BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13172_g2_i1 len=844 path=[1160:0-843]

Length=844
                                                                      Score     E

ref|XP_004231937.1|  PREDICTED: putative glycosyltransferase 7          194   2e-54   
ref|XP_006363812.1|  PREDICTED: putative glycosyltransferase 7-li...    190   4e-53   
ref|XP_009624871.1|  PREDICTED: putative glycosyltransferase 7          185   3e-51   
ref|XP_009761597.1|  PREDICTED: putative glycosyltransferase 7          180   3e-49   
emb|CDP02616.1|  unnamed protein product                                179   5e-49   
gb|ACE60602.1|  putative galactomannan galactosyl transferase           179   7e-49   Coffea arabica [arabica coffee]
ref|XP_010273069.1|  PREDICTED: putative glycosyltransferase 7          174   5e-47   
ref|XP_006363813.1|  PREDICTED: putative glycosyltransferase 7-li...    166   2e-44   
ref|XP_010646814.1|  PREDICTED: LOW QUALITY PROTEIN: putative gly...    165   5e-44   
emb|CAI79403.1|  galactomannan galactosyltransferase                    166   6e-44   Senna occidentalis [antbush]
emb|CAN80825.1|  hypothetical protein VITISV_015452                     165   1e-43   Vitis vinifera
ref|XP_010531308.1|  PREDICTED: putative glycosyltransferase 7          164   2e-43   
gb|EYU41378.1|  hypothetical protein MIMGU_mgv1a006348mg                164   3e-43   
gb|ACF33172.1|  putative galactosyl transferase                         157   5e-43   Coffea canephora [robusta coffee]
gb|KFK30380.1|  hypothetical protein AALP_AA7G253700                    162   7e-43   
ref|XP_002320005.2|  alpha galactosyltransferase family protein         162   9e-43   Populus trichocarpa [western balsam poplar]
ref|XP_008440417.1|  PREDICTED: galactomannan galactosyltransfera...    161   2e-42   
ref|XP_007047569.1|  Galactosyl transferase GMA12/MNN10 family pr...    162   2e-42   
ref|XP_011007841.1|  PREDICTED: putative glycosyltransferase 7          161   3e-42   
ref|XP_004231939.1|  PREDICTED: glycosyltransferase 6-like              161   3e-42   
ref|XP_004141854.1|  PREDICTED: galactomannan galactosyltransfera...    160   6e-42   
ref|XP_006363811.1|  PREDICTED: putative glycosyltransferase 7-like     159   2e-41   
ref|XP_011099399.1|  PREDICTED: glycosyltransferase 6-like              159   2e-41   
emb|CDX76887.1|  BnaC08g34730D                                          159   2e-41   
ref|XP_010419274.1|  PREDICTED: putative glycosyltransferase 7          153   2e-41   
emb|CDY29577.1|  BnaA03g54220D                                          158   3e-41   
ref|XP_009138524.1|  PREDICTED: glycosyltransferase 6                   158   3e-41   
ref|XP_006411860.1|  hypothetical protein EUTSA_v10027092mg             158   3e-41   
emb|CDY49440.1|  BnaA09g42270D                                          158   4e-41   
ref|XP_009117319.1|  PREDICTED: putative glycosyltransferase 7          158   4e-41   
ref|XP_002525290.1|  transferase, putative                              157   6e-41   Ricinus communis
ref|XP_011031309.1|  PREDICTED: putative glycosyltransferase 7          157   9e-41   
ref|XP_006404757.1|  hypothetical protein EUTSA_v10000162mg             157   1e-40   
gb|KHG22205.1|  Putative glycosyltransferase 7 -like protein            157   1e-40   
emb|CDX72649.1|  BnaC07g46710D                                          156   1e-40   
emb|CDP02617.1|  unnamed protein product                                157   1e-40   
ref|XP_003539263.1|  PREDICTED: galactomannan galactosyltransfera...    156   2e-40   
gb|EYU44510.1|  hypothetical protein MIMGU_mgv1a018855mg                155   3e-40   
ref|XP_002310890.2|  alpha galactosyltransferase family protein         155   4e-40   Populus trichocarpa [western balsam poplar]
ref|XP_010472288.1|  PREDICTED: putative glycosyltransferase 7          155   4e-40   
emb|CAI11454.1|  alpha-6-galactosyltransferase                          154   8e-40   Medicago truncatula
ref|XP_009777953.1|  PREDICTED: putative glycosyltransferase 7 is...    154   1e-39   
ref|XP_003608541.1|  Alpha-6-galactosyltransferase                      154   1e-39   
ref|XP_007156700.1|  hypothetical protein PHAVU_002G009900g             154   1e-39   
ref|XP_010429224.1|  PREDICTED: putative glycosyltransferase 7          154   2e-39   
gb|KHN36310.1|  Galactomannan galactosyltransferase 1                   152   3e-39   
emb|CAI11452.1|  alpha-6-galactosyltransferase                          152   4e-39   Solanum tuberosum [potatoes]
ref|XP_003517354.1|  PREDICTED: galactomannan galactosyltransfera...    152   6e-39   
gb|ACH58908.1|  galactosyl transferase                                  152   6e-39   Coffea canephora [robusta coffee]
ref|XP_009618872.1|  PREDICTED: putative glycosyltransferase 7          152   7e-39   
gb|KDO78929.1|  hypothetical protein CISIN_1g045999mg                   151   8e-39   
emb|CAD98924.1|  galactomannan galactosyltransferase                    151   8e-39   Lotus japonicus
ref|XP_010417049.1|  PREDICTED: putative glycosyltransferase 7          152   9e-39   
ref|XP_006426098.1|  hypothetical protein CICLE_v10025585mg             151   1e-38   
ref|XP_006466460.1|  PREDICTED: putative glycosyltransferase 7-like     151   1e-38   
ref|XP_002880469.1|  galactosyl transferase GMA12/MNN10 family pr...    151   1e-38   
emb|CAI11453.1|  alpha-6-galactosyltransferase                          150   2e-38   Nicotiana benthamiana
ref|XP_010432039.1|  PREDICTED: glycosyltransferase 6                   150   2e-38   
ref|NP_565544.1|  putative glycosyltransferase 7                        150   2e-38   Arabidopsis thaliana [mouse-ear cress]
sp|Q564G7.1|GMGT1_CYATE  RecName: Full=Galactomannan galactosyltr...    150   3e-38   Cyamopsis tetragonoloba [cluster bean]
ref|XP_009761596.1|  PREDICTED: glycosyltransferase 6-like              150   3e-38   
ref|XP_009607432.1|  PREDICTED: glycosyltransferase 6-like              150   3e-38   
ref|XP_007205195.1|  hypothetical protein PRUPE_ppa005681mg             150   4e-38   
ref|XP_009345079.1|  PREDICTED: putative glycosyltransferase 7          150   4e-38   
gb|KHG22229.1|  Putative glycosyltransferase 7 -like protein            150   5e-38   
ref|XP_010437192.1|  PREDICTED: glycosyltransferase 6-like              148   1e-37   
ref|XP_008363062.1|  PREDICTED: glycosyltransferase 6-like              148   1e-37   
ref|XP_010274411.1|  PREDICTED: galactomannan galactosyltransfera...    149   1e-37   
ref|XP_003611556.1|  Galactomannan galactosyltransferase                148   1e-37   
ref|NP_680773.1|  glycosyltransferase 6                                 148   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010446636.1|  PREDICTED: LOW QUALITY PROTEIN: glycosyltran...    147   2e-37   
ref|XP_002868971.1|  galactosyl transferase GMA12/MNN10 family pr...    147   3e-37   
ref|XP_004511818.1|  PREDICTED: galactomannan galactosyltransfera...    147   3e-37   
ref|XP_006294199.1|  hypothetical protein CARUB_v10023195mg             147   4e-37   
ref|XP_009361779.1|  PREDICTED: glycosyltransferase 6-like              146   6e-37   
ref|XP_008392336.1|  PREDICTED: putative glycosyltransferase 7          146   9e-37   
gb|KDP32091.1|  hypothetical protein JCGZ_12552                         145   1e-36   
ref|XP_011073681.1|  PREDICTED: glycosyltransferase 6                   145   2e-36   
emb|CAB52246.1|  alpha galactosyltransferase                            145   2e-36   Trigonella foenum-graecum [fenugreek]
ref|XP_006350640.1|  PREDICTED: putative glycosyltransferase 7-like     144   3e-36   
ref|XP_008237711.1|  PREDICTED: galactomannan galactosyltransfera...    144   5e-36   
ref|NP_195544.1|  galactosyl transferase GMA12/MNN10 family protein     135   8e-36   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001281283.1|  putative glycosyltransferase 7                     143   1e-35   
ref|XP_004294205.1|  PREDICTED: galactomannan galactosyltransfera...    142   2e-35   
gb|EPS69883.1|  hypothetical protein M569_04879                         142   3e-35   
ref|XP_010106924.1|  Galactomannan galactosyltransferase 1              141   5e-35   
ref|XP_009394361.1|  PREDICTED: galactomannan galactosyltransfera...    141   5e-35   
emb|CDP02619.1|  unnamed protein product                                140   9e-35   
ref|XP_009362595.1|  PREDICTED: LOW QUALITY PROTEIN: galactomanna...    140   2e-34   
ref|XP_006857127.1|  hypothetical protein AMTR_s00065p00144450          139   3e-34   
ref|XP_004234713.2|  PREDICTED: glycosyltransferase 6-like              139   3e-34   
gb|EYU44512.1|  hypothetical protein MIMGU_mgv1a0180271mg               131   4e-34   
gb|ACF33173.1|  putative galactomannan galactosyl transferase           138   6e-34   Coffea canephora [robusta coffee]
emb|CDP02618.1|  unnamed protein product                                137   1e-33   
gb|ADL36661.1|  CAMTA domain class transcription factor                 137   2e-33   
ref|XP_008347885.1|  PREDICTED: galactomannan galactosyltransfera...    137   2e-33   
ref|XP_003608540.1|  Galactomannan galactosyltransferase                136   2e-33   
ref|XP_004288265.1|  PREDICTED: galactomannan galactosyltransfera...    135   5e-33   
ref|XP_008238162.1|  PREDICTED: glycosyltransferase 6-like              134   1e-32   
ref|XP_008226081.1|  PREDICTED: putative glycosyltransferase 7          134   2e-32   
ref|XP_007208181.1|  hypothetical protein PRUPE_ppa017391mg             131   8e-32   
ref|XP_009777954.1|  PREDICTED: putative glycosyltransferase 7 is...    132   9e-32   
tpg|DAA64593.1|  TPA: putative galacto(gluco)mannan alpha-1,6-gal...    126   6e-31   
ref|XP_008362135.1|  PREDICTED: galactomannan galactosyltransfera...    129   1e-30   
ref|XP_003525869.1|  PREDICTED: galactomannan galactosyltransfera...    128   2e-30   
ref|XP_010028081.1|  PREDICTED: putative glycosyltransferase 7          127   4e-30   
ref|XP_009362594.1|  PREDICTED: glycosyltransferase 6-like              127   5e-30   
gb|ADL36663.1|  CAMTA domain class transcription factor                 127   5e-30   
ref|XP_010939020.1|  PREDICTED: LOW QUALITY PROTEIN: galactomanna...    127   7e-30   
gb|KDP25125.1|  hypothetical protein JCGZ_22660                         126   8e-30   
ref|XP_011099400.1|  PREDICTED: glycosyltransferase 6-like              126   9e-30   
ref|XP_008806204.1|  PREDICTED: galactomannan galactosyltransfera...    124   4e-29   
ref|XP_002513422.1|  transferase, putative                              122   2e-28   Ricinus communis
gb|ADE76992.1|  unknown                                                 121   6e-28   
ref|XP_007211970.1|  hypothetical protein PRUPE_ppa006622mg             120   7e-28   
ref|XP_008363070.1|  PREDICTED: LOW QUALITY PROTEIN: galactomanna...    117   9e-27   
ref|XP_002454367.1|  hypothetical protein SORBIDRAFT_04g029500          117   1e-26   Sorghum bicolor [broomcorn]
ref|XP_010679659.1|  PREDICTED: putative glycosyltransferase 7          117   2e-26   
ref|XP_010109205.1|  Galactomannan galactosyltransferase 1              115   7e-26   
ref|NP_001105164.1|  alpha-6-galactosyltransferase                      114   1e-25   Zea mays [maize]
dbj|BAK05879.1|  predicted protein                                      114   2e-25   
ref|XP_010943187.1|  PREDICTED: galactomannan galactosyltransfera...    110   5e-24   
ref|XP_008784727.1|  PREDICTED: putative glycosyltransferase 7          109   6e-24   
gb|EAY87343.1|  hypothetical protein OsI_08746                          109   7e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_009394626.1|  PREDICTED: galactomannan galactosyltransfera...    109   8e-24   
ref|NP_001047970.1|  Os02g0723200                                       109   8e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009406736.1|  PREDICTED: galactomannan galactosyltransfera...    108   2e-23   
gb|ABK25085.1|  unknown                                                 108   3e-23   Picea sitchensis
ref|XP_008795673.1|  PREDICTED: glycosyltransferase 6-like              106   2e-22   
gb|AHC98115.1|  putative galacto(gluco)mannan alpha-1,6-galactosy...    105   2e-22   
tpg|DAA64590.1|  TPA: putative galacto(gluco)mannan alpha-1,6-gal...    105   2e-22   
ref|XP_004953741.1|  PREDICTED: galactomannan galactosyltransfera...    103   1e-21   
ref|XP_003570475.1|  PREDICTED: galactomannan galactosyltransfera...    100   7e-21   
ref|XP_010919073.1|  PREDICTED: galactomannan galactosyltransfera...  97.4    1e-19   
ref|XP_006841140.1|  hypothetical protein AMTR_s00086p00128700        95.9    4e-19   
emb|CAI11450.1|  alpha-1,6-xylosyltransferase                         94.0    2e-18   Pinus taeda
ref|XP_010477058.1|  PREDICTED: putative glycosyltransferase 4        93.6    3e-18   
gb|ABK24302.1|  unknown                                               93.2    4e-18   Picea sitchensis
ref|XP_009414141.1|  PREDICTED: putative glycosyltransferase 2        92.8    5e-18   
ref|XP_010452740.1|  PREDICTED: putative glycosyltransferase 3        92.4    9e-18   
ref|XP_006374450.1|  hypothetical protein POPTR_0015s07290g           92.0    1e-17   
ref|XP_010258249.1|  PREDICTED: putative glycosyltransferase 5        91.7    1e-17   
ref|XP_010491391.1|  PREDICTED: putative glycosyltransferase 3        91.7    1e-17   
ref|XP_002449649.1|  hypothetical protein SORBIDRAFT_05g020911        87.8    2e-17   Sorghum bicolor [broomcorn]
ref|XP_008679453.1|  PREDICTED: galactomannan galactosyltransfera...  90.9    2e-17   
ref|XP_010498276.1|  PREDICTED: putative glycosyltransferase 5        90.9    3e-17   
ref|XP_008239899.1|  PREDICTED: putative glycosyltransferase 5        90.9    3e-17   
ref|XP_011090963.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  90.9    3e-17   
ref|XP_008374566.1|  PREDICTED: putative glycosyltransferase 5        90.9    3e-17   
ref|XP_011047184.1|  PREDICTED: putative glycosyltransferase 5        90.9    3e-17   
ref|XP_008466919.1|  PREDICTED: putative glycosyltransferase 5        88.2    3e-17   
gb|KDP31286.1|  hypothetical protein JCGZ_11662                       90.5    3e-17   
ref|XP_002514720.1|  Xyloglucan 6-xylosyltransferase, putative        90.5    3e-17   Ricinus communis
ref|XP_010537379.1|  PREDICTED: putative glycosyltransferase 5        90.5    4e-17   
ref|XP_003575986.2|  PREDICTED: galactomannan galactosyltransfera...  90.5    4e-17   
ref|XP_009339134.1|  PREDICTED: putative glycosyltransferase 5        90.1    5e-17   
ref|XP_007138911.1|  hypothetical protein PHAVU_009G248100g           89.7    6e-17   
ref|XP_009338860.1|  PREDICTED: putative glycosyltransferase 5        89.7    6e-17   
ref|NP_196389.1|  xyloglucan 6-xylosyltransferase                     89.7    7e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010666578.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     89.4    8e-17   
ref|XP_010108713.1|  Putative glycosyltransferase 3                   89.4    8e-17   
ref|XP_008393187.1|  PREDICTED: putative glycosyltransferase 5        89.4    8e-17   
ref|XP_010652172.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     89.0    1e-16   
ref|XP_010258549.1|  PREDICTED: putative glycosyltransferase 5 is...  89.0    1e-16   
emb|CBI36830.3|  unnamed protein product                              88.2    1e-16   
emb|CDY19235.1|  BnaC05g14360D                                        89.0    1e-16   
ref|XP_010258542.1|  PREDICTED: putative glycosyltransferase 5 is...  89.0    1e-16   
ref|XP_009416128.1|  PREDICTED: putative glycosyltransferase 2        88.6    1e-16   
ref|XP_007209124.1|  hypothetical protein PRUPE_ppa005479mg           89.0    1e-16   
ref|XP_010922270.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  88.6    1e-16   
ref|XP_002284667.1|  PREDICTED: putative glycosyltransferase 5        88.6    1e-16   Vitis vinifera
ref|XP_009600562.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     89.0    1e-16   
emb|CAN80739.1|  hypothetical protein VITISV_027037                   88.6    1e-16   Vitis vinifera
ref|XP_004508217.1|  PREDICTED: putative glycosyltransferase 2-like   88.6    2e-16   
ref|XP_006287623.1|  hypothetical protein CARUB_v10000835mg           89.0    2e-16   
ref|XP_010943718.1|  PREDICTED: putative glycosyltransferase 5        88.6    2e-16   
ref|XP_004154959.1|  PREDICTED: putative glycosyltransferase 3-like   88.6    2e-16   
ref|XP_004138179.1|  PREDICTED: putative glycosyltransferase 3-like   88.6    2e-16   
ref|XP_002449648.1|  hypothetical protein SORBIDRAFT_05g020910        88.2    2e-16   Sorghum bicolor [broomcorn]
dbj|BAJ96459.1|  predicted protein                                    88.6    2e-16   
ref|XP_004138178.1|  PREDICTED: putative glycosyltransferase 5-like   88.2    2e-16   
gb|EPS71488.1|  hypothetical protein M569_03267                       88.2    2e-16   
ref|XP_010523024.1|  PREDICTED: putative glycosyltransferase 3        88.2    2e-16   
ref|XP_009780568.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  88.2    2e-16   
ref|XP_006356974.1|  PREDICTED: putative glycosyltransferase 2-like   87.8    3e-16   
ref|XP_010938345.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  87.8    3e-16   
ref|XP_008235045.1|  PREDICTED: putative glycosyltransferase 2        87.4    3e-16   
ref|XP_008368989.1|  PREDICTED: putative glycosyltransferase 2        87.4    4e-16   
ref|XP_009342118.1|  PREDICTED: putative glycosyltransferase 2        87.4    4e-16   
ref|XP_008367147.1|  PREDICTED: putative glycosyltransferase 2        87.4    4e-16   
gb|ACE95677.1|  putative xylosyl transferase                          87.4    4e-16   Coffea canephora [robusta coffee]
ref|XP_009138722.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  87.4    4e-16   
emb|CDO98874.1|  unnamed protein product                              87.4    4e-16   
ref|XP_002871288.1|  galactosyl transferase GMA12/MNN10 family pr...  87.4    4e-16   
ref|XP_011071657.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  87.0    5e-16   
ref|XP_010423175.1|  PREDICTED: putative glycosyltransferase 3        87.0    5e-16   
ref|XP_003533377.1|  PREDICTED: putative glycosyltransferase 2-li...  87.0    5e-16   
gb|EAY89653.1|  hypothetical protein OsI_11184                        86.7    6e-16   Oryza sativa Indica Group [Indian rice]
gb|ABF95475.1|  Glycosyltransferase 5, putative, expressed            86.7    6e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006419581.1|  hypothetical protein CICLE_v10004948mg           86.7    7e-16   
emb|CDX93965.1|  BnaC04g21240D                                        86.7    7e-16   
ref|XP_010907157.1|  PREDICTED: putative glycosyltransferase 5        86.7    7e-16   
ref|XP_008386651.1|  PREDICTED: putative glycosyltransferase 2        86.7    7e-16   
ref|XP_010235491.1|  PREDICTED: putative glycosyltransferase 3        87.0    7e-16   
ref|XP_004229187.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     87.0    7e-16   
ref|XP_004301136.1|  PREDICTED: putative glycosyltransferase 5-like   86.7    7e-16   
ref|XP_010459505.1|  PREDICTED: putative glycosyltransferase 4        86.7    7e-16   
ref|XP_007224307.1|  hypothetical protein PRUPE_ppa019851mg           86.7    7e-16   
gb|AEN82384.1|  AT4G02500-like protein                                82.8    8e-16   
ref|XP_006489090.1|  PREDICTED: putative glycosyltransferase 2-like   86.7    8e-16   
ref|XP_008790864.1|  PREDICTED: putative glycosyltransferase 2        86.7    8e-16   
gb|ADG38703.1|  AT4G02500-like protein                                82.8    8e-16   
ref|XP_006649941.1|  PREDICTED: putative glycosyltransferase 2-like   86.7    8e-16   
gb|EYU43946.1|  hypothetical protein MIMGU_mgv1a027073mg              86.7    8e-16   
gb|EYU45549.1|  hypothetical protein MIMGU_mgv1a027105mg              86.7    8e-16   
ref|XP_004508717.1|  PREDICTED: putative glycosyltransferase 5-like   86.7    8e-16   
ref|XP_008360279.1|  PREDICTED: putative glycosyltransferase 2        86.7    8e-16   
emb|CAI11458.1|  putative glycosyltransferase                         86.7    8e-16   Nicotiana benthamiana
gb|AFW88652.1|  glycosyltransferase 5                                 86.3    9e-16   
ref|NP_001150077.1|  glycosyltransferase 5                            86.3    9e-16   Zea mays [maize]
ref|XP_006390433.1|  hypothetical protein EUTSA_v10018522mg           86.3    9e-16   
ref|XP_009352257.1|  PREDICTED: putative glycosyltransferase 2        86.3    1e-15   
emb|CDX90935.1|  BnaA03g26150D                                        86.3    1e-15   
ref|XP_006399253.1|  hypothetical protein EUTSA_v10013509mg           86.3    1e-15   
ref|XP_008795804.1|  PREDICTED: putative glycosyltransferase 2        86.3    1e-15   
ref|XP_006396461.1|  hypothetical protein EUTSA_v10028641mg           86.3    1e-15   
ref|XP_004154960.1|  PREDICTED: putative glycosyltransferase 5-like   86.3    1e-15   
ref|NP_191831.1|  xyloglucan 6-xylosyltransferase                     86.3    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009116931.1|  PREDICTED: xyloglucan 6-xylosyltransferase       86.3    1e-15   
ref|XP_004984900.1|  PREDICTED: putative glycosyltransferase 2-like   86.3    1e-15   
emb|CAJ57380.1|  alpha-1,6-xylosyltransferase                         86.3    1e-15   Physcomitrella patens
ref|XP_007201035.1|  hypothetical protein PRUPE_ppa005690mg           85.9    1e-15   
ref|XP_001776727.1|  predicted protein                                85.9    1e-15   
ref|XP_002874911.1|  hypothetical protein ARALYDRAFT_490316           85.9    1e-15   
ref|XP_010683109.1|  PREDICTED: putative glycosyltransferase 5        85.9    1e-15   
ref|XP_009149356.1|  PREDICTED: putative glycosyltransferase 4        86.3    1e-15   
gb|ADG38709.1|  AT4G02500-like protein                                82.0    1e-15   
ref|NP_567241.1|  UDP-xylosyltransferase 2                            85.9    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010429788.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  85.9    1e-15   
ref|XP_006287708.1|  hypothetical protein CARUB_v10000915mg           85.9    1e-15   
ref|XP_010456020.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     85.9    1e-15   
ref|XP_010422579.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  85.9    1e-15   
emb|CDY70090.1|  BnaCnng66640D                                        84.7    1e-15   
gb|AAC78266.1|  putative glycosyltransferase                          85.9    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003549688.1|  PREDICTED: putative glycosyltransferase 5-like   85.9    1e-15   
emb|CAN77730.1|  hypothetical protein VITISV_027412                   85.9    1e-15   Vitis vinifera
ref|XP_002465400.1|  hypothetical protein SORBIDRAFT_01g038000        85.9    1e-15   Sorghum bicolor [broomcorn]
emb|CDP21247.1|  unnamed protein product                              85.5    1e-15   
ref|XP_002967572.1|  glycosyltransferase, CAZy family GT34-like p...  85.5    1e-15   
emb|CDY70418.1|  BnaA04g27220D                                        85.9    2e-15   
ref|XP_007037433.1|  Galactosyl transferase GMA12/MNN10 family pr...  85.9    2e-15   
ref|XP_008235042.1|  PREDICTED: putative glycosyltransferase 2        85.5    2e-15   
ref|XP_004290777.1|  PREDICTED: putative glycosyltransferase 2-like   85.5    2e-15   
ref|XP_008679454.1|  PREDICTED: galactomannan galactosyltransfera...  85.9    2e-15   
emb|CBI26079.3|  unnamed protein product                              85.5    2e-15   
emb|CAI11451.1|  alpha-1,6-xylosyltransferase                         85.1    2e-15   Gossypium raimondii
emb|CDX99024.1|  BnaC09g48110D                                        85.5    2e-15   
ref|XP_010678459.1|  PREDICTED: putative glycosyltransferase 5        85.5    2e-15   
ref|XP_010471529.1|  PREDICTED: putative glycosyltransferase 5        85.5    2e-15   
ref|XP_008788330.1|  PREDICTED: putative glycosyltransferase 5        85.5    2e-15   
ref|XP_002876686.1|  hypothetical protein ARALYDRAFT_907847           85.5    2e-15   
ref|XP_006402349.1|  hypothetical protein EUTSA_v10005949mg           85.5    2e-15   
emb|CDY26738.1|  BnaA06g12840D                                        85.5    2e-15   
ref|XP_009134428.1|  PREDICTED: putative glycosyltransferase 2        85.1    2e-15   
ref|XP_002516919.1|  Xyloglucan 6-xylosyltransferase, putative        85.1    2e-15   Ricinus communis
ref|XP_010523942.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  85.1    2e-15   
gb|AFW64907.1|  glycosyltransferase 6                                 85.5    2e-15   
ref|XP_003609672.1|  Xyloglucan 6-xylosyltransferase                  85.1    2e-15   
gb|KDP27794.1|  hypothetical protein JCGZ_18874                       85.1    3e-15   
emb|CDY50378.1|  BnaCnng19100D                                        85.1    3e-15   
ref|XP_009111280.1|  PREDICTED: putative glycosyltransferase 2        85.1    3e-15   
ref|XP_009144556.1|  PREDICTED: putative glycosyltransferase 2        85.1    3e-15   
gb|KHG26935.1|  Putative glycosyltransferase 2 -like protein          85.1    3e-15   
ref|XP_006291070.1|  hypothetical protein CARUB_v10017185mg           84.7    3e-15   
ref|XP_010037455.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  84.7    3e-15   
ref|XP_008662460.1|  PREDICTED: putative glycosyltransferase 3        84.7    3e-15   
ref|XP_006307492.1|  hypothetical protein CARUB_v10009116mg           84.7    3e-15   
ref|XP_010098280.1|  Xyloglucan 6-xylosyltransferase                  84.7    3e-15   
ref|XP_004296837.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  84.7    3e-15   
ref|XP_011087267.1|  PREDICTED: putative glycosyltransferase 5        84.7    3e-15   
ref|XP_010912249.1|  PREDICTED: putative glycosyltransferase 5        84.7    3e-15   
ref|XP_011006778.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  84.7    4e-15   
ref|XP_010416293.1|  PREDICTED: putative glycosyltransferase 5        84.7    4e-15   
ref|XP_010230173.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1...  84.3    4e-15   
ref|XP_008783986.1|  PREDICTED: LOW QUALITY PROTEIN: putative gly...  84.3    4e-15   
ref|XP_002318600.2|  hypothetical protein POPTR_0012s07020g           84.3    4e-15   
ref|XP_002887538.1|  galactosyl transferase GMA12/MNN10 family pr...  84.3    4e-15   
ref|XP_010089891.1|  Putative glycosyltransferase 5                   84.3    4e-15   
ref|XP_010512668.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1...  84.3    4e-15   
ref|XP_010259619.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     84.3    5e-15   
ref|XP_006416577.1|  hypothetical protein EUTSA_v10007657mg           84.3    5e-15   
ref|XP_010269507.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     84.3    5e-15   
ref|XP_010468926.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1     84.3    5e-15   
gb|KEH31956.1|  xyloglucan xylosyltransferase                         84.3    5e-15   
gb|KFK25153.1|  hypothetical protein AALP_AA8G072800                  84.0    5e-15   
ref|NP_177578.1|  xyloglucan xylosyltransferase 5                     84.0    5e-15   
ref|NP_001047014.1|  Os02g0529600                                     84.3    5e-15   
ref|NP_001288054.1|  calmodulin binding transcription activator 1     84.0    6e-15   
dbj|BAD43079.1|  hypothetical protein                                 84.3    6e-15   
ref|XP_006300466.1|  hypothetical protein CARUB_v10020269mg           84.0    6e-15   
ref|NP_173304.2|  putative glycosyltransferase 4                      84.3    6e-15   
ref|XP_006389383.1|  glycosyltransferase 2 family protein             84.0    7e-15   
gb|AFW71661.1|  putative glycosyltransferase                          84.0    8e-15   
ref|XP_010428421.1|  PREDICTED: putative glycosyltransferase 5 is...  83.6    8e-15   
ref|NP_001105849.1|  putative glycosyltransferase                     83.6    8e-15   
ref|XP_006838788.1|  hypothetical protein AMTR_s00002p00259350        83.6    9e-15   
ref|XP_011075649.1|  PREDICTED: putative glycosyltransferase 5        83.2    9e-15   
ref|XP_002453927.1|  hypothetical protein SORBIDRAFT_04g021570        83.6    9e-15   
ref|XP_004494368.1|  PREDICTED: putative glycosyltransferase 2-like   83.6    9e-15   
ref|XP_008662468.1|  PREDICTED: putative glycosyltransferase 3        83.2    1e-14   
ref|XP_010413252.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1...  83.2    1e-14   
ref|XP_007050874.1|  Alpha-1,6-xylosyltransferase isoform 2           83.2    1e-14   
gb|KFK41883.1|  hypothetical protein AALP_AA2G184600                  83.2    1e-14   
ref|XP_007050873.1|  Alpha-1,6-xylosyltransferase isoform 1           83.2    1e-14   
gb|KHN07948.1|  Galactomannan galactosyltransferase 1                 79.3    1e-14   
ref|NP_001268156.1|  alpha-1,6-xylosyltransferase                     83.2    1e-14   
ref|XP_006647332.1|  PREDICTED: putative glycosyltransferase 5-like   83.2    1e-14   
ref|XP_009617169.1|  PREDICTED: putative glycosyltransferase 5        83.2    1e-14   
ref|XP_009106103.1|  PREDICTED: putative glycosyltransferase 5        82.8    1e-14   
ref|XP_009764347.1|  PREDICTED: putative glycosyltransferase 5        82.8    1e-14   
ref|XP_002890293.1|  hypothetical protein ARALYDRAFT_312817           83.2    1e-14   
dbj|BAK03947.1|  predicted protein                                    82.8    2e-14   
ref|NP_001152534.1|  glycosyltransferase 6                            82.8    2e-14   
gb|EAY89696.1|  hypothetical protein OsI_11232                        82.8    2e-14   
ref|NP_001173389.1|  Os03g0306100                                     82.8    2e-14   
gb|AFK30383.1|  galactosyltransferase B1                              82.8    2e-14   
gb|ABF95527.1|  Glycosyltransferase 3, putative                       82.4    2e-14   
gb|ADE59448.1|  galactosyltransferase                                 82.8    2e-14   
gb|KEH24376.1|  xyloglucan xylosyltransferase                         82.4    2e-14   
gb|KFK30846.1|  hypothetical protein AALP_AA6G033100                  83.6    2e-14   
gb|KEH19400.1|  xyloglucan xylosyltransferase                         82.8    2e-14   
ref|XP_007155288.1|  hypothetical protein PHAVU_003G188200g           82.4    2e-14   
ref|XP_007035584.1|  CAMTA domain class transcription factor          82.4    2e-14   
gb|EAY81250.1|  hypothetical protein OsI_36429                        82.4    2e-14   
ref|XP_002990826.1|  xyloglucan xylosyltransferase-like protein       82.4    2e-14   
dbj|BAK06777.1|  predicted protein                                    82.4    2e-14   
ref|XP_004134208.1|  PREDICTED: putative glycosyltransferase 2-like   82.4    2e-14   
emb|CDX69995.1|  BnaA10g23440D                                        82.4    2e-14   
ref|NP_001049853.1|  Os03g0300000                                     81.3    2e-14   
gb|EMT04084.1|  Xyloglucan 6-xylosyltransferase                       82.0    2e-14   
ref|XP_002315554.2|  glycosyltransferase 2 family protein             82.4    2e-14   
ref|XP_009122397.1|  PREDICTED: putative glycosyltransferase 3        82.0    2e-14   
ref|XP_008438884.1|  PREDICTED: putative glycosyltransferase 2        82.0    2e-14   
ref|XP_011000518.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  82.0    3e-14   
gb|EMT05890.1|  Putative glycosyltransferase 3                        82.8    3e-14   
ref|XP_002455150.1|  hypothetical protein SORBIDRAFT_03g005110        82.0    3e-14   
ref|XP_002974473.1|  xyloglucan xylosyltransferase-like protein       82.0    3e-14   
ref|XP_009385087.1|  PREDICTED: putative glycosyltransferase 5        82.0    3e-14   
ref|XP_004980587.1|  PREDICTED: galactomannan galactosyltransfera...  82.0    3e-14   
emb|CDY22055.1|  BnaA09g00840D                                        82.0    3e-14   
emb|CAI11456.1|  putative glycosyltransferase                         81.6    3e-14   
ref|XP_004500012.1|  PREDICTED: putative glycosyltransferase 5-like   81.6    3e-14   
ref|XP_003554517.1|  PREDICTED: putative glycosyltransferase 2-like   81.6    3e-14   
ref|XP_007163097.1|  hypothetical protein PHAVU_001G206000g           81.6    4e-14   
gb|EYU23497.1|  hypothetical protein MIMGU_mgv1a006132mg              81.6    4e-14   
gb|EMS45714.1|  Putative glycosyltransferase 3                        82.0    4e-14   
ref|XP_009420521.1|  PREDICTED: putative glycosyltransferase 5        81.6    4e-14   
ref|XP_009606203.1|  PREDICTED: putative glycosyltransferase 3        81.6    4e-14   
ref|XP_003628458.1|  Alpha-1 6-xylosyltransferase                     82.0    4e-14   
gb|EPS66800.1|  hypothetical protein M569_07974                       81.3    4e-14   
ref|XP_003558113.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  81.3    4e-14   
ref|XP_002442801.1|  hypothetical protein SORBIDRAFT_08g003090        81.3    4e-14   
gb|KHN43518.1|  Xyloglucan 6-xylosyltransferase                       81.3    5e-14   
ref|XP_010522780.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     81.3    5e-14   
ref|XP_009379786.1|  PREDICTED: putative glycosyltransferase 5        81.3    5e-14   
ref|XP_006365321.1|  PREDICTED: putative glycosyltransferase 5-li...  81.3    5e-14   
ref|XP_010030248.1|  PREDICTED: putative glycosyltransferase 5        81.3    6e-14   
emb|CAI11457.1|  putative glycosyltransferase                         81.3    6e-14   
ref|XP_004980167.1|  PREDICTED: putative glycosyltransferase 5-like   80.9    6e-14   
ref|XP_003524717.1|  PREDICTED: putative glycosyltransferase 5-like   80.9    6e-14   
gb|AFK30382.1|  galactosyltransferase A                               80.9    7e-14   
ref|NP_001068066.1|  Os11g0546500                                     80.9    7e-14   
gb|ACN29046.1|  unknown                                               80.9    7e-14   
gb|AHC98117.1|  putative xyloglucan alpha-1,6-xylosyltransferase      80.5    8e-14   
ref|XP_006479922.1|  PREDICTED: putative glycosyltransferase 2-li...  80.5    9e-14   
ref|XP_009761185.1|  PREDICTED: putative glycosyltransferase 5        80.5    9e-14   
dbj|BAK00169.1|  predicted protein                                    80.5    9e-14   
ref|XP_006479923.1|  PREDICTED: putative glycosyltransferase 2-li...  80.5    1e-13   
ref|XP_009790055.1|  PREDICTED: putative glycosyltransferase 5        80.5    1e-13   
gb|EPS63631.1|  hypothetical protein M569_11153                       79.0    1e-13   
ref|XP_006479921.1|  PREDICTED: putative glycosyltransferase 2-li...  80.5    1e-13   
emb|CDY11441.1|  BnaA09g40070D                                        77.0    1e-13   
gb|EMT32465.1|  Putative glycosyltransferase 3                        80.1    1e-13   
ref|XP_010318819.1|  PREDICTED: putative glycosyltransferase 5        80.1    1e-13   
gb|AFW63176.1|  hypothetical protein ZEAMMB73_999507                  79.3    1e-13   
gb|EMS58373.1|  Putative glycosyltransferase 2                        79.3    1e-13   
gb|EMS48021.1|  Putative glycosyltransferase 3                        79.3    1e-13   
ref|XP_006444290.1|  hypothetical protein CICLE_v10020012mg           79.7    2e-13   
ref|XP_004977544.1|  PREDICTED: putative glycosyltransferase 5-like   79.7    2e-13   
ref|XP_009104763.1|  PREDICTED: putative glycosyltransferase 5        79.7    2e-13   
ref|NP_001151451.1|  glycosyltransferase 5                            79.7    2e-13   
ref|XP_004952632.1|  PREDICTED: putative glycosyltransferase 5-like   79.7    2e-13   
gb|EYU35800.1|  hypothetical protein MIMGU_mgv1a006038mg              79.3    2e-13   
ref|XP_004987030.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  79.3    2e-13   
gb|EYU28806.1|  hypothetical protein MIMGU_mgv1a003740mg              79.7    2e-13   
ref|XP_004980586.1|  PREDICTED: galactomannan galactosyltransfera...  79.3    2e-13   
ref|XP_008678871.1|  PREDICTED: LOW QUALITY PROTEIN: putative gly...  79.0    2e-13   
ref|XP_001767750.1|  predicted protein                                79.0    2e-13   
gb|KGN48623.1|  hypothetical protein Csa_6G495770                     75.5    3e-13   
ref|XP_006494985.1|  PREDICTED: putative glycosyltransferase 3-like   79.0    3e-13   
ref|XP_006440652.1|  hypothetical protein CICLE_v10020086mg           79.0    3e-13   
ref|XP_004136173.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  78.6    3e-13   
ref|XP_008451599.1|  PREDICTED: xyloglucan 6-xylosyltransferase       78.6    4e-13   
dbj|BAK08324.1|  predicted protein                                    78.6    4e-13   
ref|XP_009393375.1|  PREDICTED: putative glycosyltransferase 5        78.6    4e-13   
ref|XP_001759108.1|  predicted protein                                78.2    4e-13   
gb|KEH33442.1|  xyloglucan xylosyltransferase                         78.6    4e-13   
ref|XP_002465378.1|  hypothetical protein SORBIDRAFT_01g037530        78.6    4e-13   
ref|XP_010238722.1|  PREDICTED: putative glycosyltransferase 5        78.6    5e-13   
ref|XP_002314448.2|  glycosyltransferase 2 family protein             78.2    5e-13   
emb|CAJ57381.1|  alpha-1,6-xylosyltransferase                         78.2    5e-13   
gb|EPS64541.1|  hypothetical protein M569_10236                       77.8    6e-13   
emb|CBX25402.1|  hypothetical_protein                                 77.8    7e-13   
ref|XP_004987031.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  77.8    7e-13   
ref|NP_001049886.1|  Os03g0305800                                     77.8    8e-13   
ref|XP_003558085.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1...  77.4    9e-13   
ref|NP_001066160.1|  Os12g0149300                                     77.4    1e-12   
gb|EAY82266.1|  hypothetical protein OsI_37474                        77.4    1e-12   
ref|XP_011000519.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  77.0    1e-12   
ref|XP_004987032.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  77.0    1e-12   
emb|CBX24469.1|  hypothetical_protein                                 77.0    1e-12   
dbj|BAJ93852.1|  predicted protein                                    73.9    2e-12   
ref|XP_011072798.1|  PREDICTED: putative glycosyltransferase 5        76.6    2e-12   
ref|XP_006348817.1|  PREDICTED: putative glycosyltransferase 3-like   76.3    3e-12   
tpg|DAA53369.1|  TPA: hypothetical protein ZEAMMB73_022473            75.5    3e-12   
ref|XP_004239475.1|  PREDICTED: putative glycosyltransferase 3        75.5    4e-12   
ref|XP_002990216.1|  glycosyltransferase CAZy family GT34-like pr...  75.5    4e-12   
dbj|BAK06850.1|  predicted protein                                    74.7    8e-12   
ref|XP_004980588.1|  PREDICTED: galactomannan galactosyltransfera...  73.9    1e-11   
ref|XP_008654833.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  73.6    2e-11   
ref|XP_002465379.1|  hypothetical protein SORBIDRAFT_01g037540        73.2    2e-11   
ref|XP_004978367.1|  PREDICTED: putative glycosyltransferase 5-like   72.4    5e-11   
ref|XP_002980080.1|  glycosyltransferase CAZy family GT34-like pr...  70.1    2e-10   
ref|XP_001771886.1|  predicted protein                                70.5    2e-10   
ref|XP_001777149.1|  predicted protein                                70.1    2e-10   
ref|XP_004980166.1|  PREDICTED: putative glycosyltransferase 5-like   70.5    2e-10   
ref|XP_002441834.1|  hypothetical protein SORBIDRAFT_08g003080        70.1    3e-10   
gb|AFW88602.1|  hypothetical protein ZEAMMB73_854435                  69.3    4e-10   
ref|XP_008660215.1|  PREDICTED: xyloglucan 6-xylosyltransferase-l...  69.3    5e-10   
gb|AFW56047.1|  hypothetical protein ZEAMMB73_697365                  69.3    7e-10   
ref|XP_001775066.1|  predicted protein                                68.6    8e-10   
tpg|DAA57044.1|  TPA: hypothetical protein ZEAMMB73_619966            67.8    2e-09   
ref|XP_001769838.1|  predicted protein                                67.4    2e-09   
ref|XP_001768129.1|  predicted protein                                67.0    3e-09   
ref|XP_006663818.1|  PREDICTED: putative glycosyltransferase 3-like   67.0    3e-09   
ref|XP_001773763.1|  predicted protein                                65.9    6e-09   
gb|KHN26556.1|  Putative glycosyltransferase 2                        65.5    7e-09   
gb|KHN14624.1|  Putative glycosyltransferase 2                        65.5    7e-09   
ref|XP_001755467.1|  predicted protein                                65.9    7e-09   
ref|XP_008663804.1|  PREDICTED: putative glycosyltransferase 3        65.9    8e-09   
gb|KDO71643.1|  hypothetical protein CISIN_1g047753mg                 65.5    8e-09   
ref|XP_002992573.1|  glycosyltransferase CAZy family GT34-like pr...  65.1    1e-08   
gb|ABC87290.1|  putative galactosyl transferase                       65.1    1e-08   
ref|XP_002972516.1|  glycosyltransferase CAZy family GT34-like pr...  65.1    1e-08   
ref|XP_001755939.1|  predicted protein                                65.1    1e-08   
ref|XP_001764909.1|  predicted protein                                63.5    5e-08   
ref|XP_001755245.1|  predicted protein                                62.4    1e-07   
ref|XP_001772519.1|  predicted protein                                61.6    2e-07   
ref|XP_001756042.1|  predicted protein                                61.6    2e-07   
ref|XP_006651307.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  61.6    2e-07   
ref|XP_001765298.1|  predicted protein                                60.1    5e-07   
ref|XP_001761988.1|  predicted protein                                60.1    5e-07   
ref|XP_006665210.1|  PREDICTED: putative glycosyltransferase 3-like   58.5    5e-07   
ref|XP_010094459.1|  Xyloglucan 6-xylosyltransferase                  55.1    2e-06   
ref|XP_002987473.1|  glycosyltransferase-like protein                 57.8    2e-06   
ref|XP_002980077.1|  glycosyltransferase-like protein                 57.8    2e-06   
ref|XP_010246957.1|  PREDICTED: uncharacterized protein LOC104590119  56.6    3e-06   
ref|XP_001781241.1|  predicted protein                                56.2    1e-05   
ref|XP_001767288.1|  predicted protein                                54.7    3e-05   
ref|XP_004955161.1|  PREDICTED: galactomannan galactosyltransfera...  51.2    1e-04   
ref|XP_006663513.1|  PREDICTED: putative glycosyltransferase 7-like   51.6    3e-04   
dbj|BAO02547.1|  (1-6)-alpha-D-xylosyltransferase ortholog            50.8    5e-04   



