BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13193_g1_i1 len=1106 path=[1084:0-814 1899:815-1105]

Length=1106
                                                                      Score     E

gb|EYU46744.1|  hypothetical protein MIMGU_mgv1a013710mg              70.9    7e-11   
ref|XP_003632383.1|  PREDICTED: pectinesterase inhibitor              66.6    1e-09   
ref|XP_008363728.1|  PREDICTED: uncharacterized protein LOC103427453  64.7    6e-09   
ref|XP_008355510.1|  PREDICTED: uncharacterized protein LOC103419166  64.7    8e-09   
ref|XP_009335756.1|  PREDICTED: putative invertase inhibitor          64.3    1e-08   
ref|XP_010088298.1|  Putative invertase inhibitor                     63.9    1e-08   
ref|XP_010026122.1|  PREDICTED: uncharacterized protein LOC104416421  63.9    2e-08   
ref|XP_009335752.1|  PREDICTED: putative invertase inhibitor          63.2    3e-08   
gb|EPS62398.1|  hypothetical protein M569_12395                       59.3    5e-07   
ref|XP_007200555.1|  hypothetical protein PRUPE_ppa011794mg           58.9    7e-07   
ref|XP_003633605.1|  PREDICTED: pectinesterase inhibitor-like         58.5    7e-07   
ref|XP_010259728.1|  PREDICTED: pectinesterase inhibitor-like         58.5    8e-07   
ref|XP_008386682.1|  PREDICTED: uncharacterized protein LOC103449171  57.8    2e-06   
ref|XP_008235119.1|  PREDICTED: pectinesterase inhibitor 2            55.8    7e-06   
ref|XP_008454497.1|  PREDICTED: uncharacterized protein LOC103494896  54.7    8e-06   
ref|XP_004292666.1|  PREDICTED: uncharacterized protein LOC101290930  55.1    1e-05   
ref|XP_003519758.1|  PREDICTED: pectinesterase inhibitor 1-like       53.9    3e-05   
gb|KHN08674.1|  Pectinesterase inhibitor                              53.5    3e-05   
ref|XP_004152360.1|  PREDICTED: cell wall / vacuolar inhibitor of...  53.1    3e-05   
gb|KGN52826.1|  hypothetical protein Csa_4G001930                     53.1    5e-05   
ref|XP_004156885.1|  PREDICTED: cell wall / vacuolar inhibitor of...  52.8    6e-05   
gb|EMS59210.1|  Putative invertase inhibitor                          52.8    6e-05   
gb|KDP28188.1|  hypothetical protein JCGZ_13959                       52.8    7e-05   
ref|XP_007012508.1|  Plant invertase/pectin methylesterase inhibi...  52.0    9e-05   
ref|XP_004507480.1|  PREDICTED: pectinesterase inhibitor 1-like       51.2    3e-04   
ref|XP_003606993.1|  hypothetical protein MTR_4g071020                50.4    3e-04   
ref|XP_007051213.1|  Plant invertase/pectin methylesterase inhibi...  50.4    4e-04   
gb|AFK49569.1|  unknown                                               50.1    5e-04   
ref|XP_010938360.1|  PREDICTED: putative invertase inhibitor          49.7    7e-04   
ref|XP_010054539.1|  PREDICTED: putative invertase inhibitor          49.3    9e-04   
ref|XP_009378758.1|  PREDICTED: uncharacterized protein LOC103967210  48.5    0.001   



>gb|EYU46744.1| hypothetical protein MIMGU_mgv1a013710mg [Erythranthe guttata]
Length=212

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 60/102 (59%), Gaps = 2/102 (2%)
 Frame = -1

Query  674  LAFFALKKIEKEAVNVSEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSV  495
            LAFFAL+ +E  AVN++  ++  L      L P  Q  LSDC + Y P  DLIE+A++++
Sbjct  85   LAFFALRFVEDHAVNITTDIKKFL--AVPDLAPLLQSALSDCMDQYNPLDDLIEDAINAI  142

Query  494  GNKAFPDAVKFLQDAILDLNACEESLKKITTDPTTKNPTKAD  369
              KA+ DA +F+  AI D+N C+  LK   ++   +N T  D
Sbjct  143  LAKAYSDAEQFIDAAITDINQCDAQLKAHNSEEKAENKTGED  184



>ref|XP_003632383.1| PREDICTED: pectinesterase inhibitor [Vitis vinifera]
Length=181

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 65/127 (51%), Gaps = 8/127 (6%)
 Frame = -1

