BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13158_g2_i1 len=1036 path=[1014:0-967 1982:968-1035]

Length=1036
                                                                      Score     E

dbj|BAO57283.1|  Myb family transcription factor                        227   6e-66   
ref|XP_009613640.1|  PREDICTED: protein REVEILLE 1-like isoform X1      220   3e-63   
ref|XP_009613641.1|  PREDICTED: protein REVEILLE 1-like isoform X2      219   4e-63   
ref|XP_009609237.1|  PREDICTED: protein REVEILLE 1-like isoform X1      219   6e-63   
gb|ADV29577.1|  At5g37260-like protein                                  216   3e-62   
ref|XP_009790908.1|  PREDICTED: protein REVEILLE 1-like isoform X2      217   3e-62   
ref|XP_009790907.1|  PREDICTED: protein REVEILLE 1-like isoform X1      217   3e-62   
gb|ABW22145.1|  putative At5g37260-like protein                         216   4e-62   Solanum peruvianum [Peruvian tomato]
gb|ADV29615.1|  At5g37260-like protein                                  216   4e-62   
gb|AAX44355.1|  putative At5g37260                                      215   8e-62   Solanum habrochaites
gb|ADV29575.1|  At5g37260-like protein                                  215   1e-61   
gb|ADV29557.1|  At5g37260-like protein                                  214   1e-61   
gb|ADV29614.1|  At5g37260-like protein                                  214   1e-61   
gb|ADV29591.1|  At5g37260-like protein                                  214   2e-61   
gb|ADV29570.1|  At5g37260-like protein                                  214   2e-61   
gb|ABW22153.1|  putative At5g37260-like protein                         214   3e-61   Solanum peruvianum [Peruvian tomato]
gb|ABW22152.1|  putative At5g37260-like protein                         214   3e-61   Solanum peruvianum [Peruvian tomato]
gb|AAX44353.1|  putative At5g37260                                      214   3e-61   Solanum habrochaites
gb|ABW22138.1|  putative At5g37260-like protein                         214   3e-61   Solanum peruvianum [Peruvian tomato]
gb|ABW22151.1|  putative At5g37260-like protein                         213   4e-61   Solanum peruvianum [Peruvian tomato]
gb|ABW22140.1|  putative At5g37260-like protein                         213   5e-61   Solanum peruvianum [Peruvian tomato]
gb|ADV29564.1|  At5g37260-like protein                                  213   5e-61   
gb|ADV29607.1|  At5g37260-like protein                                  213   6e-61   
gb|ABW22171.1|  putative At5g37260-like protein                         213   7e-61   Solanum chilense
ref|XP_009782662.1|  PREDICTED: protein REVEILLE 1-like isoform X1      213   7e-61   
gb|AAX44338.1|  putative At5g37260                                      213   7e-61   Solanum peruvianum [Peruvian tomato]
gb|ADV29612.1|  At5g37260-like protein                                  213   8e-61   
gb|AAX44341.1|  putative At5g37260                                      212   1e-60   Solanum peruvianum [Peruvian tomato]
gb|ABW22137.1|  putative At5g37260-like protein                         212   1e-60   Solanum peruvianum [Peruvian tomato]
gb|ADV29611.1|  At5g37260-like protein                                  211   2e-60   
gb|AAX44337.1|  putative At5g37260                                      211   2e-60   Solanum peruvianum [Peruvian tomato]
gb|ADV29640.1|  At5g37260-like protein                                  211   2e-60   
gb|ABW22124.1|  putative At5g37260-like protein                         211   2e-60   Solanum peruvianum [Peruvian tomato]
ref|XP_006350462.1|  PREDICTED: uncharacterized protein LOC102602066    212   3e-60   
ref|XP_004231624.1|  PREDICTED: protein REVEILLE 1                      211   3e-60   
gb|ABW22157.1|  putative At5g37260-like protein                         211   4e-60   Solanum chilense
gb|ABW22165.1|  putative At5g37260-like protein                         211   4e-60   Solanum chilense
gb|ABW22178.1|  putative At5g37260-like protein                         211   4e-60   Solanum chilense
gb|ADV29610.1|  At5g37260-like protein                                  211   4e-60   
gb|ABW22148.1|  putative At5g37260-like protein                         211   5e-60   Solanum peruvianum [Peruvian tomato]
gb|ABW22156.1|  putative At5g37260-like protein                         210   5e-60   Solanum chilense
gb|ABW22144.1|  putative At5g37260-like protein                         210   5e-60   Solanum peruvianum [Peruvian tomato]
gb|ABW22184.1|  putative At5g37260-like protein                         210   5e-60   Solanum chilense
gb|ABW22179.1|  putative At5g37260-like protein                         210   6e-60   Solanum chilense
gb|ABW22177.1|  putative At5g37260-like protein                         210   8e-60   Solanum chilense
gb|ABW22159.1|  putative At5g37260-like protein                         210   8e-60   Solanum chilense
gb|AAX44369.1|  putative At5g37260                                      210   8e-60   Solanum pimpinellifolium [currant tomato]
gb|AAX44336.1|  putative At5g37260                                      210   9e-60   Solanum peruvianum [Peruvian tomato]
gb|ABW22158.1|  putative At5g37260-like protein                         210   9e-60   Solanum chilense
gb|ABW22142.1|  putative At5g37260-like protein                         210   9e-60   Solanum peruvianum [Peruvian tomato]
gb|AAX44342.1|  putative At5g37260                                      210   1e-59   Solanum peruvianum [Peruvian tomato]
gb|ABW22136.1|  putative At5g37260-like protein                         209   1e-59   Solanum peruvianum [Peruvian tomato]
gb|ABW22150.1|  putative At5g37260-like protein                         209   1e-59   Solanum peruvianum [Peruvian tomato]
gb|ABW22170.1|  putative At5g37260-like protein                         209   2e-59   Solanum chilense
gb|AEO52891.1|  hypothetical protein                                    209   2e-59   
gb|AEO52888.1|  hypothetical protein                                    209   2e-59   
gb|ABW22129.1|  putative At5g37260-like protein                         208   5e-59   Solanum peruvianum [Peruvian tomato]
gb|AEO52894.1|  hypothetical protein                                    207   6e-59   
gb|AEO52898.1|  hypothetical protein                                    207   7e-59   
gb|ABW22130.1|  putative At5g37260-like protein                         207   1e-58   Solanum peruvianum [Peruvian tomato]
gb|AAX44374.1|  putative At5g37260                                      207   1e-58   Solanum pimpinellifolium [currant tomato]
gb|AEO52890.1|  hypothetical protein                                    206   2e-58   
gb|AEO52901.1|  hypothetical protein                                    206   2e-58   
gb|ABW22146.1|  putative At5g37260-like protein                         205   4e-58   Solanum peruvianum [Peruvian tomato]
gb|AAX44333.1|  putative At5g37260                                      204   9e-58   Solanum peruvianum [Peruvian tomato]
gb|AEO52897.1|  hypothetical protein                                    204   1e-57   
gb|ABW22154.1|  putative At5g37260-like protein                         204   1e-57   Solanum peruvianum [Peruvian tomato]
gb|AAX44340.1|  putative At5g37260                                      203   3e-57   Solanum peruvianum [Peruvian tomato]
gb|AEO52895.1|  hypothetical protein                                    203   4e-57   
gb|ADV29630.1|  At5g37260-like protein                                  202   5e-57   
gb|ABW22133.1|  putative At5g37260-like protein                         202   5e-57   Solanum peruvianum [Peruvian tomato]
gb|ADV29618.1|  At5g37260-like protein                                  202   7e-57   
gb|ADV29620.1|  At5g37260-like protein                                  201   2e-56   
gb|ADV29635.1|  At5g37260-like protein                                  201   2e-56   
gb|ADV29634.1|  At5g37260-like protein                                  201   2e-56   
gb|ADV29626.1|  At5g37260-like protein                                  201   2e-56   
gb|ABW22147.1|  putative At5g37260-like protein                         201   2e-56   Solanum peruvianum [Peruvian tomato]
gb|ADV29651.1|  At5g37260-like protein                                  200   3e-56   
gb|ABW22132.1|  putative At5g37260-like protein                         200   4e-56   Solanum peruvianum [Peruvian tomato]
gb|ABW22128.1|  putative At5g37260-like protein                         200   4e-56   Solanum peruvianum [Peruvian tomato]
gb|ADV29645.1|  At5g37260-like protein                                  200   4e-56   
gb|ABW22127.1|  putative At5g37260-like protein                         200   4e-56   Solanum peruvianum [Peruvian tomato]
gb|ADV29646.1|  At5g37260-like protein                                  200   4e-56   
gb|ADV29622.1|  At5g37260-like protein                                  200   5e-56   
gb|ADV29631.1|  At5g37260-like protein                                  200   5e-56   
gb|ADV29619.1|  At5g37260-like protein                                  200   5e-56   
gb|ADV29628.1|  At5g37260-like protein                                  200   5e-56   
gb|ADV29608.1|  At5g37260-like protein                                  200   5e-56   
gb|ADV29629.1|  At5g37260-like protein                                  200   5e-56   
gb|ADV29616.1|  At5g37260-like protein                                  199   6e-56   
gb|ADV29632.1|  At5g37260-like protein                                  199   6e-56   
gb|ADV29633.1|  At5g37260-like protein                                  199   7e-56   
gb|ADV29602.1|  At5g37260-like protein                                  199   7e-56   
gb|AAX44359.1|  putative At5g37260                                      199   8e-56   Solanum chmielewskii
gb|AEO52798.1|  hypothetical protein                                    199   8e-56   
gb|ADV29623.1|  At5g37260-like protein                                  199   1e-55   
gb|ADV29642.1|  At5g37260-like protein                                  199   1e-55   
gb|ABW22167.1|  putative At5g37260-like protein                         198   2e-55   Solanum chilense
gb|ABW22182.1|  putative At5g37260-like protein                         198   2e-55   Solanum chilense
gb|ABW22174.1|  putative At5g37260-like protein                         198   2e-55   Solanum chilense
gb|ADV29625.1|  At5g37260-like protein                                  198   2e-55   
gb|ABW22160.1|  putative At5g37260-like protein                         198   2e-55   Solanum chilense
gb|ABW22143.1|  putative At5g37260-like protein                         198   3e-55   Solanum peruvianum [Peruvian tomato]
gb|ABW22166.1|  putative At5g37260-like protein                         198   3e-55   Solanum chilense
gb|AAX44343.1|  putative At5g37260                                      198   3e-55   Solanum chilense
gb|ABW22155.1|  putative At5g37260-like protein                         198   3e-55   Solanum chilense
gb|AEO52801.1|  hypothetical protein                                    198   3e-55   
gb|ABW22180.1|  putative At5g37260-like protein                         198   3e-55   Solanum chilense
gb|ADV29637.1|  At5g37260-like protein                                  197   3e-55   
gb|ABW22169.1|  putative At5g37260-like protein                         197   3e-55   Solanum chilense
gb|AEO52800.1|  hypothetical protein                                    197   5e-55   
gb|AEO52806.1|  hypothetical protein                                    197   7e-55   
gb|ABW22123.1|  putative At5g37260-like protein                         197   7e-55   Solanum peruvianum [Peruvian tomato]
gb|ADV29639.1|  At5g37260-like protein                                  197   8e-55   
gb|ABW22176.1|  putative At5g37260-like protein                         196   8e-55   Solanum chilense
gb|AEO52802.1|  hypothetical protein                                    196   1e-54   
gb|AEO52889.1|  hypothetical protein                                    196   1e-54   
gb|ABW22168.1|  putative At5g37260-like protein                         196   1e-54   Solanum chilense
gb|ABW22181.1|  putative At5g37260-like protein                         195   2e-54   Solanum chilense
gb|AEO52893.1|  hypothetical protein                                    195   3e-54   
gb|ABW22173.1|  putative At5g37260-like protein                         194   5e-54   Solanum chilense
gb|AAX44344.1|  putative At5g37260                                      194   6e-54   Solanum chilense
gb|AEO52797.1|  hypothetical protein                                    194   6e-54   
gb|AAZ85376.1|  putative At5g37260                                      194   6e-54   Solanum ochranthum
gb|ABW22161.1|  putative At5g37260-like protein                         194   7e-54   Solanum chilense
gb|ABW22149.1|  putative At5g37260-like protein                         194   9e-54   Solanum peruvianum [Peruvian tomato]
gb|ABW22162.1|  putative At5g37260-like protein                         194   9e-54   Solanum chilense
gb|AEO52900.1|  hypothetical protein                                    193   1e-53   
gb|AEO52804.1|  hypothetical protein                                    191   1e-52   
ref|XP_007215304.1|  hypothetical protein PRUPE_ppa005083mg             177   3e-47   
ref|XP_002267976.2|  PREDICTED: protein REVEILLE 1                      173   2e-45   Vitis vinifera
emb|CAN68733.1|  hypothetical protein VITISV_012100                     172   3e-45   Vitis vinifera
gb|KDP35732.1|  hypothetical protein JCGZ_10504                         171   7e-45   
ref|XP_008227906.1|  PREDICTED: LOW QUALITY PROTEIN: protein REVE...    163   4e-42   
emb|CDP01692.1|  unnamed protein product                                162   1e-41   
ref|XP_009609238.1|  PREDICTED: protein REVEILLE 1-like isoform X2      157   3e-40   
ref|XP_006384118.1|  hypothetical protein POPTR_0004s07270g             156   2e-39   
ref|XP_002305260.2|  hypothetical protein POPTR_0004s07270g             153   8e-39   Populus trichocarpa [western balsam poplar]
emb|CBI27347.3|  unnamed protein product                                153   1e-38   
ref|XP_011035339.1|  PREDICTED: protein REVEILLE 1-like isoform X2      152   7e-38   
ref|XP_011035338.1|  PREDICTED: protein REVEILLE 1-like isoform X1      151   1e-37   
ref|XP_009782663.1|  PREDICTED: protein REVEILLE 1-like isoform X2      149   1e-37   
ref|XP_009367121.1|  PREDICTED: protein REVEILLE 1-like isoform X1      147   3e-36   
ref|XP_002526589.1|  DNA binding protein, putative                      147   3e-36   Ricinus communis
ref|XP_011085926.1|  PREDICTED: protein REVEILLE 1                      146   7e-36   
ref|XP_006372412.1|  hypothetical protein POPTR_0017s01380g             145   9e-36   
gb|AHZ13511.1|  RVE1-like protein                                       144   4e-35   
gb|AIL81922.1|  RVE1-like protein                                       143   5e-35   
ref|XP_008381387.1|  PREDICTED: protein REVEILLE 1-like                 143   6e-35   
gb|AIL81923.1|  RVE1-like protein                                       142   2e-34   
ref|XP_010675239.1|  PREDICTED: protein REVEILLE 2 isoform X1           139   1e-33   
ref|NP_001236066.1|  MYB transcription factor MYB177                    135   4e-32   
ref|XP_009370571.1|  PREDICTED: protein REVEILLE 1                      135   4e-32   
ref|XP_011013212.1|  PREDICTED: protein REVEILLE 1-like                 135   5e-32   
gb|KHN39497.1|  Protein CCA1                                            130   9e-31   
ref|XP_010525035.1|  PREDICTED: protein REVEILLE 1                      129   3e-30   
gb|ABL63123.1|  MYB transcription factor                                129   3e-30   Catharanthus roseus [chatas]
ref|XP_006430409.1|  hypothetical protein CICLE_v10011554mg             129   3e-30   
ref|XP_006481961.1|  PREDICTED: uncharacterized protein LOC102630458    129   7e-30   
ref|XP_010101053.1|  Myb-like protein G                                 124   2e-28   
ref|XP_010062320.1|  PREDICTED: protein REVEILLE 2                      122   6e-28   
gb|KCW69450.1|  hypothetical protein EUGRSUZ_F02906                     122   5e-27   
ref|XP_010246196.1|  PREDICTED: protein REVEILLE 1-like                 119   2e-26   
gb|EYU38934.1|  hypothetical protein MIMGU_mgv1a008764mg                116   7e-26   
ref|XP_006400263.1|  hypothetical protein EUTSA_v10013821mg             116   8e-26   
ref|XP_007141962.1|  hypothetical protein PHAVU_008G240700g             112   2e-24   
ref|XP_006287913.1|  hypothetical protein CARUB_v10001147mg             111   3e-24   
emb|CDY02714.1|  BnaC02g07210D                                          110   5e-24   
ref|XP_003519315.1|  PREDICTED: myb-like protein H-like                 110   1e-23   
ref|XP_002526271.1|  conserved hypothetical protein                     109   2e-23   Ricinus communis
ref|NP_568344.2|  myb family transcription factor RVE1                  107   6e-23   Arabidopsis thaliana [mouse-ear cress]
emb|CDX85462.1|  BnaA02g03510D                                          107   6e-23   
dbj|BAB10517.1|  unnamed protein product                                107   8e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002873821.1|  myb family transcription factor                    106   1e-22   
gb|KDO57321.1|  hypothetical protein CISIN_1g0126251mg                  104   4e-22   
gb|KDO57322.1|  hypothetical protein CISIN_1g0126251mg                  104   5e-22   
ref|XP_004490782.1|  PREDICTED: uncharacterized protein LOC101488...    105   6e-22   
ref|XP_009126176.1|  PREDICTED: protein REVEILLE 1-like                 104   6e-22   
ref|XP_008368744.1|  PREDICTED: protein REVEILLE 1-like                 100   2e-21   
ref|XP_011000774.1|  PREDICTED: protein REVEILLE 7-like                 103   3e-21   
gb|KHG08399.1|  Protein LHY -like protein                               103   5e-21   
ref|XP_004162953.1|  PREDICTED: uncharacterized LOC101217341            102   6e-21   
ref|XP_008439595.1|  PREDICTED: protein REVEILLE 2-like                 102   7e-21   
ref|XP_004137575.1|  PREDICTED: uncharacterized protein LOC101217341    102   7e-21   
ref|XP_002317724.1|  EARLY-PHYTOCHROME-RESPONSIVE1 family protein       102   8e-21   Populus trichocarpa [western balsam poplar]
ref|XP_010492675.1|  PREDICTED: protein REVEILLE 1-like                 100   1e-20   
ref|XP_007037069.1|  Homeodomain-like superfamily protein, putati...    101   2e-20   
ref|XP_010420440.1|  PREDICTED: protein REVEILLE 1-like                 100   2e-20   
ref|XP_010099675.1|  Myb-like protein G                                 100   2e-20   
gb|KGN63974.1|  hypothetical protein Csa_1G032440                       102   3e-20   
ref|XP_004150543.1|  PREDICTED: uncharacterized protein LOC101212264  99.4    4e-20   
ref|XP_010453914.1|  PREDICTED: protein REVEILLE 1 isoform X1         99.4    4e-20   
ref|XP_010453916.1|  PREDICTED: protein REVEILLE 1 isoform X3         99.0    5e-20   
ref|XP_008804812.1|  PREDICTED: protein REVEILLE 7-like                 100   5e-20   
ref|XP_004164974.1|  PREDICTED: uncharacterized LOC101212264          99.0    6e-20   
gb|KHN24174.1|  Myb-like protein G                                    97.8    6e-20   
ref|NP_001236032.1|  MYB transcription factor MYB173                  97.8    6e-20   
ref|XP_008463161.1|  PREDICTED: protein REVEILLE 1-like isoform X1    98.2    2e-19   
gb|KGN50924.1|  hypothetical protein Csa_5G341040                     98.2    2e-19   
ref|XP_008794529.1|  PREDICTED: uncharacterized protein LOC103710542  97.4    5e-19   
gb|ABH02880.1|  MYB transcription factor MYB174                       94.4    1e-18   Glycine max [soybeans]
gb|KFK25943.1|  hypothetical protein AALP_AA8G183100                  95.1    1e-18   
gb|KHN08771.1|  Myb-like protein G                                    94.7    1e-18   
ref|XP_003553057.1|  PREDICTED: protein LHY                           94.7    1e-18   
ref|XP_009385655.1|  PREDICTED: protein REVEILLE 1-like isoform X2    95.5    1e-18   
ref|XP_007209215.1|  hypothetical protein PRUPE_ppa006715mg           95.1    1e-18   
ref|XP_008240377.1|  PREDICTED: protein REVEILLE 7-like isoform X2    95.5    2e-18   
ref|XP_009385654.1|  PREDICTED: protein REVEILLE 1-like isoform X1    95.5    2e-18   
ref|XP_008240374.1|  PREDICTED: protein REVEILLE 7-like isoform X1    95.5    2e-18   
ref|XP_010099677.1|  Myb-like protein G                               95.5    2e-18   
ref|XP_004515250.1|  PREDICTED: uncharacterized protein LOC101509066  95.1    3e-18   
gb|KHG17751.1|  Protein LHY -like protein                             94.4    5e-18   
emb|CDY16939.1|  BnaC09g40660D                                        92.0    6e-18   
ref|XP_010537507.1|  PREDICTED: protein REVEILLE 7 isoform X1         93.2    7e-18   
ref|XP_003616176.1|  MYB transcription factor                         92.8    1e-17   
ref|XP_004299482.1|  PREDICTED: uncharacterized protein LOC101292702  91.7    1e-17   
emb|CDX69388.1|  BnaA10g17370D                                        92.0    1e-17   
ref|XP_002868495.1|  hypothetical protein ARALYDRAFT_493689           90.1    2e-17   
gb|KDO44080.1|  hypothetical protein CISIN_1g021851mg                 89.7    2e-17   
emb|CDX70747.1|  BnaC03g08310D                                        90.9    3e-17   
ref|XP_009121398.1|  PREDICTED: protein REVEILLE 1-like               90.9    3e-17   
ref|XP_010935334.1|  PREDICTED: protein CCA1                          92.0    3e-17   
ref|XP_007152597.1|  hypothetical protein PHAVU_004G143400g           92.0    3e-17   
gb|AAX33631.1|  Myb2                                                  84.7    3e-17   Pisum sativum [garden pea]
ref|XP_010558668.1|  PREDICTED: protein REVEILLE 1-like isoform X2    90.9    4e-17   
ref|XP_010558667.1|  PREDICTED: protein REVEILLE 1-like isoform X1    91.3    4e-17   
ref|XP_006374255.1|  hypothetical protein POPTR_0015s05430g           91.3    5e-17   
gb|KDO44076.1|  hypothetical protein CISIN_1g021851mg                 89.4    6e-17   
ref|NP_198542.1|  MYB family transcription factor Circadian 1         88.6    7e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009382073.1|  PREDICTED: protein REVEILLE 1-like               90.9    8e-17   
gb|AAS09985.1|  MYB transcription factor                              88.2    1e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CDX78737.1|  BnaA03g06490D                                        89.4    1e-16   
ref|XP_011047787.1|  PREDICTED: protein REVEILLE 7-like               90.1    2e-16   
ref|NP_001053666.1|  Os04g0583900                                     89.7    2e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003548314.1|  PREDICTED: protein CCA1                          89.7    2e-16   
ref|XP_006441350.1|  hypothetical protein CICLE_v10020130mg           89.7    2e-16   
ref|XP_006652697.1|  PREDICTED: uncharacterized protein LOC102715571  89.4    2e-16   
gb|EAY95301.1|  hypothetical protein OsI_17126                        89.4    2e-16   Oryza sativa Indica Group [Indian rice]