>ref|XP_004231937.1| PREDICTED: putative glycosyltransferase 7 [Solanum lycopersicum]
Length=455

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 121/172 (70%), Gaps = 6/172 (3%)
 Frame = -2

Query  501  MVLSSLP----GFLTMASHRCRTP-PTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSD  337
            MV   LP     + +MA   CR+   + FS+GF FAGA+++ +L +WAF SF++    +D
Sbjct  1    MVTPQLPQTHTSYTSMAKQNCRSKISSIFSDGFLFAGASIVALLVIWAFWSFMSTSPNAD  60

Query  336  FDAGRKSTAFNGVEEKQECSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKE  157
              +   ++A      K +    S GF+  +DPP+  FYDDP LSYT++KPIK WDEKR++
Sbjct  61   -PSFLTTSADQNSALKTQVDPVSLGFNLRYDPPDPTFYDDPDLSYTMEKPIKKWDEKRRQ  119

Query  156  WLEQHPSFIPGADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            WL  HPSFIPGA+ RILMV+GSQ+TPC+NPIGDHLLLR FKNKVDYCRIHGY
Sbjct  120  WLNLHPSFIPGAEERILMVSGSQSTPCKNPIGDHLLLRFFKNKVDYCRIHGY  171



>ref|XP_006363812.1| PREDICTED: putative glycosyltransferase 7-like isoform X1 [Solanum 
tuberosum]
Length=455

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 119/172 (69%), Gaps = 6/172 (3%)
 Frame = -2

Query  501  MVLSSLP----GFLTMASHRCRTP-PTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSD  337
            MV   LP     +  MA   CR+   + FS+GF FAGA+++ +L +WAF SF++    +D
Sbjct  1    MVTPQLPQTHTSYTLMAKQNCRSKISSIFSDGFLFAGASIVALLVVWAFWSFMSTSPNAD  60

Query  336  FDAGRKSTAFNGVEEKQECSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKE  157
              +   ++A      K      S GF+  +DPP+  FYD P LSYT++KPIKNWDEKR++
Sbjct  61   -PSFLITSADQNSALKTPVDPVSLGFNLRYDPPDPTFYDHPDLSYTMEKPIKNWDEKRRQ  119

Query  156  WLEQHPSFIPGADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            WL  HPSFIPGA+ RILMV+GSQ+TPC+NPIGDHLLLR FKNKVDYCRIHGY
Sbjct  120  WLNLHPSFIPGAEERILMVSGSQSTPCKNPIGDHLLLRFFKNKVDYCRIHGY  171



>ref|XP_009624871.1| PREDICTED: putative glycosyltransferase 7 [Nicotiana tomentosiformis]
Length=456

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 123/173 (71%), Gaps = 13/173 (8%)
 Frame = -2

Query  498  VLSSLPGFLTMA-SHRCRTPPT-FFSNGFAFAGATVLGVLALWAFMSFLTPGSGSD----  337
            ++ +   + +MA    C++  T  FS+GF  AG +++ +L +WAF SF++    +D    
Sbjct  6    LVQTQTSYSSMAPKQNCKSKVTSLFSDGFLCAGGSIVALLVVWAFWSFMSTSPNTDPSFF  65

Query  336  -FDAGRKSTAFNGVEEKQECSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRK  160
               A +KST    +E   E +  S GFD  +DPP+  FYDDP +SYTI+KP+KNWDEKR+
Sbjct  66   STSAAKKST----LETPGELT--SPGFDLRYDPPDPTFYDDPDVSYTIEKPVKNWDEKRR  119

Query  159  EWLEQHPSFIPGADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            +WL+ HPSF+PG +NR+LMV+GSQ+TPC+NPIGDHLLLR FKNKVDYCRIHGY
Sbjct  120  QWLKLHPSFVPGVENRVLMVSGSQSTPCKNPIGDHLLLRFFKNKVDYCRIHGY  172



>ref|XP_009761597.1| PREDICTED: putative glycosyltransferase 7 [Nicotiana sylvestris]
Length=456

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 111/151 (74%), Gaps = 11/151 (7%)
 Frame = -2

Query  438  TFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSD-----FDAGRKSTAFNGVEEKQECSD  274
            + FS+GF  AG +++ +L +WAF SF++    +D        G+KS     +E   E + 
Sbjct  28   SLFSDGFLCAGGSIVALLVVWAFWSFMSTSPNTDPSFFTSSVGKKS----ALETPGEPT-  82

Query  273  GSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTG  94
             S GFD  +DPP+  FYDDP + YTI+KP+KNWDEKR++WL+ HPSF+PG +NR+LMV+G
Sbjct  83   -SPGFDLRYDPPDPTFYDDPDVRYTIEKPVKNWDEKRRQWLKLHPSFVPGVENRVLMVSG  141

Query  93   SQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            SQ+TPC+NPIGDHLLLR FKNKVDYCRIHGY
Sbjct  142  SQSTPCKNPIGDHLLLRFFKNKVDYCRIHGY  172



>emb|CDP02616.1| unnamed protein product [Coffea canephora]
Length=448

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 102/149 (68%), Gaps = 9/149 (6%)
 Frame = -2

Query  438  TFFSNGFAFAGATVLGVLALWAFMSFLT---PGSGSDFDAGRKSTAFNGVEEKQECSDGS  268
            +FFS+ F +A  T    L  WAF SF +   P +   F  G  S      E    C  G 
Sbjct  14   SFFSSCFLYAAGTSASFLLAWAFWSFFSSPAPSANPSFSRGLAS------EAALSCPAGK  67

Query  267  QGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQ  88
             G +R +DPP+  FYDDP+LSYTI+K IKNWDEKR+EWLE+HPSF  GA +RILMVTGSQ
Sbjct  68   AGHNRSYDPPDPTFYDDPELSYTIEKTIKNWDEKRREWLEKHPSFAAGAADRILMVTGSQ  127

Query  87   ATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            ATPC+NPIGDHLLLR FKNK DYCRIHGY
Sbjct  128  ATPCKNPIGDHLLLRFFKNKADYCRIHGY  156



>gb|ACE60602.1| putative galactomannan galactosyl transferase [Coffea arabica]
Length=448

 Score =   179 bits (453),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 102/149 (68%), Gaps = 9/149 (6%)
 Frame = -2

Query  438  TFFSNGFAFAGATVLGVLALWAFMSFLT---PGSGSDFDAGRKSTAFNGVEEKQECSDGS  268
            +FFS+ F +A  T    L  WAF SF +   P +   F  G  S      E    C  G 
Sbjct  14   SFFSSCFLYAAGTSASFLLAWAFWSFFSSPAPSANPSFSRGLAS------EAALSCPAGK  67

Query  267  QGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQ  88
             G +R +DPP+  FYDDP+LSYTI+K IKNWDEKR+EWLE+HPSF  GA +RILMVTGSQ
Sbjct  68   AGHNRSYDPPDPTFYDDPELSYTIEKTIKNWDEKRREWLEKHPSFAAGAADRILMVTGSQ  127

Query  87   ATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            ATPC+NPIGDHLLLR FKNK DYCRIHGY
Sbjct  128  ATPCKNPIGDHLLLRFFKNKADYCRIHGY  156



>ref|XP_010273069.1| PREDICTED: putative glycosyltransferase 7 [Nelumbo nucifera]
Length=460

 Score =   174 bits (441),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 105/154 (68%), Gaps = 9/154 (6%)
 Frame = -2

Query  438  TFFSNGFAFAGATVLGVLALWAFMSFL--TPGSGSDFDA------GRKSTAFNGVEEKQE  283
            +F ++   F G  ++ +L +W+  SF+  TP S  +F +         S AF+  E+  E
Sbjct  24   SFLTDAILFVGGAMVALLLVWSLWSFVEPTPNSSPNFSSPVTQPNAAVSEAFSA-EDCAE  82

Query  282  CSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILM  103
             +    G +  HD P   FYDDP LSYTIDKP+KNWDEKR+EWL+ HPSFIPGA  R+L+
Sbjct  83   IAASGSGVNLRHDTPAPTFYDDPYLSYTIDKPMKNWDEKRREWLKHHPSFIPGASERVLL  142

Query  102  VTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            V+GSQ +PCRNPIGDHLLLR FKNKVDYCRIHGY
Sbjct  143  VSGSQPSPCRNPIGDHLLLRFFKNKVDYCRIHGY  176



>ref|XP_006363813.1| PREDICTED: putative glycosyltransferase 7-like isoform X2 [Solanum 
tuberosum]
Length=423

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 98/133 (74%), Gaps = 1/133 (1%)
 Frame = -2

Query  399  VLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDRLHDPPEKNFYD  220
            ++ +L +WAF SF++    +D  +   ++A      K      S GF+  +DPP+  FYD
Sbjct  8    IVALLVVWAFWSFMSTSPNAD-PSFLITSADQNSALKTPVDPVSLGFNLRYDPPDPTFYD  66

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCRNPIGDHLLLRL  40
             P LSYT++KPIKNWDEKR++WL  HPSFIPGA+ RILMV+GSQ+TPC+NPIGDHLLLR 
Sbjct  67   HPDLSYTMEKPIKNWDEKRRQWLNLHPSFIPGAEERILMVSGSQSTPCKNPIGDHLLLRF  126

Query  39   FKNKVDYCRIHGY  1
            FKNKVDYCRIHGY
Sbjct  127  FKNKVDYCRIHGY  139



>ref|XP_010646814.1| PREDICTED: LOW QUALITY PROTEIN: putative glycosyltransferase 
7 [Vitis vinifera]
Length=403

 Score =   165 bits (417),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 97/151 (64%), Gaps = 5/151 (3%)
 Frame = -2

Query  438  TFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRK-----STAFNGVEEKQECSD  274
            + FS G  F G  ++  L +W   S  +P S    +  R      ST+ +   +  +C+ 
Sbjct  25   SVFSEGVLFVGGALVAFLLVWGIWSMASPASTPSPNFERVVSDPLSTSVSDEIDSSDCAV  84

Query  273  GSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTG  94
              QG +  HDPP+  FYD+PK SY I  P+KNWDEKR+EWL+ HPSF  GA  RILM+TG
Sbjct  85   DGQGVNLRHDPPDPTFYDNPKTSYKIGTPVKNWDEKRREWLKLHPSFAAGAGERILMLTG  144

Query  93   SQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            SQ TPC+NPIGDH LLR FKNKVDYCRIHGY
Sbjct  145  SQPTPCKNPIGDHFLLRFFKNKVDYCRIHGY  175



>emb|CAI79403.1| galactomannan galactosyltransferase [Senna occidentalis]
Length=449

 Score =   166 bits (419),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 102/155 (66%), Gaps = 10/155 (6%)
 Frame = -2

Query  435  FFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQE------CSD  274
            +FS+G  F G     +L +W F SF+ P   +D +    ST    ++  +       CS 
Sbjct  12   WFSDGCLFLGGAFSALLLVWGFWSFIAPIPITDPNFDSVSTKLKTLKNPRTVPSTVICST  71

Query  273  GSQGFDRL----HDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRIL  106
             +     +    HDPPE  FYDDP+ SYT+DKP+KNWDEKR+EWL +HPSF  GA +RIL
Sbjct  72   SAAETTTVPNLRHDPPEATFYDDPETSYTLDKPMKNWDEKRQEWLNRHPSFSAGAKSRIL  131

Query  105  MVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            +VTGSQ TPC+NPIGDHLLLR FKNKVDYCR+HGY
Sbjct  132  LVTGSQPTPCKNPIGDHLLLRFFKNKVDYCRLHGY  166



>emb|CAN80825.1| hypothetical protein VITISV_015452 [Vitis vinifera]
Length=446

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 97/151 (64%), Gaps = 5/151 (3%)
 Frame = -2

Query  438  TFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRK-----STAFNGVEEKQECSD  274
            + FS G  F G  ++  L +W   S  +P S    +  R      ST+ +   +  +C+ 
Sbjct  12   SVFSEGVLFVGGALVAFLLVWGIWSMASPASTPSPNFERVVSDPLSTSVSXEIDSSDCAV  71

Query  273  GSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTG  94
              QG +  HDPP+  FYD+PK SY I  P+KNWDEKR+EWL+ HPSF  GA  RILM+TG
Sbjct  72   DGQGVNLRHDPPDPTFYDNPKTSYKIGTPVKNWDEKRREWLKLHPSFAAGAGERILMLTG  131

Query  93   SQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            SQ TPC+NPIGDH LLR FKNKVDYCRIHGY
Sbjct  132  SQPTPCKNPIGDHFLLRFFKNKVDYCRIHGY  162



>ref|XP_010531308.1| PREDICTED: putative glycosyltransferase 7 [Tarenaya hassleriana]
Length=449

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 104/145 (72%), Gaps = 12/145 (8%)
 Frame = -2

Query  432  FSNGFAFAGATVLGVLALWAFMSFL-TPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFD  256
            FS+G  F G  ++ +L +W+F SF  +P  G   D           ++  +CS  S+G D
Sbjct  28   FSDGLVFLGGALMALLLVWSFFSFSPSPNIGVKSD-----------DDTLKCSGCSRGVD  76

Query  255  RLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPC  76
              +DPP+  FYDDP LSY+I++P+K WDEKR++WLE HPSF PGA NR++MVTGSQ+TPC
Sbjct  77   LRYDPPDPVFYDDPDLSYSIERPVKGWDEKRRQWLELHPSFKPGAANRVVMVTGSQSTPC  136

Query  75   RNPIGDHLLLRLFKNKVDYCRIHGY  1
            +NPIGDHLLLR FKNKVDYCRIHGY
Sbjct  137  KNPIGDHLLLRFFKNKVDYCRIHGY  161



>gb|EYU41378.1| hypothetical protein MIMGU_mgv1a006348mg [Erythranthe guttata]
Length=447

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 105/161 (65%), Gaps = 6/161 (4%)
 Frame = -2

Query  468  MASHRCRT-PPTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEE  292
            MA +  R+   +FFS+GF F G  ++  L +WA  SF               +  +    
Sbjct  1    MAKNNGRSKAASFFSDGFFFVGGGLVAFLLVWALWSFFALSPSPTPTPTPSFSTSSFSAA  60

Query  291  KQECSDGS----QGFDRLHDPPEKNFYDDPKLSYTIDKP-IKNWDEKRKEWLEQHPSFIP  127
              E  DG      G +  +DPPEKNFYDDPKLSYTID P +KNWDEKR+EWL+QHPSF  
Sbjct  61   VPESCDGGGGGVSGPNLRYDPPEKNFYDDPKLSYTIDTPPVKNWDEKRREWLKQHPSFAA  120

Query  126  GADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHG  4
            GAD RIL+VTGSQ TPC+NPIGD+LLL+LFKNKVDYCR HG
Sbjct  121  GADRRILLVTGSQPTPCKNPIGDYLLLKLFKNKVDYCRRHG  161



>gb|ACF33172.1| putative galactosyl transferase [Coffea canephora]
Length=232

 Score =   157 bits (398),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 98/147 (67%), Gaps = 5/147 (3%)
 Frame = -2

Query  441  PTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQG  262
            PTFF +  +F  A ++ +L  +A  SF T  + ++      ST F+       C+   Q 
Sbjct  11   PTFFRDCRSFILAVLVAILLFYALWSF-TETAWTNLSV---STIFSNTTT-DHCTSQPQS  65

Query  261  FDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQAT  82
             +R HDPPE  FYDDP+L YT+DKPI NWD+KRK WL+ HPSF     +RIL++TGSQ +
Sbjct  66   LNRTHDPPEPTFYDDPELCYTLDKPIDNWDDKRKSWLKLHPSFADNIQDRILLLTGSQPS  125

Query  81   PCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            PC++PIGDHLLLR FKNK DYCRIHGY
Sbjct  126  PCKSPIGDHLLLRGFKNKADYCRIHGY  152



>gb|KFK30380.1| hypothetical protein AALP_AA7G253700 [Arabis alpina]
Length=439

 Score =   162 bits (411),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 96/144 (67%), Gaps = 7/144 (5%)
 Frame = -2

Query  432  FSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDR  253
            FSN   F     + ++ +W++ S  +P S      G + T  N   E  +CS  +  FD 
Sbjct  15   FSNIIIFLTGAFMSLILVWSYFSIFSPSSNFTILTGLRKTINN---EPTQCSGSNLQFD-  70

Query  252  LHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCR  73
               P E  FYDDP L+YTI+ PIKNWDEKRK+WLE HPSF PG+ NRI+MVTGSQ+ PC+
Sbjct  71   ---PNEPGFYDDPDLTYTIETPIKNWDEKRKQWLESHPSFKPGSSNRIVMVTGSQSKPCK  127

Query  72   NPIGDHLLLRLFKNKVDYCRIHGY  1
            NPIGDHLLLR FKNKVDYCRIH +
Sbjct  128  NPIGDHLLLRFFKNKVDYCRIHNH  151



>ref|XP_002320005.2| alpha galactosyltransferase family protein [Populus trichocarpa]
 gb|EEE98320.2| alpha galactosyltransferase family protein [Populus trichocarpa]
Length=458

 Score =   162 bits (411),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 108/157 (69%), Gaps = 4/157 (3%)
 Frame = -2

Query  468  MASHRCRTPP-TFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEE  292
            MA    R  P + FS+GF + G  +L  L +W+  S+  P S   F+    + +      
Sbjct  16   MAKSSVRNKPFSCFSDGFLYLGGALLAFLLVWSLWSYTVPHS---FEPRGSTKSATNDAR  72

Query  291  KQECSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNR  112
             Q+C   +   +  +DPP++ FYDD +LSY+I++P+KNWDEKRKEWL++HPSF PGA +R
Sbjct  73   TQQCVQENPAVNLGYDPPDQTFYDDQELSYSIERPMKNWDEKRKEWLKRHPSFAPGARDR  132

Query  111  ILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            +++VTGSQ+ PC+NPIGDHLLLR FKNKVDYCRIHGY
Sbjct  133  VVLVTGSQSKPCKNPIGDHLLLRFFKNKVDYCRIHGY  169



>ref|XP_008440417.1| PREDICTED: galactomannan galactosyltransferase 1-like [Cucumis 
melo]
Length=445

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 94/144 (65%), Gaps = 5/144 (3%)
 Frame = -2

Query  432  FSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDR  253
             ++ F F   + L +L LW F SF TP S S+FD     + F       +    S  +D 
Sbjct  24   LADVFRFLVGSFLALLLLWTFSSFFTP-SPSNFDTLHPPSDFASSSHNSQNQYPSLAYD-  81

Query  252  LHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCR  73
               PP+  FYDDPKLSY+I KPIKNWDEKR+ WL+ HPSF  GA  R+L++T SQ  PCR
Sbjct  82   ---PPDITFYDDPKLSYSIQKPIKNWDEKRRHWLKHHPSFSAGASERVLLITASQPKPCR  138

Query  72   NPIGDHLLLRLFKNKVDYCRIHGY  1
            NPIGDHLLLR FKNKVDYCRIHGY
Sbjct  139  NPIGDHLLLRFFKNKVDYCRIHGY  162



>ref|XP_007047569.1| Galactosyl transferase GMA12/MNN10 family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007047570.1| Galactosyl transferase GMA12/MNN10 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX91726.1| Galactosyl transferase GMA12/MNN10 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX91727.1| Galactosyl transferase GMA12/MNN10 family protein isoform 1 [Theobroma 
cacao]
Length=455

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 106/168 (63%), Gaps = 3/168 (2%)
 Frame = -2

Query  501  MVLSSLPGFLTMASHRCRTPPTF-FSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAG  325
            MV   L  F +    + R  P +  S+GF + G   L +L +W+F SF TP    +F+  
Sbjct  1    MVSPELSHFQSSPMAKPRNRPFWCLSDGFLYFGGACLALLLVWSFWSFFTPIP--NFEPT  58

Query  324  RKSTAFNGVEEKQECSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQ  145
                     +   +C +   G +   DP +  FYDDP++SY+++KP+K+WDEKRKEWL+ 
Sbjct  59   MTEPPSKLRKNPVDCMESGFGVNLKSDPKDPTFYDDPEMSYSLEKPVKDWDEKRKEWLKH  118

Query  144  HPSFIPGADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            HPSF  GA  RI++VTGSQ  PC+NPIGDHLLLR FKNKVDYCRIHGY
Sbjct  119  HPSFAAGARERIVLVTGSQPKPCKNPIGDHLLLRFFKNKVDYCRIHGY  166



>ref|XP_011007841.1| PREDICTED: putative glycosyltransferase 7 [Populus euphratica]
 ref|XP_011007842.1| PREDICTED: putative glycosyltransferase 7 [Populus euphratica]
Length=458

 Score =   161 bits (408),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 108/157 (69%), Gaps = 4/157 (3%)
 Frame = -2

Query  468  MASHRCRTPP-TFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEE  292
            MA    R  P + FS+GF + G  +L  L +W+  S+  P S   F+    + +     +
Sbjct  16   MAKSSVRNKPFSCFSDGFLYLGGALLAFLLVWSLWSYTVPHS---FEPNGSTKSATNDPQ  72

Query  291  KQECSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNR  112
              +C   +   +  +DPP++ FYDD ++SY+I++P+KNWDEKRKEWL++HPSF PGA +R
Sbjct  73   THQCVQENPAVNLGYDPPDQTFYDDQEMSYSIERPMKNWDEKRKEWLKRHPSFAPGARDR  132

Query  111  ILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            +++VTGSQ+ PC+NPIGDHLLLR FKNKVDYCRIHGY
Sbjct  133  VVLVTGSQSKPCKNPIGDHLLLRFFKNKVDYCRIHGY  169



>ref|XP_004231939.1| PREDICTED: glycosyltransferase 6-like [Solanum lycopersicum]
Length=443

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 94/140 (67%), Gaps = 8/140 (6%)
 Frame = -2

Query  420  FAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDRLHDP  241
            FA     VL V A+W+F   L   SG  ++          +   + C  G +  DR  DP
Sbjct  21   FAAVIVAVLLVCAIWSFTDPLPNLSGLLYN--------QNISSPEYCPPGREAVDRSSDP  72

Query  240  PEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCRNPIG  61
            PEK FY+DP+LSYTIDKPIKNWDEKR +WL+ HPSF  G  NR+L+++GSQ TPC+NP G
Sbjct  73   PEKTFYNDPELSYTIDKPIKNWDEKRVQWLQLHPSFAAGRVNRVLLLSGSQPTPCKNPRG  132

Query  60   DHLLLRLFKNKVDYCRIHGY  1
            DHLLLR FKNKVDYCRIHGY
Sbjct  133  DHLLLRFFKNKVDYCRIHGY  152



>ref|XP_004141854.1| PREDICTED: galactomannan galactosyltransferase 1-like [Cucumis 
sativus]
 ref|XP_004167675.1| PREDICTED: galactomannan galactosyltransferase 1-like [Cucumis 
sativus]
 gb|KGN48624.1| hypothetical protein Csa_6G495780 [Cucumis sativus]
Length=444

 Score =   160 bits (405),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 95/144 (66%), Gaps = 6/144 (4%)
 Frame = -2

Query  432  FSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDR  253
             ++ F F   + L +L LW F SFL P S S+FD+       +     Q     +Q    
Sbjct  24   LADVFRFLVGSFLALLLLWTFSSFLIPSS-SNFDSLHPPDFASSSRNSQ-----NQYPSL  77

Query  252  LHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCR  73
             +DPP+  FYDDPKLSY+I KPIKNWDEKR+ WL+ HPSF  GA  R+L++T SQ  PCR
Sbjct  78   AYDPPDITFYDDPKLSYSIQKPIKNWDEKRRHWLKHHPSFAAGASERVLLITASQPKPCR  137

Query  72   NPIGDHLLLRLFKNKVDYCRIHGY  1
            NPIGDHLLLR FKNKVDYCRIHGY
Sbjct  138  NPIGDHLLLRFFKNKVDYCRIHGY  161



>ref|XP_006363811.1| PREDICTED: putative glycosyltransferase 7-like [Solanum tuberosum]
Length=443

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 94/140 (67%), Gaps = 8/140 (6%)
 Frame = -2

Query  420  FAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDRLHDP  241
            FA A   VL V A+W+F   L   SG  +     S  +        C  G +  DR  DP
Sbjct  21   FAAAIVAVLLVCAIWSFTDPLPNLSGLLYSQSISSPDY--------CPPGREAVDRSSDP  72

Query  240  PEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCRNPIG  61
            PEK FYD+P+LSYTI+KPIKNWDEKR +WL+ HPSF  G  NR+L+++GSQ TPC+NP G
Sbjct  73   PEKTFYDEPELSYTINKPIKNWDEKRVQWLKLHPSFAAGRVNRVLLLSGSQPTPCKNPRG  132

Query  60   DHLLLRLFKNKVDYCRIHGY  1
            DHLLLR FKNKVDYCRIHGY
Sbjct  133  DHLLLRFFKNKVDYCRIHGY  152



>ref|XP_011099399.1| PREDICTED: glycosyltransferase 6-like [Sesamum indicum]
Length=462

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 115/185 (62%), Gaps = 27/185 (15%)
 Frame = -2

Query  501  MVLSSLPGF--LTMASHRCRT-PPTFFSNGFAFAGATVLGVL---ALWAFMS--------  364
            M  S L  F    MA H  R+    FF++GF F G  ++  L   A+W+F S        
Sbjct  1    MASSELSQFQIFPMARHNGRSKAAAFFADGFLFVGGVLVAFLVVCAIWSFFSPSPSPAPS  60

