF  856

Query  1747  IMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATP  1568
             I+LSR V+AK+LLSNL D F++ PEKEFPVGKLVTG+V++VE LSKR+EVTL+T ++   
Sbjct  857   IILSRTVEAKVLLSNLCDTFVKDPEKEFPVGKLVTGRVLNVEPLSKRIEVTLKTVNAGGQ  916

Query  1567  RKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYK  1388
              KS+   L     G++ISG+IKR+E +GLFI++  T + GLCH ++LSDD I+N+Q+RYK
Sbjct  917   PKSESYDLKKLRVGDMISGRIKRVEPYGLFITIGQTGMDGLCHKTQLSDDGIENIQARYK  976

Query  1387  AGQTvrvkvlkvdkdRHRISLGMKNSYFRDDDGEDIQTTSRQSINST--------DKGNS  1232
             AG++V  K+LK+D+++ RISL MK+SY    D  D QT S ++ N T        D  + 
Sbjct  977   AGESVTAKILKLDEEKRRISLSMKSSYLMSGDDVDAQTPSEENANETNMECDPINDPKSE  1036

Query  1231  VFIGTQSTVFPESSDADIDVSVVNTTDNILTEVESRASIPPLEVPLDDIENSDIDDAVNK  1052
             V        F E+S         + T   L +VESRASIPPLEV LDDIE +DID+   +
Sbjct  1037  VLAAVGDFGFQETSGGK-----HSGTSVALAQVESRASIPPLEVDLDDIEETDIDNG--Q  1089

Query  1051  NPDHTGGADTTDekdkkramkkakkerereiraaeerlleKDIPRNTDEFEKLVRSSPNS  872
             N     GAD  DEK K+R  +K ++ERE++I+AAE RLLE   P + DEFEKLVRSSPNS
Sbjct  1090  NHGKLQGADK-DEKSKRREKQKDREEREKKIQAAEGRLLENHAPESADEFEKLVRSSPNS  1148

Query  871   SFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEA  692
             SFVWIKYMAFMLSL D+EKARSIAE+A+ TINIREE E+LN+WVAYFNLE E+G+PP+EA
Sbjct  1149  SFVWIKYMAFMLSLADIEKARSIAERALRTINIREEEERLNIWVAYFNLENEHGSPPEEA  1208

Query  691   VMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKI  539
             V KVF+RA QYCDPKKV+LALLGVYERTE +KL D+LL++M+KKFK SCK+
Sbjct  1209  VKKVFERARQYCDPKKVYLALLGVYERTEQHKLADKLLDEMIKKFKQSCKV  1259


 Score =   566 bits (1460),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 316/678 (47%), Positives = 448/678 (66%), Gaps = 27/678 (4%)
 Frame = -2

Query  3334  LEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQ  3155
             ++ KI+ LQS D   S  NWV+ F +G +++G + E  E GVVV FE  ++V GFI    
Sbjct  1     MDEKISDLQSSDITKSECNWVEKFSIGGLMKGTIQEQNELGVVVNFENINNVLGFIPLHH  60

Query  3154  LGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDL  2975
             +GG  +  GS + A V+D+S+ E LVDLSL+PE +N    + +N ++ KKKRKR   K+L
Sbjct  61    MGGATLVPGSVVNAVVLDLSRAERLVDLSLRPELINNLNKEVSNSQS-KKKRKRGISKEL  119

Query  2974  EVNQSVNAVVEIVKENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMAL  2795
             EV+Q V+AVVEIVKE YLVLS+P  +Y +GYAS++D+NTQ LPVKQF  GQSV+A++ A+
Sbjct  120   EVHQRVSAVVEIVKEQYLVLSIPEYDYTIGYASVSDYNTQKLPVKQFSTGQSVVASVEAV  179

Query  2794  PDSSTGGRLLLLLKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGF  2615
              +  + GRLLLLL ++S  +E+S SK+ KK SS +VGS+V AEIT+IKP ELR+ FG   
Sbjct  180   QNPLSSGRLLLLLDSVSGTSETSRSKKAKKKSSCEVGSVVHAEITEIKPFELRVNFGHSL  239

Query  2614  HGRVHITEATDDNTTEGPLNDFRIGQTLTARIVSKDSRSENKRGYQWELSTKPSVL--AG  2441
              GR+HITE TD +T+E P   FR+GQ+++AR+V+K   ++ K+   WELS KP++L  + 
Sbjct  240   RGRIHITEVTDVSTSEEPFAKFRVGQSMSARVVAKPCHTDIKKSQLWELSVKPAMLRDSS  299

Query  2440  DMDGPHES--FNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQK  2267
             ++    ES    +S GQ +SGYV+KVD EW WL ISR V A+L+ILD+++E  EL+EF++
Sbjct  300   ELKDIQESEQLEFSAGQCVSGYVYKVDKEWVWLAISRNVTARLFILDTASEAHELEEFER  359

Query  2266  RFYVGKSVSGYILSANKEKKLLRLVPHTL----------LITPEDTVPSS---ESARCHI  2126
             RF VGK+VSGY+L+ NKEKK LRLV   L          + +  D + SS   +     I
Sbjct  360   RFPVGKAVSGYVLTYNKEKKTLRLVQRPLPDIHKSIANGVGSKMDNLDSSIPGDDGTLFI  419

Query  2125  REGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVL  1946
              EG +LGGRISKILPGVGG+ VQI  ++FG+VHFTE+ D WV +PL G+ EGQFVKCKVL
Sbjct  420   HEGDILGGRISKILPGVGGIRVQIGPYVFGRVHFTEINDSWVPNPLDGFREGQFVKCKVL  479

Query  1945  QVGHSVKGTTHVDLSLRWTLDTMNNQNISEHDDVHSQN--RRVQDIKDLHPDMTVQGYVK  1772
             ++  S KGT  ++LSLR +LD M++ ++SE D  ++ N  +R +  +DL PDM VQGYVK
Sbjct  480   EISSSSKGTWQIELSLRKSLDGMSSDHLSE-DCSNNDNVCKRFERSEDLSPDMGVQGYVK  538

Query  1771  NVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTL  1592
             N   KGCFI+LSR V+AK+LLSNL D F++ PEKEFPVGKL+    +     +    V  
Sbjct  539   NTMSKGCFIILSRTVEAKVLLSNLCDTFVKDPEKEFPVGKLMPLLAIMFAKKNSITNVYN  598

Query  1591  RTSSSATPRKSDIDALN-----NFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSEL  1427
                S      S++  +       FSAG  +SG + +++   +++++       L  +   
Sbjct  599   AFVSQVCLYSSELKDIQESEQLEFSAGQCVSGYVYKVDKEWVWLAISRNVTARLFILDTA  658

Query  1426  SDDH-IDNVQSRYKAGQT  1376
             S+ H ++  + R+  G+ 
Sbjct  659   SEAHELEEFERRFPVGKA  676


 Score = 70.1 bits (170),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 76/267 (28%), Positives = 126/267 (47%), Gaps = 28/267 (10%)
 Frame = -2

Query  2686  GSLVQAEITDIKPL--ELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARIVS  2513
             G ++   I+ I P    +R++ G    GRVH TE  +D+    PL+ FR GQ +  +++ 
Sbjct  732   GDILGGRISKILPGVGGIRVQIGPYVFGRVHFTE-INDSWVPNPLDGFREGQFVKCKVLE  790

Query  2512  KDSRSENKRGYQWELSTKPSVLAGDMDGPHE--------------SFNYSTGQLLSGYVF  2375
               S S  K  +Q ELS + S+     D   E              S + S    + GYV 
Sbjct  791   ISSSS--KGTWQIELSLRKSLDGMSSDHLSEDCSNNDNVCKRFERSEDLSPDMGVQGYVK  848

Query  2374  KVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRL  2195
                S+  ++ +SR V A+  +L S+   + +K+ +K F VGK V+G +L+    + L + 
Sbjct  849   NTMSKGCFIILSRTVEAK--VLLSNLCDTFVKDPEKEFPVGKLVTGRVLNV---EPLSKR  903

Query  2194  VPHTLLITPEDTVPSSESARC-HIREGSVLGGRISKILPGVGGLLVQI-DAHLFGKVHFT  2021
             +  TL        P SES     +R G ++ GRI ++ P   GL + I    + G  H T
Sbjct  904   IEVTLKTVNAGGQPKSESYDLKKLRVGDMISGRIKRVEP--YGLFITIGQTGMDGLCHKT  961

Query  2020  ELRDPWVSDPLSGYCEGQFVKCKVLQV  1940
             +L D  + +  + Y  G+ V  K+L++
Sbjct  962   QLSDDGIENIQARYKAGESVTAKILKL  988



>emb|CEF99246.1| Suppressor of forked [Ostreococcus tauri]
Length=1870

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/1469 (32%), Positives = 780/1469 (53%), Gaps = 137/1469 (9%)
 Frame = -2

Query  5533  SGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNET  5354
             SG   K    +  K++  G+KL GV++EV  + +V+SLP GLRG V  +EA D ++   T
Sbjct  22    SGWRAKYVETLKYKSLRSGVKLLGVVSEVTARGLVMSLPDGLRGTVARAEASD-VFRGAT  80

Query  5353  N------------------EMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLS  5228
                                E E ++  L  L+  GQ++ C+VL LD  K + G  +I LS
Sbjct  81    RSAGAESADDESESSDDEFEGEEETISLESLYEPGQVLRCVVLSLD--KGKTGGKRIELS  138

Query  5227  LRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVD-KMNTG  5051
             LRL  +   +  D++ EG +  A +KS EDHGYIL FG+   SGFLP  S + D  +  G
Sbjct  139   LRLENVCAGIGKDSLVEGSVAPAMVKSIEDHGYILDFGIAGTSGFLPKKSVANDLTIRRG  198

Query  5050  QLVEGVVKSVDRTRKVVY-LSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENG  4874
             ++++ V+ +     K  + ++S    +   V+ +    ++  L+PGM+VN+ V  VL +G
Sbjct  199   KILDVVITATPTGNKGYFTVTSDQKRVTSSVSHETSATNVSTLLPGMLVNSRVKQVLADG  258

Query  4873  VMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLV  4694
             ++ SF+T+F+GTVD F    V         +   +++ AR++F+D   + V L+L PHL+
Sbjct  259   ILCSFMTFFSGTVDCFQTGSVATTKGVASAFKVGQRMRARVIFVDAVAKRVCLTLLPHLL  318

Query  4693  HKKAPPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKT  4514
                +  +L K+G +F+ A + RVD G G+ L +        AY ++S + D+ V+K+EK 
Sbjct  319   EHTSI-TLPKLGKVFQTATIARVDAGQGVALSVSDGDDHIAAYAHVSQLSDERVEKVEKK  377

Query  4513  FKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIV  4334
             FK G+ V VRV+G R ++G+ + SLK+S      F+  ++ PGM+V  +V+ V+ +GAIV
Sbjct  378   FKIGRSVNVRVIGHRLMDGIVSVSLKSSVMAQPFFSLEELTPGMLVNGEVVAVEHYGAIV  437

Query  4333  QFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGC--KSKRITVTHKKTLVKSKL  4160
             + + G+KALCP  H+S+        K   G++L FRVL     S+R TV+HK+TL+KS+L
Sbjct  438   KLAEGIKALCPPLHVSDIVGRTTSSKVSPGAKLKFRVLNVDKNSRRATVSHKRTLIKSEL  497

Query  4159  DILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQ  3980
              +++S  DA  G +THG +T + ++G F+  Y  ++G A  ++LGL      S  + V Q
Sbjct  498   PVIASLEDALPGAVTHGVVTGVNEYGVFISLYGDLRGLANVNDLGLLSDQKPSDAFGVGQ  557

Query  3979  VVKCRVVSSSPASRQIVLSFTTRPMRLS-----ETEMVKPGTVVSGIVELVTPDSIV---  3824
             VV+  +VS+  + R          +RLS       E   PG +++     +TP  IV   
Sbjct  558   VVRVTIVSADASGR----------LRLSLAAGVALEAKTPGLMINASAADLTPGIIVETA  607

Query  3823  ----VNVNNG---------QSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDI  3683
                 V+   G         + ++ G ++  HLSDH   A  + SVL PG +   L+VL+ 
Sbjct  608   VVTHVSAQTGNVEVVFTAEKGNVPGIIALAHLSDHPLTATGLSSVLNPGDKIGPLVVLEG  667

Query  3682  EGFNLVLSAKYSLISTAQ--QLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSP  3509
             +    VLS K SL+ ++Q  +LP    + +P SV  GYV +    GVFVRFLG+LTG +P
Sbjct  668   KPTRAVLSRKLSLVESSQNSKLPASAEEATPGSVFPGYVASATSAGVFVRFLGKLTGLAP  727

Query  3508  RSKATDDRRYDTSEVFYIGQSVCTNILDVNGETG--RITVSLKQSLCSS--TDATFIQEY  3341
              S+  D    D  ++F +G++V   +L V+  T   R+++SLK S  SS  +DA  I+ +
Sbjct  728   PSQLVDGVSADIHDMFPVGKTVNALVLAVDTSTSPPRLSLSLKLSATSSPLSDAPLIRSF  787

Query  3340  F----LLEHKIAKLQSLDSADSGLNWVDGFGL--GSIVEGKVHEIKEFGVVVTFEKYDDV  3179
             F    LL+ ++A     ++ D G++      L  G+ ++  V+E KE+GV++      + 
Sbjct  788   FNDIELLDERVA-----NADDVGISPETAKSLQPGTWMDVTVNETKEYGVLMDMAIDSNA  842

Query  3178  FGFISGGQL-GGINVETGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKK  3002
              G ++  QL   +  E+G  ++  V+DVS+ E +VD+ ++       + +TA+ K+ K+ 
Sbjct  843   VGLVTPHQLPESVEFESGDAVKCYVLDVSRREGVVDMGMRSGLERFKRNKTASGKSLKR-  901

Query  3001  RKREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYALGYASLNDFN-TQNLPVKQFVNG  2825
                     L+V   V A VE+VK  Y V S+P  +  +GYAS++  N +     ++F   
Sbjct  902   --------LKVGDEVTADVELVKAEYAVFSLPDHSGLIGYASVHHLNRSYEDATQRFTPA  953

Query  2824  QSVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPL  2645
             Q V A +  LPD + G  LL +   IS                   G+LV+  +++I+PL
Sbjct  954   QRVKAIVAQLPDGANGRLLLTVPVTISS-----------SGGKIAAGTLVKGVVSEIQPL  1002

Query  2644  ELRLKFGSGFHGRVHITEATDDNTTEGPLNDFRIGQTLTARIVSKDSRSENKRGYQWELS  2465
             +  +   +   GR++I+E   D T E PL    +G T+ A ++        +RG   +LS
Sbjct  1003  QALVALPNNARGRLYISEF--DLTEEKPLASVSVGSTIEATVLGL----AGERGGLLDLS  1056

Query  2464  TKPSVLAGDMDGPHESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSE  2285
                   A  +DG       S G  L+ YV  +  +   +T++  V + +  +++S + SE
Sbjct  1057  VHRKS-AFSLDG------VSVGDSLNAYVLSITQDGLKVTVAPGVTSFIPKIETSDKASE  1109

Query  2284  LKE-FQKRFYVGKSVSGYILSANKEKKLLRLVPHTLLITPEDTVPSSESARCHIREGSVL  2108
             L E  + RF +G+ V    +     K+ + L   T  +   + V       C    G+ L
Sbjct  1110  LSESLETRFVIGQRVRATAVDIKLNKRRIDLTLRTESVFGSNKV-------C---VGAKL  1159

Query  2107  GGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSV  1928
              G +++++    G++VQI +H FG++H T+L D    +P + Y  G  V+ +VL V  S 
Sbjct  1160  HGIVTRVVKH-AGVMVQIGSHSFGRIHLTDLSDELKEEPSASYAAGAVVQVRVLNVSPS-  1217

Query  1927  KGTTHVDLSLRWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCF  1748
                  +DLS R +   M+++ I   D        VQD+ +L P   ++GYVK  T KGCF
Sbjct  1218  ---GEIDLSTRAS--RMSSKTILPED------AEVQDVANLVPGQRIKGYVKATTKKGCF  1266

Query  1747  IMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATP  1568
             + LSR +DA   LSNLAD FI  P   FP GKLV G++VS ++   RVE++LR   +++ 
Sbjct  1267  VALSRSIDAMCKLSNLADDFIADPIASFPPGKLVQGRIVSADAAKGRVEISLRERENSSQ  1326

Query  1567  RKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHI-DNVQSRY  1391
               +D+  ++    G+++ G ++R++ +G+FI +D T L GLCH+S  +D  I D++    
Sbjct  1327  GNADVSGVD---VGSVMMGTVRRVQPYGVFIGLDGTKLSGLCHISMFADARINDDLSLHV  1383

Query  1390  KAGQTvrvkvlkvdkdRHRISLGMKNSYF  1304
             + G+ VRVKVL+++ +  +ISLG K S F
Sbjct  1384  RQGERVRVKVLEINAETKKISLGCKASLF  1412


 Score =   293 bits (750),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 135/265 (51%), Positives = 192/265 (72%), Gaps = 2/265 (1%)
 Frame = -2

Query  925   IPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNV  746
             +P +  EFEKL+ +SP SSF+W++YMAF +S G   +AR +AE+A+  I   EE+E++N+
Sbjct  1601  VPESAMEFEKLLIASPRSSFLWVRYMAFHVSCGAYAEAREVAERAIVAIPASEETERMNI  1660

Query  745   WVAYFNLEIEYGNP-PQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKM  569
             W AY NLE +YG P P+EAV K+F RA+Q  + K +H+ L+ +YER    +  ++ L+K 
Sbjct  1661  WAAYLNLENKYGTPTPEEAVKKLFTRAVQLSNAKHLHMTLISMYERNGQQQSLEDALKKA  1720

Query  568   VKKFKHSCKIWLRRIQWA-LKQNQDNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVA  392
              KKF +S K+WL  I+ A LK N + ++ +++RA   LPKHKHIK + +TA+ E K G  
Sbjct  1721  AKKFSYSTKVWLAYIRAAVLKGNSEWARQLLDRATQALPKHKHIKILMRTALFEMKEGNP  1780

Query  391   DRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKK  212
             +RGR+MFE +L+ YP+RTD+WSVY+DQEI+ GD+  IRALFERA  L +  K MKFLFK+
Sbjct  1781  ERGRTMFEGILRNYPRRTDIWSVYIDQEIKQGDVLRIRALFERATHLDLNAKSMKFLFKR  1840

Query  211   YLAYEKSVGDEERIESVKRKAMEYV  137
             YL +E+S GD+ERI  VK++AMEYV
Sbjct  1841  YLDFERSEGDDERIAHVKQRAMEYV  1865



>ref|XP_003081436.1| rRNA processing protein Rrp5 (ISS) [Ostreococcus tauri]
Length=1947

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/1456 (32%), Positives = 776/1456 (53%), Gaps = 137/1456 (9%)
 Frame = -2

Query  5494  KNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNETN------------  5351
             K++  G+KL GV++EV  + +V+SLP GLRG V  +EA D ++   T             
Sbjct  112   KSLRSGVKLLGVVSEVTARGLVMSLPDGLRGTVARAEASD-VFRGATRSAGAESADDESE  170

Query  5350  ------EMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLALLHKNLTLD  5189
                   E E ++  L  L+  GQ++ C+VL LD  K + G  +I LSLRL  +   +  D
Sbjct  171   SSDDEFEGEEETISLESLYEPGQVLRCVVLSLD--KGKTGGKRIELSLRLENVCAGIGKD  228

Query  5188  AIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVD-KMNTGQLVEGVVKSVDRT  5012
             ++ EG +  A +KS EDHGYIL FG+   SGFLP  S + D  +  G++++ V+ +    
Sbjct  229   SLVEGSVAPAMVKSIEDHGYILDFGIAGTSGFLPKKSVANDLTIRRGKILDVVITATPTG  288

Query  5011  RKVVY-LSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTV  4835
              K  + ++S    +   V+ +    ++  L+PGM+VN+ V  VL +G++ SF+T+F+GTV
Sbjct  289   NKGYFTVTSDQKRVTSSVSHETSATNVSTLLPGMLVNSRVKQVLADGILCSFMTFFSGTV  348

Query  4834  DIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGD  4655
             D F    V         +   +++ AR++F+D   + V L+L PHL+   +  +L K+G 
Sbjct  349   DCFQTGSVATTKGVASAFKVGQRMRARVIFVDAVAKRVCLTLLPHLLEHTSI-TLPKLGK  407

Query  4654  IFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKVVRVRVLG  4475
             +F+ A + RVD G G+ L +        AY ++S + D+ V+K+EK FK G+ V VRV+G
Sbjct  408   VFQTATIARVDAGQGVALSVSDGDDHIAAYAHVSQLSDERVEKVEKKFKIGRSVNVRVIG  467

Query  4474  FRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGVKALCPLR  4295
              R ++G+ + SLK+S      F+  ++ PGM+V  +V+ V+ +GAIV+ + G+KALCP  
Sbjct  468   HRLMDGIVSVSLKSSVMAQPFFSLEELTPGMLVNGEVVAVEHYGAIVKLAEGIKALCPPL  527

Query  4294  HMSEFEIVKPRKKFQVGSELVFRVLGC--KSKRITVTHKKTLVKSKLDILSSYTDATEGL  4121
             H+S+        K   G++L FRVL     S+R TV+HK+TL+KS+L +++S  DA  G 
Sbjct  528   HVSDIVGRTTSSKVSPGAKLKFRVLNVDKNSRRATVSHKRTLIKSELPVIASLEDALPGA  587

Query  4120  ITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSSSPAS  3941
             +THG +T + ++G F+  Y  ++G A  ++LGL      S  + V QVV+  +VS+  + 
Sbjct  588   VTHGVVTGVNEYGVFISLYGDLRGLANVNDLGLLSDQKPSDAFGVGQVVRVTIVSADASG  647

Query  3940  RQIVLSFTTRPMRLS-----ETEMVKPGTVVSGIVELVTPDSIV-------VNVNNG---  3806
             R          +RLS       E   PG +++     +TP  IV       V+   G   
Sbjct  648   R----------LRLSLAAGVALEAKTPGLMINASAADLTPGIIVETAVVTHVSAQTGNVE  697

Query  3805  ------QSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSL  3644
                   + ++ G ++  HLSDH   A  + SVL PG +   L+VL+ +    VLS K SL
Sbjct  698   VVFTAEKGNVPGIIALAHLSDHPLTATGLSSVLNPGDKIGPLVVLEGKPTRAVLSRKLSL  757

Query  3643  ISTAQ--QLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTS  3470
             + ++Q  +LP    + +P SV  GYV +    GVFVRFLG+LTG +P S+  D    D  
Sbjct  758   VESSQNSKLPASAEEATPGSVFPGYVASATSAGVFVRFLGKLTGLAPPSQLVDGVSADIH  817

Query  3469  EVFYIGQSVCTNILDVNGETG--RITVSLKQSLCSS--TDATFIQEYF----LLEHKIAK  3314
             ++F +G++V   +L V+  T   R+++SLK S  SS  +DA  I+ +F    LL+ ++A 
Sbjct  818   DMFPVGKTVNALVLAVDTSTSPPRLSLSLKLSATSSPLSDAPLIRSFFNDIELLDERVA-  876

Query  3313  LQSLDSADSGLNWVDGFGL--GSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLG-GI  3143
                 ++ D G++      L  G+ ++  V+E KE+GV++      +  G ++  QL   +
Sbjct  877   ----NADDVGISPETAKSLQPGTWMDVTVNETKEYGVLMDMAIDSNAVGLVTPHQLPESV  932

Query  3142  NVETGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQ  2963
               E+G  ++  V+DVS+ E +VD+ ++       + +TA+ K+ K+         L+V  
Sbjct  933   EFESGDAVKCYVLDVSRREGVVDMGMRSGLERFKRNKTASGKSLKR---------LKVGD  983

Query  2962  SVNAVVEIVKENYLVLSVPACNYALGYASLNDFN-TQNLPVKQFVNGQSVIATIMALPDS  2786
              V A VE+VK  Y V S+P  +  +GYAS++  N +     ++F   Q V A +  LPD 
Sbjct  984   EVTADVELVKAEYAVFSLPDHSGLIGYASVHHLNRSYEDATQRFTPAQRVKAIVAQLPDG  1043

Query  2785  STGGRLLLLLKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGR  2606
             + G  LL +   IS                   G+LV+  +++I+PL+  +   +   GR
Sbjct  1044  ANGRLLLTVPVTISS-----------SGGKIAAGTLVKGVVSEIQPLQALVALPNNARGR  1092

Query  2605  VHITEATDDNTTEGPLNDFRIGQTLTARIVSKDSRSENKRGYQWELSTKPSVLAGDMDGP  2426
             ++I+E   D T E PL    +G T+ A ++        +RG   +LS      A  +DG 
Sbjct  1093  LYISEF--DLTEEKPLASVSVGSTIEATVLGL----AGERGGLLDLSVHRKS-AFSLDG-  1144

Query  2425  HESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKE-FQKRFYVGK  2249
                   S G  L+ YV  +  +   +T++  V + +  +++S + SEL E  + RF +G+
Sbjct  1145  -----VSVGDSLNAYVLSITQDGLKVTVAPGVTSFIPKIETSDKASELSESLETRFVIGQ  1199

Query  2248  SVSGYILSANKEKKLLRLVPHTLLITPEDTVPSSESARCHIREGSVLGGRISKILPGVGG  2069
              V    +     K+ + L   T  +   + V       C    G+ L G +++++    G
Sbjct  1200  RVRATAVDIKLNKRRIDLTLRTESVFGSNKV-------C---VGAKLHGIVTRVVKH-AG  1248

Query  2068  LLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWT  1889
             ++VQI +H FG++H T+L D    +P + Y  G  V+ +VL V  S      +DLS R +
Sbjct  1249  VMVQIGSHSFGRIHLTDLSDELKEEPSASYAAGAVVQVRVLNVSPS----GEIDLSTRAS  1304

Query  1888  LDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILL  1709
                M+++ I   D        VQD+ +L P   ++GYVK  T KGCF+ LSR +DA   L
Sbjct  1305  --RMSSKTILPED------AEVQDVANLVPGQRIKGYVKATTKKGCFVALSRSIDAMCKL  1356

Query  1708  SNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSA  1529
             SNLAD FI  P   FP GKLV G++VS ++   RVE++LR   +++   +D+  ++    
Sbjct  1357  SNLADDFIADPIASFPPGKLVQGRIVSADAAKGRVEISLRERENSSQGNADVSGVD---V  1413

Query  1528  GNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHI-DNVQSRYKAGQTvrvkvlkv  1352
             G+++ G ++R++ +G+FI +D T L GLCH+S  +D  I D++    + G+ VRVKVL++
Sbjct  1414  GSVMMGTVRRVQPYGVFIGLDGTKLSGLCHISMFADARINDDLSLHVRQGERVRVKVLEI  1473

Query  1351  dkdRHRISLGMKNSYF  1304
             + +  +ISLG K S F
Sbjct  1474  NAETKKISLGCKASLF  1489


 Score =   293 bits (750),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 135/265 (51%), Positives = 192/265 (72%), Gaps = 2/265 (1%)
 Frame = -2

Query  925   IPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNV  746
             +P +  EFEKL+ +SP SSF+W++YMAF +S G   +AR +AE+A+  I   EE+E++N+
Sbjct  1678  VPESAMEFEKLLIASPRSSFLWVRYMAFHVSCGAYAEAREVAERAIVAIPASEETERMNI  1737

Query  745   WVAYFNLEIEYGNP-PQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKM  569
             W AY NLE +YG P P+EAV K+F RA+Q  + K +H+ L+ +YER    +  ++ L+K 
Sbjct  1738  WAAYLNLENKYGTPTPEEAVKKLFTRAVQLSNAKHLHMTLISMYERNGQQQSLEDALKKA  1797

Query  568   VKKFKHSCKIWLRRIQWA-LKQNQDNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVA  392
              KKF +S K+WL  I+ A LK N + ++ +++RA   LPKHKHIK + +TA+ E K G  
Sbjct  1798  AKKFSYSTKVWLAYIRAAVLKGNSEWARQLLDRATQALPKHKHIKILMRTALFEMKEGNP  1857

Query  391   DRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKK  212
             +RGR+MFE +L+ YP+RTD+WSVY+DQEI+ GD+  IRALFERA  L +  K MKFLFK+
Sbjct  1858  ERGRTMFEGILRNYPRRTDIWSVYIDQEIKQGDVLRIRALFERATHLDLNAKSMKFLFKR  1917

Query  211   YLAYEKSVGDEERIESVKRKAMEYV  137
             YL +E+S GD+ERI  VK++AMEYV
Sbjct  1918  YLDFERSEGDDERIAHVKQRAMEYV  1942



>ref|XP_001419873.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98166.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=1869

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/1450 (33%), Positives = 775/1450 (53%), Gaps = 114/1450 (8%)
 Frame = -2

Query  5539  SISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDN  5360
             S SG   K    +  K++ PG KL G+I+EV  + +V+SLP GLRG V  +E      ++
Sbjct  96    SSSGGGAKYVETLKYKSLRPGAKLLGIISEVTARGLVMSLPDGLRGTVARAEVAGTSDED  155

Query  5359  ETNEMEMQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLALLHKNLTLDAIQ  5180
             + ++    S  L  L+  GQ++ C V+ L+  K + G  +I LSLRL  + + LT +++ 
Sbjct  156   DDDDDAEASLEL--LYEPGQVLRCAVVSLE--KGKTGGKRIELSLRLEKVCEGLTKESLT  211

Query  5179  EGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVD--KMNTGQLVEGVVKSVDRTRK  5006
             EG +  A ++S EDHGYIL FG+   SGFLP  + + D  ++  G++++ V+    +  K
Sbjct  212   EGSVAPAVVQSVEDHGYILSFGIADTSGFLPKKNVASDLGEIRKGRIIDVVITGAPKGNK  271

Query  5005  VVY-LSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDI  4829
               + ++S    I   V  +    ++D L+PGM+VN+ +  +L +GV +SF+TYF+GTVD 
Sbjct  272   GYFTVTSDQKRIKTSVAHETSATNVDTLLPGMLVNSRIKQILSDGVSVSFMTYFSGTVDC  331

Query  4828  FHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIF  4649
             FH   +         +   +++ ARI+F+D A++ V L+L PHL+   A   L K+G  F
Sbjct  332   FHTGALATSKGVSSAFKVGQRMRARIIFVDSASKRVSLTLLPHLLDY-ASIELPKLGKTF  390

Query  4648  EQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKVVRVRVLGFR  4469
             + AK+ RVD G G+ L I         Y ++S + D+ V+K+EK FK G+ V VRV+G R
Sbjct  391   QTAKIERVDAGQGVALSISDGKNDIAGYAHVSQLSDERVEKVEKKFKIGRSVSVRVIGHR  450

Query  4468  NLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGVKALCPLRHM  4289
              L+G+ + SLK+S      F+  ++ PGM+V  +V+ V+ +GAIV+ + G+KALCP  H+
Sbjct  451   LLDGVVSVSLKSSVMAQPFFSLDELTPGMLVNGEVLAVEHYGAIVKLAEGIKALCPPLHI  510

Query  4288  SEFEIVKPRKKFQVGSELVFRVLGC--KSKRITVTHKKTLVKSKLDILSSYTDATEGLIT  4115
             S+        K   G++L FRVL     S+R TV+HK+TL+KS+L ++    DA  G IT
Sbjct  511   SDIVGRTTSAKVAPGAKLKFRVLNVDRNSRRATVSHKRTLIKSELPVIGQIEDAVPGSIT  570

Query  4114  HGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQ  3935
             HG +T + ++G FV  Y  ++G A  ++LGL      S  + V QVV+ +VVS+  + R 
Sbjct  571   HGVVTGVNEYGVFVSLYGDLKGLAGLNDLGLLRDQKPSDAFGVGQVVRVQVVSADTSGR-  629

Query  3934  IVLSFTTRPMRLSETEMV--------KPGTVVS-GIVELVTPDSIVVNV--NNGQSHLKG  3788
             + LS  +     +   M+        KPG VV   +V  V   +  V V  +  + ++ G
Sbjct  630   LRLSLASGDADGNSASMIINASADALKPGHVVEKAVVTHVASGTGNVEVVFSMEEGNIPG  689

Query  3787  TVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQ--LPLD  3614
              V   HLSDH   A  + +VL PG E   L+VL+ +    V+S K SL+ ++++  LP  
Sbjct  690   VVPLAHLSDHPLTAQGLSAVLNPGDEIGPLVVLEGKSTRAVMSRKLSLVESSREGKLPAT  749

Query  3613  VNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTN  3434
               + +  +V  GYV +    GVFVRFLGRLTG +P S+ TD    D  E+F +G++V   
Sbjct  750   AKEATLGAVFPGYVASATAAGVFVRFLGRLTGLAPPSQLTDGTTGDVHEMFPVGKTVNAL  809

Query  3433  IL--DVNGETGRITVSLKQSLCSS--TDATFIQEYFLLEHKIAKLQSLDSADSGLNWV--  3272
             IL  D +  T R+++SLK S  SS  +DA  ++ +F        ++ LD  D G   V  
Sbjct  810   ILSVDTSTPTPRLSLSLKVSATSSPLSDAPLVRSFF------QDIEFLDDRDVGAEDVGI  863

Query  3271  -----DGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVET----GSTI  3119
                       G+ ++  V+E K++GV++      +V G ++  Q   I V+T    G  +
Sbjct  864   SPETAKSLKPGTWMDVSVNETKDYGVLMDVPIDSNVVGLVTPHQ---IPVDTTFTAGDEV  920