Query  791  KLIATACDHSKGGEACVKWLNDKENDPEISLIEINDMRDLAFFALKKIEKEAVNVSEAVE  612
            +LI   C HS   + C+  L    N  +       DM  LA  ALK     A + S+ + 
Sbjct  33   ELIEKVCQHSPHSDICMASLRTDPNSGQA------DMEGLALIALKVAHANATDTSQHIA  86

Query  611  MKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAVKFLQDAILDLNA  432
              LNN +  L P  +Q L+DC E Y+ AV+ IE+++ ++  K F D   +++ AI D++ 
Sbjct  87   KLLNNST--LDPFIEQCLTDCSEQYLDAVEQIEDSLVALTAKGFHDVDAWVKAAIADVDT  144

Query  431  CEESLKK  411
            CE+  K+
Sbjct  145  CEQGFKE  151



>ref|XP_008363728.1| PREDICTED: uncharacterized protein LOC103427453 [Malus domestica]
Length=197

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 70/148 (47%), Gaps = 6/148 (4%)
 Frame = -1

Query  827  PNLKFPAKKVDPKLIATACDHSKGGEACVKWLNDKENDPEISLIEINDMRDLAFFALKKI  648
             N    A +V+ KL+  AC HS   + C++ L    N     LI       LA+ A++  
Sbjct  35   SNTAAAAGEVNMKLLEQACQHSPRKDLCIESLEKDSNSKGADLI------GLAYIAVRLA  88

Query  647  EKEAVNVSEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAV  468
               A +V E +   L + +  L P  QQGL+DC EHY  A D +++   ++    F D  
Sbjct  89   AAMAADVDEHMRSLLMHNATTLDPMIQQGLADCVEHYSDANDQLDDCTAAISASNFKDVE  148

Query  467  KFLQDAILDLNACEESLKKITTDPTTKN  384
             ++  AI D + C++SLK   +    KN
Sbjct  149  VWVNVAISDADFCDKSLKGQESVMVAKN  176



>ref|XP_008355510.1| PREDICTED: uncharacterized protein LOC103419166 [Malus domestica]
Length=197

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 70/148 (47%), Gaps = 6/148 (4%)
 Frame = -1

Query  827  PNLKFPAKKVDPKLIATACDHSKGGEACVKWLNDKENDPEISLIEINDMRDLAFFALKKI  648
             N    A +V+ KL+  AC HS   + C++ L    N     LI       LA+ A++  
Sbjct  35   SNTAAAAGEVNMKLLEQACQHSPRKDLCIESLEKDSNSKGADLI------GLAYIAVRLA  88

Query  647  EKEAVNVSEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAV  468
               A +V E +   L + +  L P  QQGL+DC EHY  A D +++   ++    F D  
Sbjct  89   AAMAADVDEHMRSLLMHNATTLDPMIQQGLADCVEHYSDANDQLDDCTAAISASNFKDVE  148

Query  467  KFLQDAILDLNACEESLKKITTDPTTKN  384
             ++  AI D + C++SLK   +    KN
Sbjct  149  VWVNVAISDADFCDKSLKGQESVMVAKN  176



>ref|XP_009335756.1| PREDICTED: putative invertase inhibitor [Pyrus x bretschneideri]
Length=197

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 69/148 (47%), Gaps = 6/148 (4%)
 Frame = -1

Query  827  PNLKFPAKKVDPKLIATACDHSKGGEACVKWLNDKENDPEISLIEINDMRDLAFFALKKI  648
             N    A +V+ KL+  AC HS   + C++ L    N     LI       LA+ A++  
Sbjct  35   SNTAAAAGEVNMKLLEQACQHSPRKDLCIESLEKDSNSKGADLI------GLAYIAVRLA  88

Query  647  EKEAVNVSEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAV  468
               A +V E +   L + S  L P  QQGL+DC EHY  A D +++   ++    F D  
Sbjct  89   AAMAADVDEHMRSLLMHNSTSLDPVIQQGLADCVEHYSDANDQLDDCTAAISASKFKDVE  148

Query  467  KFLQDAILDLNACEESLKKITTDPTTKN  384
             ++  AI D + C+ SLK   +    KN
Sbjct  149  VWVNVAISDADFCDNSLKGQESVMVEKN  176



>ref|XP_010088298.1| Putative invertase inhibitor [Morus notabilis]
 gb|EXB33523.1| Putative invertase inhibitor [Morus notabilis]
Length=182

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/168 (29%), Positives = 87/168 (52%), Gaps = 20/168 (12%)
 Frame = -1