Query  363  ----FLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDRLHDPPEKNFYDDPKLSYTI  196
                 ++    SD  A   + A +       C D S G +  HDPPE+NFYDDP+LSY+I
Sbjct  61   FSTSVVSSRESSDISAAAANPAVS-------CGDDS-GPNLGHDPPEQNFYDDPELSYSI  112

Query  195  DK-PIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDY  19
            D  P+KNWDEKR+ WL+QHPSF  GA+NRILMVTGSQA PC+NPIGD+LLL+LFKNKVDY
Sbjct  113  DALPVKNWDEKRRAWLKQHPSFSAGAENRILMVTGSQAKPCKNPIGDYLLLKLFKNKVDY  172

Query  18   CRIHG  4
            CR HG
Sbjct  173  CRRHG  177



>emb|CDX76887.1| BnaC08g34730D [Brassica napus]
Length=448

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 103/155 (66%), Gaps = 12/155 (8%)
 Frame = -2

Query  465  ASHRCRTPPTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQ  286
            A  R R P   F++   F G   + ++ +W+F SF          +   +  F+  ++  
Sbjct  18   AGARAR-PVICFNDVVLFLGGAFMSLILVWSFFSF----------SNSPNLTFSA-DKTD  65

Query  285  ECSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRIL  106
              +  ++G D  +DP +  FYDDP LSYTI+KP+KNWDEKRK WLE HPSFIPG++NR +
Sbjct  66   ASTKCTRGIDMRYDPTDPVFYDDPDLSYTIEKPVKNWDEKRKRWLELHPSFIPGSENRTV  125

Query  105  MVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            M+TGSQ+ PC+NPIGDHLLLR FKNKVDYCRIHG+
Sbjct  126  MITGSQSGPCKNPIGDHLLLRFFKNKVDYCRIHGH  160



>ref|XP_010419274.1| PREDICTED: putative glycosyltransferase 7 [Camelina sativa]
Length=224

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 100/151 (66%), Gaps = 8/151 (5%)
 Frame = -2

Query  450  RTPPTF-FSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSD  274
            RT P   FS+   F G   + ++ +W+F SF +       +   K+   +      +C  
Sbjct  35   RTKPVICFSDVVLFLGGAFMSLILVWSFFSFSSISP----NLTVKTDDSSSSSTSTKCY-  89

Query  273  GSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTG  94
              QG D  HDP +  +YDDP LSYTI+KP+KNWDEKR+ WL  HPSFIPGA+NR +MVTG
Sbjct  90   --QGIDTNHDPTDPVYYDDPDLSYTIEKPVKNWDEKRRRWLNLHPSFIPGAENRTVMVTG  147

Query  93   SQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            SQ+ PC+NPIGDHLLLR FKNKVDYCRIHG+
Sbjct  148  SQSAPCKNPIGDHLLLRFFKNKVDYCRIHGH  178



>emb|CDY29577.1| BnaA03g54220D [Brassica napus]
Length=438

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 98/145 (68%), Gaps = 11/145 (8%)
 Frame = -2

Query  432  FSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDR  253
            FS+G  F     + ++ +W++ S  +P S       R+ T      E  +CS    GFD 
Sbjct  15   FSDGVIFFAGAFMSLILVWSYFSIFSPSSNFTLIGFRRGT------EPAKCS----GFDM  64

Query  252  LHDPPEK-NFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPC  76
              DP +  +FYDDP LSY+I++PI  WDEKRK+WLE HPSF PG++NRI+MVTGSQ  PC
Sbjct  65   QFDPEDPGSFYDDPDLSYSIERPIAGWDEKRKQWLESHPSFKPGSENRIVMVTGSQPAPC  124

Query  75   RNPIGDHLLLRLFKNKVDYCRIHGY  1
            +NPIGDHLLLR FKNKVDYCRIHG+
Sbjct  125  KNPIGDHLLLRCFKNKVDYCRIHGH  149



>ref|XP_009138524.1| PREDICTED: glycosyltransferase 6 [Brassica rapa]
Length=438

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 98/145 (68%), Gaps = 11/145 (8%)
 Frame = -2

Query  432  FSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDR  253
            FS+G  F     + ++ +W++ S  +P S       R+ T      E  +CS    GFD 
Sbjct  15   FSDGVIFFAGAFMSLILVWSYFSIFSPSSNFTLIGFRRGT------EPAKCS----GFDM  64

Query  252  LHDPPEK-NFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPC  76
              DP +  +FYDDP LSY+I++PI  WDEKRK+WLE HPSF PG++NRI+MVTGSQ  PC
Sbjct  65   QFDPEDPGSFYDDPDLSYSIERPITGWDEKRKQWLESHPSFKPGSENRIVMVTGSQPAPC  124

Query  75   RNPIGDHLLLRLFKNKVDYCRIHGY  1
            +NPIGDHLLLR FKNKVDYCRIHG+
Sbjct  125  KNPIGDHLLLRCFKNKVDYCRIHGH  149



>ref|XP_006411860.1| hypothetical protein EUTSA_v10027092mg, partial [Eutrema salsugineum]
 gb|ESQ53313.1| hypothetical protein EUTSA_v10027092mg, partial [Eutrema salsugineum]
Length=440

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 94/144 (65%), Gaps = 10/144 (7%)
 Frame = -2

Query  432  FSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDR  253
             S+G  F     + ++ +W++ S  +P S          T   G     +CS    G D 
Sbjct  19   LSDGVIFLAGAFMSLILVWSYFSIFSPSSNYSL------TGLRGDGGPIKCS----GLDM  68

Query  252  LHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCR  73
              DPP+  FYDDP LSY+I+K +  WDEKRK WLE HPSF PG++NRI+MVTGSQ+TPC+
Sbjct  69   QFDPPDSGFYDDPDLSYSIEKSVTGWDEKRKRWLELHPSFKPGSENRIVMVTGSQSTPCK  128

Query  72   NPIGDHLLLRLFKNKVDYCRIHGY  1
            NPIGDHLLLR FKNKVDYCRIHG+
Sbjct  129  NPIGDHLLLRCFKNKVDYCRIHGH  152



>emb|CDY49440.1| BnaA09g42270D [Brassica napus]
Length=448

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 102/153 (67%), Gaps = 14/153 (9%)
 Frame = -2

Query  453  CRTPPTF-FSNGFAFAGATVLGVLALWAFMSFL-TPGSGSDFDAGRKSTAFNGVEEKQEC  280
             RT P   F++   F G   + ++ +W+F SF  +P      D    ST         +C
Sbjct  20   ARTRPVICFNDVVLFLGGAFMSLILVWSFFSFSNSPNLTFSPDKTDAST---------KC  70

Query  279  SDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMV  100
            +   +G D  +DP +  FYDDP LSYTI+KP+KNWDEKRK WLE HPSFIPG++NR +M+
Sbjct  71   T---RGIDMRYDPTDPVFYDDPDLSYTIEKPVKNWDEKRKRWLELHPSFIPGSENRTVMI  127

Query  99   TGSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            TGSQ+ PC+NPIGDHLLLR FKNKVDYCRIHG+
Sbjct  128  TGSQSGPCKNPIGDHLLLRFFKNKVDYCRIHGH  160



>ref|XP_009117319.1| PREDICTED: putative glycosyltransferase 7 [Brassica rapa]
Length=448

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 102/153 (67%), Gaps = 14/153 (9%)
 Frame = -2

Query  453  CRTPPTF-FSNGFAFAGATVLGVLALWAFMSFL-TPGSGSDFDAGRKSTAFNGVEEKQEC  280
             RT P   F++   F G   + ++ +W+F SF  +P      D    ST         +C
Sbjct  20   ARTRPVICFNDVVLFLGGAFMSLILVWSFFSFSNSPNLTFSPDKTDAST---------KC  70

Query  279  SDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMV  100
            +   +G D  +DP +  FYDDP LSYTI+KP+KNWDEKRK WLE HPSFIPG++NR +M+
Sbjct  71   T---RGIDMRYDPTDPVFYDDPDLSYTIEKPVKNWDEKRKRWLELHPSFIPGSENRTVMI  127

Query  99   TGSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            TGSQ+ PC+NPIGDHLLLR FKNKVDYCRIHG+
Sbjct  128  TGSQSGPCKNPIGDHLLLRFFKNKVDYCRIHGH  160



>ref|XP_002525290.1| transferase, putative [Ricinus communis]
 gb|EEF37118.1| transferase, putative [Ricinus communis]
Length=446

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 92/144 (64%), Gaps = 7/144 (5%)
 Frame = -2

Query  432  FSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDR  253
            FS+ F + G  +L  L +W+  S+  P       +            KQ C   +   D 
Sbjct  21   FSDTFLYLGGALLSFLIIWSLWSYTAPNINLSDSSSSNL-------RKQTCVQQNPSPDL  73

Query  252  LHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCR  73
             +DPP+  FYDDP LSY+I+KPIKNWDEKRK WLE+HPSF   A +R++MVTGSQ  PC+
Sbjct  74   GYDPPDTTFYDDPDLSYSIEKPIKNWDEKRKRWLEKHPSFSAPARDRVVMVTGSQTKPCK  133

Query  72   NPIGDHLLLRLFKNKVDYCRIHGY  1
            NPIGDH LLR FKNKVDYCRIHGY
Sbjct  134  NPIGDHFLLRFFKNKVDYCRIHGY  157



>ref|XP_011031309.1| PREDICTED: putative glycosyltransferase 7 [Populus euphratica]
 ref|XP_011016265.1| PREDICTED: putative glycosyltransferase 7 [Populus euphratica]
Length=457

 Score =   157 bits (397),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 106/160 (66%), Gaps = 5/160 (3%)
 Frame = -2

Query  477  FLTMASHRCRT-PPTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNG  301
            F  MA    RT P + FS+G  + GA +L  L +W+  S+       +FD    + +   
Sbjct  13   FSPMAKSSVRTKPSSCFSDGSLYLGAALLAFLLVWSLWSY---ALSHNFDPKTSAKSVAN  69

Query  300  VEEKQECSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGA  121
                 EC   +   +  +DPP++ FYDD +LSY+I+KPIKNWDEKRKEWL+ HPSF PGA
Sbjct  70   TH-AHECVQENPEVNLHYDPPDQTFYDDQELSYSIEKPIKNWDEKRKEWLKHHPSFAPGA  128

Query  120  DNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
             +R+++VTGSQ  PC+NPIGDHLLLR FKNKVDYCRIHGY
Sbjct  129  RDRVVLVTGSQPKPCKNPIGDHLLLRFFKNKVDYCRIHGY  168



>ref|XP_006404757.1| hypothetical protein EUTSA_v10000162mg [Eutrema salsugineum]
 gb|ESQ46210.1| hypothetical protein EUTSA_v10000162mg [Eutrema salsugineum]
Length=449

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 103/152 (68%), Gaps = 11/152 (7%)
 Frame = -2

Query  453  CRTPPTF-FSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECS  277
             RT P F FS+   F G   + ++ +W+F SF +      F A +        +E  +CS
Sbjct  20   ARTRPVFCFSDVVLFLGGAFMSLILVWSFFSFSSISPNLSFSAVK-------TDESTKCS  72

Query  276  DGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVT  97
               +G D  +DP +  FYDDP LSYTI+KP+K WDEKR+ WLE HPSFIPG++NR +M+T
Sbjct  73   ---RGIDMRYDPTDPVFYDDPDLSYTIEKPVKGWDEKRRRWLELHPSFIPGSENRTVMIT  129

Query  96   GSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            GSQ+ PC+NPIGDHLLLR FKNKVDYCRIHG+
Sbjct  130  GSQSGPCKNPIGDHLLLRFFKNKVDYCRIHGH  161



>gb|KHG22205.1| Putative glycosyltransferase 7 -like protein [Gossypium arboreum]
Length=452

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 100/163 (61%), Gaps = 8/163 (5%)
 Frame = -2

Query  489  SLPGFLTMASHRCRTPPTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTA  310
            SL  F  MA  R R+     S+ F + G   L +L + +F SF TP           S+A
Sbjct  7    SLSQFSPMAKPRNRSFWCL-SDSFLYCGGVFLAILLVCSFWSFFTPTLNF-------SSA  58

Query  309  FNGVEEKQECSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFI  130
                     C +   G +   DP +  FYDDP+LSY+I+KP+KNWD+KRK+WL  HPSF 
Sbjct  59   ITDPSSAVSCKESGFGVNLKSDPKDLTFYDDPELSYSIEKPVKNWDKKRKQWLNHHPSFA  118

Query  129  PGADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
             GA  RI++VTGSQ  PC+NPIGDHLLLR FKNKVDYCRIHGY
Sbjct  119  AGASERIVVVTGSQPKPCKNPIGDHLLLRSFKNKVDYCRIHGY  161



>emb|CDX72649.1| BnaC07g46710D [Brassica napus]
Length=438

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 97/145 (67%), Gaps = 11/145 (8%)
 Frame = -2

Query  432  FSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDR  253
            F +G  F     + ++ +W++ S  +P S       R+ T      E  +CS    GFD 
Sbjct  15   FRDGVIFFAGAFMSLILVWSYFSIFSPSSNFTLIGFRRGT------EPAKCS----GFDM  64

Query  252  LHDPPEK-NFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPC  76
              DP +  +FYDDP LSY+I++PI  WDEKRK+WLE HPSF PG++NRI+MVTGSQ  PC
Sbjct  65   QFDPEDPGSFYDDPDLSYSIERPITGWDEKRKQWLESHPSFKPGSENRIVMVTGSQPAPC  124

Query  75   RNPIGDHLLLRLFKNKVDYCRIHGY  1
            +NPIGDHLLLR FKNKVDYCRIHG+
Sbjct  125  KNPIGDHLLLRCFKNKVDYCRIHGH  149



>emb|CDP02617.1| unnamed protein product [Coffea canephora]
Length=444

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 98/147 (67%), Gaps = 5/147 (3%)
 Frame = -2

Query  441  PTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQG  262
            PTFF +  +F  A ++ +L  +A  SF T  + ++      ST F+       C+   Q 
Sbjct  11   PTFFRDCRSFILAVLVAILLFYALWSF-TETAWTNLSV---STIFSNTT-TDHCTSQPQS  65

Query  261  FDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQAT  82
             +R HDPPE  FYDDP+L YT+DKPI NWD+KRK WL+ HPSF     +RIL++TGSQ +
Sbjct  66   LNRTHDPPEPTFYDDPELCYTLDKPIDNWDDKRKSWLKLHPSFADNIQDRILLLTGSQPS  125

Query  81   PCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            PC++PIGDHLLLR FKNK DYCRIHGY
Sbjct  126  PCKSPIGDHLLLRGFKNKADYCRIHGY  152



>ref|XP_003539263.1| PREDICTED: galactomannan galactosyltransferase 1-like isoformX1 
[Glycine max]
 ref|XP_006590622.1| PREDICTED: galactomannan galactosyltransferase 1-like isoform 
X2 [Glycine max]
Length=452

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 99/154 (64%), Gaps = 12/154 (8%)
 Frame = -2

Query  459  HRCRTPPTFFSNGFAFAGATVLGVLALWAFMSFLT--PGSGSDFDAGRKSTAFNGVEEKQ  286
            HR +T   F S+G  F G     ++ +W F SF T  P    +F++  K+ A        
Sbjct  21   HRNKTSSVFLSDGSLFLGGAFSALILVWGFSSFTTTIPKETPNFESLTKNDAV-------  73

Query  285  ECSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRIL  106
                G+  F+   DPP++ FYDDP++ YT+DK ++NWDEKR+EWL+ HPSF  GA  R+ 
Sbjct  74   -PHHGTPDFN--FDPPDRTFYDDPQMGYTMDKKVRNWDEKREEWLKLHPSFAAGARERVF  130

Query  105  MVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHG  4
            MVTGSQ  PCRNPIGDHLLLR FKNKVDYCR+HG
Sbjct  131  MVTGSQPKPCRNPIGDHLLLRFFKNKVDYCRLHG  164



>gb|EYU44510.1| hypothetical protein MIMGU_mgv1a018855mg [Erythranthe guttata]
Length=438

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 102/161 (63%), Gaps = 6/161 (4%)
 Frame = -2

Query  468  MASHRCRT-PPTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFD----AGRKSTAFN  304
            MA H  R+   +F S+GF F    ++    +WAF SF  P     F     +G K  + N
Sbjct  1    MAKHNGRSKAASFLSDGFLFVAGAMVAFFFVWAFWSFFAPDPSPAFTTSPLSGMKHGSDN  60

Query  303  GVEEKQECSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKP-IKNWDEKRKEWLEQHPSFIP  127
                         G +   DPPE+ FYDDP+L YTID P +++WD KR+EWL+QHP+F  
Sbjct  61   TPSLNCGGGGVGSGPNLRQDPPEQTFYDDPELKYTIDAPAVQDWDGKRREWLKQHPTFAA  120

Query  126  GADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHG  4
            GA++RI MVTGSQATPC+NPIGD+LLL+LFKNKVDYCR HG
Sbjct  121  GAEDRIFMVTGSQATPCKNPIGDYLLLKLFKNKVDYCRRHG  161



>ref|XP_002310890.2| alpha galactosyltransferase family protein [Populus trichocarpa]
 gb|EEE91340.2| alpha galactosyltransferase family protein [Populus trichocarpa]
Length=457

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 105/160 (66%), Gaps = 5/160 (3%)
 Frame = -2

Query  477  FLTMASHRCRT-PPTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNG  301
            F  MA    RT P + FS+G  + GA +L  L +W+  S+       +FD    + +   
Sbjct  13   FSPMAKSGVRTKPSSCFSDGSLYLGAALLAFLLVWSLWSY---ALSRNFDPKTSAKSVAN  69

Query  300  VEEKQECSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGA  121
                 EC   +      +DPP++ FYDD +LSY+I+KPIKNWDEKRKEWL+ HPSF PGA
Sbjct  70   TH-AHECVQENPEVSLHYDPPDQTFYDDQELSYSIEKPIKNWDEKRKEWLKHHPSFAPGA  128

Query  120  DNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
             +R+++VTGSQ  PC+NPIGDHLLLR FKNKVDYCRIHGY
Sbjct  129  RDRVVLVTGSQPKPCKNPIGDHLLLRFFKNKVDYCRIHGY  168



>ref|XP_010472288.1| PREDICTED: putative glycosyltransferase 7 [Camelina sativa]
Length=455

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 101/153 (66%), Gaps = 15/153 (10%)
 Frame = -2

Query  450  RTPPTF-FSNGFAFAGATVLGVLALWAFMSFLT--PGSGSDFDAGRKSTAFNGVEEKQEC  280
            RT P   FS+   F G   + ++ +W+F SF +  P      D    ST         +C
Sbjct  27   RTKPVICFSDVVLFLGGAFMSLILVWSFFSFSSISPNLTVKTDDSSSST---------KC  77

Query  279  SDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMV  100
                QG D  HDP +  +YDDP LSYTIDKP+KNWDEKR+ WL  HPSFIPGA+NR +MV
Sbjct  78   Y---QGIDTNHDPTDPVYYDDPDLSYTIDKPVKNWDEKRRRWLNLHPSFIPGAENRTVMV  134

Query  99   TGSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            TGSQ++PC+NPIGDHLLLR FKNKVDYCRIHG+
Sbjct  135  TGSQSSPCKNPIGDHLLLRFFKNKVDYCRIHGH  167



>emb|CAI11454.1| alpha-6-galactosyltransferase [Medicago truncatula]
 gb|AES90738.2| galactosyl transferase GMA12/MNN10 family protein [Medicago truncatula]
Length=438

 Score =   154 bits (390),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 98/151 (65%), Gaps = 12/151 (8%)
 Frame = -2

Query  438  TFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQ--  265
            ++ S+G  F    +  +L +W   SF+TP S ++         FN +  K +  + +   
Sbjct  13   SWLSSGCIFILGAMAALLFIWGLSSFITPISNTN-------PKFNSITTKLKSFNFTTNT  65

Query  264  ---GFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTG  94
               G D LHDP +K FYDDP+  YT+DKP+KNWDEKRKEWL  HPSF+ GA  +IL++TG
Sbjct  66   DFAGPDFLHDPSDKTFYDDPQTCYTMDKPVKNWDEKRKEWLLHHPSFVVGASEKILVITG  125

Query  93   SQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            SQ T C NPIGDHLLLR FKNKVDYCRIH +
Sbjct  126  SQPTKCDNPIGDHLLLRFFKNKVDYCRIHNH  156



>ref|XP_009777953.1| PREDICTED: putative glycosyltransferase 7 isoform X1 [Nicotiana 
sylvestris]
Length=431

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 97/158 (61%), Gaps = 10/158 (6%)
 Frame = -2

Query  474  LTMASHRCRTPPTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVE  295
            +T   +R +   +FFS+GF F G T++ VL   A  SF++P          KS   N   
Sbjct  1    MTKQDYRTKVA-SFFSDGFVFVGGTLVAVLVFLAIWSFISPNPSFSTIMMSKSNTLNS--  57

Query  294  EKQECSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADN  115
                    S  F+   D  E  FYDD  L+Y I+KPIKNWDEKR +WL+ HP+F  G   
Sbjct  58   -------KSAVFNLNQDSQEPTFYDDQDLNYGIEKPIKNWDEKRSKWLKLHPTFNHGVKE  110

Query  114  RILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            RIL+V+GSQ+ PC+NP+GDHLLLR +KNKVDYCRIHGY
Sbjct  111  RILVVSGSQSMPCKNPMGDHLLLRFYKNKVDYCRIHGY  148



>ref|XP_003608541.1| Alpha-6-galactosyltransferase [Medicago truncatula]
Length=462

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 98/151 (65%), Gaps = 12/151 (8%)
 Frame = -2

Query  438  TFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQ--  265
            ++ S+G  F    +  +L +W   SF+TP S ++         FN +  K +  + +   
Sbjct  13   SWLSSGCIFILGAMAALLFIWGLSSFITPISNTN-------PKFNSITTKLKSFNFTTNT  65

Query  264  ---GFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTG  94
               G D LHDP +K FYDDP+  YT+DKP+KNWDEKRKEWL  HPSF+ GA  +IL++TG
Sbjct  66   DFAGPDFLHDPSDKTFYDDPQTCYTMDKPVKNWDEKRKEWLLHHPSFVVGASEKILVITG  125

Query  93   SQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            SQ T C NPIGDHLLLR FKNKVDYCRIH +
Sbjct  126  SQPTKCDNPIGDHLLLRFFKNKVDYCRIHNH  156



>ref|XP_007156700.1| hypothetical protein PHAVU_002G009900g [Phaseolus vulgaris]
 gb|ESW28694.1| hypothetical protein PHAVU_002G009900g [Phaseolus vulgaris]
Length=450

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 94/152 (62%), Gaps = 10/152 (7%)
 Frame = -2

Query  456  RCRTPPTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECS  277
            R +T   F S+G  F G     ++ +W F SF T            +   N     Q  +
Sbjct  28   RNKTSSIFLSDGCLFLGGAFSALILVWGFSSFTT----------FPNDTLNLETLSQNDA  77

Query  276  DGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVT  97
               +  D   DPP+K F+DDP++ YTIDK ++NWDEKR+EWL+ HPSF  GA  R+LM+T
Sbjct  78   ASPRTPDLTFDPPDKTFFDDPQMGYTIDKKVRNWDEKREEWLKLHPSFSAGAKERVLMIT  137

Query  96   GSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            GSQ  PCRNPIGDHLLLR FKNKVDYCR+HGY
Sbjct  138  GSQPEPCRNPIGDHLLLRFFKNKVDYCRLHGY  169



>ref|XP_010429224.1| PREDICTED: putative glycosyltransferase 7 [Camelina sativa]
Length=455

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 101/153 (66%), Gaps = 15/153 (10%)
 Frame = -2

Query  450  RTPPTF-FSNGFAFAGATVLGVLALWAFMSFLT--PGSGSDFDAGRKSTAFNGVEEKQEC  280
            RT P   FS+   F G   + ++ +W+F SF +  P      D    ST         +C
Sbjct  27   RTKPVICFSDVVLFLGGAFMSLILVWSFFSFSSISPNLTVKTDDSSSST---------KC  77

Query  279  SDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMV  100
                QG D  HDP +  +YDDP LSYTI+KP+KNWDEKR+ WL  HPSFIPGA+NR +MV
Sbjct  78   Y---QGIDTNHDPTDPVYYDDPDLSYTIEKPVKNWDEKRRRWLNLHPSFIPGAENRTVMV  134

Query  99   TGSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            TGSQ++PC+NPIGDHLLLR FKNKVDYCRIHG+
Sbjct  135  TGSQSSPCKNPIGDHLLLRFFKNKVDYCRIHGH  167



>gb|KHN36310.1| Galactomannan galactosyltransferase 1 [Glycine soja]
Length=417

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 99/160 (62%), Gaps = 13/160 (8%)
 Frame = -2

Query  474  LTMAS-HRCRTPPTFFSNGFAFAGATVLGVLALWAFMSFLT--PGSGSDFDAGRKSTAFN  304
            + MA  HR ++   F S+G  F G     ++ +W F SF T  P    +F++  K+ A  
Sbjct  18   MMMAKPHRNKSSSLFLSDGCLFLGGAFSALILVWGFSSFTTTIPNDTPNFESLSKNDA--  75

Query  303  GVEEKQECSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPG  124
                    +      D   DPP++ FYDDP++ YT+DK ++NWDEKR+EWL+ HPSF  G
Sbjct  76   --------ASHHIAPDFNFDPPDRTFYDDPQMGYTMDKKVRNWDEKREEWLKLHPSFAAG  127

Query  123  ADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHG  4
            A  R+ MVTGSQ  PCRNP GDHLLLR FKNKVDYCR+HG
Sbjct  128  ARERVFMVTGSQPKPCRNPTGDHLLLRFFKNKVDYCRLHG  167



>emb|CAI11452.1| alpha-6-galactosyltransferase [Solanum tuberosum]
Length=443

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 92/140 (66%), Gaps = 8/140 (6%)
 Frame = -2

Query  420  FAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDRLHDP  241
            FA A   VL V A+W+F   L   SG  +     S  +        C  G +  DR  DP
Sbjct  21   FAAAIVAVLLVCAIWSFTDPLPNLSGLLYSQSISSPDY--------CPPGREAVDRSSDP  72

Query  240  PEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCRNPIG  61
             EK FYD+P+LSYTI+KPIKNWDEKR +WL+ HPSF  G  NR+L+++GSQ TPC+N  G
Sbjct  73   LEKTFYDEPELSYTINKPIKNWDEKRVQWLKLHPSFAAGRVNRVLLLSGSQPTPCKNARG  132

Query  60   DHLLLRLFKNKVDYCRIHGY  1
            DHLLLR FKNKVDYCRIHGY
Sbjct  133  DHLLLRFFKNKVDYCRIHGY  152



>ref|XP_003517354.1| PREDICTED: galactomannan galactosyltransferase 1-like [Glycine 
max]
Length=449

 Score =   152 bits (384),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 99/160 (62%), Gaps = 13/160 (8%)
 Frame = -2

Query  474  LTMAS-HRCRTPPTFFSNGFAFAGATVLGVLALWAFMSFLT--PGSGSDFDAGRKSTAFN  304
            + MA  HR ++   F S+G  F G     ++ +W F SF T  P    +F++  K+ A  
Sbjct  18   MMMAKPHRNKSSSLFLSDGCLFLGGAFSALILVWGFSSFTTTIPNDTPNFESLSKNDA--  75

Query  303  GVEEKQECSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPG  124
                    +      D   DPP++ FYDDP++ YT+DK ++NWDEKR+EWL+ HPSF  G
Sbjct  76   --------ASHHIAPDFNFDPPDRTFYDDPQMGYTMDKKVRNWDEKREEWLKLHPSFAAG  127

Query  123  ADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHG  4
            A  R+ MVTGSQ  PCRNP GDHLLLR FKNKVDYCR+HG
Sbjct  128  ARERVFMVTGSQPKPCRNPTGDHLLLRFFKNKVDYCRLHG  167



>gb|ACH58908.1| galactosyl transferase [Coffea canephora]
Length=444

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 95/147 (65%), Gaps = 5/147 (3%)
 Frame = -2

Query  441  PTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQG  262
            PTFF +  +F  A ++ +L  +A  SF T  + ++       +A         C+   Q 
Sbjct  11   PTFFRDCRSFILAVLVAILLFYALWSF-TETAWTNLSV----SAIFSNTTTDHCTSQPQS  65

Query  261  FDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQAT  82
             +R HDPPE  FYDDP+L YT+DKPI NWD+KRK WL+ HPSF     +RIL++TGSQ +
Sbjct  66   LNRAHDPPEPTFYDDPELCYTLDKPIDNWDDKRKSWLKLHPSFADSIQDRILLLTGSQPS  125

Query  81   PCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            PC++PIGDHLLLR  KNK DYCRIHGY
Sbjct  126  PCKSPIGDHLLLRGSKNKADYCRIHGY  152



>ref|XP_009618872.1| PREDICTED: putative glycosyltransferase 7 [Nicotiana tomentosiformis]
Length=443

 Score =   152 bits (383),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 114/176 (65%), Gaps = 19/176 (11%)
 Frame = -2

Query  519  VICAHKMVL-SSLPGFLTMASHRCRTPPTFFSNGFAFAGATVLGVLALWAFMSFLTPG-S  346
            +I  HKMV  +  P  +T   +R +   +FFS+ F F G T++ +L L A  SF++P  S
Sbjct  1    MIDLHKMVSHNDAPRSITKQDYRTKVS-SFFSDWFVFVGGTLVALLVLLALWSFISPNPS  59

Query  345  GSDFDAGRKSTA-FNGVEEKQECSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDE  169
             S     + +T  FN  ++ QE +               +FYDDP L+Y+I+KPIKNWDE
Sbjct  60   FSTIIISKSNTLDFNLNQDSQEAA---------------SFYDDPDLNYSIEKPIKNWDE  104

Query  168  KRKEWLEQHPSFIPGADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            KR +WL+ HP+F PG   RIL+V+GSQ+TPC+NPIGDHLLLR FKNKVDYCRIHGY
Sbjct  105  KRNKWLKLHPTFNPGIKERILVVSGSQSTPCKNPIGDHLLLRFFKNKVDYCRIHGY  160



>gb|KDO78929.1| hypothetical protein CISIN_1g045999mg [Citrus sinensis]
Length=438

 Score =   151 bits (382),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 98/152 (64%), Gaps = 7/152 (5%)
 Frame = -2

Query  456  RCRTPPTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECS  277
            R +T P   ++GF F G     +L +W+F S L   S   FD    ST  +  +   E  
Sbjct  19   RNKTHPCL-TDGFLFLGGAFFALLIVWSFSSLLN--SAPRFD----STPLSEAKATSEAR  71

Query  276  DGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVT  97
                  +  +DPP++ FYDD +LSY+I+K I++WDEKRK WL+ HPSF  GA  R+++VT
Sbjct  72   SPGCAANLRYDPPDETFYDDQELSYSIEKKIEDWDEKRKRWLKLHPSFAAGARERVVLVT  131

Query  96   GSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            GSQ  PC+NPIGDHLLLR FKNKVDYCRIHGY
Sbjct  132  GSQPKPCKNPIGDHLLLRFFKNKVDYCRIHGY  163



>emb|CAD98924.1| galactomannan galactosyltransferase [Lotus japonicus]
Length=437

 Score =   151 bits (382),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 89/143 (62%), Gaps = 0/143 (0%)
 Frame = -2

Query  435  FFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFD  256
            + S+G  F    +  +L +W   SF+ P   +D      +     +   +     S   D
Sbjct  13   WLSDGCCFLTGALSALLLVWGLCSFIIPFPNTDPKLNSVAAKLKSLNLPRNQITTSSAQD  72

Query  255  RLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPC  76
             L+D PE  FYDDP++SYT+DKP+ NWDEKR++WL  HPSF  GA +RIL+VTGSQ   C
Sbjct  73   LLYDSPETTFYDDPEMSYTMDKPVTNWDEKRRQWLLHHPSFAAGASDRILLVTGSQPKRC  132

Query  75   RNPIGDHLLLRLFKNKVDYCRIH  7
             NPIGDHLLLR FKNKVDYCRIH
Sbjct  133  HNPIGDHLLLRFFKNKVDYCRIH  155



>ref|XP_010417049.1| PREDICTED: putative glycosyltransferase 7 [Camelina sativa]
Length=466

 Score =   152 bits (383),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 100/151 (66%), Gaps = 8/151 (5%)
 Frame = -2

Query  450  RTPPTF-FSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSD  274
            RT P   FS+   F G   + ++ +W+F SF +       +   K+   +      +C  
Sbjct  35   RTKPVICFSDVVLFLGGAFMSLILVWSFFSFSSISP----NLTVKTDDSSSSSTSTKCY-  89

Query  273  GSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTG  94
              QG D  HDP +  +YDDP LSYTI+KP+KNWDEKR+ WL  HPSFIPGA+NR +MVTG
Sbjct  90   --QGIDTNHDPTDPVYYDDPDLSYTIEKPVKNWDEKRRRWLNLHPSFIPGAENRTVMVTG  147

Query  93   SQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            SQ+ PC+NPIGDHLLLR FKNKVDYCRIHG+
Sbjct  148  SQSAPCKNPIGDHLLLRFFKNKVDYCRIHGH  178



>ref|XP_006426098.1| hypothetical protein CICLE_v10025585mg [Citrus clementina]
 gb|ESR39338.1| hypothetical protein CICLE_v10025585mg [Citrus clementina]
Length=452

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 98/152 (64%), Gaps = 7/152 (5%)
 Frame = -2

Query  456  RCRTPPTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECS  277
            R +T P   ++GF F G     +L +W+F S L   S   FD    ST  +  +   E  
Sbjct  19   RNKTHPCL-TDGFLFLGGAFFALLIVWSFSSLLN--SAPRFD----STPLSEAKATSEAR  71

Query  276  DGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVT  97
                  +  +DPP++ FYDD +LSY+I+K I++WDEKRK WL+ HPSF  GA  R+++VT
Sbjct  72   SPGCAANLRYDPPDETFYDDQELSYSIEKKIEDWDEKRKRWLKLHPSFAAGARERVVLVT  131

Query  96   GSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            GSQ  PC+NPIGDHLLLR FKNKVDYCRIHGY
Sbjct  132  GSQPKPCKNPIGDHLLLRFFKNKVDYCRIHGY  163



>ref|XP_006466460.1| PREDICTED: putative glycosyltransferase 7-like [Citrus sinensis]
Length=452

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 98/152 (64%), Gaps = 7/152 (5%)
 Frame = -2

Query  456  RCRTPPTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECS  277
            R +T P   ++GF F G     +L +W+F S L   S   FD    ST  +  +   E  
Sbjct  19   RNKTHPCL-TDGFLFLGGAFFALLIVWSFSSLLN--SAPRFD----STPLSEAKATSEAR  71

Query  276  DGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVT  97
                  +  +DPP++ FYDD +LSY+I+K I++WDEKRK WL+ HPSF  GA  R+++VT
Sbjct  72   SPGCAANLRYDPPDETFYDDQELSYSIEKKIEDWDEKRKRWLKLHPSFAAGARERVVLVT  131