Query  3118  QAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEI  2939
             +  V+DVS+ E +VD+ ++       + +T++ K+ KK         L+V   V+A VE+
Sbjct  921   KGYVLDVSRREGVVDIGMRDGLGKFKRNKTSSGKSLKK---------LKVGDQVSAEVEL  971

Query  2938  VKENYLVLSVPACNYALGYASLNDFNTQ-NLPVKQFVNGQSVIATIMALPDSSTGGRLLL  2762
             +K  Y+ LS+P  N  +G+A ++  N +     ++F   Q V A I  LP+    GRLLL
Sbjct  972   IKAEYVALSLPEHNGLIGFAPVHHLNLRYEDASERFTPTQCVKAVIAQLPEGEM-GRLLL  1030

Query  2761  LLKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATD  2582
              +        S              G+LV+  +++++ L+  +   +   GR++I+E + 
Sbjct  1031  TVPVTKGTTASGRIA---------AGTLVKGVVSEVQNLQALVALPNNARGRLYISEFSP  1081

Query  2581  DNTTEGPLNDFRIGQTLTARIVSKDSRSENKRGYQWELST--KPSVLAGDMDGPHESFNY  2408
                T  PL    +G T+ A ++         RG   +LS   K + +  D+         
Sbjct  1082  GEDT--PLESISVGSTVEATVMGL----AGDRGGLLDLSMHRKSAFVLEDV---------  1126

Query  2407  STGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELK-EFQKRFYVGKSVSGYI  2231
             S G  +S YV  V  +   +TI+  + + +  +++S + SEL  +   RF VG+ VS  I
Sbjct  1127  SVGDDVSAYVVSVTDDGIKVTIAPGITSFIPKIETSDKSSELAMKLSSRFTVGERVSAII  1186

Query  2230  LSANKEKKLLRLVPHTLLITPEDTVPSSESARCHIREGSVLGGRISKILPGVGGLLVQID  2051
             +     KK + L   T             S    +  G+ + G I++++  V GL+VQ+ 
Sbjct  1187  VGVKATKKRVDLSLRT----------DGASGSSRVCVGAKVQGIITRVVENV-GLMVQLG  1235

Query  2050  AHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNN  1871
             +H  G+VH T++ D +  DP + Y  GQ V+ +VL    +      +DLS+R +   +++
Sbjct  1236  SHSVGRVHLTDMADEYDDDPCAKYEAGQVVQVRVLNASSN----GELDLSMRAS--RLSS  1289

Query  1870  QNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADG  1691
             +  S  D        + DI +L P   V+GYVK  + KGCFI LSR +DA   LSNLAD 
Sbjct  1290  KRTSPTDP------EITDISNLVPGQRVKGYVKATSKKGCFIALSRGIDAMCKLSNLADS  1343

Query  1690  FIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISG  1511
             FI  P K FP GKLV G++VS ++   RVE+  R  + AT   +D+   +    G+++ G
Sbjct  1344  FIADPAKTFPPGKLVEGRIVSADAAKGRVELAFR-ETDATQGNADV---STVKVGDVLIG  1399

Query  1510  KIKRIESFGLFISVDNTNLVGLCHVSELSDDHI-DNVQSRYKAGQTvrvkvlkvdkdRHR  1334
              ++R++ +G+F+S+D T L GLCH+S  +D  I D++ S  + G+ VR KVL+++ + ++
Sbjct  1400  TVRRVQPYGVFVSLDGTKLSGLCHISMFADARISDDLASHVRQGERVRTKVLEINTETNK  1459

Query  1333  ISLGMKNSYF  1304
             ISLG+K S F
Sbjct  1460  ISLGIKASLF  1469


 Score =   303 bits (775),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 141/265 (53%), Positives = 194/265 (73%), Gaps = 2/265 (1%)
 Frame = -2

Query  925   IPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNV  746
             IP +  EFEKL+ +SP SSF+W++YMAF +S G  ++A+ +AE+A+  I   EE+E++NV
Sbjct  1596  IPESAMEFEKLLIASPRSSFLWVRYMAFHVSCGAYDEAKEVAERALGAIPASEEAERMNV  1655

Query  745   WVAYFNLEIEYGNP-PQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKM  569
             W AY NLE +YG P P+EAV K+F RA+Q  D K +HL L+ +YER       +E L+K 
Sbjct  1656  WAAYLNLENKYGTPSPEEAVKKLFTRAVQIADAKHMHLTLVSMYERNAQEDALEESLKKA  1715

Query  568   VKKFKHSCKIWLRRIQWA-LKQNQDNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVA  392
              KKF +S KIWL  I+ A LK + + ++ +++RA   LPKHKHIK +T+TA+LE K G  
Sbjct  1716  AKKFSYSAKIWLAYIRSAVLKNDSEKARKLLDRATQSLPKHKHIKILTRTALLEMKEGNP  1775

Query  391   DRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKK  212
             +RGR+MFE +L+ YP+RTD+WSVY+DQEI+ GD+  IRALFERA  L +  K MKFLFK+
Sbjct  1776  ERGRTMFEGILRNYPRRTDIWSVYIDQEIKQGDIQRIRALFERATHLDLNAKSMKFLFKR  1835

Query  211   YLAYEKSVGDEERIESVKRKAMEYV  137
             YL +E+S GD+ERI  VK++AMEYV
Sbjct  1836  YLDFERSEGDDERIAHVKQRAMEYV  1860



>ref|XP_002504340.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65598.1| predicted protein [Micromonas sp. RCC299]
Length=2018

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/1534 (32%), Positives = 782/1534 (51%), Gaps = 180/1534 (12%)
 Frame = -2

Query  5494  KNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLASEAHD------------PLWDNETN  5351
             KN+  GMK+ GV+ EVN++ + VSLP GL+G V  +EA D            P  D+ + 
Sbjct  79    KNLRVGMKVLGVVTEVNDRGLTVSLPNGLKGTVTRAEASDVLAPASKRGKKGPDGDDPSE  138

Query  5350  EMEMQSNY------------LSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLALLH  5207
               E +S              L+ +F VGQ++ C V  L   K ++G  +I LS RL+ + 
Sbjct  139   ASESESESEEEDEDEDERLDLTSMFQVGQILRCKVRQLG--KGKSGGKRIDLSTRLSQVC  196

Query  5206  KNLTLDAIQEGIILSAYIKSTEDHGYILHFGLP-SFSGFLPIHS--QS-VDKMNTGQLVE  5039
              N++  ++ +G+ + A + S EDHGY+L FG   S +GFLP  S  QS VD +  G +++
Sbjct  197   SNISGHSLTDGMAVPACVNSVEDHGYVLSFGCSDSPTGFLPRKSCPQSLVDTLVRGSILD  256

Query  5038  GVV-----KSVDRTRK-----VVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMS  4889
              V+     K   R R      V+  ++ P  +A+ VT +  G ++  L+PGM+VNA V +
Sbjct  257   VVIAGDEGKDGKRARSKGPGGVMQCTADPKRVAQAVTHEGDGAAMSTLLPGMLVNARVKA  316

Query  4888  VLENGVMLSFLTYFTGTVDIFHL----QQVFPPPSWKDDYPQNKKVNARILFIDPATRAV  4721
             VL +G+ ++F+TYFT TVD FH+        P P+    +   ++V AR+L++D A + V
Sbjct  317   VLADGLQMNFMTYFTATVDAFHVGGGVHGAAPDPAAA--HKTGERVRARVLYVDAAAKRV  374

Query  4720  GLSLNPHLVHKKA---PPSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPV---PTPAYVY  4559
             GL+L PHLV  +A     ++ K G IFE A V RVD  +G+LLE+ S      PT  Y +
Sbjct  375   GLTLRPHLVTLEASVRAGAMPKPGTIFETAVVRRVDTAIGVLLELKSENENVHPTFGYCH  434

Query  4558  ISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMV  4379
             ISD  D+ + K+EK FK GK VR RV+G R ++ +AT S K++  +    +  ++ PGM 
Sbjct  435   ISDAADEHLDKLEKRFKVGKKVRARVIGSRAMDSVATVSCKSTVLDQPFLSLEELVPGMQ  494

Query  4378  VKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGCK--SK  4205
             V+ +V+ V+ +GA+V+ + GVKALCP  H+S+        K + G    FRV+       
Sbjct  495   VRGEVVAVEPYGAVVKLAPGVKALCPPNHISDIPGRVTNAKVKEGLSAKFRVVSVDRVKG  554

Query  4204  RITVTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELG  4025
             R  VTHKK L++S+L +++S  DAT G  THG +T +E +G FV+ Y  ++G A   +LG
Sbjct  555   RAVVTHKKQLIRSELPVVASLDDATPGTTTHGVVTGVEPYGVFVQLYGNLRGLAGLQDLG  614

Query  4024  LDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTT------------RPMRLSETEMV  3881
             L         + V QVV+  V+ S    ++I LS                P    +    
Sbjct  615   LAADQTPQEAFAVGQVVRATVIRSDRGEQKIKLSLAPGGAVANGNDLDGTPGEKGDVGAP  674

Query  3880  KPGTVV-SGIVELV--TPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYE  3710
             +PGTVV S  V+ V     ++ V +  G   + G V+   +SDH      +     PG E
Sbjct  675   EPGTVVESATVKRVDEATGNVQVTLPGG---VPGVVTAAQMSDHPLTGAGLSQAFAPGDE  731

Query  3709  FDQLLVLDIEGFNLVLSAKYSLISTAQ--QLPLDVNQISPHSVVHGYVCNVIGN-GVFVR  3539
                L+ L+ +    +LS K SL+  A+   LP D++ +   ++  GYV +   N GVFVR
Sbjct  732   IGPLVALEAKPRRSILSRKASLVEAARGGTLPEDISGVVVGAIYPGYVASATANAGVFVR  791

Query  3538  FLGRLTGFSPRSKATD---DRRYDTSEVFYIGQSVCTNILDVNG--ETGRITVSLK----  3386
             FLGRLTG +P S+ TD       D  E+F +GQ+V   ++ V+   E  R+++SL     
Sbjct  792   FLGRLTGLAPPSQLTDVPVAGGVDPEEMFALGQTVLARVVSVDATVEPPRLSLSLAPRGV  851

Query  3385  -QSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGF---------GLGSIVEGK  3236
               S   + +A  I+  F  +  +A   + + A SG    +GF          +G  ++G 
Sbjct  852   AASSGVTAEAPLIRSIFT-DVDVADRLADERAASGGEAPEGFLTAAANEKLKVGEEIKGV  910

Query  3235  VHEIKEFGVVVTFEKYD-DVFGFISGGQLGGINVET--------GSTIQAAVIDVSKIEH  3083
             VH ++E+GV+V     D D  G ++  QL   N +         G  I   V+DVS+ E 
Sbjct  911   VHAVREYGVLVDMPDVDPDAVGLVAFHQLPNANGDNEEPKHPAEGEKITGRVLDVSRREG  970

Query  3082  LVDLSLKPEFVN---GSKPQTANDKTQKKKRK--REAQKDLEVNQSVNAVVEIVKENYLV  2918
             +VD+  +P       G K   A    + KKRK  +     LE+   V A VE+VK  Y V
Sbjct  971   VVDIGARPSLTGAKVGKKGAKALTTAELKKRKAAQAGAHKLEIGSKVTAEVELVKPEYAV  1030

Query  2917  LSVPACNYALGYASLN----DFNTQNLPVKQFVNGQSVIATIMALPDS-STGGRLLLLLK  2753
             LS+P    A+ YAS+N     FN   +  ++F  G+ V A +     S S G RLLL + 
Sbjct  1031  LSLPDHGGAIAYASVNLLNRRFNEDEVETERFAVGRKVTAFVAGNAASGSPGDRLLLTVP  1090

Query  2752  AISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEATDDNT  2573
             A    A+S+      + S+   G  ++  + +++ ++  L   +G  GR+H TE      
Sbjct  1091  A----AKSNKGAGSGEASAVGAGLAMEGVVKEVQSMQAILTLPNGRKGRLHATE-----L  1141

Query  2572  TEG--PLNDFRIGQTLTARIVSKDSRSENKRGYQWELSTKPSV--------LAGDMDGPH  2423
              EG  P+    +G TL    +         RG   EL+ + SV         A D  G  
Sbjct  1142  AEGAFPMKKIAVGATLNVVTLG----PAGDRGNMLELTVRRSVEESREIARAATDAGGGD  1197

Query  2422  ESF----------NYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSEL-KE  2276
              S             S G  + G V  V ++   + ++  + A++  +++    + L K 
Sbjct  1198  GSGAGIAGTAALATLSEGDEIDGIVSAVSADTLAIAVAPGLTARVPKIETGDSIAALRKA  1257

Query  2275  FQKRFYVGKSVSGYILSANKEKKLLRLVPHTLLITPEDTVPSSESARCHIREGSVLGGRI  2096
                RF VG+ V    L+A+  +K + +           T+ S++  + ++ EG+ + G +
Sbjct  1258  LTSRFTVGERVKMTALAADVARKKIIV-----------TLRSAD--KRNVVEGAKIAGIV  1304

Query  2095  SKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTT  1916
             SKI PG GG+ VQ+++   G+VH T++ D   S+P   +  G+ V+ +VL VG       
Sbjct  1305  SKIAPGGGGVFVQLNSRQHGRVHVTDIADDPRSEPWKLHSVGEAVEVRVLGVGEG----G  1360

Query  1915  HVDLSLRWT-LDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIML  1739
              VDLS++ + L +  + N             +  +  L P   V G+VK V   GCF+ +
Sbjct  1361  EVDLSMKSSALKSKGSSN------------GISSVSQLAPGAHVSGFVKQVNKGGCFVAI  1408

Query  1738  SRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSS-SATPRK  1562
             SR VDA++ + NLAD F+  P +EFP GKLV G ++SV+  S R E+TLR+    A   +
Sbjct  1409  SRSVDARVKMCNLADTFVSDPAQEFPKGKLVKGTILSVDESSGRAEMTLRSDGMDAAAGR  1468

Query  1561  SDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHI-DNVQSRYKA  1385
             S ID   +   G++  G ++R++++G+F+++D +   GLCH+S  +D  I D+++   +A
Sbjct  1469  SQIDNNAHVEEGSVQMGTVRRVQTYGVFVTLDGSGRSGLCHISMFADARIKDSLEQHVRA  1528

Query  1384  GQTvrvkvlkvdkdRHRISLGMKNSYFRDDDGED  1283
             G+ VRVKVL+VD++  +ISLGMK S F DD+  D
Sbjct  1529  GERVRVKVLQVDEETGKISLGMKPSLFADDEMPD  1562


 Score =   286 bits (731),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 129/269 (48%), Positives = 188/269 (70%), Gaps = 7/269 (3%)
 Frame = -2

Query  922   PRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVW  743
             P    +FEKL+ SSP SS+VW++YMAF +S+G  ++ARS+AE+A+  I   +E E++NVW
Sbjct  1745  PETAQDFEKLIMSSPRSSYVWLRYMAFQMSVGAYDEARSVAERALKAIPADDEDERMNVW  1804

Query  742   VAYFNLEIEYGNP-PQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMV  566
             VAY NLE  +G P P+EA++K+F RA +  +PKK+HL L G+YER+    +  + L+   
Sbjct  1805  VAYLNLENLHGKPSPREALLKLFDRATKVANPKKLHLTLAGIYERSGQDDMAAQTLKTAT  1864

Query  565   KKFKHSCKIWLRRIQWAL----KQNQD--NSQSIVNRALLCLPKHKHIKFITQTAILEFK  404
             ++F  S K+WL  I+  +     +N D  + +  ++RA   LPK KH+K + QTA+LE +
Sbjct  1865  RRFGQSAKVWLAHIRAQILHVGDKNADPESVRKALDRATQSLPKRKHVKVLVQTALLEIR  1924

Query  403   CGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKF  224
              G  +RGR+MFE +L+ YPKRTD+WS Y+DQEI+ GD D  R+L ERA  L + PK MKF
Sbjct  1925  EGSVERGRTMFESILRNYPKRTDIWSTYIDQEIKQGDPDRTRSLLERATHLDLNPKSMKF  1984

Query  223   LFKKYLAYEKSVGDEERIESVKRKAMEYV  137
             LFK+YL +E+ VGD +RIE VK++A++YV
Sbjct  1985  LFKRYLNFEREVGDRQRIEHVKQRALDYV  2013



>ref|XP_004334641.1| S1 RNA binding domain containing protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR12628.1| S1 RNA binding domain containing protein [Acanthamoeba castellanii 
str. Neff]
Length=1936

 Score =   610 bits (1572),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 469/1560 (30%), Positives = 786/1560 (50%), Gaps = 108/1560 (7%)
 Frame = -2

Query  5731  LEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAE-------------DRylkkkkqhkl  5591
             +EDE  D PRGG S ++  E+ ++  + D++F  E              +   +KK+   
Sbjct  1     MEDE--DLPRGGGSAVTPLEVRKIHKQADSDFLFEIKSSKGKKGAKSPAKKDTRKKRKPA  58

Query  5590  ykKNQSVEDDLGSLFGHSISG-KLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPG  5414
                    +   G     S++    PK    +  K+++PG  L G + +V +  + ++LP 
Sbjct  59    EDDEDDDKPKDGEGLASSVTAFNFPKFIEPLRFKSLAPGTSLLGAVTKVKDFKMHLTLPS  118

Query  5413  GLRGLVLASEAHDPLWDNETNEMEMQSNYL---SGLFHVGQLVSCIVLHLDDDKKEAGKW  5243
             GL G+V  +E  D L +   ++++ + + L   S  F  GQLV C++  L++ +K   K 
Sbjct  119   GLTGVVPITEVTDTLSELLASKVDDEDDVLPKMSAFFKPGQLVPCVIKALEEREK-GNKK  177

Query  5242  KIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSV--  5069
              + LSLR +LL++NL +  I  G+ +   +KS EDHGYI+ FG   F+GFL   +  +  
Sbjct  178   NVVLSLRPSLLNQNLAIGNITPGMAIHGSVKSVEDHGYIISFGTNEFTGFLVKDTAEMTE  237

Query  5068  -DKMNTGQLVEG-----VVKSVDRTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMV  4907
              ++  T Q V G     VV SV R    V +   PD  +  VTKD    +I  L  GM++
Sbjct  238   DEESQTAQFVVGQPVACVVDSVKRENNTVTVHYDPDKFSTAVTKDNNVFTIQTLKAGMLI  297

Query  4906  NASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATR  4727
             NA V  V + G+ L FL YF GTV   HL    P      +YP+ KKV  RI+ +D   +
Sbjct  298   NAQVKKVYKQGLFLQFLGYFGGTVSSQHLG--CPLSKLSANYPEGKKVLGRIVHVDYENK  355

Query  4726  AVGLSLNPHLVHKKAP--PSLVKVGDIFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYIS  4553
                 SL PH+V  +A   P  V +G  FE AKV  VDK  GL LE+P+ P    A    +
Sbjct  356   MASFSLLPHIVKYQAYEFPEAVHIGQRFEAAKVTMVDKRNGLFLELPTEP--AQAAFVPA  413

Query  4552  dvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVK  4373
              +   E ++  K ++ G+ V  RV+    LEG+ T ++K S  + +     D+  G  +K
Sbjct  414   TLVSDESEENLKKYRMGREVVCRVVSRDPLEGVVTVAMKQSILDLAFLRREDIPIGKKLK  473

Query  4372  AKVITVDSFGAIVQFSSGVKALCPLRHMSEF-EIVKPRKKFQVGSELVFRVLGCK--SKR  4202
               ++ +   G ++  +  ++A CP   MS+  ++  P   F++G  +  + L     + R
Sbjct  474   GTILELVPKGMVISLTKSIRAFCPSSQMSDITQLQNPAAHFKIGDTIKCKALSVDPVAGR  533

Query  4201  ITVTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGL  4022
             + VT KK+LV S L +++S+ DA  G+ +HG+I+ ++++G FV F+NGV G    S+L  
Sbjct  534   VIVTCKKSLVSSDLPVITSFEDAEPGVQSHGYISSVKEYGVFVTFFNGVTGLVGLSQLSN  593

Query  4021  DPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTR-PMRLSETEM-----VKPGTVVS  3860
             +   +   +Y   QVVKC V++     ++I LSF  +    + E E      +K G++VS
Sbjct  594   NFVDNPEKVYTAGQVVKCHVLTCDAQKKRISLSFLKKQKQEVLENEAYNWNELKVGSMVS  653

Query  3859  GIVELVTPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIE  3680
             G V+ +   ++ V ++ G   + G +   HLSDH G  + +++ L  G    ++LV    
Sbjct  654   GTVKYLVDGAVRVELSGG---IAGVLPNPHLSDHVGHCEAIRATLSKGSVLKEMLVWSKN  710

Query  3679  GFN--LVLSAKYSLISTAQ--QLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFS  3512
                  + LS K SLI  A+  QL       +  ++  G +  +   G FV F   + G +
Sbjct  711   EAQKRITLSCKPSLIEAAKSGQLLQAREDFTSGTLSTGIIRGIETFGCFVEFANSIAGLA  770

Query  3511  PRSKATDDRRYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCS-STDATFIQEYFL  3335
               +   D    D    F +GQ+V   ++D  G+  +++++LK S C  +T  +F+Q YF 
Sbjct  771   YVTNLVDGPLDDLKTRFTVGQTVRARVVDSTGD--KLSLTLKPSQCGPNTSISFLQSYFK  828

Query  3334  LEHKIAKLQSLDSA-DSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGG  3158
              E  IA  +   +A    +NW   F +GS VE  +  +K+FG V+TF    +V GF    
Sbjct  829   EEEAIASSKPEGAAPKPKVNW-SAFEIGSSVEATIKILKDFGAVLTFAD-PNVTGFAVKD  886

Query  3157  QLGGINVE--TGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQ  2984
             Q+   N E   G+ ++A V+D+ K  +++D+SL+PE ++ + P ++    +  KRK +  
Sbjct  887   QIPEDNEELTEGAKVKAVVLDIDKQRYIIDVSLQPELISAALPASSQPAKKTAKRKSKGS  946

Query  2983  KD---LEVNQSVNAVVEIVKENYLVLSVPACNYA--LGYASLNDFNTQNL-PVKQFVNGQ  2822
              +   L+V   V + VE++K +YLV+SVP+      +GY +  D NTQ+  P  +F+  +
Sbjct  947   NEAEGLKVGDEVESRVELIKGSYLVVSVPSTKPGVHVGYVATKDCNTQHTDPFSKFIIHE  1006

Query  2821  SVIATIMALPDSSTGGRLLLLLKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLE  2642
                A +  +P S+   R+LLLL  I +  +          +    G++V+A+IT + P +
Sbjct  1007  KCKAIVKEIP-STPNSRMLLLLSKIEKEEDKKKKNPAIDVTDLKAGNIVKAKITSVLPTQ  1065

Query  2641  LRLKFGSGFHGRVHITEATDD----NTTEGPLNDFRIGQTLTARIVSKDSRSENK-----  2489
             L +  GS   GRVHITE  DD    N    PL  + IG  +  +++    R++++     
Sbjct  1066  LNVSLGSHIRGRVHITEIADDISQLNGHANPLLKYTIGDHIEGKVLDVVLRAKHRLLPIS  1125

Query  2488  -----RGYQWELSTKPSVLA-GD-MDGPHESF-NYSTGQLLSGYVFKVDSEWAWLTISRE  2333
                       +LS +P+ LA G+    P  +    S G+ L G V +V  +  W++++  
Sbjct  1126  HQNPVTSRSVDLSLRPADLALGEGQAAPRRTLETLSVGEKLLGVVDRVTPDGVWVSVTCI  1185

Query  2332  VRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKL--LRLVPHTLLITPEDT  2159
             ++ +++ILD S    ++++  +++ VG +V+ Y+   + +KK   L LVP+ +L +P   
Sbjct  1186  LKGRVFILDMSDSAKDIRDLSEKYAVGTAVTCYVKHVDTQKKALDLTLVPNGVLTSPPT-  1244

Query  2158  VPSSESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGY  1979
                S      I+ G+V+ GRISKILPGV G+ +Q+  H +G+V  T++ D +  +PL+  
Sbjct  1245  --HSLQKGTEIKPGTVVLGRISKILPGV-GVNMQLSPHTYGRVFITDIADDYTENPLADL  1301

Query  1978  CEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHP  1799
              EG   +C VL      KG   VDLSLR +   +NN  + +      +   ++ + DL  
Sbjct  1302  KEGDVRECYVL----GAKG-NKVDLSLRPS--RVNNLQVPKEQLAFPE---IESVADLAV  1351

Query  1798  DMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVES  1619
                V+GYV   +    F+ L+R + A+I    L    ++     FPVGKLV  KV S+  
Sbjct  1352  GKMVRGYVTETSTSAVFVALNRSLSARITRRELGQSPVKKIGVAFPVGKLVEAKVKSIGK  1411

Query  1618  LSK---RVEVTLRTSSSATPRKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVG  1448
               K   ++E+TL T      R S   A  +   G  +   I+ ++   L + +  + L+G
Sbjct  1412  RKKNEAKIELTLGT------RGSKKLAFGDLKEGMKVKATIQSVKEKNLLVQIKRSKLIG  1465

Query  1447  LCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSYFRDD-DGEDIQTT  1271
             +C +SELSDD +D+    YK G  V+  V+K+D +R R  + +K S+F  D D  D +T 
Sbjct  1466  MCRISELSDDFVDHPAKYYKEGDAVKALVIKIDPERQRFEVSLKPSHFEGDIDSSDEETA  1525


 Score =   293 bits (750),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 136/266 (51%), Positives = 193/266 (73%), Gaps = 4/266 (2%)
 Frame = -2

Query  922   PRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVW  743
             P+  D++EKL+ +SPNSSF+WIKYMAF LS+ ++++AR IAE+A+  IN REE EKLNVW
Sbjct  1669  PKTADDYEKLLLASPNSSFLWIKYMAFQLSIAEIDRAREIAERALKRINFREEQEKLNVW  1728

Query  742   VAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVK  563
             VA  NLE ++G+   E++M+VFQRAL Y DPK V+L L+G+YER+E YKL +EL + M K
Sbjct  1729  VALMNLENKHGS--NESLMQVFQRALTYNDPKTVNLQLVGIYERSEQYKLAEELYKAMTK  1786

Query  562   KFKHSCKIWLRRIQWALK--QNQDNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVAD  389
             KFKHS +IWLR  Q+ LK   + + ++ ++ RAL  LPK KHI  I++ A +EFK G  +
Sbjct  1787  KFKHSWQIWLRYSQFHLKNLHSIEGARKVLERALQVLPKKKHIGVISKMAQMEFKHGSPE  1846

Query  388   RGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKY  209
             RGR++FE +L  YPKR D+W +Y+D E+ +GD   IR LFE+  +L +  KKM++ F++Y
Sbjct  1847  RGRTIFEGILSNYPKRVDIWGIYIDMELALGDHGAIRNLFEKVTTLQLSSKKMRYFFERY  1906

Query  208   LAYEKSVGDEERIESVKRKAMEYVES  131
             L +EK  G +E +  V+ KA +YV S
Sbjct  1907  LKFEKEHGTKESVGHVREKARQYVLS  1932



>ref|XP_007510306.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18651.1| predicted protein [Bathycoccus prasinos]
Length=2077

 Score =   578 bits (1491),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 468/1543 (30%), Positives = 779/1543 (50%), Gaps = 204/1543 (13%)
 Frame = -2

Query  5494  KNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNY----  5327
             K +  G+KL G+++ V+ K ++VSL  GL+G V  SEA D  +    + ++ +S      
Sbjct  139   KTLRRGVKLLGIVSHVSNKGLIVSLQNGLKGTVSKSEASDAFYITNKDRVKRKSKKKPSS  198

Query  5326  -----------------------------------LSGLFHVGQLVSCIVLHLDDDKKEA  5252
                                                L  LFHVGQ+V C V++LD+ K   
Sbjct  199   YSSSEEEFSSSSSSSEESSGEEEEEEDGGKKAKIGLESLFHVGQIVRCAVVNLDEGK--T  256

Query  5251  GKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHS--  5078
             G  +I L+LRL+ +   L  + + EG  + A + S EDHGYI+ FG+   +GFL   S  
Sbjct  257   GGKRIELTLRLSQVCAGLDKECLTEGAAIPAVVTSVEDHGYIVEFGIDGSTGFLSRDSAG  316

Query  5077  QSVDKMNTGQLVEGVV--------------KSVDRTRKV----VY-LSSAPDAIAKYVTK  4955
                D + TGQL+E V+              K   R  K+    VY +S+     +  +  
Sbjct  317   DEHDSLLTGQLIEVVIALTPKAKKDINNNKKKNGRGSKLGESNVYKVSADTKRCSSAIAL  376

Query  4954  DLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFPPPSWKDDYPQ  4775
             + K   I  ++PGM+V A V SVLE+G+ +SF+TYF+GT+D FH+            + +
Sbjct  377   ENKSTLISTILPGMLVKARVKSVLEDGISVSFMTYFSGTIDCFHI-----AAEDTTSFKE  431

Query  4774  NKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSLV-KVGDIFEQAKVIRVDKGLGLLLE  4598
              +K+ +R++F+D   + VGLSL PHL+  ++P S++   G IFE A + RVD  +G+ L+
Sbjct  432   GQKLRSRVIFVDAQNKRVGLSLQPHLLEARSPASILPSTGSIFENAMINRVDPNVGVSLQ  491

Query  4597  IPSS--PVPTPAYVYISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAF  4424
             I           Y ++S + D  V+K+EK +K GK V+VRV+G R L+ +A  SLK S  
Sbjct  492   ISQGGKTRSVAGYAHVSHLSDDHVEKIEKKYKVGKQVKVRVIGHRLLDAVANVSLKRSVL  551

Query  4423  EGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVG  4244
             E   F+  ++ PGM+VK +V+  + FGAIV+ + GVKALCP  H+S+        K   G
Sbjct  552   EQPFFSLEELVPGMIVKGEVLATEHFGAIVKLAEGVKALCPPIHVSDIVGRTTSSKVTPG  611

Query  4243  SELVFRVLGC-KSK-RITVTHKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVR  4070
             + L FRV+   +S+ R  VTHK+ L+KS+L +L +  DA  G  THG I+ +  +G FV 
Sbjct  612   AILKFRVISVDRSRHRAIVTHKRALIKSELPVLKTIEDAIPGRTTHGIISGVVDYGVFVT  671

Query  4069  FYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTTRPMRLSE-  3893
              Y  ++G A   +LGL  G  I+  Y V QV++  +VS+     ++ LS         + 
Sbjct  672   LYGNLKGLAGSQDLGLAEGQSIADAYAVGQVIRTTIVSADRGENKLRLSLGGGGGNEDDN  731

Query  3892  ----------------------TEMVKPGTVVSG--IVELVTPDSIV-VNVNNGQSHLKG  3788
                                   T+ V  G V +   I ++V   SI+ V  +  +   +G
Sbjct  732   AAEGAEATVGAAAAAAAAISLSTDAVPIGKVFASATITKIVQGSSIIEVTSSTEEGSFQG  791

Query  3787  TVSTQHLSDHRGLADLMKSVLKPGYEF-DQLLVLDIEGFNLVLSAKYSLIS--TAQQLPL  3617
              V+ QHLSD+   A  M S LK G       +V++ +   +V+S K S+I   T+  LP 
Sbjct  792   LVAFQHLSDNPVTALSMASTLKVGEVLPGAFVVIERKPKRVVMSRKLSIIEAVTSSSLPD  851

Query  3616  DVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCT  3437
               +++    +  GYV +    GVFVRFLG LTG +P S+  D    + ++ F++GQ+V  
Sbjct  852   RADKVKAGKIYPGYVASTSSTGVFVRFLGSLTGLAPPSQIPDG--CNATDSFFVGQTVQA  909

Query  3436  NILDVNGET--GRITVSLKQSLCSS--TDATFIQEYF----LLEHKIAKLQSLDSADSGL  3281
              +L V+ E    R+++SL+    +   +DA  I+ +F     L+ K+A  Q    A++ L
Sbjct  910   MVLSVDVECVPPRLSLSLRLQTTAQPLSDAPLIRSFFADLEFLDFKVA--QDPKEAETLL  967

Query  3280  N--WVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQL-GGINVET---GSTI  3119
             +   V  F  G  +EG ++E K++GV++  ++ ++  G +S  Q+   + +E     + +
Sbjct  968   SEKTVRMFEPGCDIEGSINETKDYGVLIDIDEDENAVGLVSPHQVPESVEIEEFTPETRL  1027

Query  3118  QAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEI  2939
                V+DVS+ E ++D+  K   V  ++   +  K +K K    A K L+V ++  A+VE+
Sbjct  1028  SGRVLDVSRREGVIDIG-KVSVV--TEKNLSKKKKKKVKSASAALKKLKVGEATEAIVEL  1084

Query  2938  VKENYLVLSVPACNYALGYASLNDFNTQ-NLPVKQFVNGQSVIATIMALPDSST------  2780
             +K  Y++LS+P  + A+GYA ++  N + N   ++F   Q V   I  +P +S+      
Sbjct  1085  IKAQYVILSLPKYSDAIGYAPVHYCNVRLNDASERFEVNQRVNVVIAQVPSASSPDDVKG  1144

Query  2779  ----GGRLLLLLKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFH  2612
                   RLLL +  +            K NS   VG+  Q  +++++PL+  +   +   
Sbjct  1145  DEFYSNRLLLTVPYVD---------TNKSNSGPKVGTKFQGVVSELQPLQALVSLPNSKK  1195