Query  920  KMASRFLLLALIFCYLSLNNNVYSIQPQQIIPNLKFPAKKVDPKLIATACDHSKGGEACV  741
            K  + FLLL  I  Y+S     YS  PQQ + +      +     +  AC H+   ++C+
Sbjct  2    KFINTFLLL-FITLYIS-----YS--PQQAVAH----GHQSHANNLEKACQHAGHKDSCI  49

Query  740  KWLNDKENDPEISLIEINDMRDLAFFALKKIEKEAVNVSEAVEMKLNNGSEVLPPETQQG  561
              L   ++DP       +D++ L   AL+     A ++SE +++ LN+ S  L P  Q G
Sbjct  50   SML---QSDPNS---HSSDVKGLTLIALRLASSNASDISEHIKVLLNDSS--LDPAVQDG  101

Query  560  LSDCREHYVPAVDLIEEAVDSVGNKAFPDAVKFLQDAILDLNACEESL  417
            LS+C E+Y+ A + ++++V ++   A+ D   ++  AI+D  +C+ +L
Sbjct  102  LSECLEYYLDAAEQLDDSVAALLANAYKDVEAWVNVAIIDAASCDSAL  149



>ref|XP_010026122.1| PREDICTED: uncharacterized protein LOC104416421 [Eucalyptus grandis]
Length=203

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 60/104 (58%), Gaps = 4/104 (4%)
 Frame = -1

Query  713  PEISLIEINDMRDLAFFALKKIEKEAVNVSEAVEMKLNNGSEVLPPETQQGLSDCREHYV  534
            PE+      D+  LA  AL+     A + S  ++  L + +  L P+ QQGLSDC EHYV
Sbjct  76   PEVG--SATDIGVLAIAALRFATTNASDTSAHIQGLLKDIT--LAPDVQQGLSDCAEHYV  131

Query  533  PAVDLIEEAVDSVGNKAFPDAVKFLQDAILDLNACEESLKKITT  402
             AV+ +++++ ++  KA+ D   ++Q AI D +ACE   +++ T
Sbjct  132  DAVEQLDDSLAALTVKAYGDVHTWVQTAIADADACEAVFQQVAT  175



>ref|XP_009335752.1| PREDICTED: putative invertase inhibitor [Pyrus x bretschneideri]
Length=197

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 69/148 (47%), Gaps = 6/148 (4%)
 Frame = -1

Query  827  PNLKFPAKKVDPKLIATACDHSKGGEACVKWLNDKENDPEISLIEINDMRDLAFFALKKI  648
             N    A +V+ KL+  AC HS   + C++ L    N     LI       LA+ A++  
Sbjct  35   SNTAAAAGEVNMKLLEQACQHSPRKDLCIESLEKDSNSKGADLI------GLAYIAVRLA  88

Query  647  EKEAVNVSEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAV  468
               A +V E +   L + +  L P  QQGL+DC EHY  A D +++   ++    F D  
Sbjct  89   AAMAADVDEHMRSLLMHNATSLDPVIQQGLADCVEHYSDANDQLDDCTAAISASKFKDVE  148

Query  467  KFLQDAILDLNACEESLKKITTDPTTKN  384
             ++  AI D + C+ SLK   +    KN
Sbjct  149  VWVNVAISDADFCDNSLKGQESVMVEKN  176



>gb|EPS62398.1| hypothetical protein M569_12395 [Genlisea aurea]
Length=207

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 51/93 (55%), Gaps = 6/93 (6%)
 Frame = -1

Query  686  DMRDLAFFALKKIEKEAVNVSEAVEMKLNNGSEV--LPPETQQGLSDCREHYVPAVDLIE  513
            D   LAFFALK +E  A N++    M +     +  L P  Q  LS+C + Y P  DLIE
Sbjct  75   DANGLAFFALKYVEDHAANLT----MDIAKAGTIPNLDPMFQAALSECMDQYTPLGDLIE  130

Query  512  EAVDSVGNKAFPDAVKFLQDAILDLNACEESLK  414
            +A+++V   A+ DA  F+   I +++ C+  L+
Sbjct  131  DAINAVLANAYGDAKTFIDATISNIDVCDTKLR  163



>ref|XP_007200555.1| hypothetical protein PRUPE_ppa011794mg [Prunus persica]
 gb|EMJ01754.1| hypothetical protein PRUPE_ppa011794mg [Prunus persica]
Length=195

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/132 (30%), Positives = 65/132 (49%), Gaps = 6/132 (5%)
 Frame = -1

Query  809  AKKVDPKLIATACDHSKGGEACVKWLNDKENDPEISLIEINDMRDLAFFALKKIEKEAVN  630
            A  V+  LI  AC H+   + C+  L   +NDP     +  D+  LA+ A++     A  
Sbjct  37   AGVVNMNLIQQACQHAPHKDLCIDIL---KNDPNS---KGADLTGLAYIAIRLAGAYASE  90