Query  96   GSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            GSQ  PC+NPIGDHLLLR FKNKVDYCRIHGY
Sbjct  132  GSQPKPCKNPIGDHLLLRFFKNKVDYCRIHGY  163



>ref|XP_002880469.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH56728.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=434

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 96/152 (63%), Gaps = 13/152 (9%)
 Frame = -2

Query  453  CRTPPTF-FSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECS  277
             RT P   FS+   F G   + ++ +W+F SF +                  V+  +  +
Sbjct  7    ARTRPVICFSDVVLFLGGAFMSLILVWSFFSFYSISPNLT------------VKTNETSA  54

Query  276  DGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVT  97
              S   D  +DP +  +YD+P L+YTI+KP+KNWDEKR+ WL  HPSFI GA+NR +MVT
Sbjct  55   KCSPEIDMKYDPTDPVYYDEPDLTYTIEKPVKNWDEKRRRWLNLHPSFIIGAENRTVMVT  114

Query  96   GSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            GSQ+ PC+NPIGDHLLLR FKNKVDYCRIHG+
Sbjct  115  GSQSAPCKNPIGDHLLLRFFKNKVDYCRIHGH  146



>emb|CAI11453.1| alpha-6-galactosyltransferase [Nicotiana benthamiana]
Length=443

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = -2

Query  306  NGVEEKQECSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIP  127
              V   + C    +  DR++DPPEK FYDDP LSYTI+KPIKNW+EKR EWL+ HPSF  
Sbjct  51   QNVTSPEYCPPDREAVDRIYDPPEKTFYDDPDLSYTINKPIKNWEEKRIEWLKLHPSFAA  110

Query  126  GADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            G   R+L++TGSQ TPC+ PIGDHLLLR FKNKVDYCRIHGY
Sbjct  111  GRAKRVLLLTGSQPTPCKYPIGDHLLLRFFKNKVDYCRIHGY  152



>ref|XP_010432039.1| PREDICTED: glycosyltransferase 6 [Camelina sativa]
Length=429

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 89/142 (63%), Gaps = 9/142 (6%)
 Frame = -2

Query  426  NGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDRLH  247
            N   F    +  +  +W++  F +P S         +    G+   +E      G +   
Sbjct  9    NSVIFFAGALTSLTLIWSYFLFFSPSS---------NFTITGLLHDKEPVKKCSGLNMQF  59

Query  246  DPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCRNP  67
            DPPE   YDDP LSY+IDK I NWDEKR +WLE HPSF PG +NRI+MVTGSQ++PC+NP
Sbjct  60   DPPEPGLYDDPDLSYSIDKSITNWDEKRHQWLESHPSFKPGLENRIVMVTGSQSSPCKNP  119

Query  66   IGDHLLLRLFKNKVDYCRIHGY  1
            IGDHLLLR FKNKVDY RIHG+
Sbjct  120  IGDHLLLRCFKNKVDYARIHGH  141



>ref|NP_565544.1| putative glycosyltransferase 7 [Arabidopsis thaliana]
 sp|O81007.1|GT7_ARATH RecName: Full=Putative glycosyltransferase 7; Short=AtGT7 [Arabidopsis 
thaliana]
 gb|AAC32437.1| Expressed protein [Arabidopsis thaliana]
 emb|CAC01675.1| putative golgi glycosyltransferase [Arabidopsis thaliana]
 gb|AAK59529.1| unknown protein [Arabidopsis thaliana]
 gb|AAL15201.1| unknown protein [Arabidopsis thaliana]
 gb|AEC07370.1| putative glycosyltransferase 7 [Arabidopsis thaliana]
 gb|AHL38845.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=449

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 87/125 (70%), Gaps = 3/125 (2%)
 Frame = -2

Query  375  AFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDRLHDPPEKNFYDDPKLSYTI  196
            AFMS +   S   F +   +      E   +CS    G D   DP +  +YDDP L+YTI
Sbjct  40   AFMSLILVWSFFSFSSISPNLTVKNEESSNKCS---SGIDMSQDPTDPVYYDDPDLTYTI  96

Query  195  DKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYC  16
            +KP+KNWDEKR+ WL  HPSFIPGA+NR +MVTGSQ+ PC+NPIGDHLLLR FKNKVDYC
Sbjct  97   EKPVKNWDEKRRRWLNLHPSFIPGAENRTVMVTGSQSAPCKNPIGDHLLLRFFKNKVDYC  156

Query  15   RIHGY  1
            RIHG+
Sbjct  157  RIHGH  161



>sp|Q564G7.1|GMGT1_CYATE RecName: Full=Galactomannan galactosyltransferase 1 [Cyamopsis 
tetragonoloba]
 emb|CAI79402.1| galactomannan galactosyltransferase [Cyamopsis tetragonoloba]
Length=435

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 92/147 (63%), Gaps = 1/147 (1%)
 Frame = -2

Query  441  PTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQG  262
            P + SNG  F       +L LW   SF+ P   +D      +T+   +   +  +  +  
Sbjct  11   PKWISNGCCFLLGAFTALLLLWGLCSFIIPIPNTDPKLNSVATSLRSLNFPKNPA-ATLP  69

Query  261  FDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQAT  82
             +  HDPP+  FYDDP+ SYT+DKP+KNWDEKRKEWL  HPSF   A ++IL+VTGSQ  
Sbjct  70   PNLQHDPPDTTFYDDPETSYTMDKPMKNWDEKRKEWLLHHPSFGAAARDKILLVTGSQPK  129

Query  81   PCRNPIGDHLLLRLFKNKVDYCRIHGY  1
             C NPIGDHLLLR FKNKVDYCR+H Y
Sbjct  130  RCHNPIGDHLLLRFFKNKVDYCRLHNY  156



>ref|XP_009761596.1| PREDICTED: glycosyltransferase 6-like [Nicotiana sylvestris]
Length=443

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 90/135 (67%), Gaps = 5/135 (4%)
 Frame = -2

Query  405  ATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDRLHDPPEKNF  226
            A ++ +L + A  SF  P     F       +   V   + C    +  DR +DPPEK F
Sbjct  23   AAIVALLLVCAIWSFTDP-----FPNFSNFLSKQNVTSPEYCPPDREAVDRRYDPPEKTF  77

Query  225  YDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCRNPIGDHLLL  46
            YDDP+LSYTI+KPIKNWD+KR +WL+ HP+F  G  NR+L++TGSQ TPC+ P GDHLLL
Sbjct  78   YDDPELSYTINKPIKNWDDKRIQWLKLHPTFAAGRANRVLLLTGSQPTPCKYPKGDHLLL  137

Query  45   RLFKNKVDYCRIHGY  1
            R FKNKVDYCRIHGY
Sbjct  138  RFFKNKVDYCRIHGY  152



>ref|XP_009607432.1| PREDICTED: glycosyltransferase 6-like [Nicotiana tomentosiformis]
Length=443

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 89/135 (66%), Gaps = 5/135 (4%)
 Frame = -2

Query  405  ATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDRLHDPPEKNF  226
            A ++ +L + A  SF  P     F       +   V   + C    +  DR +DPPEK F
Sbjct  23   AAIVALLLVCAIWSFTDP-----FPNFSNFLSKQNVTSPEYCPPDREAVDRRYDPPEKTF  77

Query  225  YDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCRNPIGDHLLL  46
            YDDP+LSYTI+KPIKNWDEKR +WL+ HPSF  G  NR+L++TGSQ TPC+ P GDHLLL
Sbjct  78   YDDPELSYTINKPIKNWDEKRIQWLKFHPSFAAGRANRVLLLTGSQPTPCKYPKGDHLLL  137

Query  45   RLFKNKVDYCRIHGY  1
            R FKNKVDYCRIH Y
Sbjct  138  RFFKNKVDYCRIHSY  152



>ref|XP_007205195.1| hypothetical protein PRUPE_ppa005681mg [Prunus persica]
 gb|EMJ06394.1| hypothetical protein PRUPE_ppa005681mg [Prunus persica]
Length=448

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 96/148 (65%), Gaps = 5/148 (3%)
 Frame = -2

Query  444  PPTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQ  265
            P ++ ++   F     L +L L+ F SF++  S  +F  GR  T+     E  +C+D + 
Sbjct  18   PSSWLADSLLFLSGAFLALLVLFTFYSFVSTYSSPNF--GRTVTSPPPTAEPDQCADDA-  74

Query  264  GFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQA  85
              +   DPP+  FYDD ++ YT+  P++NWDEKR++WL  HPS  PGA  RILMVTGSQ 
Sbjct  75   --NLRRDPPDPTFYDDREVRYTLGDPVQNWDEKRRQWLLLHPSLAPGAGERILMVTGSQP  132

Query  84   TPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
              CRNPIGDHLLLR FKNKVDYCR+HG+
Sbjct  133  AACRNPIGDHLLLRFFKNKVDYCRLHGH  160



>ref|XP_009345079.1| PREDICTED: putative glycosyltransferase 7 [Pyrus x bretschneideri]
Length=442

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 97/149 (65%), Gaps = 15/149 (10%)
 Frame = -2

Query  441  PTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQG  262
            P+  ++GF F G   L +  +WAF++F+ P + S FD+     A+N          G  G
Sbjct  22   PSLIADGFLFVGGASLALSVVWAFLTFINPTTIS-FDS---ILAWNA---------GPCG  68

Query  261  FDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGA--DNRILMVTGSQ  88
             D   DPPE  FYDD  LSY   +P+K+WD KR+EWL+ HPSF  GA  DNR+L+VTGSQ
Sbjct  69   PDLSSDPPEPTFYDDENLSYAFGEPVKDWDSKRREWLKLHPSFAAGAEADNRVLLVTGSQ  128

Query  87   ATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
             T C+NP+GDHL LR FKNKVDYCRIHG+
Sbjct  129  PTACKNPVGDHLQLRFFKNKVDYCRIHGH  157



>gb|KHG22229.1| Putative glycosyltransferase 7 -like protein [Gossypium arboreum]
Length=456

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 92/142 (65%), Gaps = 2/142 (1%)
 Frame = -2

Query  426  NGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDRLH  247
            + F   G   L +L + +F SF TP    +       +  N      +CS+   G +   
Sbjct  28   DAFLVFGVAFLALLLVASFWSFFTPTPNFEPTVTDPPSKLNM--NPVDCSESGFGVNLKS  85

Query  246  DPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCRNP  67
            DP    FYDDP++SY+++KP+K+WD+KR EWL+QHPSF  GA  RI++VTGSQ  PC+NP
Sbjct  86   DPKNPTFYDDPEMSYSLEKPVKDWDKKRAEWLKQHPSFAAGARERIVLVTGSQPKPCKNP  145

Query  66   IGDHLLLRLFKNKVDYCRIHGY  1
            IGDHLLLR FKNKVDYCRIHGY
Sbjct  146  IGDHLLLRFFKNKVDYCRIHGY  167



>ref|XP_010437192.1| PREDICTED: glycosyltransferase 6-like [Camelina sativa]
Length=429

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 89/142 (63%), Gaps = 9/142 (6%)
 Frame = -2

Query  426  NGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDRLH  247
            N   F       +  +W++  F +  S         + A  G+   +E      G D   
Sbjct  9    NSVIFFAGAFTSLTLIWSYFLFFSASS---------NFAITGLLHDKEPVKKCSGLDMQF  59

Query  246  DPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCRNP  67
            DPPE  FYDDP LSY+I++ I NWDEKR +W+E HPSF PG +NRI+MVTGSQ++PC+NP
Sbjct  60   DPPEPGFYDDPDLSYSIERSITNWDEKRYQWIESHPSFKPGLENRIVMVTGSQSSPCKNP  119

Query  66   IGDHLLLRLFKNKVDYCRIHGY  1
            IGDHLLLR FKNKVDY RIHG+
Sbjct  120  IGDHLLLRCFKNKVDYARIHGH  141



>ref|XP_008363062.1| PREDICTED: glycosyltransferase 6-like [Malus domestica]
Length=442

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 95/148 (64%), Gaps = 15/148 (10%)
 Frame = -2

Query  441  PTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQG  262
            P+  ++GF F G   L +  +WA ++F+ P + S FD      A+N          G  G
Sbjct  22   PSLIADGFLFVGGASLALSVVWALLTFINPTTIS-FD---NFIAWNA---------GPCG  68

Query  261  FDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGA--DNRILMVTGSQ  88
             D   DPPE  FYDD  LSY   +P+K+WD KRKEWL+ HPSF  GA  DNR+L+VTGSQ
Sbjct  69   PDLRSDPPETTFYDDENLSYAFGEPVKDWDSKRKEWLKLHPSFAAGAAVDNRVLLVTGSQ  128

Query  87   ATPCRNPIGDHLLLRLFKNKVDYCRIHG  4
             T C+NP+GDHL +RLFKNKVDYCRIHG
Sbjct  129  PTVCKNPVGDHLQMRLFKNKVDYCRIHG  156



>ref|XP_010274411.1| PREDICTED: galactomannan galactosyltransferase 1-like [Nelumbo 
nucifera]
Length=467

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 99/162 (61%), Gaps = 9/162 (6%)
 Frame = -2

Query  462  SHRCRTPPTFFSNGFAFAGATVLGVL---ALWA-FMSFLTPGSGSDFDAGRKSTAFNGVE  295
            S+RC+   +  ++   F G  ++ +L   ALW+  M    P         R   + + V 
Sbjct  21   SYRCKISSSL-TDAILFVGGVMVALLLFCALWSSIMPVPNPTPTFSSAVTRPKPSVSEVF  79

Query  294  EKQECSDG--SQGFDRLHDPPEKNFYDDPKLSYTIDK--PIKNWDEKRKEWLEQHPSFIP  127
               +C+    S   +R HDP    FYDDP LSY +DK  PIKNWD+KR+EWL+ HP F P
Sbjct  80   ASDDCAQVVVSMRVNRSHDPSSPTFYDDPNLSYYVDKDKPIKNWDKKRREWLKHHPYFSP  139

Query  126  GADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            G   RIL+V+GSQ +PC+NPIGDHLLLR FKNKVDYCRIHGY
Sbjct  140  GIQERILLVSGSQPSPCQNPIGDHLLLRFFKNKVDYCRIHGY  181



>ref|XP_003611556.1| Galactomannan galactosyltransferase [Medicago truncatula]
 gb|AES94514.1| galactosyl transferase GMA12/MNN10 family protein [Medicago truncatula]
Length=446

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 93/152 (61%), Gaps = 10/152 (7%)
 Frame = -2

Query  456  RCRTPPTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECS  277
            R ++   F S+GF F G     +L +W F SF  P    +     KS   N V       
Sbjct  21   RNKSSSIFLSDGFLFLGGAFSALLLVWGFSSFTNPIPNDNLTL--KSHKNNVVSYSTP--  76

Query  276  DGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVT  97
                  D   DPP++ FYDDP++ YT+   +++WDEKR+EWL+ HPSF  GA  R+LMVT
Sbjct  77   ------DLRFDPPDQTFYDDPEMEYTMSVKLEDWDEKREEWLKHHPSFSAGAKERVLMVT  130

Query  96   GSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            GSQ +PC+NPIGDHLLLR FKNKVDY RIHGY
Sbjct  131  GSQPSPCKNPIGDHLLLRFFKNKVDYSRIHGY  162



>ref|NP_680773.1| glycosyltransferase 6 [Arabidopsis thaliana]
 sp|Q9SZG1.1|GT6_ARATH RecName: Full=Glycosyltransferase 6; Short=AtGT6 [Arabidopsis 
thaliana]
 emb|CAB38308.1| putative protein [Arabidopsis thaliana]
 emb|CAB80434.1| putative protein [Arabidopsis thaliana]
 gb|ABH04623.1| At4g37690 [Arabidopsis thaliana]
 gb|AEE86828.1| glycosyltransferase 6 [Arabidopsis thaliana]
 gb|AHL38658.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=432

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 91/144 (63%), Gaps = 14/144 (10%)
 Frame = -2

Query  432  FSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDR  253
             S+G  F     + +  +W++ S  +P   S    G+            +CS    G D 
Sbjct  15   LSDGVFFLAGAFMSLTLVWSYFSIFSPSFTSLRHDGKPV----------QCS----GLDM  60

Query  252  LHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCR  73
              DP E  FYDDP LSY+I+KPI  WDEKR +W E HPSF PG++NRI+MVTGSQ++PC+
Sbjct  61   QFDPSEPGFYDDPDLSYSIEKPITKWDEKRNQWFESHPSFKPGSENRIVMVTGSQSSPCK  120

Query  72   NPIGDHLLLRLFKNKVDYCRIHGY  1
            NPIGDHLLLR FKNKVDY RIHG+
Sbjct  121  NPIGDHLLLRCFKNKVDYARIHGH  144



>ref|XP_010446636.1| PREDICTED: LOW QUALITY PROTEIN: glycosyltransferase 6 [Camelina 
sativa]
Length=428

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 89/142 (63%), Gaps = 9/142 (6%)
 Frame = -2

Query  426  NGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDRLH  247
            N   F    +  +  LW++    +P S         +    G+   ++      G D   
Sbjct  9    NSIIFFAGALTSLTLLWSYFLIFSPSS---------NFTITGLLHDKQPVKKCSGLDMQF  59

Query  246  DPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCRNP  67
            DPPE  FYDDP LSY+I++ I NWDEKR +WLE HPSF PG +NRI++VTGSQ++PC+NP
Sbjct  60   DPPEPGFYDDPDLSYSIERSITNWDEKRHQWLESHPSFKPGLENRIVIVTGSQSSPCKNP  119

Query  66   IGDHLLLRLFKNKVDYCRIHGY  1
            IGDHLLLR FKNKVDY RIHG+
Sbjct  120  IGDHLLLRCFKNKVDYARIHGH  141



>ref|XP_002868971.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH45230.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=436

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 92/144 (64%), Gaps = 10/144 (7%)
 Frame = -2

Query  432  FSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDR  253
             S+G  F     + +  +W++ S  +P     F   R         E  +CS    G + 
Sbjct  15   LSDGAIFLAGAFMSLTLVWSYFSIFSPSFTFTFTGLRHGG------EPVQCS----GLNM  64

Query  252  LHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCR  73
              DP E  FYDDP+LSY+I+K I NWDEKR +W + HPSF PG++NRILMVTGSQ++PC+
Sbjct  65   QLDPREPGFYDDPELSYSIEKSITNWDEKRHQWFKSHPSFKPGSENRILMVTGSQSSPCK  124

Query  72   NPIGDHLLLRLFKNKVDYCRIHGY  1
            NPIGDHLLLR FKNKVDY RIHG+
Sbjct  125  NPIGDHLLLRCFKNKVDYARIHGH  148



>ref|XP_004511818.1| PREDICTED: galactomannan galactosyltransferase 1-like [Cicer 
arietinum]
Length=458

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 96/161 (60%), Gaps = 18/161 (11%)
 Frame = -2

Query  471  TMA--SHRCRTPPTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGV  298
            TMA  + R ++   F S+G  F G     +L +W F SF              + + N  
Sbjct  28   TMAKPTFRNKSSSIFLSDGLLFLGGAFSALLLVWGFSSF--------------TNSINNP  73

Query  297  EEKQECSD--GSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPG  124
              K   +D       D L DP +  FYD+P++ YTID  ++NWDEKR+EWL+ HPSF  G
Sbjct  74   NLKLHQNDVISYSTPDLLSDPLDPTFYDEPEMGYTIDDKVQNWDEKREEWLKLHPSFSAG  133

Query  123  ADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
               R+LMVTGSQ +PCRNPIGDHLLLR FKNKVDYCRIHGY
Sbjct  134  VKERVLMVTGSQPSPCRNPIGDHLLLRCFKNKVDYCRIHGY  174



>ref|XP_006294199.1| hypothetical protein CARUB_v10023195mg [Capsella rubella]
 gb|EOA27097.1| hypothetical protein CARUB_v10023195mg [Capsella rubella]
Length=452

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 98/153 (64%), Gaps = 14/153 (9%)
 Frame = -2

Query  450  RTPPTF-FSNGFAFAGATVLGVLALWAFMSFLT--PGSGSDFDAGRKSTAFNGVEEKQEC  280
            RT P   FS+   F G   + ++ +W+F SF +  P      D    S+         +C
Sbjct  23   RTRPVICFSDVVLFLGGAFMSLILVWSFFSFSSISPNLTVKTDGSSSSST--------KC  74

Query  279  SDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMV  100
                 G D  HDP +  +YDD  LSYTI+KP+KNWDEKR+ W   HPSFIPGA+NR +MV
Sbjct  75   Y---HGIDTNHDPTDPVYYDDSDLSYTIEKPVKNWDEKRRRWFNLHPSFIPGAENRTVMV  131

Query  99   TGSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            TGSQ++PC+NPIGDHLLLR FKNKVDYCRIHG+
Sbjct  132  TGSQSSPCKNPIGDHLLLRFFKNKVDYCRIHGH  164



>ref|XP_009361779.1| PREDICTED: glycosyltransferase 6-like [Pyrus x bretschneideri]
Length=442

 Score =   146 bits (369),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 93/148 (63%), Gaps = 15/148 (10%)
 Frame = -2

Query  441  PTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQG  262
            P+  ++GF F G   L +  +WA ++F+ P + S FD      A            G  G
Sbjct  22   PSLIADGFLFVGGASLALSVVWALLTFINPTTIS-FDNIITWNA------------GPCG  68

Query  261  FDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGA--DNRILMVTGSQ  88
             D   DPPE  FYDD  LSY   +P+K+WD KR+EWL+ HPSF  GA  DNR+L+VTGSQ
Sbjct  69   PDLRSDPPEPTFYDDENLSYAFGEPVKDWDSKRREWLKLHPSFAAGAAVDNRVLLVTGSQ  128

Query  87   ATPCRNPIGDHLLLRLFKNKVDYCRIHG  4
             T C+NP+GDHL LRLFKNKVDYCRIHG
Sbjct  129  PTVCKNPVGDHLQLRLFKNKVDYCRIHG  156



>ref|XP_008392336.1| PREDICTED: putative glycosyltransferase 7 [Malus domestica]
Length=442

 Score =   146 bits (368),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 93/148 (63%), Gaps = 15/148 (10%)
 Frame = -2

Query  441  PTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQG  262
            P+  ++GF F G   L +  +WA ++F+ P + S FD      A+N          G  G
Sbjct  22   PSLIADGFLFVGGASLALSVVWALLTFINPTTIS-FD---NXIAWNA---------GPCG  68

Query  261  FDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGA--DNRILMVTGSQ  88
             D   DPPE  FYDD  LSY   +P+K+WD KR EWL+ HPSF  GA  DNR+L+VTGSQ
Sbjct  69   PDLRSDPPEXTFYDDENLSYAFGEPVKDWDSKRXEWLKLHPSFAAGAAVDNRVLLVTGSQ  128

Query  87   ATPCRNPIGDHLLLRLFKNKVDYCRIHG  4
             T C+NP+GDHL  RLFKNKVDYCRIHG
Sbjct  129  PTVCKNPVGDHLQXRLFKNKVDYCRIHG  156



>gb|KDP32091.1| hypothetical protein JCGZ_12552 [Jatropha curcas]
Length=453

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 98/148 (66%), Gaps = 6/148 (4%)
 Frame = -2

Query  444  PPTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQ  265
            P + F++ F + G  +L  L +W+  S+  P   S F+     T +      QE      
Sbjct  23   PSSCFTDIFRYLGGGLLAFLLVWSLWSYAGPDISSSFEP--IITDYRSKVSLQE----EP  76

Query  264  GFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQA  85
              +  +DPP++ FYDDP+L Y+I+  +K+WDEKRKEWL+ HPSF  GA +R++MVTGSQ+
Sbjct  77   AVNLRYDPPDRTFYDDPELRYSIESKVKDWDEKRKEWLKHHPSFAAGARDRVVMVTGSQS  136

Query  84   TPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            +PC+NPIGDH LLR FKNKVDYCRIHGY
Sbjct  137  SPCKNPIGDHFLLRFFKNKVDYCRIHGY  164



>ref|XP_011073681.1| PREDICTED: glycosyltransferase 6 [Sesamum indicum]
Length=466

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 102/170 (60%), Gaps = 13/170 (8%)
 Frame = -2

Query  474  LTMASHRCRTPPT-FFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAF-NG  301
             +MA +  R+ P  F S+G  F G  ++  L +WAF SF +P           S    +G
Sbjct  12   FSMAKNNGRSKPRGFLSDGVIFCGGALVAFLVVWAFWSFFSPSPSPTPSFSTSSFKLPHG  71

Query  300  VEEKQE----------CSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPI-KNWDEKRKEW  154
             E              C+      + LHD PE NFYDDP LSY ID P+ KNWDEKR+EW
Sbjct  72   SETSSSSSPSAAASSTCAYNVSSPNPLHDLPEPNFYDDPGLSYRIDAPVVKNWDEKRREW  131

Query  153  LEQHPSFIPGADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHG  4
            L+QHP+   GA+NR+LMVTGSQA PC+NPIGD+LLL+ FKNKVDY R HG
Sbjct  132  LKQHPALAAGAENRVLMVTGSQAKPCKNPIGDYLLLKFFKNKVDYSRRHG  181



>emb|CAB52246.1| alpha galactosyltransferase [Trigonella foenum-graecum]
Length=438

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 92/151 (61%), Gaps = 13/151 (9%)
 Frame = -2

Query  435  FFSNGFAFAGATVLGVLALWAFMSFLTPGSGSD-----FDAGRKSTAFNGVEEKQECSDG  271
            + SNG  F    +  +L +W   SF+ P   S+     F    KS  F         +  
Sbjct  13   WLSNGCIFLLGAMSALLMIWGLNSFIAPIPNSNPKFNSFTTKLKSLNFT-------TNTN  65

Query  270  SQGFDRLHDPPEKNFYDDPKLSYTI-DKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTG  94
              G D LHDP +K FYDDP+  YT+ DKP+KNWDEKRKEWL  HPSF  GA  +IL++TG
Sbjct  66   FAGPDLLHDPSDKTFYDDPETCYTMMDKPMKNWDEKRKEWLFHHPSFAAGATEKILVITG  125

Query  93   SQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            SQ T C NPIGDHLLLR +KNKVDYCRIH +
Sbjct  126  SQPTKCDNPIGDHLLLRFYKNKVDYCRIHNH  156



>ref|XP_006350640.1| PREDICTED: putative glycosyltransferase 7-like [Solanum tuberosum]
Length=411

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 95/150 (63%), Gaps = 30/150 (20%)
 Frame = -2

Query  438  TFFSNGFAFAGATVLGVLALWAFMSFLTPGSGS---DFDAGRKSTAFNGVEEKQECSDGS  268
            +FFSN F F G T++ VLALW+FMS   P   +   DF+  ++ +               
Sbjct  6    SFFSNVFMFVGGTLVIVLALWSFMSPKYPSFSTINLDFNLDQEGST--------------  51

Query  267  QGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSF-IPGADNRILMVTGS  91
                        NFYD+P LSYTI+KPI+NW++KR++W   HPSF + G   RIL+V+GS
Sbjct  52   ------------NFYDEPNLSYTIEKPIQNWNDKRRQWFNLHPSFKLEGEKERILIVSGS  99

Query  90   QATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            Q+TPC+NP+GDHLLLR FKNKVDY RIHGY
Sbjct  100  QSTPCKNPVGDHLLLRFFKNKVDYSRIHGY  129



>ref|XP_008237711.1| PREDICTED: galactomannan galactosyltransferase 1-like [Prunus 
mume]
 ref|XP_008237720.1| PREDICTED: galactomannan galactosyltransferase 1-like [Prunus 
mume]
Length=448

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 94/148 (64%), Gaps = 5/148 (3%)
 Frame = -2

Query  444  PPTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQ  265
            P ++ ++   F     L +L L+ F SF++  S  +F   R  T+     E  +C+D + 
Sbjct  18   PSSWLADSVLFFSGAFLALLVLFTFYSFVSTYSSPNF--ARTVTSPPPTAEPDQCADDA-  74

Query  264  GFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQA  85
              +   DPP+  FYDD ++ YT+  P++NWDEKR++WL  HPS   GA  RILMVTGSQ 
Sbjct  75   --NLRRDPPDPTFYDDREVRYTLGDPVQNWDEKRQQWLLLHPSLAAGAGERILMVTGSQP  132

Query  84   TPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
              CRNPIGDHLLLR FKNKVDYCR+HG+
Sbjct  133  AACRNPIGDHLLLRFFKNKVDYCRLHGH  160



>ref|NP_195544.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
thaliana]
 emb|CAB37487.1| putative protein [Arabidopsis thaliana]
 emb|CAB80496.1| putative protein [Arabidopsis thaliana]
 gb|ABJ98587.1| At4g38310 [Arabidopsis thaliana]
 gb|AEE86912.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
thaliana]
 gb|AHL38653.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=120

 Score =   135 bits (341),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 71/83 (86%), Gaps = 1/83 (1%)
 Frame = -2

Query  246  DPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCRNP  67
            DPPE  FYDDP LSY+I+K I NWDEKR EW + HPSF PG++NRILMVTGSQ++PC+NP
Sbjct  4    DPPEPGFYDDPDLSYSIEKSITNWDEKRHEWFKSHPSFKPGSENRILMVTGSQSSPCKNP  63

Query  66   IGDH-LLLRLFKNKVDYCRIHGY  1
            IGDH LLLR FKNKVDY RIHG+
Sbjct  64   IGDHLLLLRCFKNKVDYARIHGH  86



>ref|NP_001281283.1| putative glycosyltransferase 7 [Malus domestica]
 gb|ADL36662.1| CAMTA domain class transcription factor [Malus domestica]
Length=442

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 94/149 (63%), Gaps = 15/149 (10%)
 Frame = -2

Query  441  PTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQG  262
            P+  ++GF F G   L +  +WA ++F+ P + S  D+     A+N          G  G
Sbjct  22   PSLIADGFLFVGGASLALSVVWALLTFINPTTIS-LDS---IIAWNA---------GPCG  68

Query  261  FDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGA--DNRILMVTGSQ  88
             D   D PE  FYDD  LSY   +P+K+WD KR+EWL+ HPSF  GA  DNR+L+VTGSQ
Sbjct  69   PDLSSDSPEPTFYDDENLSYAFGEPVKDWDSKRREWLKLHPSFAAGAAADNRVLLVTGSQ  128

Query  87   ATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
             T C+NP+GDHL LR FKNKVDYCRIHG+
Sbjct  129  PTVCKNPVGDHLQLRFFKNKVDYCRIHGH  157



>ref|XP_004294205.1| PREDICTED: galactomannan galactosyltransferase 1-like [Fragaria 
vesca subsp. vesca]
Length=434

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 90/146 (62%), Gaps = 17/146 (12%)
 Frame = -2

Query  441  PTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQG  262
            P+  ++GF F G   + +  +WA +SF+ P S  D      +                Q 
Sbjct  23   PSLIADGFLFVGGAAMALSLVWALISFINPTSTFDTIITYST---------------PQA  67

Query  261  FDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQAT  82
             D  +DPPE  FYDDP LSY++   I+NWDEKR+EWL  HPSF  G  +R+++VTGSQ +
Sbjct  68   PDFTYDPPEPTFYDDPTLSYSVGDAIQNWDEKRREWLRVHPSF--GVGDRVVLVTGSQPS  125

Query  81   PCRNPIGDHLLLRLFKNKVDYCRIHG  4
             C+NP+GDHL LRLFKNKVDYCR+HG
Sbjct  126  VCKNPVGDHLQLRLFKNKVDYCRLHG  151



>gb|EPS69883.1| hypothetical protein M569_04879, partial [Genlisea aurea]
Length=420

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 92/145 (63%), Gaps = 17/145 (12%)
 Frame = -2

Query  435  FFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFD  256
            +FS+GF F    +  VL +W    F++        A      F  + +  E +DG     
Sbjct  8    YFSDGFLFITGVLASVLVVWTVWCFVS--------ATTVPLHFPELRDF-EYADG-----  53

Query  255  RLHDPPEKNFYDDPKLSYTIDKPI-KNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATP  79
              +D PE NFYDDP L+YTI+ P+ + WDEKR  WL QHPSF  GA  R+LMVTGSQATP
Sbjct  54   --YDLPELNFYDDPDLNYTIEAPVVEKWDEKRAAWLRQHPSFAAGARKRVLMVTGSQATP  111

Query  78   CRNPIGDHLLLRLFKNKVDYCRIHG  4
            C+NP+GDHLLL+LFKNKVDYCR HG
Sbjct  112  CKNPVGDHLLLKLFKNKVDYCRRHG  136



>ref|XP_010106924.1| Galactomannan galactosyltransferase 1 [Morus notabilis]
 gb|EXC12640.1| Galactomannan galactosyltransferase 1 [Morus notabilis]
Length=459

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 93/149 (62%), Gaps = 4/149 (3%)
 Frame = -2

Query  435  FFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGR---KSTAFNGVEEKQECSDG-S  268
            + S+G  F G   + +L +W+  S  +P      D  R   K      +     C++G +
Sbjct  28   WISDGILFLGGAFIAILLIWSLWSIASPSPNPTSDFLRPELKPREKEVMPRVINCAEGEA  87

Query  267  QGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQ  88
             G +   D PE+ FYD P+L+Y+I  P+ +WDEKR+ WL ++PSF PGA  RILM+TGSQ
Sbjct  88   HGANLRCDSPERTFYDSPELNYSIGSPVMDWDEKRRCWLRKNPSFAPGASERILMLTGSQ  147

Query  87   ATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
             + C+NPIGDHLLLR FKNKVDY RIHGY
Sbjct  148  PSACKNPIGDHLLLRFFKNKVDYSRIHGY  176



>ref|XP_009394361.1| PREDICTED: galactomannan galactosyltransferase 1-like [Musa acuminata 
subsp. malaccensis]
Length=451

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 89/153 (58%), Gaps = 14/153 (9%)
 Frame = -2

Query  456  RCRTPPTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECS  277
            R  + P+ FS+G  FAG   + +L  W   +F +  +  D  A   S +           
Sbjct  22   RRSSKPSLFSDGLVFAGGAGVALLVFWVVSTFFSAVTVVDPSAFPFSVS-----------  70

Query  276  DGSQGFDRLHD--PPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILM  103
              S  F  LHD  PP   FYDDP +SYTID+P+  WD KR++WL  HP+F      R+LM
Sbjct  71   -SSAAFPDLHDRDPPGATFYDDPSVSYTIDRPLTGWDAKRRDWLRLHPAFGGYGRERVLM  129

Query  102  VTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHG  4
            VTGSQ  PCRNP+GDHLLLR FKNKVDYCR HG
Sbjct  130  VTGSQPGPCRNPVGDHLLLRFFKNKVDYCRRHG  162



>emb|CDP02619.1| unnamed protein product [Coffea canephora]
Length=469

 Score =   140 bits (354),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 99/152 (65%), Gaps = 21/152 (14%)
 Frame = -2

Query  444  PPTFFSNGFAFAGA--TVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDG  271
            PP+   +   F  A  TVL V  +W+F      G  S+F      T F+      +CS G
Sbjct  41   PPSLSRDKSVFIAAAITVLLVCVIWSFT-----GPFSNF-----PTLFSS-----DCS-G  84

Query  270  SQG--FDRLHDPPEKNFYDDPKLSYTID-KPIKNWDEKRKEWLEQHPSFIPGADNRILMV  100
            S G  F+R  DP E  FYDDP++SYT+D  P+KNWDEKRKEWL+ HP+F  G  NR+L++
Sbjct  85   SPGQFFNRADDPQETTFYDDPEISYTVDGNPVKNWDEKRKEWLKLHPTFAAGVQNRMLLL  144