Query  2611  GRVHITEATDDNTTEGPLNDFRIGQTLTARIVSKDSRSENKRGYQWELSTKPSVLAGDMD  2432
             GR+HITE      ++ PL +  +G T+   ++         RG   +L+ + S    D D
Sbjct  1196  GRIHITETGAFAKSKFPLEELSLGLTVNVAVLGM----AGDRGGLLDLTLRSS---ADED  1248

Query  2431  GPHESFNYST-----------------------GQLLSGYVFKVDSEWAWLTISREVRAQ  2321
                E+ N +                        GQ +  YV  V  +   + I  E+ A 
Sbjct  1249  KDDENVNKNAKNGNDDFDATASLKRPTLQTLEVGQSIHAYVISVLPDGVKVCIRPEITAF  1308

Query  2320  LYILDSSAEPSELKE-FQKRFYVGKSVSGYILSANKEKKLLRLVPHTLLITPEDTVPSSE  2144
             + ++++++   ELK+  +KRF  G+ +   I++ N  KK                V  S 
Sbjct  1309  VPLIETASSIKELKKPLEKRFSKGEKIKATIVNVNVSKK---------------HVDVSF  1353

Query  2143  SARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQF  1964
               +  +  G+ + G IS+   G   ++V++ AH+ G+V  T++ D +   P S       
Sbjct  1354  RDQNSVSVGAKVFGIISRFNKGTS-MMVRLGAHVTGRVFLTDVSDEFQEKPFSEMK----  1408

Query  1963  VKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQ  1784
             V   V     S+K +  VDLS+R +L + + +        +  N  + D K+L     V 
Sbjct  1409  VGNVVEVRVVSMKSSGEVDLSMRPSLLSKSGEKKK-----NVANPEINDAKNLEVGKEVS  1463

Query  1783  GYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRV  1604
             GYVK+V   GCF+ LSR VDA I L+NLADGF+  P  EFP G+L+ G+++S ++ + RV
Sbjct  1464  GYVKSVGKSGCFVALSRNVDALIKLTNLADGFVVKPSVEFPTGRLIRGRILSADAKTNRV  1523

Query  1603  EVTLRTSS--SATPRKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSE  1430
             E++LR S   S TP K   +A+ +   G+++ G ++ ++S+G+F+++D + + GLCH+S 
Sbjct  1524  EMSLRASQSDSKTPNK---EAVASLKVGDVVMGTVRSVQSYGVFVTLDESGISGLCHISM  1580

Query  1429  LSDDHI-DNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSYF  1304
              +D H+ D++ +  +AG+ VR K++KVD +  ++SLG+K S F
Sbjct  1581  FADMHVKDDLANHVRAGERVRAKIMKVDYETSKVSLGIKASVF  1623


 Score =   286 bits (733),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 133/266 (50%), Positives = 194/266 (73%), Gaps = 2/266 (1%)
 Frame = -2

Query  925   IPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNV  746
             +P +  E+EKL+ +SP SSF+WI+Y+AF +S+G  E AR++AE+A+  I  +EE E++N+
Sbjct  1803  LPESASEYEKLILASPLSSFLWIQYVAFQVSVGAYEDARAVAERALEAIPAQEEDERMNI  1862

Query  745   WVAYFNLEIEYGNP-PQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKM  569
             W+AY NLE  +G P P+EAV ++F+RA+   DPKK++L L+ +Y R E  ++ +E L+ +
Sbjct  1863  WIAYLNLENSHGLPNPKEAVSRLFKRAVNLADPKKLYLVLVDMYTRAEQIEILEETLKLI  1922

Query  568   VKKFKHSCKIWLRRIQW-ALKQNQDNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVA  392
             VKKF+ SCK+WL  I+   LK + + S+ +++RA   LPK KHIK + + A+LE K G  
Sbjct  1923  VKKFRSSCKVWLTYIRHVTLKGDAEGSRKLLDRATTSLPKRKHIKLLVKVALLEMKEGDP  1982

Query  391   DRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKK  212
             +RGR+MFE +L+ YPKRTD+WSVY+DQEI+    + IRALFERA  L +  + MKFLFK+
Sbjct  1983  ERGRTMFEGILRNYPKRTDIWSVYIDQEIKQNIPERIRALFERATHLELNARSMKFLFKR  2042

Query  211   YLAYEKSVGDEERIESVKRKAMEYVE  134
             YL YE+S G+ ER+  VK +AMEYVE
Sbjct  2043  YLEYERSHGNTERMTYVKARAMEYVE  2068



>emb|CCI11234.1| unnamed protein product [Albugo candida]
Length=1953

 Score =   554 bits (1428),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 538/1943 (28%), Positives = 911/1943 (47%), Gaps = 247/1943 (13%)
 Frame = -2

Query  5503  ITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDN-------ETNEM  5345
             I  K+I   M L G+I E+ +  +++SLP  L G V   E  D   D+         +++
Sbjct  103   INFKSIKSNMLLLGLIREITDTGLLISLPSKLNGFVPIEECSDEFHDHIRPSSSSTVSKI  162

Query  5344  EMQSNYLSGL---FHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLALLHKNLTLDAIQEG  5174
               +++ L+ L   F + Q V CIVL    D K  GK  + LS+RL+LLH   T +++++ 
Sbjct  163   ASKASKLASLDAIFSINQYVPCIVLTKSKDAK--GK-NLILSMRLSLLHAEYTPNSVRKS  219

Query  5173  IILSAYIKSTEDHGYILHFGLPSFSGFLPI--------HSQSVDKMNTGQLVEGVVKSVD  5018
             + +   ++S ED G +++ G+     F P                +  G+     V +V+
Sbjct  220   MTMFGTVQSMEDQGAVVNLGIRGMHAFAPKAQLVAACPEDPECANVQMGRQYLFTVLTVN  279

Query  5017  RTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGT  4838
                  V LS A     K VT+    +++  ++PG+++N  V  V+ NG+ ++FLT+F GT
Sbjct  280   THTSTVTLSPARSQTIKAVTRG-DHLTMKHMLPGLLLNVRVEQVVSNGLFVNFLTFFHGT  338

Query  4837  VDIFHLQQVF------PPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAP-  4679
             VD  H+ ++          +W   + +  K  ARI+ +DP  + + LS+  H+VH   P 
Sbjct  339   VDCNHISRLIFQDGSDDTKTWNALFKKGIKSRARIIGVDPTEKKIMLSMASHIVHLDHPL  398

Query  4678  -PSLVKVGDIFEQAKVIRVDKGLGLLLEIP-------SSPVPT-PAYVYISdvddkevkk  4526
                 + VG I + A + R+D G+G+LL +P       SS  P  P YV+IS+V D  + K
Sbjct  399   DAQTMPVGSIIDTATIERIDPGIGMLLSLPFPEQVAASSKNPKLPGYVHISNVSDAHIDK  458

Query  4525  me-KTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDS  4349
                K +  G  +R RV+G  + + + T S K S+   +V  H D+KPG  VKAK++ +  
Sbjct  459   NLDKKYSIGDNIRCRVIGSASFDNIVTVSCKESSLSQTVLRHCDLKPGQQVKAKILAMKD  518

Query  4348  FGAIVQFSSGVKALCPLRHMSEFEIVKPRK------KFQVGSELVFRVLGCK--SKRITV  4193
             +G +++ S GV+ L   +H+      K  K      KFQ G  +  +VL     SK+  +
Sbjct  519   WGILLEISEGVRGLVTTQHVPSMVASKLPKSKDTIGKFQQGRMVDAQVLHVDTVSKKTFL  578

Query  4192  THKKTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPG  4013
             T K+ L++S+  IL++Y  A  GL+T G+ITKI K+G  V FY GV G  P S L     
Sbjct  579   TMKRALMESQFPILATYKGAENGLVTMGYITKIAKYGVIVSFYGGVHGLVPASTLHQAGI  638

Query  4012  SDISSMYHVEQVVKCRVVSSSPASRQIVLSF-TTRPMRLSETEMVKPGTVVSGI-VELVT  3839
                   Y + QVV+ RV       ++++LS  TT     S T+    G+++  + V  V 
Sbjct  639   ECFEDAYTLGQVVRARVTQCDVKKQRLLLSLNTTNIPTQSNTKDSVVGSIIRDVQVTDVD  698

Query  3838  PDSIVVNVNNGQSHLKGTVSTQHLSD---HRGLADLMKSVLKPGYEF--DQLLVLDIEGF  3674
              +  V+ V      + G V+  HL+D   H  L D++ + ++ G ++   + +VL     
Sbjct  699   MEEHVIRVKTPLGVI-GNVAFVHLTDFPRHAFLVDMILASIRKGEQWTGQEFVVLSQSSD  757

Query  3673  N-LVLSAKYSLISTAQQLPLDVNQISPHSVVHGYVCNV-IGNGVFVRFLGRLTGFSPRSK  3500
               L LS K  L      +P  +  I   + + G+V  +    GVFV FL  LTGF+ +S 
Sbjct  758   QVLALSRKAMLTRHIFTIPQTIESIHEDAKIFGFVSAIEPEKGVFVEFLNHLTGFAHKS-  816

Query  3499  ATDDR--RYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEH  3326
               D++  +  + + F +G+++  ++L+   + G+ +V  +       ++  +  YF    
Sbjct  817   LVDEKFVQVISPDAFQVGETIVCSVLN-KSQAGKFSVDFR---ARHFESEVLPSYFA---  869

Query  3325  KIAKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQ---  3155
                  +      S  +   GF +G +V+G++         V    Y  VF F + G    
Sbjct  870   -----EWTRQIYSETDVYQGFPVGLVVDGEL---------VAERSYGSVFSFGTSGSHAS  915

Query  3154  ---LGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQ  2984
                 G + V +G + +           L+D  ++ +   G           +K+R R  +
Sbjct  916   VLVCGSVQVPSGCSHKLV---------LIDFDVEKKVYVGILDDKLGRSCSQKRRSRWER  966

Query  2983  KDLEVNQSVNAVVEIVK--ENYLVLSVPACNYA-LGYASLNDFNTQNLPVKQFVNGQSVI  2813
               L + Q+++A V  +   ++Y V+++       LG   L+ F  +  P K  V   S+ 
Sbjct  967   --LAIGQNLDARVLAIGSWKHYAVVAIHVGKKTQLGVVQLSYF-WRPAP-KCVVKDSSIR  1022

Query  2812  ATIMA------------------LP-------DSSTGGRLLLLLKAISEVAEsssskrgk  2708
               ++A                  LP       D        LL  A+S        +   
Sbjct  1023  CRVVAPCLRDARENDVIQTPFENLPLLRLCDDDDHLQKPAKLLRDAVS------MPRYKH  1076

Query  2707  knsSYDVGSLVQAEITDIKP--LELRLKFGSGFHGRVHITEATD----DNTTEGPLNDFR  2546
                   VG LV   I  IK   +E++LK        V +    D    DN    PL+ + 
Sbjct  1077  STEELQVGKLVTGRIATIKHDGMEIKLKATKQCGKVVAMVSIIDVDAGDNENH-PLDRYA  1135

Query  2545  IGQTLTARIVSKDSRSENKRG----------YQWELSTKPSVLAGDM------DGPHESF  2414
                 +T RI++   +  N+R           +  +LS +   ++ D       D   E+ 
Sbjct  1136  PKMAVTGRILTIMQKGANQRKPVSESNPATFHILQLSLRQQDVSSDQIEHVRADWGLENA  1195

Query  2413  N---YSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSV  2243
                    G +L G V +  S    + +S  V   L+ ++ S E S L+ +++ + VGK V
Sbjct  1196  GSKLLCEGCVLDGVVVEQKSSGLLVRLSHRVIGFLHCMEISTEQSVLEHYRELYPVGKRV  1255

Query  2242  SG-YILSANKEKKLLRLVPHTLLITPEDTVPSSESARCHIREGSVLGGRISKILPGVG--  2072
              G +IL  +  ++ + L            + +S+ A   I E   +G  ++ I+      
Sbjct  1256  DGCHILGVDHAERRVDL----------SLIHASKEA---ITEKLQIGNSVTGIVLDSSKK  1302

Query  2071  ------GLLVQIDAHLFGKVHFTELRDP--WVSDPL--SGYCEGQFVKCKVLQVGHSVKG  1922
                    L++Q+ A+ FG+V  TELR P  W S  L  S +  G F+   +L V   V  
Sbjct  1303  ASFRPPSLMLQLSAYTFGRVCVTELRPPSEWQSQMLEESEFKPGNFLTGTLLSVQKEV--  1360

Query  1921  TTHVDLSLRWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIM  1742
                       TL     ++ S+++           I DL     V G + + +  GCF+ 
Sbjct  1361  -------CEITLRPYRQESSSKYE-----------IGDL-----VTGIIASTSYMGCFVR  1397

Query  1741  LSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRK  1562
             +   V  ++LL +L+D FI+ P  EFPVGK+V G++   E    R + TL   S  +   
Sbjct  1398  VDHIVTIRVLLRDLSDDFIKDPISEFPVGKVVAGRITGKE---MRQDSTLYGMSLKSSIV  1454

Query  1561  SD-IDAL--NNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDN-VQSR  1394
             SD I AL  +N   G I++G + +I+ +G+F+ ++ +N+ GLCH+SE+ D+ I+  +   
Sbjct  1455  SDGIAALTWSNLKEGMIVTGTVSKIQPYGVFVKLNQSNVSGLCHISEIGDERIEKPLTEL  1514

Query  1393  YKAGQTvrvkvlkvdkdRHRISLGMKNSYFRDDDGEDIQTTSRQSINSTDKGNSVFIGTQ  1214
             +K G +V+ KVLKV  +  RISLG K +YF D+  E+I  T+  +I+  D    + I   
Sbjct  1515  FKEGDSVKAKVLKVKLENRRISLGFKPTYF-DEPNENI-GTNMDAIDEQDDDQCMQI---  1569

Query  1213  STVFPESSDADIDVSVVNTTDNILTEVESRASIPPLEVPLDDIENSDID-DAVNKNPDHT  1037
                F   S+A+ +      +++         S+ PL + +D+ E  D +  AV    D  
Sbjct  1570  IETFEAKSEAESEAGAETESESEPASEAEGVSVQPLSMDIDNDEREDEEVPAVGFQWDEF  1629

Query  1036  GGADTTDekdkkramkkakke---rereiraaeerlleKDIPRNTDEFEKLVRSSPNSSF  866
             G +     K   + +          +      +E  L +   ++  +FE+L+   P  ++
Sbjct  1630  GVSVPESPKVTPKTVCARNALWIDEKSVGVREKELALSEQEAQSAQDFERLLTIHPQDAY  1689

Query  865   VWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVM  686
             +WI+YMAF +SL +V+ AR +A +A   I  R+E EKLNVW+AY NLE ++G+   E+  
Sbjct  1690  LWIRYMAFHVSLQEVQLARDVAMRATRMIAFRDEKEKLNVWIAYLNLEHDFGDA--ESFQ  1747

Query  685   KVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQ  506
             +V Q ALQ   PK ++L L+ +Y R+  +    E+L  M KKFK S  +W+R +++ + +
Sbjct  1748  RVLQSALQVNPPKSIYLHLVDLYVRSNQHANVLEVLSTMQKKFKSSRAVWIRALRYFVLE  1807

Query  505   NQDNSQS--IVNRALLCLPKHKHIKFITQTAILEF--KCG------VADRGRSMFERMLK  356
             N D  ++  +++ AL  LP  KH+  + +  +  +  + G        ++ R++ E +L 
Sbjct  1808  NADQVKAAEVISSALNNLPGVKHVDILVKYGLFLYDPRAGKDTSWNAVEKARTVLEGVLA  1867

Query  355   EYPKRTDLWSVYLDQEIRVG--------DMDVIRALFERAISLSIPPKKMKFLFKKYLAY  200
              YPKR DLW+VY D+EIR+         D + IR LFER +++    KKMKF FKKY+++
Sbjct  1868  TYPKRMDLWNVYADKEIRLCKDTNCTEEDRERIRQLFERLLAMKFSTKKMKFWFKKYISF  1927

Query  199   EKSVGDEERIESVKRKAMEYVES  131
             E+S GDE  ++ VK+ A  YVE+
Sbjct  1928  EQSFGDEAHVDHVKQLAKSYVEN  1950



>gb|KDO70793.1| hypothetical protein CISIN_1g0001732mg, partial [Citrus sinensis]
Length=463

 Score =   506 bits (1304),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 281/440 (64%), Positives = 362/440 (82%), Gaps = 6/440 (1%)
 Frame = -2

Query  1831  RRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGK  1652
             + ++ I+DL P+M VQGYVKNVT KGCFIMLSRK+DAK+LLSNL+DG++ESPEKEFP+GK
Sbjct  5     KHLEKIEDLSPNMIVQGYVKNVTSKGCFIMLSRKLDAKVLLSNLSDGYVESPEKEFPIGK  64

Query  1651  LVTGKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNNFSAGNIISGKIKRIESFGLFIS  1472
             LV G+V+SVE LSKRVEVTL+TS S T  +S+I+ L+N   G+I+ G+IKR+ES+GLFI+
Sbjct  65    LVAGRVLSVEPLSKRVEVTLKTSDSRTASQSEINNLSNLHVGDIVIGQIKRVESYGLFIT  124

Query  1471  VDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSYFRDDD  1292
             ++NTNLVGLCHVSELS+DH+DN+++ Y+AG+ V+VK+LKVDK++ RISLGMK+SYF+ +D
Sbjct  125   IENTNLVGLCHVSELSEDHVDNIETIYRAGEKVKVKILKVDKEKRRISLGMKSSYFK-ND  183

Query  1291  GEDIQTTSRQSINSTDKGNSVFIGTQSTVFPESSDA--DIDVSVVNTTDNILTEVESRAS  1118
              +++Q +S +  +   +    +   +S++   SS A  D+D+   +    +L ++ESRAS
Sbjct  184   ADNLQMSSEEESDEAIEEVGSY--NRSSLLENSSVAVQDMDMESEDGGSLVLAQIESRAS  241

Query  1117  IPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkramkkakkerereiraaeerl  938
             +PPLEV LDD E  D+D+ +++N  HT  A T DEK+ + A KK K+ERE+EIRAAEERL
Sbjct  242   VPPLEVNLDD-EQPDMDNGISQNQGHTDEAKTIDEKNNRHAKKKEKEEREQEIRAAEERL  300

Query  937   leKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESE  758
             LEKD PR  DEFE+LVRSSPNSSFVWIKYMAFMLS+ DVEKARSIAE+A+ TINIREE+E
Sbjct  301   LEKDAPRTPDEFERLVRSSPNSSFVWIKYMAFMLSMADVEKARSIAERALQTINIREENE  360

Query  757   KLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELL  578
             KLN+WVAYFNLE EYGNPP+EAV+KVFQRALQYCDPKKVHLALLG+YERTE  KL DELL
Sbjct  361   KLNIWVAYFNLENEYGNPPEEAVVKVFQRALQYCDPKKVHLALLGLYERTEQNKLADELL  420

Query  577   EKMVKKFKHSCKIWLRRIQW  518
              KM+KKFKHSCK+ +  + +
Sbjct  421   YKMIKKFKHSCKVIIELLSF  440


 Score = 62.8 bits (151),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 49/169 (29%), Positives = 83/169 (49%), Gaps = 10/169 (6%)
 Frame = -2

Query  4399  DVKPGMVVKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEIVKPRKKFQVGSELVFRVL  4220
             D+ P M+V+  V  V S G  +  S  + A   L ++S+  +  P K+F +G  +  RVL
Sbjct  12    DLSPNMIVQGYVKNVTSKGCFIMLSRKLDAKVLLSNLSDGYVESPEKEFPIGKLVAGRVL  71

Query  4219  GCK--SKRITVTHK----KTLVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYN-  4061
               +  SKR+ VT K    +T  +S+++ LS   +   G I  G I ++E +G F+   N 
Sbjct  72    SVEPLSKRVEVTLKTSDSRTASQSEINNLS---NLHVGDIVIGQIKRVESYGLFITIENT  128

Query  4060  GVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLSFTT  3914
              + G    SEL  D   +I ++Y   + VK +++      R+I L   +
Sbjct  129   NLVGLCHVSELSEDHVDNIETIYRAGEKVKVKILKVDKEKRRISLGMKS  177



>ref|XP_002954137.1| rRNA processing protein Rrp5/programmed cell death protein 11 
[Volvox carteri f. nagariensis]
 gb|EFJ44854.1| rRNA processing protein Rrp5/programmed cell death protein 11 
[Volvox carteri f. nagariensis]
Length=2192

 Score =   549 bits (1414),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 481/1665 (29%), Positives = 778/1665 (47%), Gaps = 252/1665 (15%)
 Frame = -2

Query  5740  PLQLEDEVPDFPRGGASLLSKEELDEVRAEVDAEFEAEDRylkkkkqhklykKNQSVEDD  5561
             P  +++E  DFPRGGA  L+  E  E+      E E E    K+ K  K     Q  E+D
Sbjct  40    PFAVKEE--DFPRGGADTLTALERRELTEAARREVEQELADGKQPKSKKARLSKQEDEED  97

Query  5560  LGSLF---GHSISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLA  5390
               + F     ++ GKL K  + +  K++  G ++WG++ EV  + +VVSL  GLRG V  
Sbjct  98    --TFFRKHAAAVEGKLAKHVDLLRVKDLHAGTRVWGMVLEVTPRGLVVSLAHGLRGYVAP  155

Query  5389  SEAHDPLW----DNETNEMEMQSNY---------------------LSGLFHVGQLVSCI  5285
             ++A D L       +T       +                      L+ LF VGQ V  +
Sbjct  156   NQASDVLALMLKAQKTAAAAAAGDRGDVARKKGAALLEAAGGVVPPLTDLFVVGQFVRGV  215

Query  5284  VLHLDDDKKEAGKWK---IWLSLRLALLHKNLTLDAIQEGIILSAYIKSTEDHGYILHFG  5114
             V+     +   G      + LSL L  +   L  +A+ EG+ L A ++S EDHGY L FG
Sbjct  216   VMEAPTGEDTGGGRSAKHVALSLLLRDVQGGLGSEAVAEGLALGAVVRSVEDHGYTLSFG  275

Query  5113  LPSFSGFLPIHSQSVD-----KMNTGQLVEGVVKSVDRTRKVVYLSSAPDAIAKYVTKDL  4949
             +   SGFL              +  G L++ VV++    R V+ +S AP  +A  VT++ 
Sbjct  276   IKGTSGFLRKKDHEAQFGEGVALQVGGLIDVVVRNAADKRNVL-VSCAPGDVAAAVTREA  334

Query  4948  KGIS-IDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHL------------QQVF  4808
             +G+S +  ++PG ++N  V  VL NG+++SFLT+F GTVD++HL                
Sbjct  335   EGMSGLGAVLPGALLNVKVRKVLSNGLLVSFLTFFHGTVDLYHLPAASAAAAAAATGGAA  394

Query  4807  PPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKVIR  4628
                 W+  YP+  K+ AR+L+ D   +  GLSL PHL  +  P  +  +G +F +A+V+R
Sbjct  395   GSKDWRKLYPEGTKLRARLLYADLVRKRAGLSLLPHLAAQTLPSPVPVLGSVFPEAEVVR  454

Query  4627  VDK--GLGLLLEIPSSPV-PTPAYVYISdv------ddkevkkmeKTFKPGKVVRVRVLG  4475
             +D   G GLLL +   P  P   Y ++S+         + V  M + +K G  +  RV+G
Sbjct  455   LDAAGGPGLLLRMEGLPEGPVAGYCHVSNALEEKKVAKEAVAAMAEKYKVGTKLPARVIG  514

Query  4474  FRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITV---DSFGA-IVQFSSGVKAL  4307
             +R L+G+A+ +++ S    +V + +D+ PGM+V   VI+V   D  G  +VQ + GVK L
Sbjct  515   YRLLDGMASVTVRPSQVNAAVLSFTDLTPGMLVAGTVISVPDRDGDGPLLVQIAEGVKGL  574

Query  4306  CPLRHMSEFEIV-----------KPRKKFQVGSELVFRVLGCK--SKRITVTHKKTLVKS  4166
              P  H SE               K R K +VG  +  RVL     ++++T+T +K  + +
Sbjct  575   VPPLHASELTGAAAAAAGKTSGGKRRIKVKVGDRVEARVLDLDLGARKVTLTLRKAFLAT  634

Query  4165  KLDILSSYTDATEGLITHGWITKI-EKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYH  3989
             K   L S   A  G   HG +T + ++ G FV F++G+ G A   +LGL+PG D+   + 
Sbjct  635   KAAPLVSAAQAVPGSRFHGMVTGLHDRLGVFVSFFSGLSGLASHDDLGLEPGQDVKEAFG  694

Query  3988  VEQVVKCRVVSSSPASRQIVLSFTTRPMRLSETEMVKPGTVVSGIVELVTP----DSIVV  3821
             + QVV+  ++S++   R  +   +      +       G     ++  + P    +++V+
Sbjct  695   IGQVVRATILSTA-GGRIKLSLASKSAAAEAAAAAASNGISTPDLLGGLQPGDIAEAVVL  753

Query  3820  NVNNGQS-----------------------------HLKGTVSTQHLSDHRGLADLMKSV  3728
              V+NG                                ++  +   HLSDH    +  ++V
Sbjct  754   KVHNGGEGGDAASSATPFYTCRLERPGVSGGGSVPLGVRARLEVPHLSDHPAALEAFRAV  813

Query  3727  LKPGYEFDQLLVLD-IEGFNLV-LSAKYSLIS--TAQQLPLDVNQISPHSVVHGYVCNVI  3560
             ++PG +  +++VL+ +E    V +S K SL++   A +LP    ++   +V+ GYV +V 
Sbjct  814   VRPGTKLGRVVVLERLEAARCVRVSRKPSLLAAGAAGRLPRRFEEVVEGAVLPGYVASVT  873

Query  3559  GNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDVNGETGRITVSLKQS  3380
              + V+VRFLG LTG +   + +D    +   +F  GQSV   +   +    R T+ L+ S
Sbjct  874   PDAVYVRFLGGLTGRAGLPQLSDVFVSEPRLLFAEGQSVRAQVAVCDAARQRFTLMLRPS  933

Query  3379  LCSSTDATFIQEYFLLEHKIAKLQSLDSA----------------------------DSG  3284
             + +STD  F+ +YF    ++ +LQ+L +                              + 
Sbjct  934   VTASTDGAFLLDYF---KEMQQLQALRAEAEAEPGGGGGGGDGAAGNGAANGGSAAPPAD  990

Query  3283  LNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLG--GINVETGSTIQAA  3110
             L+    F LG +   +VHE+KE+G+V   +++ DV G +     G  G +   G+ ++  
Sbjct  991   LDPARVFPLGGLAAARVHEVKEYGIVCDMDEHPDVVGLVPSSHAGALGPSPAVGTRVRGR  1050

Query  3109  VIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKE  2930
             V+DV   + LV+LSLKP  V  ++   A     ++         L+   +V AVVE ++ 
Sbjct  1051  VLDVVGHQGLVELSLKPGMVAAAEDGAAGRAAARQ---------LKPGVAVEAVVEGIRP  1101

Query  2929  N-YLVLSVPACNYALGYASLNDFNT--QNLPVKQFVNGQSVIATIMALPDSSTGGRLLL-  2762
               YL+LS+P  + AL YA++ D+NT   +L  + F  GQ + AT+ A P  +  GR++  
Sbjct  1102  GEYLILSLPQHSAALAYAAVTDYNTPRPDLVPRTFTVGQRLTATVAATPPDAPLGRIVCH  1161

Query  2761  --LLKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRVHITEA  2588
               L +         ++  G K  + D GS+V+A +T I+P +L                 
Sbjct  1162  VPLTRIGGGAGGKGAAASGGKKVTLDPGSVVEAVVTGIQPYQL-----------------  1204

Query  2587  TDDNTTEGPLNDFRIGQTLTARIVSKDSRSENKR-GYQWELSTKPSVLAGDMDG--PHES  2417
               D +  G       G+T+ A ++ +    E  R G  W+LS +PS LA    G  P  S
Sbjct  1205  --DVSVCG-------GKTVEAVVLGRLQTGEGHRPGSVWDLSLRPSRLAKAKKGEPPVPS  1255

Query  2416  FNYST---GQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKS  2246
                S+   GQ L  +V +V  +  WL     VR ++  LD+S +P  L +    F  G  
Sbjct  1256  VTLSSLAPGQQLPCFVLEVAEDALWLGAGPAVRGRVAALDASLDPDVLTDLSSTFPPGTV  1315

Query  2245  VSGYILSANKEKKLLRLVPHTLLITPEDTVPSSESARCHIR--------------EGSVL  2108
             V   +L+ ++++  L L     LI      P S + R  +               EG+++
Sbjct  1316  VLARVLAVSRKRNSLDLS----LID-----PCSGTTRGSVAGGGAAATTAAPLPPEGALV  1366

Query  2107  GGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSV  1928
              GRI  +    GG+ V I     G V  T++ D WV D  +G  EG +V+ +VL      
Sbjct  1367  MGRI--LAANGGGVRVSIGHRRAGSVALTDIYDEWVPDARAGLREGAYVRVRVLG-----  1419

Query  1927  KGTTHVDLSLRWTLDTM---NNQNISEHDDVHSQNRRVQDIKDLHPDM----------TV  1787
             +      LSLR +       +  +++                   P++          TV
Sbjct  1420  RDGDFAVLSLRPSRGGAVAGSKPSVTAAGSKKQGGSSSSATAAAAPELISADSLKVGATV  1479

Query  1786  QGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKR  1607
              GYVK    KG F+ L R  D  I L NL+DGFIE P   FP G  +  +V+ V     R
Sbjct  1480  TGYVKRCDAKGLFLALDRFRDGHIKLVNLSDGFIEDPAAAFPAGMQLEARVLRVGE-GGR  1538

Query  1606  VEVTLR-----TSSSATPRKSDIDALNNFSAGNIISGKIKRIESFGLFISV-DNTNLVGL  1445
             +E+TLR     TS SA P    + +L+    G ++SG+++R+E FG+F+ V  N  LVGL
Sbjct  1539  IELTLRSATRQTSGSAAP---AVQSLSELRPGQLVSGRVRRVERFGVFVEVGGNPGLVGL  1595

Query  1444  CHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNS  1310
              H+SEL+D  + ++ S +K+ Q VR  V KVD +  R+SL MK S
Sbjct  1596  AHISELADGPVKDINSVFKSKQLVRAVVTKVDVEASRLSLSMKPS  1640


 Score =   293 bits (750),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 139/288 (48%), Positives = 192/288 (67%), Gaps = 29/288 (10%)
 Frame = -2

Query  907   EFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVWVAYFN  728
             +FE+LV SSPNSSFVWIKYMA  L  GDV+ AR +A++A+ TIN REE EK NVWVA+ N
Sbjct  1901  DFERLVLSSPNSSFVWIKYMALHLGKGDVDAARKVAQRALDTINYREEGEKFNVWVAWLN  1960

Query  727   LEIEYGNPP--QEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVKKFK  554
             LE  YG+ P  +EAVM++ +RALQY D KK++LA LG++ER+    L ++++  + KKF 
Sbjct  1961  LENAYGSSPSPEEAVMELLKRALQYTDQKKMYLAALGIFERSGRDDLAEQVVRTLTKKFG  2020

Query  553   HSCKIWLRRIQWALKQN---------------------------QDNSQSIVNRALLCLP  455
              S K+W R ++ +L++                              +++ ++ RAL  LP
Sbjct  2021  GSAKVWARALERSLQKGDGETPIFISYVPPSPVPYANFLRALRVAQSARQLLERALQSLP  2080

Query  454   KHKHIKFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRA  275
               KHIK + + A+ EF+ G A+RGR + E +L+ YPKR DLW+VY+DQE++ G+   IRA
Sbjct  2081  PRKHIKALVRAALAEFRLGSAERGRGILEGVLRNYPKRLDLWNVYIDQELKTGEQQRIRA  2140

Query  274   LFERAISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVES  131
             LFERA  L +PPKKMKFLF++YL YEK  GD   +E VKR+AME+VES
Sbjct  2141  LFERATHLPLPPKKMKFLFRRYLEYEKEEGDTAAVEHVKRRAMEFVES  2188



>dbj|BAK04508.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=450

 Score =   495 bits (1274),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 277/462 (60%), Positives = 353/462 (76%), Gaps = 19/462 (4%)
 Frame = -2

Query  1513  GKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSRYKAGQTvrvkvlkvdkdRHR  1334
             G++KR+ES+GLF+++ ++ LVGLCH+SELSD+ + ++ + Y+AG  V+ K+LK+D+DRHR
Sbjct  2     GQVKRVESYGLFVTIKSSELVGLCHISELSDEPVLDINACYRAGDMVKAKILKIDQDRHR  61

Query  1333  ISLGMKNSYFRDDDGEDIQTTSRQSINSTDKGNSVFIGTQSTVFPESSDADIDVSVVNTT  1154
             +SLG+K SYF  D  +D      ++ N  D G  V +       P+ S         N+T
Sbjct  62    VSLGLKESYFDSDMTDD------ENDNEND-GERVPMDISRA--PQISGG------FNST  106

Query  1153  DNILTEVESRASIPPLEVPLDDIENSDIDDAVNKNPDHTGGADTTDekdkkramkkakke  974
              + L   E RASIP L+V LD+ E SD  +   K  +   G+++  +K  +R  +KA+K+
Sbjct  107   -SFLPGPEPRASIPALQVTLDEYEGSD-QEGDQKGHEIANGSESNVKKSDRRLKEKARKQ  164