Query  629  VSEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAVKFLQDA  450
            V   +   L N +  L P  QQG++DC EHY  A + +++ + ++  K F D   ++  A
Sbjct  91   VDAHLRSLLINNATTLSPVVQQGVADCIEHYSDANEQLDDCIAAMSTKNFKDVEVWVNVA  150

Query  449  ILDLNACEESLK  414
            I D + C++S  
Sbjct  151  ISDADYCDDSFS  162



>ref|XP_003633605.1| PREDICTED: pectinesterase inhibitor-like [Vitis vinifera]
Length=193

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 78/174 (45%), Gaps = 13/174 (7%)
 Frame = -1

Query  833  IIPNLKFPAKKVDPKLIATACDHSKGGEACVKWLNDKENDPEISLIEINDMRDLAFFALK  654
            IIPN K     +  +LIA  CDH+   + C+  L       +  L E+  +      ALK
Sbjct  31   IIPNQK---SSLGEELIAQVCDHAIYKDLCISSLQSVPESKDADLFELTTI------ALK  81

Query  653  KIEKEAVNVSEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPD  474
                 A  + + V+  LN         T Q L+DC E+Y  A+D IE+++ ++ +K + D
Sbjct  82   LAATNATEIKKYVQKLLNKSHS--DRYTHQCLADCSENYEDALDRIEDSLKALESKGYND  139

Query  473  AVKFLQDAILDLNACEESL--KKITTDPTTKNPTKADQYATMAINHRDVLESHV  318
               ++  A+ D  +CEE    +     P T   T  +Q  ++A+   + L   V
Sbjct  140  VNTWVTAAMADAESCEEGFLDRPGHKSPLTGRSTIFNQLCSIALTITNFLSGSV  193



>ref|XP_010259728.1| PREDICTED: pectinesterase inhibitor-like [Nelumbo nucifera]
Length=182

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/139 (24%), Positives = 73/139 (53%), Gaps = 9/139 (6%)
 Frame = -1

Query  824  NLKFPAKKVDPKLIATACDHSKGGEACVKWLNDKENDPEISLIEINDMRDLAFFALKKIE  645
            ++  P     P LI   C H+   + C++ +   E +P+ +    +D++ LA  ALK   
Sbjct  20   SVDHPGGGGIPDLIKETCQHAVYTDLCIQTM---ELEPDSAK---SDIKSLASIALKIAA  73

Query  644  KEAVNVSEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAVK  465
                 +S+ +   +   ++   P  QQ L+DC E+Y+ A+D +E+++ ++ ++ + D   
Sbjct  74   SNGTYISDYIRRLIQTTAD---PYLQQCLTDCSENYIDAIDQLEDSISALESRGYSDINH  130

Query  464  FLQDAILDLNACEESLKKI  408
            ++  A+ ++ +CEE  K++
Sbjct  131  WVTGAMNEIESCEEGFKEV  149



>ref|XP_008386682.1| PREDICTED: uncharacterized protein LOC103449171 [Malus domestica]
Length=197

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 68/136 (50%), Gaps = 6/136 (4%)
 Frame = -1

Query  824  NLKFPAKKVDPKLIATACDHSKGGEACVKWLNDKENDPEISLIEINDMRDLAFFALKKIE  645
            N    A +V+ KL+  AC  S   + C++ L   E DP     +  D+  LAF A++   
Sbjct  36   NTAAAAGEVNMKLLEQACQXSPRKDLCIETL---EKDPNS---KGADLTGLAFVAIRLAA  89

Query  644  KEAVNVSEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAVK  465
              A +V E +   L + +  L P  QQGL+DC EHY  A + +++ V+++      +   
Sbjct  90   AMASDVDEHMRSLLIHNATTLDPTIQQGLADCIEHYSDANEQLDDCVEAISTHNLEEVEL  149

Query  464  FLQDAILDLNACEESL  417
            ++  AI D + C+ SL
Sbjct  150  WVNVAISDADLCDSSL  165



>ref|XP_008235119.1| PREDICTED: pectinesterase inhibitor 2 [Prunus mume]
Length=195

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 64/131 (49%), Gaps = 6/131 (5%)
 Frame = -1

Query  809  AKKVDPKLIATACDHSKGGEACVKWLNDKENDPEISLIEINDMRDLAFFALKKIEKEAVN  630
            A  V+  LI  AC H+   + C+  L   +NDP     +  D+  LA+ +++     A  
Sbjct  37   AGVVNMNLIQQACQHAPHKDLCINAL---KNDPNS---KGADLIGLAYISIRLAGAYASE  90