Query  99   TGSQATPCRNPIGDHLLLRLFKNKVDYCRIHG  4
            TGSQ +PC++P GDHLLLR FKNKVDYCRIHG
Sbjct  145  TGSQPSPCKSPSGDHLLLRCFKNKVDYCRIHG  176



>ref|XP_009362595.1| PREDICTED: LOW QUALITY PROTEIN: galactomannan galactosyltransferase 
1-like [Pyrus x bretschneideri]
Length=495

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 100/162 (62%), Gaps = 6/162 (4%)
 Frame = -2

Query  483  PGFLTMASHRCRT-PPTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAF  307
            P    M+    RT P ++ ++G  F G   + +L L    +F+TP S  +F+  R     
Sbjct  50   PELPQMSKPYARTRPSSWVADGLLFFGGAFIALLLLLTLWTFVTPSSIPNFN--RTVAPP  107

Query  306  NGVEEKQECSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIP  127
                E  +C+D S   D   DP  + FYDD ++ YT+ +P+++WDEKR++WL  HPS   
Sbjct  108  PTAVETDQCADDS---DLRRDPRNRTFYDDREVRYTLGQPVRDWDEKRRQWLLHHPSLAV  164

Query  126  GADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            GA  RILMVTGSQ + C+NPIGDHLLLR FKNKVDYCRIHG+
Sbjct  165  GAGERILMVTGSQPSACKNPIGDHLLLRFFKNKVDYCRIHGH  206



>ref|XP_006857127.1| hypothetical protein AMTR_s00065p00144450 [Amborella trichopoda]
 gb|ERN18594.1| hypothetical protein AMTR_s00065p00144450 [Amborella trichopoda]
Length=478

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 99/161 (61%), Gaps = 17/161 (11%)
 Frame = -2

Query  462  SHRCRTPPTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQE  283
            + +CR  P   ++   F G  +  +L ++A  S   P + +       +T+F+ V  K +
Sbjct  41   ARKCRLKPDHLTDTLIFTGGAMAALLLIYAIYSLCNPTAIT-------TTSFSEV--KPQ  91

Query  282  CSDGSQGFDRLHDPPEKN-------FYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPG  124
              +     D  H P  +N       FYDDP LSY ++KPIKNWD+ R++W+EQ+PS    
Sbjct  92   NPNPPLAHD-CHHPKLQNPFSTIPTFYDDPNLSYRVEKPIKNWDQNRRQWMEQNPSLSLN  150

Query  123  ADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            ++ ++L+VTGSQA PCRNP+GDHLLLR FKNKVDYCR+HGY
Sbjct  151  SEEKVLLVTGSQAKPCRNPVGDHLLLRFFKNKVDYCRLHGY  191



>ref|XP_004234713.2| PREDICTED: glycosyltransferase 6-like [Solanum lycopersicum]
Length=446

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 96/153 (63%), Gaps = 33/153 (22%)
 Frame = -2

Query  438  TFFSNGFAFAGATVLG---VLALWAFMSFLTPGSGS---DFDAGRKSTAFNGVEEKQECS  277
            +FFSN F F G T++    +LALW+F+S   P   +   DF+  ++ +            
Sbjct  38   SFFSNVFMFVGGTLVTLSIILALWSFISPKYPKFSTINLDFNLDQEGST-----------  86

Query  276  DGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSF-IPGADNRILMV  100
                           NFYD+P LSYTI+KPI+NWD+KR++W   HPSF + G  +R+L+V
Sbjct  87   ---------------NFYDEPNLSYTIEKPIQNWDDKRRQWFNLHPSFKLEGEKDRVLIV  131

Query  99   TGSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            +GSQ+TPC+NPIGDHLLLR FKNKVDY RIHGY
Sbjct  132  SGSQSTPCKNPIGDHLLLRFFKNKVDYSRIHGY  164



>gb|EYU44512.1| hypothetical protein MIMGU_mgv1a0180271mg, partial [Erythranthe 
guttata]
Length=131

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 83/137 (61%), Gaps = 13/137 (9%)
 Frame = -2

Query  411  AGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDRLHDPPEK  232
              A +L  LA+W F             A  ++T  + +  +   + G    +      EK
Sbjct  1    VAAAILTFLAVWTF-------------ADPRATFSSLLSARNAAACGGASTNTSQISTEK  47

Query  231  NFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCRNPIGDHL  52
             FYDDP+  YTIDKP+ NWDEKRK WL  +P+F P + N +++VTGSQ + C+NP+GDHL
Sbjct  48   TFYDDPETRYTIDKPMINWDEKRKHWLNHNPTFGPKSKNGVIIVTGSQPSACKNPLGDHL  107

Query  51   LLRLFKNKVDYCRIHGY  1
            LLR FKNK+DYCRIHGY
Sbjct  108  LLRFFKNKIDYCRIHGY  124



>gb|ACF33173.1| putative galactomannan galactosyl transferase [Coffea canephora]
Length=447

 Score =   138 bits (348),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = -2

Query  282  CSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILM  103
            C+      +R HDP E  FYD+P+L+YT+ K IK+WD+KRK WL  HPSF  GAD RIL+
Sbjct  58   CNGEPPAVNRTHDPKEATFYDEPELTYTLGKTIKDWDKKRKSWLNLHPSFAAGADTRILI  117

Query  102  VTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            VTGSQ +PC+NPIGDHLLLR FKNK DY RIHGY
Sbjct  118  VTGSQPSPCKNPIGDHLLLRCFKNKADYSRIHGY  151



>emb|CDP02618.1| unnamed protein product [Coffea canephora]
Length=447

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = -2

Query  282  CSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILM  103
            C+      +R HDP +  FYD+P+L+YT+ K IK+WD+KRK WL  HPSF  GAD RIL+
Sbjct  58   CNGEPPAVNRTHDPKQATFYDEPELTYTLGKTIKDWDKKRKSWLNLHPSFAAGADTRILI  117

Query  102  VTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            VTGSQ +PC+NPIGDHLLLR FKNK DY RIHGY
Sbjct  118  VTGSQPSPCKNPIGDHLLLRCFKNKADYSRIHGY  151



>gb|ADL36661.1| CAMTA domain class transcription factor [Malus domestica]
Length=449

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 94/148 (64%), Gaps = 5/148 (3%)
 Frame = -2

Query  444  PPTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQ  265
            P ++ ++G  F G   + +L L    +F+TP S  +F+  R         E  +C+D + 
Sbjct  18   PSSWVADGLLFFGGAFIALLLLLTLWTFVTPSSIPNFN--RTVAPPPTAAEPDQCADDA-  74

Query  264  GFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQA  85
              D   DP  + FYDD ++ YT+ +P+++WDEKR +WL  HPS   GA  RILMVTGSQ 
Sbjct  75   --DLRRDPRNRTFYDDREVRYTLGQPVRDWDEKRWQWLLHHPSLASGAGERILMVTGSQP  132

Query  84   TPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            + C+NPIGDHLLLR FKNKVDYCRIHG+
Sbjct  133  SACKNPIGDHLLLRFFKNKVDYCRIHGH  160



>ref|XP_008347885.1| PREDICTED: galactomannan galactosyltransferase 1-like [Malus 
domestica]
Length=449

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 94/148 (64%), Gaps = 5/148 (3%)
 Frame = -2

Query  444  PPTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQ  265
            P ++ ++G  F G   + +L L    +F+TP S  +F+  R         E  +C+D + 
Sbjct  18   PSSWVADGLLFFGGAFIALLLLLTLWTFVTPSSIPNFN--RTVAPPPTAAEPDQCADDA-  74

Query  264  GFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQA  85
              D   DP  + FYDD ++ YT+ +P+++WDEKR +WL  HPS   GA  RILMVTGSQ 
Sbjct  75   --DLRRDPRNRTFYDDREVRYTLGQPVRDWDEKRWQWLLHHPSLASGAGERILMVTGSQP  132

Query  84   TPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            + C+NPIGDHLLLR FKNKVDYCRIHG+
Sbjct  133  SACKNPIGDHLLLRFFKNKVDYCRIHGH  160



>ref|XP_003608540.1| Galactomannan galactosyltransferase [Medicago truncatula]
 gb|AES90737.1| galactosyl transferase GMA12/MNN10 family protein [Medicago truncatula]
Length=422

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -2

Query  258  DRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATP  79
            + + DPPEK FYDDP LSY++++P+K WD+KR  WL+ HPSF  GA +RIL++TGSQ TP
Sbjct  56   EAIQDPPEKTFYDDPTLSYSVEEPMKQWDKKRSHWLQLHPSFAAGASDRILVLTGSQPTP  115

Query  78   CRNPIGDHLLLRLFKNKVDYCRIHG  4
            C+NPIGDHLLLR FKNKVDYCRIH 
Sbjct  116  CKNPIGDHLLLRCFKNKVDYCRIHN  140



>ref|XP_004288265.1| PREDICTED: galactomannan galactosyltransferase 1-like [Fragaria 
vesca subsp. vesca]
Length=457

 Score =   135 bits (341),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 82/121 (68%), Gaps = 4/121 (3%)
 Frame = -2

Query  366  SFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKP  187
            SF+ P   S  + GR  T    +      SD   G D + DPP++ FYDDP+L+YTI  P
Sbjct  48   SFINPSPSSSPNFGRAVTP--PISNPGRHSD--PGPDLMSDPPDRTFYDDPELTYTIGSP  103

Query  186  IKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIH  7
            +KNWDEKR++WL  HPSF  GA  RILMVTGSQ + C+N IGDHLLLR FKNKVDY RIH
Sbjct  104  VKNWDEKRRQWLMYHPSFGAGAAERILMVTGSQPSACKNHIGDHLLLRFFKNKVDYSRIH  163

Query  6    G  4
            G
Sbjct  164  G  164



>ref|XP_008238162.1| PREDICTED: glycosyltransferase 6-like [Prunus mume]
Length=417

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 91/157 (58%), Gaps = 15/157 (10%)
 Frame = -2

Query  468  MASHRCRTPPTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEK  289
            MA    +T P   ++GF F      G+   W+   +                 F  +   
Sbjct  1    MAKSIHQTKPC--ADGFCFLAGLFFGLFCFWSLTLY------------HYKPHFGFIPFS  46

Query  288  QECSDGSQGFDRLH-DPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNR  112
             + SD       LH DPP + FYDDP+LSY I+KP+ NWD+KR+ WL+ HPSF  G+ +R
Sbjct  47   AKASDYGAEAPILHSDPPHETFYDDPELSYFIEKPVNNWDQKRRVWLDLHPSFTAGSRDR  106

Query  111  ILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            +L+VTGSQ + C+NPIGDHLLLR FKNK DYCR+HG+
Sbjct  107  VLLVTGSQPSVCKNPIGDHLLLRFFKNKADYCRLHGH  143



>ref|XP_008226081.1| PREDICTED: putative glycosyltransferase 7 [Prunus mume]
Length=439

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 93/148 (63%), Gaps = 16/148 (11%)
 Frame = -2

Query  441  PTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQG  262
            P+  ++GF F G   + +  +WA ++F+ P           ST+ + +      S G  G
Sbjct  23   PSLIADGFLFVGGASMALSLVWALLTFINP-----------STSIDNI---ITWSTGGCG  68

Query  261  FDRLHDPPEKNFYDDPKLSYTI-DKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQA  85
             D   DP E  FYDDP LSY   ++P+K+WD KR+EWL+ HPSF   ++ ++L+VTGSQ 
Sbjct  69   PDLGSDPSEPTFYDDPNLSYAFGEEPMKDWDLKRREWLKLHPSF-AASEEKVLLVTGSQP  127

Query  84   TPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
              C+NP+GDHL LRLFKNKVDYCRIHG+
Sbjct  128  NVCKNPVGDHLQLRLFKNKVDYCRIHGH  155



>ref|XP_007208181.1| hypothetical protein PRUPE_ppa017391mg, partial [Prunus persica]
 gb|EMJ09380.1| hypothetical protein PRUPE_ppa017391mg, partial [Prunus persica]
Length=366

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -2

Query  246  DPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCRNP  67
            DPP + FYDDP+LSY I+KP+ NWD+KR  WL+ HPSF  G+ +R+L+VTGSQ + C+NP
Sbjct  11   DPPHETFYDDPELSYFIEKPVNNWDQKRHVWLDLHPSFTAGSRDRVLLVTGSQPSVCKNP  70

Query  66   IGDHLLLRLFKNKVDYCRIHGY  1
            IGDHLLLR FKNKVDYCR+HG+
Sbjct  71   IGDHLLLRFFKNKVDYCRLHGH  92



>ref|XP_009777954.1| PREDICTED: putative glycosyltransferase 7 isoform X2 [Nicotiana 
sylvestris]
Length=412

 Score =   132 bits (331),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 88/149 (59%), Gaps = 10/149 (7%)
 Frame = -2

Query  474  LTMASHRCRTPPTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVE  295
            +T   +R +   +FFS+GF F G T++ VL   A  SF++P          KS   N   
Sbjct  1    MTKQDYRTKVA-SFFSDGFVFVGGTLVAVLVFLAIWSFISPNPSFSTIMMSKSNTLNS--  57

Query  294  EKQECSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADN  115
                    S  F+   D  E  FYDD  L+Y I+KPIKNWDEKR +WL+ HP+F  G   
Sbjct  58   -------KSAVFNLNQDSQEPTFYDDQDLNYGIEKPIKNWDEKRSKWLKLHPTFNHGVKE  110

Query  114  RILMVTGSQATPCRNPIGDHLLLRLFKNK  28
            RIL+V+GSQ+ PC+NP+GDHLLLR +KNK
Sbjct  111  RILVVSGSQSMPCKNPMGDHLLLRFYKNK  139



>tpg|DAA64593.1| TPA_inf: putative galacto(gluco)mannan alpha-1,6-galactosyltransferase, 
partial [Pinus taeda]
Length=254

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 92/152 (61%), Gaps = 9/152 (6%)
 Frame = -2

Query  432  FSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDR  253
             ++G  F G  V  +L +W F       S  + +A    +     +   + + G+ G +R
Sbjct  33   LNDGLIFMGGAVSALLLVWVFWRIGYTNSSMEMEAELSVSPKCPDQCFSDGNSGTTGRNR  92

Query  252  LH------DPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHP---SFIPGADNRILMV  100
            +       +   +NFY++P+++YTI +PI++WD KRK WL++HP   +F      R+LMV
Sbjct  93   VDHSVDEWEKSSENFYNNPEVTYTIGQPIRDWDRKRKLWLDRHPQVKNFTDDGKPRVLMV  152

Query  99   TGSQATPCRNPIGDHLLLRLFKNKVDYCRIHG  4
            +GSQA PCRNPIGDHLLLR FKNKVDYCR+HG
Sbjct  153  SGSQAVPCRNPIGDHLLLRFFKNKVDYCRLHG  184



>ref|XP_008362135.1| PREDICTED: galactomannan galactosyltransferase 1-like [Malus 
domestica]
Length=504

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 81/120 (68%), Gaps = 5/120 (4%)
 Frame = -2

Query  360  LTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIK  181
            ++P S  +F   R  T      E  +C+D     +   DP  + FYDD ++ YT+ +P++
Sbjct  101  VSPSSIPNF--SRXVTPPPTAAEPDQCADDD---NLRRDPTNQTFYDDREVRYTLGQPVQ  155

Query  180  NWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            +WDEKR++WL  HPS   GA+ RILMVTGSQ + CRNPIGDHLLLR FKNKVDYCRIHG+
Sbjct  156  DWDEKRRQWLLHHPSLAAGAEGRILMVTGSQPSACRNPIGDHLLLRFFKNKVDYCRIHGH  215



>ref|XP_003525869.1| PREDICTED: galactomannan galactosyltransferase 1-like [Glycine 
max]
Length=428

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 79/123 (64%), Gaps = 12/123 (10%)
 Frame = -2

Query  366  SFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKP  187
            SF+ P   SD +    ST  + ++           F    D PE  FYDDP+ SYT+DKP
Sbjct  37   SFIIPIPNSDPELNPVSTKLSSLQ-----------FPTNTDSPETTFYDDPETSYTMDKP  85

Query  186  IKNWDEKRKEWLEQHPSF-IPGADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRI  10
            + NWDEKRK+WL  HPSF +   D++IL+VTGSQ   C NPIGDHLLLR FKNKVDYCR+
Sbjct  86   MHNWDEKRKQWLLHHPSFTVTTHDSKILVVTGSQPKRCHNPIGDHLLLRFFKNKVDYCRL  145

Query  9    HGY  1
            H Y
Sbjct  146  HNY  148



>ref|XP_010028081.1| PREDICTED: putative glycosyltransferase 7 [Eucalyptus grandis]
 gb|KCW54740.1| hypothetical protein EUGRSUZ_I00693 [Eucalyptus grandis]
Length=460

 Score =   127 bits (320),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 98/164 (60%), Gaps = 7/164 (4%)
 Frame = -2

Query  483  PGFLTMASHRC-RTPPTF-FSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTA  310
            P   TMA H   R   +  FS+   F G  ++ +L +W+F SF  P S S   A   S+A
Sbjct  4    PEASTMAKHALLRNRASLCFSDACLFLGGVLMALLLVWSFSSFAYPPSASQTLAASSSSA  63

Query  309  FNGVEEKQECSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFI  130
                  +   +  +   D        NFYDDP+LSY++++P++ WDEKR+EWL QHPS  
Sbjct  64   AAEAPPECAAAAAAPPRD---SEESDNFYDDPELSYSMERPMRGWDEKRREWLRQHPSLA  120

Query  129  PG--ADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHG  4
             G     R+++VTGSQ +PC+N IGDHLLLR FKNKVDYCR+HG
Sbjct  121  SGEGGRERVVLVTGSQPSPCKNKIGDHLLLRFFKNKVDYCRLHG  164



>ref|XP_009362594.1| PREDICTED: glycosyltransferase 6-like [Pyrus x bretschneideri]
Length=422

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -2

Query  246  DPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCRNP  67
            DP +  FYDDP+LSY I+ P+KNWD+KR+ WL+ HPS   G+ +R+L+VTGSQ + C+NP
Sbjct  66   DPIDTTFYDDPELSYFIESPVKNWDQKRRVWLDLHPSLASGSRDRVLLVTGSQPSKCKNP  125

Query  66   IGDHLLLRLFKNKVDYCRIHGY  1
            IGDHLLLRLFKNKVDYCR+HG+
Sbjct  126  IGDHLLLRLFKNKVDYCRLHGH  147



>gb|ADL36663.1| CAMTA domain class transcription factor [Malus domestica]
Length=441

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 80/120 (67%), Gaps = 5/120 (4%)
 Frame = -2

Query  360  LTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIK  181
            ++P S  +F   R  T      E  +C+D     +   DP  + FYDD ++ YT+ +P++
Sbjct  38   VSPSSIPNF--SRTVTPPPTAAEPDQCADDD---NLRRDPTNQTFYDDREVRYTLGQPVQ  92

Query  180  NWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            +WDEKR++WL  HPS   GA+ RILMVTGS  + CRNPIGDHLLLR FKNKVDYCRIHG+
Sbjct  93   DWDEKRRQWLLHHPSLAAGAEGRILMVTGSHPSSCRNPIGDHLLLRFFKNKVDYCRIHGH  152



>ref|XP_010939020.1| PREDICTED: LOW QUALITY PROTEIN: galactomannan galactosyltransferase 
1-like [Elaeis guineensis]
Length=470

 Score =   127 bits (318),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 84/157 (54%), Gaps = 11/157 (7%)
 Frame = -2

Query  441  PTFFSNGFAFAGATVLGVLALWAFMSFLTPG----SGSDFDAGRKSTAFNGVEEKQECSD  274
            PT  ++   F       +L  W   SFL+P     S         S++F+        S 
Sbjct  26   PTLLADSLVFIAGAFSALLLFWILSSFLSPXPPMTSFPHSPTYTYSSSFSPSLHFANLSI  85

Query  273  GSQGF-----DRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHP--SFIPGADN  115
                F     D L DPP+  FYDDP LSYTID  + +WD+KR+ WL  HP  S  PG   
Sbjct  86   HPDPFNDTDPDLLRDPPDSTFYDDPSLSYTIDHHLSDWDDKRRHWLRLHPWLSPAPGGRE  145

Query  114  RILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHG  4
            RILM++GSQ  PC NP+GDHLLLR  KNK+DYCR HG
Sbjct  146  RILMISGSQPNPCHNPVGDHLLLRFLKNKIDYCRRHG  182



>gb|KDP25125.1| hypothetical protein JCGZ_22660 [Jatropha curcas]
Length=432

 Score =   126 bits (317),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 68/84 (81%), Gaps = 1/84 (1%)
 Frame = -2

Query  249  HDPPEKNFYDDPK-LSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCR  73
            +DPP++ FYDD   L+Y+ID  +KNWD KRKEWL  HPSF  G+ NRIL+VTGSQ   C+
Sbjct  72   YDPPDRTFYDDVDFLNYSIDSSVKNWDVKRKEWLNFHPSFASGSSNRILLVTGSQPFACK  131

Query  72   NPIGDHLLLRLFKNKVDYCRIHGY  1
            NPIGD+LLLR FKNKVDYCR+HGY
Sbjct  132  NPIGDNLLLRFFKNKVDYCRLHGY  155



>ref|XP_011099400.1| PREDICTED: glycosyltransferase 6-like [Sesamum indicum]
Length=430

 Score =   126 bits (316),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 83/141 (59%), Gaps = 20/141 (14%)
 Frame = -2

Query  411  AGATVLGVLALWAFM----SFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDRLHD  244
            A  T L   ALWAF     SF T  S  +                +EC  G +  D   +
Sbjct  17   AAVTALLFCALWAFSDPLPSFSTLLSNPNI---------------KECLQGGRALDMNQE  61

Query  243  PPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCRNPI  64
            P  K FYDDP + YTIDKP+  WDEKR EWL+ + + +  + NR+L+VTGSQ +PC+NP 
Sbjct  62   PLHKTFYDDPNIQYTIDKPVIGWDEKRSEWLKHYTTTM-FSRNRVLVVTGSQPSPCKNPS  120

Query  63   GDHLLLRLFKNKVDYCRIHGY  1
            GDHLLLR FKNKVDY RIHGY
Sbjct  121  GDHLLLRCFKNKVDYSRIHGY  141



>ref|XP_008806204.1| PREDICTED: galactomannan galactosyltransferase 1-like [Phoenix 
dactylifera]
Length=469

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 84/157 (54%), Gaps = 11/157 (7%)
 Frame = -2

Query  441  PTFFSNGFAFAGATVLGVLALWAFMSFLTPGS-GSDFDAGRKSTAFNGVEEKQECSDGS-  268
            PT  ++   F       +L  W   S L+P +  + F    +  + +        ++ S 
Sbjct  26   PTLLADSLVFIAGAFSALLLFWILSSILSPATPMTSFSPSPRYYSSSSFSPYLHFANLSI  85

Query  267  -------QGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHP--SFIPGADN  115
                      D L DPP   FYDDP LSYTID+ I +WD+KR+ WL  HP  S  PG   
Sbjct  86   HPDLFNDTDPDLLRDPPNSTFYDDPSLSYTIDRHITDWDDKRRRWLRLHPWLSPAPGGRE  145

Query  114  RILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHG  4
            RILM++GSQ  PCRNPIGDHLLLR  KNKVDYCR  G
Sbjct  146  RILMISGSQPNPCRNPIGDHLLLRFLKNKVDYCRRFG  182



>ref|XP_002513422.1| transferase, putative [Ricinus communis]
 gb|EEF48825.1| transferase, putative [Ricinus communis]
Length=424

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 68/89 (76%), Gaps = 3/89 (3%)
 Frame = -2

Query  267  QGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQ  88
             G +  +DPP+  FYDDP LSY+I+  IK+WD KR EWL+ HPSF   A N+IL+V+GSQ
Sbjct  62   HGINLSYDPPDPTFYDDPNLSYSIESSIKDWDAKRMEWLKHHPSF---ASNQILLVSGSQ  118

Query  87   ATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
               C+N +GD+LLLR FKNKVDYCRIHGY
Sbjct  119  PLACKNTVGDNLLLRFFKNKVDYCRIHGY  147



>gb|ADE76992.1| unknown [Picea sitchensis]
Length=477

 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 88/162 (54%), Gaps = 12/162 (7%)
 Frame = -2

Query  456  RCRTPPTFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGR--------KSTAFNG  301
            R +      ++G  F G  V  +L +WA        S  + +           +  + NG
Sbjct  25   RLKQIVESLNDGLIFMGGAVSALLLVWALWRIGYSNSSMEMETELSFPQKCPDQCISSNG  84

Query  300  VEEKQECSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHP---SFI  130
                   +    G D      E NFY++P+++YTI +PI++WD+KRK WL++HP   +F 
Sbjct  85   NRGSISSNRIDHGVDEWEKSSE-NFYNNPEVTYTIGQPIRDWDKKRKLWLDRHPRVKNFT  143

Query  129  PGADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHG  4
                 R+LMV+GSQ  PCRNP GDHLLLR FKNKVDYCR+HG
Sbjct  144  DDGKPRVLMVSGSQGVPCRNPFGDHLLLRFFKNKVDYCRLHG  185



>ref|XP_007211970.1| hypothetical protein PRUPE_ppa006622mg [Prunus persica]
 gb|EMJ13169.1| hypothetical protein PRUPE_ppa006622mg [Prunus persica]
Length=402

 Score =   120 bits (302),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 85/133 (64%), Gaps = 16/133 (12%)
 Frame = -2

Query  396  LGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDRLHDPPEKNFYDD  217
            + +  +WA ++F+ P           ST+ + +      S G  G D   DP E  FYDD
Sbjct  1    MALSLVWALLTFINP-----------STSIDNI---ITWSTGGCGPDLGSDPSEPTFYDD  46

Query  216  PKLSYTI-DKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCRNPIGDHLLLRL  40
            P LSY   ++P+K+WD KR+EWL+ HPSF   ++ ++L+VTGSQ   C+NP+GDHL LRL
Sbjct  47   PNLSYAFGEEPMKDWDLKRREWLKLHPSF-AASEEKVLLVTGSQPNVCKNPVGDHLQLRL  105

Query  39   FKNKVDYCRIHGY  1
            FKNKVDYCRIHG+
Sbjct  106  FKNKVDYCRIHGH  118



>ref|XP_008363070.1| PREDICTED: LOW QUALITY PROTEIN: galactomannan galactosyltransferase 
1-like, partial [Malus domestica]
Length=383

 Score =   117 bits (293),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 64/90 (71%), Gaps = 0/90 (0%)
 Frame = -2

Query  270  SQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGS  91
            + G D  +DP E  FYDDP  SY I +P+++WDEKRK+WL  HPSF     +R+L+V GS
Sbjct  11   AHGLDSGYDPAEPTFYDDPNFSYLIGQPVEDWDEKRKKWLLHHPSFSASVRDRVLLVKGS  70

Query  90   QATPCRNPIGDHLLLRLFKNKVDYCRIHGY  1
            Q+    NP+GDHLLLR FKNKVD+C  HGY
Sbjct  71   QSXASSNPVGDHLLLRFFKNKVDHCXPHGY  100



>ref|XP_002454367.1| hypothetical protein SORBIDRAFT_04g029500 [Sorghum bicolor]
 gb|EES07343.1| hypothetical protein SORBIDRAFT_04g029500 [Sorghum bicolor]
Length=443

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -2

Query  234  KNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCRNPIGDH  55
            + FYDDP L+YT+D+PI  WDEKR  WL  HP    G + R+LMV+GSQ TPCR+P GDH
Sbjct  68   RTFYDDPALAYTVDRPITGWDEKRAGWLRAHPELAGGGEERVLMVSGSQPTPCRSPGGDH  127

Query  54   LLLRLFKNKVDYCRIHG  4
             L+RL KNK DYCR+HG
Sbjct  128  TLMRLLKNKADYCRLHG  144



>ref|XP_010679659.1| PREDICTED: putative glycosyltransferase 7 [Beta vulgaris subsp. 
vulgaris]
Length=431

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 83/143 (58%), Gaps = 18/143 (13%)
 Frame = -2

Query  429  SNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDRL  250
            S+   F G  ++  L +W+   F               TA             +Q   ++
Sbjct  29   SDVVMFLGGALVAFLLIWSLWCF---------------TAPPSSSSSFSPPLPTQTQTQV  73

Query  249  HDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCRN  70
              P    FYDDP++ YT++ P++NWDEKRK+W+ ++PS I G D +++MVTGSQ  PC+N
Sbjct  74   Q-PDPTTFYDDPEMGYTLESPVQNWDEKRKQWMGRNPS-ISGPD-KVVMVTGSQPGPCKN  130

Query  69   PIGDHLLLRLFKNKVDYCRIHGY  1
            P+GDH LLR FKNKVDYCRIHGY
Sbjct  131  PMGDHFLLRFFKNKVDYCRIHGY  153



>ref|XP_010109205.1| Galactomannan galactosyltransferase 1 [Morus notabilis]
 gb|EXC21327.1| Galactomannan galactosyltransferase 1 [Morus notabilis]
Length=433

 Score =   115 bits (287),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 85/153 (56%), Gaps = 32/153 (21%)
 Frame = -2

Query  438  TFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGF  259
            +  ++GF F     L +  +WA +SF                           +D +Q F
Sbjct  24   SLIADGFLFIVGASLALFLIWALLSFTNQ------------------------NDVAQSF  59

Query  258  D-RLHD--PPE--KNFYDDPKLSYTI--DKPIKNWDEKRKEWLEQHPSF-IPGADNRILM  103
            + +LH   PP+    FYDD  LSY+I  D PIKNWDEKR++WL  H  +    +  RIL+
Sbjct  60   NSQLHTDHPPQLISTFYDDATLSYSIQNDNPIKNWDEKRQQWLRYHYQYQTHNSKPRILL  119

Query  102  VTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHG  4
            VTGS+   C NP+GDHLLLRLFKNKVDYCRIHG
Sbjct  120  VTGSRPAVCSNPVGDHLLLRLFKNKVDYCRIHG  152



>ref|NP_001105164.1| alpha-6-galactosyltransferase [Zea mays]
 emb|CAI11455.1| alpha-6-galactosyltransferase [Zea mays]
 gb|ACF82483.1| unknown [Zea mays]
 gb|AFW63649.1| hypothetical protein ZEAMMB73_992521 [Zea mays]
Length=444

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 58/77 (75%), Gaps = 1/77 (1%)
 Frame = -2

Query  231  NFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADN-RILMVTGSQATPCRNPIGDH  55
             FYDDP L+YT+D+PI  WDEKR  WL  HP F  G +  R+LMV+GSQ TPCR+P GDH
Sbjct  74   TFYDDPALAYTVDRPITGWDEKRAGWLRAHPEFAGGGEKGRVLMVSGSQPTPCRSPGGDH  133

Query  54   LLLRLFKNKVDYCRIHG  4
             L+RL KNK DYCR+HG
Sbjct  134  TLMRLLKNKADYCRLHG  150



>dbj|BAK05879.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=427

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -2

Query  237  EKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCRNPIGD  58
             + FYDDP+++YT+D+PI  WDEKR +WL  HP      + R+LMV+GSQ  PCR+P GD
Sbjct  52   RRTFYDDPEVTYTVDRPITGWDEKRAQWLRAHPELAGAGEGRVLMVSGSQPAPCRSPTGD  111

Query  57   HLLLRLFKNKVDYCRIHG  4
            HLL RL KNK DYCR++G
Sbjct  112  HLLTRLLKNKADYCRLNG  129



>ref|XP_010943187.1| PREDICTED: galactomannan galactosyltransferase 1-like [Elaeis 
guineensis]
Length=537

 Score =   110 bits (276),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 58/77 (75%), Gaps = 1/77 (1%)
 Frame = -2

Query  231  NFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCRNPIGDHL  52
             FYDDP LSYT+D+PI +WD KR++WL  HP F    D RILMVTGS+   C NP GDHL
Sbjct  171  TFYDDPDLSYTLDRPISDWDAKRRQWLRLHPWFSATPD-RILMVTGSKPGRCSNPTGDHL  229

Query  51   LLRLFKNKVDYCRIHGY  1
            LLR +KNK DYCRIHG+
Sbjct  230  LLRFYKNKADYCRIHGF  246



>ref|XP_008784727.1| PREDICTED: putative glycosyltransferase 7 [Phoenix dactylifera]
Length=436

 Score =   109 bits (273),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 60/83 (72%), Gaps = 6/83 (7%)
 Frame = -2

Query  231  NFYDDPKLSYTIDK-PIKNWDEKRKEWLEQHP-----SFIPGADNRILMVTGSQATPCRN  70
             FYDDP LSYT+D   + NWD KR+ WL  HP     SFI   + R+LMV+GSQ +PCRN
Sbjct  55   TFYDDPSLSYTLDGGHLSNWDSKRRHWLRLHPTLSSSSFIQEKEERVLMVSGSQPSPCRN  114

Query  69   PIGDHLLLRLFKNKVDYCRIHGY  1
            P GDHLLLR +KNK DYCRIHG+
Sbjct  115  PAGDHLLLRFYKNKSDYCRIHGH  137



>gb|EAY87343.1| hypothetical protein OsI_08746 [Oryza sativa Indica Group]
 gb|EAZ24444.1| hypothetical protein OsJ_08194 [Oryza sativa Japonica Group]
Length=422

 Score =   109 bits (272),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = -2

Query  234  KNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCRNPIGDH  55
            + FYDDP ++YTID+PI  WDEKR EWL  HP    G   R+LMV+GSQ  PC +P GD 
Sbjct  56   RTFYDDPGVAYTIDRPIVGWDEKRAEWLRAHPELAGGGGERVLMVSGSQPEPCGSPAGDS  115

Query  54   LLLRLFKNKVDYCRIHG  4
            LL RL KNK+DYCR++G
Sbjct  116  LLTRLLKNKLDYCRLNG  132



>ref|XP_009394626.1| PREDICTED: galactomannan galactosyltransferase 1-like [Musa acuminata 
subsp. malaccensis]
Length=429

 Score =   109 bits (272),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = -2

Query  246  DPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCRNP  67
            D P+  FYDD  +SY  D+ + +WD KR+EWL  HP+F      R++MVTGSQ  PCRN 
Sbjct  60   DAPDATFYDDASVSYAFDRSLTDWDAKRREWLRLHPNFDGNGRERVVMVTGSQPGPCRNR  119

Query  66   IGDHLLLRLFKNKVDYCRIHG  4
             GDHLLLR FKNKVDYCR HG
Sbjct  120  EGDHLLLRFFKNKVDYCRRHG  140



>ref|NP_001047970.1| Os02g0723200 [Oryza sativa Japonica Group]
 dbj|BAD13026.1| putative alpha galactosyltransferase [Oryza sativa Japonica Group]
 dbj|BAF09884.1| Os02g0723200 [Oryza sativa Japonica Group]
 dbj|BAG98296.1| unnamed protein product [Oryza sativa Japonica Group]
Length=447

 Score =   109 bits (272),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = -2