gb|EAZ31766.1|  hypothetical protein OsJ_15918                        89.4    2e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003534089.1|  PREDICTED: protein CCA1 isoform 1                89.0    3e-16   
emb|CDO98602.1|  unnamed protein product                              89.4    3e-16   
gb|KFK33315.1|  hypothetical protein AALP_AA6G359200                  86.7    4e-16   
ref|XP_008393486.1|  PREDICTED: protein REVEILLE 7-like               88.6    4e-16   
gb|ABH02924.1|  MYB transcription factor MYB131                       87.0    4e-16   Glycine max [soybeans]
ref|XP_009413064.1|  PREDICTED: protein REVEILLE 5-like               88.6    5e-16   
ref|XP_011086968.1|  PREDICTED: protein REVEILLE 2-like isoform X1    87.8    7e-16   
ref|XP_011086969.1|  PREDICTED: protein REVEILLE 2-like isoform X2    87.8    7e-16   
gb|EMT17444.1|  Myb-like protein G                                    86.3    2e-15   
ref|XP_006478113.1|  PREDICTED: uncharacterized protein LOC102614...  86.3    2e-15   
ref|XP_006284219.1|  hypothetical protein CARUB_v10005376mg           84.3    2e-15   
ref|XP_009131586.1|  PREDICTED: protein REVEILLE 1-like isoform X1    85.5    3e-15   
ref|XP_009131587.1|  PREDICTED: protein REVEILLE 1-like isoform X2    85.1    3e-15   
ref|XP_006647697.1|  PREDICTED: protein CCA1-like                     86.3    3e-15   
gb|EYU30891.1|  hypothetical protein MIMGU_mgv1a018822mg              83.2    4e-15   
gb|AHB59600.1|  putative MYB-related protein 13                       85.1    5e-15   
ref|NP_173269.1|  early-phytochrome-responsive1                       84.3    6e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007146984.1|  hypothetical protein PHAVU_006G086700g           84.3    6e-15   
ref|XP_006405937.1|  hypothetical protein EUTSA_v10028153mg           82.8    9e-15   
gb|AAF25987.1|AC013354_6  F15H18.16                                   83.6    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001117304.1|  early-phytochrome-responsive1                    84.0    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|NP_683543.1|  myb family transcription factor                     82.8    1e-14   Arabidopsis thaliana [mouse-ear cress]
gb|ABH02927.1|  MYB transcription factor MYB140                       79.3    1e-14   Glycine max [soybeans]
gb|EYU22283.1|  hypothetical protein MIMGU_mgv1a024824mg              82.8    2e-14   
gb|ABH02928.1|  MYB transcription factor MYB144                       78.6    2e-14   Glycine max [soybeans]
ref|XP_010528596.1|  PREDICTED: protein REVEILLE 2                    82.4    2e-14   
ref|XP_010440832.1|  PREDICTED: protein REVEILLE 2-like               82.0    2e-14   
ref|XP_010435556.1|  PREDICTED: protein REVEILLE 2-like               81.6    2e-14   
ref|XP_010037005.1|  PREDICTED: protein REVEILLE 7                    83.2    3e-14   
emb|CDY26997.1|  BnaC06g12130D                                        81.6    3e-14   
ref|NP_001289226.1|  protein REVEILLE 7-like                          82.8    4e-14   
ref|XP_009355963.1|  PREDICTED: protein REVEILLE 7-like               82.8    4e-14   
ref|NP_001146835.1|  LOC100280442                                     82.4    4e-14   Zea mays [maize]
ref|NP_001047765.1|  Os02g0685200                                     82.8    4e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009618565.1|  PREDICTED: protein REVEILLE 1-like isoform X1    82.4    5e-14   
gb|AIB05807.1|  MYB-related transcription factor                      82.4    5e-14   
gb|ACG29096.1|  hypothetical protein                                  82.0    6e-14   Zea mays [maize]
ref|XP_010450482.1|  PREDICTED: protein REVEILLE 2-like               80.5    6e-14   
ref|XP_009618566.1|  PREDICTED: protein REVEILLE 1-like isoform X2    82.0    6e-14   
ref|XP_008812464.1|  PREDICTED: protein CCA1-like isoform X1          82.4    6e-14   
ref|XP_009367123.1|  PREDICTED: protein REVEILLE 1-like isoform X2    81.6    9e-14   
ref|XP_009768903.1|  PREDICTED: uncharacterized protein LOC104219...  81.6    1e-13   
ref|XP_009768904.1|  PREDICTED: protein REVEILLE 1-like isoform X2    81.3    1e-13   
ref|XP_009144670.1|  PREDICTED: protein REVEILLE 2                    80.1    1e-13   
ref|XP_010537508.1|  PREDICTED: protein REVEILLE 7 isoform X2         80.9    1e-13   
gb|ADL36788.1|  MYBR domain class transcription factor                81.3    1e-13   
ref|XP_010940231.1|  PREDICTED: protein CCA1-like                     80.5    2e-13   
emb|CDY26169.1|  BnaA06g12480D                                        79.0    3e-13   
ref|NP_001288892.1|  protein REVEILLE 7                               79.3    3e-13   
ref|XP_006855608.1|  hypothetical protein AMTR_s00044p00072910        80.1    3e-13   
gb|KEH26846.1|  myb transcription factor                              79.3    6e-13   
ref|XP_002892995.1|  early-phytochrome-responsive1                    78.6    7e-13   
gb|AES70883.2|  myb transcription factor                              78.2    7e-13   
ref|XP_001767701.1|  cca1b circadian clock protein CCA1b              74.7    8e-13   
ref|XP_004235390.1|  PREDICTED: protein REVEILLE 7                    79.0    8e-13   
ref|XP_002964171.1|  hypothetical protein SELMODRAFT_29451            73.2    9e-13   
ref|XP_011072049.1|  PREDICTED: protein REVEILLE 7-like isoform X2    78.6    9e-13   
ref|XP_011072048.1|  PREDICTED: protein REVEILLE 7-like isoform X1    78.6    9e-13   
gb|KDO44079.1|  hypothetical protein CISIN_1g021851mg                 77.4    1e-12   
ref|XP_006305253.1|  hypothetical protein CARUB_v10009624mg           77.4    1e-12   
gb|AAU90342.2|  Myb-like DNA-binding protein, putative                77.8    2e-12   
ref|XP_010675240.1|  PREDICTED: protein REVEILLE 1 isoform X2         76.6    3e-12   
dbj|BAI39991.1|  circadian clock-associated protein 1a                77.8    3e-12   
ref|XP_010477007.1|  PREDICTED: protein REVEILLE 7                    76.6    3e-12   
gb|AGM20683.1|  EPR                                                   77.4    3e-12   
emb|CDY19206.1|  BnaC05g14070D                                        76.3    4e-12   
dbj|BAI39992.1|  circadian clock-associated protein 1b                77.0    5e-12   
gb|AEA50874.1|  lhy1                                                  72.8    5e-12   
ref|XP_006416617.1|  hypothetical protein EUTSA_v10008035mg           75.9    5e-12   
emb|CBI38726.3|  unnamed protein product                              73.6    6e-12   
emb|CDY61862.1|  BnaAnng17890D                                        76.6    6e-12   
ref|XP_009394111.1|  PREDICTED: protein REVEILLE 1-like               76.3    6e-12   
ref|XP_010459445.1|  PREDICTED: protein REVEILLE 7-like               75.1    8e-12   
ref|XP_006829218.1|  hypothetical protein AMTR_s00001p00272270        75.9    1e-11   
ref|XP_002301448.2|  hypothetical protein POPTR_0002s18190g           75.9    1e-11   
ref|XP_002948050.1|  hypothetical protein VOLCADRAFT_39186            69.3    1e-11   
ref|XP_006386665.1|  hypothetical protein POPTR_0002s18190g           75.5    1e-11   
ref|XP_004966528.1|  PREDICTED: protein CCA1-like isoform X2          75.1    1e-11   
ref|XP_009335251.1|  PREDICTED: protein LHY-like isoform X1           75.9    1e-11   
dbj|BAP76056.1|  putative LHY                                         75.9    1e-11   
ref|XP_004966527.1|  PREDICTED: protein CCA1-like isoform X1          75.1    1e-11   
gb|ABH02918.1|  MYB transcription factor MYB114                       72.0    1e-11   
ref|XP_008244198.1|  PREDICTED: protein CCA1                          70.5    1e-11   
ref|NP_001145595.1|  uncharacterized protein LOC100279070             75.1    1e-11   
ref|XP_002448396.1|  hypothetical protein SORBIDRAFT_06g026500        75.1    1e-11   
ref|XP_006386663.1|  hypothetical protein POPTR_0002s18190g           75.5    2e-11   
emb|CDX80750.1|  BnaC03g00040D                                        75.1    2e-11   
gb|ADW09013.1|  LHY                                                   75.1    2e-11   
ref|XP_007218929.1|  hypothetical protein PRUPE_ppa001765mg           75.1    2e-11   
ref|XP_004953478.1|  PREDICTED: uncharacterized protein LOC101769...  74.7    2e-11   
ref|XP_008661387.1|  PREDICTED: LHY protein isoform X3                75.1    2e-11   
ref|NP_001131529.2|  LHY protein                                      75.1    2e-11   
gb|AHW98794.1|  LATE ELONGATED HYPOCOTYL                              75.1    2e-11   
ref|XP_003573469.1|  PREDICTED: protein CCA1                          75.1    2e-11   
ref|XP_008661386.1|  PREDICTED: LHY protein isoform X2                75.1    2e-11   
ref|XP_008661383.1|  PREDICTED: LHY protein isoform X1                75.1    2e-11   
dbj|BAP76057.1|  putative LHY                                         75.1    2e-11   
ref|XP_008244202.1|  PREDICTED: protein LHY-like isoform X3           74.3    2e-11   
ref|XP_008244201.1|  PREDICTED: protein LHY-like isoform X2           74.3    2e-11   
ref|XP_004494878.1|  PREDICTED: protein LHY-like isoform X1           75.1    2e-11   
gb|AES82836.2|  late elongated hypocotyl-like protein                 75.1    2e-11   
gb|AII99804.1|  late elongated hypocotyl a                            75.1    2e-11   
ref|XP_004976600.1|  PREDICTED: uncharacterized protein LOC101769551  74.3    2e-11   
ref|XP_007051396.1|  Homeodomain-like superfamily protein isoform 2   74.7    2e-11   
dbj|BAJ92173.1|  predicted protein                                    74.7    2e-11   
gb|AEW48245.1|  circadian clock associated 1                          74.7    2e-11   
gb|AAU20773.1|  late elongated hypocotyl                              74.7    2e-11   
ref|XP_008244200.1|  PREDICTED: protein LHY-like isoform X1           74.3    2e-11   
gb|AAQ73524.1|  circadian clock associated1                           74.7    2e-11   
gb|EPS72249.1|  hypothetical protein M569_02508                       69.7    2e-11   
ref|XP_008808261.1|  PREDICTED: protein LHY isoform X3                74.7    2e-11   
ref|XP_007051397.1|  Homeodomain-like superfamily protein isoform 3   74.7    2e-11   
gb|EEC82927.1|  hypothetical protein OsI_27882                        74.7    2e-11   
gb|ADU60099.1|  circadian clock associated protein 1                  74.7    3e-11   
ref|XP_008808259.1|  PREDICTED: protein LHY isoform X1                74.7    3e-11   
ref|NP_001147482.1|  LHY protein                                      74.7    3e-11   
ref|XP_008808260.1|  PREDICTED: protein LHY isoform X2                74.7    3e-11   
emb|CDY15205.1|  BnaC05g00840D                                        74.7    3e-11   
ref|NP_001061032.1|  Os08g0157600                                     74.7    3e-11   
ref|XP_010687373.1|  PREDICTED: protein LHY-like isoform X2           74.7    3e-11   
gb|KHF99862.1|  Protein LHY -like protein                             74.7    3e-11   
ref|XP_008677179.1|  PREDICTED: LHY protein isoform X1                74.7    3e-11   
ref|XP_007051399.1|  Homeodomain-like superfamily protein isoform 5   74.7    3e-11   
dbj|BAC99516.1|  putative LHY protein                                 74.7    3e-11   
ref|XP_002443890.1|  hypothetical protein SORBIDRAFT_07g003870        74.7    3e-11   
ref|XP_004140527.1|  PREDICTED: protein LHY-like                      74.7    3e-11   
gb|ACL81163.1|  late elongated hypocotyl-like protein                 74.7    3e-11   
ref|XP_010687317.1|  PREDICTED: protein LHY-like isoform X1           74.7    3e-11   
gb|KDP28402.1|  hypothetical protein JCGZ_14173                       74.7    3e-11   
ref|XP_007051395.1|  Homeodomain-like superfamily protein isoform 1   74.7    3e-11   
ref|XP_008459828.1|  PREDICTED: protein LHY-like isoform X2           74.7    3e-11   
emb|CDX90004.1|  BnaA10g00780D                                        74.3    3e-11   
ref|XP_004972798.1|  PREDICTED: protein LHY-like isoform X1           74.7    3e-11   
dbj|BAH09382.1|  transcription factor LHY                             74.7    3e-11   
ref|XP_010556648.1|  PREDICTED: protein LHY-like isoform X3           74.3    3e-11   
gb|KHG16794.1|  Protein LHY                                           74.3    3e-11   
ref|XP_008459822.1|  PREDICTED: protein LHY-like isoform X1           74.3    3e-11   
ref|XP_006659137.1|  PREDICTED: protein CCA1-like isoform X1          74.3    3e-11   
ref|XP_011039461.1|  PREDICTED: protein LHY-like isoform X1           74.3    3e-11   
ref|XP_010661511.1|  PREDICTED: protein LHY-like isoform X3           74.3    3e-11   
ref|XP_009119664.1|  PREDICTED: protein LHY                           74.3    3e-11   
ref|XP_002515093.1|  conserved hypothetical protein                   74.3    3e-11   
ref|XP_006418374.1|  hypothetical protein EUTSA_v10007028mg           74.3    3e-11   
ref|XP_004306608.1|  PREDICTED: protein CCA1-like                     74.3    3e-11   
ref|XP_006659144.1|  PREDICTED: protein CCA1-like isoform X8          74.3    3e-11   
gb|KFK42494.1|  protein late elongated hypocotyl                      74.3    3e-11   
ref|XP_010474690.1|  PREDICTED: protein LHY                           74.3    3e-11   
ref|XP_008343467.1|  PREDICTED: protein LHY-like                      74.3    3e-11   
ref|XP_007139035.1|  hypothetical protein PHAVU_009G259600g           68.9    3e-11   
ref|XP_011039495.1|  PREDICTED: protein LHY-like isoform X2           74.3    3e-11   
ref|XP_010661513.1|  PREDICTED: protein LHY-like isoform X4           74.3    3e-11   
emb|CAA07004.1|  late elongated hypocotyl                             74.3    3e-11   
ref|XP_010457176.1|  PREDICTED: protein LHY-like                      74.3    3e-11   
ref|NP_001077437.1|  protein LHY                                      74.3    3e-11   
ref|NP_171614.1|  protein LHY                                         74.3    3e-11   
ref|XP_006306976.1|  hypothetical protein CARUB_v10008551mg           74.3    4e-11   
ref|XP_010241051.1|  PREDICTED: protein LHY-like                      74.3    4e-11   
gb|AAS09977.1|  MYB transcription factor                              74.3    4e-11   
ref|XP_010556640.1|  PREDICTED: protein LHY-like isoform X1           74.3    4e-11   
gb|AFW57285.1|  putative MYB DNA-binding domain superfamily protein   68.9    4e-11   
ref|XP_011025352.1|  PREDICTED: protein LHY-like                      74.3    4e-11   
ref|XP_006418373.1|  hypothetical protein EUTSA_v10007028mg           74.3    4e-11   
dbj|BAH19541.1|  AT1G01060                                            74.3    4e-11   
ref|XP_010480692.1|  PREDICTED: protein LHY isoform X1                74.3    4e-11   
ref|XP_003600632.1|  MYB transcription factor MYB174                  73.2    4e-11   
ref|XP_009620290.1|  PREDICTED: protein LHY                           73.9    4e-11   
gb|KHN11366.1|  Protein LHY                                           73.9    4e-11   
ref|XP_006604920.1|  PREDICTED: protein LHY isoform X3                73.9    4e-11   
ref|XP_003580392.1|  PREDICTED: protein REVEILLE 7-like               73.6    4e-11   
ref|XP_010507964.1|  PREDICTED: protein CCA1-like isoform X2          73.9    4e-11   
ref|XP_010507962.1|  PREDICTED: protein CCA1-like isoform X1          73.9    4e-11   
ref|XP_009111205.1|  PREDICTED: protein LHY-like                      73.9    4e-11   
ref|XP_010661508.1|  PREDICTED: protein LHY-like isoform X1           73.9    4e-11   
ref|XP_010525244.1|  PREDICTED: protein CCA1                          73.9    5e-11   
emb|CAN81352.1|  hypothetical protein VITISV_012722                   73.9    5e-11   
ref|NP_001236400.1|  MYB transcription factor MYB114                  73.9    5e-11   
ref|XP_010661510.1|  PREDICTED: protein LHY-like isoform X2           73.9    5e-11   
ref|XP_010518363.1|  PREDICTED: protein CCA1-like isoform X1          73.6    5e-11   
ref|XP_008788724.1|  PREDICTED: protein LHY-like isoform X1           73.9    5e-11   
ref|XP_010518365.1|  PREDICTED: protein CCA1-like isoform X2          73.6    5e-11   
ref|XP_002962328.1|  hypothetical protein SELMODRAFT_78481            68.2    5e-11   
gb|KHN16397.1|  Protein LHY                                           73.9    5e-11   
dbj|BAM67028.1|  late elongated hypocotyl-like                        73.6    5e-11   
ref|XP_010498220.1|  PREDICTED: protein REVEILLE 7-like               72.8    5e-11   
gb|ACF60466.1|  myb transcription factor                              73.6    5e-11   
ref|XP_008811397.1|  PREDICTED: protein LHY-like                      73.6    5e-11   
ref|XP_010542804.1|  PREDICTED: protein LHY-like isoform X3           73.6    5e-11   
ref|XP_004248416.1|  PREDICTED: protein LHY                           73.6    5e-11   
emb|CDP08615.1|  unnamed protein product                              73.6    5e-11   
ref|XP_006604919.1|  PREDICTED: protein LHY isoform X2                73.9    5e-11   
ref|XP_006604918.1|  PREDICTED: protein LHY isoform X1                73.9    5e-11   
ref|NP_001058645.1|  Os06g0728700                                     73.2    6e-11   
gb|EEC81347.1|  hypothetical protein OsI_24535                        73.2    6e-11   
ref|XP_011093093.1|  PREDICTED: protein LHY-like                      73.6    6e-11   
ref|XP_008788728.1|  PREDICTED: protein LHY-like isoform X3           73.6    6e-11   
ref|XP_009794791.1|  PREDICTED: protein LHY                           73.6    6e-11   
ref|XP_004166513.1|  PREDICTED: protein CCA1-like                     68.2    6e-11   
emb|CDX80051.1|  BnaA05g01050D                                        73.6    6e-11   
ref|NP_001288869.1|  cataract, congenital, cerulean type, 1           73.2    6e-11   
ref|XP_009142594.1|  PREDICTED: protein CCA1 isoform X2               73.2    6e-11   
dbj|BAK19069.1|  late elongated hypocotyl homolog                     73.6    6e-11   
ref|XP_010559151.1|  PREDICTED: protein CCA1-like isoform X1          73.6    7e-11   
ref|XP_010934912.1|  PREDICTED: LOW QUALITY PROTEIN: protein LHY-...  73.6    7e-11   
ref|XP_010559160.1|  PREDICTED: protein CCA1-like isoform X3          73.6    7e-11   
dbj|BAD97866.1|  LHY homologue1                                       73.2    7e-11   
ref|XP_006352623.1|  PREDICTED: protein LHY-like                      73.6    7e-11   
ref|XP_010919033.1|  PREDICTED: protein LHY-like isoform X1           73.6    7e-11   
ref|XP_010559159.1|  PREDICTED: protein CCA1-like isoform X2          73.2    7e-11   
ref|XP_010919035.1|  PREDICTED: protein LHY-like isoform X2           73.6    7e-11   
gb|EMT23919.1|  Myb-like protein G                                    68.6    7e-11   
ref|XP_010941176.1|  PREDICTED: LOW QUALITY PROTEIN: protein LHY-...  73.6    7e-11   
ref|XP_010559161.1|  PREDICTED: protein CCA1-like isoform X4          73.2    7e-11   
gb|KFK37450.1|  protein late elongated hypocotyl                      73.2    7e-11   
ref|XP_001782277.1|  cca1a circadian clock protein CCA1a              67.4    8e-11   
gb|AIR93784.1|  circadian clock-associated 1                          73.2    8e-11   
gb|EMS48519.1|  Protein LHY                                           68.6    8e-11   
ref|XP_009420434.1|  PREDICTED: protein LHY-like isoform X1           73.2    8e-11   
gb|AAR20887.1|  circadian oscillator component                        73.2    8e-11   
gb|ABN06082.1|  Homeodomain-related                                   69.7    8e-11   
emb|CDY41563.1|  BnaC04g00590D                                        73.2    8e-11   
ref|XP_005652015.1|  hypothetical protein COCSUDRAFT_55478            73.2    9e-11   
ref|XP_001418464.1|  predicted protein                                71.2    9e-11   
gb|AIR93783.1|  circadian clock-associated 1                          72.8    9e-11   
ref|NP_850460.1|  protein CCA1                                        72.8    1e-10   
dbj|BAD97870.1|  LHY homologue1                                       72.8    1e-10   
emb|CAZ68125.1|  putative CCA1 protein                                72.8    1e-10   
ref|XP_002880268.1|  hypothetical protein ARALYDRAFT_904154           72.8    1e-10   
dbj|BAD97871.1|  LHY homologue2                                       72.4    1e-10   
ref|XP_002452742.1|  hypothetical protein SORBIDRAFT_04g031590        72.4    1e-10   
ref|XP_008354055.1|  PREDICTED: LOW QUALITY PROTEIN: protein CCA1...  72.4    1e-10   
gb|AEV91181.1|  MYB-related protein                                   72.4    1e-10   
ref|XP_006293847.1|  hypothetical protein CARUB_v10022831mg           72.4    1e-10   
dbj|BAH09383.1|  transcription factor LHY                             72.4    1e-10   
gb|ABK96054.1|  unknown                                               72.4    1e-10   
gb|KDO86645.1|  hypothetical protein CISIN_1g004262mg                 72.4    1e-10   
gb|EPS59701.1|  hypothetical protein M569_15103                       68.9    1e-10   
ref|XP_006491393.1|  PREDICTED: protein LHY-like isoform X5           72.4    1e-10   
gb|AGH20047.1|  CCA1-like protein                                     72.4    1e-10   
gb|KDO86638.1|  hypothetical protein CISIN_1g004262mg                 72.4    1e-10   
ref|XP_006444706.1|  hypothetical protein CICLE_v10018964mg           72.4    1e-10   
ref|XP_006491389.1|  PREDICTED: protein LHY-like isoform X1           72.4    1e-10   
dbj|BAJ86643.1|  predicted protein                                    72.0    1e-10   
gb|KDO86644.1|  hypothetical protein CISIN_1g004262mg                 72.4    1e-10   
gb|EAY87102.1|  hypothetical protein OsI_08501                        72.0    2e-10   
ref|XP_008676827.1|  PREDICTED: putative MYB DNA-binding domain s...  71.6    2e-10   
ref|XP_006656522.1|  PREDICTED: dentin sialophosphoprotein-like       72.0    2e-10   
ref|XP_008676826.1|  PREDICTED: putative MYB DNA-binding domain s...  71.6    2e-10   
ref|XP_010054141.1|  PREDICTED: protein LHY isoform X2                72.0    2e-10   
ref|XP_010054137.1|  PREDICTED: protein LHY isoform X1                72.0    2e-10   
ref|XP_009395074.1|  PREDICTED: protein LHY-like isoform X1           72.0    2e-10   
ref|XP_009385734.1|  PREDICTED: protein LHY-like isoform X3           72.0    2e-10   
ref|XP_009385732.1|  PREDICTED: protein LHY-like isoform X1           72.0    2e-10   
ref|XP_008676825.1|  PREDICTED: putative MYB DNA-binding domain s...  71.6    2e-10   
ref|XP_009385737.1|  PREDICTED: protein LHY-like isoform X6           72.0    2e-10   
ref|XP_009385736.1|  PREDICTED: protein LHY-like isoform X5           71.6    2e-10   
ref|XP_009385735.1|  PREDICTED: protein LHY-like isoform X4           71.6    2e-10   
ref|XP_003528756.1|  PREDICTED: protein LHY isoform X1                72.0    2e-10   
ref|XP_009385738.1|  PREDICTED: protein LHY-like isoform X7           71.6    2e-10   
ref|NP_001235187.1|  late elongated hypocotyl and circadian clock...  71.6    2e-10   
gb|KHN15871.1|  Protein LHY                                           71.6    2e-10   
ref|XP_006598673.1|  PREDICTED: late elongated hypocotyl and circ...  71.6    2e-10   