Query  629  VSEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAVKFLQDA  450
            V   +   L N +  L P  QQG++DC EHY  A + +++ V ++  K + D   ++  A
Sbjct  91   VDAHLRSLLINNATTLSPVVQQGVADCIEHYSDANEQLDDCVAAMSTKNYKDVEVWVNVA  150

Query  449  ILDLNACEESL  417
            I D + C+ S 
Sbjct  151  ISDADYCDNSF  161



>ref|XP_008454497.1| PREDICTED: uncharacterized protein LOC103494896 [Cucumis melo]
Length=118

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 54/98 (55%), Gaps = 4/98 (4%)
 Frame = -1

Query  674  LAFFALKKIEKEAVNVSEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSV  495
            LA  AL+     A ++SE++++ LN  S+   P  QQGL DC + Y+ A   +++++ ++
Sbjct  3    LALVALRLASSNASDISESIKVMLNETSQN-EPAVQQGLFDCLDEYLDASQQLDDSIAAI  61

Query  494  GNKAFPDAVKFLQDAILDLNACEESLKKITTDPTTKNP  381
              KA+ D  K++  A+ D+  CE S     T P+   P
Sbjct  62   IAKAYGDVEKWVHAAVADVRTCENSFP---TKPSVLTP  96



>ref|XP_004292666.1| PREDICTED: uncharacterized protein LOC101290930 [Fragaria vesca 
subsp. vesca]
Length=198

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 74/163 (45%), Gaps = 6/163 (4%)
 Frame = -1

Query  905  FLLLALIFCYLSLNNNVYSIQPQQIIPNLKFPAKKVDPKLIATACDHSKGGEACVKWLND  726
            FL    +  +++L  N   +  Q   P    P+  V   L+  AC  +   + C+  L  
Sbjct  9    FLSTLCVLQHVALAANSKPVGGQPGKPARGQPSGPVSGNLLEEACKQATNKDLCINSLKK  68

Query  725  KENDPEISLIEINDMRDLAFFALKKIEKEAVNVSEAVEMKLNNGSEVLPPETQQGLSDCR  546
              N       +  D+  LAF AL+     A +V   +   +   +  L P+ QQG+ DC 
Sbjct  69   DPNS------QGADLTGLAFIALRLAAANAADVESHLRTLMLKNATGLDPDVQQGVQDCI  122

Query  545  EHYVPAVDLIEEAVDSVGNKAFPDAVKFLQDAILDLNACEESL  417
            + Y  A + ++++V ++ +K   D V +++ AI D N CE SL
Sbjct  123  DSYTDANEQLDDSVAALSDKKCKDVVVWVKVAIADSNYCESSL  165



>ref|XP_003519758.1| PREDICTED: pectinesterase inhibitor 1-like [Glycine max]
Length=180

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 87/170 (51%), Gaps = 19/170 (11%)
 Frame = -1

Query  806  KKVDPKLIATACDHSKGGEACVKWLNDKENDPEISLIEINDMRDLAFFALKKIEKEAVNV  627
            +K+  +LI + C +    E C++ L+   +DP+    +  D+++LA  +LK     A  +
Sbjct  26   EKIGKELIKSICKNRGNDELCMQVLS---SDPDS---DHADLQELALISLKAAASNASGI  79

Query  626  SEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAVKFLQDAI  447
                +  ++N  + L P+ QQGL+DC+E+ + A   I++AV S+ N    DA  +L+ A+
Sbjct  80   LNDCKRMIDN--QDLEPKIQQGLADCKENLLDAEGQIQDAVASILNNDKLDAQVWLKAAL  137

Query  446  LDLNACEESLKKITTDPTTKNPTKADQYATMAINHRDVLESHVVITQSIL  297
              ++ C++S+           P   D  +  +++ R +    V I +++L
Sbjct  138  AAIDTCDDSI-----------PGDDDVLSRKSVSFRQLCNIAVAINKAML  176



>gb|KHN08674.1| Pectinesterase inhibitor [Glycine soja]
Length=166

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 87/170 (51%), Gaps = 19/170 (11%)
 Frame = -1

Query  806  KKVDPKLIATACDHSKGGEACVKWLNDKENDPEISLIEINDMRDLAFFALKKIEKEAVNV  627
            +K+  +LI + C +    E C++ L+   +DP+    +  D+++LA  +LK     A  +
Sbjct  12   EKIGKELIKSICKNRGNDELCMQVLS---SDPDS---DHADLQELALISLKAAASNASGI  65