Query  973   rereiraaeerlleKDIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEK  794
             RE EI A EER L+KD P+  DEFEKLVRSSPNSSFVWIKYMAF+L L DVEKARS+AE+
Sbjct  165   REIEISALEERALQKDTPQTPDEFEKLVRSSPNSSFVWIKYMAFLLDLADVEKARSVAER  224

Query  793   AVSTINIREESEKLNVWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYE  614
             A+ TINIREE EKLNVWVAYFNLE EYG+P ++AV K+FQRALQYCDPKKVHLALLG+YE
Sbjct  225   ALRTINIREEEEKLNVWVAYFNLENEYGSPREDAVKKIFQRALQYCDPKKVHLALLGMYE  284

Query  613   RTEHYKLGDELLEKMVKKFKHSCKIWLRRIQWALKQNQDNS--QSIVNRALLCLPKHKHI  440
             RT+  +L DEL ++M K+FK SCK+WLRRIQ++L Q +D    +S+VNRALL LP+ K I
Sbjct  285   RTKQNELADELFDRMTKRFKTSCKVWLRRIQFSLTQGKDVEYIKSVVNRALLSLPQSKRI  344

Query  439   KFITQTAILEFKCGVADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERA  260
             KF+TQTAILEFKCGVA+ GRS FE +L+EYPKRTD+WSVYLDQEIR+GD ++IRALF+R 
Sbjct  345   KFLTQTAILEFKCGVAEEGRSRFELILREYPKRTDIWSVYLDQEIRLGDTEIIRALFDRV  404

Query  259   ISLSIPPKKMKFLFKKYLAYEKSVGDEERIESVKRKAMEYVE  134
               LS+PPKKMKFLFKKYL YEK+ GDEERIE VK+KAMEYVE
Sbjct  405   TCLSLPPKKMKFLFKKYLRYEKAQGDEERIEHVKQKAMEYVE  446



>ref|XP_005834243.1| hypothetical protein GUITHDRAFT_137461 [Guillardia theta CCMP2712]
 gb|EKX47263.1| hypothetical protein GUITHDRAFT_137461 [Guillardia theta CCMP2712]
Length=1592

 Score =   504 bits (1299),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 426/1472 (29%), Positives = 729/1472 (50%), Gaps = 106/1472 (7%)
 Frame = -2

Query  5539  SISGKLPKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLASEAHDPL---  5369
             S S K+PK    +  K ++ GM L G + EV + D  +SLP  L G V   E  D L   
Sbjct  114   SDSMKMPKFIEPLRFKKLNTGMLLCGFVKEVRQADATISLPNNLTGWVEIDEISDELSAV  173

Query  5368  WDNETNEMEMQSNYLSGLFHVGQLVSCIVLH---LDDDKKEAGKWKIWLSLRLALLHKNL  5198
              +    + E  +  L     +G  V C++L    L    K+  K  I +SL+ + ++  L
Sbjct  174   LEQVLEDEEADAPPLEDYIWIGMPVRCVILSTAVLSTAGKQQHK-NISVSLKPSRVNSAL  232

Query  5197  TLDAIQEGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDKMNTGQLVEGVVKSVD  5018
              LD + +G+ L   + S ++ GY +  G    + FLP    S  ++  GQL+E  VK V 
Sbjct  233   ALDTLHKGLSLYGAVSSKQEKGYTISLGTSEATAFLPFQEVSRGELKVGQLLETYVKKVK  292

Query  5017  RTRKVVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGT  4838
             +  K+  +S+  +++   +TK+++ +++D L+PGM+    V  V E+G+++ FL +F GT
Sbjct  293   KEHKLAIVSTQRESLEDSLTKEIESLTLDNLLPGMIFKCKVAKVHESGLVVRFLNFFFGT  352

Query  4837  VDIFHLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSL---V  4667
             +D+FHL  V       + + + + V ARI+ +D     +GLSL  H++    PP +   V
Sbjct  353   IDLFHLPLVGSGKGV-EQFSEKQVVTARIISLDVGANRIGLSLRRHVLDSLPPPYVQADV  411

Query  4666  KVGDIFEQAKVIRVDKGLGLLLEIP---SSPVPTPAYVYISdvddkevkkmeKTFKPGKV  4496
             K+G  F+ A V RVD  +G+LLE+            YV+IS+V D+ V+K+EK    GK 
Sbjct  412   KMGQRFDGAIVRRVDPEVGVLLEVQLGGEGSESLEGYVHISNVSDERVEKVEKEVAVGKE  471

Query  4495  VRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGV  4316
             V  RV+GF   +GL   S+K S     V  + D+ PG +VK KV  +   G +V  S  V
Sbjct  472   VSCRVIGFSWADGLINMSMKPSVLAAEVLLYDDLTPGDLVKVKVERLSEEGCLVSISDNV  531

Query  4315  KALCPLRHMSEFEIVKPRKKFQVGSELVFRVLGC--KSKRITVTHKKTLVKSKLDILSSY  4142
             +   P  H ++  +V P ++   G  +  RVL    +++++ +T KKTLV S L +++  
Sbjct  532   RGYIPSSHFADVALVNPERRLLPGKMIKARVLRVNPQTRQLLLTLKKTLVSSSLPLIARV  591

Query  4141  TDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSD-ISSMYHVEQVVKCR  3965
              DA  G+++HG + K+++ G  V F+   +GF PRSELG++  ++ +   +  +QV+K R
Sbjct  592   EDAKVGMLSHGVVYKVQESGVLVSFFGTAKGFLPRSELGIEQEAERVEDCFKPDQVLKVR  651

Query  3964  VVSSSPASRQIVLSFTTRPMR---LSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQSHL  3794
             V+S     ++IVLS          ++ +  +  G +V   V     ++++V   NG    
Sbjct  652   VLSVEVDRKRIVLSLKAAKENSQIIATSARLTVGELVEMEVVEKQEEALLVRAANGAV--  709

Query  3793  KGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDI--EGFNLVLSAKYSLISTAQQ--  3626
              G +   HL+DH  LA L    L+P       LVLD+       +++ K SL+S  ++  
Sbjct  710   -GFLPRPHLADHSNLAALAFQQLQPEARLT-CLVLDLLANKSRYLVTVKPSLLSAVREEN  767

Query  3625  LPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQS  3446
              P  + Q+ P   + GYV +V   GVFVRFLGRLT  +P S        D   +F  GQS
Sbjct  768   FPSSLAQLHPQQFLQGYVFSVKSCGVFVRFLGRLTALAPSSSLAAGHVDDPQSLFEEGQS  827

Query  3445  VCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDG  3266
             V   +           V+LK S+C STD++F++     E  + + Q        +   + 
Sbjct  828   VRCCV-----------VTLKPSICLSTDSSFLKSMEATEQLVLEAQ--------MKGGES  868

Query  3265  FGLGSIVEGKVHEIKEFGVV---VTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVS  3095
                G +VE +V E    GV    + FE    + G       G   V TG   +  V+ + 
Sbjct  869   KRAGQVVEEQVVEALCVGVKGKELHFELPGSLVGVCPPHLHGRAKVTTGKRYKVCVLLID  928

Query  3094  KIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVL  2915
             K+   V + ++ E V       A+ +  KK + +E +++L    SV  +V++V E  +VL
Sbjct  929   KLRERVYVGMEDELV-------ASLQASKKGKGKEKEQELMPADSVRGIVQLVGEERVVL  981

Query  2914  SVPACNYALGYASLNDFNTQ-NLPVKQFVNGQSVIATIMALPDSSTGGRLLLLL------  2756
             S+P  +  L  AS+ DFN +     KQFV GQS+   ++     +TG  +L++       
Sbjct  982   SLPQ-SRKLAVASIEDFNVRGERARKQFVPGQSMDVLVL----EATGAPVLVMRADSGSG  1036

Query  2755  ------------KAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFH  2612
                         + +    E+    R       + G LV+  +  +K     ++ G G  
Sbjct  1037  KTQRREGQKVDDEELMRNGENCKGARLTSMEEAERGKLVKGIVHSVKATHANVRLGGGLR  1096

Query  2611  GRVHITEATD-DNTTEGPLNDFRI---GQTLTARIVSKDSRSENKRGYQW-ELSTKPSVL  2447
             G + + +A D +   EG  N   +   GQ + AR++   S +   R  +   LS +PS L
Sbjct  1097  GVIDLLDAMDPEEMREGKENRLSMLQQGQAIDARVLGVFSPARAGRDTRLVALSIRPSEL  1156

Query  2446  AGDMDGP---HESFN-YSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELK  2279
             A   + P     S +    G+ + G V KV+ +  W+ +   ++ ++  LD+S E + L+
Sbjct  1157  AQPEETPLTKRPSLDELKEGEEVEGMVEKVEGDCLWVHLGSSLKGRVEQLDASRELTVLE  1216

Query  2278  EFQKRFYVGKSVSGYILSAN--KEKKLLRLVPHTLLITPEDTVPSSESARCHIREGSVLG  2105
               +K F VG+ V   +++ +  K +  LRL+        + +    +     I+ G V+ 
Sbjct  1217  NLKKNFKVGQGVRASVIAVDVGKSRVDLRLLEEGEKGKEKGSGRKRKKGEEAIQVGEVVP  1276

Query  2104  GRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVK  1925
              +I K  PG  G ++++  H FG+VH  ++ D  V  PLS +  GQ V+C VL+      
Sbjct  1277  AKIVKARPGF-GFVLKLGLHSFGRVHICDIADAAVDAPLSLFKVGQLVRCCVLEAEED--  1333

Query  1924  GTTHVDLSLRWTLDTMNNQNISEHDDV---HSQNRRVQDIKDLHPDMTVQGYVKNVTPKG  1754
                   LSLR +   ++ +   E ++    H     V  +K+L     + GYVK+ +  G
Sbjct  1334  ---GFALSLRPS--RVSGKRRGEEEEAVREHGAFPEVSSVKELAVGQLLSGYVKSASSAG  1388

Query  1753  CFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSA  1574
              F+ L R+V A++ +S L+DG+++  +  FP G+ V+G+V+SVE   ++V+++L+ S   
Sbjct  1389  VFVQLGRQVTARVKISELSDGYVKDVKANFPPGRRVSGRVISVEVKKEQVDLSLKRSVVL  1448

Query  1573  TPRKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSR  1394
               R+      ++   G +++G +K ++SFG+F+ +  + L GLCH+SE+ ++ + ++  +
Sbjct  1449  GKRRV---GWSDLQVGQVVAGAVKSVQSFGVFVRIRGSELDGLCHISEVGEEFVRDLSKQ  1505

Query  1393  YKAGQTvrvkvlkvdkdRHRISLGMKNSYFRD  1298
             +K G  V+ K+L++D  R  ISLGMK  Y +D
Sbjct  1506  FKQGDKVKAKILRMDPQRKTISLGMKPEYLQD  1537



>ref|XP_008862834.1| hypothetical protein H310_01497 [Aphanomyces invadans]
 gb|ETW09029.1| hypothetical protein H310_01497 [Aphanomyces invadans]
Length=1855

 Score =   457 bits (1177),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 420/1470 (29%), Positives = 707/1470 (48%), Gaps = 147/1470 (10%)
 Frame = -2

Query  5521  PKSANRITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEME  5342
             P  A+ IT K + P M + G++ ++N+ DIVVSLP  L G+V+  E  D L ++  + ++
Sbjct  75    PALAHTITFKTLRPQMLVMGIVRQINDHDIVVSLPNKLNGVVVRKETADELHNDNASSVK  134

Query  5341  MQSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILS  5162
                  L+ LFH+GQ V+C+VL     K++ GK +I LSLR +L++ NLT+  + +G  + 
Sbjct  135   -----LTDLFHIGQYVACVVL--KSSKEDRGK-RIELSLRTSLVNANLTIKHMVKGASVY  186

Query  5161  AYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDKMNT----GQLVEGVVKSVDRTRKVVYL  4994
             A + S EDHG +++ G+  F+GF+P     + + +T    GQL   VV SV+       L
Sbjct  187   ASVVSVEDHGVVVNVGVRGFTGFIPSKDLHLPEGHTDAHPGQLFFCVVASVNTHTNTATL  246

Query  4993  SSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQ  4814
             ++      K VT+     ++  L  GM++N  V  VL NG+ ++FLT+F+GTV+  H+  
Sbjct  247   TTERSVAVKAVTRG-DSYTMSTLSLGMLLNVKVEDVLANGLQVNFLTFFSGTVEFNHMSN  305

Query  4813  VFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQAKV  4634
                   W   Y +  K  ARI+ ID AT+AV LS+ PH+V+ +AP     +GD+ + A V
Sbjct  306   PCQK-EWAAAYSKGLKGRARIVAIDAATKAVMLSMAPHIVYLQAPEFKHAIGDVVQDAVV  364

Query  4633  IRVDKGLGLLLEI--PSS----PVP----TPAYVYISdvddkevkkmeKTFKPGKVVRVR  4484
              R+D G+GLLL +  PSS     +P     PAY +IS V D  + K+EK FK  ++V  R
Sbjct  365   HRIDAGIGLLLSLAGPSSVGGERLPWKDFRPAYAHISRVSDSRIDKLEKNFKLDQIVAGR  424

Query  4483  VLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGVKALC  4304
             V+G+   +GL   +L  SA   +V   +D+ PG ++K KV++V+S+G +V    GV+ + 
Sbjct  425   VVGYSAFDGLVNLTLAPSALSKAVLRQADLVPGSLIKGKVVSVESWGILVDICEGVRGVV  484

Query  4303  PLRHMSEFEIVKPRKKFQVGSELVFRVL--GCKSKRITVTHKKTLVKSKLDILSSYTDAT  4130
                H     + K   K++ G  +  RVL     SK+  +T KK LV S L  L+SY  AT
Sbjct  485   SASHAPSVALKKTMSKYKPGHAIEVRVLQVDIASKKTYLTLKKGLVSSDLPPLTSYDQAT  544

Query  4129  EGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSSS  3950
              G + HG++TKI   G  V FYNGV G  P + L      DI + Y   QVVK  V    
Sbjct  545   PGTVAHGFVTKIADFGLIVGFYNGVFGLVPAATLHNAGVEDIGAAYTPGQVVKVAVARCD  604

Query  3949  PASRQIVLSF-TTRPMRLSETEMVKPG---TVVSGI----VELVTPDSIV-VNVNNGQSH  3797
                +++ L+F TT  M  +  +   P     V +G       +   DSIV V   +G   
Sbjct  605   STKKRMTLTFDTTGSMSKTAAKGSLPSLSPAVAAGTVVSVSVVEVEDSIVRVQTTDG---  661

Query  3796  LKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPL  3617
             ++G V   HL+D           +  G  FD L++   +   L L+ K +L++   ++P 
Sbjct  662   IEGIVPVVHLTD---FPRAFSPSVAVGDAFDALVLFQSQDGLLHLTKKPTLVAQKAKMPS  718

Query  3616  DVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCT  3437
                 ++   VV G+V ++   GVFV FL  L   +P +  TD        +F IG +V  
Sbjct  719   TFKDVAEGQVVTGFVRDIRPFGVFVSFLNNLQALAPIAFLTDRFVSSPDGLFEIGDTVQC  778

Query  3436  NILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGL  3257
              +  V+ E                     +  F+L+ ++    S+D   + L        
Sbjct  779   VVHKVDAE---------------------KNQFMLDFRVPS-PSVDGLAALLAEHAASHA  816

Query  3256  GSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIE-HL  3080
              +I     H   E  V ++ + Y    G++         V   +T      D  +++  L
Sbjct  817   PAIAHTVGHT--EKAVFISAKAY----GYVCSLSDDDTTVVVPNTTHLDWTDNDRVKLRL  870

Query  3079  VDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYLVLSVPAC  2900
             +D   + +   G        K   KK ++ A + L  +  V+A + +V++ Y V++V A 
Sbjct  871   IDYDFEKQVYYGHADPAEFVKAGDKKGRKAASR-LTKDTPVDATIVLVRDEYAVVTV-AD  928

Query  2899  NYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSSTGGR-------LLLLLKAISE  2741
             ++A+    +  F+  +    ++      +  ++       G         L++L  + S+
Sbjct  929   SHAVALLQVTSFHQPSATCDEWALEVGQVHKVIVKGHVKAGSSAPFDDVPLVVLASSFSK  988

Query  2740  VAEsssskrgkkn------sSYDVGSLVQAEITDIK--PLELRLKFGSGFHGRVH--ITE  2591
               +   S    ++      + + +G+ V   I  IK   +EL++K  +   G+V+  ++ 
Sbjct  989   KQQLKKSDASHEHLPKYHGTDFVIGASVTGRIIGIKEDAMELKIKCTTS-AGKVNAFVSI  1047

Query  2590  ATDDNTTEG--PLNDFRIGQTLTARIVSKDSRSENKR------GYQWELSTKPSVLAGDM  2435
                D TT+G  P + + +   +T RIV+   +  N+R            S   S+ A D 
Sbjct  1048  VDVDGTTKGTHPFDAYSVNSIVTGRIVALVEKGANQRKPVGPDNVANFRSINVSLRAADQ  1107

Query  2434  DGPHESFN----------YSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSE  2285
                H +              +G+ L G V +   +   + +S  V   +++L+ S +P+ 
Sbjct  1108  TRNHLTPRADWADAGYELLQSGKFLPGVVVETTKDGVMVRLSARVVGFVHVLELSEDPAA  1167

Query  2284  LKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTLLITPEDTVPSSESARCHIREGSVLG  2105
             L  F + F VG  +S  +LS ++E K L L  H             +  R     GSV+ 
Sbjct  1168  LASFAQSFPVGTPLSVRVLSCDREAKTLDLTTH-------------KETRSGFAVGSVVL  1214

Query  2104  GRISKILPGVGG--LLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVKCKVLQVGHS  1931
             GR++  +  +    ++VQ+ AH FG++  TE+ D   + PL+G+  G FV+  VL     
Sbjct  1215  GRVNLKVRALAAPSVMVQVGAHTFGRICVTEVHDTPSNLPLAGFVHGTFVQAVVLS----  1270

Query  1930  VKGTTHVDLSLRWTLDTMNNQNISEHDDVH-SQNRRVQDIKDLHPDMTVQGYVKNVTPKG  1754
                    + SL  T+ +    N +E+     +Q  ++  + DL     V GYV  V   G
Sbjct  1271  ------NEPSLELTVKSSALANPTEYVAADCAQKGKLPQVGDL-----VSGYVATVATGG  1319

Query  1753  CFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSA  1574
              F+ L R V A+++L +L+D F++ P   FP G LV G+V  VE  + +VE++L+ S   
Sbjct  1320  VFVRLHRSVTARVMLRDLSDDFVKEPSTAFPPGTLVAGRVTKVE--NGKVELSLKASIVT  1377

Query  1573  TPRKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDNVQSR  1394
               + +    + +   G  + G I+ I+++G+F+ +DN+++ GLCH+SE++D  + ++   
Sbjct  1378  GGQMT----VKSLQVGQTVKGTIRSIQAYGVFVLLDNSSVSGLCHISEVADAKVKSLDGV  1433

Query  1393  YKAGQTvrvkvlkvdkdRHRISLGMKNSYF  1304
             +  G  V+ KVLKV+    R+SLG+K SYF
Sbjct  1434  FSVGDYVKAKVLKVEGG--RVSLGLKPSYF  1461


 Score =   241 bits (614),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/270 (43%), Positives = 180/270 (67%), Gaps = 7/270 (3%)
 Frame = -2

Query  925   IPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNV  746
             +P + D+FE+L+  SP +SF+WI+YMAF +S  D+  AR +A +A S I+ R+  EK NV
Sbjct  1590  VPESADDFERLLAVSPQNSFLWIQYMAFHVSQTDIAAARDVATRATSKISFRDVQEKFNV  1649

Query  745   WVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDEL--LEK  572
             WVA+ N E ++G+  + +  +VF  A +  DPKKV+L L+ +Y R  H ++ D L  L+ 
Sbjct  1650  WVAFLNFEHDHGD--EASFQRVFNSACRANDPKKVYLQLVEIYSR--HNQVDDVLSTLKT  1705

Query  571   MVKKFKHSCKIWLRRIQWALKQNQDNS-QSIVNRALLCLPKHKHIKFITQTAILEFKCGV  395
             M KKF  S K+WLR +++ +  +   + + +++R++  LPKHKH+K +T+ A ++++ G 
Sbjct  1706  MQKKFNTSAKVWLRGLKYHMAADDAAAARQLLSRSMQSLPKHKHVKVLTKFAFMQYEYGQ  1765

Query  394   ADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFK  215
              + GR++FE+++  YPK+ DLW+VYLD+EI+ G  D  R LFERA+SLS+  KKMK LFK
Sbjct  1766  HEHGRTVFEQLVATYPKKMDLWNVYLDREIKYGSQDSTRLLFERALSLSLSAKKMKALFK  1825

Query  214   KYLAYEKSVGDEERIESVKRKAMEYVESLA  125
             KYL YE   G +  +  V+  A  YVE+ A
Sbjct  1826  KYLTYEIDHGTDASVAHVQALAAAYVEASA  1855



>gb|ETK91126.1| hypothetical protein L915_05266 [Phytophthora parasitica]
Length=1934

 Score =   457 bits (1175),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 418/1525 (27%), Positives = 711/1525 (47%), Gaps = 184/1525 (12%)
 Frame = -2

Query  5512  ANRITPKNISPGMKLWGVIAEVNE-KDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQ  5336
             A  ++ K +  GM L G + +V + +D+++SLP  L G V  SE  D   +    + + +
Sbjct  72    ATLLSFKTLRKGMLLLGCVRQVTDGQDLMISLPNKLNGTVALSECSDEFHEFLQTQKKAK  131

Query  5335  SNY--------LSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLALLHKNLTLDAIQ  5180
                        LS +F VGQ V C+VL      K   + +I LSLR +L+H  L+  ++ 
Sbjct  132   QQDEEEEQLQPLSTIFKVGQFVPCVVLATGKTDK---RKQIQLSLRTSLIHAELSPSSLT  188

Query  5179  EGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDKMNTGQLVEGVVKSVDRTRKVV  5000
             +G  L A + S EDHG I++ G+     F+P   +    ++ GQ +   V S++      
Sbjct  189   KGASLHATVSSVEDHGAIVNLGIRGVHAFVP-RKELATPVHKGQHLLVNVVSMNTHTNTA  247

Query  4999  YLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHL  4820
              ++     + K VT+     ++  LVPGM++N  V  VLENG+ ++FLT+FT TV+  H+
Sbjct  248   TVTIDRSQVVKAVTRG-DSFTLKQLVPGMLLNVRVEDVLENGLSVTFLTFFTATVEQNHM  306

Query  4819  QQVFP-PPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQ  4643
                 P    W++ Y +  K  ARI+ ID   + + LS+ PH+VH + P SL  VGDI E+
Sbjct  307   S--LPCERGWEESYRKGMKARARIISIDYIAKQITLSMAPHVVHMQVPESLFSVGDIIEE  364

Query  4642  AKVIRVDKGLGLLLEIPSS---------------------PVPTPAYVYISdvddkevkk  4526
             A + R+D G+G+LL + +                          P YV+IS+V DK V K
Sbjct  365   ATIERIDAGVGMLLSLKNQDEDVEMGDASDKKESTTNAKWKAFAPGYVHISNVSDKRVDK  424

Query  4525  meKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSF  4346
             +EK F  G  ++ RVLGF   + +A+ S K  +   +V  H D+KPG  V  K+++V+ +
Sbjct  425   LEKKFTVGSSIKCRVLGFSPFDAVASVSCKEHSISQTVLRHKDLKPGTKVNGKILSVEPW  484

Query  4345  GAIVQFSSGVKALCPLRHMSEFEIVKPRK--KFQVGSELVFRVL--GCKSKRITVTHKKT  4178
             G +++ S GV+ L   +HM  F + K     K++VG     RVL     + +  +T K  
Sbjct  485   GILMEISEGVRGLVTPQHMPAFLLNKKANNGKYKVGKTANARVLHVDLDANKTYLTMKSG  544

Query  4177  LVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISS  3998
             L+ S L +LSS+ +AT GLI HG+ITKI ++G  V FYN V G  P + L      ++  
Sbjct  545   LLSSDLPVLSSFQEATMGLIAHGFITKIGEYGVIVTFYNNVYGLVPMAVLQQAGIENLEE  604

Query  3997  MYHVEQVVKCRVVSSSPASRQIVLSFTT-------RPMRLSETEMVKPGTVVSGI-VELV  3842
              Y + QVVK RV    P  ++++LSF T       +P    ET     GT ++ + +  V
Sbjct  605   AYVLGQVVKARVTRCDPNRKRLMLSFDTTSNSSSNKPTAAPETASKLVGTTITNVKITDV  664

Query  3841  TPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFD----QLLVLDIEGF  3674
                   V   +G   ++G +    L+D      L+  ++K     D     LLV+  E  
Sbjct  665   ETTCFRVQTKDG---MEGVLPFVQLTDFPRNTPLVDEIVKRFSAGDVISEPLLVVSQESD  721

Query  3673  N-LVLSAKYSLISTAQQ---LPLDVNQISPHSVVHGYVCNV-IGNGVFVRFLGRLTGFSP  3509
               L LS K  L+  A +   +P     +  ++V+ GYV +V +  GVFV+FL  +   +P
Sbjct  722   GVLTLSKKPLLLEFASRKAIVPRTFGDVQENAVLIGYVTSVNVSKGVFVKFLNNVVAVAP  781

Query  3508  RSKATDDRRYDTSE-VFYIGQSVCTNILDVNGETGRITVSLKQ-SLCSSTDAT------F  3353
             +    +       E +F IG++V  ++  +N E  +  V  +Q S    T++T      F
Sbjct  782   KGFLKEQFVAQIDEGMFEIGETVTCSVEKINKEKKQFVVGFQQSSFVLPTNSTNKARPAF  841

Query  3352  IQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFG  3173
              Q Y   +  +     +  A         F LG   + +   ++ +G V   EK ++   
Sbjct  842   FQAYLREQASVRNAAEVKKAP--------FALGKTEKAEFVGVRPYGAVFALEKDEETVT  893

Query  3172  FISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEF--VNGSKPQTANDKTQKKKR  2999
              +          + G +++  + D        D S    +  V+ S  ++ + K++K+K+
Sbjct  894   VLVPSVTENKEWDEGDSVKLLLTD-------YDFSKNVYYGAVDESLVKSGSKKSRKQKQ  946

Query  2998  KREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYA----LGYASLNDF-------NTQN  2852
             + +A   +    SV AV     E Y V+S P    A     G   L DF       +   
Sbjct  947   RVKAGGKIAA-ASVLAVSPT--EKYAVVSFPDPQNADLLQFGVVQLCDFWCPSQTSSQLG  1003

Query  2851  LPVKQFVNGQSVIATIMALPDSSTGGRLLLL------LKAISEVAEsssskrgkknsSYD  2690
             + V   +  + V +T+ +  +S+    L+LL      L   S+++   +S +  K +  D
Sbjct  1004  IEVGASIECRVVQSTLKSGSNSTPFDDLVLLALEEDELVTKSKISSRKASFKAPKYTHED  1063

Query  2689  --VGSLVQAEITDI--KPLELRL---KFGSGFHGRVHITEATDDNTTEG---PLNDFRIG  2540
               +GS+V   I+ I    +E+R+   K        V I +    +   G   P + + + 
Sbjct  1064  LVLGSIVTGVISGISENSMEIRVESHKKAGKVRAVVSIVDVDGIDEKSGHSHPFDRYSVN  1123

Query  2539  QTLTARIVSKDSRSENK----------RGYQWELSTKPSVLAGD--------------MD  2432
              T+T R+++  ++  NK          + +  +LS +   +AGD              ++
Sbjct  1124  TTVTGRVIAVTAKGANKLKPVSEENPAKFHALQLSLRSEDVAGDEKVKDVQRFVRPDWLE  1183

Query  2431  GPHESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVG  2252
             G         G  + G V   D ++  + +S  V   L  ++ S +   ++EFQ +F VG
Sbjct  1184  GSAGRALLKEGNSVEGVVSDQDVDYLTIKLSSNVTGTLSCVEVSEDVGVIREFQDKFPVG  1243

Query  2251  KSVSGYILSANKEKKLLRLVPHTLLITPEDTVPSSESARCH--IREGSVLGGRISKILPG  2078
             K V  ++L  + EKK + L           +V  S SA+C   ++ G+++ G IS     
Sbjct  1244  KRVKCFLLQVDDEKKTVDL-----------SVIHSSSAQCKAVVKSGAIVNGVISTKKSA  1292

Query  2077  VG--GLLVQIDAHLFGKVHFTELRDPWVSD--PLSGYCEGQFVKCKVLQVGHSVKGTTHV  1910
             +    ++VQ+ AH FG+V  TEL+  W +D   L  +  G+ V+C VL   ++     H+
Sbjct  1293  IRPPSIMVQLGAHTFGRVCITELQTKWENDMLELPQFAAGKVVRCVVLSTSNN-----HI  1347

Query  1909  DLSLRWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRK  1730
             DLSLR   D + N            +R V D+        V   V   T  GCF+ + R 
Sbjct  1348  DLSLRE--DALANPKEYAKKTSKPADRSVGDL--------VPAIVATTTSSGCFVRVDRH  1397

Query  1729  VDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDID  1550
               A+++L +L+D F++ P+ +FP GKLV G+V      +K+ +  L  S  A+    D+ 
Sbjct  1398  TTARVMLRDLSDDFVKDPQTQFPSGKLVAGRV------TKKSDRGLELSLKASVVSDDVS  1451

Query  1549  AL--NNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDN-VQSRYKAGQ  1379
                 ++   G  + G I +++++G+F+ ++ T + GLCH+SE++D+ +   +   +  G 
Sbjct  1452  VFKWSDLKEGLTVKGTITKVQTYGVFVRIEKTTISGLCHISEIADEKVTQPLDQIFSEGD  1511

Query  1378  TvrvkvlkvdkdRHRISLGMKNSYF  1304
                VK   +  +  R+S G+K SYF
Sbjct  1512  --YVKAKVLKVEDRRVSFGLKPSYF  1534


 Score =   244 bits (622),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/269 (42%), Positives = 183/269 (68%), Gaps = 3/269 (1%)
 Frame = -2

Query  928   DIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLN  749
             ++P++  ++E+L+  SP SS++WI++MAF +SL +++ AR +A +A S ++ R+E EKLN
Sbjct  1666  EVPQSASDYERLLAVSPQSSYLWIQFMAFHVSLTEIDLARDVAVRATSAVSFRDEKEKLN  1725

Query  748   VWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKM  569
             VWVAY NLE ++G+    + ++VF+ ALQ   PK+V+L L+ +Y R E ++   + L  M
Sbjct  1726  VWVAYLNLEHDFGD--DASFLRVFKSALQVNHPKRVYLHLVDLYARAEEHEDVKQTLATM  1783

Query  568   VKKFKHSCKIWLRRIQWALKQNQ-DNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVA  392
              KKF+ S + W+R +Q+ + + Q   +   + R+L  L  HKH+  I +   L ++ G  
Sbjct  1784  QKKFRTSKQTWIRSLQYLVGEKQFAEAAETLQRSLKSLAAHKHLPVILKYGQLLYEQGEL  1843

Query  391   DRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKK  212
             D+ R++FE +L  YPKR DLW+VYLD+EI+ GD+ ++RALFER +++    KKMKFLFKK
Sbjct  1844  DKARTIFEGILANYPKRMDLWNVYLDKEIKFGDVALVRALFERLLAMDFSAKKMKFLFKK  1903

Query  211   YLAYEKSVGDEERIESVKRKAMEYVESLA  125
             YL +E+  GD+E +E VK+ A ++V S A
Sbjct  1904  YLQFEQDQGDDEHVEHVKQLAKDFVASAA  1932



>gb|ETP48926.1| hypothetical protein F442_05459 [Phytophthora parasitica P10297]
Length=1934

 Score =   456 bits (1173),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 417/1525 (27%), Positives = 711/1525 (47%), Gaps = 184/1525 (12%)
 Frame = -2

Query  5512  ANRITPKNISPGMKLWGVIAEVNE-KDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQ  5336
             A  ++ K +  GM L G + +V + +D+++SLP  L G V  SE  D   +    + + +
Sbjct  72    ATLLSFKTLRKGMLLLGCVRQVTDGQDLMISLPNKLNGTVALSECSDEFHEFLQTQKKAK  131

Query  5335  SNY--------LSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLALLHKNLTLDAIQ  5180
                        LS +F VGQ V C+VL      K   + +I LSLR +L+H  L+  ++ 
Sbjct  132   QQDEEEEQLQPLSTIFKVGQFVPCVVLATGKTDK---RKQIQLSLRTSLIHAELSPSSLT  188

Query  5179  EGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDKMNTGQLVEGVVKSVDRTRKVV  5000
             +G  L A + S EDHG I++ G+     F+P   +    ++ GQ +   V S++      
Sbjct  189   KGASLHATVSSVEDHGAIVNLGIRGVHAFVP-RKELATPVHKGQHLLVNVVSMNTHTNTA  247

Query  4999  YLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHL  4820
              ++     + K VT+     ++  LVPGM++N  V  VLENG+ ++FLT+FT TV+  H+
Sbjct  248   TVTIDRSQVVKAVTRG-DSFTLKQLVPGMLLNVRVEDVLENGLSVTFLTFFTATVEQNHM  306