>dbj|BAO57283.1| Myb family transcription factor [Ipomoea nil]
Length=487

 Score =   227 bits (579),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 207/407 (51%), Positives = 241/407 (59%), Gaps = 73/407 (18%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RESNG D  +VKPIEIPPPRPKRKPMH
Sbjct  71    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESNGTDVNSVKPIEIPPPRPKRKPMH  130

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEK---ENRSPTSVLFALDSEGQasads  352
             PYPRKLVI      G    EK T S+  NL   EK   EN+SPTSVL AL SEG+ + DS
Sbjct  131   PYPRKLVI----AGGAPAQEKLTSSVPSNLCPVEKENQENQSPTSVLSALGSEGEGTTDS  186

Query  353   spnaspscvssaTG---GGILFSKHCNVLVEENGSSSP------------PPGNLELLPL  487
             + N SP  VSSA G    G L S+ CN+L EEN SS P            P   LEL P 
Sbjct  187   TLNGSPPPVSSALGDSSSGFLPSEQCNLLQEENRSSLPVQPSTNPGPDEQPFARLELFPQ  246

Query  488   DDGRVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDLKA-------PMATHSFSWN  634
             ++G V     E+S+   LKLFGKTVLV+ SH  SSPTS   K         +AT S  W 
Sbjct  247   ENGFVNDCSTEASSTYSLKLFGKTVLVTDSHRPSSPTSGTSKTLPTEANDEVATQSLPWT  306

Query  635   LS----------------------IGHGDYSECKPVPSLPWALPRAPSSSAGFPCVQVHS  748
              +                      I + +  E    PSLPW LP A   +A FP VQVH 
Sbjct  307   FAPMKILFGSPECTSTSLYYPPTQIEYSNTVESVLAPSLPWGLPYA---TASFPRVQVHD  363

Query  749   PVAIKARPFSFDSKDNVEEKEDAKEGSSTCSNSGSVNV-GICVDKNLDTET---------  898
             P+ +KARP  FD K+  E+ E+ KE SS  SNSGSVN+    + KN +TET         
Sbjct  364   PIPVKARPV-FDPKE-TEDNENRKEASSAASNSGSVNILEKHIGKNSETETETETGESEE  421

Query  899   -QSGQRIGSDSSCFKRTTEIVILEQKTARSTKRTKGFMPYKRCLAER  1036
              QS ++IGS+ S F R TE    + +T+ S+KR KGF+PYKRCLAER
Sbjct  422   QQSSEKIGSEVSAF-RPTETTNFKLRTS-SSKRMKGFLPYKRCLAER  466



>ref|XP_009613640.1| PREDICTED: protein REVEILLE 1-like isoform X1 [Nicotiana tomentosiformis]
Length=488

 Score =   220 bits (561),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 183/401 (46%), Positives = 231/401 (58%), Gaps = 71/401 (18%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RESN  DA +VKPIEIPPPRPKRKPMH
Sbjct  82    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESNSGDASSVKPIEIPPPRPKRKPMH  141

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
             PYPRKL  TPV   G L PEK TRS+SPN+S+SE+EN+SPTSVL A  S+   + DSS  
Sbjct  142   PYPRKLA-TPVK-SGTLVPEKLTRSISPNMSMSEQENQSPTSVLSAHGSDALGTGDSSKR  199

Query  362   aspscvssaTGG----GILFSKHCNVLVEENGSSSPPPGN------------LELLPLDD  493
             +  +   S+ GG    G + S+  N ++++  SS+P   N            LELLP + 
Sbjct  200   SGSASPVSSAGGGNSDGFVLSEPPNFILQD--SSTPAQANASTNPENQACVKLELLPQEG  257

Query  494   GRVRESSTAQYLKLFGKTVLVSGSHTLSSPTS------RDLKAPMATHSFSWNL------  637
                 E+S+   LKLFGKTVLV+ S     PTS       D+    A  + SWN+      
Sbjct  258   S--AETSSTPCLKLFGKTVLVTESQR-PCPTSGTCKIETDVNDEAALPTASWNIMPMKFT  314

Query  638   -----------------------SIGHGDY-SECKPVPSLPWALPRAPSSSAGFPCVQVH  745
                                    S     + + C     LPW    +  +S  FPC+QV 
Sbjct  315   ASDSDCVSSTLTMGTPPPFYYLPSQNENQWPTRCASATLLPWG---SSCASVSFPCIQVL  371

Query  746   SPVAIKARPFSFDSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQ----R  913
             +P+ IK RP   D  +N+E+K++ KEGSST SN+  V+  +  DKN+D E QS Q    +
Sbjct  372   NPIPIKGRPIFND--NNLEDKQNQKEGSSTGSNTEPVSTEMSGDKNMDVEAQSSQHPLEK  429

Query  914   IGSDSSCFKRTTEIVILEQKTARSTKRTKGFMPYKRCLAER  1036
             +  + S     T  ++   + A STKR KGF+PYKRCLAER
Sbjct  430   VRKELSSRPSETSSLV---RRASSTKRIKGFVPYKRCLAER  467



>ref|XP_009613641.1| PREDICTED: protein REVEILLE 1-like isoform X2 [Nicotiana tomentosiformis]
Length=478

 Score =   219 bits (559),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 183/401 (46%), Positives = 231/401 (58%), Gaps = 71/401 (18%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RESN  DA +VKPIEIPPPRPKRKPMH
Sbjct  72    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESNSGDASSVKPIEIPPPRPKRKPMH  131

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
             PYPRKL  TPV   G L PEK TRS+SPN+S+SE+EN+SPTSVL A  S+   + DSS  
Sbjct  132   PYPRKLA-TPVK-SGTLVPEKLTRSISPNMSMSEQENQSPTSVLSAHGSDALGTGDSSKR  189

Query  362   aspscvssaTGG----GILFSKHCNVLVEENGSSSPPPGN------------LELLPLDD  493
             +  +   S+ GG    G + S+  N ++++  SS+P   N            LELLP + 
Sbjct  190   SGSASPVSSAGGGNSDGFVLSEPPNFILQD--SSTPAQANASTNPENQACVKLELLPQEG  247

Query  494   GRVRESSTAQYLKLFGKTVLVSGSHTLSSPTS------RDLKAPMATHSFSWNL------  637
                 E+S+   LKLFGKTVLV+ S     PTS       D+    A  + SWN+      
Sbjct  248   S--AETSSTPCLKLFGKTVLVTESQR-PCPTSGTCKIETDVNDEAALPTASWNIMPMKFT  304

Query  638   -----------------------SIGHGDY-SECKPVPSLPWALPRAPSSSAGFPCVQVH  745
                                    S     + + C     LPW    +  +S  FPC+QV 
Sbjct  305   ASDSDCVSSTLTMGTPPPFYYLPSQNENQWPTRCASATLLPWG---SSCASVSFPCIQVL  361

Query  746   SPVAIKARPFSFDSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQ----R  913
             +P+ IK RP   D  +N+E+K++ KEGSST SN+  V+  +  DKN+D E QS Q    +
Sbjct  362   NPIPIKGRPIFND--NNLEDKQNQKEGSSTGSNTEPVSTEMSGDKNMDVEAQSSQHPLEK  419

Query  914   IGSDSSCFKRTTEIVILEQKTARSTKRTKGFMPYKRCLAER  1036
             +  + S     T  ++   + A STKR KGF+PYKRCLAER
Sbjct  420   VRKELSSRPSETSSLV---RRASSTKRIKGFVPYKRCLAER  457



>ref|XP_009609237.1| PREDICTED: protein REVEILLE 1-like isoform X1 [Nicotiana tomentosiformis]
Length=468

 Score =   219 bits (557),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 185/390 (47%), Positives = 226/390 (58%), Gaps = 49/390 (13%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RESN  D  +VK IEIPPPRPKRKPMH
Sbjct  61    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESNNGDVSSVKSIEIPPPRPKRKPMH  120

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRKLVI PV   G L PEK  RS SPNL +SE EN+SPTSVL AL S+      +S  
Sbjct  121   PYPRKLVI-PVK-SGTLAPEKSKRSGSPNLCLSETENQSPTSVLSALGSDAFGTVDSSKP  178

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S   +  S   S   G ++ S+  +  +E+  SS      S  P N     LEL P D+ 
Sbjct  179   SESPSPVSSAVSENCGDLVLSEQSDFNLEKRRSSPAQAYASSNPDNQACVKLELFPEDND  238

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTS-----RDLKAPMATHSFSWN-----  634
              V+    E+S+   LKLFGKTV V+ S  LSSPTS      D+    A+ + S +     
Sbjct  239   FVKEGSVEASSTHSLKLFGKTVFVTDSCVLSSPTSGQISLADVNNEPASRTLSQSSFPMK  298

Query  635   ------------LSIGHGDYSECKPVP--SLPWALPRAPSS--SAGFPCVQVHSPVAIKA  766
                         +++ H   +   P P  S+P  L    SS  SA F C QVH+P+ +K 
Sbjct  299   FSPSDSECAPSTVTMYHAPAANGSPRPNKSVPCHLLSGESSYVSAAFSCTQVHNPIPMKG  358

Query  767   RPFSFDSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRT  946
             R F  D KD+ EEKE  KEGSST SN+ SV+  + VDK +  E QS +   +    F   
Sbjct  359   RAFFID-KDS-EEKETQKEGSSTGSNTESVSTELSVDKRVGIEAQSSRNREAGRELFSVR  416