Query  626  SEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAVKFLQDAI  447
                +  ++N  + L P+ QQGL+DC+E+ + A   I++AV S+ N    DA  +L+ A+
Sbjct  66   LNDCKRMIDN--QDLEPKIQQGLADCKENLLDAEGQIQDAVASILNNDKLDAQVWLKAAL  123

Query  446  LDLNACEESLKKITTDPTTKNPTKADQYATMAINHRDVLESHVVITQSIL  297
              ++ C++S+           P   D  +  +++ R +    V I +++L
Sbjct  124  AAIDTCDDSI-----------PGDDDVLSRKSVSFRQLCNIAVAINKAML  162



>ref|XP_004152360.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2-like 
[Cucumis sativus]
Length=145

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 55/102 (54%), Gaps = 3/102 (3%)
 Frame = -1

Query  686  DMRDLAFFALKKIEKEAVNVSEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEA  507
            D   LA  AL+     A ++SE++++ LN  S+   P  QQ L DC + Y+ A   ++++
Sbjct  25   DKMGLALVALRLASSNASDISESIKVMLNETSQNNEPTVQQALFDCLDEYLEASQQLDDS  84

Query  506  VDSVGNKAFPDAVKFLQDAILDLNACEESLKKITTDPTTKNP  381
            + ++  KA+ D  ++++ A+ ++  CE S     T P+   P
Sbjct  85   IAAIIAKAYGDVQEWVRVAVTNVRTCESSFP---TKPSVLTP  123



>gb|KGN52826.1| hypothetical protein Csa_4G001930 [Cucumis sativus]
Length=181

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 55/102 (54%), Gaps = 3/102 (3%)
 Frame = -1

Query  686  DMRDLAFFALKKIEKEAVNVSEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEA  507
            D   LA  AL+     A ++SE++++ LN  S+   P  QQ L DC + Y+ A   ++++
Sbjct  61   DKMGLALVALRLASSNASDISESIKVMLNETSQNNEPTVQQALFDCLDEYLEASQQLDDS  120

Query  506  VDSVGNKAFPDAVKFLQDAILDLNACEESLKKITTDPTTKNP  381
            + ++  KA+ D  ++++ A+ ++  CE S     T P+   P
Sbjct  121  IAAIIAKAYGDVQEWVRVAVTNVRTCESSFP---TKPSVLTP  159



>ref|XP_004156885.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2-like 
[Cucumis sativus]
Length=167

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 55/102 (54%), Gaps = 3/102 (3%)
 Frame = -1

Query  686  DMRDLAFFALKKIEKEAVNVSEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEA  507
            D   LA  AL+     A ++SE++++ LN  S+   P  QQ L DC + Y+ A   ++++
Sbjct  47   DKMGLALVALRLASSNASDISESIKVMLNETSQNNEPTVQQALFDCLDEYLEASQQLDDS  106

Query  506  VDSVGNKAFPDAVKFLQDAILDLNACEESLKKITTDPTTKNP  381
            + ++  KA+ D  ++++ A+ ++  CE S     T P+   P
Sbjct  107  IAAIIAKAYGDVQEWVRVAVTNVRTCESSFP---TKPSVLTP  145



>gb|EMS59210.1| Putative invertase inhibitor [Triticum urartu]
Length=174

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 48/93 (52%), Gaps = 3/93 (3%)
 Frame = -1

Query  686  DMRDLAFFALKKIEKEAVNVSEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEA  507
            D R L   A K  + EA N  E ++  + +G++    + +  LS+CR HY  A++ +E A
Sbjct  58   DKRGLVVIATKITQAEAANTRERIDALMASGTD---KKVKGCLSECRVHYTIALNWLEAA  114

Query  506  VDSVGNKAFPDAVKFLQDAILDLNACEESLKKI  408
               + +    DA   L+  IL ++ CEE  +K+
Sbjct  115  AKGIESGNLQDAEVTLRGVILGIDTCEEGFRKL  147



>gb|KDP28188.1| hypothetical protein JCGZ_13959 [Jatropha curcas]
Length=182

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 59/135 (44%), Gaps = 8/135 (6%)
 Frame = -1

Query  815  FPAKKVDPKLIATACDHSKGGEACVKWLNDKENDPEISLIEINDMRDLAFFALKKIEKEA  636
            FP +     L+   C+HS     C++  N        SL        L   A+K   + A
Sbjct  23   FPHQIAGSGLVEQVCEHSHNKTKCIESFNSNPTSEGASL------EQLGVLAIKLAVQNA  76