Query  234  KNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCRNPIGDH  55
            + FYDDP ++YTID+PI  WDEKR EWL  HP    G   R+LMV+GSQ  PC +P GD 
Sbjct  81   RTFYDDPGVAYTIDRPIVGWDEKRAEWLRAHPELAGGGGERVLMVSGSQPEPCGSPAGDS  140

Query  54   LLLRLFKNKVDYCRIHG  4
            LL RL KNK+DYCR++G
Sbjct  141  LLTRLLKNKLDYCRLNG  157



>ref|XP_009406736.1| PREDICTED: galactomannan galactosyltransferase 1-like [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 57/77 (74%), Gaps = 2/77 (3%)
 Frame = -2

Query  231  NFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCRNPIGDHL  52
             FYDDP LSYTID+PI NWD KR+EWL  +PS      +R++MVTGS    C NP GDHL
Sbjct  113  TFYDDPSLSYTIDRPITNWDSKRREWLRLNPSL--ATPDRVVMVTGSPPGRCPNPGGDHL  170

Query  51   LLRLFKNKVDYCRIHGY  1
            LLR +KNK DYCR+HGY
Sbjct  171  LLRFYKNKADYCRLHGY  187



>gb|ABK25085.1| unknown [Picea sitchensis]
Length=479

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 68/114 (60%), Gaps = 6/114 (5%)
 Frame = -2

Query  327  GRKSTAFNGVEEKQECSDGSQGFDRLHDPPEK---NFYDDPKLSYTIDKPIKNWDEKRKE  157
            G  +   N   E++      +   R  D  E+   NFY D   SYT+   +KNWD KR++
Sbjct  86   GSSAIQQNQTNEREMNDKEEESLYRSMDQWEESSDNFYADSDFSYTVGSTVKNWDTKRQQ  145

Query  156  WLEQHP---SFIPGADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHG  4
            WL  HP   ++  G   RIL++TGSQ  PC+NPIGDHLLLR FKNK DYCRIHG
Sbjct  146  WLRAHPHIKNYTEGGKPRILVLTGSQPYPCKNPIGDHLLLRCFKNKQDYCRIHG  199



>ref|XP_008795673.1| PREDICTED: glycosyltransferase 6-like [Phoenix dactylifera]
Length=516

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 56/77 (73%), Gaps = 1/77 (1%)
 Frame = -2

Query  231  NFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCRNPIGDHL  52
             FYDDP LSYT+D+ I +WD KR +WL  HP F    D R+LMVTGS+   C NP GDHL
Sbjct  157  TFYDDPDLSYTLDRSISDWDAKRHQWLRLHPWFSATPD-RVLMVTGSKPGQCSNPTGDHL  215

Query  51   LLRLFKNKVDYCRIHGY  1
            LLR +KNK DYCRIHG+
Sbjct  216  LLRFYKNKADYCRIHGF  232



>gb|AHC98115.1| putative galacto(gluco)mannan alpha-1,6-galactosyltransferase 
[Pinus radiata]
Length=480

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 57/79 (72%), Gaps = 3/79 (4%)
 Frame = -2

Query  231  NFYDDPKLSYTIDKPIKNWDEKRKEWLEQHP---SFIPGADNRILMVTGSQATPCRNPIG  61
            NFY D   SYT+   +KNWD KR++WL  HP   ++  G   RIL++TGSQ  PC+NPIG
Sbjct  121  NFYADSDFSYTVGNTVKNWDAKRQQWLRAHPHIKNYTEGGRPRILVLTGSQPYPCKNPIG  180

Query  60   DHLLLRLFKNKVDYCRIHG  4
            DHL+LR FKNK DYCRIHG
Sbjct  181  DHLILRTFKNKQDYCRIHG  199



>tpg|DAA64590.1| TPA_inf: putative galacto(gluco)mannan alpha-1,6-galactosyltransferase 
[Pinus taeda]
Length=480

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 57/79 (72%), Gaps = 3/79 (4%)
 Frame = -2

Query  231  NFYDDPKLSYTIDKPIKNWDEKRKEWLEQHP---SFIPGADNRILMVTGSQATPCRNPIG  61
            NFY D   SYT+   +KNWD KR++WL  HP   ++  G   RIL++TGSQ  PC+NPIG
Sbjct  121  NFYADSDFSYTVGNTVKNWDAKRQQWLRAHPHIKNYTEGGRPRILVLTGSQPYPCKNPIG  180

Query  60   DHLLLRLFKNKVDYCRIHG  4
            DHL+LR FKNK DYCRIHG
Sbjct  181  DHLILRTFKNKQDYCRIHG  199



>ref|XP_004953741.1| PREDICTED: galactomannan galactosyltransferase 1-like [Setaria 
italica]
Length=429

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -2

Query  231  NFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCRNPIGDHL  52
             FYDDP LSYT+D+ I  WDEKR  W   HP    G    +LMV+GSQ  PC  P GDH 
Sbjct  62   TFYDDPALSYTVDRSITGWDEKRAGWARAHPEVSAGGVEGVLMVSGSQPAPCGAPGGDHT  121

Query  51   LLRLFKNKVDYCRIHG  4
            LLRL KNK DYCR+HG
Sbjct  122  LLRLLKNKADYCRLHG  137



>ref|XP_003570475.1| PREDICTED: galactomannan galactosyltransferase 1-like [Brachypodium 
distachyon]
Length=417

 Score =   100 bits (249),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 55/82 (67%), Gaps = 5/82 (6%)
 Frame = -2

Query  234  KNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFI-----PGADNRILMVTGSQATPCRN  70
            + FYDDP++SYT+D+PI  WD KR  W+  HP  +      G   R+LMV+GSQ  PC  
Sbjct  50   RTFYDDPEVSYTMDRPITGWDAKRAAWIRAHPELLHQHAARGEGERVLMVSGSQPAPCGA  109

Query  69   PIGDHLLLRLFKNKVDYCRIHG  4
            P GDH L RL KNK+DYCR++G
Sbjct  110  PRGDHFLTRLLKNKLDYCRLNG  131



>ref|XP_010919073.1| PREDICTED: galactomannan galactosyltransferase 1-like [Elaeis 
guineensis]
Length=436

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 56/81 (69%), Gaps = 4/81 (5%)
 Frame = -2

Query  231  NFYDDPKLSYTIDK-PIKNWDEKRKEWLEQHPSFIPGA---DNRILMVTGSQATPCRNPI  64
             FYDDP LSYT+D   + +WD KR+ WL  HP+    A   D RILMV+ S  +PCRN  
Sbjct  65   TFYDDPSLSYTLDGGHLSDWDAKRRHWLRLHPNPSSSAKEKDERILMVSASHPSPCRNLD  124

Query  63   GDHLLLRLFKNKVDYCRIHGY  1
            GDHLLLR +KNK DYCRIHG+
Sbjct  125  GDHLLLRFYKNKADYCRIHGH  145



>ref|XP_006841140.1| hypothetical protein AMTR_s00086p00128700 [Amborella trichopoda]
 gb|ERN02815.1| hypothetical protein AMTR_s00086p00128700 [Amborella trichopoda]
Length=441

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 55/75 (73%), Gaps = 3/75 (4%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHP---SFIPGADNRILMVTGSQATPCRNPIGDHLL  49
            +P ++YT+   I +WD+KRK WL +HP   +F+ G   RIL+VTGSQ  PC NPIGDH L
Sbjct  97   NPNITYTLGPKILDWDQKRKAWLNEHPEFPNFLAGGRPRILLVTGSQPNPCDNPIGDHYL  156

Query  48   LRLFKNKVDYCRIHG  4
            L+  KNK+DYCR+HG
Sbjct  157  LKAAKNKIDYCRLHG  171



>emb|CAI11450.1| alpha-1,6-xylosyltransferase [Pinus taeda]
 gb|AHC98116.1| xyloglucan alpha-1,6-xylosyltransferase [Pinus radiata]
 tpg|DAA64591.1| TPA_inf: xyloglucan alpha-1,6-xylosyltransferase [Pinus taeda]
Length=444

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 85/176 (48%), Gaps = 16/176 (9%)
 Frame = -2

Query  489  SLPGFLTMASHRCRTPPTFFSNGFAFAGATVLGVLALWAFM---SFLTPGSGSDFD----  331
             +PGFL +   R R       N         + VL L   +    F TP    DF+    
Sbjct  2    QVPGFLALGGRRIRQIQRAMQNAKVTLLCLFVTVLVLRGTIGAGKFGTPEQ--DFNEIRE  59

Query  330  ---AGRKSTAFNGVEEK-QECSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKR  163
                GR+      + E   E S+         +  E +   DP + Y+    I +WD++R
Sbjct  60   HLIVGRRGEPHRVLTEVVAESSNNKTPPVVEEEVEEPDVERDPSVPYSFGPKISDWDDQR  119

Query  162  KEWLEQHPSF---IPGADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHG  4
             EWL ++P+F   +PG   RIL+VTGS   PC +P+GDHLLL+  KNK+DYCR+HG
Sbjct  120  SEWLAENPAFPNFLPGGRPRILLVTGSAPAPCESPVGDHLLLKSIKNKIDYCRLHG  175



>ref|XP_010477058.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010477059.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010477061.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010477062.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010477063.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
Length=456

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 83/156 (53%), Gaps = 17/156 (11%)
 Frame = -2

Query  438  TFFSNGFAFAGATVLGVLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQ-------EC  280
            TFF+         V  +L L A +S    GS S+ D+ ++S     +EE+        E 
Sbjct  39   TFFNIKIMILCGFV-TILVLLATISIGNLGSSSNADSVKQSF----IEEETIPMTILPEI  93

Query  279  SDGSQGFDRLH-DPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADN---R  112
               S   D +  +PP+   +  P  +YT+   + NWD +RK WL Q+P F P   N   R
Sbjct  94   PSDSNSTDLVAAEPPKAEIFTTPNATYTLGPKVTNWDSQRKVWLNQNPEF-PSTVNGKAR  152

Query  111  ILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHG  4
            IL++TGS  +PC  PIGD+ LL+  KNK+DYCR+HG
Sbjct  153  ILLLTGSSPSPCDKPIGDYYLLKSVKNKIDYCRLHG  188



>gb|ABK24302.1| unknown [Picea sitchensis]
 gb|ACN41079.1| unknown [Picea sitchensis]
Length=444

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 54/75 (72%), Gaps = 3/75 (4%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPSF---IPGADNRILMVTGSQATPCRNPIGDHLL  49
            DP + Y+    I +WD++R+EWL ++P+F   +PG   RIL+VTGS   PC NP+GDH L
Sbjct  101  DPNVPYSFGPKISDWDDQRREWLAENPAFPNFLPGGRPRILLVTGSAPAPCENPVGDHFL  160

Query  48   LRLFKNKVDYCRIHG  4
            L+  KNK+DYCR+HG
Sbjct  161  LKSIKNKIDYCRLHG  175



>ref|XP_009414141.1| PREDICTED: putative glycosyltransferase 2 [Musa acuminata subsp. 
malaccensis]
Length=441

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 61/103 (59%), Gaps = 8/103 (8%)
 Frame = -2

Query  303  GVEEKQECSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHP---SF  133
             + E+Q     S G +   DPP      DP   Y++   I +WDE+R +WL +HP   +F
Sbjct  70   ALTEQQPQHTDSNGAEEEEDPPR-----DPSKPYSLGPKISDWDEQRADWLRRHPERPNF  124

Query  132  IPGADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHG  4
            +     R+L+VTGS   PC NP+GDH LL+  KNK+DYCR+HG
Sbjct  125  LGSTKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRVHG  167



>ref|XP_010452740.1| PREDICTED: putative glycosyltransferase 3 [Camelina sativa]
Length=459

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 58/85 (68%), Gaps = 6/85 (7%)
 Frame = -2

Query  249  HDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADNR---ILMVTGSQATP  79
            ++PPE +   D  ++YT+   I NWD+KRK WL Q+P F P   NR   +L++TGS   P
Sbjct  107  NEPPESDL--DLNMTYTLGLKITNWDQKRKLWLTQNPGF-PSVVNRKAKVLLLTGSPPKP  163

Query  78   CRNPIGDHLLLRLFKNKVDYCRIHG  4
            C NPIGDH LL+  KNK+DYCRIHG
Sbjct  164  CDNPIGDHYLLKSVKNKIDYCRIHG  188



>ref|XP_006374450.1| hypothetical protein POPTR_0015s07290g [Populus trichocarpa]
 gb|ERP52247.1| hypothetical protein POPTR_0015s07290g [Populus trichocarpa]
Length=453

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 75/138 (54%), Gaps = 10/138 (7%)
 Frame = -2

Query  396  LGVLALWAFMSFL----TPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDRLHDPPEKN  229
            + +  L  F++ L    T G GS   +   +   N +EE        +      DP E  
Sbjct  48   IKITILCGFVTILVLRGTVGIGSLSSSDADAVNQNLIEETNRILKEIRSDSEPDDPAESE  107

Query  228  FYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADN---RILMVTGSQATPCRNPIGD  58
               +P ++Y++   I NW+++RK WL Q+P F P   N   RIL++TGS  +PC NPIGD
Sbjct  108  I--NPNVTYSLGPKISNWNQERKVWLSQNPEF-PNFVNGKPRILLLTGSPPSPCDNPIGD  164

Query  57   HLLLRLFKNKVDYCRIHG  4
            H LL+  KNK+DYCRIHG
Sbjct  165  HYLLKAIKNKIDYCRIHG  182



>ref|XP_010258249.1| PREDICTED: putative glycosyltransferase 5 [Nelumbo nucifera]
Length=455

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 54/75 (72%), Gaps = 4/75 (5%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADN---RILMVTGSQATPCRNPIGDHLL  49
            +P ++YT+   I NWDE+RK WL+++P F P   N   RIL+VTGS   PC NPIGDH L
Sbjct  111  NPNVTYTLGPKISNWDEERKAWLDRNPEF-PNYINGKARILLVTGSPPNPCDNPIGDHYL  169

Query  48   LRLFKNKVDYCRIHG  4
            L+  KNK+DYCRIHG
Sbjct  170  LKAIKNKIDYCRIHG  184



>ref|XP_010491391.1| PREDICTED: putative glycosyltransferase 3 [Camelina sativa]
Length=459

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 58/84 (69%), Gaps = 4/84 (5%)
 Frame = -2

Query  249  HDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSF--IPGADNRILMVTGSQATPC  76
            ++PP+ +   D  ++YT+   I NWD+KRK WL Q+PSF  +     ++L++TGS   PC
Sbjct  107  NEPPDSDL--DLNMTYTLGPKITNWDQKRKLWLTQNPSFPSVVNGKAKVLLLTGSPPKPC  164

Query  75   RNPIGDHLLLRLFKNKVDYCRIHG  4
             NPIGDH LL+  KNK+DYCRIHG
Sbjct  165  DNPIGDHYLLKSVKNKIDYCRIHG  188



>ref|XP_002449649.1| hypothetical protein SORBIDRAFT_05g020911 [Sorghum bicolor]
 gb|EES08637.1| hypothetical protein SORBIDRAFT_05g020911 [Sorghum bicolor]
Length=185

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 50/80 (63%), Gaps = 5/80 (6%)
 Frame = -2

Query  234  KNFYDDPKLSYTIDKP---IKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCRNPI  64
            + FYDDP+LSY +  P   +  WD KR +WL         A  R++MV+GSQ  PC    
Sbjct  85   RTFYDDPELSYAVAAPGRRLTGWDAKRAQWLRSRGRR--NAPERVVMVSGSQPEPCPGAA  142

Query  63   GDHLLLRLFKNKVDYCRIHG  4
            GDHLLLR  KNK+DYCR+HG
Sbjct  143  GDHLLLRFLKNKLDYCRLHG  162



>ref|XP_008679453.1| PREDICTED: galactomannan galactosyltransferase 1-like [Zea mays]
 gb|AFW64905.1| hypothetical protein ZEAMMB73_022035 [Zea mays]
Length=441

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = -2

Query  234  KNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHP-SFIPGADNRILMVTGSQATPCRNPIGD  58
            + FYDDP+LSY + + +  WD KR +WL          A  R++MVTGSQ  PC+   GD
Sbjct  68   RTFYDDPELSYALGRRVTGWDAKRAQWLRSRGLGDRRNAPERVVMVTGSQPEPCKGAGGD  127

Query  57   HLLLRLFKNKVDYCRIHG  4
            HLLLR  KNKVDYCR+HG
Sbjct  128  HLLLRFLKNKVDYCRLHG  145



>ref|XP_010498276.1| PREDICTED: putative glycosyltransferase 5 [Camelina sativa]
Length=456

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 75/143 (52%), Gaps = 18/143 (13%)
 Frame = -2

Query  396  LGVLALWAFMSFLTPGSGSDFDAGRKS---------TAFNGVEEKQECSDGSQGFDRLHD  244
            + +L L A +S    GS S+ D+ ++S         T    +      +D         +
Sbjct  52   VTILVLLATISIGNFGSSSNADSVKQSFIKEETIPMTILPEIPSDSNSTDLGAA-----E  106

Query  243  PPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADN---RILMVTGSQATPCR  73
            PP+   +  P  +YT+   + NWD +RK WL Q+P F P   N   RIL++TGS  +PC 
Sbjct  107  PPKAEIFTTPNATYTLGPKVTNWDSQRKAWLNQNPEF-PSTVNGKARILLLTGSSPSPCD  165

Query  72   NPIGDHLLLRLFKNKVDYCRIHG  4
             PIGD+ LL+  KNK+DYCR+HG
Sbjct  166  KPIGDYYLLKSVKNKIDYCRLHG  188



>ref|XP_008239899.1| PREDICTED: putative glycosyltransferase 5 [Prunus mume]
 ref|XP_008239903.1| PREDICTED: putative glycosyltransferase 5 [Prunus mume]
Length=459

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 77/138 (56%), Gaps = 7/138 (5%)
 Frame = -2

Query  396  LGVLALWAFMSFL----TPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDRLHDPPEKN  229
            + +  L  F++ L    T G G+  ++   +   N +EE        +     +DP E  
Sbjct  50   IKITILCGFVTILVLRGTIGVGNLGNSEADAINQNIIEETNRILAEIRSDSDPNDPDELT  109

Query  228  FYD-DPKLSYTIDKPIKNWDEKRKEWLEQHPSF--IPGADNRILMVTGSQATPCRNPIGD  58
              + +P ++YT+   I NWD++RK WL+ +P F  +     R+L+VTGS   PC NPIGD
Sbjct  110  QTEINPNITYTLGPKIANWDKERKAWLQSNPEFPSLVNGKPRVLLVTGSPPKPCDNPIGD  169

Query  57   HLLLRLFKNKVDYCRIHG  4
            H LL++ KNK+DYCR+HG
Sbjct  170  HYLLKVIKNKIDYCRLHG  187



>ref|XP_011090963.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Sesamum indicum]
Length=459

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 70/119 (59%), Gaps = 15/119 (13%)
 Frame = -2

Query  348  SGSDFDAGRKSTA-FNGVEEKQECSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWD  172
            SGS  ++G  S A F+  +  ++  DG + F R           DP   Y++   I +WD
Sbjct  80   SGSSTESGSNSYAEFDITKILKDEDDGVEEFKR-----------DPSQPYSLGPKISDWD  128

Query  171  EKRKEWLEQHP---SFIPGADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHG  4
            ++R EWL+++P   +FI     R+L+VTGS   PC NP+GDH LL+  KNK+DYCR+HG
Sbjct  129  QQRAEWLQRNPRFPNFIAENKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRVHG  187



>ref|XP_008374566.1| PREDICTED: putative glycosyltransferase 5 [Malus domestica]
Length=458

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 74/137 (54%), Gaps = 7/137 (5%)
 Frame = -2

Query  396  LGVLALWAFMSFL----TPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDRLHDPPEKN  229
            + +  L  F++ L    T G GS   +   +   N +EE        +     +DP E  
Sbjct  51   IKITILCGFVTILVLRGTIGVGSLGSSETDAVNQNLIEETNRILAEIRSDSDPNDPDELT  110

Query  228  FYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSF--IPGADNRILMVTGSQATPCRNPIGDH  55
               +P ++YT+   I NWD +RK+WL  +P F  +     R+L+VTGS   PC NPIGDH
Sbjct  111  -ETNPNITYTLGPKIANWDAERKDWLRSNPDFPSLVNGKPRVLLVTGSPPKPCDNPIGDH  169

Query  54   LLLRLFKNKVDYCRIHG  4
             LL++ KNK+DYCR+HG
Sbjct  170  YLLKVIKNKIDYCRLHG  186



>ref|XP_011047184.1| PREDICTED: putative glycosyltransferase 5 [Populus euphratica]
Length=453

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 74/138 (54%), Gaps = 10/138 (7%)
 Frame = -2

Query  396  LGVLALWAFMSFL----TPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDRLHDPPEKN  229
            + +  L  F++ L    T G GS   +   +   N +EE        +      DP E  
Sbjct  48   IKITILCGFVTILVLRGTVGIGSLSSSDADAVNQNLIEETNRILKEIRSDSEPDDPAESE  107

Query  228  FYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADN---RILMVTGSQATPCRNPIGD  58
               +P  +Y++   I NW+++RK WL Q+P F P   N   RIL++TGS  +PC NPIGD
Sbjct  108  I--NPNATYSLGPKISNWNQERKVWLSQNPEF-PNFVNGKPRILLLTGSPPSPCDNPIGD  164

Query  57   HLLLRLFKNKVDYCRIHG  4
            H LL+  KNK+DYCRIHG
Sbjct  165  HYLLKAIKNKIDYCRIHG  182



>ref|XP_008466919.1| PREDICTED: putative glycosyltransferase 5, partial [Cucumis melo]
Length=236

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 54/75 (72%), Gaps = 4/75 (5%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADN---RILMVTGSQATPCRNPIGDHLL  49
            +P ++YT+   I NW+++RK WL+Q+P F P   N   RIL+VTGS   PC NPIGDH L
Sbjct  81   NPNVTYTLGPKIVNWNQERKVWLDQNPEF-PNYVNKRARILLVTGSPPKPCDNPIGDHYL  139

Query  48   LRLFKNKVDYCRIHG  4
            L+  KNK+DYCR+HG
Sbjct  140  LKAIKNKIDYCRLHG  154



>gb|KDP31286.1| hypothetical protein JCGZ_11662 [Jatropha curcas]
Length=422

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 78/141 (55%), Gaps = 13/141 (9%)
 Frame = -2

Query  396  LGVLALWAFMSFL----TPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDRLHDP---P  238
            + +  L  F++ L    T G G+   +  ++   N +EE        +  D   DP   P
Sbjct  14   IKITILCGFVTILVLRGTIGIGNLTSSDAEAINQNLIEETNRILAEIRSDDDPTDPNELP  73

Query  237  EKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQH---PSFIPGADNRILMVTGSQATPCRNP  67
            E     +P ++YT+   I NWD++RK WL Q+   P+F+ G   RIL++TGS   PC NP
Sbjct  74   EPEI--NPNVTYTLGPKIANWDQERKVWLTQNAEFPNFVNGK-ARILLLTGSPPKPCDNP  130

Query  66   IGDHLLLRLFKNKVDYCRIHG  4
            IGDH LL+  KNK+DYCRIHG
Sbjct  131  IGDHYLLKAIKNKIDYCRIHG  151



>ref|XP_002514720.1| Xyloglucan 6-xylosyltransferase, putative [Ricinus communis]
 gb|EEF47826.1| Xyloglucan 6-xylosyltransferase, putative [Ricinus communis]
Length=454

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 78/139 (56%), Gaps = 9/139 (6%)
 Frame = -2

Query  396  LGVLALWAFMSFL----TPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDRLHDPPEK-  232
            + +  L  F++ L    T G GS   +  ++   N +EE        +  +   DP E  
Sbjct  49   IKITILCGFVTILVLRGTIGIGSLTSSDAEAINQNLIEETNRILAEIRSDNDPTDPDEPP  108

Query  231  NFYDDPKLSYTIDKPIKNWDEKRKEWLEQHP---SFIPGADNRILMVTGSQATPCRNPIG  61
                +P ++YT+   I+NWD++RK W  Q+P   SF+ G   RIL++TGS  +PC NPIG
Sbjct  109  ELEINPNVTYTLGPKIENWDQERKVWRNQNPEFPSFVNGKP-RILLLTGSPPSPCDNPIG  167

Query  60   DHLLLRLFKNKVDYCRIHG  4
            DH LL+  KNK+DYCRIHG
Sbjct  168  DHYLLKAIKNKIDYCRIHG  186



>ref|XP_010537379.1| PREDICTED: putative glycosyltransferase 5 [Tarenaya hassleriana]
Length=455

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 54/75 (72%), Gaps = 4/75 (5%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADN---RILMVTGSQATPCRNPIGDHLL  49
            DP ++YT+   I NWD +RK WL+Q+P F P + N   RIL++TGS   PC NPIGDH L
Sbjct  114  DPNVTYTLGPKITNWDSQRKVWLDQNPEF-PNSVNGKARILLLTGSPPKPCDNPIGDHYL  172

Query  48   LRLFKNKVDYCRIHG  4
            L+  KNK+DYCR+HG
Sbjct  173  LKSVKNKIDYCRLHG  187



>ref|XP_003575986.2| PREDICTED: galactomannan galactosyltransferase 1-like [Brachypodium 
distachyon]
Length=479

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 52/80 (65%), Gaps = 2/80 (3%)
 Frame = -2

Query  237  EKNFYDDPKLSYTID--KPIKNWDEKRKEWLEQHPSFIPGADNRILMVTGSQATPCRNPI  64
             + FYDDP+LSY +   + +  WD KR EWL  H     G   R++M++GSQ+ PC+   
Sbjct  100  RRTFYDDPELSYAVGGGRRLTGWDAKRAEWLRIHGLNNGGGQERVVMLSGSQSHPCKGAG  159

Query  63   GDHLLLRLFKNKVDYCRIHG  4
            GDH LLR  KNKVDYCR+HG
Sbjct  160  GDHALLRFLKNKVDYCRLHG  179



>ref|XP_009339134.1| PREDICTED: putative glycosyltransferase 5 [Pyrus x bretschneideri]
Length=460

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 75/138 (54%), Gaps = 7/138 (5%)
 Frame = -2

Query  396  LGVLALWAFMSFL----TPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDRLHDPPEKN  229
            + +  L  F++ L    T G GS   +   +   N +EE        +     +DP E  
Sbjct  51   IKITILCGFVTILVLRGTIGVGSLGSSEADAVNQNLIEETNRILAEIRSDSDPNDPDELT  110

Query  228  FYD-DPKLSYTIDKPIKNWDEKRKEWLEQHPSF--IPGADNRILMVTGSQATPCRNPIGD  58
              + +P ++YT+   I NWD +RK+WL  +P F  +     R+L+VTGS   PC NPIGD
Sbjct  111  ETEINPNITYTLGPKIANWDSERKDWLGSNPDFPSLVNGKPRVLLVTGSPPKPCDNPIGD  170

Query  57   HLLLRLFKNKVDYCRIHG  4
            H LL++ KNK+DYCR+HG
Sbjct  171  HYLLKVIKNKIDYCRLHG  188



>ref|XP_007138911.1| hypothetical protein PHAVU_009G248100g [Phaseolus vulgaris]
 gb|ESW10905.1| hypothetical protein PHAVU_009G248100g [Phaseolus vulgaris]
Length=452

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 56/84 (67%), Gaps = 3/84 (4%)
 Frame = -2

Query  246  DPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLE---QHPSFIPGADNRILMVTGSQATPC  76
            +PP ++   DP   YT+   I +WDE+R+ WL    ++P+FI     R+L+VTGS   PC
Sbjct  97   EPPSEDEKRDPNAPYTLGPKISDWDEQRRAWLRANPEYPNFIRPNKPRVLLVTGSSPKPC  156

Query  75   RNPIGDHLLLRLFKNKVDYCRIHG  4
             NP+GDH L++  KNK+DYCR+HG
Sbjct  157  ENPVGDHYLVKSIKNKIDYCRVHG  180



>ref|XP_009338860.1| PREDICTED: putative glycosyltransferase 5 [Pyrus x bretschneideri]
Length=460

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 78/139 (56%), Gaps = 9/139 (6%)
 Frame = -2

Query  396  LGVLALWAFMSFL----TPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDRLHDPPEKN  229
            + +  L  F++ L    T G G+   +   +   N +EE        +     +DP E  
Sbjct  51   IKITILCGFVTILVLRGTIGVGNLGSSEADAVNQNLIEETNRILAEIRSDSDPNDPDELT  110

Query  228  FYD-DPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADN---RILMVTGSQATPCRNPIG  61
              + +P ++YT+   I NWD++RK+WL  +P F P + N   R+L+VTGS   PC NPIG
Sbjct  111  ETEMNPNITYTLGPKIANWDKERKDWLRLNPDF-PSSVNGKPRVLLVTGSPPKPCDNPIG  169

Query  60   DHLLLRLFKNKVDYCRIHG  4
            DH LL++ KNK+DYCR+HG
Sbjct  170  DHYLLKVIKNKIDYCRLHG  188



>ref|NP_196389.1| xyloglucan 6-xylosyltransferase [Arabidopsis thaliana]
 sp|Q9LF80.1|GT3_ARATH RecName: Full=Putative glycosyltransferase 3; Short=AtGT3 [Arabidopsis 
thaliana]
 emb|CAC01676.1| putative golgi glycosyltransferase [Arabidopsis thaliana]
 dbj|BAB11451.1| alpha galactosyltransferase protein [Arabidopsis thaliana]
 gb|AAQ56808.1| At5g07720 [Arabidopsis thaliana]
 dbj|BAE99734.1| alpha galactosyltransferase protein [Arabidopsis thaliana]
 gb|AED91197.1| xyloglucan 6-xylosyltransferase [Arabidopsis thaliana]
 gb|AHL38639.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=457

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 83/164 (51%), Gaps = 12/164 (7%)
 Frame = -2

Query  471  TMASHRCRTPP---TFFSNGFAFAGATVL-GVLALWAFMSFLTPGSG-SDFDAGRKSTAF  307
            TMAS   R PP         F     T+L G + +      +    G SD D   ++   
Sbjct  27   TMASGGVRRPPPRGRQIQKTFNNVKMTILCGFVTILVLRGTIGINFGTSDADVVNQNIIE  86

Query  306  NGVEEKQECSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHP---S  136
                   E    S   D  ++PP+ +   D  ++YT+   I NWD+KRK WL Q+P   S
Sbjct  87   ETNRLLAEIRSDSDPTDS-NEPPDSDL--DLNMTYTLGPKITNWDQKRKLWLTQNPDFPS  143

Query  135  FIPGADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHG  4
            FI G   ++L++TGS   PC NPIGDH LL+  KNK+DYCRIHG
Sbjct  144  FINGK-AKVLLLTGSPPKPCDNPIGDHYLLKSVKNKIDYCRIHG  186



>ref|XP_010666578.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Beta vulgaris subsp. 
vulgaris]
Length=452

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 57/84 (68%), Gaps = 6/84 (7%)
 Frame = -2

Query  246  DPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQH---PSFIPGADNRILMVTGSQATPC  76
            +P EK    DP   Y++   I +WDE+R+EWLE++   P+F+     R+L+VTGS   PC
Sbjct  103  EPAEK---IDPNKPYSLGPKISDWDEQRREWLEKNKEFPNFVQPNKPRVLLVTGSSPKPC  159

Query  75   RNPIGDHLLLRLFKNKVDYCRIHG  4
             NP+GDH LL+  KNK+DYCRIHG
Sbjct  160  ENPVGDHYLLKSIKNKIDYCRIHG  183



>ref|XP_010108713.1| Putative glycosyltransferase 3 [Morus notabilis]
 gb|EXC20024.1| Putative glycosyltransferase 3 [Morus notabilis]
Length=449

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 70/123 (57%), Gaps = 11/123 (9%)
 Frame = -2

Query  360  LTPGSGSDFDAGRKSTAFNGV-EEKQECSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPI  184
            LT  S  D +  R +   N +  E +  SD +       +PPE     +P  +Y++   I
Sbjct  66   LTGSSSDDAEVRRIAEETNRILAEIRSDSDPTDA----DEPPESE--TNPNATYSLGPKI  119

Query  183  KNWDEKRKEWLEQHPSFIPGADN---RILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCR  13
             NWD++RK WL Q+P F P   N   R+L+VTGS   PC NPIGDH LL+  KNK+DYCR
Sbjct  120  SNWDQERKLWLGQNPQF-PNYINGKARVLLVTGSPPKPCDNPIGDHYLLKSIKNKIDYCR  178

Query  12   IHG  4
            IHG
Sbjct  179  IHG  181



>ref|XP_008393187.1| PREDICTED: putative glycosyltransferase 5 [Malus domestica]
Length=460

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 76/138 (55%), Gaps = 7/138 (5%)
 Frame = -2

Query  396  LGVLALWAFMSFL----TPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDRLHDPPEKN  229
            + +  L  F++ L    T G G+   +   +   N +EE        +     +DP E  
Sbjct  51   IKITILCGFVTILVLRGTIGVGNLGSSEADAVNQNLIEETNRILAEIRSDSDPNDPDELT  110

Query  228  FYD-DPKLSYTIDKPIKNWDEKRKEWLEQHPSF--IPGADNRILMVTGSQATPCRNPIGD  58
              + +P ++YT+   I NWD++RK+WL  +P F  +     R+L+VTGS   PC NPIGD
Sbjct  111  ETEINPNITYTLGPKIANWDKERKDWLRLNPDFPSLVNGKPRVLLVTGSPPKPCDNPIGD  170

Query  57   HLLLRLFKNKVDYCRIHG  4
            H LL++ KNK+DYCR+HG
Sbjct  171  HYLLKVIKNKIDYCRLHG  188



>ref|XP_010652172.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Vitis vinifera]
 emb|CAN59912.1| hypothetical protein VITISV_017033 [Vitis vinifera]
Length=452

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 67/123 (54%), Gaps = 12/123 (10%)
 Frame = -2

Query  336  FDAGRKSTAFNGVEEKQECSDGSQGFDR---------LHDPPEKNFYDDPKLSYTIDKPI  184
            F   +++     +EE Q  S  S   +          L D  + +   DPK  Y++   I
Sbjct  58   FSPRKRAEPHRVLEEVQTTSSSSSELNNYATFDLNKLLVDEEDDSEKPDPKKPYSLGPKI  117

Query  183  KNWDEKRKEWLEQHPSF---IPGADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCR  13
             +WDE+R  WLEQ+P+F   I     R+L+VTGS   PC NP+GDH LL+  KNK+DYCR
Sbjct  118  SDWDEQRSTWLEQNPNFPNFIGPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCR  177

Query  12   IHG  4
            +HG
Sbjct  178  LHG  180



>ref|XP_010258549.1| PREDICTED: putative glycosyltransferase 5 isoform X2 [Nelumbo 
nucifera]
Length=457

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 50/74 (68%), Gaps = 2/74 (3%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPSF--IPGADNRILMVTGSQATPCRNPIGDHLLL  46
            +P ++YT+   I NW+E+RK WL  +P F        RIL+VTGS   PC NPIGDH LL
Sbjct  111  NPNITYTLGPKISNWNEERKAWLNNNPEFPNYISGKARILLVTGSPPNPCDNPIGDHYLL  170