Query  947   TEIVILEQKTARSTKRTKGFMPYKRCLAER  1036
               +  L ++ A S KR KGF+PYKRCLAER
Sbjct  417   ASVPSLFERRANSAKRVKGFVPYKRCLAER  446



>gb|ADV29577.1| At5g37260-like protein [Solanum habrochaites]
Length=446

 Score =   216 bits (551),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 174/379 (46%), Positives = 222/379 (59%), Gaps = 44/379 (12%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  + +VEE+ SS      S  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFVVEESRSSPARAYDSSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAH--KPPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPSLPWALPRAP--------------SSSAGFPCVQVHSPVAIKARPFSFDSKDNV  799
                P PS  +A P                  SS   PC QVHSP+ +K RP  F+ +D +
Sbjct  293   IVPPTPSYYFATPNGSPGPNQSGVATHLPWGSSCAVPCTQVHSPIPMKGRPL-FNDRD-L  350

Query  800   EEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVILEQKTA  979
             E KE  KEGSST SN+ SV+  +  DKN++ E QS + +  +S        +  L ++ A
Sbjct  351   EGKEAQKEGSSTGSNAESVDAELSGDKNMEIEAQSSRNVVEESV----RASVPSLFERRA  406

Query  980   RSTKRTKGFMPYKRCLAER  1036
              STKR KGF+PYKRCLAER
Sbjct  407   NSTKRVKGFVPYKRCLAER  425



>ref|XP_009790908.1| PREDICTED: protein REVEILLE 1-like isoform X2 [Nicotiana sylvestris]
Length=474

 Score =   217 bits (553),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 179/390 (46%), Positives = 229/390 (59%), Gaps = 53/390 (14%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RESN  DA +VKPIEIPPPRPKRKPMH
Sbjct  72    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESNNGDASSVKPIEIPPPRPKRKPMH  131

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
             PYPRKL  TPV   G L PEKPTRS+SPN+S+SE++N+SP SVL A  S+   + DSS  
Sbjct  132   PYPRKLA-TPVK-SGTLVPEKPTRSISPNMSMSEQKNQSPASVLSAHGSDALGTVDSSKR  189

Query  362   aspscvssaTGG----GILFSKHCNVLVEENGSSSPPPGNLELLPLDDGRVR----ESST  517
                +   S  GG    G + S+  N +++++ S +     LELLP +   V+    E+S+
Sbjct  190   NGSASPVSPAGGGNSDGFVLSEPPNFILQDSSSLAQACVKLELLPQEVNFVKEGSAETSS  249

Query  518   AQYLKLFGKTVLV---------SGSHTLSSPTSRDLKAPMATHSF-------------SW  631
                LKLFGKTVLV         SG+  + +  + +   P A+ +              S 
Sbjct  250   TPCLKLFGKTVLVTESQRPRPTSGTCKIETDVNDEAALPTASLNLMPMKFTASDSDCGSS  309

Query  632   NLSIGHGD---YSE----------CKPVPSLPWALPRAPSSSAGFPCVQVHSPVAIKARP  772
              L++G      YS           C     LPW    +  +S  FPC+QV +P+ IK RP
Sbjct  310   TLTVGTPPPFYYSPSQNENQWPTGCASATLLPWG---SSCASVSFPCIQVLNPIPIKGRP  366

Query  773   FSFDSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRI--GSDSSCFKRT  946
                D  + +E+K++ KEGSST SN+  V+  +  DKN+D E QS Q     +      R 
Sbjct  367   LFND--NELEDKQNQKEGSSTGSNTEPVSAEMGGDKNMDIEAQSSQHPLEKARKELSSRP  424

Query  947   TEIVILEQKTARSTKRTKGFMPYKRCLAER  1036
             +E   L ++ A STKR KGF+PYKRCLAER
Sbjct  425   SETPSLVRR-ASSTKRVKGFVPYKRCLAER  453



>ref|XP_009790907.1| PREDICTED: protein REVEILLE 1-like isoform X1 [Nicotiana sylvestris]
Length=484

 Score =   217 bits (553),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 179/390 (46%), Positives = 229/390 (59%), Gaps = 53/390 (14%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RESN  DA +VKPIEIPPPRPKRKPMH
Sbjct  82    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESNNGDASSVKPIEIPPPRPKRKPMH  141

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
             PYPRKL  TPV   G L PEKPTRS+SPN+S+SE++N+SP SVL A  S+   + DSS  
Sbjct  142   PYPRKLA-TPVK-SGTLVPEKPTRSISPNMSMSEQKNQSPASVLSAHGSDALGTVDSSKR  199

Query  362   aspscvssaTGG----GILFSKHCNVLVEENGSSSPPPGNLELLPLDDGRVR----ESST  517
                +   S  GG    G + S+  N +++++ S +     LELLP +   V+    E+S+
Sbjct  200   NGSASPVSPAGGGNSDGFVLSEPPNFILQDSSSLAQACVKLELLPQEVNFVKEGSAETSS  259

Query  518   AQYLKLFGKTVLV---------SGSHTLSSPTSRDLKAPMATHSF-------------SW  631
                LKLFGKTVLV         SG+  + +  + +   P A+ +              S 
Sbjct  260   TPCLKLFGKTVLVTESQRPRPTSGTCKIETDVNDEAALPTASLNLMPMKFTASDSDCGSS  319

Query  632   NLSIGHGD---YSE----------CKPVPSLPWALPRAPSSSAGFPCVQVHSPVAIKARP  772
              L++G      YS           C     LPW    +  +S  FPC+QV +P+ IK RP
Sbjct  320   TLTVGTPPPFYYSPSQNENQWPTGCASATLLPWG---SSCASVSFPCIQVLNPIPIKGRP  376

Query  773   FSFDSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRI--GSDSSCFKRT  946
                D  + +E+K++ KEGSST SN+  V+  +  DKN+D E QS Q     +      R 
Sbjct  377   LFND--NELEDKQNQKEGSSTGSNTEPVSAEMGGDKNMDIEAQSSQHPLEKARKELSSRP  434

Query  947   TEIVILEQKTARSTKRTKGFMPYKRCLAER  1036
             +E   L ++ A STKR KGF+PYKRCLAER
Sbjct  435   SETPSLVRR-ASSTKRVKGFVPYKRCLAER  463



>gb|ABW22145.1| putative At5g37260-like protein [Solanum peruvianum]
Length=446

 Score =   216 bits (550),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 175/385 (45%), Positives = 222/385 (58%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +P P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENCGDLVLSEPFDFAVEESRSSPARAYATPNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPRSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPSPNGSPGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  DKN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGDKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|ADV29615.1| At5g37260-like protein [Solanum arcanum]
Length=446

 Score =   216 bits (550),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 174/385 (45%), Positives = 223/385 (58%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPSDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSCYFPTPNGSPGPNQSSVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  DKN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGDKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|AAX44355.1| putative At5g37260 [Solanum habrochaites]
 gb|AAX44356.1| putative At5g37260 [Solanum habrochaites]
 gb|AAX44357.1| putative At5g37260 [Solanum habrochaites]
 gb|AAX44358.1| putative At5g37260 [Solanum habrochaites]
 gb|ADV29554.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29555.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29556.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29558.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29559.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29560.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29565.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29566.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29567.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29571.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29572.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29573.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29574.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29576.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29578.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29579.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29580.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29581.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29582.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29583.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29584.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29585.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29586.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29587.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29588.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29589.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29590.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29592.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29593.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29594.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29595.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29596.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29597.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29598.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29599.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29601.1| At5g37260-like protein [Solanum habrochaites]
Length=446

 Score =   215 bits (548),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 175/385 (45%), Positives = 222/385 (58%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  + +VEE+ SS      S  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFVVEESRSSPARAYDSSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAH--KPPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  DKN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKEAQKEGSSTGSNAESVDAELSGDKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|ADV29575.1| At5g37260-like protein [Solanum habrochaites]
Length=446

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 175/385 (45%), Positives = 222/385 (58%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  + +VEE+ SS      S  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFVVEESRSSPARAYDSSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAH--KPPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  DKN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKEAQKEGSSTGSNAESVDAELSGDKNMEIEAQSSRYVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|ADV29557.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29561.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29562.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29563.1| At5g37260-like protein [Solanum habrochaites]
Length=446

 Score =   214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 175/385 (45%), Positives = 222/385 (58%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  + +VEE+ SS      S  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFVVEESRSSPARAYDSSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAH--KPPTDETLTRSSFPAKFLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  DKN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKEAQKEGSSTGSNAESVDAELSGDKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|ADV29614.1| At5g37260-like protein [Solanum arcanum]
 gb|ADV29617.1| At5g37260-like protein [Solanum arcanum]
Length=446

 Score =   214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 174/385 (45%), Positives = 223/385 (58%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLALEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFTTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  DKN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGDKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|ADV29591.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29600.1| At5g37260-like protein [Solanum habrochaites]
Length=446

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 175/385 (45%), Positives = 221/385 (57%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  + +VEE+ SS      S  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFVVEESRSSPALAYDSSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAH--KPPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPAPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN  SV+  +  DKN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKEAQKEGSSTGSNVESVDAELSGDKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|ADV29570.1| At5g37260-like protein [Solanum habrochaites]
Length=446

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 174/385 (45%), Positives = 222/385 (58%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  + +VEE+ SS      S  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFVVEESRSSPARAYDSSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAH--KPPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  DKN++ E Q+ + +  +S        +  
Sbjct  346   NDRD-LEGKEAQKEGSSTGSNAESVDAELSGDKNMEIEAQNSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|ABW22153.1| putative At5g37260-like protein [Solanum peruvianum]
Length=446

 Score =   214 bits (544),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 174/385 (45%), Positives = 222/385 (58%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSESENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPRSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSAGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  +KN++ E QS + +  +S      T +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNVVEESV----RTSVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|ABW22152.1| putative At5g37260-like protein [Solanum peruvianum]
Length=446

 Score =   214 bits (544),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 175/385 (45%), Positives = 221/385 (57%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPRSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSPV +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPVPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  DKN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGDKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|AAX44353.1| putative At5g37260 [Solanum habrochaites]
 gb|AAX44354.1| putative At5g37260 [Solanum habrochaites]
Length=446

 Score =   214 bits (544),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 174/385 (45%), Positives = 222/385 (58%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK I+IPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIDIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  + +VEE+ SS      S  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFVVEESRSSPARAYDSSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAH--KPPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  DKN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKEAQKEGSSTGSNAESVDAELSGDKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|ABW22138.1| putative At5g37260-like protein [Solanum peruvianum]
Length=446

 Score =   214 bits (544),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 173/385 (45%), Positives = 222/385 (58%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSCSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  + +VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPRSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  +KN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|ABW22151.1| putative At5g37260-like protein [Solanum peruvianum]
Length=446

 Score =   213 bits (543),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 174/385 (45%), Positives = 221/385 (57%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  DKN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGDKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|ABW22140.1| putative At5g37260-like protein [Solanum peruvianum]
Length=446

 Score =   213 bits (542),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 174/385 (45%), Positives = 221/385 (57%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPRSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  DKN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGDKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|ADV29564.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29568.1| At5g37260-like protein [Solanum habrochaites]
 gb|ADV29569.1| At5g37260-like protein [Solanum habrochaites]
Length=446

 Score =   213 bits (542),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 174/385 (45%), Positives = 222/385 (58%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  + +VEE+ SS      S  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFVVEESRSSPARAYDSSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAH--KPPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  DK+++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKEAQKEGSSTGSNAESVDAELSGDKSMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|ADV29607.1| At5g37260-like protein [Solanum arcanum]
Length=446

 Score =   213 bits (542),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 173/385 (45%), Positives = 223/385 (58%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPRSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFTTPNGCPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  +KN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|ABW22171.1| putative At5g37260-like protein [Solanum chilense]
 gb|ABW22172.1| putative At5g37260-like protein [Solanum chilense]
Length=446

 Score =   213 bits (541),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 174/385 (45%), Positives = 221/385 (57%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPRPSYYFPSPNGSPGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  DKN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGDKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>ref|XP_009782662.1| PREDICTED: protein REVEILLE 1-like isoform X1 [Nicotiana sylvestris]
Length=467

 Score =   213 bits (543),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 182/391 (47%), Positives = 221/391 (57%), Gaps = 51/391 (13%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RESN  D  +VK IEIPPPRPKRKPMH
Sbjct  61    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESNNGDVSSVKSIEIPPPRPKRKPMH  120

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRKL I PV   G L PE   RS SPNL +SE EN+SPTSVL A  S+      +S  
Sbjct  121   PYPRKLAI-PVK-SGTLAPEISKRSASPNLCLSETENQSPTSVLSARGSDAFGTVDSSKP  178

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S   +  S   S   G ++ S+  +  +E+  SS      S  P N     LEL P D+ 
Sbjct  179   SESPSPVSSAVSENCGDLVLSEQSDFNLEKRRSSPAQAYASSNPDNQACVKLELFPEDND  238

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTS-----RDLKAPMATHSFSWN---LS  640
              V+    E+S+   LKLFGKTV V+ S  LSSPTS      D+    A+ + S N   + 
Sbjct  239   FVKEGSVEASSTHSLKLFGKTVFVADSCVLSSPTSGQILLADVNDEPASRTLSQNSFPMK  298

Query  641   IGHGDYSECKPVPSLPWALPRAPSS-------------------SAGFPCVQVHSPVAIK  763
                 D SEC P     +  P A  S                   SA F C QVH+P+ +K
Sbjct  299   FSPSD-SECAPSTVTMYHAPAANGSPRPNKSVSCHLLSWGSSYVSAAFSCTQVHNPIPMK  357

Query  764   ARPFSFDSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKR  943
              R   FD KD+ E++E  KEGSST SN+ SV+  + VDK+L  E Q  +   +    F  
Sbjct  358   GRAL-FDHKDS-EDQEIQKEGSSTGSNTESVSAELSVDKSLGVEAQISRNQEARRELFSI  415

Query  944   TTEIVILEQKTARSTKRTKGFMPYKRCLAER  1036
                +  L ++ A STKR KGF+PYKRCLAER
Sbjct  416   RASVPSLFERRANSTKRVKGFVPYKRCLAER  446



>gb|AAX44338.1| putative At5g37260 [Solanum peruvianum]
Length=446

 Score =   213 bits (541),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 172/379 (45%), Positives = 220/379 (58%), Gaps = 44/379 (12%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECRRSSFS  292

Query  662   ECKPVPSLPWALPRAP--------------SSSAGFPCVQVHSPVAIKARPFSFDSKDNV  799
                P PS  +  P                  SS   PC QVHSP+ +K RP  F+ +D +
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPRRSSCAVPCTQVHSPIPMKGRPL-FNDRD-L  350

Query  800   EEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVILEQKTA  979
             E KE  KEGSST SN+ SV+  +  DKN++ E QS + +  +S        +  L ++ A
Sbjct  351   EGKETQKEGSSTGSNAESVDAELSGDKNMEIEAQSSRNVVEESV----RASVPSLFERRA  406

Query  980   RSTKRTKGFMPYKRCLAER  1036
              STKR KGF+PYKRCLAER
Sbjct  407   NSTKRVKGFVPYKRCLAER  425



>gb|ADV29612.1| At5g37260-like protein [Solanum arcanum]
Length=446

 Score =   213 bits (541),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 173/385 (45%), Positives = 223/385 (58%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLALEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPRSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  +KN++ E QS + +  +S        +  
Sbjct  346   NDRD-MEGKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|AAX44341.1| putative At5g37260 [Solanum peruvianum]
Length=446

 Score =   212 bits (540),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 173/385 (45%), Positives = 222/385 (58%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  + +VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPRSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSAGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  +KN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|ABW22137.1| putative At5g37260-like protein [Solanum peruvianum]
Length=446

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 174/381 (46%), Positives = 220/381 (58%), Gaps = 48/381 (13%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-GGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPSLPWA----------------LPRAPSSSAGFPCVQVHSPVAIKARPFSFDSKD  793
                P PS  +                 LPR   SS   PC QVHSP+ +K RP   DS  
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPRG--SSCAVPCTQVHSPIPMKGRPLFNDS--  348

Query  794   NVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVILEQK  973
             ++E KE  KEGSST SN+ SV+  +  DKN++ E QS + +   S        +  L ++
Sbjct  349   DLEGKETQKEGSSTGSNAESVDAELSGDKNMEIEAQSSRNVVEQSV----RASVPSLFER  404

Query  974   TARSTKRTKGFMPYKRCLAER  1036
              A STKR KGF+PYKRCLAER
Sbjct  405   RANSTKRVKGFVPYKRCLAER  425



>gb|ADV29611.1| At5g37260-like protein [Solanum arcanum]
Length=446

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 174/385 (45%), Positives = 221/385 (57%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-GGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++       SW+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLSWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFTTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             +  D +E KE  KEGSST SN+ SV+  +  +KN++ E QS + +  +S        +  
Sbjct  346   NDGD-LEGKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|AAX44337.1| putative At5g37260 [Solanum peruvianum]
Length=446

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 173/385 (45%), Positives = 221/385 (57%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPRSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  +KN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|ADV29640.1| At5g37260-like protein [Solanum arcanum]
 gb|ADV29641.1| At5g37260-like protein [Solanum arcanum]
 gb|ADV29643.1| At5g37260-like protein [Solanum arcanum]
 gb|ADV29644.1| At5g37260-like protein [Solanum arcanum]
 gb|ADV29647.1| At5g37260-like protein [Solanum arcanum]
Length=446

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 172/385 (45%), Positives = 222/385 (58%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++  +  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLFEPFDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFTTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  +KN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|ABW22124.1| putative At5g37260-like protein [Solanum peruvianum]
 gb|ABW22125.1| putative At5g37260-like protein [Solanum peruvianum]
 gb|ABW22126.1| putative At5g37260-like protein [Solanum peruvianum]
 gb|ABW22131.1| putative At5g37260-like protein [Solanum peruvianum]
Length=446

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 173/385 (45%), Positives = 221/385 (57%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPRSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  +KN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>ref|XP_006350462.1| PREDICTED: uncharacterized protein LOC102602066 [Solanum tuberosum]
Length=476

 Score =   212 bits (539),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 180/402 (45%), Positives = 226/402 (56%), Gaps = 77/402 (19%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  74    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  133

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+V TP+   G L  EK  RS SP+L +SE EN+SPTSVL A  S+      ++  
Sbjct  134   PYPRKMV-TPLK-SGTLASEKLNRSGSPDLYLSEPENQSPTSVLSAFGSDAFGTVDSTKP  191

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  + +VEE+ SS      S  P N     LEL P D+ 
Sbjct  192   SEQSSPVSSAVAENSGDLVLSEPSDFIVEESRSSPARAYTSSNPANQTCVKLELFPEDND  251

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSS-------------PTSRDL-KAPMATHS  622
              V+    E+S+ Q LKLFGKTVLV+ ++  SS             P SR L ++      
Sbjct  252   FVKEGSDEASSTQCLKLFGKTVLVTDTYMPSSTSGQISLTDENDEPASRTLPRSTFPAKY  311

Query  623   FSWNLSIGHGDYSECKPVPS--------------------LPWALPRAPSSSAGFPCVQV  742
               W+       +S   P PS                    LPW       SSA   C QV
Sbjct  312   LHWDSECPRSTFSIVPPTPSYYFPTPNVSPGTNQSDSTPLLPWG------SSAAVRCTQV  365

Query  743   HSPVAIKARPFSFDSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGS  922
             H+P+ +K RP  F+ +D +E KE  KEGSST SN+ SV+  +  DKNL+ E QS + +  
Sbjct  366   HNPIPMKGRPL-FNDRD-LEGKETQKEGSSTGSNTESVDAELSGDKNLEIEAQSSRNLVE  423

Query  923   DS----SCFKRTTEIVILEQKTARSTKRTKGFMPYKRCLAER  1036
             +S    S F+R           A STKR KGF+PYKRCLAER
Sbjct  424   ESVRGGSLFER----------RANSTKRVKGFVPYKRCLAER  455



>ref|XP_004231624.1| PREDICTED: protein REVEILLE 1 [Solanum lycopersicum]
Length=464

 Score =   211 bits (538),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 171/380 (45%), Positives = 220/380 (58%), Gaps = 45/380 (12%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  74    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  133

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  134   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  191

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  192   SEQSSPVSSAVAENSGDLVLSEPFDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  251

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  252   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  309

Query  662   ECKPVPSLPWALPRAPS---------------SSAGFPCVQVHSPVAIKARPFSFDSKDN  796
                P PS  +  P   S               SS   PC QVHSP+ +K RP   D    
Sbjct  310   IVPPTPSYYFTTPNGSSGPNQSGVATTHLPWGSSCAVPCTQVHSPIPMKGRPLFNDRY--  367

Query  797   VEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVILEQKT  976
             +E KE  KEGSST SN+ SV+  +  +KN++ E QS + +  +S        +  L ++ 
Sbjct  368   LEGKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNVVEESV----RASVPSLFERR  423

Query  977   ARSTKRTKGFMPYKRCLAER  1036
             A STKR KGF+PYKRCLAER
Sbjct  424   ANSTKRVKGFVPYKRCLAER  443



>gb|ABW22157.1| putative At5g37260-like protein [Solanum chilense]
Length=446

 Score =   211 bits (536),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 172/385 (45%), Positives = 220/385 (57%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFDTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEAFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
               +    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FAKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  +KN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|ABW22165.1| putative At5g37260-like protein [Solanum chilense]
Length=446

 Score =   211 bits (536),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 172/385 (45%), Positives = 220/385 (57%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEAFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
               +    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FAKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  +KN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|ABW22178.1| putative At5g37260-like protein [Solanum chilense]
 gb|ABW22187.1| putative At5g37260-like protein [Solanum chilense]
Length=446

 Score =   211 bits (536),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 171/379 (45%), Positives = 221/379 (58%), Gaps = 44/379 (12%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHV TKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVATKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  + +VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAEISGDLVLSEPFDFVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPSLPWALPRAP--------------SSSAGFPCVQVHSPVAIKARPFSFDSKDNV  799
                P PS  +  P A                SS   PC QVHSP+ +K RP  F+ +D +
Sbjct  293   IVPPTPSYYFPSPNASPGPNQSGAATHLPWGSSCAVPCTQVHSPIPMKGRPL-FNDRD-L  350

Query  800   EEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVILEQKTA  979
             E KE  KEGSST SN+ SV+  +  +KN++ E QS + +  +S        +  L ++ A
Sbjct  351   EGKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNVVEESV----RASVPSLFERRA  406

Query  980   RSTKRTKGFMPYKRCLAER  1036
              STKR KGF+PYKRCLAER
Sbjct  407   NSTKRVKGFVPYKRCLAER  425



>gb|ADV29610.1| At5g37260-like protein [Solanum arcanum]
Length=446

 Score =   211 bits (536),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 173/385 (45%), Positives = 222/385 (58%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLALEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPSDLVVEESRSSPARTYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPRSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             +  D +E KE  KEGSST SN+ SV+  +  +KN++ E QS + +  +S        +  
Sbjct  346   NDID-MEGKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|ABW22148.1| putative At5g37260-like protein [Solanum peruvianum]
Length=446

 Score =   211 bits (536),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 173/385 (45%), Positives = 221/385 (57%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +P P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENCGDLVLSEPFDFAVEESRSSPARAYATPNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P  S                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTRSYYFPSPNGSPGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  +KN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|ABW22156.1| putative At5g37260-like protein [Solanum chilense]
Length=446

 Score =   210 bits (535),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 172/385 (45%), Positives = 221/385 (57%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHV TKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVATKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  + +VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAEISGDLVLSEPFDFVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPSPNGSPGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  +KN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEVKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|ABW22144.1| putative At5g37260-like protein [Solanum peruvianum]
Length=446

 Score =   210 bits (535),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 173/385 (45%), Positives = 221/385 (57%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV R+S+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRDSSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-GGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVRES----STAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+ES    S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKESSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPRSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  +KN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|ABW22184.1| putative At5g37260-like protein [Solanum chilense]
Length=446

 Score =   210 bits (535),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 172/385 (45%), Positives = 219/385 (57%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHV TKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVATKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEAFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
               +    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FAKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  DKN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGDKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|ABW22179.1| putative At5g37260-like protein [Solanum chilense]
Length=446

 Score =   210 bits (535),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 172/385 (45%), Positives = 221/385 (57%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVG KTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGAKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  + +VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSDVAENSGDLVLSEPFDFVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPRSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPSPNGSPGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  +KN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|ABW22177.1| putative At5g37260-like protein [Solanum chilense]
 gb|ABW22185.1| putative At5g37260-like protein [Solanum chilense]
Length=446

 Score =   210 bits (534),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 172/385 (45%), Positives = 220/385 (57%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHV TKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVATKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEAFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLIRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPSPNGSPGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  +KN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|ABW22159.1| putative At5g37260-like protein [Solanum chilense]
Length=446

 Score =   210 bits (534),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 172/385 (45%), Positives = 220/385 (57%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHV TKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVATKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  +KN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|AAX44369.1| putative At5g37260 [Solanum pimpinellifolium]
 gb|AAX44370.1| putative At5g37260 [Solanum pimpinellifolium]
 gb|AAX44371.1| putative At5g37260 [Solanum pimpinellifolium]
 gb|AAX44372.1| putative At5g37260 [Solanum pimpinellifolium]
 gb|AAX44373.1| putative At5g37260 [Solanum pimpinellifolium]
 gb|AAX44375.1| putative At5g37260 [Solanum pimpinellifolium]
 gb|AAX44376.1| putative At5g37260 [Solanum pimpinellifolium]
 gb|AAX44377.1| putative At5g37260 [Solanum pimpinellifolium]
Length=447

 Score =   210 bits (534),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 172/386 (45%), Positives = 220/386 (57%), Gaps = 57/386 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS---------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFS  778
                P PS                     LPW       SS   PC QVHSP+ +K RP  
Sbjct  293   IVPPTPSYYFTTPNGSPGPNQSGVATTHLPWG------SSCAVPCTQVHSPIPMKGRPLF  346

Query  779   FDSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIV  958
              D    +E KE  KEGSST SN+ SV+  +  +KN++ E QS + +  +S        + 
Sbjct  347   NDRY--LEGKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNVVEESV----RASVP  400

Query  959   ILEQKTARSTKRTKGFMPYKRCLAER  1036
              L ++ A STKR KGF+PYKRCLAER
Sbjct  401   SLFERRANSTKRVKGFVPYKRCLAER  426



>gb|AAX44336.1| putative At5g37260 [Solanum peruvianum]
Length=446

 Score =   210 bits (534),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 173/385 (45%), Positives = 220/385 (57%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPRSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P  S                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTASYYFPTPNGSPGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  DKN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKEAQKEGSSTGSNAESVDAELSGDKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|ABW22158.1| putative At5g37260-like protein [Solanum chilense]
Length=446

 Score =   210 bits (534),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 174/385 (45%), Positives = 223/385 (58%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  + +VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAEISGDLVLSEPFDFVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPRPSYYFPSPNGSPGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSS+ SN+ SV+  +  +KNL+ E QS + +  +S    R +   +
Sbjct  346   NDRD-LEGKETQKEGSSSGSNAESVDAELSGEKNLEIEAQSSRNVVEESV---RASVPSL  401

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
              E + A STKR KGF+PYKRCLAER
Sbjct  402   FEGR-ANSTKRVKGFVPYKRCLAER  425



>gb|ABW22142.1| putative At5g37260-like protein [Solanum peruvianum]
Length=446

 Score =   210 bits (534),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 172/385 (45%), Positives = 221/385 (57%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV R+S+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRDSSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-GGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECTRSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPAPSYYFTTPNGSPGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  +KN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|AAX44342.1| putative At5g37260 [Solanum peruvianum]
Length=446

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 173/385 (45%), Positives = 220/385 (57%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G +  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-NGTMASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      S    N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFAVEESRSSPARAYASSNQANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPRSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  DKN++ E QS + +  +S        +  
Sbjct  346   NDRD-MEGKETQKEGSSTGSNAESVDAELSGDKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|ABW22136.1| putative At5g37260-like protein [Solanum peruvianum]
Length=446

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 172/385 (45%), Positives = 221/385 (57%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV R+S+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRDSSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-GGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPRSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  +KN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|ABW22150.1| putative At5g37260-like protein [Solanum peruvianum]
Length=446

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 172/381 (45%), Positives = 221/381 (58%), Gaps = 48/381 (13%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
               +    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FAKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPRSTFS  292

Query  662   ECKPVPSLPWA----------------LPRAPSSSAGFPCVQVHSPVAIKARPFSFDSKD  793
                P PS  +                 LPR   SS   PC QVHSP+ +K RP  F+ +D
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPRG--SSCAVPCTQVHSPIPMKGRPL-FNDRD  349

Query  794   NVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVILEQK  973
              +E KE  KEGSST SN+ SV+  +  +KN++ E QS + +  +S        +  L ++
Sbjct  350   -LEGKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNVVEESV----RASVPSLFER  404

Query  974   TARSTKRTKGFMPYKRCLAER  1036
              A STKR KGF+PYKRCLAER
Sbjct  405   RANSTKRVKGFVPYKRCLAER  425



>gb|ABW22170.1| putative At5g37260-like protein [Solanum chilense]
Length=446

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 219/385 (57%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAIAENSGDLVLSEAFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
               +    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FAKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPSPNGSPGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  +KN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCL ER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLGER  425



>gb|AEO52891.1| hypothetical protein, partial [Solanum peruvianum]
 gb|AEO52892.1| hypothetical protein, partial [Solanum peruvianum]
Length=445

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 172/385 (45%), Positives = 219/385 (57%), Gaps = 57/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPRSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  +KN++ E QS + +            +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNV-----VEAVRASVPS  399

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  400   LFERRANSTKRVKGFVPYKRCLAER  424



>gb|AEO52888.1| hypothetical protein, partial [Solanum peruvianum]
Length=445

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 172/385 (45%), Positives = 219/385 (57%), Gaps = 57/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPRSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  +KN++ E QS + +            +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNV-----VEAVRASVPS  399

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  400   LFERRANSTKRVKGFVPYKRCLAER  424



>gb|ABW22129.1| putative At5g37260-like protein [Solanum peruvianum]
Length=446

 Score =   208 bits (529),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 220/385 (57%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHV TKTAVQIRSHAQKFFSKV R+S+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVATKTAVQIRSHAQKFFSKVVRDSSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPRSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  +KN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|AEO52894.1| hypothetical protein, partial [Solanum peruvianum]
Length=445

 Score =   207 bits (528),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 172/385 (45%), Positives = 218/385 (57%), Gaps = 57/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENYGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECTRSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPAPSYYFTTPNGSPGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  +KN+  E QS + +            +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGEKNMKIEAQSSRNV-----VEAVRASVPS  399

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  400   LFERRANSTKRVKGFVPYKRCLAER  424



>gb|AEO52898.1| hypothetical protein, partial [Solanum peruvianum]
Length=445

 Score =   207 bits (527),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 219/385 (57%), Gaps = 57/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV R+S+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRDSSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-GGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECTRSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPAPSYYFTTPNGSPGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  +KN++ E QS + +            +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNV-----VEAVRASVPS  399

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  400   LFERRANSTKRVKGFVPYKRCLAER  424



>gb|ABW22130.1| putative At5g37260-like protein [Solanum peruvianum]
Length=446

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 220/385 (57%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHV TKTAVQIRSHAQKFFSKV R+S+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVATKTAVQIRSHAQKFFSKVVRDSSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPRSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  +KN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNVVEESV----RAGVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|AAX44374.1| putative At5g37260 [Solanum pimpinellifolium]
 gb|AAX44378.1| putative At5g37260 [Solanum pimpinellifolium]
Length=447

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 171/386 (44%), Positives = 220/386 (57%), Gaps = 57/386 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHT-LSSPTSRDLKAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H  L+  T    ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHMPLTDETL--TRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS---------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFS  778
                P PS                     LPW       SS   PC QVHSP+ +K RP  
Sbjct  293   IVPPTPSYYFTTPNGSPGPNQSGVATTHLPWG------SSCAVPCTQVHSPIPMKGRPLF  346

Query  779   FDSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIV  958
              D    +E KE  KEGSST SN+ SV+  +  +KN++ E QS + +  +S        + 
Sbjct  347   NDRY--LEGKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNVVEESV----RASVP  400

Query  959   ILEQKTARSTKRTKGFMPYKRCLAER  1036
              L ++ A STKR KGF+PYKRCLAER
Sbjct  401   SLFERRANSTKRVKGFVPYKRCLAER  426



>gb|AEO52890.1| hypothetical protein, partial [Solanum peruvianum]
 gb|AEO52899.1| hypothetical protein, partial [Solanum peruvianum]
Length=445

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 218/385 (57%), Gaps = 57/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHV TKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVATKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPRSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  +KN++ E QS + +            +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNV-----VEAVRASVPS  399

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  400   LFERRANSTKRVKGFVPYKRCLAER  424



>gb|AEO52901.1| hypothetical protein, partial [Solanum peruvianum]
Length=445

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 172/385 (45%), Positives = 217/385 (56%), Gaps = 57/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      +   
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSNLGSDAFGTVDSPKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPLSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPRSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P  S                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTASYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  DKN++ E QS + +            +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGDKNMEIEAQSSRNV-----VEAVRASVPS  399

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  400   LFERRANSTKRVKGFVPYKRCLAER  424



>gb|ABW22146.1| putative At5g37260-like protein [Solanum peruvianum]
Length=446

 Score =   205 bits (522),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 219/385 (57%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P  + 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEGND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P  S                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTRSYYFPSPNGSPGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  +KN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|AAX44333.1| putative At5g37260 [Solanum peruvianum]
 gb|AAX44334.1| putative At5g37260 [Solanum peruvianum]
 gb|AAX44335.1| putative At5g37260 [Solanum peruvianum]
 gb|AAX44339.1| putative At5g37260 [Solanum peruvianum]
Length=443

 Score =   204 bits (520),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 172/385 (45%), Positives = 221/385 (57%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLALEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPSDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPRSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSAGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+      + L+ E QS + +  +S   +    +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDA-----EYLEIEAQSSRNVVEES--VRVRASVPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|AEO52897.1| hypothetical protein, partial [Solanum peruvianum]
Length=446

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 170/386 (44%), Positives = 214/386 (55%), Gaps = 58/386 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG-----Qasa  346
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+          
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  347   dsspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDD  493
                 +   S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+
Sbjct  175   SEQSSPVSSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEDN  234

Query  494   GRVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDY  658
               V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +
Sbjct  235   DFVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPRSTF  292

Query  659   SECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFS  778
             S   P PS                    LPW       SS   PC QVHSP+ +K RP  
Sbjct  293   SIVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-  345

Query  779   FDSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIV  958
             F+ +D +E KE  KEGSST SN+ SV+  +  +KN++ E QS + +            + 
Sbjct  346   FNDRD-LEGKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNV-----VEAVRASVP  399

Query  959   ILEQKTARSTKRTKGFMPYKRCLAER  1036
              L ++ A S KR KGF+PYKRCLAER
Sbjct  400   SLFERRANSMKRVKGFVPYKRCLAER  425



>gb|ABW22154.1| putative At5g37260-like protein [Solanum peruvianum]
Length=446

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 219/385 (57%), Gaps = 56/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMP-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P  + 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEGND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P  S                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTRSYYFPSPNGSPGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+  +  +KN++ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDAELSGEKNMEIEAQSSRNVVEESV----RASVPS  400

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  401   LFERRANSTKRVKGFVPYKRCLAER  425



>gb|AAX44340.1| putative At5g37260 [Solanum peruvianum]
Length=441

 Score =   203 bits (516),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 172/385 (45%), Positives = 220/385 (57%), Gaps = 61/385 (16%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLALEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPRSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+      + L+ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDA-----EYLEIEAQSSRNVVEESV----RASVPS  395

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  396   LFERRANSTKRVKGFVPYKRCLAER  420



>gb|AEO52895.1| hypothetical protein, partial [Solanum peruvianum]
 gb|AEO52896.1| hypothetical protein, partial [Solanum peruvianum]
Length=442

 Score =   203 bits (516),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 219/385 (57%), Gaps = 60/385 (16%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLALEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPSDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPRSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSAGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E KE  KEGSST SN+ SV+      + L+ E QS + +       +    +  
Sbjct  346   NDRD-LEGKETQKEGSSTGSNAESVDA-----EYLEIEAQSSRNV---VEAVRVRASVPS  396

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  397   LFERRANSTKRVKGFVPYKRCLAER  421



>gb|ADV29630.1| At5g37260-like protein [Solanum arcanum]
 gb|ADV29636.1| At5g37260-like protein [Solanum arcanum]
 gb|ADV29638.1| At5g37260-like protein [Solanum arcanum]
Length=443

 Score =   202 bits (515),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 219/385 (57%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G +L S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLLLSEPFDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGAATNLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K + KEGSST SN+ SV+      + L+ E QS   +  +    +    +  
Sbjct  346   NDRD-LEGKGNQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASVPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|ABW22133.1| putative At5g37260-like protein [Solanum peruvianum]
 gb|ABW22141.1| putative At5g37260-like protein [Solanum peruvianum]
Length=443

 Score =   202 bits (515),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 171/381 (45%), Positives = 220/381 (58%), Gaps = 51/381 (13%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSCSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  + +VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPSLPWA----------------LPRAPSSSAGFPCVQVHSPVAIKARPFSFDSKD  793
                P PS  +                 LPR   SS   PC QVHSP+ +K RP  F+ +D
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPRG--SSCAVPCTQVHSPIPMKGRPL-FNDRD  349

Query  794   NVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVILEQK  973
              +E K   KEGSST SN+ SV+      + L+ E QS + +  +S   +    +  L ++
Sbjct  350   -LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSRNVVEES--VRVRASVPSLFER  401

Query  974   TARSTKRTKGFMPYKRCLAER  1036
              A STKR KGF+PYKRCLAER
Sbjct  402   RANSTKRVKGFVPYKRCLAER  422



>gb|ADV29618.1| At5g37260-like protein [Solanum arcanum]
Length=443

 Score =   202 bits (514),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 219/385 (57%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G +L S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLLLSEPFDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K + KEGSST SN+ SV+      + L+ E QS   +  +    +    +  
Sbjct  346   NDRD-LEGKGNQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASVPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|ADV29620.1| At5g37260-like protein [Solanum arcanum]
 gb|ADV29624.1| At5g37260-like protein [Solanum arcanum]
Length=443