Query  635  VNVSEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAVKFLQ  456
               S  ++  L  G++ L P  QQ +S C E Y  A   +E+++D++          ++ 
Sbjct  77   TYTSLYMQQFL--GNQTLDPAVQQAVSHCAEQYSNASQELEDSIDALSTDDRHTVFTWVS  134

Query  455  DAILDLNACEESLKK  411
             AI ++ +CE+ LK+
Sbjct  135  AAITNIESCEDKLKE  149



>ref|XP_007012508.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
 gb|EOY30127.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
Length=169

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 71/144 (49%), Gaps = 13/144 (9%)
 Frame = -1

Query  788  LIATACDHSKGGEACVKWLNDKENDPEISLIEINDMRDLAFFALK-KIEKEAVNVSEAVE  612
            L++ AC H++  E CV  L   ++DP+    E +D+R LA  AL   I      +S    
Sbjct  21   LVSNACSHTQFYEVCVSTL---KSDPQS---EKSDIRGLADIALNVSIAYGMETLSHINS  74

Query  611  MKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAVKFLQDAILDLNA  432
            +K + G+    P   + LSDC E Y  AVD ++E+  ++  K++      +  A+ D + 
Sbjct  75   LKFSPGNYT--PFASRCLSDCMEEYSDAVDNLQESAQALRTKSYTTVNTLVAAAMTDSDT  132

Query  431  CEESLKKITTDPTTKNP-TKADQY  363
            CE    ++   P  + P T+ +QY
Sbjct  133  CEGGFGEM---PGNEPPLTQRNQY  153



>ref|XP_004507480.1| PREDICTED: pectinesterase inhibitor 1-like [Cicer arietinum]
Length=197

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 80/173 (46%), Gaps = 14/173 (8%)
 Frame = -1

Query  923  EKMASRFLLLALIFCYLSLNNNVYSIQPQQ----IIPNLKFPAKKVDPKLIATACDHSKG  756
            E + +++L L  I  Y+ L N+  +I  +     + P   F  K     LI   CD +  
Sbjct  2    EVVTTKYLYLLAI--YIILLNHQIAIATENKDNVLFPENLFSHKGKTSDLIKKVCDQTPN  59

Query  755  GEACVKWLNDKENDPEISLIEINDMRDLAFFALKKIEKEAVNVSEAVEMKLNNGSEVLPP  576
             + C++ L  +      +L      +DLA  +LK     A  +   V+M +++    L P
Sbjct  60   KDLCLEVLLSEPTSEHATL------QDLAMISLKVAASNATGILTDVKMMIDDPD--LDP  111

Query  575  ETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAVKFLQDAILDLNACEESL  417
              QQGL+DC+E  + A   +E+ V ++   +  D   +LQ A+  ++ C+ S+
Sbjct  112  GIQQGLADCKETLLDAEGQLEDTVAAILGNSKRDVQLWLQAALAAIDTCDASI  164



>ref|XP_003606993.1| hypothetical protein MTR_4g071020 [Medicago truncatula]
 gb|AES89190.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=178

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 65/127 (51%), Gaps = 8/127 (6%)
 Frame = -1

Query  797  DPKLIATACDHSKGGEACVKWLNDKENDPEISLIEINDMRDLAFFALKKIEKEAVNVSEA  618
            D  LI+  C +    E CV  L+  +   + +L      +DLA  +L+     A  +   
Sbjct  26   DNPLISKVCANLPNKEQCVSILSSDKLSQQATL------KDLAMISLRVAASNATGILSD  79

Query  617  VEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAVKFLQDAILDL  438
            V+M +++ +  L P  QQGL+DC+E  + A   +E+ V ++ + A  DA  +LQ A+  +
Sbjct  80   VKMMIDDPN--LDPGIQQGLADCKETLLDAESQLEDTVAALLSNAKHDAQLWLQAALAAI  137

Query  437  NACEESL  417
            + C+ S+
Sbjct  138  DTCDASI  144



>ref|XP_007051213.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
 gb|EOX95370.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
Length=177

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/163 (24%), Positives = 68/163 (42%), Gaps = 11/163 (7%)
 Frame = -1

Query  857  VYSIQPQQIIPNLKFPAKKVDPKLIATACDHSKGGEACVKWLNDKENDPEISLIEINDMR  678
            ++S+    +   L F     D  LI + C  S+  + C   +N+    P        D+R
Sbjct  7    LFSVAIFCLASFLFFNCCDADKALIDSICKESQDYDFCTSTINNHAGSPTA------DLR  60

Query  677  DLAFFALKKIEKEAVNVSEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDS  498
             LA  A  +   +  +  + +   L    +V  P  +Q L DC+  Y  ++   + A  S
Sbjct  61   GLALIAASQTVSQIQDTLDRIPTILK---QVQDPLGKQRLGDCQTDYNTSLGKFQSAFGS  117