Query  45   RLFKNKVDYCRIHG  4
            +  KNK+DYCRIHG
Sbjct  171  KAIKNKIDYCRIHG  184



>emb|CBI36830.3| unnamed protein product [Vitis vinifera]
Length=382

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 52/75 (69%), Gaps = 3/75 (4%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPSF---IPGADNRILMVTGSQATPCRNPIGDHLL  49
            DPK  Y++   I +WDE+R  WLEQ+P+F   I     R+L+VTGS   PC NP+GDH L
Sbjct  99   DPKKPYSLGPKISDWDEQRSTWLEQNPNFPNFIGPNKPRVLLVTGSSPKPCENPVGDHYL  158

Query  48   LRLFKNKVDYCRIHG  4
            L+  KNK+DYCR+HG
Sbjct  159  LKSIKNKIDYCRLHG  173



>emb|CDY19235.1| BnaC05g14360D [Brassica napus]
Length=452

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 71/132 (54%), Gaps = 5/132 (4%)
 Frame = -2

Query  390  VLALWAFMSFLTPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDR-LHDPPEKNFYDDP  214
            +L L   +SF   GS +  DA  ++          E    S   D  L +PP+     +P
Sbjct  55   ILVLLGTVSFGNLGSSNADDAVNQNLIKETKPILAESPSASVPNDLDLEEPPKAEV--NP  112

Query  213  KLSYTIDKPIKNWDEKRKEWLEQHPSF--IPGADNRILMVTGSQATPCRNPIGDHLLLRL  40
             ++YT+   I NWD +RK WL Q+P F  I     RIL++TGS   PC  PIGD+ LL+ 
Sbjct  113  NVTYTLGPRITNWDSQRKVWLNQNPGFPSIVNGKARILLLTGSPPGPCDKPIGDYYLLKS  172

Query  39   FKNKVDYCRIHG  4
             KNK+DYCRIHG
Sbjct  173  VKNKIDYCRIHG  184



>ref|XP_010258542.1| PREDICTED: putative glycosyltransferase 5 isoform X1 [Nelumbo 
nucifera]
Length=461

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 50/74 (68%), Gaps = 2/74 (3%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPSF--IPGADNRILMVTGSQATPCRNPIGDHLLL  46
            +P ++YT+   I NW+E+RK WL  +P F        RIL+VTGS   PC NPIGDH LL
Sbjct  111  NPNITYTLGPKISNWNEERKAWLNNNPEFPNYISGKARILLVTGSPPNPCDNPIGDHYLL  170

Query  45   RLFKNKVDYCRIHG  4
            +  KNK+DYCRIHG
Sbjct  171  KAIKNKIDYCRIHG  184



>ref|XP_009416128.1| PREDICTED: putative glycosyltransferase 2 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009416136.1| PREDICTED: putative glycosyltransferase 2 [Musa acuminata subsp. 
malaccensis]
Length=432

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 55/88 (63%), Gaps = 8/88 (9%)
 Frame = -2

Query  258  DRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHP---SFIPGADNRILMVTGSQ  88
            D   DPP      DP   Y++   I +WDE+R +WL +HP   SF+     R+L+VTGS 
Sbjct  76   DSEEDPPR-----DPSQPYSLGPKISDWDEQRADWLRRHPERPSFLGPNKPRVLLVTGSS  130

Query  87   ATPCRNPIGDHLLLRLFKNKVDYCRIHG  4
              PC NP+GDH LL+  KNK+DYCR+HG
Sbjct  131  PKPCENPVGDHYLLKSIKNKIDYCRVHG  158



>ref|XP_007209124.1| hypothetical protein PRUPE_ppa005479mg [Prunus persica]
 gb|EMJ10323.1| hypothetical protein PRUPE_ppa005479mg [Prunus persica]
Length=459

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 75/138 (54%), Gaps = 7/138 (5%)
 Frame = -2

Query  396  LGVLALWAFMSFL----TPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDRLHDPPEKN  229
            + +  L  F++ L    T G G+   +   +   N +EE        +     +DP E  
Sbjct  50   IKITILCGFVTILVLRGTIGVGNLGSSEADAVNQNIIEETNRILAEIRSDSDPNDPDELT  109

Query  228  FYD-DPKLSYTIDKPIKNWDEKRKEWLEQHPSF--IPGADNRILMVTGSQATPCRNPIGD  58
              + +P ++YT+   I NWD++R  WL+ +P F  +     R+L+VTGS   PC NPIGD
Sbjct  110  QTEINPNITYTLGPKIANWDKERNAWLQSNPEFPSLVNGKPRVLLVTGSPPKPCDNPIGD  169

Query  57   HLLLRLFKNKVDYCRIHG  4
            H LL++ KNK+DYCR+HG
Sbjct  170  HYLLKVIKNKIDYCRLHG  187



>ref|XP_010922270.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Elaeis guineensis]
Length=454

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 54/84 (64%), Gaps = 8/84 (10%)
 Frame = -2

Query  246  DPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHP---SFIPGADNRILMVTGSQATPC  76
            DPP+     DP + YT+   I +WDE+R  WL +HP   +F      R+L+VTGS   PC
Sbjct  98   DPPQ-----DPNIPYTLGPKISDWDEQRAAWLRRHPESPNFWGPNKPRVLLVTGSSPKPC  152

Query  75   RNPIGDHLLLRLFKNKVDYCRIHG  4
             NP+GDH LL+  KNK+DYCR+HG
Sbjct  153  ENPVGDHYLLKSIKNKIDYCRVHG  176



>ref|XP_002284667.1| PREDICTED: putative glycosyltransferase 5 [Vitis vinifera]
Length=450

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 52/74 (70%), Gaps = 2/74 (3%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPSF--IPGADNRILMVTGSQATPCRNPIGDHLLL  46
            +P ++YT+   I NW+E+RK WL+++P F        RIL+VTGS   PC NPIGDH LL
Sbjct  108  NPNVTYTLGPKITNWNEERKVWLDRNPEFPNFVNGKARILLVTGSPPNPCDNPIGDHYLL  167

Query  45   RLFKNKVDYCRIHG  4
            +  KNK+DYCRIHG
Sbjct  168  KSIKNKIDYCRIHG  181



>ref|XP_009600562.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Nicotiana tomentosiformis]
Length=464

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 55/85 (65%), Gaps = 3/85 (4%)
 Frame = -2

Query  249  HDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQH---PSFIPGADNRILMVTGSQATP  79
             D  E  F  DP   Y++   I +WDE+R EWL+++   P+F+     R+L+VTGS   P
Sbjct  107  EDDGEPEFKRDPNEPYSLGPKISDWDEQRAEWLKKNLNFPNFVGPNKPRVLLVTGSSPKP  166

Query  78   CRNPIGDHLLLRLFKNKVDYCRIHG  4
            C NPIGDH LL+  KNK+DYCR+HG
Sbjct  167  CENPIGDHYLLKSIKNKIDYCRLHG  191



>emb|CAN80739.1| hypothetical protein VITISV_027037 [Vitis vinifera]
Length=450

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 52/74 (70%), Gaps = 2/74 (3%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPSF--IPGADNRILMVTGSQATPCRNPIGDHLLL  46
            +P ++YT+   I NW+E+RK WL+++P F        RIL+VTGS   PC NPIGDH LL
Sbjct  108  NPNVTYTLGPKITNWNEERKVWLDRNPEFPNFVNGKARILLVTGSPPNPCDNPIGDHYLL  167

Query  45   RLFKNKVDYCRIHG  4
            +  KNK+DYCRIHG
Sbjct  168  KSIKNKIDYCRIHG  181



>ref|XP_004508217.1| PREDICTED: putative glycosyltransferase 2-like [Cicer arietinum]
Length=452

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 51/75 (68%), Gaps = 3/75 (4%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQ---HPSFIPGADNRILMVTGSQATPCRNPIGDHLL  49
            DPK  YT+   I +WDE+R +WL     +PSFI     R+L+VTGS   PC NP+GDH L
Sbjct  105  DPKTPYTLGPKISDWDEQRSKWLRNNPDYPSFIRPNKPRVLLVTGSSPKPCENPVGDHYL  164

Query  48   LRLFKNKVDYCRIHG  4
            L+  KNK+DYCR+HG
Sbjct  165  LKSIKNKIDYCRLHG  179



>ref|XP_006287623.1| hypothetical protein CARUB_v10000835mg, partial [Capsella rubella]
 gb|EOA20521.1| hypothetical protein CARUB_v10000835mg, partial [Capsella rubella]
Length=485

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 4/84 (5%)
 Frame = -2

Query  249  HDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSF--IPGADNRILMVTGSQATPC  76
            ++PP+ +   D  ++YT+   I NWD++RK WL Q+P F  +     ++L++TGS   PC
Sbjct  133  NEPPDSDL--DLNMTYTLGPKITNWDQQRKLWLTQNPDFPSVVNGKAKVLLLTGSPPKPC  190

Query  75   RNPIGDHLLLRLFKNKVDYCRIHG  4
             NPIGDH LL+  KNK+DYCRIHG
Sbjct  191  DNPIGDHYLLKSVKNKIDYCRIHG  214



>ref|XP_010943718.1| PREDICTED: putative glycosyltransferase 5 [Elaeis guineensis]
Length=453

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 50/71 (70%), Gaps = 3/71 (4%)
 Frame = -2

Query  207  SYTIDKPIKNWDEKRKEWLEQHPSF---IPGADNRILMVTGSQATPCRNPIGDHLLLRLF  37
            +YT+   I +WDE+R+ WL  HP F   I G   RIL+VTGS  +PC NPIGDH LL+  
Sbjct  118  NYTLGPKISDWDEQRRRWLADHPEFPSRIAGGKPRILLVTGSPPSPCDNPIGDHYLLKGT  177

Query  36   KNKVDYCRIHG  4
            KNK+DYCR+HG
Sbjct  178  KNKIDYCRLHG  188



>ref|XP_004154959.1| PREDICTED: putative glycosyltransferase 3-like [Cucumis sativus]
Length=460

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 54/75 (72%), Gaps = 4/75 (5%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADN---RILMVTGSQATPCRNPIGDHLL  49
            +P ++YT+   I NW+++RK WL+Q+P F P   N   RIL+VTGS   PC NPIGDH L
Sbjct  114  NPNVTYTLGPKIVNWNQERKVWLDQNPEF-PNYVNKRARILLVTGSPPKPCDNPIGDHYL  172

Query  48   LRLFKNKVDYCRIHG  4
            L+  KNK+DYCR+HG
Sbjct  173  LKAIKNKIDYCRLHG  187



>ref|XP_004138179.1| PREDICTED: putative glycosyltransferase 3-like [Cucumis sativus]
 gb|KGN63690.1| hypothetical protein Csa_1G010930 [Cucumis sativus]
Length=460

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 54/75 (72%), Gaps = 4/75 (5%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADN---RILMVTGSQATPCRNPIGDHLL  49
            +P ++YT+   I NW+++RK WL+Q+P F P   N   RIL+VTGS   PC NPIGDH L
Sbjct  114  NPNVTYTLGPKIVNWNQERKVWLDQNPEF-PNYVNKRARILLVTGSPPKPCDNPIGDHYL  172

Query  48   LRLFKNKVDYCRIHG  4
            L+  KNK+DYCR+HG
Sbjct  173  LKAIKNKIDYCRLHG  187



>ref|XP_002449648.1| hypothetical protein SORBIDRAFT_05g020910 [Sorghum bicolor]
 gb|EES08636.1| hypothetical protein SORBIDRAFT_05g020910 [Sorghum bicolor]
Length=449

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 53/80 (66%), Gaps = 4/80 (5%)
 Frame = -2

Query  234  KNFYDDPKLSYTIDKPIKNWDEKRKEWLEQH---PSFIPGADNRILMVTGSQATPCRNPI  64
            + FYDD  LSY + + + +WD KR +WL       +  P A+ R++MV+GSQ  PCR   
Sbjct  74   RTFYDDADLSYALGRRVTDWDAKRAQWLRSRGLGRNAGPAAE-RVVMVSGSQPEPCRGAG  132

Query  63   GDHLLLRLFKNKVDYCRIHG  4
            GDHLLLR  KNKVDYCR+HG
Sbjct  133  GDHLLLRFLKNKVDYCRLHG  152



>dbj|BAJ96459.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=474

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 63/108 (58%), Gaps = 4/108 (4%)
 Frame = -2

Query  315  TAFNGVEEKQECSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQH-P  139
            T+F   + + + SD    + RL   P   + DD  LSY +D+ +  WD KR EWL QH P
Sbjct  78   TSFPQHQAEDDDSDSEGLYARLAAHPRTFYDDDAGLSYAVDRRVTGWDAKRAEWLRQHYP  137

Query  138  SFIP---GADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHG  4
              +    G   R++M++GSQ+ PC    GDH+LLR  KNK+DY R+HG
Sbjct  138  RGLRARRGPGERVVMLSGSQSYPCAGDGGDHMLLRFLKNKLDYARLHG  185



>ref|XP_004138178.1| PREDICTED: putative glycosyltransferase 5-like [Cucumis sativus]
 gb|KGN63689.1| hypothetical protein Csa_1G009930 [Cucumis sativus]
Length=460

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 54/75 (72%), Gaps = 4/75 (5%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADN---RILMVTGSQATPCRNPIGDHLL  49
            +P ++YT+   I NW+++RK WL+Q+P F P   N   RIL+VTGS   PC NPIGDH L
Sbjct  114  NPNVTYTLGPKIVNWNQERKVWLDQNPEF-PNYVNKRARILLVTGSPPKPCDNPIGDHYL  172

Query  48   LRLFKNKVDYCRIHG  4
            L+  KNK+DYCR+HG
Sbjct  173  LKAIKNKIDYCRLHG  187



>gb|EPS71488.1| hypothetical protein M569_03267 [Genlisea aurea]
Length=450

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 52/78 (67%), Gaps = 3/78 (4%)
 Frame = -2

Query  228  FYDDPKLSYTIDKPIKNWDEKRKEWLEQHP---SFIPGADNRILMVTGSQATPCRNPIGD  58
            F  DP   YT+   I +WD++R EWL+ +P   +FI G   R+L+VTGS   PC NPIGD
Sbjct  102  FKRDPSQPYTLGPKISDWDQQRGEWLKNNPDFPNFITGNKPRVLLVTGSSPKPCENPIGD  161

Query  57   HLLLRLFKNKVDYCRIHG  4
            H LL+  KNK+DYCR+H 
Sbjct  162  HYLLKSIKNKIDYCRLHA  179



>ref|XP_010523024.1| PREDICTED: putative glycosyltransferase 3 [Tarenaya hassleriana]
Length=454

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 55/84 (65%), Gaps = 3/84 (4%)
 Frame = -2

Query  246  DPPEKNFYD-DPKLSYTIDKPIKNWDEKRKEWLEQHPSF--IPGADNRILMVTGSQATPC  76
            DP E    D +  ++YT+   I NWDE+RK WL Q+P F  +     RIL++TGS   PC
Sbjct  100  DPDEPTESDLNLNMTYTLGPKITNWDEQRKVWLSQNPEFPNVVNGKPRILLLTGSPPKPC  159

Query  75   RNPIGDHLLLRLFKNKVDYCRIHG  4
             NPIGDH LL+  KNK+DYCR+HG
Sbjct  160  DNPIGDHYLLKSVKNKIDYCRLHG  183



>ref|XP_009780568.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Nicotiana 
sylvestris]
Length=466

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 54/85 (64%), Gaps = 3/85 (4%)
 Frame = -2

Query  249  HDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQH---PSFIPGADNRILMVTGSQATP  79
             D  E  F  DP   Y +   I +WDE+R EWL+++   P+F+     R+L+VTGS   P
Sbjct  109  EDDGEPEFKRDPNEPYNLGPKISDWDEQRAEWLKKNLNFPNFVGPNKPRVLLVTGSSPKP  168

Query  78   CRNPIGDHLLLRLFKNKVDYCRIHG  4
            C NPIGDH LL+  KNK+DYCR+HG
Sbjct  169  CENPIGDHYLLKSIKNKIDYCRLHG  193



>ref|XP_006356974.1| PREDICTED: putative glycosyltransferase 2-like [Solanum tuberosum]
Length=464

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 54/85 (64%), Gaps = 3/85 (4%)
 Frame = -2

Query  249  HDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSF---IPGADNRILMVTGSQATP  79
             D  E  F  DP   Y +   I +WDE+R EWL+++P+F   +     R+L+VTGS   P
Sbjct  108  EDDGEPEFKRDPNQPYALGPKITDWDEQRGEWLKKNPNFPNFVGTNKPRVLLVTGSSPKP  167

Query  78   CRNPIGDHLLLRLFKNKVDYCRIHG  4
            C NP+GDH LL+  KNK+DYCR+HG
Sbjct  168  CENPVGDHYLLKSIKNKIDYCRLHG  192



>ref|XP_010938345.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Elaeis guineensis]
Length=449

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 53/84 (63%), Gaps = 8/84 (10%)
 Frame = -2

Query  246  DPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHP---SFIPGADNRILMVTGSQATPC  76
            DPP      DP + Y++   I +WDE+R  WL +HP   +F      R+L+VTGS   PC
Sbjct  94   DPPR-----DPNIPYSLGPKISDWDEQRAAWLRRHPESPNFWGSNKPRVLLVTGSSPKPC  148

Query  75   RNPIGDHLLLRLFKNKVDYCRIHG  4
             NP+GDH LL+  KNK+DYCR+HG
Sbjct  149  ENPVGDHYLLKSIKNKIDYCRVHG  172



>ref|XP_008235045.1| PREDICTED: putative glycosyltransferase 2 [Prunus mume]
Length=448

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 52/75 (69%), Gaps = 3/75 (4%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQH---PSFIPGADNRILMVTGSQATPCRNPIGDHLL  49
            DP   YT+   I NWDE+R +WL+++   P+FI     R+L+VTGS   PC NP+GDH L
Sbjct  103  DPNKPYTLGPKISNWDEQRSKWLKENTNFPNFIGPNKPRVLLVTGSSPKPCENPVGDHYL  162

Query  48   LRLFKNKVDYCRIHG  4
            L+  KNK+DYCR+HG
Sbjct  163  LKSIKNKIDYCRLHG  177



>ref|XP_008368989.1| PREDICTED: putative glycosyltransferase 2 [Malus domestica]
Length=448

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 51/75 (68%), Gaps = 3/75 (4%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPSF---IPGADNRILMVTGSQATPCRNPIGDHLL  49
            DP   YT+   I NWDE+R +WL ++P+F   +     R+L+VTGS   PC NP+GDH L
Sbjct  102  DPNKPYTLGPKISNWDEQRSKWLRENPNFPNFVGPGKPRVLLVTGSSPKPCENPVGDHYL  161

Query  48   LRLFKNKVDYCRIHG  4
            L+  KNK+DYCR+HG
Sbjct  162  LKSIKNKIDYCRLHG  176



>ref|XP_009342118.1| PREDICTED: putative glycosyltransferase 2 [Pyrus x bretschneideri]
 ref|XP_009342138.1| PREDICTED: putative glycosyltransferase 2 [Pyrus x bretschneideri]
Length=449

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 51/75 (68%), Gaps = 3/75 (4%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPSF---IPGADNRILMVTGSQATPCRNPIGDHLL  49
            DP   YT+   I NWDE+R +WL ++P+F   +     R+L+VTGS   PC NP+GDH L
Sbjct  103  DPNKPYTLGPKISNWDEQRSKWLRENPNFPNFVGPGKPRVLLVTGSSPKPCENPVGDHYL  162

Query  48   LRLFKNKVDYCRIHG  4
            L+  KNK+DYCR+HG
Sbjct  163  LKSIKNKIDYCRLHG  177



>ref|XP_008367147.1| PREDICTED: putative glycosyltransferase 2 [Malus domestica]
Length=460

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 58/87 (67%), Gaps = 4/87 (5%)
 Frame = -2

Query  252  LHDPPE-KNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHP---SFIPGADNRILMVTGSQA  85
            L D PE ++   DP   Y++   I NWDE+R +WL+++P   +F+     R+L+VTGS  
Sbjct  101  LKDEPETEDXKRDPNQPYSLGPKISNWDEQRSDWLKKNPGFPNFVGPNKPRVLLVTGSSP  160

Query  84   TPCRNPIGDHLLLRLFKNKVDYCRIHG  4
             PC NP+GDH LL+  KNK+DYCR+HG
Sbjct  161  KPCENPVGDHYLLKSIKNKIDYCRLHG  187



>gb|ACE95677.1| putative xylosyl transferase [Coffea canephora]
Length=460

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 55/84 (65%), Gaps = 3/84 (4%)
 Frame = -2

Query  246  DPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSF---IPGADNRILMVTGSQATPC  76
            D  E  +  DP   Y++   I NWD++R EWL+++P+F   +     R+L+VTGS   PC
Sbjct  105  DGDEVVYKRDPNQPYSLGPKISNWDQQRAEWLKKNPNFRNFVAPNKPRVLLVTGSSPKPC  164

Query  75   RNPIGDHLLLRLFKNKVDYCRIHG  4
             NP+GDH LL+  KNK+DYCR+HG
Sbjct  165  ENPVGDHYLLKSIKNKIDYCRLHG  188



>ref|XP_009138722.1| PREDICTED: xyloglucan 6-xylosyltransferase-like [Brassica rapa]
Length=459

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 51/70 (73%), Gaps = 3/70 (4%)
 Frame = -2

Query  204  YTIDKPIKNWDEKRKEWLEQHPSF---IPGADNRILMVTGSQATPCRNPIGDHLLLRLFK  34
            Y++   I +WDE+R++WL+Q+PSF   +     R+L+VTGS   PC NP+GDH LL+  K
Sbjct  120  YSLGPKISDWDEQRRDWLKQNPSFPNFVAANKPRVLLVTGSAPKPCENPVGDHYLLKSIK  179

Query  33   NKVDYCRIHG  4
            NK+DYCRIHG
Sbjct  180  NKIDYCRIHG  189



>emb|CDO98874.1| unnamed protein product [Coffea canephora]
Length=460

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 55/84 (65%), Gaps = 3/84 (4%)
 Frame = -2

Query  246  DPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSF---IPGADNRILMVTGSQATPC  76
            D  E  +  DP   Y++   I NWD++R EWL+++P+F   +     R+L+VTGS   PC
Sbjct  105  DGDEVVYKRDPNQPYSLGPKISNWDQQRAEWLKKNPNFRNFVAPNKPRVLLVTGSSPKPC  164

Query  75   RNPIGDHLLLRLFKNKVDYCRIHG  4
             NP+GDH LL+  KNK+DYCR+HG
Sbjct  165  ENPVGDHYLLKSIKNKIDYCRLHG  188



>ref|XP_002871288.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH47547.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=457

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 59/85 (69%), Gaps = 6/85 (7%)
 Frame = -2

Query  249  HDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHP---SFIPGADNRILMVTGSQATP  79
            ++PP+ +   D  ++YT+   I NWD++RK WL Q+P   SF+ G   ++L++TGS   P
Sbjct  105  NEPPDSDL--DLNMTYTLGPKITNWDQQRKLWLTQNPDFPSFVNGK-AKVLLLTGSPPKP  161

Query  78   CRNPIGDHLLLRLFKNKVDYCRIHG  4
            C NPIGDH LL+  KNK+DYCRIHG
Sbjct  162  CDNPIGDHYLLKSVKNKIDYCRIHG  186



>ref|XP_011071657.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like, partial [Sesamum 
indicum]
Length=454

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 53/78 (68%), Gaps = 3/78 (4%)
 Frame = -2

Query  228  FYDDPKLSYTIDKPIKNWDEKRKEWLEQHP---SFIPGADNRILMVTGSQATPCRNPIGD  58
            F  DP   Y++   I +WDE+R EWL+++P   +FI     R+L+VTGS   PC NP+GD
Sbjct  108  FKRDPSQPYSLGPNISDWDEQRAEWLKKNPDFPNFIAENKPRVLLVTGSSPKPCENPVGD  167

Query  57   HLLLRLFKNKVDYCRIHG  4
            H LL+  KNK+DYCR+HG
Sbjct  168  HYLLKSIKNKIDYCRLHG  185



>ref|XP_010423175.1| PREDICTED: putative glycosyltransferase 3 [Camelina sativa]
Length=459

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 56/84 (67%), Gaps = 4/84 (5%)
 Frame = -2

Query  249  HDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSF--IPGADNRILMVTGSQATPC  76
            ++PP+ +   D  ++YT+   I NWD+KRK WL Q+P F  +     ++L++TGS   PC
Sbjct  107  NEPPDSDL--DLNMTYTLGPKITNWDQKRKLWLTQNPGFPSVVNGKAKVLLLTGSPPKPC  164

Query  75   RNPIGDHLLLRLFKNKVDYCRIHG  4
             N IGDH LL+  KNK+DYCRIHG
Sbjct  165  DNSIGDHYLLKSVKNKIDYCRIHG  188



>ref|XP_003533377.1| PREDICTED: putative glycosyltransferase 2-like isoform 3 [Glycine 
max]
Length=450

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 53/84 (63%), Gaps = 3/84 (4%)
 Frame = -2

Query  246  DPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQ---HPSFIPGADNRILMVTGSQATPC  76
            +PP  +   +P   YT+   I NWDE+R  WL     +P+FI     R+L+VTGS   PC
Sbjct  95   EPPTDDEKPNPNAPYTLGPKISNWDEQRSSWLSNNPDYPNFIGPNKPRVLLVTGSSPKPC  154

Query  75   RNPIGDHLLLRLFKNKVDYCRIHG  4
             NP+GDH L++  KNK+DYCR+HG
Sbjct  155  ENPVGDHYLVKSIKNKIDYCRVHG  178



>gb|EAY89653.1| hypothetical protein OsI_11184 [Oryza sativa Indica Group]
Length=436

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 52/84 (62%), Gaps = 6/84 (7%)
 Frame = -2

Query  246  DPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPS---FIPGADNRILMVTGSQATPC  76
            DPP +   D P   YT+   I +WDE+R  W  +HP    F+     R+L+VTGS   PC
Sbjct  84   DPPPRTLRDPP---YTLGPKISDWDEQRAAWHRRHPETPPFVNDVKPRVLLVTGSSPKPC  140

Query  75   RNPIGDHLLLRLFKNKVDYCRIHG  4
             NP+GDH LL+  KNK+DYCR+HG
Sbjct  141  ENPVGDHYLLKSIKNKMDYCRVHG  164



>gb|ABF95475.1| Glycosyltransferase 5, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ43011.1| hypothetical protein OsJ_27597 [Oryza sativa Japonica Group]
Length=448

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 52/84 (62%), Gaps = 6/84 (7%)
 Frame = -2

Query  246  DPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPS---FIPGADNRILMVTGSQATPC  76
            DPP +   D P   YT+   I +WDE+R  W  +HP    F+     R+L+VTGS   PC
Sbjct  96   DPPPRTLRDPP---YTLGPKISDWDEQRAAWHRRHPETPPFVNDVKPRVLLVTGSSPKPC  152

Query  75   RNPIGDHLLLRLFKNKVDYCRIHG  4
             NP+GDH LL+  KNK+DYCR+HG
Sbjct  153  ENPVGDHYLLKSIKNKMDYCRVHG  176



>ref|XP_006419581.1| hypothetical protein CICLE_v10004948mg [Citrus clementina]
 gb|ESR32821.1| hypothetical protein CICLE_v10004948mg [Citrus clementina]
Length=454

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 70/124 (56%), Gaps = 13/124 (10%)
 Frame = -2

Query  336  FDAGRKSTAFNGVEEKQECSDGSQGFD----------RLHDPPEKNFYDDPKLSYTIDKP  187
            F A RK    + V E+ + +D ++  D          +L     ++   DP   Y++   
Sbjct  58   FYAHRKRVEPHRVLEEVQTTDAAKTADPNNYEKFDMNKLFVDEGEDEKRDPNKQYSLGPK  117

Query  186  IKNWDEKRKEWLEQHPS---FIPGADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYC  16
            I +WDE+R EWL+++P+   F+     R+L+VTGS   PC NP+GDH LL+  KNK+DYC
Sbjct  118  ISDWDEQRSEWLKKNPTLPNFLRPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYC  177

Query  15   RIHG  4
            RIHG
Sbjct  178  RIHG  181



>emb|CDX93965.1| BnaC04g21240D [Brassica napus]
Length=458

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 60/89 (67%), Gaps = 4/89 (4%)
 Frame = -2

Query  261  FDRLHDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSF--IPGADN-RILMVTGS  91
            F ++ +  E+   D  K  Y++   I +WDE+R++WL+Q+PSF     A+  R+L+VTGS
Sbjct  98   FKKIFEGDEEKALDRSK-PYSLGPKISDWDEQRRDWLKQNPSFPNFAAANKPRVLLVTGS  156

Query  90   QATPCRNPIGDHLLLRLFKNKVDYCRIHG  4
               PC NP+GDH LL+  KNK+DYCRIHG
Sbjct  157  APKPCENPVGDHYLLKSIKNKIDYCRIHG  185



>ref|XP_010907157.1| PREDICTED: putative glycosyltransferase 5 [Elaeis guineensis]
Length=452

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 51/71 (72%), Gaps = 3/71 (4%)
 Frame = -2

Query  207  SYTIDKPIKNWDEKRKEWLEQHPSF---IPGADNRILMVTGSQATPCRNPIGDHLLLRLF  37
            +YT+   I +WDE+R+ WL ++P F   + G + RIL+VTGS   PC NPIGDH LL+  
Sbjct  117  NYTLGPKISDWDEQRRRWLRENPGFPSQVAGGNPRILLVTGSPPNPCDNPIGDHYLLKST  176

Query  36   KNKVDYCRIHG  4
            KNK+DYCR+HG
Sbjct  177  KNKIDYCRLHG  187



>ref|XP_008386651.1| PREDICTED: putative glycosyltransferase 2 [Malus domestica]
Length=449

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 50/75 (67%), Gaps = 3/75 (4%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPSF---IPGADNRILMVTGSQATPCRNPIGDHLL  49
            DP   YT+   I NWDE R +WL ++P+F   I     R+L+VTGS   PC NP+GDH L
Sbjct  103  DPNKPYTLGPKISNWDELRSKWLRENPNFPNFIGPGKPRVLLVTGSSPKPCENPVGDHYL  162

Query  48   LRLFKNKVDYCRIHG  4
            L+  KNK+DYCR+HG
Sbjct  163  LKSIKNKIDYCRLHG  177



>ref|XP_010235491.1| PREDICTED: putative glycosyltransferase 3 [Brachypodium distachyon]
 ref|XP_010235492.1| PREDICTED: putative glycosyltransferase 3 [Brachypodium distachyon]
 ref|XP_010235493.1| PREDICTED: putative glycosyltransferase 3 [Brachypodium distachyon]
Length=477

 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 49/64 (77%), Gaps = 3/64 (5%)
 Frame = -2

Query  186  IKNWDEKRKEWLEQHPSF---IPGADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYC  16
            I  WD++R++WL ++P F   +PG  +RIL+VTGSQ  PC NP+GDH LL+  KNK+DYC
Sbjct  147  ISGWDQQRRQWLAKNPGFPTTVPGGKSRILLVTGSQPGPCDNPLGDHYLLKTTKNKIDYC  206

Query  15   RIHG  4
            R+HG
Sbjct  207  RLHG  210



>ref|XP_004229187.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Solanum lycopersicum]
Length=464

 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 54/85 (64%), Gaps = 3/85 (4%)
 Frame = -2

Query  249  HDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSF---IPGADNRILMVTGSQATP  79
             D  E  F  DP   Y +   I +WDE+R EWL+++P+F   +     R+L+VTGS   P
Sbjct  108  EDDGEPEFKRDPNQPYALGPKIIDWDEQRGEWLKKNPNFPNFVGTNKPRVLLVTGSSPKP  167

Query  78   CRNPIGDHLLLRLFKNKVDYCRIHG  4
            C NP+GDH LL+  KNK+DYCR+HG
Sbjct  168  CENPVGDHYLLKSIKNKIDYCRLHG  192



>ref|XP_004301136.1| PREDICTED: putative glycosyltransferase 5-like [Fragaria vesca 
subsp. vesca]
Length=456

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 73/141 (52%), Gaps = 10/141 (7%)
 Frame = -2

Query  396  LGVLALWAFMSFL----TPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDRLHDPPE--  235
            + +  L  F++ L    T G G+   +   +   N +EE        +     +DP E  
Sbjct  46   IKITILCGFVTILVLRGTIGVGNLGTSDADAVNQNLIEETNRILAEIRSDADPNDPDEFL  105

Query  234  --KNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSF--IPGADNRILMVTGSQATPCRNP  67
                   +P ++YT+   I NWD +R +WL+ +P F  +     R+L+VTGS   PC NP
Sbjct  106  NGTQITSNPNVTYTLGPKIGNWDSERAQWLQSNPEFPNLVNGKPRVLLVTGSPPKPCDNP  165

Query  66   IGDHLLLRLFKNKVDYCRIHG  4
            IGDH LL+  KNK+DYCR+HG
Sbjct  166  IGDHYLLKAIKNKIDYCRLHG  186



>ref|XP_010459505.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010459506.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010459508.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010459509.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
Length=472

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 53/82 (65%), Gaps = 4/82 (5%)
 Frame = -2

Query  240  PEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADN---RILMVTGSQATPCRN  70
            P+   +  P  +YT+   + NWD +RK WL Q+P F P   N   RIL++TGS  +PC  
Sbjct  124  PKAEIFTTPNATYTLGPKVTNWDSQRKAWLNQNPEF-PSTVNGRARILLLTGSSPSPCDK  182

Query  69   PIGDHLLLRLFKNKVDYCRIHG  4
            PIGD+ LL+  KNK+DYCR+HG
Sbjct  183  PIGDYYLLKSVKNKIDYCRLHG  204



>ref|XP_007224307.1| hypothetical protein PRUPE_ppa019851mg [Prunus persica]
 gb|EMJ25506.1| hypothetical protein PRUPE_ppa019851mg [Prunus persica]
Length=442

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 52/75 (69%), Gaps = 3/75 (4%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPSF---IPGADNRILMVTGSQATPCRNPIGDHLL  49
            DP   Y++   I +WDE+R +WL+++PSF   +     R+L+VTGS   PC NP+GDH L
Sbjct  112  DPNTPYSLGPKISDWDEQRSDWLKKNPSFPNFLGPNKPRVLLVTGSSPKPCENPVGDHYL  171

Query  48   LRLFKNKVDYCRIHG  4
            L+  KNK+DYCRIHG
Sbjct  172  LKSIKNKIDYCRIHG  186



>gb|AEN82384.1| AT4G02500-like protein, partial [Capsella rubella]
 gb|AEN82385.1| AT4G02500-like protein, partial [Capsella rubella]
 gb|AEN82386.1| AT4G02500-like protein, partial [Capsella rubella]
 gb|AEN82387.1| AT4G02500-like protein, partial [Capsella rubella]
 gb|AEN82388.1| AT4G02500-like protein, partial [Capsella rubella]
 gb|AEN82389.1| AT4G02500-like protein, partial [Capsella rubella]
 gb|AEN82390.1| AT4G02500-like protein, partial [Capsella rubella]
 gb|AEN82391.1| AT4G02500-like protein, partial [Capsella rubella]
Length=167

 Score = 82.8 bits (203),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 49/70 (70%), Gaps = 3/70 (4%)
 Frame = -2