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 218/385 (57%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G +L S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLLLSEPFDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    +  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASVPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|ADV29635.1| At5g37260-like protein [Solanum arcanum]
Length=443

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 219/385 (57%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAIAENSGDLVLSEPFDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K + KEGSST SN+ SV+      + L+ E QS   +  +    +    +  
Sbjct  346   NDRD-LEGKGNQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASVPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|ADV29634.1| At5g37260-like protein [Solanum arcanum]
Length=443

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 219/385 (57%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAIAENSGDLVLSEPFDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGAATNLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K + KEGSST SN+ SV+      + L+ E QS   +  +    +    +  
Sbjct  346   NDRD-LEGKGNQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASVPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|ADV29626.1| At5g37260-like protein [Solanum arcanum]
Length=443

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 219/385 (57%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAIAENSGDLVLSEPFDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K + KEGSST SN+ SV+      + L+ E QS   +  +    +    +  
Sbjct  346   NDRD-LEGKGNQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASVPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|ABW22147.1| putative At5g37260-like protein [Solanum peruvianum]
Length=443

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 170/381 (45%), Positives = 218/381 (57%), Gaps = 51/381 (13%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPRSTFS  292

Query  662   ECKPVPSLPWA----------------LPRAPSSSAGFPCVQVHSPVAIKARPFSFDSKD  793
                P PS  +                 LPR   SS   PC QVHSP+ +K RP  +D   
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPRG--SSCAVPCTQVHSPIPMKGRPLFYDR--  348

Query  794   NVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVILEQK  973
             ++E K   KEGSST SN+ SV+      + L+ E QS + +  +S   +    +  L ++
Sbjct  349   DLEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSRNVVEES--VRVRASVPSLFER  401

Query  974   TARSTKRTKGFMPYKRCLAER  1036
              A STKR KGF+PYKRCLAER
Sbjct  402   RANSTKRVKGFVPYKRCLAER  422



>gb|ADV29651.1| At5g37260-like protein [Solanum arcanum]
Length=443

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 219/385 (57%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-GGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K + KEGSST SN+ SV+      + L+ E QS   +  +    +    +  
Sbjct  346   NDRD-LEGKGNQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASVPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|ABW22132.1| putative At5g37260-like protein [Solanum peruvianum]
Length=443

 Score =   200 bits (509),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 171/381 (45%), Positives = 219/381 (57%), Gaps = 51/381 (13%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPSLPWA----------------LPRAPSSSAGFPCVQVHSPVAIKARPFSFDSKD  793
                P PS  +                 LPR   SS   PC QVHSP+ +K RP  F+ +D
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPRG--SSCAVPCTQVHSPIPMKGRPL-FNDRD  349

Query  794   NVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVILEQK  973
              +E K   KEGSST SN+ SV+      + L+ E QS + +  +S   +    +  L ++
Sbjct  350   -LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSRNVVEES--VRVRASVPSLFER  401

Query  974   TARSTKRTKGFMPYKRCLAER  1036
              A STKR KGF+PYKRCLAER
Sbjct  402   RANSTKRVKGFVPYKRCLAER  422



>gb|ABW22128.1| putative At5g37260-like protein [Solanum peruvianum]
 gb|ABW22134.1| putative At5g37260-like protein [Solanum peruvianum]
Length=443

 Score =   200 bits (509),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 171/381 (45%), Positives = 219/381 (57%), Gaps = 51/381 (13%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTEETLTRSSFPAKYLPWDSECPRSTFS  292

Query  662   ECKPVPSLPWA----------------LPRAPSSSAGFPCVQVHSPVAIKARPFSFDSKD  793
                P PS  +                 LPR   SS   PC QVHSP+ +K RP  F+ +D
Sbjct  293   IVPPTPSYYFPTPNGSLGPNQSGVATHLPRG--SSCAVPCTQVHSPIPMKGRPL-FNDRD  349

Query  794   NVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVILEQK  973
              +E K   KEGSST SN+ SV+      + L+ E QS + +  +S   +    +  L ++
Sbjct  350   -LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSRNVVEES--VRVRASVPSLFER  401

Query  974   TARSTKRTKGFMPYKRCLAER  1036
              A STKR KGF+PYKRCLAER
Sbjct  402   RANSTKRVKGFVPYKRCLAER  422



>gb|ADV29645.1| At5g37260-like protein [Solanum arcanum]
Length=443

 Score =   200 bits (508),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 219/385 (57%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSALAENSGDLVLSEPFDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGAATNLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    + +  +  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEELVTVRAS--VPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|ABW22127.1| putative At5g37260-like protein [Solanum peruvianum]
 gb|ABW22135.1| putative At5g37260-like protein [Solanum peruvianum]
 gb|ABW22139.1| putative At5g37260-like protein [Solanum peruvianum]
Length=443

 Score =   200 bits (508),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 171/381 (45%), Positives = 219/381 (57%), Gaps = 51/381 (13%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTEETLTRSSFPAKYLPWDSECPRSTFS  292

Query  662   ECKPVPSLPWA----------------LPRAPSSSAGFPCVQVHSPVAIKARPFSFDSKD  793
                P PS  +                 LPR   SS   PC QVHSP+ +K RP  F+ +D
Sbjct  293   IVPPTPSYYFPTPNGSLGPNQSGVATHLPRG--SSCAVPCTQVHSPIPMKGRPL-FNDRD  349

Query  794   NVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVILEQK  973
              +E K   KEGSST SN+ SV+      + L+ E QS + +  +S   +    +  L ++
Sbjct  350   -LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSRNVVEES--VRVRASVPSLFER  401

Query  974   TARSTKRTKGFMPYKRCLAER  1036
              A STKR KGF+PYKRCLAER
Sbjct  402   RANSTKRVKGFVPYKRCLAER  422



>gb|ADV29646.1| At5g37260-like protein [Solanum arcanum]
 gb|ADV29648.1| At5g37260-like protein [Solanum arcanum]
 gb|ADV29649.1| At5g37260-like protein [Solanum arcanum]
 gb|ADV29650.1| At5g37260-like protein [Solanum arcanum]
Length=443

 Score =   200 bits (508),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 218/385 (57%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSALAENSGDLVLSEPFDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGAATNLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    +  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASVPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|ADV29622.1| At5g37260-like protein [Solanum arcanum]
Length=443

 Score =   200 bits (508),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 218/385 (57%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGAATNLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    +  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASVPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|ADV29631.1| At5g37260-like protein [Solanum arcanum]
Length=443

 Score =   200 bits (508),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 218/385 (57%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    +  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASVPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|ADV29619.1| At5g37260-like protein [Solanum arcanum]
 gb|ADV29621.1| At5g37260-like protein [Solanum arcanum]
Length=443

 Score =   200 bits (508),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 218/385 (57%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFTTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    +  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASVPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|ADV29628.1| At5g37260-like protein [Solanum arcanum]
Length=443

 Score =   200 bits (508),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 218/385 (57%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAIAENSGDLVLSEPFDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    +  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASVPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|ADV29608.1| At5g37260-like protein [Solanum arcanum]
 gb|ADV29613.1| At5g37260-like protein [Solanum arcanum]
Length=443

 Score =   200 bits (508),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 168/379 (44%), Positives = 218/379 (58%), Gaps = 47/379 (12%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPSLPWALPRAP--------------SSSAGFPCVQVHSPVAIKARPFSFDSKDNV  799
                P PS  +  P                  SS   PC QVHSP+ +K RP  F+ +D +
Sbjct  293   IVPPTPSYYFTTPNGSPGPNQSGVATHLLWGSSCAVPCTQVHSPIPMKGRPL-FNDRD-L  350

Query  800   EEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVILEQKTA  979
             E K + KEGSST SN+ SV+      + L+ E QS   +  +    +    +  L ++ A
Sbjct  351   EGKGNQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASVPSLFERRA  403

Query  980   RSTKRTKGFMPYKRCLAER  1036
              STKR KGF+PYKRCLAER
Sbjct  404   SSTKRVKGFVPYKRCLAER  422



>gb|ADV29629.1| At5g37260-like protein [Solanum arcanum]
Length=443

 Score =   200 bits (508),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 218/385 (57%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+  +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDRCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G +L S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLLLSEPFDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K + KEGSST SN+ SV+      + L+ E QS   +  +    +    +  
Sbjct  346   NDRD-LEGKGNQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASVPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|ADV29616.1| At5g37260-like protein [Solanum arcanum]
Length=443

 Score =   199 bits (507),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 218/385 (57%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDLVVEESRSSPARAYATSTPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPRSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    +  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASVPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|ADV29632.1| At5g37260-like protein [Solanum arcanum]
Length=443

 Score =   199 bits (507),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 218/385 (57%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFTTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    +  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASVPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|ADV29633.1| At5g37260-like protein [Solanum arcanum]
Length=443

 Score =   199 bits (507),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 218/385 (57%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G +L S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLLLSEPFDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    +  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASVPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ + STKR KGF+PYKRCLAER
Sbjct  398   LFERRSNSTKRVKGFVPYKRCLAER  422



>gb|ADV29602.1| At5g37260-like protein [Solanum arcanum]
 gb|ADV29603.1| At5g37260-like protein [Solanum arcanum]
 gb|ADV29604.1| At5g37260-like protein [Solanum arcanum]
 gb|ADV29605.1| At5g37260-like protein [Solanum arcanum]
 gb|ADV29606.1| At5g37260-like protein [Solanum arcanum]
 gb|ADV29609.1| At5g37260-like protein [Solanum arcanum]
Length=443

 Score =   199 bits (507),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 218/385 (57%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTVETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFTTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    +  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASVPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|AAX44359.1| putative At5g37260 [Solanum chmielewskii]
 gb|AAX44360.1| putative At5g37260 [Solanum chmielewskii]
 gb|AAX44361.1| putative At5g37260 [Solanum chmielewskii]
 gb|AAX44362.1| putative At5g37260 [Solanum chmielewskii]
 gb|AAX44363.1| putative At5g37260 [Solanum chmielewskii]
 gb|AAX44364.1| putative At5g37260 [Solanum chmielewskii]
 gb|AAX44365.1| putative At5g37260 [Solanum chmielewskii]
 gb|AAX44366.1| putative At5g37260 [Solanum chmielewskii]
 gb|AAX44367.1| putative At5g37260 [Solanum chmielewskii]
 gb|AAX44368.1| putative At5g37260 [Solanum chmielewskii]
Length=443

 Score =   199 bits (507),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 218/385 (57%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPRSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQCGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    +  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASVPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|AEO52798.1| hypothetical protein, partial [Solanum chilense]
Length=443

 Score =   199 bits (507),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 216/385 (56%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEAFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    I  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASIPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|ADV29623.1| At5g37260-like protein [Solanum arcanum]
Length=443

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 217/385 (56%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    +  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASVPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L  + A STKR KGF+PYKRCLAER
Sbjct  398   LFDRRANSTKRVKGFVPYKRCLAER  422



>gb|ADV29642.1| At5g37260-like protein [Solanum arcanum]
Length=443

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 169/385 (44%), Positives = 218/385 (57%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSALAENSGDLVLSEPFDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ + LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTECLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW L      S   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGAATHLPWGL------SCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    +  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASVPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|ABW22167.1| putative At5g37260-like protein [Solanum chilense]
Length=441

 Score =   198 bits (504),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 216/385 (56%), Gaps = 61/385 (16%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEAFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
               +    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FAKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSRNVVEESV----RASVPS  395

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  396   LFERRANSTKRVKGFVPYKRCLAER  420



>gb|ABW22182.1| putative At5g37260-like protein [Solanum chilense]
Length=439

 Score =   198 bits (504),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 170/381 (45%), Positives = 214/381 (56%), Gaps = 55/381 (14%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHV TKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVATKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+   + DS+  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSELENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  362   aspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDGRVR-  505
             +  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+   + 
Sbjct  175   SEQSSPVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEDNDFAKE  234

Query  506   ---ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYSECKP  673
                E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S   P
Sbjct  235   GSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFSIVPP  292

Query  674   VPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSFDSKD  793
              PS                    LPW       SS   PC QVHSP+ +K RP  F+ +D
Sbjct  293   TPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-FNDRD  345

Query  794   NVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVILEQK  973
              +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    I  L ++
Sbjct  346   -LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASIPSLFEQ  397

Query  974   TARSTKRTKGFMPYKRCLAER  1036
              A STKR KGF+PYKRCLAER
Sbjct  398   RANSTKRVKGFVPYKRCLAER  418



>gb|ABW22174.1| putative At5g37260-like protein [Solanum chilense]
Length=441

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 169/385 (44%), Positives = 216/385 (56%), Gaps = 61/385 (16%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKP+H
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPLH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEAFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
               +    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FAKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSRNVVEESV----RASVPS  395

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  396   LFERRANSTKRVKGFVPYKRCLAER  420



>gb|ADV29625.1| At5g37260-like protein [Solanum arcanum]
 gb|ADV29627.1| At5g37260-like protein [Solanum arcanum]
Length=443

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 169/385 (44%), Positives = 217/385 (56%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    +  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASVPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++   STKR KGF+PYKRCLAER
Sbjct  398   LFERRVNSTKRVKGFVPYKRCLAER  422



>gb|ABW22160.1| putative At5g37260-like protein [Solanum chilense]
Length=443

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 216/385 (56%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +A  G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAANSGDLVLSEAFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
               +    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FAKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    I  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASIPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|ABW22143.1| putative At5g37260-like protein [Solanum peruvianum]
Length=443

 Score =   198 bits (503),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 170/381 (45%), Positives = 218/381 (57%), Gaps = 51/381 (13%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHV TKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVATKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPSLPWA----------------LPRAPSSSAGFPCVQVHSPVAIKARPFSFDSKD  793
                P PS  +                 LPR   SS   PC QVHSP+ +K RP  F+ +D
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPRG--SSCAVPCTQVHSPIPMKGRPL-FNDRD  349

Query  794   NVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVILEQK  973
              +E K   KEGSST SN+ SV+      + L+ E QS + +  +S   +    +  L ++
Sbjct  350   -LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSRNVVEES--VRVRASVPSLFER  401

Query  974   TARSTKRTKGFMPYKRCLAER  1036
              A STKR KGF+PYKRCLAER
Sbjct  402   RANSTKRVKGFVPYKRCLAER  422



>gb|ABW22166.1| putative At5g37260-like protein [Solanum chilense]
Length=443

 Score =   198 bits (503),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 215/385 (56%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSETENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEAFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
               +    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FAKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    I  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASIPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|AAX44343.1| putative At5g37260 [Solanum chilense]
 gb|AAX44345.1| putative At5g37260 [Solanum chilense]
 gb|AAX44347.1| putative At5g37260 [Solanum chilense]
 gb|AAX44349.1| putative At5g37260 [Solanum chilense]
 gb|AAX44350.1| putative At5g37260 [Solanum chilense]
 gb|AAX44351.1| putative At5g37260 [Solanum chilense]
 gb|AAX44352.1| putative At5g37260 [Solanum chilense]
 gb|AEO52803.1| hypothetical protein, partial [Solanum chilense]
Length=443

 Score =   198 bits (503),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 215/385 (56%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEAFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
               +    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FAKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    I  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASIPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|ABW22155.1| putative At5g37260-like protein [Solanum chilense]
 gb|ABW22163.1| putative At5g37260-like protein [Solanum chilense]
Length=443

 Score =   198 bits (503),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 215/385 (56%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEAFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
               +    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FAKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    I  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASIPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|AEO52801.1| hypothetical protein, partial [Solanum chilense]
Length=443

 Score =   198 bits (503),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 215/385 (56%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAIAENSGDLVLSEAFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
               +    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FAKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSSYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    I  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASIPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|ABW22180.1| putative At5g37260-like protein [Solanum chilense]
 gb|ABW22183.1| putative At5g37260-like protein [Solanum chilense]
 gb|ABW22186.1| putative At5g37260-like protein [Solanum chilense]
 gb|ABW22188.1| putative At5g37260-like protein [Solanum chilense]
 gb|ABW22189.1| putative At5g37260-like protein [Solanum chilense]
 gb|ABW22190.1| putative At5g37260-like protein [Solanum chilense]
Length=443

 Score =   198 bits (503),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 215/385 (56%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEAFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
               +    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FAKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    I  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASIPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|ADV29637.1| At5g37260-like protein [Solanum arcanum]
Length=443

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 216/385 (56%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+  +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDRCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G +L S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLLLSEPFDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    +  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASVPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L  + A STKR KGF+PYKRCLAER
Sbjct  398   LFDRRANSTKRVKGFVPYKRCLAER  422



>gb|ABW22169.1| putative At5g37260-like protein [Solanum chilense]
 gb|AEO52799.1| hypothetical protein, partial [Solanum chilense]
Length=443

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 215/385 (56%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAIAENSGDLVLSEAFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
               +    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FAKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSSYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    I  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASIPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|AEO52800.1| hypothetical protein, partial [Solanum chilense]
Length=443

 Score =   197 bits (501),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 215/385 (56%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAIAENSGDLVLSEAFDFAVEESRSSPARAYATLNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
               +    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FAKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSSYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    I  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASIPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|AEO52806.1| hypothetical protein, partial [Solanum chilense]
Length=443

 Score =   197 bits (500),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 169/385 (44%), Positives = 213/385 (55%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+     S  G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMATQLKS--GTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEAFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
               +    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FAKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    I  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASIPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|ABW22123.1| putative At5g37260-like protein [Solanum peruvianum]
Length=443

 Score =   197 bits (500),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 169/385 (44%), Positives = 217/385 (56%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHV TKTAVQIRSHAQKFFSKV R+S+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVATKTAVQIRSHAQKFFSKVVRDSSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPRSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS + +  +S   +    +  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSRNVVEES--VRVRASVPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|ADV29639.1| At5g37260-like protein [Solanum arcanum]
Length=442

 Score =   197 bits (500),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 168/385 (44%), Positives = 214/385 (56%), Gaps = 60/385 (16%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+        G L  EK  RS SP+  +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMATL---KSGTLASEKLNRSGSPDRCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  173

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G +L S+  +++VEE+ SS      +  P N     LEL P D+ 
Sbjct  174   SEQSSPVSSAVAENSGDLLLSEPFDLVVEESRSSPARAYATSNPANQACVKLELFPEDND  233

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  234   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  291

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  292   IVPPTPSYYFPTPNGSPGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  344

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    +  
Sbjct  345   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASVPS  396

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  397   LFERRANSTKRVKGFVPYKRCLAER  421



>gb|ABW22176.1| putative At5g37260-like protein [Solanum chilense]
Length=443

 Score =   196 bits (499),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 169/385 (44%), Positives = 215/385 (56%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA ++K IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSMKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEAFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
               +    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FAKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    I  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASIPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|AEO52802.1| hypothetical protein, partial [Solanum chilense]
 gb|AEO52805.1| hypothetical protein, partial [Solanum chilense]
Length=443

 Score =   196 bits (499),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 214/385 (56%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P DD 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEAFDFAVEESRSSPARAYATSNPANQACVKLELFPEDDD  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
               +    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FAKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P  S                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTQSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    I  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASIPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|AEO52889.1| hypothetical protein, partial [Solanum peruvianum]
Length=442