Query  4819  QQVFP-PPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQ  4643
                 P    W++ Y +  K  ARI+ ID   + + LS+ PH+VH + P SL  VGDI E+
Sbjct  307   S--LPCERGWEESYRKGMKARARIISIDYIAKQITLSMAPHVVHMQVPESLFSVGDIIEE  364

Query  4642  AKVIRVDKGLGLLLEIPSS---------------------PVPTPAYVYISdvddkevkk  4526
             A + R+D G+G+LL + +                          P YV+IS+V DK V K
Sbjct  365   ATIERIDAGVGMLLSLKNQDEDVEMGDASDKKESTTNAKWKAFAPGYVHISNVSDKRVDK  424

Query  4525  meKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSF  4346
             +EK F  G  ++ RVLGF   + +A+ S K  +   +V  H D+KPG  V  K+++V+ +
Sbjct  425   LEKKFTVGSSIKCRVLGFSPFDAVASVSCKEHSISQTVLRHKDLKPGTKVNGKILSVEPW  484

Query  4345  GAIVQFSSGVKALCPLRHMSEFEIVKPRK--KFQVGSELVFRVL--GCKSKRITVTHKKT  4178
             G +++ S GV+ L   +HM  F + K     K++VG     RVL     + +  +T K  
Sbjct  485   GILMEISEGVRGLVTPQHMPAFLLNKKANNGKYKVGKTANARVLHVDLDANKTYLTMKSG  544

Query  4177  LVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISS  3998
             L+ S L +LSS+ +AT GLI HG+ITKI ++G  V FYN V G  P + L      ++  
Sbjct  545   LLSSDLPVLSSFQEATMGLIAHGFITKIGEYGVIVTFYNNVYGLVPMAVLQQAGIENLEE  604

Query  3997  MYHVEQVVKCRVVSSSPASRQIVLSFTT-------RPMRLSETEMVKPGTVVSGI-VELV  3842
              Y + QVVK RV    P  ++++LSF T       +P    ET     GT ++ + +  V
Sbjct  605   AYVLGQVVKARVTRCDPNRKRLMLSFDTTSNSSSNKPTAAPETASKLVGTTITNVKITDV  664

Query  3841  TPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFD----QLLVLDIEGF  3674
                   V   +G   ++G +    L+D      L+  ++K     D     LLV+  E  
Sbjct  665   ETTCFRVQTKDG---MEGVLPFVQLTDFPRNTPLVDEIVKRFSAGDVISEPLLVVSQESD  721

Query  3673  N-LVLSAKYSLISTAQQ---LPLDVNQISPHSVVHGYVCNV-IGNGVFVRFLGRLTGFSP  3509
               L LS K  L+  A +   +P     +  ++V+ GYV +V +  GVFV+FL  +   +P
Sbjct  722   GVLTLSKKPLLLEFASRKAIVPRTFGDVQENAVLIGYVTSVNVSKGVFVKFLNNVVAVAP  781

Query  3508  RSKATDDRRYDTSE-VFYIGQSVCTNILDVNGETGRITVSLKQS-LCSSTDAT------F  3353
             +    +       E +F IG++V  ++  +N E  +  V  +Q+     T++T      F
Sbjct  782   KGFLKEQFVAQIDEGMFEIGETVTCSVEKINKEKKQFVVGFQQTNFVLPTNSTNKARPAF  841

Query  3352  IQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFG  3173
              Q Y   +  +     +  A         F LG   + +   ++ +G V   EK ++   
Sbjct  842   FQAYLREQASVRNAAEVKKAP--------FALGKTEKAEFVGVRPYGAVFALEKDEETVT  893

Query  3172  FISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEF--VNGSKPQTANDKTQKKKR  2999
              +          + G +++  + D        D S    +  V+ S  ++ + K++K+K+
Sbjct  894   VLVPSVTENKEWDEGDSVKLLLTD-------YDFSKNVYYGAVDESLVKSGSKKSRKQKQ  946

Query  2998  KREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYA----LGYASLNDF-------NTQN  2852
             + +A   +    SV AV     E Y V+S P    A     G   L DF       +   
Sbjct  947   RVKAGGKIAA-ASVLAVSPT--EKYAVVSFPDPQNADLLQFGVVQLCDFWCPSQTSSQLG  1003

Query  2851  LPVKQFVNGQSVIATIMALPDSSTGGRLLLL------LKAISEVAEsssskrgkknsSYD  2690
             + V   +  + V +T+ +  +S+    L+LL      L   S+++   +S +  K +  D
Sbjct  1004  IEVGASIECRVVQSTLKSGSNSTPFDDLVLLALEEDELVTKSKISSHKASFKAPKYTHED  1063

Query  2689  --VGSLVQAEITDI--KPLELRL---KFGSGFHGRVHITEATDDNTTEG---PLNDFRIG  2540
               +GS+V   I+ I    +E+R+   K        V I +    +   G   P + + + 
Sbjct  1064  LVLGSIVTGVISGISENSMEIRVESHKKAGKVRAVVSIVDVDGIDEKSGHSHPFDRYSVN  1123

Query  2539  QTLTARIVSKDSRSENK----------RGYQWELSTKPSVLAGD--------------MD  2432
              T+T R+++  ++  NK          + +  +LS +   +AGD              ++
Sbjct  1124  TTVTGRVIAVTAKGANKLKPVSEENPAKFHALQLSLRSEDVAGDEKVKDVQRFVRPDWLE  1183

Query  2431  GPHESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVG  2252
             G         G  + G V   D ++  + +S  V   L  ++ S +   ++EFQ +F VG
Sbjct  1184  GSAGRALLKEGNSVEGVVSDQDVDYLTIKLSSNVTGTLSCVEVSEDVGVIREFQGKFPVG  1243

Query  2251  KSVSGYILSANKEKKLLRLVPHTLLITPEDTVPSSESARCH--IREGSVLGGRISKILPG  2078
             K V  ++L  + EKK + L           +V  S SA+C   ++ G+++ G IS     
Sbjct  1244  KRVKCFLLQVDDEKKTVDL-----------SVIHSSSAQCKAVVKSGAIVNGVISTKKSA  1292

Query  2077  VG--GLLVQIDAHLFGKVHFTELRDPWVSD--PLSGYCEGQFVKCKVLQVGHSVKGTTHV  1910
             +    ++VQ+ AH FG+V  TEL+  W +D   L  +  G+ V+C VL   ++     H+
Sbjct  1293  IRPPSIMVQLGAHTFGRVCITELQTKWENDMLELPQFAAGKVVRCVVLSTSNN-----HI  1347

Query  1909  DLSLRWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRK  1730
             DLSLR   D + N            +R V D+        V   V   T  GCF+ + R 
Sbjct  1348  DLSLRE--DALANPKEYAKKTSKPADRSVGDL--------VPAIVATTTSSGCFVRVDRH  1397

Query  1729  VDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDID  1550
               A+++L +L+D F++ P+ +FP GKLV G+V      +K+ +  L  S  A+    D+ 
Sbjct  1398  TTARVMLRDLSDDFVKDPQTQFPSGKLVAGRV------TKKSDRGLELSLKASVVSDDVS  1451

Query  1549  AL--NNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDN-VQSRYKAGQ  1379
                 ++   G  + G I +++++G+F+ ++ T + GLCH+SE++D+ +   +   +  G 
Sbjct  1452  VFKWSDLKEGLTVKGTITKVQTYGVFVRIEKTTISGLCHISEIADEKVTQPLDQIFSEGD  1511

Query  1378  TvrvkvlkvdkdRHRISLGMKNSYF  1304
                VK   +  +  R+S G+K SYF
Sbjct  1512  --YVKAKVLKVEDRRVSFGLKPSYF  1534


 Score =   244 bits (622),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/269 (42%), Positives = 183/269 (68%), Gaps = 3/269 (1%)
 Frame = -2

Query  928   DIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLN  749
             ++P++  ++E+L+  SP SS++WI++MAF +SL +++ AR +A +A S ++ R+E EKLN
Sbjct  1666  EVPQSASDYERLLAVSPQSSYLWIQFMAFHVSLTEIDLARDVAVRATSAVSFRDEKEKLN  1725

Query  748   VWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKM  569
             VWVAY NLE ++G+    + ++VF+ ALQ   PK+V+L L+ +Y R E ++   + L  M
Sbjct  1726  VWVAYLNLEHDFGD--DASFLRVFKSALQVNHPKRVYLHLVDLYARAEEHEDVKQTLATM  1783

Query  568   VKKFKHSCKIWLRRIQWALKQNQ-DNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVA  392
              KKF+ S + W+R +Q+ + + Q   +   + R+L  L  HKH+  I +   L ++ G  
Sbjct  1784  HKKFRTSKQTWIRSLQYLVGEKQFAEAAETLQRSLKSLAAHKHLPVILKYGQLLYEQGEL  1843

Query  391   DRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKK  212
             D+ R++FE +L  YPKR DLW+VYLD+EI+ GD+ ++RALFER +++    KKMKFLFKK
Sbjct  1844  DKARTIFEGILANYPKRMDLWNVYLDKEIKFGDVALVRALFERLLAMDFSAKKMKFLFKK  1903

Query  211   YLAYEKSVGDEERIESVKRKAMEYVESLA  125
             YL +E+  GD+E +E VK+ A ++V S A
Sbjct  1904  YLQFEQDQGDDEHVEHVKQLAKDFVASAA  1932



>gb|ETL97664.1| hypothetical protein L917_05106 [Phytophthora parasitica]
Length=1934

 Score =   455 bits (1171),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 416/1525 (27%), Positives = 711/1525 (47%), Gaps = 184/1525 (12%)
 Frame = -2

Query  5512  ANRITPKNISPGMKLWGVIAEVNE-KDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQ  5336
             A  ++ K +  GM L G + +V + +D+++SLP  L G V  SE  D   +    + + +
Sbjct  72    ATLLSFKTLRKGMLLLGCVRQVTDGQDLMISLPNKLNGTVALSECSDEFHEFLQTQKKAK  131

Query  5335  SNY--------LSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLALLHKNLTLDAIQ  5180
                        LS +F VGQ V C+VL      K   + +I LSLR +L+H  L+  ++ 
Sbjct  132   QQDEEEEQLQPLSTIFKVGQFVPCVVLATGKTDK---RKQIQLSLRTSLIHAELSPSSLT  188

Query  5179  EGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDKMNTGQLVEGVVKSVDRTRKVV  5000
             +G  L A + S EDHG I++ G+     F+P   +    ++ GQ +   V S++      
Sbjct  189   KGASLHATVSSVEDHGAIVNLGIRGVHAFVP-RKELATPVHKGQHLLVNVVSMNTHTNTA  247

Query  4999  YLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHL  4820
              ++     + K VT+     ++  LVPGM++N  V  VLENG+ ++FLT+FT TV+  H+
Sbjct  248   TVTIDRSQVVKAVTRG-DSFTLKQLVPGMLLNVRVEDVLENGLSVTFLTFFTATVEQNHM  306

Query  4819  QQVFP-PPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQ  4643
                 P    W++ Y +  K  ARI+ ID   + + LS+ PH+VH + P SL  VGDI E+
Sbjct  307   S--LPCERGWEESYRKGMKARARIISIDYIAKQITLSMAPHVVHMQVPESLFSVGDIIEE  364

Query  4642  AKVIRVDKGLGLLLEIPSS---------------------PVPTPAYVYISdvddkevkk  4526
             A + R+D G+G+LL + +                          P YV+IS+V DK V K
Sbjct  365   ATIERIDAGVGMLLSLKNQDEDVEMGDASDKKESTTNAKWKAFAPGYVHISNVSDKRVDK  424

Query  4525  meKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSF  4346
             +EK F  G  ++ RVLGF   + +A+ S K  +   +V  H D+KPG  V  K+++V+ +
Sbjct  425   LEKKFTVGSSIKCRVLGFSPFDAVASVSCKEHSISQTVLRHKDLKPGTKVNGKILSVEPW  484

Query  4345  GAIVQFSSGVKALCPLRHMSEFEIVKPRK--KFQVGSELVFRVL--GCKSKRITVTHKKT  4178
             G +++ S GV+ L   +HM  F + K     K++VG     RVL     + +  +T K  
Sbjct  485   GILMEISEGVRGLVTPQHMPAFLLNKKANNGKYKVGKTANARVLHVDLDANKTYLTMKSG  544

Query  4177  LVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISS  3998
             L+ S L +LSS+ +AT GLI HG+ITKI ++G  V FYN V G  P + L      ++  
Sbjct  545   LLSSDLPVLSSFQEATMGLIAHGFITKIGEYGVIVTFYNNVYGLVPMAVLQQAGIENLEE  604

Query  3997  MYHVEQVVKCRVVSSSPASRQIVLSFTT-------RPMRLSETEMVKPGTVVSGI-VELV  3842
              Y + QVVK RV    P  ++++LSF T       +P    ET     GT ++ + +  V
Sbjct  605   AYVLGQVVKARVTRCDPNRKRLMLSFDTTSNSSSNKPTAAPETASKLVGTTITNVKITDV  664

Query  3841  TPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFD----QLLVLDIEGF  3674
                   V   +G   ++G +    L+D      L+  ++K     D     LLV+  E  
Sbjct  665   ETTCFRVQTKDG---MEGVLPFVQLTDFPRNTPLVDEIVKRFSAGDVISEPLLVVSQESD  721

Query  3673  N-LVLSAKYSLISTAQQ---LPLDVNQISPHSVVHGYVCNV-IGNGVFVRFLGRLTGFSP  3509
               L LS K  L+  A +   +P     +  ++V+ GYV +V +  GVFV+FL  +   +P
Sbjct  722   GVLTLSKKPLLLEFASRKAIVPRTFGDVQENAVLIGYVTSVNVSKGVFVKFLNNVVAVAP  781

Query  3508  RSKATDDRRYDTSE-VFYIGQSVCTNILDVNGETGRITVSLKQS-LCSSTDAT------F  3353
             +    +       E +F IG++V  ++  +N E  +  V  +Q+     T++T      F
Sbjct  782   KGFLKEQFVAQIDEGMFEIGETVTCSVEKINKEKKQFVVGFQQTNFVLPTNSTNKARPAF  841

Query  3352  IQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFG  3173
              Q Y   +  +     +  A         F LG   + +   ++ +G V   EK ++   
Sbjct  842   FQAYLREQASVRNAAEVKKAP--------FALGKTEKAEFVGVRPYGAVFALEKDEETVT  893

Query  3172  FISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEF--VNGSKPQTANDKTQKKKR  2999
              +          + G +++  + D        D S    +  V+ S  ++ + K++K+K+
Sbjct  894   VLVPSVTENKEWDEGDSVKLLLTD-------YDFSKNVYYGAVDESLVKSGSKKSRKQKQ  946

Query  2998  KREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYA----LGYASLNDF-------NTQN  2852
             + +A   +    SV AV     E Y V+S P    A     G   L DF       +   
Sbjct  947   RVKAGGKIAA-ASVLAVSPT--EKYAVVSFPDPQNADLLQFGVVQLCDFWCPSQTSSQLG  1003

Query  2851  LPVKQFVNGQSVIATIMALPDSSTGGRLLLL------LKAISEVAEsssskrgkknsSYD  2690
             + V   +  + V +T+ +  +S+    L+LL      L   S+++   +S +  K +  D
Sbjct  1004  IEVGASIECRVVQSTLKSGSNSTPFDDLVLLALEEDELVTKSKISSHKASFKAPKYTHED  1063

Query  2689  --VGSLVQAEITDI--KPLELRL---KFGSGFHGRVHITEATDDNTTEG---PLNDFRIG  2540
               +GS+V   I+ I    +E+R+   K        V I +    +   G   P + + + 
Sbjct  1064  LVLGSIVTGVISGISENSMEIRVESHKKAGKVRAVVSIVDVDGIDEKSGHSHPFDRYSVN  1123

Query  2539  QTLTARIVSKDSRSENK----------RGYQWELSTKPSVLAGD--------------MD  2432
              T+T R+++  ++  NK          + +  +LS +   +AGD              ++
Sbjct  1124  TTVTGRVIAVTAKGANKLKPVSEENPAKFHALQLSLRSEDVAGDEKVKDVQRFVRPDWLE  1183

Query  2431  GPHESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVG  2252
             G         G  + G V   D ++  + +S  V   L  ++ S +   ++EFQ +F VG
Sbjct  1184  GSAGRALLKEGNSVEGVVSDQDVDYLTIKLSSNVTGTLSCVEVSEDVGVIREFQDKFPVG  1243

Query  2251  KSVSGYILSANKEKKLLRLVPHTLLITPEDTVPSSESARCH--IREGSVLGGRISKILPG  2078
             K V  ++L  + EKK + L           +V  S SA+C   ++ G+++ G IS     
Sbjct  1244  KRVKCFLLQVDDEKKTVDL-----------SVIHSSSAQCKAVVKSGAIVNGVISTKKSA  1292

Query  2077  VG--GLLVQIDAHLFGKVHFTELRDPWVSD--PLSGYCEGQFVKCKVLQVGHSVKGTTHV  1910
             +    ++VQ+ AH FG+V  TEL+  W +D   L  +  G+ V+C VL   ++     H+
Sbjct  1293  IRPPSIMVQLGAHTFGRVCITELQTKWENDMLELPQFAAGKVVRCVVLSTSNN-----HI  1347

Query  1909  DLSLRWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRK  1730
             DLSLR   D + N            +R V D+        V   V   T  GCF+ + R 
Sbjct  1348  DLSLRE--DALANPKEYAKKTSKPADRSVGDL--------VPAIVATTTSSGCFVRVDRH  1397

Query  1729  VDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDID  1550
               A+++L +L+D F++ P+ +FP GKLV G+V      +K+ +  L  S  A+    D+ 
Sbjct  1398  TTARVMLRDLSDDFVKDPQTQFPSGKLVAGRV------TKKSDRGLELSLKASVVSDDVS  1451

Query  1549  AL--NNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDN-VQSRYKAGQ  1379
                 ++   G  + G I +++++G+F+ ++ T + GLCH+SE++D+ +   +   +  G 
Sbjct  1452  VFKWSDLKEGLTVKGTITKVQTYGVFVRIEKTTISGLCHISEIADEKVTQPLDQIFSEGD  1511

Query  1378  TvrvkvlkvdkdRHRISLGMKNSYF  1304
                VK   +  +  R++ G+K SYF
Sbjct  1512  --YVKAKVLKVEDRRVAFGLKPSYF  1534


 Score =   244 bits (622),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/269 (42%), Positives = 183/269 (68%), Gaps = 3/269 (1%)
 Frame = -2

Query  928   DIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLN  749
             ++P++  ++E+L+  SP SS++WI++MAF +SL +++ AR +A +A S ++ R+E EKLN
Sbjct  1666  EVPQSASDYERLLAVSPQSSYLWIQFMAFHVSLTEIDLARDVAVRATSAVSFRDEKEKLN  1725

Query  748   VWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKM  569
             VWVAY NLE ++G+    + ++VF+ ALQ   PK+V+L L+ +Y R E ++   + L  M
Sbjct  1726  VWVAYLNLEHDFGD--DASFLRVFKSALQVNHPKRVYLHLVDLYARAEEHEDVKQTLATM  1783

Query  568   VKKFKHSCKIWLRRIQWALKQNQ-DNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVA  392
              KKF+ S + W+R +Q+ + + Q   +   + R+L  L  HKH+  I +   L ++ G  
Sbjct  1784  HKKFRTSKQTWIRSLQYLVGEKQFAEAAETLQRSLKSLAAHKHLPVILKYGQLLYEQGEL  1843

Query  391   DRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKK  212
             D+ R++FE +L  YPKR DLW+VYLD+EI+ GD+ ++RALFER +++    KKMKFLFKK
Sbjct  1844  DKARTIFEGILANYPKRMDLWNVYLDKEIKFGDVALVRALFERLLAMDFSAKKMKFLFKK  1903

Query  211   YLAYEKSVGDEERIESVKRKAMEYVESLA  125
             YL +E+  GD+E +E VK+ A ++V S A
Sbjct  1904  YLQFEQDQGDDEHVEHVKQLAKDFVASAA  1932



>gb|ETO79951.1| hypothetical protein F444_05454 [Phytophthora parasitica P1976]
Length=1934

 Score =   455 bits (1171),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 416/1525 (27%), Positives = 711/1525 (47%), Gaps = 184/1525 (12%)
 Frame = -2

Query  5512  ANRITPKNISPGMKLWGVIAEVNE-KDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQ  5336
             A  ++ K +  GM L G + +V + +D+++SLP  L G V  SE  D   +    + + +
Sbjct  72    ATLLSFKTLRKGMLLLGCVRQVTDGQDLMISLPNKLNGTVALSECSDEFHEFLQTQKKAK  131

Query  5335  SNY--------LSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLALLHKNLTLDAIQ  5180
                        LS +F VGQ V C+VL      K   + +I LSLR +L+H  L+  ++ 
Sbjct  132   QQDEEEEQLQPLSTIFKVGQFVPCVVLATGKTDK---RKQIQLSLRTSLIHAELSPSSLT  188

Query  5179  EGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDKMNTGQLVEGVVKSVDRTRKVV  5000
             +G  L A + S EDHG I++ G+     F+P   +    ++ GQ +   V S++      
Sbjct  189   KGASLHATVSSVEDHGVIVNLGIRGVHAFVP-RKELATPVHKGQHLLVNVVSMNTHTNTA  247

Query  4999  YLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHL  4820
              ++     + K VT+     ++  LVPGM++N  V  VLENG+ ++FLT+FT TV+  H+
Sbjct  248   TVTIDRSQVVKAVTRG-DSFTLKQLVPGMLLNVRVEDVLENGLSVTFLTFFTATVEQNHM  306

Query  4819  QQVFP-PPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQ  4643
                 P    W++ Y +  K  ARI+ ID   + + LS+ PH+VH + P SL  VGDI E+
Sbjct  307   S--LPCERGWEESYRKGMKARARIISIDYIAKQITLSMAPHVVHMQVPESLFSVGDIIEE  364

Query  4642  AKVIRVDKGLGLLLEIPSS---------------------PVPTPAYVYISdvddkevkk  4526
             A + R+D G+G+LL + +                          P YV+IS+V DK V K
Sbjct  365   ATIERIDAGVGMLLSLKNQDEDVEMGDASDKKESTTNAKWKAFAPGYVHISNVSDKRVDK  424

Query  4525  meKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSF  4346
             +EK F  G  ++ RVLGF   + +A+ S K  +   +V  H D+KPG  V  K+++V+ +
Sbjct  425   LEKKFTVGSSIKCRVLGFSPFDAVASVSCKEHSISQTVLRHKDLKPGTKVNGKILSVEPW  484

Query  4345  GAIVQFSSGVKALCPLRHMSEFEIVKPRK--KFQVGSELVFRVL--GCKSKRITVTHKKT  4178
             G +++ S GV+ L   +HM  F + K     K++VG     RVL     + +  +T K  
Sbjct  485   GILMEISEGVRGLVTPQHMPAFLLNKKANNGKYKVGKTANARVLHVDLDANKTYLTMKSG  544

Query  4177  LVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISS  3998
             L+ S L +LSS+ +AT GLI HG+ITKI ++G  V FYN V G  P + L      ++  
Sbjct  545   LLSSDLPVLSSFQEATMGLIAHGFITKIGEYGVIVTFYNNVYGLVPMAVLQQAGIENLEE  604

Query  3997  MYHVEQVVKCRVVSSSPASRQIVLSFTT-------RPMRLSETEMVKPGTVVSGI-VELV  3842
              Y + QVVK RV    P  ++++LSF T       +P    ET     GT ++ + +  V
Sbjct  605   AYVLGQVVKARVTRCDPNRKRLMLSFDTTSNSSSNKPTAAPETASKLVGTTITNVKITDV  664

Query  3841  TPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFD----QLLVLDIEGF  3674
                   V   +G   ++G +    L+D      L+  ++K     D     LLV+  E  
Sbjct  665   ETTCFRVQTKDG---MEGVLPFVQLTDFPRNTPLVDEIVKRFSAGDVISEPLLVVSQESD  721

Query  3673  N-LVLSAKYSLISTAQQ---LPLDVNQISPHSVVHGYVCNV-IGNGVFVRFLGRLTGFSP  3509
               L LS K  L+  A +   +P     +  ++V+ GYV +V +  GVFV+FL  +   +P
Sbjct  722   GVLTLSKKPLLLEFASRKAIVPRTFGDVQENAVLIGYVTSVNVSKGVFVKFLNNVVAVAP  781

Query  3508  RSKATDDRRYDTSE-VFYIGQSVCTNILDVNGETGRITVSLKQS-LCSSTDAT------F  3353
             +    +       E +F IG++V  ++  +N E  +  V  +Q+     T++T      F
Sbjct  782   KGFLKEQFVAQIDEGMFEIGETVTCSVEKINKEKKQFVVGFQQTNFVLPTNSTNKARPAF  841

Query  3352  IQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFG  3173
              Q Y   +  +     +  A         F LG   + +   ++ +G V   EK ++   
Sbjct  842   FQAYLREQASVRNAAEVKKAP--------FALGKTEKAEFVGVRPYGAVFALEKDEETVT  893

Query  3172  FISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEF--VNGSKPQTANDKTQKKKR  2999
              +          + G +++  + D        D S    +  V+ S  ++ + K++K+K+
Sbjct  894   VLVPSVTENKEWDEGDSVKLLLTD-------YDFSKNVYYGAVDESLVKSGSKKSRKQKQ  946

Query  2998  KREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYA----LGYASLNDF-------NTQN  2852
             + +A   +    SV AV     E Y V+S P    A     G   L DF       +   
Sbjct  947   RVKAGGKIAA-ASVLAVSPT--EKYAVVSFPDPQNADLLQFGVVQLCDFWCPSQTSSQLG  1003

Query  2851  LPVKQFVNGQSVIATIMALPDSSTGGRLLLL------LKAISEVAEsssskrgkknsSYD  2690
             + V   +  + V +T+ +  +S+    L+LL      L   S+++   +S +  K +  D
Sbjct  1004  IEVGASIECRVVQSTLKSGSNSTPFDDLVLLALEEDELVTKSKISSHKASFKAPKYTHED  1063

Query  2689  --VGSLVQAEITDI--KPLELRL---KFGSGFHGRVHITEATDDNTTEG---PLNDFRIG  2540
               +GS+V   I+ I    +E+R+   K        V I +    +   G   P + + + 
Sbjct  1064  LVLGSIVTGVISGISENSMEIRVESHKKAGKVRAVVSIVDVDGIDEKSGHSHPFDRYSVN  1123

Query  2539  QTLTARIVSKDSRSENK----------RGYQWELSTKPSVLAGD--------------MD  2432
              T+T R+++  ++  NK          + +  +LS +   +AGD              ++
Sbjct  1124  TTVTGRVIAVTAKGANKLKPVSEENPAKFHALQLSLRSEDVAGDEKVKDVQRFVRPDWLE  1183

Query  2431  GPHESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVG  2252
             G         G  + G V   D ++  + +S  V   L  ++ S +   ++EFQ +F VG
Sbjct  1184  GSAGRALLKEGNSVEGVVSDQDVDYLTIKLSSNVTGTLSCVEVSEDVGVIREFQDKFPVG  1243

Query  2251  KSVSGYILSANKEKKLLRLVPHTLLITPEDTVPSSESARCH--IREGSVLGGRISKILPG  2078
             K V  ++L  + EKK + L           +V  S SA+C   ++ G+++ G IS     
Sbjct  1244  KRVKCFLLQVDDEKKTVDL-----------SVIHSSSAQCKAVVKSGAIVNGVISTKKSA  1292

Query  2077  VG--GLLVQIDAHLFGKVHFTELRDPWVSD--PLSGYCEGQFVKCKVLQVGHSVKGTTHV  1910
             +    ++VQ+ AH FG+V  TEL+  W +D   L  +  G+ V+C VL   ++     H+
Sbjct  1293  IRPPSIMVQLGAHTFGRVCITELQTKWENDMLELPQFAAGKVVRCVVLSTSNN-----HI  1347

Query  1909  DLSLRWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRK  1730
             DLSLR   D + N            +R V D+        V   V   T  GCF+ + R 
Sbjct  1348  DLSLRE--DALANPKEYAKKTSKPADRSVGDL--------VPAIVATTTSSGCFVRVDRH  1397

Query  1729  VDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDID  1550
               A+++L +L+D F++ P+ +FP GKLV G+V      +K+ +  L  S  A+    D+ 
Sbjct  1398  TTARVMLRDLSDDFVKDPQTQFPSGKLVAGRV------TKKSDRGLELSLKASVVSDDVS  1451

Query  1549  AL--NNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDN-VQSRYKAGQ  1379
                 ++   G  + G I +++++G+F+ ++ T + GLCH+SE++D+ +   +   +  G 
Sbjct  1452  VFKWSDLKEGLTVKGTITKVQTYGVFVRIEKTTISGLCHISEIADEKVTQPLDQIFSEGD  1511

Query  1378  TvrvkvlkvdkdRHRISLGMKNSYF  1304
                VK   +  +  R++ G+K SYF
Sbjct  1512  --YVKAKVLKVEDRRVAFGLKPSYF  1534


 Score =   244 bits (622),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/269 (42%), Positives = 183/269 (68%), Gaps = 3/269 (1%)
 Frame = -2

Query  928   DIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLN  749
             ++P++  ++E+L+  SP SS++WI++MAF +SL +++ AR +A +A S ++ R+E EKLN
Sbjct  1666  EVPQSASDYERLLAVSPQSSYLWIQFMAFHVSLTEIDLARDVAVRATSAVSFRDEKEKLN  1725

Query  748   VWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKM  569
             VWVAY NLE ++G+    + ++VF+ ALQ   PK+V+L L+ +Y R E ++   + L  M
Sbjct  1726  VWVAYLNLEHDFGD--DASFLRVFKSALQVNHPKRVYLHLVDLYARAEEHEDVKQTLATM  1783

Query  568   VKKFKHSCKIWLRRIQWALKQNQ-DNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVA  392
              KKF+ S + W+R +Q+ + + Q   +   + R+L  L  HKH+  I +   L ++ G  
Sbjct  1784  HKKFRTSKQTWIRSLQYLVGEKQFAEAAETLQRSLKSLAAHKHLPVILKYGQLLYEQGEL  1843

Query  391   DRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKK  212
             D+ R++FE +L  YPKR DLW+VYLD+EI+ GD+ ++RALFER +++    KKMKFLFKK
Sbjct  1844  DKARTIFEGILANYPKRMDLWNVYLDKEIKFGDVALVRALFERLLAMDFSAKKMKFLFKK  1903

Query  211   YLAYEKSVGDEERIESVKRKAMEYVESLA  125
             YL +E+  GD+E +E VK+ A ++V S A
Sbjct  1904  YLQFEQDQGDDEHVEHVKQLAKDFVASAA  1932



>gb|ETI51209.1| hypothetical protein F443_05409 [Phytophthora parasitica P1569]
 gb|ETM50821.1| hypothetical protein L914_05222 [Phytophthora parasitica]
Length=1934

 Score =   455 bits (1171),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 416/1525 (27%), Positives = 711/1525 (47%), Gaps = 184/1525 (12%)
 Frame = -2

Query  5512  ANRITPKNISPGMKLWGVIAEVNE-KDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQ  5336
             A  ++ K +  GM L G + +V + +D+++SLP  L G V  SE  D   +    + + +
Sbjct  72    ATLLSFKTLRKGMLLLGCVRQVTDGQDLMISLPNKLNGTVALSECSDEFHEFLQTQKKAK  131

Query  5335  SNY--------LSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLALLHKNLTLDAIQ  5180
                        LS +F VGQ V C+VL      K   + +I LSLR +L+H  L+  ++ 
Sbjct  132   QQDEEEEQLQPLSTIFKVGQFVPCVVLATGKTDK---RKQIQLSLRTSLIHAELSPSSLT  188

Query  5179  EGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDKMNTGQLVEGVVKSVDRTRKVV  5000
             +G  L A + S EDHG I++ G+     F+P   +    ++ GQ +   V S++      
Sbjct  189   KGASLHATVSSVEDHGAIVNLGIRGVHAFVP-RKELATPVHKGQHLLVNVVSMNTHTNTA  247

Query  4999  YLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHL  4820
              ++     + K VT+     ++  LVPGM++N  V  VLENG+ ++FLT+FT TV+  H+
Sbjct  248   TVTIDRSQVVKAVTRG-DSFTLKQLVPGMLLNVRVEDVLENGLSVTFLTFFTATVEQNHM  306

Query  4819  QQVFP-PPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQ  4643
                 P    W++ Y +  K  ARI+ ID   + + LS+ PH+VH + P SL  VGDI E+
Sbjct  307   S--LPCERGWEESYRKGMKARARIISIDYIAKQITLSMAPHVVHMQVPESLFSVGDIIEE  364

Query  4642  AKVIRVDKGLGLLLEIPSS---------------------PVPTPAYVYISdvddkevkk  4526
             A + R+D G+G+LL + +                          P YV+IS+V DK V K
Sbjct  365   ATIERIDAGVGMLLSLKNQDEDVEMGDASDKKESTTNAKWKAFAPGYVHISNVSDKRVDK  424

Query  4525  meKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSF  4346
             +EK F  G  ++ RVLGF   + +A+ S K  +   +V  H D+KPG  V  K+++V+ +
Sbjct  425   LEKKFTVGSSIKCRVLGFSPFDAVASVSCKEHSISQTVLRHKDLKPGTKVNGKILSVEPW  484