Query  497  VGNKAFPDAVKFLQDAILDLNACEESLKKITTDPTTKNPTKAD  369
              NKA+ DA+ F++D    +  C  S ++    PT  +P   D
Sbjct  118  TSNKAYWDALSFVRDGTNIVIDCHNSYRR--DGPTATSPIAED  158



>gb|AFK49569.1| unknown [Medicago truncatula]
Length=186

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 71/125 (57%), Gaps = 8/125 (6%)
 Frame = -1

Query  788  LIATACDHS-KGGEACVKWLNDKENDPEISLIEINDMRDLAFFALKKIEKEAVNVSEAVE  612
            LI   C  + K  + CV+ L+   +DP+ +    +D+ DLA  AL+ + + A  +   V+
Sbjct  29   LITRVCQLAQKNSDLCVEVLS---SDPKSA--NADDINDLAIIALRVVARNASAMLNDVK  83

Query  611  MKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAVKFLQDAILDLNA  432
              +++ +  L PE QQGL+DC+E+ + A   +E+ + ++  ++  D+ K+L+ A+  +  
Sbjct  84   SMIDDAN--LDPEVQQGLADCKENILDAESQLEDTIAALLVESDVDSQKWLKAALAAITT  141

Query  431  CEESL  417
            C+ S+
Sbjct  142  CDNSI  146



>ref|XP_010938360.1| PREDICTED: putative invertase inhibitor [Elaeis guineensis]
Length=183

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 78/159 (49%), Gaps = 10/159 (6%)
 Frame = -1

Query  794  PKLIATACDHSKGG-EACVKWLNDKENDPEISLIEINDMRDLAFFALKKIEKEAVNVSEA  618
            P+LI   C H+K   + CV  L+   +DP+ +    +D+R L   ALK   +     ++ 
Sbjct  30   PELIRETCMHTKSHHDLCVAVLS---SDPKSN---TSDVRGLLEIALKLTTENLTKTADF  83

Query  617  VEMKLNNG-SEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAVKFLQDAILD  441
            V   L+    +   P  QQ L+ C + Y+ AVD +  A  ++ +K + D  K++  AI D
Sbjct  84   VADFLDEADKKSTEPGLQQCLAYCEDEYIDAVDQLTNAAAALESKVYKDVEKWVAVAITD  143

Query  440  LNACEESLKKITTDPT--TKNPTKADQYATMAINHRDVL  330
            + AC++  + I  D    TK  +  D+  ++ ++   +L
Sbjct  144  VKACQQECRDIPGDKRGLTKKNSDIDRLCSITLSINKIL  182



>ref|XP_010054539.1| PREDICTED: putative invertase inhibitor [Eucalyptus grandis]
 gb|KCW76826.1| hypothetical protein EUGRSUZ_D01181 [Eucalyptus grandis]
Length=182

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 57/137 (42%), Gaps = 13/137 (9%)
 Frame = -1

Query  746  CVKWLNDKENDPEISLIEINDMRDLAFFALKKIEKEAVNVSEAVEMKLNNGSEVLPPETQ  567
            CVK L    +DP+       D++ L   AL  +E    +    ++  L    +   P   
Sbjct  48   CVKALG---SDPKS---RTADVQGLGLIALNLLESSVTSTGSDIQQLLKQKQD---PYVH  98

Query  566  QGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAVKFLQDAILDLNACEESL--KKITTDPT  393
            Q LSDC + Y  A++  +EAV +   K FPD    +     D   CE     KK  T P 
Sbjct  99   QCLSDCSDLYSDALETTKEAVGAYQEKRFPDVQNSMSTVSTDATTCESQFKEKKGVTSPL  158

Query  392  TKNPTKADQ--YATMAI  348
            TK    A Q  Y  +AI
Sbjct  159  TKQNGDATQLSYIELAI  175



>ref|XP_009378758.1| PREDICTED: uncharacterized protein LOC103967210 [Pyrus x bretschneideri]
Length=107

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 40/75 (53%), Gaps = 0/75 (0%)
 Frame = -1

Query  638  AVNVSEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAVKFL  459
            A +V E +   L + S  L P  QQGL+DC EHY  A D +++   ++    F D   ++
Sbjct  2    AADVDEHMRSLLMHNSTSLDPVIQQGLADCVEHYSDANDQLDDCTAAISASKFKDVEVWV  61

Query  458  QDAILDLNACEESLK  414
              AI D + C+ SLK
Sbjct  62   NVAISDADFCDNSLK  76



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2629592296512