 Score =   196 bits (499),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 169/381 (44%), Positives = 216/381 (57%), Gaps = 52/381 (14%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHV TKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVATKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPSLPWA----------------LPRAPSSSAGFPCVQVHSPVAIKARPFSFDSKD  793
                P PS  +                 LPR   SS   PC QVHSP+ +K RP  F+ +D
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPRG--SSCAVPCTQVHSPIPMKGRPL-FNDRD  349

Query  794   NVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVILEQK  973
              +E K   KEGSST SN+ SV+      + L+ E QS + +       +    +  L ++
Sbjct  350   -LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSRNV---VEAVRVRASVPSLFER  400

Query  974   TARSTKRTKGFMPYKRCLAER  1036
              A STKR KGF+PYKRCLAER
Sbjct  401   RANSTKRVKGFVPYKRCLAER  421



>gb|ABW22168.1| putative At5g37260-like protein [Solanum chilense]
Length=441

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 169/385 (44%), Positives = 215/385 (56%), Gaps = 61/385 (16%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHV TKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVATKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEAFDFAVEESRSSPARAYATSNPSNQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
               +    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FAKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS + +  +S        +  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSRNVVEESV----RASVPS  395

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  396   LFERRANSTKRVKGFVPYKRCLAER  420



>gb|ABW22181.1| putative At5g37260-like protein [Solanum chilense]
Length=443

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 169/385 (44%), Positives = 214/385 (56%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEAFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
               +    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FAKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P PS                    LPW       SS   PC QVH P+ +K RP  F
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHIPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    I  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASIPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|AEO52893.1| hypothetical protein, partial [Solanum peruvianum]
Length=442

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 168/381 (44%), Positives = 216/381 (57%), Gaps = 52/381 (14%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHV TKTAVQIRSHAQKFFSKV R+S+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVATKTAVQIRSHAQKFFSKVVRDSSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPSLPWA----------------LPRAPSSSAGFPCVQVHSPVAIKARPFSFDSKD  793
                P PS  +                 LPR   SS   PC QVHSP+ +K RP  F+ +D
Sbjct  293   IVPPTPSYYFPTPNGSPGPNQSGVATHLPRG--SSCAVPCTQVHSPIPMKGRPL-FNDRD  349

Query  794   NVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVILEQK  973
              +E K   KEGSST SN+ SV+      + L+ E QS + +       +    +  L ++
Sbjct  350   -LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSRNV---VEAVRVRASVPSLFER  400

Query  974   TARSTKRTKGFMPYKRCLAER  1036
              A STKR KGF+PYKRCLAER
Sbjct  401   RANSTKRVKGFVPYKRCLAER  421



>gb|ABW22173.1| putative At5g37260-like protein [Solanum chilense]
 gb|ABW22175.1| putative At5g37260-like protein [Solanum chilense]
Length=443

 Score =   194 bits (494),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 169/385 (44%), Positives = 214/385 (56%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAIAENSGDLVLSEAFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
               +    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FAKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P  S                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTQSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    I  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASIPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|AAX44344.1| putative At5g37260 [Solanum chilense]
 gb|AAX44346.1| putative At5g37260 [Solanum chilense]
 gb|AAX44348.1| putative At5g37260 [Solanum chilense]
 gb|ABW22164.1| putative At5g37260-like protein [Solanum chilense]
Length=443

 Score =   194 bits (494),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 169/385 (44%), Positives = 214/385 (56%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEAFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
               +    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FAKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P  S                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTQSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    I  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASIPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|AEO52797.1| hypothetical protein, partial [Solanum chilense]
Length=443

 Score =   194 bits (494),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 169/385 (44%), Positives = 214/385 (56%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEAFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
               +    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FAKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P  S                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTQSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    I  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASIPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|AAZ85376.1| putative At5g37260 [Solanum ochranthum]
Length=427

 Score =   194 bits (493),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 171/399 (43%), Positives = 217/399 (54%), Gaps = 74/399 (19%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQ FFSKV RES+ DDA +VK IEIPPPRPKRKPMH
Sbjct  28    LHGRAWRRIEEHVGTKTAVQIRSHAQNFFSKVVRESSNDDASSVKSIEIPPPRPKRKPMH  87

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+     S  G L  EK  RS SP+  +SE EN+SPTSVL AL S+      ++  
Sbjct  88    PYPRKMATPRKS--GTLASEKLKRSGSPDFCLSEPENQSPTSVLSALGSDAFGTVDSTKP  145

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  + +VEE+ SS      S  P N     LEL P D+ 
Sbjct  146   SELSSPVSSAVAENSGDLVLSEPSDFVVEESRSSPARAYASSNPANQACVKLELFPEDND  205

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSS--------------PTSRDL-KAPMATH  619
              V+    E+S+ Q LKLFGKTVLV+ +H  SS              P S+ L ++     
Sbjct  206   FVKEGSDEASSTQCLKLFGKTVLVTDAHMPSSTSGQISLTDENDDEPASQTLPRSSFPAK  265

Query  620   SFSWNLSIGHGDYSECKPVPS--------------------LPWALPRAPSSSAGFPCVQ  739
                W+       +S   P PS                    LPW       SS   PC Q
Sbjct  266   YLLWDSECPRSTFSIVPPSPSYYFPTPNGSPGPNQSGAATHLPWG------SSCAVPCTQ  319

Query  740   VHSPVAIKARPFSFDSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIG  919
             VHSP+ +K  P  F+ ++ +E KE  KEGSST SN+ SV+      + L+ E QS + + 
Sbjct  320   VHSPIPMKGSPL-FNDRE-LEGKETQKEGSSTGSNAESVDA-----EYLEIEAQSSRNVV  372

Query  920   SDSSCFKRTTEIVILEQKTARSTKRTKGFMPYKRCLAER  1036
                        +  L ++ A STKR KGF+PYKRCLAER
Sbjct  373   ESVRA-----SVPSLFERRANSTKRVKGFVPYKRCLAER  406



>gb|ABW22161.1| putative At5g37260-like protein [Solanum chilense]
Length=443

 Score =   194 bits (493),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 169/385 (44%), Positives = 214/385 (56%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEAFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
               +    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FAKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                  PS                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPSTPSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    I  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASIPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|ABW22149.1| putative At5g37260-like protein [Solanum peruvianum]
Length=443

 Score =   194 bits (492),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 169/385 (44%), Positives = 216/385 (56%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P  + 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEPFDFAVEESRSSPARAYATSNPANQACVKLELFPEGND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
              V+    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FVKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P  S                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTRSYYFPSPNGSPGPNQSGAATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS + +  +S   +    +  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSRNVVEES--VRVRASVPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|ABW22162.1| putative At5g37260-like protein [Solanum chilense]
Length=443

 Score =   194 bits (492),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 169/385 (44%), Positives = 214/385 (56%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAIAENSGDLVLSEAFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
               +    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FAKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P  S                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTQSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    I  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPDVVEE--LVRVRASIPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>gb|AEO52900.1| hypothetical protein, partial [Solanum peruvianum]
Length=442

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 169/385 (44%), Positives = 213/385 (55%), Gaps = 60/385 (16%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAIAENSGDLVLSEAFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
               +    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FAKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P  S                    LPW       SS   PC QVHSP+ +K RP  F
Sbjct  293   IVPPTQSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVHSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +       +    I  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNV---LEVVRVRASIPS  396

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  397   LFERRANSTKRVKGFVPYKRCLAER  421



>gb|AEO52804.1| hypothetical protein, partial [Solanum chilense]
Length=443

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 168/385 (44%), Positives = 213/385 (55%), Gaps = 59/385 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES+  DA +VK IEIPPPRPKRKPMH
Sbjct  57    LHGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESSNGDASSVKSIEIPPPRPKRKPMH  116

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRK+  TP+   G L  EK  RS SP+L +SE EN+SPTSVL  L S+      ++  
Sbjct  117   PYPRKMA-TPLK-SGTLASEKLNRSGSPDLCLSEPENQSPTSVLSTLGSDAFGTVDSTKP  174

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDG  496
             S  ++  S   +   G ++ S+  +  VEE+ SS      +  P N     LEL P D+ 
Sbjct  175   SEQSSPVSSAVAENSGDLVLSEAFDFAVEESRSSPARAYATSNPANQACVKLELFPEDND  234

Query  497   RVR----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDL-KAPMATHSFSWNLSIGHGDYS  661
               +    E+S+ Q LKLFGKTVLV+ +H    PT   L ++        W+       +S
Sbjct  235   FAKEGSDEASSTQCLKLFGKTVLVTDAHM--PPTDETLTRSSFPAKYLPWDSECPQSTFS  292

Query  662   ECKPVPS--------------------LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF  781
                P  S                    LPW       SS   PC QV SP+ +K RP  F
Sbjct  293   IVPPTQSYYFPTPNGSPGPNQSGVATHLPWG------SSCAVPCTQVRSPIPMKGRPL-F  345

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             + +D +E K   KEGSST SN+ SV+      + L+ E QS   +  +    +    I  
Sbjct  346   NDRD-LEGKGTQKEGSSTGSNAESVDA-----EYLEIEAQSSPNVVEE--LVRVRASIPS  397

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A STKR KGF+PYKRCLAER
Sbjct  398   LFERRANSTKRVKGFVPYKRCLAER  422



>ref|XP_007215304.1| hypothetical protein PRUPE_ppa005083mg [Prunus persica]
 gb|EMJ16503.1| hypothetical protein PRUPE_ppa005083mg [Prunus persica]
Length=478

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 167/394 (42%), Positives = 217/394 (55%), Gaps = 62/394 (16%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWR+IEEHVGTKTAVQIRSHAQKFFSKV R+SNG +  + +PI+IPPPRPKRKPM 
Sbjct  79    LYGRAWRKIEEHVGTKTAVQIRSHAQKFFSKVARDSNGSNEISEEPIDIPPPRPKRKPMR  138

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFAL--DSEGQasadss  355
             PYPRKLV  PV+    +  E+PTRS SPNLSVSE EN+SPTSVL  +  D+ G A +++ 
Sbjct  139   PYPRKLV-HPVNKETFI-VERPTRSASPNLSVSEPENQSPTSVLSVIGSDTLGSADSNTP  196

Query  356   pnaspscvssaTGGGILF--SKHCNVLVEENGSSSPPPGNLELLPLDD----GRVRESST  517
               +     S+A   G+    S+  N  +EE+GS+S  P  LEL P D+    G   E  +
Sbjct  197   SRSLSPVSSAADVHGVDLNQSEPPNPSLEESGSTS--PAKLELFPTDNVDASGVSSEEVS  254

Query  518   AQYLKLFGKTVLVSGSHTLSSP---TSRDLKA----------------------------  604
             A+ LKLFG+TVLV+ SH  SSP   TS+ L +                            
Sbjct  255   ARSLKLFGRTVLVTDSHRPSSPTLGTSKSLPSDVKEEKPVQISTPCNFTATESASGSVEH  314

Query  605   -----PMATHSFSWNLSIGHGDYSECKPVPSLP---WAL-PRAPSSSAGFPCVQVHSPVA  757
                  P   H   + +   + + +  +P  + P   W L P+ P     FP +  H P A
Sbjct  315   VWDNFPYGVHPGMYFMQFQNQNSNLVEPGSAYPVPWWTLCPKLP-----FPFIPFHKPQA  369

Query  758   IKARPFSFDSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCF  937
             +K     FD     + KE  KEGS T S++GSVN     DK L  ET+  ++  +    F
Sbjct  370   VKEH---FDGNLG-DPKEVEKEGSWTGSDAGSVNDEENGDKCLGIETEGKEQEPNSVLQF  425

Query  938   KRTTEIVILEQKTARST-KRTKGFMPYKRCLAER  1036
             K +      E + + S  K  KGF+PYKRCLAER
Sbjct  426   KASANSAFSELRASPSPGKCRKGFVPYKRCLAER  459



>ref|XP_002267976.2| PREDICTED: protein REVEILLE 1 [Vitis vinifera]
Length=495

 Score =   173 bits (438),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 171/412 (42%), Positives = 211/412 (51%), Gaps = 81/412 (20%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RE++G +  + +PIEIPPPRPKRKP+H
Sbjct  77    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRETSGGNTNSAEPIEIPPPRPKRKPVH  136

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
             PYPRKLV      + +L+P  P RS+SPN S SE+EN+SPTSVL A+ SE   S  S+  
Sbjct  137   PYPRKLVHPLRKGISVLEP--PVRSVSPNFSASEQENQSPTSVLSAVGSETLGSTLSNTQ  194

Query  362   aspscvssaTGG---GILFSKHCNVLVEENGSSSPP------------PGNLELLPLD--  490
                    S+  G     +F    N   EEN S SP             P   EL P +  
Sbjct  195   NGSPSPVSSAAGVNPDRMFLPELNPPTEENASPSPVLTTSSSVPDEPLPMKFELFPQEIF  254

Query  491   --DGRVRESSTAQYLKLFGKTVLVSGSHTLSSPTSRDLKAP------MATHSFSWNLSIG  646
               +  V E+ST + LKLFG+TVLV+ SH  SSPT+   +        M   +  WN +  
Sbjct  255   AKECSVEEAST-RTLKLFGRTVLVTDSHRPSSPTTSKSQPSDINNEGMHVETLPWNSTPT  313

Query  647   HG-------DYSECKPVPS-----------------------LPW-----ALPRAPSSSA  721
                       +S  +P PS                       LPW      +P       
Sbjct  314   ESSPENSSFSWSHLQPQPSGAFYYMHFQKEDSNCVEAGTTAPLPWWTFYGGIP-------  366

Query  722   GFPCVQVHSPVAIKARPFSFDSK-DNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTET  898
               P + +H   +IKA     D+K     +KE  KEGS T SN+GSVN G   D N D ET
Sbjct  367   -IPFLPLHHQDSIKAHE---DTKFAETHDKEIQKEGSWTGSNTGSVNEGGNCDTNWDVET  422

Query  899   QSGQ------RIGSDSSCFKRTTEIVILEQKTARSTKRTKGFMPYKRCLAER  1036
             QS Q         SDS+   + +E     +    + K  KGFMPYKRCLAER
Sbjct  423   QSHQPYLDTMEKESDSAFELKLSERSAFSRGRTNTDKCVKGFMPYKRCLAER  474



>emb|CAN68733.1| hypothetical protein VITISV_012100 [Vitis vinifera]
Length=543

 Score =   172 bits (437),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 171/412 (42%), Positives = 211/412 (51%), Gaps = 81/412 (20%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RE++G +  + +PIEIPPPRPKRKP+H
Sbjct  125   LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRETSGGNTNSAEPIEIPPPRPKRKPVH  184

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
             PYPRKLV      + +L+P  P RS+SPN S SE+EN+SPTSVL A+ SE   S  S+  
Sbjct  185   PYPRKLVHPLRKGISVLEP--PVRSVSPNFSASEQENQSPTSVLSAVGSETLGSTLSNTQ  242

Query  362   aspscvssaTGG---GILFSKHCNVLVEENGSSSPP------------PGNLELLPLD--  490
                    S+  G     +F    N   EEN S SP             P   EL P +  
Sbjct  243   NGSPSPVSSAAGVNPDRMFLPELNPPTEENASPSPVLTTSSSVPDEPLPMKFELFPQEIF  302

Query  491   --DGRVRESSTAQYLKLFGKTVLVSGSHTLSSPTSRDLKAP------MATHSFSWNLSIG  646
               +  V E+ST + LKLFG+TVLV+ SH  SSPT+   +        M   +  WN +  
Sbjct  303   AKECSVEEAST-RTLKLFGRTVLVTDSHRPSSPTTSKSQPSDINNEGMHVETLPWNSTPT  361

Query  647   HG-------DYSECKPVPS-----------------------LPW-----ALPRAPSSSA  721
                       +S  +P PS                       LPW      +P       
Sbjct  362   ESSPENSSFSWSHLQPQPSGAFYYMHFQKEDSNCVEAGTTAPLPWWTFYGGIP-------  414

Query  722   GFPCVQVHSPVAIKARPFSFDSK-DNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTET  898
               P + +H   +IKA     D+K     +KE  KEGS T SN+GSVN G   D N D ET
Sbjct  415   -IPFLPLHHQDSIKAHE---DTKFAETHDKEIQKEGSWTGSNTGSVNEGGNCDTNWDVET  470

Query  899   QSGQ------RIGSDSSCFKRTTEIVILEQKTARSTKRTKGFMPYKRCLAER  1036
             QS Q         SDS+   + +E     +    + K  KGFMPYKRCLAER
Sbjct  471   QSHQPYLDTMEKESDSAFELKLSERSAFSRGRTNTDKCVKGFMPYKRCLAER  522



>gb|KDP35732.1| hypothetical protein JCGZ_10504 [Jatropha curcas]
Length=498

 Score =   171 bits (433),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 166/412 (40%), Positives = 219/412 (53%), Gaps = 88/412 (21%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RE++G +  +V+PIEIPPPRPKRKP+H
Sbjct  87    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVREASGSNTASVEPIEIPPPRPKRKPVH  146

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
             PYPRK+ + PV+    + PE+P RSLSPN S+SE+EN+SPTSVL  + S+   S DS+  
Sbjct  147   PYPRKM-MHPVNKETSV-PEQPLRSLSPNFSISEQENQSPTSVLSVVGSDALGSNDSNIP  204

Query  362   aspscvssaTGGGIL--FSK-HCNVLVEENGSSSPPP-------------GNLELLPLDD  493
                    S   G     FS    N+  E++GS SP P               L L P +D
Sbjct  205   NRSVSPVSFASGSHANDFSTCEPNLTPEDDGSPSPAPPTAVALDDQSPKVQKLNLFPKED  264

Query  494   ----GRVRESSTAQYLKLFGKTVLVSGSHTLSSPTSRDLKAPMATHSFSWNLSIGHGDYS  661
                  R+   ++ + LKLFG+TVLV+G HT SSPT+ + K             +   D +
Sbjct  265   VFPEERLVAETSTRSLKLFGRTVLVTGCHTPSSPTTGNSK-------------LLQSDEN  311

Query  662   ECKPVPSLPW-----------------ALPRAPSSSAGFPCVQVHSPVAIKA--------  766
             E KPV  L W                  LP  P  +  +  +Q  +P +++A        
Sbjct  312   EVKPVQPLSWNFMATELQSGNRDCTWNHLPHGPPGALYYLPLQKENPNSVEAGSTLPWWA  371

Query  767   ----RPFSF--------------DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDT  892
                  PF                 + + +++KE  KEGS T SNSGSVN G  VDKN D 
Sbjct  372   FCGGMPFPIVPFHKQEPAKIHLESNGEEIQDKEIQKEGSWTGSNSGSVNDGENVDKNPDW  431

Query  893   ETQSGQRIGSDSSCFKRTTEIVILE----QKTARSTKRTKGFMPYKRCLAER  1036
             ETQS Q    +   +       +LE    +K   S++  +GF+PYK+ +AER
Sbjct  432   ETQSRQLPREEKEPYP------VLELKPSEKLVSSSRSMRGFVPYKKRIAER  477



>ref|XP_008227906.1| PREDICTED: LOW QUALITY PROTEIN: protein REVEILLE 1 [Prunus mume]
Length=491