Query  4345  GAIVQFSSGVKALCPLRHMSEFEIVKPRK--KFQVGSELVFRVL--GCKSKRITVTHKKT  4178
             G +++ S GV+ L   +HM  F + K     K++VG     RVL     + +  +T K  
Sbjct  485   GILMEISEGVRGLVTPQHMPAFLLNKKANNGKYKVGKTANARVLHVDLDANKTYLTMKSG  544

Query  4177  LVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISS  3998
             L+ S L +LSS+ +AT GLI HG+ITKI ++G  V FYN V G  P + L      ++  
Sbjct  545   LLSSDLPVLSSFQEATMGLIAHGFITKIGEYGVIVTFYNNVYGLVPMAVLQQAGIENLEE  604

Query  3997  MYHVEQVVKCRVVSSSPASRQIVLSFTT-------RPMRLSETEMVKPGTVVSGI-VELV  3842
              Y + QVVK RV    P  ++++LSF T       +P    ET     GT ++ + +  V
Sbjct  605   AYVLGQVVKARVTRCDPNRKRLMLSFDTTSNSSSNKPTAAPETASKLVGTTITNVKITDV  664

Query  3841  TPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFD----QLLVLDIEGF  3674
                   V   +G   ++G +    L+D      L+  ++K     D     LLV+  E  
Sbjct  665   ETTCFRVQTKDG---MEGVLPFVQLTDFPRNTPLVDEIVKRFSAGDVISEPLLVVSQESD  721

Query  3673  N-LVLSAKYSLISTAQQ---LPLDVNQISPHSVVHGYVCNV-IGNGVFVRFLGRLTGFSP  3509
               L LS K  L+  A +   +P     +  ++V+ GYV +V +  GVFV+FL  +   +P
Sbjct  722   GVLTLSKKPLLLEFASRKAIVPRTFGDVQENAVLIGYVTSVNVSKGVFVKFLNNVVAVAP  781

Query  3508  RSKATDDRRYDTSE-VFYIGQSVCTNILDVNGETGRITVSLKQS-LCSSTDAT------F  3353
             +    +       E +F IG++V  ++  +N E  +  V  +Q+     T++T      F
Sbjct  782   KGFHKEQFVAQIDEGMFEIGETVTCSVEKINKEKKQFVVGFQQTNFVLPTNSTNKARPAF  841

Query  3352  IQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFG  3173
              Q Y   +  +     +  A         F LG   + +   ++ +G V   EK ++   
Sbjct  842   FQAYLREQASVRNAAEVKKAP--------FALGKTEKAEFVGVRPYGAVFALEKDEETVT  893

Query  3172  FISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEF--VNGSKPQTANDKTQKKKR  2999
              +          + G +++  + D        D S    +  V+ S  ++ + K++K+K+
Sbjct  894   VLVPSVTENKEWDEGDSVKLLLTD-------YDFSKNVYYGAVDESLVKSGSKKSRKQKQ  946

Query  2998  KREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYA----LGYASLNDF-------NTQN  2852
             + +A   +    SV AV     E Y V+S P    A     G   L DF       +   
Sbjct  947   RVKAGGKIAA-ASVLAVSPT--EKYAVVSFPDPQNADLLQFGVVQLCDFWCPSQTSSQLG  1003

Query  2851  LPVKQFVNGQSVIATIMALPDSSTGGRLLLL------LKAISEVAEsssskrgkknsSYD  2690
             + V   +  + V +T+ +  +S+    L+LL      L   S+++   +S +  K +  D
Sbjct  1004  IEVGASIECRVVQSTLKSGSNSTPFDDLVLLALEEDELVTKSKISSHKASFKAPKYTHED  1063

Query  2689  --VGSLVQAEITDI--KPLELRL---KFGSGFHGRVHITEATDDNTTEG---PLNDFRIG  2540
               +GS+V   I+ I    +E+R+   K        V I +    +   G   P + + + 
Sbjct  1064  LVLGSIVTGVISGISENSMEIRVESHKKAGKVRAVVSIVDVDGIDEKSGHSHPFDRYSVN  1123

Query  2539  QTLTARIVSKDSRSENK----------RGYQWELSTKPSVLAGD--------------MD  2432
              T+T R+++  ++  NK          + +  +LS +   +AGD              ++
Sbjct  1124  TTVTGRVIAVTAKGANKLKPVSEENPAKFHALQLSLRSEDVAGDEKVKDVQRFVRPDWLE  1183

Query  2431  GPHESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVG  2252
             G         G  + G V   D ++  + +S  V   L  ++ S +   ++EFQ +F VG
Sbjct  1184  GSAGRALLKEGNSVEGVVSDQDVDYLTIKLSSNVTGTLSCVEVSEDVGVIREFQDKFPVG  1243

Query  2251  KSVSGYILSANKEKKLLRLVPHTLLITPEDTVPSSESARCH--IREGSVLGGRISKILPG  2078
             K V  ++L  + EKK + L           +V  S SA+C   ++ G+++ G IS     
Sbjct  1244  KRVKCFLLQVDDEKKTVDL-----------SVIHSSSAQCKAVVKSGAIVNGVISTKKSA  1292

Query  2077  VG--GLLVQIDAHLFGKVHFTELRDPWVSD--PLSGYCEGQFVKCKVLQVGHSVKGTTHV  1910
             +    ++VQ+ AH FG+V  TEL+  W +D   L  +  G+ V+C VL   ++     H+
Sbjct  1293  IRPPSIMVQLGAHTFGRVCITELQTKWENDMLELPQFAAGKVVRCVVLSTSNN-----HI  1347

Query  1909  DLSLRWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRK  1730
             DLSLR   D + N            +R V D+        V   V   T  GCF+ + R 
Sbjct  1348  DLSLRE--DALANPKEYAKKTSKPADRSVGDL--------VPAIVATTTSSGCFVRVDRH  1397

Query  1729  VDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDID  1550
               A+++L +L+D F++ P+ +FP GKLV G+V      +K+ +  L  S  A+    D+ 
Sbjct  1398  TTARVMLRDLSDDFVKDPQTQFPSGKLVAGRV------TKKSDRGLELSLKASVVSDDVS  1451

Query  1549  AL--NNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDN-VQSRYKAGQ  1379
                 ++   G  + G I +++++G+F+ ++ T + GLCH+SE++D+ +   +   +  G 
Sbjct  1452  VFKWSDLKEGLTVKGTITKVQTYGVFVRIEKTTISGLCHISEIADEKVTQPLDQIFSEGD  1511

Query  1378  TvrvkvlkvdkdRHRISLGMKNSYF  1304
                VK   +  +  R++ G+K SYF
Sbjct  1512  --YVKAKVLKVEDRRVAFGLKPSYF  1534


 Score =   244 bits (622),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/269 (42%), Positives = 183/269 (68%), Gaps = 3/269 (1%)
 Frame = -2

Query  928   DIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLN  749
             ++P++  ++E+L+  SP SS++WI++MAF +SL +++ AR +A +A S ++ R+E EKLN
Sbjct  1666  EVPQSASDYERLLAVSPQSSYLWIQFMAFHVSLTEIDLARDVAVRATSAVSFRDEKEKLN  1725

Query  748   VWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKM  569
             VWVAY NLE ++G+    + ++VF+ ALQ   PK+V+L L+ +Y R E ++   + L  M
Sbjct  1726  VWVAYLNLEHDFGD--DASFLRVFKSALQVNHPKRVYLHLVDLYARAEEHEDVKQTLATM  1783

Query  568   VKKFKHSCKIWLRRIQWALKQNQ-DNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVA  392
              KKF+ S + W+R +Q+ + + Q   +   + R+L  L  HKH+  I +   L ++ G  
Sbjct  1784  HKKFRTSKQTWIRSLQYLVGEKQFAEAAETLQRSLKSLAAHKHLPVILKYGQLLYEQGEL  1843

Query  391   DRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKK  212
             D+ R++FE +L  YPKR DLW+VYLD+EI+ GD+ ++RALFER +++    KKMKFLFKK
Sbjct  1844  DKARTIFEGILANYPKRMDLWNVYLDKEIKFGDVALVRALFERLLAMDFSAKKMKFLFKK  1903

Query  211   YLAYEKSVGDEERIESVKRKAMEYVESLA  125
             YL +E+  GD+E +E VK+ A ++V S A
Sbjct  1904  YLQFEQDQGDDEHVEHVKQLAKDFVASAA  1932



>gb|ETL44499.1| hypothetical protein L916_05221 [Phytophthora parasitica]
Length=1934

 Score =   455 bits (1170),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 417/1525 (27%), Positives = 710/1525 (47%), Gaps = 184/1525 (12%)
 Frame = -2

Query  5512  ANRITPKNISPGMKLWGVIAEVNE-KDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQ  5336
             A  ++ K +  GM L G + +V + +D+++SLP  L G V  SE  D   +    + + +
Sbjct  72    ATLLSFKTLRKGMLLLGCVRQVTDGQDLMISLPNKLNGTVALSECSDEFHEFLQTQKKAK  131

Query  5335  SNY--------LSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLALLHKNLTLDAIQ  5180
                        LS +F VGQ V C+VL      K   + +I LSLR +L+H  L+  ++ 
Sbjct  132   QQDEEEEQLQPLSTIFKVGQFVPCVVLATGKTDK---RKQIQLSLRTSLIHAELSPSSLT  188

Query  5179  EGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDKMNTGQLVEGVVKSVDRTRKVV  5000
             +G  L A + S EDHG I++ G+     F+P   +    ++ GQ +   V S++      
Sbjct  189   KGASLHATVSSVEDHGAIVNLGIRGVHAFVP-RKELATPVHKGQHLLVNVVSMNTHTNTA  247

Query  4999  YLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHL  4820
              ++     + K VT+     ++  LVPGM++N  V  VLENG+ ++FLT+FT TV+  H+
Sbjct  248   TVTIDRSQVVKAVTRG-DSFTLKQLVPGMLLNVRVEDVLENGLSVTFLTFFTATVEQNHM  306

Query  4819  QQVFP-PPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQ  4643
                 P    W++ Y +  K  ARI+ ID   + + LS+ PH+VH + P SL  VGDI E+
Sbjct  307   S--LPCERGWEESYRKGMKARARIISIDYIAKQITLSMAPHVVHMQVPESLFSVGDIIEE  364

Query  4642  AKVIRVDKGLGLLLEIPSS---------------------PVPTPAYVYISdvddkevkk  4526
             A + R+D G+G+LL + +                          P YV+IS+V DK V K
Sbjct  365   ATIERIDAGVGMLLSLKNQDEDVEMGDASDKKESTTNAKWKAFAPGYVHISNVSDKRVDK  424

Query  4525  meKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSF  4346
             +EK F  G  ++ RVLGF   + +A+ S K  +   +V  H D+KPG  V  K+++V+ +
Sbjct  425   LEKKFTVGSSIKCRVLGFSPFDAVASVSCKEHSISQTVLRHKDLKPGTKVNGKILSVEPW  484

Query  4345  GAIVQFSSGVKALCPLRHMSEFEIVKPRK--KFQVGSELVFRVL--GCKSKRITVTHKKT  4178
             G +++ S GV+ L   +HM  F + K     K++VG     RVL     + +  +T K  
Sbjct  485   GILMEISEGVRGLVTPQHMPAFLLNKKANNGKYKVGKTANARVLHVDLDANKTYLTMKSG  544

Query  4177  LVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISS  3998
             L+ S L +LSS+ +AT GLI HG+ITKI ++G  V FYN V G  P + L      ++  
Sbjct  545   LLSSDLPVLSSFQEATMGLIAHGFITKIGEYGVIVTFYNNVYGLVPMAVLQQAGIENLEE  604

Query  3997  MYHVEQVVKCRVVSSSPASRQIVLSFTT-------RPMRLSETEMVKPGTVVSGI-VELV  3842
              Y + QVVK RV    P  ++++LSF T       +P    ET     GT ++ + +  V
Sbjct  605   AYVLGQVVKARVTRCDPNRKRLMLSFDTTSNSSSNKPTAAPETASKLVGTTITNVKITDV  664

Query  3841  TPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFD----QLLVLDIEGF  3674
                   V   +G   ++G +    L+D      L+  ++K     D     LLV+  E  
Sbjct  665   ETTCFRVQTKDG---MEGVLPFVQLTDFPRNTPLVDEIVKRFSAGDVISEPLLVVSQESD  721

Query  3673  N-LVLSAKYSLISTAQQ---LPLDVNQISPHSVVHGYVCNV-IGNGVFVRFLGRLTGFSP  3509
               L LS K  L+  A +   +P     +  ++V+ GYV +V +  GVFV+FL  +   +P
Sbjct  722   GVLTLSKKPLLLEFASRKAIVPRTFGDVQENAVLIGYVTSVNVSKGVFVKFLNNVVAVAP  781

Query  3508  RSKATDDRRYDTSE-VFYIGQSVCTNILDVNGETGRITVSLKQ-SLCSSTDAT------F  3353
             +    +       E +F IG++V  ++  +N E  +  V  +Q S    T++T      F
Sbjct  782   KGFLKEQFVAQIDEGMFEIGETVTCSVEKINKEKKQFVVGFQQSSFVLPTNSTNKARPAF  841

Query  3352  IQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFG  3173
              Q Y   +  +     +  A         F LG   + +   ++ +G V   EK ++   
Sbjct  842   FQAYLREQASVRNAAEVKKAP--------FALGKTEKAEFVGVRPYGAVFALEKDEETVT  893

Query  3172  FISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEF--VNGSKPQTANDKTQKKKR  2999
              +          + G +++  + D        D S    +  V+ S  ++ + K++K+K+
Sbjct  894   VLVPSVTENKEWDEGDSVKLLLTD-------YDFSKNVYYGAVDESLVKSGSKKSRKQKQ  946

Query  2998  KREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYA----LGYASLNDF-------NTQN  2852
             + +A   +    SV AV     E Y V+S P    A     G   L DF       +   
Sbjct  947   RVKAGGKIAA-ASVLAVSPT--EKYAVVSFPDPQNADLLQFGVVQLCDFWCPSQTSSQLG  1003

Query  2851  LPVKQFVNGQSVIATIMALPDSSTGGRLLLL------LKAISEVAEsssskrgkknsSYD  2690
             + V   +  + V +T+ +  +S+    L+LL      L   S+++   +S +  K +  D
Sbjct  1004  IEVGASIECRVVQSTLKSGSNSTPFDDLVLLALEEDELVTKSKISSRKASFKAPKYTHED  1063

Query  2689  --VGSLVQAEITDI--KPLELRL---KFGSGFHGRVHITEATDDNTTEG---PLNDFRIG  2540
               +GS V   I+ I    +E+R+   K        V I +    +   G   P + + + 
Sbjct  1064  LVLGSTVTGVISGISENSMEIRVESHKKAGKVRAVVSIVDVDGIDEKSGHSHPFDRYSVN  1123

Query  2539  QTLTARIVSKDSRSENK----------RGYQWELSTKPSVLAGD--------------MD  2432
              T+T R+++  ++  NK          + +  +LS +   +AGD              ++
Sbjct  1124  TTVTGRVIAVTAKGANKLKPVSEENPAKFHALQLSLRSEDVAGDEKVKDVQRFVRPDWLE  1183

Query  2431  GPHESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVG  2252
             G         G  + G V   D ++  + +S  V   L  ++ S +   ++EFQ +F VG
Sbjct  1184  GSAGRALLKEGNSVEGVVSDQDVDYLTIKLSSNVTGTLSCVEVSEDVDVIREFQDKFPVG  1243

Query  2251  KSVSGYILSANKEKKLLRLVPHTLLITPEDTVPSSESARCH--IREGSVLGGRISKILPG  2078
             K V  ++L  + EKK + L           +V  S SA+C   ++ G+++ G IS     
Sbjct  1244  KRVKCFLLQVDDEKKTVDL-----------SVIHSSSAQCKAVVKSGAIVNGVISTKKSA  1292

Query  2077  VG--GLLVQIDAHLFGKVHFTELRDPWVSD--PLSGYCEGQFVKCKVLQVGHSVKGTTHV  1910
             +    ++VQ+ AH FG+V  TEL+  W +D   L  +  G+ V+C VL   ++     H+
Sbjct  1293  IRPPSIMVQLGAHTFGRVCITELQTKWENDMLELPQFAAGKVVRCVVLSTSNN-----HI  1347

Query  1909  DLSLRWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRK  1730
             DLSLR   D + N            +R V D+        V   V   T  GCF+ + R 
Sbjct  1348  DLSLRE--DALANPKEYAKKTSKPADRSVGDL--------VPAIVATTTSSGCFVRVDRH  1397

Query  1729  VDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDID  1550
               A+++L +L+D F++ P+ +FP GKLV G+V      +K+ +  L  S  A+    D+ 
Sbjct  1398  TTARVMLRDLSDDFVKDPQTQFPSGKLVAGRV------TKKSDRGLELSLKASVVSDDVS  1451

Query  1549  AL--NNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDN-VQSRYKAGQ  1379
                 ++   G  + G I +++++G+F+ ++ T + GLCH+SE++D+ +   +   +  G 
Sbjct  1452  VFKWSDLKEGLTVKGTITKVQTYGVFVRIEKTTISGLCHISEIADEKVTQPLDQIFSEGD  1511

Query  1378  TvrvkvlkvdkdRHRISLGMKNSYF  1304
                VK   +  +  R++ G+K SYF
Sbjct  1512  --YVKAKVLKVEDRRVAFGLKPSYF  1534


 Score =   243 bits (621),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/269 (42%), Positives = 183/269 (68%), Gaps = 3/269 (1%)
 Frame = -2

Query  928   DIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLN  749
             ++P++  ++E+L+  SP SS++WI++MAF +SL +++ AR +A +A S ++ R+E EKLN
Sbjct  1666  EVPQSASDYERLLAVSPQSSYLWIQFMAFHVSLTEIDLARDVAVRATSAVSFRDEKEKLN  1725

Query  748   VWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKM  569
             VWVAY NLE ++G+    + ++VF+ ALQ   PK+V+L L+ +Y R E ++   + L  M
Sbjct  1726  VWVAYLNLEHDFGD--DASFLRVFKSALQVNHPKRVYLHLVDLYARAEEHEDVKQTLATM  1783

Query  568   VKKFKHSCKIWLRRIQWALKQNQ-DNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVA  392
              KKF+ S + W+R +Q+ + + Q   +   + R+L  L  HKH+  I +   L ++ G  
Sbjct  1784  HKKFRTSKQTWIRSLQYLVGEKQFAEAAETLQRSLKSLAAHKHLPVILKYGQLLYEQGEL  1843

Query  391   DRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKK  212
             D+ R++FE +L  YPKR DLW+VYLD+EI+ GD+ ++RALFER +++    KKMKFLFKK
Sbjct  1844  DKARTIFEGILANYPKRMDLWNVYLDKEIKFGDVALVRALFERLLAMDFSAKKMKFLFKK  1903

Query  211   YLAYEKSVGDEERIESVKRKAMEYVESLA  125
             YL +E+  GD+E +E VK+ A ++V S A
Sbjct  1904  YLQFEQDQGDDEHVEHVKQLAKDFVASAA  1932



>ref|XP_008902842.1| hypothetical protein PPTG_09583 [Phytophthora parasitica INRA-310]
 gb|ETN11918.1| hypothetical protein PPTG_09583 [Phytophthora parasitica INRA-310]
Length=1934

 Score =   455 bits (1170),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 418/1525 (27%), Positives = 710/1525 (47%), Gaps = 184/1525 (12%)
 Frame = -2

Query  5512  ANRITPKNISPGMKLWGVIAEVNE-KDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQ  5336
             A  ++ K +  GM L G + +V + +D+++SLP  L G V  SE  D   +    + + +
Sbjct  72    ATLLSFKTLRKGMLLLGCVRQVTDGQDLMISLPNKLNGTVALSECSDEFHEFLQTQKKAK  131

Query  5335  SNY--------LSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLALLHKNLTLDAIQ  5180
                        LS +F VGQ V C+VL      K   + +I LSLR +L+H  L+  ++ 
Sbjct  132   QQDEEEEQLQPLSTIFKVGQFVPCVVLATGKTDK---RKQIQLSLRTSLIHAELSPSSLT  188

Query  5179  EGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDKMNTGQLVEGVVKSVDRTRKVV  5000
             +G  L A + S EDHG I++ G+     F+P   +    ++ GQ +   V S++      
Sbjct  189   KGASLHATVSSVEDHGAIVNLGIRGVHAFVP-RKELATPVHKGQHLLVNVVSMNTHTNTA  247

Query  4999  YLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHL  4820
              ++     + K VT+     ++  LVPGM++N  V  VLENG+ ++FLT+FT TV+  H+
Sbjct  248   TVTIDRSQVVKAVTRG-DSFTLKQLVPGMLLNVRVEDVLENGLSVTFLTFFTATVEQNHM  306

Query  4819  QQVFP-PPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQ  4643
                 P    W++ Y +  K  ARI+ ID   + + LS+ PH+VH + P SL  VGDI E+
Sbjct  307   S--LPCERGWEESYRKGMKARARIISIDYIAKQITLSMAPHVVHMQVPESLFSVGDIIEE  364

Query  4642  AKVIRVDKGLGLLLEIPSS---------------------PVPTPAYVYISdvddkevkk  4526
             A + R+D G+G+LL + +                          P YV+IS+V DK V K
Sbjct  365   ATIERIDAGVGMLLSLKNQDEDVEMGDASDKKESTTNAKWKAFAPGYVHISNVSDKRVDK  424

Query  4525  meKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSF  4346
             +EK F  G  ++ RVLGF   + +A+ S K  +   +V  H D+KPG  V  K+++V+ +
Sbjct  425   LEKKFTVGSSIKCRVLGFSPFDAVASVSCKEHSISQTVLRHKDLKPGTKVNGKILSVEPW  484

Query  4345  GAIVQFSSGVKALCPLRHMSEFEIVKPRK--KFQVGSELVFRVL--GCKSKRITVTHKKT  4178
             G +++ S GV+ L   +HM  F + K     K++VG     RVL     + +  +T K  
Sbjct  485   GILMEISEGVRGLVTPQHMPAFLLNKKANNGKYKVGKTANARVLHVDLDANKTYLTMKSG  544

Query  4177  LVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISS  3998
             L+ S L +LSS+ +AT GLI HG+ITKI ++G  V FYN V G  P + L      ++  
Sbjct  545   LLSSDLPVLSSFQEATMGLIAHGFITKIGEYGVIVTFYNNVYGLVPMAVLQQAGIENLEE  604

Query  3997  MYHVEQVVKCRVVSSSPASRQIVLSFTT-------RPMRLSETEMVKPGTVVSGI-VELV  3842
              Y + QVVK RV    P  ++++LSF T       +P    ET     GT ++ + +  V
Sbjct  605   AYVLGQVVKARVTRCDPNRKRLMLSFDTTSNSSSNKPTAAPETASKLVGTTITNVKITDV  664

Query  3841  TPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFD----QLLVLDIEGF  3674
                   V   +G   ++G +    L+D      L+  ++K     D     LLV+  E  
Sbjct  665   ETTCFRVQTKDG---MEGVLPFVQLTDFPRNTPLVDEIVKRFSAGDVISEPLLVVSQESD  721

Query  3673  N-LVLSAKYSLISTAQQ---LPLDVNQISPHSVVHGYVCNV-IGNGVFVRFLGRLTGFSP  3509
               L LS K  L+  A +   +P     +  ++V+ GYV +V +  GVFV+FL  +   +P
Sbjct  722   GVLTLSKKPLLLEFASRKAIVPRTFGDVQENAVLIGYVTSVNVSKGVFVKFLNNVVAVAP  781

Query  3508  RSKATDDRRYDTSE-VFYIGQSVCTNILDVNGETGRITVSLKQ-SLCSSTDAT------F  3353
             +    +       E +F IG++V  ++  +N E  +  V  +Q S    T++T      F
Sbjct  782   KGFLKEQFVAQIDEGMFEIGETVTCSVEKINKEKKQFVVGFQQSSFVLPTNSTNKARPAF  841

Query  3352  IQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFG  3173
              Q Y   +  +     +  A         F LG   + +   ++ +G V   EK ++   
Sbjct  842   FQAYLREQASVRNAAEVKKAP--------FALGKTEKAEFVGVRPYGAVFALEKDEETAT  893

Query  3172  FISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEF--VNGSKPQTANDKTQKKKR  2999
              +          + G +++  + D        D S    +  V+ S  ++ + K++K+K+
Sbjct  894   VLVPSVTENKEWDEGDSVKLLLTD-------YDFSKNVYYGAVDESLVKSGSKKSRKQKQ  946

Query  2998  KREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYA----LGYASLNDF-------NTQN  2852
             + +A   +    SV AV     E Y V+S P    A     G   L DF       +   
Sbjct  947   RVKAGGKIAA-ASVLAVSPT--EKYAVVSFPDPQNADLLQFGVVQLCDFWCPSQTSSQLG  1003

Query  2851  LPVKQFVNGQSVIATIMALPDSSTGGRLLLL------LKAISEVAEsssskrgkknsSYD  2690
             + V   +  + V +T+ +  +S+    L+LL      L   S+++   +S +  K +  D
Sbjct  1004  IEVGASIECRVVQSTLKSGSNSTPFDDLVLLALEEDELVTKSKISSRKASFKAPKYTHED  1063

Query  2689  --VGSLVQAEITDI--KPLELRL---KFGSGFHGRVHITEATDDNTTEG---PLNDFRIG  2540
               +GS V   I+ I    +E+R+   K        V I +    +   G   P + + + 
Sbjct  1064  LVLGSTVTGVISGISENSMEIRVESHKKAGKVRAVVSIVDVDGIDEKSGHSHPFDRYSVN  1123

Query  2539  QTLTARIVSKDSRSENK----------RGYQWELSTKPSVLAGD--------------MD  2432
              T+T R+++  ++  NK          + +  +LS +   +AGD              ++
Sbjct  1124  TTVTGRVIAVTAKGANKLKPVSEENPAKFHALQLSLRSEDVAGDEKVKDVQRFVRPDWLE  1183

Query  2431  GPHESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVG  2252
             G         G  + G V   D ++  + +S  V   L  ++ S +   ++EFQ +F VG
Sbjct  1184  GSAGRALLKEGNSVEGVVSDQDVDYLTIKLSSNVTGTLSCVEVSEDVDVIREFQDKFPVG  1243

Query  2251  KSVSGYILSANKEKKLLRLVPHTLLITPEDTVPSSESARCH--IREGSVLGGRISKILPG  2078
             K V  ++L  + EKK + L           +V  S SA+C   ++ G+++ G IS     
Sbjct  1244  KRVKCFLLQVDDEKKTVDL-----------SVIHSSSAQCKAVVKSGAIVNGVISTKKSA  1292

Query  2077  VG--GLLVQIDAHLFGKVHFTELRDPWVSD--PLSGYCEGQFVKCKVLQVGHSVKGTTHV  1910
             +    ++VQ+ AH FG+V  TEL+  W +D   L  +  G+ V+C VL   ++     H+
Sbjct  1293  IRPPSIMVQLGAHTFGRVCITELQTKWENDMLELPQFAAGKVVRCVVLSTSNN-----HI  1347

Query  1909  DLSLRWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRK  1730
             DLSLR   D + N            +R V D+        V   V   T  GCF+ + R 
Sbjct  1348  DLSLRE--DALANPKEYAKKTSKPADRSVGDL--------VPAIVATTTSSGCFVRVDRH  1397

Query  1729  VDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDID  1550
               A+++L +L+D F++ P+ +FP GKLV G+V      +K+ +  L  S  A+    D+ 
Sbjct  1398  TTARVMLRDLSDDFVKDPQTQFPSGKLVAGRV------TKKSDRGLELSLKASVVSDDVS  1451

Query  1549  AL--NNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDN-VQSRYKAGQ  1379
                 ++   G  + G I +++++G+F+ ++ T + GLCH+SE++D+ +   +   +  G 
Sbjct  1452  VFKWSDLKEGLTVKGTITKVQTYGVFVRIEKTTISGLCHISEIADEKVTQPLDQIFSEGD  1511

Query  1378  TvrvkvlkvdkdRHRISLGMKNSYF  1304
                VK   +  +  R+S G+K SYF
Sbjct  1512  --YVKAKVLKVEDRRVSFGLKPSYF  1534


 Score =   244 bits (622),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/269 (42%), Positives = 183/269 (68%), Gaps = 3/269 (1%)
 Frame = -2

Query  928   DIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLN  749
             ++P++  ++E+L+  SP SS++WI++MAF +SL +++ AR +A +A S ++ R+E EKLN
Sbjct  1666  EVPQSASDYERLLAVSPQSSYLWIQFMAFHVSLTEIDLARDVAVRATSAVSFRDEKEKLN  1725

Query  748   VWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKM  569
             VWVAY NLE ++G+    + ++VF+ ALQ   PK+V+L L+ +Y R E ++   + L  M
Sbjct  1726  VWVAYLNLEHDFGD--DASFLRVFKSALQVNHPKRVYLHLVDLYARAEEHEDVKQTLATM  1783

Query  568   VKKFKHSCKIWLRRIQWALKQNQ-DNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVA  392
              KKF+ S + W+R +Q+ + + Q   +   + R+L  L  HKH+  I +   L ++ G  
Sbjct  1784  QKKFRTSKQTWIRSLQYLVGEKQFAEAAETLQRSLKSLAAHKHLPVILKYGQLLYEQGEL  1843

Query  391   DRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKK  212
             D+ R++FE +L  YPKR DLW+VYLD+EI+ GD+ ++RALFER +++    KKMKFLFKK
Sbjct  1844  DKARTIFEGILANYPKRMDLWNVYLDKEIKFGDVALVRALFERLLAMDFSAKKMKFLFKK  1903

Query  211   YLAYEKSVGDEERIESVKRKAMEYVESLA  125
             YL +E+  GD+E +E VK+ A ++V S A
Sbjct  1904  YLQFEQDQGDDEHVEHVKQLAKDFVASAA  1932



>gb|ETP20972.1| hypothetical protein F441_05416 [Phytophthora parasitica CJ01A1]
Length=1934

 Score =   455 bits (1170),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 417/1525 (27%), Positives = 710/1525 (47%), Gaps = 184/1525 (12%)
 Frame = -2

Query  5512  ANRITPKNISPGMKLWGVIAEVNE-KDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQ  5336
             A  ++ K +  GM L G + +V + +D+++SLP  L G V  SE  D   +    + + +
Sbjct  72    ATLLSFKTLRKGMLLLGCVRQVTDGQDLMISLPNKLNGTVALSECSDEFHEFLQTQKKAK  131

Query  5335  SNY--------LSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLALLHKNLTLDAIQ  5180
                        LS +F VGQ V C+VL      K   + +I LSLR +L+H  L+  ++ 
Sbjct  132   QQDEEEEQLQPLSTIFKVGQFVPCVVLATGKTDK---RKQIQLSLRTSLIHAELSPSSLT  188

Query  5179  EGIILSAYIKSTEDHGYILHFGLPSFSGFLPIHSQSVDKMNTGQLVEGVVKSVDRTRKVV  5000
             +G  L A + S EDHG I++ G+     F+P   +    ++ GQ +   V S++      
Sbjct  189   KGASLHATVSSVEDHGVIVNLGIRGVHAFVP-RKELATPVHKGQHLLVNVVSMNTHTNTA  247

Query  4999  YLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHL  4820
              ++     + K VT+     ++  LVPGM++N  V  VLENG+ ++FLT+FT TV+  H+
Sbjct  248   TVTIDRSQVVKAVTRG-DSFTLKQLVPGMLLNVRVEDVLENGLSVTFLTFFTATVEQNHM  306

Query  4819  QQVFP-PPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSLVKVGDIFEQ  4643
                 P    W++ Y +  K  ARI+ ID   + + LS+ PH+VH + P SL  VGDI E+
Sbjct  307   S--LPCERGWEESYRKGMKARARIISIDYIAKQITLSMAPHVVHMQVPESLFSVGDIIEE  364

Query  4642  AKVIRVDKGLGLLLEIPSS---------------------PVPTPAYVYISdvddkevkk  4526
             A + R+D G+G+LL + +                          P YV+IS+V DK V K
Sbjct  365   ATIERIDAGVGMLLSLKNQDEDVEMGDASDKKESTTNAKWKAFAPGYVHISNVSDKRVDK  424

Query  4525  meKTFKPGKVVRVRVLGFRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSF  4346
             +EK F  G  ++ RVLGF   + +A+ S K  +   +V  H D+KPG  V  K+++V+ +
Sbjct  425   LEKKFTVGSSIKCRVLGFSPFDAVASVSCKEHSISQTVLRHKDLKPGTKVNGKILSVEPW  484

Query  4345  GAIVQFSSGVKALCPLRHMSEFEIVKPRK--KFQVGSELVFRVL--GCKSKRITVTHKKT  4178
             G +++ S GV+ L   +HM  F + K     K++VG     RVL     + +  +T K  
Sbjct  485   GILMEISEGVRGLVTPQHMPAFLLNKKANNGKYKVGKTANARVLHVDLDANKTYLTMKSG  544

Query  4177  LVKSKLDILSSYTDATEGLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISS  3998
             L+ S L +LSS+ +AT GLI HG+ITKI ++G  V FYN V G  P + L      ++  
Sbjct  545   LLSSDLPVLSSFQEATMGLIAHGFITKIGEYGVIVTFYNNVYGLVPMAVLQQAGIENLEE  604

Query  3997  MYHVEQVVKCRVVSSSPASRQIVLSFTT-------RPMRLSETEMVKPGTVVSGI-VELV  3842
              Y + QVVK RV    P  ++++LSF T       +P    ET     GT ++ + +  V
Sbjct  605   AYVLGQVVKARVTRCDPNRKRLMLSFDTTSNSSSNKPTAAPETASKLVGTTITNVKITDV  664

Query  3841  TPDSIVVNVNNGQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFD----QLLVLDIEGF  3674
                   V   +G   ++G +    L+D      L+  ++K     D     LLV+  E  
Sbjct  665   ETTCFRVQTKDG---MEGVLPFVQLTDFPRNTPLVDEIVKRFSAGDVISEPLLVVSQESD  721

Query  3673  N-LVLSAKYSLISTAQQ---LPLDVNQISPHSVVHGYVCNV-IGNGVFVRFLGRLTGFSP  3509
               L LS K  L+  A +   +P     +  ++V+ GYV +V +  GVFV+FL  +   +P
Sbjct  722   GVLTLSKKPLLLEFASRKAIVPRTFGDVQENAVLIGYVTSVNVSKGVFVKFLNNVVAVAP  781

Query  3508  RSKATDDRRYDTSE-VFYIGQSVCTNILDVNGETGRITVSLKQS-LCSSTDAT------F  3353
             +    +       E +F IG++V  ++  +N E  +  V  +Q+     T++T      F
Sbjct  782   KGFLKEQFVAQIDEGMFEIGETVTCSVEKINKEKKQFVVGFQQTNFVLPTNSTNKARPAF  841

Query  3352  IQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFG  3173
              Q Y   +  +     +  A         F LG   + +   ++ +G V   EK ++   
Sbjct  842   FQAYLREQASVRNAAEVKKAP--------FALGKTEKAEFVGVRPYGAVFALEKDEETVT  893

Query  3172  FISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSLKPEF--VNGSKPQTANDKTQKKKR  2999
              +          + G +++  + D        D S    +  V+ S  ++ + K++K+K+
Sbjct  894   VLVPSVTENKEWDEGDSVKLLLTD-------YDFSKNVYYGAVDESLVKSGSKKSRKQKQ  946

Query  2998  KREAQKDLEVNQSVNAVVEIVKENYLVLSVPACNYA----LGYASLNDF-------NTQN  2852
             + +A   +    SV AV     E Y V+S P    A     G   L DF       +   
Sbjct  947   RVKAGGKIAA-ASVLAVSPT--EKYAVVSFPDPQNADLLQFGVVQLCDFWCPSQTSSQLG  1003

Query  2851  LPVKQFVNGQSVIATIMALPDSSTGGRLLLL------LKAISEVAEsssskrgkknsSYD  2690
             + V   +  + V +T+ +  +S+    L+LL      L   S+++   +S +  K +  D
Sbjct  1004  IEVGASIECRVVQSTLKSGSNSTPFDDLVLLALEEDELVTKSKISSHKASFKAPKYTHED  1063

Query  2689  --VGSLVQAEITDI--KPLELRL---KFGSGFHGRVHITEATDDNTTEG---PLNDFRIG  2540
               +GS V   I+ I    +E+R+   K        V I +    +   G   P + + + 
Sbjct  1064  LVLGSTVTGVISGISENSMEIRVESHKKAGKVRAVVSIVDVDGIDEKSGHSHPFDRYSVN  1123

Query  2539  QTLTARIVSKDSRSENK----------RGYQWELSTKPSVLAGD--------------MD  2432
              T+T R+++  ++  NK          + +  +LS +   +AGD              ++
Sbjct  1124  TTVTGRVIAVTAKGANKLKPVSEENPAKFHALQLSLRSEDVAGDEKVKDVQRFVRPDWLE  1183

Query  2431  GPHESFNYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVG  2252
             G         G  + G V   D ++  + +S  V   L  ++ S +   ++EFQ +F VG
Sbjct  1184  GSAGRALLKEGNSVEGVVSDQDVDYLTIKLSSNVTGTLSCVEVSEDVDVIREFQDKFPVG  1243

Query  2251  KSVSGYILSANKEKKLLRLVPHTLLITPEDTVPSSESARCH--IREGSVLGGRISKILPG  2078
             K V  ++L  + EKK + L           +V  S SA+C   ++ G+++ G IS     
Sbjct  1244  KRVKCFLLQVDDEKKTVDL-----------SVIHSSSAQCKAVVKSGAIVNGVISTKKSA  1292

Query  2077  VG--GLLVQIDAHLFGKVHFTELRDPWVSD--PLSGYCEGQFVKCKVLQVGHSVKGTTHV  1910
             +    ++VQ+ AH FG+V  TEL+  W +D   L  +  G+ V+C VL   ++     H+
Sbjct  1293  IRPPSIMVQLGAHTFGRVCITELQTKWENDMLELPQFAAGKVVRCVVLSTSNN-----HI  1347

Query  1909  DLSLRWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRK  1730
             DLSLR   D + N            +R V D+        V   V   T  GCF+ + R 
Sbjct  1348  DLSLRE--DALANPKEYAKKTSKPADRSVGDL--------VPAIVATTTSSGCFVRVDRH  1397

Query  1729  VDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATPRKSDID  1550
               A+++L +L+D F++ P+ +FP GKLV G+V      +K+ +  L  S  A+    D+ 
Sbjct  1398  TTARVMLRDLSDDFVKDPQTQFPSGKLVAGRV------TKKSDRGLELSLKASVVSDDVS  1451

Query  1549  AL--NNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSELSDDHIDN-VQSRYKAGQ  1379
                 ++   G  + G I +++++G+F+ ++ T + GLCH+SE++D+ +   +   +  G 
Sbjct  1452  VFKWSDLKEGLTVKGTITKVQTYGVFVRIEKTTISGLCHISEIADEKVTQPLDQIFSEGD  1511

Query  1378  TvrvkvlkvdkdRHRISLGMKNSYF  1304
                VK   +  +  R+S G+K SYF
Sbjct  1512  --YVKAKVLKVEDRRVSFGLKPSYF  1534


 Score =   244 bits (622),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/269 (42%), Positives = 183/269 (68%), Gaps = 3/269 (1%)
 Frame = -2

Query  928   DIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLN  749
             ++P++  ++E+L+  SP SS++WI++MAF +SL +++ AR +A +A S ++ R+E EKLN
Sbjct  1666  EVPQSASDYERLLAVSPQSSYLWIQFMAFHVSLTEIDLARDVAVRATSAVSFRDEKEKLN  1725

Query  748   VWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKM  569
             VWVAY NLE ++G+    + ++VF+ ALQ   PK+V+L L+ +Y R E ++   + L  M
Sbjct  1726  VWVAYLNLEHDFGD--DASFLRVFKSALQVNHPKRVYLHLVDLYARAEEHEDVKQTLATM  1783

Query  568   VKKFKHSCKIWLRRIQWALKQNQ-DNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVA  392
              KKF+ S + W+R +Q+ + + Q   +   + R+L  L  HKH+  I +   L ++ G  
Sbjct  1784  HKKFRTSKQTWIRSLQYLVGEKQFAEAAETLQRSLKSLAAHKHLPVILKYGQLLYEQGEL  1843

Query  391   DRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKK  212
             D+ R++FE +L  YPKR DLW+VYLD+EI+ GD+ ++RALFER +++    KKMKFLFKK
Sbjct  1844  DKARTIFEGILANYPKRMDLWNVYLDKEIKFGDVALVRALFERLLAMDFSAKKMKFLFKK  1903

Query  211   YLAYEKSVGDEERIESVKRKAMEYVESLA  125
             YL +E+  GD+E +E VK+ A ++V S A
Sbjct  1904  YLQFEQDQGDDEHVEHVKQLAKDFVASAA  1932



>ref|XP_004989312.1| hypothetical protein PTSG_12966 [Salpingoeca rosetta]
 gb|EGD79227.1| hypothetical protein PTSG_12966 [Salpingoeca rosetta]
Length=2005

 Score =   447 bits (1149),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 397/1430 (28%), Positives = 673/1430 (47%), Gaps = 144/1430 (10%)
 Frame = -2

Query  5317  LFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKSTED  5138
             LF VGQ + C V      + +  +  I L++    ++K L   A+ +G +++A +KS E+
Sbjct  182   LFSVGQQIVCRV---KSTELKNNRPIINLTVNPTAINKGLETAALVKGRVVAACVKSIEE  238

Query  5137  HGYILHFGLPSFSGFLPIHSQS--VDKMNTGQLVEG-----VVKSVDRTRKVVYLSSAPD  4979
             HGY+L  G+   +GFL  ++     +K+ T  LV G      + +  +  +   + +AP 
Sbjct  239   HGYVLDLGVGHATGFLSTNNAKPLCEKLGTKSLVPGHPLLVALTTTVKGGRAAKVIAAPS  298

Query  4978  AIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVFP--  4805
              +A     D + +++  L  G++V+A V +   +G++ S L  F   V  +HL  V    
Sbjct  299   EVAATKLTD-EEVTLKQLRAGLLVDAKVKAHTRSGLIASALG-FDANVHYYHLPHVSGGD  356

Query  4804  -PPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKK--APPSLVKVGDIFEQAKV  4634
                  K  YP+   V ARI+F +PA  ++ LSL P  +  +  A  +   +G I E A V
Sbjct  357   VQKRLKTAYPEGSVVPARIIFSNPAASSLNLSLLPAHISMRGSAAGTGATLGAIVETATV  416

Query  4633  IRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEGL  4454
             +R D   G +L++ ++      +V  S V DK+     K  KPG V R R++    ++ +
Sbjct  417   LRTDGRGGAVLDLGAA---GQGFVAPSRVSDKKSDASLKKLKPGSVHRARIISVHPMDNI  473

Query  4453  ATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFEI  4274
                SL+ S  +   + + D+  G VV+A V +++ +GA+V+ S  ++ L P  H ++  +
Sbjct  474   VAVSLQKSVLDLPYYRYEDIPAGAVVEATVESLEEYGALVRLSDTIRGLVPALHFADVTL  533

Query  4273  VKPRKKFQVGSELVFRVLGC-----KSKRITVTHKKTLVKSKLDILSSYTDATEGLITHG  4109
              KP  KF  G+++  RVL         +R+  T KKTLV+S L +++S   A  G++ HG
Sbjct  534   RKPAVKFHPGAKVKCRVLSNIVTSKGKRRLAFTCKKTLVESDLPVIASAASARRGMLAHG  593

Query  4108  WITKIEKHGCFVRFYNGVQGFAPRSEL-GLDPGSDISSMYHVEQVVKCRVVSSSPASRQI  3932
             +I  I   GC VRFYN V+G  P  EL   +   D S+ +   QVVKCRVV +  A R+I
Sbjct  594   FIDSIRPFGCIVRFYNNVKGLVPLKELSATEKIKDASAYFKEGQVVKCRVVQTDQAKRRI  653

Query  3931  VLSFTTRPMRLSETEMVK---------PGTVVSGIVELVTPDSIVVNVNNGQSHLKGTVS  3779
              LSF      LSE ++ K         PG++V+ +++ V    + V++      ++ T+ 
Sbjct  654   GLSFIH--TALSEDDINKQRDTVTALSPGSIVTAVIDSVQTSGLNVHLKE-NPLVRVTID  710

Query  3778  TQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQQLPLDVNQIS  3599
             + HL+DH  LA  M S    G +   +++      N+ LS K SL+  A++  +      
Sbjct  711   SMHLTDHPSLAPQMASCFTEGQKITAVVIWK-RNRNVSLSLKPSLMVQAKEAVVASKDEL  769

Query  3598  PHSVVH-GYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDV  3422
                  H GY+ +      FV  +G ++G  P  +A+          F   Q+VC  +  +
Sbjct  770   KEGEQHFGYISSSTRTMSFVNLIGSVSGMCPIREASSGYVRSMESYFSPNQTVCARVHAI  829

Query  3421  NGETGRITVSLKQS-LCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGLGSIV  3245
               + G++  S K + L    +A+FIQ YF    +IA     D        V  +  G +V
Sbjct  830   --KDGKVDFSFKSAQLSPQQEASFIQSYFADLERIAVSSRSD--------VLKYKAGDVV  879

Query  3244  EGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVETGSTIQAAVIDVSKIEHLVDLSL  3065
                V +IK++G+ V  +  D   GFIS  Q  G+ +ET   ++A V+DV   + ++DL +
Sbjct  880   SAVVKDIKDYGITVVTD--DGCTGFISSAQAKGVPLETDGKVEAVVLDVDTAKSVLDLGV  937

Query  3064  KPEFVNGSKP------------------QTANDKTQKKKRKREAQKDLEVNQSVNAVVEI  2939
             +P  V G+K                   +    +   +  + +  + L   Q  +A +E+
Sbjct  938   RPSLVAGAKKVLGGAGEKKKSKKKGKKGKKGKQQQDDEDDEDKPVEKLSQEQEADATIEL  997

Query  2938  VKENYLVLSVPACNYALGYASLNDFNTQNLPVKQFVNGQSVIATIMALPDSST-------  2780
             VKE+Y+VLSV   +  L  A+   +N +  P ++   G      ++AL +  T       
Sbjct  998   VKEDYMVLSV--GDGRLVVAACKSYNDRESPFRKHFPGNGARVKVLALDEKHTFVQVLAE  1055

Query  2779  ---GGRLLLLLKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHG  2609
                G       +A    A+          S   +G++++A+I+ I   +L LK   G  G
Sbjct  1056  DNKGKGKDAKKQAKKADADKKQVAALSPASDATMGAIIKAKISAIHKAQLNLKLAGGGRG  1115

Query  2608  RVHITEATDDNTTEGPLND-------FRIGQTLTARIVS-KDSRSENKRGYQWELST---  2462
             RVHITE       E P  D       F   Q +  R++  +D+++ N         T   
Sbjct  1116  RVHITE------VEQPQEDGAKSFDPFTKNQVVECRVIGYRDAKNHNFLPITHTNFTSTI  1169

Query  2461  -KPSVLAGDMDGPHESF-------NYSTGQLLSGYVFKVDSEWAWLTISREVRAQLYILD  2306
              + S+ A D+    +             GQ L G V  V+    W+ IS  +  ++ +  
Sbjct  1170  VEASMRAQDLSKSKKKVVPRLTADQVQVGQKLLGVVGAVEPNRMWIDISIHLSGRVSL--  1227

Query  2305  SSAEP---SELKEFQKRFYVGKSVSGYILSA-NKEKKLLRLVPHTLLITPEDTVPSSESA  2138
              +A+P     LK  Q  +  G  ++ ++++  N + +L  + P T     E       + 
Sbjct  1228  QNAQPLNGDMLKSLQDMYEPGSPITTWVVAVKNGKVELSTIDPAT---QEEQENKEITTG  1284

Query  2137  RCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQFVK  1958
             R H + GS+              L+V++     G+VH  ++ D + +DP   +   + VK
Sbjct  1285  RVHTK-GSI-------------HLIVRLGRGKKGRVHICDVDDKFHADPFQRFALHELVK  1330

Query  1957  CKVLQV---GHSVKGTTHVDLSLRWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTV  1787
              K ++     H  +     D  L      ++    +  D +      +    D+  D  V
Sbjct  1331  VKKVEAPKHSHRNEQQHKADCQLSMRPSEIDTSTAAPRDPI------IASAADVKQDQIV  1384

Query  1786  QGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVTGKVVSVESLSKR  1607
             +GYV NVT  G F+ LSR V A++ ++NL+D FI+   K F  G+LV GKV+ V    K 
Sbjct  1385  RGYVCNVTDNGVFVALSRHVSARVKIANLSDLFIKDFTKVFKPGQLVKGKVLFVTDDGK-  1443

Query  1606  VEVTLRTSSSATPRKSDIDALNNFSAGNIISGKIKRIESFGLFISVDNTNLVGLCHVSEL  1427
             +E+TL+  S+  PR+S     N+   G I++G IKR+ESFG+F+++DN+ L GL H+SE 
Sbjct  1444  IELTLK-RSAVNPRESKPVRYNDLKIGQIVAGVIKRVESFGVFVTIDNSKLSGLAHISEC  1502

Query  1426  SDDHIDNVQSRYKAGQTvrvkvlkvdkdRHRISLGMKNSYF--RDDDGED  1283
             +D  IDN+ + Y  G  V+ K+L+++K++ RISL +K S    +   GED
Sbjct  1503  ADAKIDNLDAVYNVGDAVKAKILRLNKEKKRISLTLKPSAVEGKQSTGED  1552


 Score =   267 bits (682),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/265 (46%), Positives = 179/265 (68%), Gaps = 3/265 (1%)
 Frame = -2

Query  922   PRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVW  743
             P+   +F++LV  +PNSS+ WI+YMA+ L L +++KAR++ ++A+STIN REE E++NVW
Sbjct  1740  PQTPMDFDRLVLQAPNSSYAWIRYMAYYLKLTELDKARAVGKRALSTINFREEKERMNVW  1799

Query  742   VAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVK  563
             VA  NLE  YG P    +  VF  A +  DP++++  L+ +YER+  ++  DEL + M K
Sbjct  1800  VALLNLENAYGTPA--TLNNVFTEACRQMDPQRMYFHLVSIYERSHKFREADELFQVMCK  1857

Query  562   KFKHSCKIWLRRIQWALKQNQDN-SQSIVNRALLCLPKHKHIKFITQTAILEFKCGVADR  386
             KF    ++WLR  ++  K+ +   ++ ++ R+L  LP+  H+  I +  ILEFK G  +R
Sbjct  1858  KFNKVQRVWLRFAEFKFKRGRSKEARQVLERSLKSLPRPDHVDTIVKFGILEFKQGDVER  1917

Query  385   GRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYL  206
              R++FE +L  YPKR DLWS+YLDQE RVGD  VIRALFER I+L++  KKM+F FK+YL
Sbjct  1918  ARTIFENVLSNYPKRVDLWSIYLDQEQRVGDKGVIRALFERVITLNLSSKKMRFFFKRYL  1977

Query  205   AYEKSVGDEERIESVKRKAMEYVES  131
              +EK  GD   +E VK KA EYV S
Sbjct  1978  DFEKEHGDAGHVEHVKEKAREYVAS  2002



>ref|XP_005154602.1| PREDICTED: protein RRP5 homolog [Melopsittacus undulatus]
Length=1837

 Score =   443 bits (1139),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 388/1400 (28%), Positives = 652/1400 (47%), Gaps = 172/1400 (12%)
 Frame = -2

Query  5488  ISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLA---SEAHDPLWDNETNEMEMQSNY--L  5324
             +  GM L G I EV++ ++VVSLP GL G V     S+A+  L   +  + E+  +   L
Sbjct  80    LCEGMLLLGCIKEVSDYELVVSLPNGLSGFVPVTQISDAYSKLLSKQVAQGELLEDLHSL  139

Query  5323  SGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYIKST  5144
               L+  G LV CIV  ++  K   G+  I LS+    ++K+L   A+  G++LS ++ S 
Sbjct  140   VDLYSPGTLVRCIVTTIE--KSADGRRSIKLSIDPKKVNKSLNASALASGMLLSGFVSSV  197

Query  5143  EDHGYILHFGLPSFSGFLPIHS-----QSVDK---MNTGQLVEGVVKSVDRTRKVVYLSS  4988
             EDHGY++  G+   + FLP        ++V K   +  GQ +  V+  V    +VV LS 
Sbjct  198   EDHGYLIDIGVNGTNAFLPRQKAQNYIKTVKKGSDLKIGQNLNCVIVEVKNGGRVVLLSI  257

Query  4987  APDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQQVF  4808
                 +A  +  + +  S+  L+PG++V A V  V   G+ LSFL++FTG VD  H+    
Sbjct  258   DRSEVASSLATEQQNWSLSNLLPGLVVKARVQKVAPLGIKLSFLSFFTGIVDFMHMD---  314

Query  4807  PPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSLV---KVGDIFEQAK  4637
               P     Y  ++ V A I+ I+P T+ V L+L    +H    P+ +   ++G + E++ 
Sbjct  315   --PEKSMSYSPDQVVKACIISINPTTKVVRLTLRQAFLHPGGSPNQISNDRIGAVVEEST  372

Query  4636  VIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKVVRVRVLGFRNLEG  4457
             V    K  G + E+      T A+  +  +           FK G   + R++ +  ++ 
Sbjct  373   VKAFYKQFGAVFELDDG---TLAFARLKHLSKTRKSFKPGAFKAGCKHKCRIIDYSLMDE  429

Query  4456  LATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGVKALCPLRHMSEFE  4277
             +   SLK    E     + D+  G VV+ KV  +   G  V+ +  +K L P  H+++  
Sbjct  430   MCVVSLKYQIIEARFLQYQDIHTGDVVQGKVFALKPVGMQVKVTDAIKGLVPSMHLADVI  489

Query  4276  IVKPRKKFQVGSELVFRVLGCK--SKRITVTHKKTLVKSKLDILSSYTDATEGLITHGWI  4103
             + +P KK+ +G ++  RVL C    K++ +T KK LV+SKL +LS+Y DA  GLITHG++
Sbjct  490   LKQPEKKYNIGDQVRCRVLECNPAGKKLILTLKKNLVQSKLPVLSNYEDAKPGLITHGFV  549

Query  4102  TKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQIVLS  3923
                 + GC V+FYN V+G  P++EL  +P S    ++H  QVVK  V+   P   +++LS
Sbjct  550   VCAREFGCIVKFYNDVKGLVPKNELSSEPISCPDEVFHEGQVVKVMVLKCEPEQERLLLS  609

Query  3922  F--TTRPMRLSETEMV--KPGTVVSGIVELV-------TPDSIVVNVNNGQSHLKGTVST  3776
             F  + +P      E    K   V   I E+V         + + V+V   + ++  ++ T
Sbjct  610   FRLSNKPALDDRKECTPKKKQEVKYQIGEMVDVKILKKRDNGLEVSVLEDEGNVIASIPT  669

Query  3775  QHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQ--QLPLDVNQI  3602
              HLSD      L+   L+ G    +++ L   G  ++LS K ++IS  Q  Q+  + ++I
Sbjct  670   VHLSDFVATCKLLWHCLQEGDVLPRVMCLSDNGERIILSRKSAVISAVQEEQVVRNFSEI  729

Query  3601  SPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCTNILDV  3422
              P  ++ GYV NV+  GVFV F   +TG +P+   +D    DT + F +GQ+V   ++ +
Sbjct  730   QPGMLLTGYVRNVMPFGVFVEFPFGVTGLAPKVSMSDKFVTDTKDHFVVGQTVIAKVMSI  789

Query  3421  NGETGRITVSLKQSLCSSTDA-----TFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGL  3257
             + E  R+ ++LK S CSS D+       + +YF    ++ ++++L       N     GL
Sbjct  790   DEEKQRVLLNLKVSECSSGDSAAESFALLNQYF---KEMKEIRNLLRRRGESNMTQ--GL  844

Query  3256  GSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGINVET------------GSTIQA  3113
               +V G     KE  +VV   K +D     SGG + G+ V              G   +A
Sbjct  845   CELVPG-----KELQLVVQDVK-EDGSALFSGGCVTGLTVTATRYHLGDKKIIPGEKTKA  898

Query  3112  AVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVK  2933
              V+ V  +   V +SL+ E +                 KR A++ L  N    A+V+ + 
Sbjct  899   LVLHVDALTSKVYVSLREELL-----------------KRRAKQRLTENSQHYAIVQHIA  941

Query  2932  ENYLVLSVPACNY-ALGYAS-LND---FNTQNLPVKQFVNGQSVIATIMALPDSSTGGRL  2768
             E + ++S+      A+  AS  ND   F+++ L V     GQ++ AT+ A+ ++  G  L
Sbjct  942   EEFAIVSLETGQLAAIPIASHFNDTFRFDSEKLKV-----GQTISATLRAVKENDHG--L  994

Query  2767  LLLLKAIS----------EVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSG  2618
             LL ++  +          E   +          S  +G +V   +  +KP  + +     
Sbjct  995   LLAVQGAAKKNVFARVRNESETALEEVLAAVKHSLSLGDVVTGTVKSVKPTHVTVAIDDK  1054

Query  2617  FHGRVHITEATDDNTTEGPLNDF-----RIGQTLTARIVSKDSRSENKRGYQ--------  2477
               G +H +   D    E P+  F     + GQ +TAR+V    R  N   Y         
Sbjct  1055  LTGSIHASRILD----EVPIGSFPTFTLKAGQKVTARVVG--GRDVNTHRYLPITHPHFT  1108

Query  2476  ---WELSTKPSVLAGDMDG---PHESFN------YSTGQLLSGYV--FKVDSEWAWLTIS  2339
                 ELS +PS + G++     P E         YS GQ ++ +V  + +   W  + ++
Sbjct  1109  RSIPELSIRPSEIEGEVTAVLSPKEDSATKKLELYSVGQTITCFVKKYNILKNWLEVEVA  1168

Query  2338  REVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTLLITPEDT  2159
              +VR ++  L  S     LK  +K F  G+++S  +   +        V  T L      
Sbjct  1169  PDVRGRVPHLLLSLSTKVLKHPEKSFKNGQAISATVTGTD--------VTETNLYLSLTG  1220

Query  2158  VPSSESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGY  1979
             + S E       +G++  G ++K+ P + GL + +     GKV    L D +  DPL  +
Sbjct  1221  IQSLE-------QGTITVGMVTKVTPHI-GLTIALPGGKTGKVSIFHLSDTYTEDPLGDF  1272

Query  1978  CEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHP  1799
               G+ V+C +L           + LSLR +   +N ++ S+ +DV      +  IKD+  
Sbjct  1273  KAGKIVRCYILS-----NENGKIQLSLRQS--RLNPKSKSKVEDVE-----ITCIKDVKK  1320

Query  1798  DMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESP---EKEFPVGKLVTGKVVS  1628
                V+GYVK++T  G F  LS  +  +IL  N++  F++     EK  P GKL+T KV+ 
Sbjct  1321  GQLVRGYVKSITSSGVFFGLSPSLLGRILFQNVSPYFVQKHSLYEKYLPEGKLLTAKVLG  1380

Query  1627  VESLSKRVEVTLRTSSSATP  1568
             V    K +E++L    +  P
Sbjct  1381  VNGKEKHIELSLLPEDTGMP  1400


 Score =   271 bits (692),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 128/265 (48%), Positives = 183/265 (69%), Gaps = 3/265 (1%)
 Frame = -2

Query  922   PRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVW  743
             P++ D+F++LV SSPNSS +W++YMAF L   ++EKAR++AE+A+ TI+ REE EKLNVW
Sbjct  1568  PQSADDFDRLVLSSPNSSILWLQYMAFHLQATEIEKARAVAERALKTISFREEQEKLNVW  1627

Query  742   VAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVK  563
             VA  NLE  YG   +E +MKVF+RA+QY +P KV   L  +Y  +E YK  +EL   M+K
Sbjct  1628  VALLNLENMYGT--EETLMKVFERAVQYNEPLKVFQHLCDIYASSEKYKQAEELYHTMLK  1685

Query  562   KFKHSCKIWLRRIQWALKQNQ-DNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVADR  386
             +F+    +WL+   + LKQ Q D +  ++ RA+  LP  +H+  I++ A LEF+ G A+ 
Sbjct  1686  RFRQEKSVWLKYASFLLKQGQTDATHRLLERAVKALPTKEHVDVISRFAQLEFRFGDAEH  1745

Query  385   GRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYL  206
              +++FE  L  YPKRTD+WS+Y+D  I+ G    +R +FER + LS+ PKKMKFLFK+YL
Sbjct  1746  AKALFESTLSSYPKRTDIWSIYIDIMIKHGSQKEVRDIFERVVHLSLAPKKMKFLFKRYL  1805

Query  205   AYEKSVGDEERIESVKRKAMEYVES  131
              YEK  G  E + +VKR A+EYVE+
Sbjct  1806  DYEKKFGTTESVLAVKRAALEYVET  1830



>tpg|DAA59939.1| TPA: hypothetical protein ZEAMMB73_130902 [Zea mays]
Length=285

 Score =   400 bits (1028),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 192/269 (71%), Positives = 231/269 (86%), Gaps = 3/269 (1%)
 Frame = -2

Query  928  DIPRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLN  749
            DIP+  D+FEKLVRSSPNSSF+WIKYMA +L L DVEKAR++AE+A+ TI  REE EKLN
Sbjct  9    DIPQTPDDFEKLVRSSPNSSFIWIKYMATLLDLADVEKARAVAERALKTIIPREEEEKLN  68

Query  748  VWVAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKM  569
            VWVAYFNLE EYG+P ++AV KVFQRALQYCDPKK+HLALL +YERTE Y+L DELL++M
Sbjct  69   VWVAYFNLENEYGSPREDAVKKVFQRALQYCDPKKLHLALLAMYERTEQYELADELLDRM  128

Query  568  VKKFKHSCKIWLRRIQWALKQNQDNS--QSIVNRALLCLPKHKHIKFITQTAILEFKCGV  395
             K+FK SCKIWL RIQ+ALKQ +D    ++IVNRALL LP  K IKF++QTAILEFKCGV
Sbjct  129  TKRFKTSCKIWLCRIQFALKQGKDVEYIKAIVNRALLSLPHRKRIKFLSQTAILEFKCGV  188

Query  394  ADRGRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFK  215
             + GRS FE +L+EYPKRTDLWSVYLDQEIR+GD++VIRALFER   L++PPKKM+FLFK
Sbjct  189  PEEGRSRFELILREYPKRTDLWSVYLDQEIRLGDVEVIRALFERVTCLTLPPKKMQFLFK  248

Query  214  KYLAYEKSVG-DEERIESVKRKAMEYVES  131
            KYL +EKS+G D ERI+ V++KA+EYV+S
Sbjct  249  KYLNFEKSLGKDNERIQLVQQKAIEYVQS  277



>ref|XP_009085460.1| PREDICTED: protein RRP5 homolog [Serinus canaria]
Length=1834

 Score =   440 bits (1131),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 375/1399 (27%), Positives = 646/1399 (46%), Gaps = 164/1399 (12%)
 Frame = -2

Query  5503  ITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLA---SEAHDPLWDNETNEMEM--  5339
             +T + +  GM L G I EV++ ++ +SLP GL G V     S+A+  L   +  + E+  
Sbjct  77    LTIEALCEGMLLLGCIKEVSDYELAISLPNGLSGFVPVTQISDAYSNLLSKQVAQGEVLE  136

Query  5338  QSNYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSA  5159
             + N L  LF  G LV CIV  ++  K + G+  I LS+    ++K L   A+  G++LS 
Sbjct  137   ELNSLPDLFSPGTLVRCIVTSIE--KSDDGRRSIKLSIDPKQVNKGLNSTALAAGMLLSG  194

Query  5158  YIKSTEDHGYILHFGLPSFSGFLPIHSQSVD---------KMNTGQLVEGVVKSVDRTRK  5006
              + S EDHGY++  G+P    FLP H ++ +          +  GQ +  ++  V    +
Sbjct  195   SVLSVEDHGYLIDIGVPGTHAFLP-HQKAKNYIKAAKKGPDLKIGQNLNCLIVEVKSEGR  253

Query  5005  VVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIF  4826
             VV LS     +A  +  +    ++  L+PG++V A V  V   G+ L+FL+YFTG VD  
Sbjct  254   VVCLSIDRSEVAASIATERHNWALSNLLPGLVVKARVQKVAPLGMKLTFLSYFTGIVDFM  313

Query  4825  HLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSLV---KVGD  4655
             H+      P     Y  ++ V A +L + P +RAV L+L P  +H    P  +   ++G 
Sbjct  314   HMD-----PEKSMSYSPDQVVKACVLSVHPTSRAVRLTLLPPFLHAGGAPRQLPGQRMGA  368

Query  4654  IFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKVVRVRVLG  4475
             + E+A V    K  G + E+      T A+  +  +           FK G   + R++ 
Sbjct  369   VLEEATVKAFYKQFGAIFELDDG---TLAFARLKHLSKTRKSFKPGAFKEGCKHKCRIID  425

Query  4474  FRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGVKALCPLR  4295
             +  ++ +   SLK    E     + D+  G VV+ KV+++   G  V+ + G++ L P  
Sbjct  426   YSLMDEMCIVSLKNQIIEARFLQYQDIHTGDVVQGKVLSLKPIGMQVKVADGIRGLVPSL  485

Query  4294  HMSEFEIVKPRKKFQVGSELVFRVLGCK--SKRITVTHKKTLVKSKLDILSSYTDATEGL  4121
             H+S+  + +P KKF +G EL  RVL C    K++ +T KK+L++SKL +L++Y DA  GL
Sbjct  486   HLSDVILKQPEKKFNIGDELKCRVLECNPGGKKLILTLKKSLIQSKLPVLTNYEDAKPGL  545

Query  4120  ITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSSSPAS  3941
             ITHG++    + GC V+FYN V+G  P++ELG +P S    +++  QV+K  V+   P  
Sbjct  546   ITHGFVVCAREFGCIVKFYNDVKGLVPKNELGSEPISCPDKVFYEGQVLKVMVLKCEPQQ  605

Query  3940  RQIVLSFTTRPMRLSET------EMVKP----------GTVVSGIVELVTPDSIVVNVNN  3809
              +++LSF     RLS T      +   P          G +V   +     + + V++  
Sbjct  606   ERLLLSF-----RLSSTSGPEDKQKCTPKEKKEMKYHIGEIVDVKILKKKDNGLEVSILE  660

Query  3808  GQSHLKGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQ  3629
              + ++   +   HLSD    + L+   L+ G    +++ L  +G +++LS K ++IS  Q
Sbjct  661   DEDNVVAWIPILHLSDFVATSKLLWHCLQEGDVLPRVMYLSDKGEHIILSRKSAVISAVQ  720