Query  204  YTIDKPIKNWDEKRKEWLEQHPSF---IPGADNRILMVTGSQATPCRNPIGDHLLLRLFK  34
            YT+   I +WDE+R +WL ++PSF   I     R+L+VTGS   PC NP+GDH LL+  K
Sbjct  2    YTLGPKISDWDEQRSDWLAKNPSFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYLLKSIK  61

Query  33   NKVDYCRIHG  4
            NK+DYCR+HG
Sbjct  62   NKIDYCRLHG  71



>ref|XP_006489090.1| PREDICTED: putative glycosyltransferase 2-like [Citrus sinensis]
Length=454

 Score = 86.7 bits (213),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 52/75 (69%), Gaps = 3/75 (4%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPS---FIPGADNRILMVTGSQATPCRNPIGDHLL  49
            DP   Y++   I +WDE+R EWL+++P+   F+     R+L+VTGS   PC NP+GDH L
Sbjct  107  DPNKQYSLGPKISDWDEQRSEWLKKNPTLPNFLRPNKPRVLLVTGSSPKPCENPVGDHYL  166

Query  48   LRLFKNKVDYCRIHG  4
            L+  KNK+DYCRIHG
Sbjct  167  LKSIKNKIDYCRIHG  181



>ref|XP_008790864.1| PREDICTED: putative glycosyltransferase 2 [Phoenix dactylifera]
Length=449

 Score = 86.7 bits (213),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 53/84 (63%), Gaps = 8/84 (10%)
 Frame = -2

Query  246  DPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHP---SFIPGADNRILMVTGSQATPC  76
            DPP      DP + Y++   I +WDE+R  WL +HP   +F      R+L+VTGS   PC
Sbjct  94   DPPR-----DPNIPYSLGPKISDWDEQRAAWLRRHPESPNFWGPNKPRVLLVTGSSPKPC  148

Query  75   RNPIGDHLLLRLFKNKVDYCRIHG  4
             NP+GDH LL+  KNK+DYCR+HG
Sbjct  149  ENPVGDHYLLKSIKNKIDYCRVHG  172



>gb|ADG38703.1| AT4G02500-like protein [Capsella grandiflora]
 gb|ADG38704.1| AT4G02500-like protein [Capsella grandiflora]
 gb|ADG38705.1| AT4G02500-like protein [Capsella grandiflora]
 gb|ADG38706.1| AT4G02500-like protein [Capsella grandiflora]
 gb|ADG38707.1| AT4G02500-like protein [Capsella grandiflora]
 gb|ADG38708.1| AT4G02500-like protein [Capsella grandiflora]
Length=165

 Score = 82.8 bits (203),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 49/70 (70%), Gaps = 3/70 (4%)
 Frame = -2

Query  204  YTIDKPIKNWDEKRKEWLEQHPSF---IPGADNRILMVTGSQATPCRNPIGDHLLLRLFK  34
            YT+   I +WDE+R +WL ++PSF   I     R+L+VTGS   PC NP+GDH LL+  K
Sbjct  1    YTLGPKISDWDEQRSDWLAKNPSFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYLLKSIK  60

Query  33   NKVDYCRIHG  4
            NK+DYCR+HG
Sbjct  61   NKIDYCRLHG  70



>ref|XP_006649941.1| PREDICTED: putative glycosyltransferase 2-like [Oryza brachyantha]
Length=448

 Score = 86.7 bits (213),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 53/84 (63%), Gaps = 6/84 (7%)
 Frame = -2

Query  246  DPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPS---FIPGADNRILMVTGSQATPC  76
            DPP ++  D P   YT+   I +WDE+R  W  +HP    F+     R+L+VTGS   PC
Sbjct  96   DPPPRSLRDPP---YTLGPKISDWDEQRAAWHRRHPETPPFLNDVKPRVLLVTGSSPKPC  152

Query  75   RNPIGDHLLLRLFKNKVDYCRIHG  4
             NP+GDH LL+  KNK+DYCR+HG
Sbjct  153  ENPVGDHYLLKSIKNKMDYCRVHG  176



>gb|EYU43946.1| hypothetical protein MIMGU_mgv1a027073mg [Erythranthe guttata]
Length=462

 Score = 86.7 bits (213),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 64/118 (54%), Gaps = 15/118 (13%)
 Frame = -2

Query  351  GSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWD  172
            G G+D + G     F+  +  ++  DG + F R           DP   Y +   I +WD
Sbjct  83   GGGTD-NGGNSYAEFDITKVLKDEEDGVEEFKR-----------DPSQPYALGPKISDWD  130

Query  171  EKRKEWLEQ---HPSFIPGADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIH  7
            ++R EWL     +P+FI     R+L+VTGS   PC NP+GDH LL+  KNK+DYCR+H
Sbjct  131  QQRSEWLTNNPNYPNFITDKKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRLH  188



>gb|EYU45549.1| hypothetical protein MIMGU_mgv1a027105mg [Erythranthe guttata]
Length=460

 Score = 86.7 bits (213),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 52/78 (67%), Gaps = 3/78 (4%)
 Frame = -2

Query  228  FYDDPKLSYTIDKPIKNWDEKRKEWLEQHPS---FIPGADNRILMVTGSQATPCRNPIGD  58
            F  DP   Y++   I NWD +R +WL+++P+   FI     R+L+VTGS   PC NP+GD
Sbjct  113  FQRDPSQPYSLGPKISNWDSQRSQWLKKNPNSPNFIAENKPRVLLVTGSSPKPCENPVGD  172

Query  57   HLLLRLFKNKVDYCRIHG  4
            H LL+  KNK+DYCR+HG
Sbjct  173  HYLLKSIKNKIDYCRLHG  190



>ref|XP_004508717.1| PREDICTED: putative glycosyltransferase 5-like [Cicer arietinum]
Length=446

 Score = 86.7 bits (213),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 50/74 (68%), Gaps = 2/74 (3%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPSF--IPGADNRILMVTGSQATPCRNPIGDHLLL  46
            +P  ++T+   I NWD +RK WL Q+P +    G   RIL++TGS   PC NPIGDH LL
Sbjct  102  NPNATFTLGPKITNWDSQRKSWLNQNPEYPNFIGGKARILLLTGSPPKPCDNPIGDHYLL  161

Query  45   RLFKNKVDYCRIHG  4
            +  KNK+DYCR+HG
Sbjct  162  KSIKNKIDYCRLHG  175



>ref|XP_008360279.1| PREDICTED: putative glycosyltransferase 2 [Malus domestica]
Length=460

 Score = 86.7 bits (213),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 58/87 (67%), Gaps = 4/87 (5%)
 Frame = -2

Query  252  LHDPPE-KNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHP---SFIPGADNRILMVTGSQA  85
            L D PE ++   DP   Y++   I NWDE+R +WL+++P   +F+     R+L+VTGS  
Sbjct  101  LKDEPETEDDKRDPNQPYSLGPKISNWDEQRSDWLKKNPGFPNFVGPNKPRVLLVTGSSP  160

Query  84   TPCRNPIGDHLLLRLFKNKVDYCRIHG  4
             PC NP+GDH LL+  KNK+DYCR+HG
Sbjct  161  KPCENPVGDHYLLKSIKNKIDYCRLHG  187



>emb|CAI11458.1| putative glycosyltransferase [Nicotiana benthamiana]
Length=450

 Score = 86.7 bits (213),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 74/138 (54%), Gaps = 10/138 (7%)
 Frame = -2

Query  396  LGVLALWAFMSFL----TPGSGSDFDAGRKSTAFNGVEEKQECSDGSQGFDRLHDPPEKN  229
            + +  L  F++ L    T G GS   +G  +   N +EE     D  +    L DP +  
Sbjct  45   IKITILCGFVTILVLRGTIGFGSLASSGSDAENANLIEETNRILDEIRSDTDLDDPSDT-  103

Query  228  FYDDPKLSYTIDKPIKNWDEKRKEWLEQHP---SFIPGADNRILMVTGSQATPCRNPIGD  58
             +     +Y++   I  WD  RK WL+++P   +FI G   R+L+VTGS   PC NP GD
Sbjct  104  -FSHLNSTYSLGPKITTWDADRKFWLQKNPDFPNFIHGKP-RVLLVTGSPPNPCDNPTGD  161

Query  57   HLLLRLFKNKVDYCRIHG  4
            H LL++ KNK+DYCRIHG
Sbjct  162  HYLLKVMKNKIDYCRIHG  179



>gb|AFW88652.1| glycosyltransferase 5 [Zea mays]
Length=448

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 53/84 (63%), Gaps = 6/84 (7%)
 Frame = -2

Query  246  DPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPS---FIPGADNRILMVTGSQATPC  76
            DPP ++  D P   YT+   I +WDE+R  W  +HP    F+     R+L+VTGS   PC
Sbjct  97   DPPPRSLRDPP---YTLGPKISDWDEQRAAWHRRHPETPPFLNDIKPRVLLVTGSSPKPC  153

Query  75   RNPIGDHLLLRLFKNKVDYCRIHG  4
             NP+GDH LL+  KNK+DYCR+HG
Sbjct  154  ENPVGDHYLLKSIKNKMDYCRVHG  177



>ref|NP_001150077.1| glycosyltransferase 5 [Zea mays]
 gb|ACG37718.1| glycosyltransferase 5 [Zea mays]
Length=450

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 53/84 (63%), Gaps = 6/84 (7%)
 Frame = -2

Query  246  DPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPS---FIPGADNRILMVTGSQATPC  76
            DPP ++  D P   YT+   I +WDE+R  W  +HP    F+     R+L+VTGS   PC
Sbjct  99   DPPPRSLRDPP---YTLGPKISDWDEQRAAWHRRHPETPPFLNDIKPRVLLVTGSSPKPC  155

Query  75   RNPIGDHLLLRLFKNKVDYCRIHG  4
             NP+GDH LL+  KNK+DYCR+HG
Sbjct  156  ENPVGDHYLLKSIKNKMDYCRVHG  179



>ref|XP_006390433.1| hypothetical protein EUTSA_v10018522mg [Eutrema salsugineum]
 gb|ESQ27719.1| hypothetical protein EUTSA_v10018522mg [Eutrema salsugineum]
Length=456

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 55/142 (39%), Positives = 75/142 (53%), Gaps = 15/142 (11%)
 Frame = -2

Query  396  LGVLALWAFMSFL----TPGSGSDFDAGRKSTAFNGVEEKQ----ECSDGSQGFDRLHDP  241
            + +  L  F++ L    T G G+   +   +   N +EE      E    S   D L +P
Sbjct  49   IKITILCGFVTILVLRGTIGVGNLGSSSADAVNQNIIEETNRILAEIRSDSDPTD-LDEP  107

Query  240  PEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADN---RILMVTGSQATPCRN  70
             E +   +P  +Y +   I NWD +RK WL Q+P F P   N   RIL++TGS   PC N
Sbjct  108  QETDM--NPNATYALGPKITNWDSQRKVWLNQNPEF-PSTVNGRARILLLTGSPPKPCDN  164

Query  69   PIGDHLLLRLFKNKVDYCRIHG  4
            PIGDH LL+  KNK+DYCR+HG
Sbjct  165  PIGDHYLLKSVKNKIDYCRLHG  186



>ref|XP_009352257.1| PREDICTED: putative glycosyltransferase 2 [Pyrus x bretschneideri]
Length=463

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 58/87 (67%), Gaps = 4/87 (5%)
 Frame = -2

Query  252  LHDPPE-KNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPSF---IPGADNRILMVTGSQA  85
            L D PE ++   DP   Y++   I +WDE+R +WL+++PSF   +     R+L+VTGS  
Sbjct  101  LKDEPETEDEKRDPNQPYSLGPKISDWDEQRSDWLKKNPSFPNFVGPNKPRVLLVTGSSP  160

Query  84   TPCRNPIGDHLLLRLFKNKVDYCRIHG  4
             PC NP+GDH LL+  KNK+DYCR+HG
Sbjct  161  KPCENPVGDHYLLKSIKNKIDYCRLHG  187



>emb|CDX90935.1| BnaA03g26150D [Brassica napus]
Length=449

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 51/75 (68%), Gaps = 3/75 (4%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPSF---IPGADNRILMVTGSQATPCRNPIGDHLL  49
            DP   YT+   I +WDE+R +WL ++PSF   I     R+L+VTGS   PC NP+GDH L
Sbjct  100  DPNKPYTLGPKISDWDEQRSDWLSKNPSFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYL  159

Query  48   LRLFKNKVDYCRIHG  4
            L+  KNK+DYCR+HG
Sbjct  160  LKSIKNKIDYCRLHG  174



>ref|XP_006399253.1| hypothetical protein EUTSA_v10013509mg [Eutrema salsugineum]
 gb|ESQ40706.1| hypothetical protein EUTSA_v10013509mg [Eutrema salsugineum]
Length=454

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 59/85 (69%), Gaps = 6/85 (7%)
 Frame = -2

Query  249  HDPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHP---SFIPGADNRILMVTGSQATP  79
            ++PP+ +   +  ++YT+   I NWD++R+ WL Q+P   SF+ G   R+L++TGS   P
Sbjct  102  NEPPDSDL--ELNMTYTLGPKITNWDQQREMWLTQNPDFPSFVNGK-ARVLLLTGSPPKP  158

Query  78   CRNPIGDHLLLRLFKNKVDYCRIHG  4
            C NPIGDH LL+  KNK+DYCRIHG
Sbjct  159  CDNPIGDHYLLKSVKNKIDYCRIHG  183



>ref|XP_008795804.1| PREDICTED: putative glycosyltransferase 2 [Phoenix dactylifera]
Length=452

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 53/84 (63%), Gaps = 8/84 (10%)
 Frame = -2

Query  246  DPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHP---SFIPGADNRILMVTGSQATPC  76
            DPP      DP + Y++   I +WDE+R  WL +HP   +F      R+L+VTGS   PC
Sbjct  97   DPPR-----DPNVPYSLGPKISDWDEQRAAWLRRHPESPNFWGPNKPRVLLVTGSSPKPC  151

Query  75   RNPIGDHLLLRLFKNKVDYCRIHG  4
             NP+GDH LL+  KNK+DYCR+HG
Sbjct  152  ENPVGDHYLLKSIKNKIDYCRVHG  175



>ref|XP_006396461.1| hypothetical protein EUTSA_v10028641mg [Eutrema salsugineum]
 gb|ESQ37914.1| hypothetical protein EUTSA_v10028641mg [Eutrema salsugineum]
Length=464

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 51/75 (68%), Gaps = 3/75 (4%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPSF---IPGADNRILMVTGSQATPCRNPIGDHLL  49
            DP   YT+   I +WDE+R +WL ++PSF   I     R+L+VTGS   PC NP+GDH L
Sbjct  116  DPNKPYTLGPKISDWDEQRSDWLAKNPSFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYL  175

Query  48   LRLFKNKVDYCRIHG  4
            L+  KNK+DYCR+HG
Sbjct  176  LKSIKNKIDYCRLHG  190



>ref|XP_004154960.1| PREDICTED: putative glycosyltransferase 5-like [Cucumis sativus]
Length=460

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 53/75 (71%), Gaps = 4/75 (5%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADN---RILMVTGSQATPCRNPIGDHLL  49
            +P ++Y +   I NW+++RK WL+Q+P F P   N   RIL+VTGS   PC NPIGDH L
Sbjct  114  NPNVTYKLGPKIVNWNQERKVWLDQNPEF-PNYVNKRARILLVTGSPPKPCDNPIGDHYL  172

Query  48   LRLFKNKVDYCRIHG  4
            L+  KNK+DYCR+HG
Sbjct  173  LKAIKNKIDYCRLHG  187



>ref|NP_191831.1| xyloglucan 6-xylosyltransferase [Arabidopsis thaliana]
 ref|NP_001030917.1| xyloglucan 6-xylosyltransferase [Arabidopsis thaliana]
 sp|Q9LZJ3.1|XXT1_ARATH RecName: Full=Xyloglucan 6-xylosyltransferase 1; Short=AtXT1 
[Arabidopsis thaliana]
 gb|AAL11581.1|AF424587_1 AT3g62720/F26K9_150 [Arabidopsis thaliana]
 emb|CAB83122.1| alpha galactosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAN73295.1| At3g62720/F26K9_150 [Arabidopsis thaliana]
 dbj|BAH20193.1| AT3G62720 [Arabidopsis thaliana]
 gb|AEE80383.1| xyloglucan 6-xylosyltransferase [Arabidopsis thaliana]
 gb|AEE80384.1| xyloglucan 6-xylosyltransferase [Arabidopsis thaliana]
 gb|AHL38717.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=460

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 51/70 (73%), Gaps = 3/70 (4%)
 Frame = -2

Query  204  YTIDKPIKNWDEKRKEWLEQHPSF---IPGADNRILMVTGSQATPCRNPIGDHLLLRLFK  34
            Y++   I +WDE+R++WL+Q+PSF   +     R+L+VTGS   PC NP+GDH LL+  K
Sbjct  117  YSLGPKISDWDEQRRDWLKQNPSFPNFVAPNKPRVLLVTGSAPKPCENPVGDHYLLKSIK  176

Query  33   NKVDYCRIHG  4
            NK+DYCRIHG
Sbjct  177  NKIDYCRIHG  186



>ref|XP_009116931.1| PREDICTED: xyloglucan 6-xylosyltransferase [Brassica rapa]
Length=456

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 51/70 (73%), Gaps = 3/70 (4%)
 Frame = -2

Query  204  YTIDKPIKNWDEKRKEWLEQHPSF---IPGADNRILMVTGSQATPCRNPIGDHLLLRLFK  34
            Y++   I +WDE+R++WL+Q+PSF   +     R+L+VTGS   PC NP+GDH LL+  K
Sbjct  116  YSLGPKISDWDEQRRDWLKQNPSFPNFVAPNKPRVLLVTGSAPKPCENPVGDHYLLKSIK  175

Query  33   NKVDYCRIHG  4
            NK+DYCRIHG
Sbjct  176  NKIDYCRIHG  185



>ref|XP_004984900.1| PREDICTED: putative glycosyltransferase 2-like [Setaria italica]
Length=451

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 52/84 (62%), Gaps = 6/84 (7%)
 Frame = -2

Query  246  DPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPS---FIPGADNRILMVTGSQATPC  76
            DPP +   D P   YT+   I +WDE+R  W  +HP    F+     R+L+V+GS   PC
Sbjct  100  DPPPRTLRDPP---YTLGPKISDWDEQRANWHRRHPETPPFLNDVKPRVLLVSGSSPKPC  156

Query  75   RNPIGDHLLLRLFKNKVDYCRIHG  4
             NP+GDH LL+  KNK+DYCR+HG
Sbjct  157  ENPVGDHYLLKSIKNKIDYCRVHG  180



>emb|CAJ57380.1| alpha-1,6-xylosyltransferase [Physcomitrella patens]
Length=454

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 73/140 (52%), Gaps = 10/140 (7%)
 Frame = -2

Query  396  LGVLALWAFMSFLTPGS--GSDFDAGRKSTAFNGVEEK----QECSDGSQGFDRLHDPPE  235
            L V  L  F++ L      G+ F + RK T  +  + K    ++ S   +        PE
Sbjct  39   LRVTILCGFVTVLVLRGTIGTSFGSQRKGTVEHSAQPKIFSDEKSSREPRRVLSATTEPE  98

Query  234  KNF--YDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGAD--NRILMVTGSQATPCRNP  67
             +     D  L Y +   I NWDE+R  WL++HP     +   +RIL+VTGSQ  PC NP
Sbjct  99   TDIEPVLDSSLPYKLGPHISNWDEQRAMWLQKHPRMAKTSRGRDRILLVTGSQPKPCDNP  158

Query  66   IGDHLLLRLFKNKVDYCRIH  7
             GDHLLL+  KNK+DYCR+H
Sbjct  159  AGDHLLLKSLKNKMDYCRLH  178



>ref|XP_007201035.1| hypothetical protein PRUPE_ppa005690mg [Prunus persica]
 gb|EMJ02234.1| hypothetical protein PRUPE_ppa005690mg [Prunus persica]
Length=448

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 52/75 (69%), Gaps = 3/75 (4%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPSF---IPGADNRILMVTGSQATPCRNPIGDHLL  49
            +P   YT+   I NWDE+R +WL+++P+F   I     R+L+VTGS   PC NP+GDH L
Sbjct  102  EPNKPYTLGPKISNWDEQRSKWLKENPNFPNFIGPNKPRVLLVTGSSPKPCENPVGDHYL  161

Query  48   LRLFKNKVDYCRIHG  4
            L+  KNK+DYCR+HG
Sbjct  162  LKSIKNKIDYCRLHG  176



>ref|XP_001776727.1| predicted protein [Physcomitrella patens]
 gb|EDQ58421.1| predicted protein [Physcomitrella patens]
Length=454

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 73/140 (52%), Gaps = 10/140 (7%)
 Frame = -2

Query  396  LGVLALWAFMSFLTPGS--GSDFDAGRKSTAFNGVEEK----QECSDGSQGFDRLHDPPE  235
            L V  L  F++ L      G+ F + RK T  +  + K    ++ S   +        PE
Sbjct  39   LRVTILCGFVTVLVLRGTIGTSFGSQRKGTVEHSAQPKIFSDEKSSREPRRVLSATTEPE  98

Query  234  KNF--YDDPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGAD--NRILMVTGSQATPCRNP  67
             +     D  L Y +   I NWDE+R  WL++HP     +   +RIL+VTGSQ  PC NP
Sbjct  99   TDIEPVLDSSLPYKLGPHISNWDEQRAMWLQKHPRMAKTSRGRDRILLVTGSQPKPCDNP  158

Query  66   IGDHLLLRLFKNKVDYCRIH  7
             GDHLLL+  KNK+DYCR+H
Sbjct  159  AGDHLLLKSLKNKMDYCRLH  178



>ref|XP_002874911.1| hypothetical protein ARALYDRAFT_490316 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51170.1| hypothetical protein ARALYDRAFT_490316 [Arabidopsis lyrata subsp. 
lyrata]
Length=463

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 51/75 (68%), Gaps = 3/75 (4%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPSF---IPGADNRILMVTGSQATPCRNPIGDHLL  49
            DP   YT+   I +WDE+R +WL ++PSF   I     R+L+VTGS   PC NP+GDH L
Sbjct  115  DPNKPYTLGPKISDWDEQRSDWLAKNPSFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYL  174

Query  48   LRLFKNKVDYCRIHG  4
            L+  KNK+DYCR+HG
Sbjct  175  LKSIKNKIDYCRLHG  189



>ref|XP_010683109.1| PREDICTED: putative glycosyltransferase 5 [Beta vulgaris subsp. 
vulgaris]
Length=446

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 71/118 (60%), Gaps = 12/118 (10%)
 Frame = -2

Query  345  GSDFDAGRKSTAFNGVEEKQEC-SDGSQGFDRLHDPPEKNFYDDPKLSYTIDKPIKNWDE  169
            G+  DA R +     +    E  SDG++  D   D P  N    P +++T    I NWD+
Sbjct  71   GTSSDAERSNLEAEAMRVIAEIRSDGAEIDD---DEPPFN----PNITFTFGPKITNWDD  123

Query  168  KRKEWL---EQHPSFIPGADNRILMVTGSQATPCRNPIGDHLLLRLFKNKVDYCRIHG  4
            +RKEWL   +++P+++ G   R+L+V+GS   PC NPIGDH LL+  KNK+DYCR+HG
Sbjct  124  QRKEWLGLNKEYPNYVNGKP-RMLLVSGSPPNPCDNPIGDHYLLKSIKNKIDYCRLHG  180



>ref|XP_009149356.1| PREDICTED: putative glycosyltransferase 4 [Brassica rapa]
Length=503

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 50/74 (68%), Gaps = 2/74 (3%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPSF--IPGADNRILMVTGSQATPCRNPIGDHLLL  46
            +P ++YT+   I NWD +RK WL Q+P F  I     RIL++TGS   PC  PIGD+ LL
Sbjct  162  NPNVTYTLGPRITNWDSQRKVWLSQNPGFPSIVNGKARILLLTGSSPGPCDKPIGDYYLL  221

Query  45   RLFKNKVDYCRIHG  4
            +  KNK+DYCRIHG
Sbjct  222  KTVKNKIDYCRIHG  235



>gb|ADG38709.1| AT4G02500-like protein [Neslia paniculata]
Length=165

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 49/70 (70%), Gaps = 3/70 (4%)
 Frame = -2

Query  204  YTIDKPIKNWDEKRKEWLEQHPSF---IPGADNRILMVTGSQATPCRNPIGDHLLLRLFK  34
            YT+   I +WDE+R +WL ++PSF   I     R+L+VTGS   PC NP+GDH LL+  K
Sbjct  1    YTLGPKILDWDEQRSDWLAKNPSFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYLLKSIK  60

Query  33   NKVDYCRIHG  4
            NK+DYCR+HG
Sbjct  61   NKIDYCRLHG  70



>ref|NP_567241.1| UDP-xylosyltransferase 2 [Arabidopsis thaliana]
 sp|O22775.1|XXT2_ARATH RecName: Full=Xyloglucan 6-xylosyltransferase 2; Short=AtXT2; 
AltName: Full=Putative glycosyltransferase 2; Short=AtGT2 [Arabidopsis 
thaliana]
 gb|AAC19271.1| T14P8.23 [Arabidopsis thaliana]
 emb|CAC01674.1| putative golgi glycosyltransferase [Arabidopsis thaliana]
 gb|AAL14393.1| AT4g02500/T10P11_20 [Arabidopsis thaliana]
 gb|AAM98170.1| putative glycosyltransferase [Arabidopsis thaliana]
 gb|AAP31945.1| At4g02500 [Arabidopsis thaliana]
 gb|AEE82181.1| UDP-xylosyltransferase 2 [Arabidopsis thaliana]
 gb|AHL38708.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=461

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 51/75 (68%), Gaps = 3/75 (4%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPSF---IPGADNRILMVTGSQATPCRNPIGDHLL  49
            DP   YT+   I +WDE+R +WL ++PSF   I     R+L+VTGS   PC NP+GDH L
Sbjct  113  DPNKPYTLGPKISDWDEQRSDWLAKNPSFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYL  172

Query  48   LRLFKNKVDYCRIHG  4
            L+  KNK+DYCR+HG
Sbjct  173  LKSIKNKIDYCRLHG  187



>ref|XP_010429788.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Camelina sativa]
Length=464

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 51/75 (68%), Gaps = 3/75 (4%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPSF---IPGADNRILMVTGSQATPCRNPIGDHLL  49
            DP   YT+   I +WDE+R +WL ++PSF   I     R+L+VTGS   PC NP+GDH L
Sbjct  116  DPNKPYTLGPKISDWDEQRSDWLAKNPSFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYL  175

Query  48   LRLFKNKVDYCRIHG  4
            L+  KNK+DYCR+HG
Sbjct  176  LKSIKNKIDYCRLHG  190



>ref|XP_006287708.1| hypothetical protein CARUB_v10000915mg [Capsella rubella]
 ref|XP_006287709.1| hypothetical protein CARUB_v10000915mg [Capsella rubella]
 gb|EOA20606.1| hypothetical protein CARUB_v10000915mg [Capsella rubella]
 gb|EOA20607.1| hypothetical protein CARUB_v10000915mg [Capsella rubella]
Length=460

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 51/75 (68%), Gaps = 3/75 (4%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPSF---IPGADNRILMVTGSQATPCRNPIGDHLL  49
            DP   YT+   I +WDE+R +WL ++PSF   I     R+L+VTGS   PC NP+GDH L
Sbjct  112  DPNKPYTLGPKISDWDEQRSDWLAKNPSFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYL  171

Query  48   LRLFKNKVDYCRIHG  4
            L+  KNK+DYCR+HG
Sbjct  172  LKSIKNKIDYCRLHG  186



>ref|XP_010456020.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Camelina sativa]
 ref|XP_010456021.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Camelina sativa]
Length=463

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 51/75 (68%), Gaps = 3/75 (4%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPSF---IPGADNRILMVTGSQATPCRNPIGDHLL  49
            DP   YT+   I +WDE+R +WL ++PSF   I     R+L+VTGS   PC NP+GDH L
Sbjct  115  DPNKPYTLGPKISDWDEQRSDWLAKNPSFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYL  174

Query  48   LRLFKNKVDYCRIHG  4
            L+  KNK+DYCR+HG
Sbjct  175  LKSIKNKIDYCRLHG  189



>ref|XP_010422579.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Camelina sativa]
Length=463

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 51/75 (68%), Gaps = 3/75 (4%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPSF---IPGADNRILMVTGSQATPCRNPIGDHLL  49
            DP   YT+   I +WDE+R +WL ++PSF   I     R+L+VTGS   PC NP+GDH L
Sbjct  115  DPNKPYTLGPKISDWDEQRSDWLAKNPSFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYL  174

Query  48   LRLFKNKVDYCRIHG  4
            L+  KNK+DYCR+HG
Sbjct  175  LKSIKNKIDYCRLHG  189



>emb|CDY70090.1| BnaCnng66640D, partial [Brassica napus]
Length=354

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 51/75 (68%), Gaps = 3/75 (4%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPSF---IPGADNRILMVTGSQATPCRNPIGDHLL  49
            DP   YT+   I +WDE+R +WL ++P+F   I     R+L+VTGS   PC NP+GDH L
Sbjct  113  DPNKPYTLGPKISDWDEQRSDWLAKNPTFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYL  172

Query  48   LRLFKNKVDYCRIHG  4
            L+  KNK+DYCR+HG
Sbjct  173  LKSIKNKIDYCRLHG  187



>gb|AAC78266.1| putative glycosyltransferase [Arabidopsis thaliana]
 emb|CAB80743.1| putative glycosyltransferase [Arabidopsis thaliana]
Length=459

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 51/75 (68%), Gaps = 3/75 (4%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPSF---IPGADNRILMVTGSQATPCRNPIGDHLL  49
            DP   YT+   I +WDE+R +WL ++PSF   I     R+L+VTGS   PC NP+GDH L
Sbjct  113  DPNKPYTLGPKISDWDEQRSDWLAKNPSFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYL  172

Query  48   LRLFKNKVDYCRIHG  4
            L+  KNK+DYCR+HG
Sbjct  173  LKSIKNKIDYCRLHG  187



>ref|XP_003549688.1| PREDICTED: putative glycosyltransferase 5-like [Glycine max]
Length=447

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 51/74 (69%), Gaps = 2/74 (3%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPSF--IPGADNRILMVTGSQATPCRNPIGDHLLL  46
            +P  ++T+   I NWD +RK WL Q+P +  + G   RIL++TGS   PC NPIGDH LL
Sbjct  103  NPNDTFTLGPKIDNWDTERKNWLHQNPEYPNVIGGKPRILLLTGSPPKPCDNPIGDHYLL  162

Query  45   RLFKNKVDYCRIHG  4
            +  KNK+DYCR+HG
Sbjct  163  KSIKNKIDYCRLHG  176



>emb|CAN77730.1| hypothetical protein VITISV_027412 [Vitis vinifera]
Length=450

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 51/75 (68%), Gaps = 3/75 (4%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPSF---IPGADNRILMVTGSQATPCRNPIGDHLL  49
            DP   Y++   I +WDE+R EWL ++P+F   I     R+L+VTGS   PC NP+GDH L
Sbjct  104  DPNKPYSLGPKISDWDEQRAEWLRKNPNFPNFIGPNKPRVLLVTGSSPKPCENPVGDHYL  163

Query  48   LRLFKNKVDYCRIHG  4
            L+  KNK+DYCR+HG
Sbjct  164  LKAIKNKIDYCRLHG  178



>ref|XP_002465400.1| hypothetical protein SORBIDRAFT_01g038000 [Sorghum bicolor]
 gb|EER92398.1| hypothetical protein SORBIDRAFT_01g038000 [Sorghum bicolor]
Length=446

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 52/84 (62%), Gaps = 6/84 (7%)
 Frame = -2

Query  246  DPPEKNFYDDPKLSYTIDKPIKNWDEKRKEWLEQHPS---FIPGADNRILMVTGSQATPC  76
            DPP +   D P   YT+   I +WDE+R  W  +HP    F+     R+L+VTGS   PC
Sbjct  95   DPPPRTLRDPP---YTLGPKISDWDEQRAAWHRRHPETPPFLNDIKPRVLLVTGSSPKPC  151

Query  75   RNPIGDHLLLRLFKNKVDYCRIHG  4
             NP+GDH LL+  KNK+DYCR+HG
Sbjct  152  ENPVGDHYLLKSIKNKMDYCRVHG  175



>emb|CDP21247.1| unnamed protein product [Coffea canephora]
Length=436

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 69/126 (55%), Gaps = 16/126 (13%)
 Frame = -2

Query  348  SGSDFDAGRK-STAFNGVEEKQECS-------DGSQGFDRLHDPPEKNFYDDPKLSYTID  193
            S S    GR+ S  FN ++    C         G+ GF  L    +    D+   +Y++ 
Sbjct  36   SSSVVPRGRQISKTFNNIKITILCGFVTILVLRGTIGFGNLAVVVD----DNSNGTYSLG  91

Query  192  KPIKNWDEKRKEWLEQHPSFIPGADN---RILMVTGSQATPCRNPIGDHLLLRLFKNKVD  22
              IKNWDE+RK WL ++P F P   N   RIL+VTGS   PC N IGDH LL+  KNK+D
Sbjct  92   PKIKNWDEQRKVWLSKNPEF-PNFVNGKPRILLVTGSPPNPCDNAIGDHYLLKAVKNKID  150

Query  21   YCRIHG  4
            YCRIHG
Sbjct  151  YCRIHG  156



>ref|XP_002967572.1| glycosyltransferase, CAZy family GT34-like protein [Selaginella 
moellendorffii]
 ref|XP_002981772.1| xyloglucan alpha-1,6-glycosyltransferase [Selaginella moellendorffii]
 gb|EFJ17254.1| xyloglucan alpha-1,6-glycosyltransferase [Selaginella moellendorffii]
 gb|EFJ30919.1| glycosyltransferase, CAZy family GT34-like protein [Selaginella 
moellendorffii]
Length=439

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 52/75 (69%), Gaps = 4/75 (5%)
 Frame = -2

Query  219  DPKLSYTIDKPIKNWDEKRKEWLEQHPSFIPGADN---RILMVTGSQATPCRNPIGDHLL  49
            D  + Y++   I +WDE+R EWL ++P  +P   N   RIL+VTGSQ  PC NP+GDH L
Sbjct  101  DSGMPYSLGPKISDWDEQRGEWLRKNPH-MPAVVNGKPRILLVTGSQPKPCDNPVGDHYL  159

Query  48   LRLFKNKVDYCRIHG  4
            L+  KNKVDYCR+HG
Sbjct  160  LKAIKNKVDYCRLHG  174



>emb|CDY70418.1| BnaA04g27220D [Brassica napus]
Length=460

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 50/70 (71%), Gaps = 3/70 (4%)
 Frame = -2

Query  204  YTIDKPIKNWDEKRKEWLEQHPSF---IPGADNRILMVTGSQATPCRNPIGDHLLLRLFK  34
            Y++   I +WDE+R +WL+Q+PSF   +     R+L+VTGS   PC NP+GDH LL+  K
Sbjct  121  YSLGPKISDWDEQRIDWLKQNPSFPNFVAANKPRVLLVTGSAPKPCENPVGDHYLLKSIK  180

Query  33   NKVDYCRIHG  4
            NK+DYCRIHG
Sbjct  181  NKIDYCRIHG  190



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1639611019956