Query  3628  --QLPLDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYI  3455
               Q+    ++I P  ++ GYV NV+  GVFV F   +TG +P+   +D    DT + F +
Sbjct  721   EEQVVRSFSEIQPGMLLTGYVRNVMPFGVFVEFPFGVTGLAPKVSMSDKFVTDTKDHFVV  780

Query  3454  GQSVCTNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSL-DSADSGLN  3278
             GQ+V   ++ ++ E  R+ ++LK S CSS D+   + + LL     +L+ + D    G +
Sbjct  781   GQTVIAKVMSIDEEKQRVLLNLKVSECSSGDSA-AESFGLLNQYFKELKEIRDLVRRGES  839

Query  3277  WVDGFGLGSIVEGKVHEIKE-----------FGVVVTFEKYDDVFGFISGGQLGGINVET  3131
              +     G  V   V +++E            G+ VT  +Y           LG  N+  
Sbjct  840   SICELVPGKRVHLVVQDVREDGSALFSGSSFTGLTVTATRY----------HLGDKNIGP  889

Query  3130  GSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNA  2951
             G   +A V+ V  +   V +SL+ E +                 K+  Q+ L  N   + 
Sbjct  890   GEKRKALVLHVDALTSEVFVSLREELL-----------------KQRPQRRLRENSQHSV  932

Query  2950  VVEIVKENYLVLSVPACNYALGY---ASLND---FNTQNLPVKQFVNGQSVIATIMALPD  2789
             VV+ + E++ + S+P             LND   F+++ L V     GQ++ AT+ A+ +
Sbjct  933   VVQHITEHFAIASLPETGQLAAVPIACHLNDTFRFDSEKLRV-----GQTIFATLKAVKE  987

Query  2788  SSTGGRLL--------LLLKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRL  2633
             +  G  L         + ++  +E   +          S   G +V   +  +KP  + +
Sbjct  988   NKHGVLLAVQGPAKKNVFVRVRNESETALEEMLPAVKHSLSPGDVVTGTVKSVKPTHVTV  1047

Query  2632  KFGSGFHGRVHITEATDDNTTEG-PLNDFRIGQTLTARIV-SKDSRSENKRGYQW-----  2474
                    G +H +   D+      P +  + GQ +TAR++  +D  +             
Sbjct  1048  AIDDKLTGSIHASRILDEVPIGSFPTSTLKAGQKVTARVIGGRDVNTHRCLPITHPHFTQ  1107

Query  2473  ---ELSTKPSVLAGDMDG-----PHESFN----YSTGQLLSGYVFKVD--SEWAWLTISR  2336
                ELS +PS   G+           S      Y  GQ ++ +V K +    W  + ++ 
Sbjct  1108  SIPELSIRPSEKEGEFTAMLNLKEESSLKKLGLYDVGQTVTCFVKKYNMLKHWLEVEVAP  1167

Query  2335  EVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTLLITPEDTV  2156
             ++R ++  L  S     LK  +K F  G+++S  +   +  +  L L    +    +DT+
Sbjct  1168  DIRGRVPHLLLSLNTKVLKHPEKSFRSGQAISATVTGTDATETSLCLSLTGIQSLEQDTI  1227

Query  2155  PSSESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYC  1976
                          SV  G ++K+ P V GL + +     GKV    L D +  +PL  + 
Sbjct  1228  -------------SV--GMVTKVTPHV-GLTIALPGGKAGKVSLFHLNDTYTENPLGNFK  1271

Query  1975  EGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPD  1796
              G+ V+C +L           + LSLR +   +N +  S+ +D+      +  IKD+   
Sbjct  1272  VGKIVRCYILS-----NENGKIQLSLRQS--RLNPKITSKVEDIE-----ITSIKDVKKG  1319

Query  1795  MTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESP---EKEFPVGKLVTGKVVSV  1625
               V+GYVK++TP G F  LS  +  +IL  N++  F++     EK  P GKL+T KV+ V
Sbjct  1320  QLVRGYVKSITPSGVFFGLSTSLLGRILFQNVSPYFVQKHSLYEKYLPEGKLLTAKVLRV  1379

Query  1624  ESLSKRVEVTLRTSSSATP  1568
                 KR+E++L    +  P
Sbjct  1380  NRKEKRIELSLLPEDTGMP  1398


 Score =   265 bits (678),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 126/265 (48%), Positives = 179/265 (68%), Gaps = 3/265 (1%)
 Frame = -2

Query  922   PRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVW  743
             P++ D+F++LV  SPNSS +W++YMAF L   ++EKAR++AE+A+ TI+ REE EKLNVW
Sbjct  1565  PQSADDFDRLVLGSPNSSILWLQYMAFHLQATEIEKARAVAERALKTISFREEQEKLNVW  1624

Query  742   VAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVK  563
             VA  NLE  YG   +E +MKVF+RA+QY +P KV   L  +Y  +E YK  +EL   M+K
Sbjct  1625  VALLNLENMYGT--EETLMKVFERAVQYNEPLKVFQHLCDIYASSEKYKQAEELYHTMLK  1682

Query  562   KFKHSCKIWLRRIQWALKQNQ-DNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVADR  386
             +F+    +WL+   + LKQ Q + +  ++ RAL  LP  +H+  I++ A LEF  G  + 
Sbjct  1683  RFRQEKSVWLKYASFLLKQGQAEATHRLLERALKALPTKEHVDVISRFAQLEFHSGDTEH  1742

Query  385   GRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYL  206
              +++FE  L  YPKRTD+WS+Y+D  I+ G    +R +FER I LS+ PKKMKF FK+YL
Sbjct  1743  AKALFESTLSSYPKRTDIWSIYMDIMIKHGTQKEVRDIFERVIHLSLAPKKMKFFFKRYL  1802

Query  205   AYEKSVGDEERIESVKRKAMEYVES  131
              YEK  G  E + +VKR A+EYVE+
Sbjct  1803  DYEKKFGTAESVLAVKRAALEYVET  1827



>ref|XP_009910115.1| PREDICTED: LOW QUALITY PROTEIN: protein RRP5 homolog [Haliaeetus 
albicilla]
Length=1829

 Score =   439 bits (1130),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 380/1395 (27%), Positives = 653/1395 (47%), Gaps = 160/1395 (11%)
 Frame = -2

Query  5503  ITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLA---SEAHDPLWDNETNEMEMQS  5333
             +T + +  GM + G I EV++ ++V+SLP GL G V     S+A+  L   E  + E+  
Sbjct  75    LTIEALCEGMLVLGCIKEVSDYELVISLPNGLSGFVPVTQISDAYSKLLSKEVAQGELLE  134

Query  5332  --NYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSA  5159
               N LS ++  G LV CIV  ++  K   G+  I LS+    ++K L   A+  G++LS 
Sbjct  135   DLNSLSDMYSPGMLVRCIVTSVE--KSADGRRSIKLSIDPKKVNKGLNASALASGMLLSG  192

Query  5158  YIKSTEDHGYILHFGLPSFSGFLPIHS-----QSVDK---MNTGQLVEGVVKSVDRTRKV  5003
             ++ S EDHGY++  G+     FLP        ++V +   +  GQ +  ++  V    +V
Sbjct  193   FVSSVEDHGYLIDIGVSGTHAFLPRQKAQNYIKAVKRGPDLKIGQNLNCIIVEVKNEGRV  252

Query  5002  VYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFH  4823
             V LS     +A  +  + +  ++  L+PG++V A V  V+  G+ LSFL+ FTG VD  H
Sbjct  253   VRLSVDRSEVAASLATERQNWTLSNLLPGLVVKARVQKVVPLGMKLSFLSSFTGIVDFMH  312

Query  4822  LQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSLV---KVGDI  4652
             +      P    +Y  ++ + A IL I P ++ V L+L    +     P  +   ++G +
Sbjct  313   MD-----PEKSMNYSPDQVLKACILSIHPTSKVVRLTLRQAFLCPGGSPDQLSNDRMGAV  367

Query  4651  FEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKVVRVRVLGF  4472
              E++ V    K  G + E+      T A+  +  +           FK G   + R++ +
Sbjct  368   VEESTVKAFYKQFGAVFELDDG---TLAFARLKHLSKTRKSFKPGAFKTGCKHKCRIIDY  424

Query  4471  RNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGVKALCPLRH  4292
               ++ +   SLK    E     + D+  G VV+ KV  +   G  V+ + G+K L P  H
Sbjct  425   SLMDEMCIVSLKYQIIEARFLQYQDIHTGDVVQGKVFALKPIGMQVKVTDGIKGLVPSMH  484

Query  4291  MSEFEIVKPRKKFQVGSELVFRVLGCK--SKRITVTHKKTLVKSKLDILSSYTDATEGLI  4118
             +++  + +P KK+ +G E+  RVL C    +++ +T KK+L++SKL +LS+Y DA  GLI
Sbjct  485   LADVILKQPEKKYNIGDEVRCRVLECNPAGRKLILTLKKSLIQSKLPVLSNYEDAKAGLI  544

Query  4117  THGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSSSPASR  3938
             THG++    + GC V+FYN V+G  P++EL  +P S    ++H  QVVK  V+   P   
Sbjct  545   THGFVVCAREFGCIVKFYNDVKGLVPKNELSSEPISSPDKVFHEGQVVKVMVLKCEPQQE  604

Query  3937  QIVLSF--TTRPMRLSETEMV--KPGTVVSGIVELV------TPDS-IVVNVNNGQSHLK  3791
             +++LSF  +++P    + E    K   V   I E+V        DS + V++   + ++ 
Sbjct  605   RLLLSFRLSSKPAPEDKKECTPKKKQEVKYQIGEMVDVKVLKKKDSGLEVSILEDEGNVI  664

Query  3790  GTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQ--QLPL  3617
              ++ T HLSD      L+   L+ G    +++ L  +G +++LS K ++IS  Q  Q+  
Sbjct  665   ASIPTMHLSDFVATCKLLWHCLQEGDVLPRVMCLSDKGDHIILSRKSAVISAVQEEQIVR  724

Query  3616  DVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVCT  3437
               ++I P  ++ GYV NV+  GVFV F   +TG +P+   +D    DT + F +GQ+V  
Sbjct  725   SFSEIQPGMLLTGYVRNVMPFGVFVEFPFGVTGLAPKVSMSDKFVTDTKDHFVVGQTVTA  784

Query  3436  NILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDSADSGLNWVDGFGL  3257
              ++ ++ E  R+ ++LK S CSS D+  + +YF    +I  L       S        GL
Sbjct  785   KVMSIDEEKQRVLLNLKVSECSSGDSXLLNQYFKEMKEIRNLLRRRGEPSTTQ-----GL  839

Query  3256  GSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGG--------QLGGINVETGSTIQAAVID  3101
               +V G     KE  +VV   K +D     SG          LG  N+  G   +A V+ 
Sbjct  840   CELVPG-----KELQLVVQDVK-EDGSALFSGSWVPPATRYHLGDKNIVPGEKTKALVLH  893

Query  3100  VSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNAVVEIVKENYL  2921
             V  +   V +SL+ E +                 K+ A++ L  N   +A+V+ + E++ 
Sbjct  894   VDALTSKVYVSLREELL-----------------KQRAKQRLTENSQHSAIVQHIAEDFA  936

Query  2920  VLSVPACNY--ALGYAS-LND---FNTQNLPVKQFVNGQSVIATIMALPDSSTG------  2777
             V+S+       A+  AS  ND   F+++ L V     GQ++IAT+  +  +  G      
Sbjct  937   VVSLLETGQLAAIPIASHFNDTFRFDSEKLKV-----GQTIIATLKVVKVNDHGVLLAVQ  991

Query  2776  --GRLLLLLKAISEVAEsssskrgkknsSYDVGSLVQAEITDIKPLELRLKFGSGFHGRV  2603
                +  + ++  +E   +          S  +G  V   +  +KP  + +       G +
Sbjct  992   DPAKKKVFVRVRNESETALEEMLPAVKHSLSLGDTVTGTVKSVKPTHVTVAIDDKLTGSI  1051

Query  2602  HITEATDDNTTEGPLNDF-----RIGQTLTARIVSKDSRSENKRGYQ-----------WE  2471
             H +   D    E P+  F     + GQ +TAR++    R  N   Y             E
Sbjct  1052  HASRILD----EVPIGSFPTYTLKAGQKVTARVIG--GRDVNTHRYLPITHPHFTRSIPE  1105

Query  2470  LSTKPSVLAGDM--------DGPHESFN-YSTGQLLSGYV--FKVDSEWAWLTISREVRA  2324
             LS +PS + G +        D   +    Y+ GQ ++ +V  + +   W  + ++ ++R 
Sbjct  1106  LSIRPSEIEGKVTAMLNLKEDSALKKLGVYNVGQTVTCFVKKYNILKNWLEVEVAPDIRG  1165

Query  2323  QLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKLLRLVPHTLLITPEDTVPSSE  2144
             ++  L  S     LK  +K F  G++VS  +   +        V  T L      + S E
Sbjct  1166  RVPHLLLSLNTKVLKHPEKSFKNGQAVSATVTGTD--------VTETNLCLSLTGIQSLE  1217

Query  2143  SARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPWVSDPLSGYCEGQF  1964
                    +G++  G ++K+ P V GL + +     GKV+   L D +  +PL  +  G+ 
Sbjct  1218  -------QGTITVGMVTKVTPHV-GLTIALPGGKTGKVNIFHLNDTYTENPLGDFKVGKI  1269

Query  1963  VKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISEHDDVHSQNRRVQDIKDLHPDMTVQ  1784
             V+C +L           + LSLR +   +N ++ S+ +DV      +  IKD+     V+
Sbjct  1270  VRCCILS-----NENGKIQLSLRQS--RLNPKSNSKVEDVE-----ITCIKDVKKGQLVR  1317

Query  1783  GYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESP---EKEFPVGKLVTGKVVSVESLS  1613
             GYVK+++P G F  LS  +  +IL  N++  F++     EK  P GKL+T KV+ V    
Sbjct  1318  GYVKSISPSGVFFGLSTSLLGRILFQNVSPYFVQKHSLYEKYLPEGKLLTAKVLGVNGKE  1377

Query  1612  KRVEVTLRTSSSATP  1568
             K +E++L    +  P
Sbjct  1378  KHIELSLLPEDTGMP  1392


 Score =   267 bits (682),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 127/265 (48%), Positives = 180/265 (68%), Gaps = 3/265 (1%)
 Frame = -2

Query  922   PRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVW  743
             P++ D+F++LV SSPNSS +W++YMAF L   ++EKAR++AE+A+ TI  REE EKLNVW
Sbjct  1560  PQSADDFDRLVLSSPNSSILWLQYMAFHLQATEIEKARAVAERALKTICFREEQEKLNVW  1619

Query  742   VAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVK  563
             VA  NLE  YG   +E +MKVF+RA+QY +P KV   L  +Y  +E YK  +EL   M+K
Sbjct  1620  VALLNLENMYGT--EETLMKVFERAVQYNEPLKVFQHLCDIYANSEKYKQAEELYHTMLK  1677

Query  562   KFKHSCKIWLRRIQWALKQNQ-DNSQSIVNRALLCLPKHKHIKFITQTAILEFKCGVADR  386
             +F+    +WL+   + LKQ Q + +  ++ RAL  LP  +H+  I++ A LEF+ G  + 
Sbjct  1678  RFRQEKSVWLKYASFLLKQGQTEATHRLLERALKALPTKEHVDVISRFAQLEFRFGDPEH  1737

Query  385   GRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYL  206
              +++FE  L  YPKRTD+WS+Y+D  I+ G    +R +FER I LS+ PKKMKF FK+YL
Sbjct  1738  AKALFESTLSSYPKRTDIWSIYMDIMIKHGSQKEVRDIFERVIHLSLAPKKMKFFFKRYL  1797

Query  205   AYEKSVGDEERIESVKRKAMEYVES  131
              YEK  G  E + +VKR A+EYVE+
Sbjct  1798  DYEKKFGTAESVLAVKRAALEYVET  1822



>ref|XP_003787398.1| PREDICTED: protein RRP5 homolog [Otolemur garnettii]
Length=1870

 Score =   439 bits (1128),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 393/1415 (28%), Positives = 657/1415 (46%), Gaps = 195/1415 (14%)
 Frame = -2

Query  5494  KNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLASEAHDPLWDNETNEMEMQSNYLSGL  5315
             +++  GM++ G + EVNE ++V+SLP GLRG V  +E  D  +  + NE   Q   L  L
Sbjct  87    ESLCEGMRILGCVKEVNELELVISLPNGLRGFVQVTEICDA-YTKKLNEQVTQEEPLKDL  145

Query  5314  FHV------GQLVSCIVLHLDDDKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSAYI  5153
              H+      G LV C+V  +D    E GK  + LSL    +++ L+ ++++ G++L+  +
Sbjct  146   LHLPELFSPGMLVRCVVSSVDTT--ERGKKSVKLSLNPKNVNRVLSAESLKPGMLLTGTV  203

Query  5152  KSTEDHGYILHFGLPSFSGFLPI--------HSQSVDKMNTGQLVEGVVKSVDRTRKVVY  4997
              S EDHGY++  G+     FLP+              K+  GQ +  V++ V  +  VV 
Sbjct  204   SSLEDHGYLVDIGVDGTRAFLPLPKAQEYIRQKNKGAKLKVGQYLNCVIEEVKASGGVVS  263

Query  4996  LSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIFHLQ  4817
             L+     ++  +T + +  +++ L+PG++V A V  V  +G+ L+FLT+FTG VD  HL 
Sbjct  264   LAIGHAEVSTAITTEEQNWTLNNLLPGLVVKAQVQKVTPHGLTLNFLTFFTGLVDFMHLD  323

Query  4816  QVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPP---SLVKVGDIFE  4646
                  P     Y  N+ V A IL + P TR V LSL P L+    P    S   +G + +
Sbjct  324   -----PKKAGTYFSNQAVRACILCVHPRTRVVRLSLRPILLQPGRPLIRLSCQHLGAVLD  378

Query  4645  QAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKVVRVRVLGFRN  4466
                V       G    +      T AY  +S + D E       FKPG   + R++ +  
Sbjct  379   DVSVQGFFNKAGATFRLKDG---TLAYARLSHLSDSENSFNPDAFKPGNTHKCRIIDYSQ  435

Query  4465  LEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGVKALCPLRHMS  4286
             ++ LA  SL+T+  E     + D+KP  VVK  V+T+  +G +V+    ++ L P  H++
Sbjct  436   MDELALLSLRTAIIEAQYLRYHDIKPAAVVKGTVLTIKPYGMLVKVGEQIRGLVPAMHLA  495

Query  4285  EFEIVKPRKKFQVGSELVFRVLGC--KSKRITVTHKKTLVKSKLDILSSYTDATEGLITH  4112
             +  I  P KK+ VG E+  RVL C  ++K++ +T KKTLV+SKL  ++ Y+D   GL TH
Sbjct  496   DIPIKNPEKKYHVGDEVKCRVLLCDPEAKKLMMTLKKTLVESKLRAIACYSDVKPGLQTH  555

Query  4111  GWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSSSPASRQI  3932
             G+I +++ +GC V+FYN VQG  P+ EL  +   D   +++  QVVK  V++  P+  ++
Sbjct  556   GFIIRVKDYGCIVKFYNDVQGLVPKHELSAEYIPDPERVFYTGQVVKAVVLNCEPSKERM  615

Query  3931  VLSFTTRPMRLSETEMVKPGT-------VVSGIVELV-------TPDSIVVNVNNGQSHL  3794
             +LSF      LS+ E+ K  T        V  I +LV       T D + V V    S++
Sbjct  616   LLSFKL----LSDPELQKEPTGHSRKKGRVINIGQLVDVRISEKTKDGLEVTVL--PSNI  669

Query  3793  KGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQ--QLP  3620
                + T HLSDH   + L+   L+PG    ++L L     +++L  K +L+ST +  Q P
Sbjct  670   PAFLPTPHLSDHVANSPLLYHWLQPGDTLHRVLCLSRSEGHVLLCRKPALVSTVEGGQDP  729

Query  3619  LDVNQISPHSVVHGYVCNVIGNGVFVRFLGRLTGFSPRSKATDDRRYDTSEVFYIGQSVC  3440
              + ++I P  ++ G+V ++   GVFV+F   L+G +P++  +D     TS+ F  GQ+V 
Sbjct  730   KNFSEIHPGMLLIGFVKSIKDYGVFVQFPSGLSGLAPKAIMSDKFVTSTSDHFVEGQTVV  789

Query  3439  TNILDVNGETGRITVSLKQSLCSSTDATFIQEYFLLEHKIAKLQSLDS----ADSGL-NW  3275
               + +V+ E  R+ +SL+ S C   DA       LL   + +LQ + S     DS L   
Sbjct  790   AKVTNVDEEKQRMLLSLRLSDCMLGDAA-TTSLLLLNQCLEELQGVRSLMRNRDSILIQT  848

Query  3274  VDGFGLGSIVEGKVHEIKEFGVVVTFEKYDDVFGFISGGQLGGI------------NVET  3131
             +     G I+E  V E+ E G VV            SGG + G+             VE+
Sbjct  849   LAEMTPGMILELVVQEVLEDGSVV-----------FSGGPVPGLVLRASKYHRAGQEVES  897

Query  3130  GSTIQAAVIDVSKIEHLVDLSLKPEFVNGSKPQTANDKTQKKKRKREAQKDLEVNQSVNA  2951
             G   +  V++V  ++  V +SL  + VN    +       +                  A
Sbjct  898   GQKKKVVVLNVDMLKLEVYVSLHQDLVNKKAKKLKKGSEHQ------------------A  939

Query  2950  VVEIVKENYLVLSVPACNYALGY---ASLND---FNTQNLPVKQFVNGQSVIATIMALPD  2789
             +V+ ++E++ V S+    +   +   + LND   F+++ L V     GQ V  T+     
Sbjct  940   IVQHLEESFAVASLVDTGHLAAFSLTSHLNDTFRFDSEKLQV-----GQGVSLTLKTTEP  994

Query  2788  SSTGGRLLLLLKAISEVAEsssskrgkknsSYD--------------------VGSLVQA  2669
               TG    LLL      A+ +  +  K + + D                    +G +V  
Sbjct  995   GVTG----LLLAVEGPAAKRTMRRTQKDSETVDEDEEVDPALAIATIKKHALSIGDMVTG  1050

Query  2668  EITDIKPLELRLKFGSGFHGRVHITEATDDNTTEG--PLNDFRIGQTLTARIV-SKDSRS  2498
              +  IKP  + +    G  G +H +   DD   EG  P    ++G+T+TAR++  +D ++
Sbjct  1051  TVKSIKPTHVVVTLEDGIIGCIHASHILDD-VPEGTCPTAKLQVGKTVTARVIGGRDVKT  1109

Query  2497  ------ENKRGYQW--ELSTKPSVLAGDMDGPHESFN------------YSTGQLLSGYV  2378
                    + R  +   ELS +PS L    DG H + N            Y  GQ ++ ++
Sbjct  1110  FKFLPVSHPRFVRTIPELSVRPSELE---DG-HTALNSHSVSPMEKIKQYQAGQTVTCFL  1165

Query  2377  --FKVDSEWAWLTISREVRAQLYILDSSAEPSELKEFQKRFYVGKSVSGYILSANKEKKL  2204
               + V  +W  + I+ +VR ++ +L +S     LK   K+F +G+++S  ++  +  K  
Sbjct  1166  KKYNVVKKWLEVEIAPDVRGRIPLLLTSLSFKVLKHPDKKFRIGQALSATVVGPDSSKAF  1225

Query  2203  LRLVPHTLLITPEDTVPSSESARCHIREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHF  2024
             + L     LI P             + +G V  GR++K+ P   GL+V       G+V  
Sbjct  1226  VCLS----LIGPHK-----------LEKGEVAMGRVAKVTPN-EGLMVSFPFGKMGRVSV  1269

Query  2023  TELRDPWVSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISEHDDV  1844
               + D +   PL  +   + V+C VL     V     + LSLR +      ++  E  ++
Sbjct  1270  FHVSDSYSEMPLEDFIPQKVVRCYVLSTEDEV-----LTLSLRSSKTNPETKSRVEDPEI  1324

Query  1843  HSQNRRVQDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESP---E  1673
             +S       I D+     ++GYVK++ P+G    L   V      S ++   +       
Sbjct  1325  NS-------IHDVKKGQLLRGYVKSIEPQGVLFGLGPSVVGLAQYSKVSQYSLFKKALYN  1377

Query  1672  KEFPVGKLVTGKVVSVESLSKRVEVTLRTSSSATP  1568
             K  P G+L+T K++SV      VE++   S +  P
Sbjct  1378  KYLPEGRLLTAKILSVNHQKNLVELSFLPSDTGKP  1412


 Score =   274 bits (700),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 128/265 (48%), Positives = 189/265 (71%), Gaps = 3/265 (1%)
 Frame = -2

Query  922   PRNTDEFEKLVRSSPNSSFVWIKYMAFMLSLGDVEKARSIAEKAVSTINIREESEKLNVW  743
             P + D+F++LV SSPNSS +W++YMAF L   ++EKAR++AE+A+ TI+ REE EKLNVW
Sbjct  1601  PESADDFDRLVLSSPNSSILWLQYMAFHLQATEIEKARAVAERALKTISFREEQEKLNVW  1660

Query  742   VAYFNLEIEYGNPPQEAVMKVFQRALQYCDPKKVHLALLGVYERTEHYKLGDELLEKMVK  563
             VA  NLE  YG+  QE++ KVF+RA+QY +P KV+L L  +Y ++E ++   EL  +M+K
Sbjct  1661  VALLNLENMYGS--QESLTKVFERAVQYNEPLKVYLHLADIYAKSEKFQEAGELYNRMLK  1718

Query  562   KFKHSCKIWLRRIQWALKQNQDN-SQSIVNRALLCLPKHKHIKFITQTAILEFKCGVADR  386
             +F+    +W++   + L+++Q   S  ++ RAL CLP+ +HI  I + A LEF+ G A+R
Sbjct  1719  RFRQEKAVWIKYGAFLLRRSQAGASHRVLQRALECLPRKEHIDVIAKFAQLEFQLGDAER  1778

Query  385   GRSMFERMLKEYPKRTDLWSVYLDQEIRVGDMDVIRALFERAISLSIPPKKMKFLFKKYL  206
              +++FE ML  YPKRTD+WSVY+D  I+      +R +FER I LS+ PK+MKF FK+YL
Sbjct  1779  AKAIFENMLSIYPKRTDVWSVYIDMTIKHCSQKEVRDIFERVIHLSLAPKRMKFFFKRYL  1838

Query  205   AYEKSVGDEERIESVKRKAMEYVES  131
              YEK  G E+ +++VK KA+EYVE+
Sbjct  1839  DYEKQHGTEKDVQAVKAKALEYVEA  1863


 Score = 59.7 bits (143),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 60/263 (23%), Positives = 110/263 (42%), Gaps = 24/263 (9%)
 Frame = -2

Query  2179  LITPEDTVPSSESARCH-IREGSVLGGRISKILPGVGGLLVQIDAHLFGKVHFTELRDPW  2003
             L++    +  ++  R H I+  +V+ G +  I P   G+LV++   + G V    L D  
Sbjct  441   LLSLRTAIIEAQYLRYHDIKPAAVVKGTVLTIKPY--GMLVKVGEQIRGLVPAMHLADIP  498

Query  2002  VSDPLSGYCEGQFVKCKVLQVGHSVKGTTHVDLSLRWTLDTMNNQNISEHDDVHSQNRRV  1823
             + +P   Y  G  VKC+VL      K    + ++L+ TL             V S+ R +
Sbjct  499   IKNPEKKYHVGDEVKCRVLLCDPEAK---KLMMTLKKTL-------------VESKLRAI  542

Query  1822  QDIKDLHPDMTVQGYVKNVTPKGCFIMLSRKVDAKILLSNLADGFIESPEKEFPVGKLVT  1643
                 D+ P +   G++  V   GC +     V   +    L+  +I  PE+ F  G++V 
Sbjct  543   ACYSDVKPGLQTHGFIIRVKDYGCIVKFYNDVQGLVPKHELSAEYIPDPERVFYTGQVVK  602

Query  1642  GKVVSVESLSKRVEVTLRTSSSATPRKSDIDALNN----FSAGNIISGKIKRIESFGLFI  1475
               V++ E   +R+ ++ +  S    +K             + G ++  +I      GL +
Sbjct  603   AVVLNCEPSKERMLLSFKLLSDPELQKEPTGHSRKKGRVINIGQLVDVRISEKTKDGLEV  662

Query  1474  SVDNTNLVGLCHVSELSDDHIDN  1406
             +V  +N+        LS DH+ N
Sbjct  663   TVLPSNIPAFLPTPHLS-DHVAN  684



>ref|XP_421739.4| PREDICTED: protein RRP5 homolog isoform X6 [Gallus gallus]
 ref|XP_004942318.1| PREDICTED: protein RRP5 homolog isoform X7 [Gallus gallus]
Length=1837

 Score =   437 bits (1124),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 386/1403 (28%), Positives = 646/1403 (46%), Gaps = 170/1403 (12%)
 Frame = -2

Query  5503  ITPKNISPGMKLWGVIAEVNEKDIVVSLPGGLRGLVLA---SEAHDPLWDNETNEMEMQS  5333
             +T K +  GM   G I EV   ++V+SLP GL G V     S+A+  L   +  + E+  
Sbjct  77    LTIKELCEGMLFLGCIKEVTVFELVISLPNGLTGFVPVTHISDAYSELLSKQVTQGELLE  136

Query  5332  --NYLSGLFHVGQLVSCIVLHLDDDKKEAGKWKIWLSLRLALLHKNLTLDAIQEGIILSA  5159
               N LS L+  G LV C+V  ++  K   G+  I LS+    ++K L+  A+  G++LS 
Sbjct  137   DLNSLSDLYSPGMLVRCVVTSVE--KSADGRRSIKLSINPKSVNKGLSASALTSGMLLSG  194

Query  5158  YIKSTEDHGYILHFGLPSFSGFLPIHSQSVD---------KMNTGQLVEGVVKSVDRTRK  5006
             ++ S EDHGY++  G+     FLP H ++ +          +  GQ +  V++ V    +
Sbjct  195   FVSSVEDHGYLIDIGVSGTHAFLP-HQKAQNYIKAVKRGSDLKIGQSLNCVIEEVKNEGR  253

Query  5005  VVYLSSAPDAIAKYVTKDLKGISIDLLVPGMMVNASVMSVLENGVMLSFLTYFTGTVDIF  4826
             VV LS+    +A  +  + +  ++  L+PG++V A V  V   GV L+FL+ FTG VD  
Sbjct  254   VVRLSADRSEVAASIATEQQNWTLSNLLPGLVVKAQVQKVAPLGVSLTFLSSFTGIVDFM  313

Query  4825  HLQQVFPPPSWKDDYPQNKKVNARILFIDPATRAVGLSLNPHLVHKKAPPSLV---KVGD  4655
             H+      P    +Y  N+ V A IL   P ++ V L+L    +H    P+ +   ++G 
Sbjct  314   HVD-----PEKSTNYSPNQMVKACILSTHPTSKVVRLTLRQAFLHPGGSPNQLSNDRIGA  368

Query  4654  IFEQAKVIRVDKGLGLLLEIPSSPVPTPAYVYISdvddkevkkmeKTFKPGKVVRVRVLG  4475
             + E++ V    K  G + ++    +   A+     +           FK G   + R++ 
Sbjct  369   VVEESTVKAFYKQFGAVFQLDDGML---AFARPKHLSKTRKSFKPAAFKAGCKHKCRIID  425

Query  4474  FRNLEGLATGSLKTSAFEGSVFTHSDVKPGMVVKAKVITVDSFGAIVQFSSGVKALCPLR  4295
             +  ++ +   SLK    E     + D+  G V++ KV+++   G  V+ + G+K L P  
Sbjct  426   YSLMDEMCIVSLKHQIIEARFLRYEDIHTGDVMQGKVLSLKPIGMQVKVTDGIKGLVPSM  485

Query  4294  HMSEFEIVKPRKKFQVGSELVFRVLGCK--SKRITVTHKKTLVKSKLDILSSYTDATEGL  4121
             H+++  + +P KK+ VG E+  RVL C    K++ +T KKTLV+SKL +LSSY DA  GL
Sbjct  486   HLADVILKQPEKKYNVGDEVRCRVLECNPAEKKLFLTLKKTLVQSKLPVLSSYEDAEPGL  545

Query  4120  ITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGSDISSMYHVEQVVKCRVVSSSPAS  3941
             ITHG++    + GC V+FYN V+G  P++EL  +P S    ++H  QVVK  V+   P  
Sbjct  546   ITHGFVVCAREFGCIVKFYNDVKGLVPKNELSSEPISCPDKVFHDGQVVKVMVLKCEPQQ  605

Query  3940  RQIVLSF----TTRPMRLSETEMVKPGTVVSGIVELVTPDSIVVNVNNGQ-------SHL  3794
              +++LSF     T P   SE    K   V   I E+V  + +  N N  +        ++
Sbjct  606   ERLLLSFRLSSRTVPEGRSECIPKKKQQVKYQIGEMVDVEVLKKNENGLEVSILEDGGNV  665

Query  3793  KGTVSTQHLSDHRGLADLMKSVLKPGYEFDQLLVLDIEGFNLVLSAKYSLISTAQ--QLP  3620
                + T HLSD    + L+   L+ G    +++ L  +G  ++L  K ++IS  Q  Q+ 
Sbjct  666   IAWLPTVHLSDFVANSKLLWHCLQEGDVLPRVMCLSDKGDRIILCRKSAVISAVQEEQVV  725

Query  3619  LDVNQISPHSVVH