 Score =   163 bits (413),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 170/408 (42%), Positives = 214/408 (52%), Gaps = 81/408 (20%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWR+IEEHVGTKTAVQIRSHAQKFFSKV R+SNG +      I+IPPPRPKRKPM 
Sbjct  83    LYGRAWRKIEEHVGTKTAVQIRSHAQKFFSKVARDSNGSNX-----IDIPPPRPKRKPMR  137

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSE----GQasad  349
             PYPRKLV  PV+    +  E+PTRS SPNLSVSE EN+SPTSVL  + S+      ++  
Sbjct  138   PYPRKLV-HPVNKETFI-VERPTRSASPNLSVSEPENQSPTSVLSVIGSDTLGSADSNTP  195

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGSSSPPPG------------NLELLPLDD  493
             S   +  S  +   G  +  S+  N  +EE+GS+SP                LEL P D+
Sbjct  196   SRSLSPVSSAADVHGVDLNHSEPPNPSLEESGSTSPAVAENGSLPNMQLSMKLELFPTDN  255

Query  494   ----GRVRESSTAQYLKLFGKTVLVSGSHTLSSP---TSRDLKAPM--------------  610
                 G   E  +A+ LKLFG+TVLV+ SH  SSP   TS+ L + +              
Sbjct  256   VDASGVSAEEVSARSLKLFGRTVLVTDSHRPSSPTMGTSKSLPSDVKEEKPVQTSTLCNF  315

Query  611   -ATHSFS------WN---LSIGHGDY--------------SECKPVPSLPWAL-PRAPSS  715
              AT S S      W+     +  G Y                  PVP   W+L P+ P  
Sbjct  316   TATESASGSVEHVWDNFPYGVHPGMYFMQFQNQNSNLVESGSAYPVPW--WSLCPKLP--  371

Query  716   SAGFPCVQVHSPVAIKARPFSFDSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTE  895
                FP +  H P A+K     FD     + KE  KEGS T S++GSVN     DK L  E
Sbjct  372   ---FPFIPFHKPQAVKEH---FDGNLG-DPKEVEKEGSWTGSDAGSVNDEESGDKCLGIE  424

Query  896   TQSGQRIGSDSSCFKRTTEIVILEQKTARST-KRTKGFMPYKRCLAER  1036
             T+  ++  +    FK +      E + + S  K  KGF+PYKRCLAER
Sbjct  425   TEGKEQEPNSVLQFKASANSAFSELRASPSPGKCRKGFVPYKRCLAER  472



>emb|CDP01692.1| unnamed protein product [Coffea canephora]
Length=475

 Score =   162 bits (409),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 170/410 (41%), Positives = 206/410 (50%), Gaps = 82/410 (20%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RESN  D+ +VKPIEIPPPRPKRKP+H
Sbjct  63    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESNNGDSGSVKPIEIPPPRPKRKPLH  122

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
             PYPRKL  +  S  G L  EK  +S + N+    + N+SPTSVL A  S+     DSS  
Sbjct  123   PYPRKLSASVKS--GALALEK--QSAAANICSPAEANQSPTSVLSAFGSDAPGVTDSSTP  178

Query  362   aspscvssaTGGGILFSKHCNVLVEENGSSSPP---------------------PGNLEL  478
                    S+  GG         ++ E  + SPP                     P  LEL
Sbjct  179   EGSLSPVSSVIGG-----SSGFVLSEPPNLSPPKPNASPSSSQVNNCSNQDEKLPLKLEL  233

Query  479   LPLDDGRVRES----STAQYLKLFGKTVLVSGSHTLSSPTSRDLKAPMATHS-------F  625
              P D+  V+E     S+ Q LKLFGKTV+V+ S   SSPT    K    +HS        
Sbjct  234   FPEDNCFVKEGSEEVSSTQCLKLFGKTVMVTDSCRPSSPTHLTCKMQPPSHSDGKFAQAL  293

Query  626   SWN---LSIGHGDY---------------------------SECKPVPSLPWALPRAPSS  715
              WN   +    GD                            SE  P  SL W   +    
Sbjct  294   PWNFVPIKYSQGDLERSWGALPFGTHGTLFCLPLGGERSKPSETTPPSSLQWWTYQG---  350

Query  716   SAGFPCVQVHSPVAIKARPFSFDSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTE  895
              A FP V++HSP+ IKA  F  D +D V++ E  K+GSS+ SN+          +NL  E
Sbjct  351   GASFPFVRIHSPIPIKASCFG-DQRD-VQDMEIQKDGSSSDSNAECECAEAESSRNL--E  406

Query  896   TQSGQRIGSD---SSCFKRTTEIVILEQKTARSTKRTKGFMPYKRCLAER  1036
              QS Q + +    +    R  E   LE K A S K TKGF+PYKRCLAER
Sbjct  407   AQSCQFLFAKEERAQASSRPCETSFLELK-AGSGKCTKGFVPYKRCLAER  455



>ref|XP_009609238.1| PREDICTED: protein REVEILLE 1-like isoform X2 [Nicotiana tomentosiformis]
Length=411

 Score =   157 bits (396),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 160/385 (42%), Positives = 206/385 (54%), Gaps = 59/385 (15%)
 Frame = +2

Query  47    KTAVQIRSHAQKFF----------SKVERESNGDDAKTVKPIEIppprpkrkpmhpyprk  196
             ++   +RS +Q+F           S+V RESN  D  +VK IEIPPPRPKRKPMHPYPRK
Sbjct  9     RSEAMLRSFSQRFAAPISHNIYMPSEVVRESNNGDVSSVKSIEIPPPRPKRKPMHPYPRK  68

Query  197   LVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasadsspna  364
             LVI PV   G L PEK  RS SPNL +SE EN+SPTSVL AL S+      +S  S   +
Sbjct  69    LVI-PVKS-GTLAPEKSKRSGSPNLCLSETENQSPTSVLSALGSDAFGTVDSSKPSESPS  126

Query  365   spscvssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDGRVRE-  508
               S   S   G ++ S+  +  +E+  SS      S  P N     LEL P D+  V+E 
Sbjct  127   PVSSAVSENCGDLVLSEQSDFNLEKRRSSPAQAYASSNPDNQACVKLELFPEDNDFVKEG  186

Query  509   ---SSTAQYLKLFGKTVLVSGSHTLSSPTS-----RDLKAPMATHSFSWN----------  634
                +S+   LKLFGKTV V+ S  LSSPTS      D+    A+ + S +          
Sbjct  187   SVEASSTHSLKLFGKTVFVTDSCVLSSPTSGQISLADVNNEPASRTLSQSSFPMKFSPSD  246

Query  635   -------LSIGHGDYSECKPVP--SLPWALPRAPSS--SAGFPCVQVHSPVAIKARPFSF  781
                    +++ H   +   P P  S+P  L    SS  SA F C QVH+P+ +K R F  
Sbjct  247   SECAPSTVTMYHAPAANGSPRPNKSVPCHLLSGESSYVSAAFSCTQVHNPIPMKGRAFFI  306

Query  782   DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVI  961
             D KD+ EEKE  KEGSST SN+ SV+  + VDK +  E QS +   +    F     +  
Sbjct  307   D-KDS-EEKETQKEGSSTGSNTESVSTELSVDKRVGIEAQSSRNREAGRELFSVRASVPS  364

Query  962   LEQKTARSTKRTKGFMPYKRCLAER  1036
             L ++ A S KR KGF+PYKRCLAER
Sbjct  365   LFERRANSAKRVKGFVPYKRCLAER  389



>ref|XP_006384118.1| hypothetical protein POPTR_0004s07270g [Populus trichocarpa]
 gb|ERP61915.1| hypothetical protein POPTR_0004s07270g [Populus trichocarpa]
Length=485

 Score =   156 bits (394),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 171/412 (42%), Positives = 213/412 (52%), Gaps = 89/412 (22%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES G +  +V+PIEIPPPRPKRKPMH
Sbjct  75    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESGGSNTSSVEPIEIPPPRPKRKPMH  134

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
             PYPRKL   P+    +L PEK  RS SPN S+SE+EN+SPTSVL A+ S+   S DS   
Sbjct  135   PYPRKLA-HPLE-KELLIPEKSLRSSSPNFSISEQENQSPTSVLSAVGSDALGSTDSDTP  192

Query  362   aspscvssaTGGGILFSKHCNVLVEENGSSSPPPGNL---ELLP----LD---------D  493
                    S  GG      H +   EE+GS SP   +    E  P    LD         D
Sbjct  193   NHSLSPVSFAGG----VHHADSSPEEDGSPSPATASSVPDEQFPKVEKLDSSPEENVSSD  248

Query  494   GRVRESSTAQYLKLFGKTVLVSGSHTLSSPT------------SRDLKAPMATHSFSWNL  637
               V E ++ + LKLFG+TVLV+  H  SSP                L  P+  ++ +   
Sbjct  249   EPVVEETSTRSLKLFGRTVLVTEWHKPSSPNMGTSKLSTPDAAEEKLVRPLTLNNVAAEF  308

Query  638   SIGHGDYSECKPVPS-------------------------LPW-----ALPRAPSSSAGF  727
                +G+ S   P+P                          LPW     A+P        F
Sbjct  309   PFRNGE-STWSPLPHGSHGALCYKKFQKENSSPAQNDSAPLPWWTLYGAMP--------F  359

Query  728   PCVQVHSPVAIKARPF--SFDSK-DNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTET  898
             PC+  H     K  P   + DSK D V++KE  KE S T SNSG V+ G  VDKN+D ET
Sbjct  360   PCIPFH-----KKEPAIENLDSKGDEVQDKEIPKEVSWTGSNSGLVSEGENVDKNMDAET  414

Query  899   QSGQRIGSDSSCFKRTTEIVILEQKTARSTKRT------KGFMPYKRCLAER  1036
             +S Q+   +        E+  L +K+A S  +       KGF+PYK+ +AER
Sbjct  415   ES-QQFSYEEKELSPIFELK-LTRKSASSGSKVINEKCPKGFVPYKKRIAER  464



>ref|XP_002305260.2| hypothetical protein POPTR_0004s07270g [Populus trichocarpa]
 gb|EEE85771.2| hypothetical protein POPTR_0004s07270g [Populus trichocarpa]
Length=429

 Score =   153 bits (387),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 166/366 (45%), Positives = 202/366 (55%), Gaps = 53/366 (14%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES G +  +V+PIEIPPPRPKRKPMH
Sbjct  75    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESGGSNTSSVEPIEIPPPRPKRKPMH  134

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
             PYPRKL   P+    +L PEK  RS SPN S+SE+EN+SPTSVL A+ S+   S DS   
Sbjct  135   PYPRKLA-HPLE-KELLIPEKSLRSSSPNFSISEQENQSPTSVLSAVGSDALGSTDSDTP  192

Query  362   aspscvssaTGGGILFSKHCNVLVEENGSSSPP----------PGNLELLPLD----DGR  499
                    S  GG      H +   EE+GS SP           P  L+  P +    D  
Sbjct  193   NHSLSPVSFAGG----VHHADSSPEEDGSPSPATASSVPDEQFPKKLDSSPEENVSSDEP  248

Query  500   VRESSTAQYLKLFGKTVLVSGSHTLSSPTSRDLKAPMATHSFSWNLSIGHGDYSECKPVP  679
             V E ++ + LKLFG+TVLV+  H  SSP        M T   S        D +E K V 
Sbjct  249   VVEETSTRSLKLFGRTVLVTEWHKPSSPN-------MGTSKLS------TPDAAEEKLV-  294

Query  680   SLPWALPRAPSSSAGFPCVQVHSPVAIKARPFSFDSK-DNVEEKEDAKEGSSTCSNSGSV  856
               P  L      +A FP     S         + DSK D V++KE  KE S T SNSG V
Sbjct  295   -RPLTLNNV---AAEFPFRNGESTWK------NLDSKGDEVQDKEIPKEVSWTGSNSGLV  344

Query  857   NVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVILEQKTARSTKRT------KGFMPYK  1018
             + G  VDKN+D ET+S Q+   +        E+  L +K+A S  +       KGF+PYK
Sbjct  345   SEGENVDKNMDAETES-QQFSYEEKELSPIFELK-LTRKSASSGSKVINEKCPKGFVPYK  402

Query  1019  RCLAER  1036
             + +AER
Sbjct  403   KRIAER  408



>emb|CBI27347.3| unnamed protein product [Vitis vinifera]
Length=479

 Score =   153 bits (387),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 163/406 (40%), Positives = 205/406 (50%), Gaps = 85/406 (21%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RE++G +  + +PIEIPPPRPKRKP+H
Sbjct  77    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRETSGGNTNSAEPIEIPPPRPKRKPVH  136

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
             PYPRKLV      + +L+P  P RS+SPN S SE+EN+SPTSVL A+ SE   S  S+  
Sbjct  137   PYPRKLVHPLRKGISVLEP--PVRSVSPNFSASEQENQSPTSVLSAVGSETLGSTLSNTQ  194

Query  362   aspscvssaTGG---GILFSKHCNVLVEENGSSSPP------------PGNLELLPLD--  490
                    S+  G     +F    N   EEN S SP             P   EL P +  
Sbjct  195   NGSPSPVSSAAGVNPDRMFLPELNPPTEENASPSPVLTTSSSVPDEPLPMKFELFPQEIF  254

Query  491   --DGRVRESSTAQYLKLFGKTVLVSGSHTLSSPTSRDLKAP------MATHSFSWNLSIG  646
               +  V E+ST + LKLFG+TVLV+ SH  SSPT+   +        M   +  WN +  
Sbjct  255   AKECSVEEAST-RTLKLFGRTVLVTDSHRPSSPTTSKSQPSDINNEGMHVETLPWNSTPT  313

Query  647   HG-------DYSECKPVPS-----------------------LPW-----ALPRAPSSSA  721
                       +S  +P PS                       LPW      +P       
Sbjct  314   ESSPENSSFSWSHLQPQPSGAFYYMHFQKEDSNCVEAGTTAPLPWWTFYGGIP-------  366

Query  722   GFPCVQVHSPVAIKARPFSFDSK-DNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTET  898
               P + +H   +IKA     D+K     +KE  KEGS T SN+GS +        LDT  
Sbjct  367   -IPFLPLHHQDSIKAHE---DTKFAETHDKEIQKEGSWTGSNTGSSH-----QPYLDTME  417

Query  899   QSGQRIGSDSSCFKRTTEIVILEQKTARSTKRTKGFMPYKRCLAER  1036
             +      SDS+   + +E     +    + K  KGFMPYKRCLAER
Sbjct  418   KE-----SDSAFELKLSERSAFSRGRTNTDKCVKGFMPYKRCLAER  458



>ref|XP_011035339.1| PREDICTED: protein REVEILLE 1-like isoform X2 [Populus euphratica]
Length=488

 Score =   152 bits (383),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 167/411 (41%), Positives = 210/411 (51%), Gaps = 87/411 (21%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES   +  +V+ IEIPPPRPKRKPMH
Sbjct  78    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESGDSNTSSVESIEIPPPRPKRKPMH  137

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
             PYPRKL   P+    +L PEK  RS SPN S+SE+EN+SPTSVL A+ S+   S DS   
Sbjct  138   PYPRKLA-HPLE-KELLIPEKSLRSSSPNFSISEQENQSPTSVLSAVGSDALGSTDSDTA  195

Query  362   aspscvssaTGGGILFSKHCNVLVEENGSSSPPPGNL---ELLP----LD---------D  493
                    S  GG      H +   EE+G  SP   +    E  P    LD         +
Sbjct  196   NHSLSPVSFAGG----VHHADSSPEEDGYPSPATASSVPDEQFPKVEKLDSSPKENVSSE  251

Query  494   GRVRESSTAQYLKLFGKTVLVSGSHTLSSPT------------SRDLKAPMATHSFSWNL  637
               V E ++ + LKLFG TVLV+  H  SSP                L  P+  ++ +   
Sbjct  252   EPVVEETSTRSLKLFGWTVLVTECHKPSSPNVGTSKLSTLDTAEEKLVRPLTLNNVAAEF  311

Query  638   SIGHGDYSECKPVP-------------------------SLPW-----ALPRAPSSSAGF  727
                +G+ S   P+P                         +LPW     A+P        F
Sbjct  312   PSRNGE-STWSPLPHGSHGALCYMKFQKENSSPAQNDSATLPWWTFYGAMP--------F  362

Query  728   PCVQVHSPV-AIKARPFSFDSK-DNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQ  901
             PC+  H    AI+    + DSK D V++KE  KE S T S SGSV+ G   DKN+D ET+
Sbjct  363   PCIPFHKKEHAIE----NLDSKGDEVQDKEIPKEVSWTGSTSGSVSEGENGDKNMDAETE  418

Query  902   SGQRIGSDSSCFKRTTEIVILEQKTARS------TKRTKGFMPYKRCLAER  1036
             S Q+   +        E+  L +K+A S       K  KGF+PYK+ +AER
Sbjct  419   S-QQFSYEEKEISPIFELK-LTKKSASSGSEVINEKCPKGFVPYKKRIAER  467



>ref|XP_011035338.1| PREDICTED: protein REVEILLE 1-like isoform X1 [Populus euphratica]
Length=503

 Score =   151 bits (381),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 167/411 (41%), Positives = 210/411 (51%), Gaps = 87/411 (21%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES   +  +V+ IEIPPPRPKRKPMH
Sbjct  93    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESGDSNTSSVESIEIPPPRPKRKPMH  152

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
             PYPRKL   P+    +L PEK  RS SPN S+SE+EN+SPTSVL A+ S+   S DS   
Sbjct  153   PYPRKLA-HPLE-KELLIPEKSLRSSSPNFSISEQENQSPTSVLSAVGSDALGSTDSDTA  210

Query  362   aspscvssaTGGGILFSKHCNVLVEENGSSSPPPGNL---ELLP----LD---------D  493
                    S  GG      H +   EE+G  SP   +    E  P    LD         +
Sbjct  211   NHSLSPVSFAGG----VHHADSSPEEDGYPSPATASSVPDEQFPKVEKLDSSPKENVSSE  266

Query  494   GRVRESSTAQYLKLFGKTVLVSGSHTLSSPT------------SRDLKAPMATHSFSWNL  637
               V E ++ + LKLFG TVLV+  H  SSP                L  P+  ++ +   
Sbjct  267   EPVVEETSTRSLKLFGWTVLVTECHKPSSPNVGTSKLSTLDTAEEKLVRPLTLNNVAAEF  326

Query  638   SIGHGDYSECKPVP-------------------------SLPW-----ALPRAPSSSAGF  727
                +G+ S   P+P                         +LPW     A+P        F
Sbjct  327   PSRNGE-STWSPLPHGSHGALCYMKFQKENSSPAQNDSATLPWWTFYGAMP--------F  377

Query  728   PCVQVHSPV-AIKARPFSFDSK-DNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQ  901
             PC+  H    AI+    + DSK D V++KE  KE S T S SGSV+ G   DKN+D ET+
Sbjct  378   PCIPFHKKEHAIE----NLDSKGDEVQDKEIPKEVSWTGSTSGSVSEGENGDKNMDAETE  433

Query  902   SGQRIGSDSSCFKRTTEIVILEQKTARS------TKRTKGFMPYKRCLAER  1036
             S Q+   +        E+  L +K+A S       K  KGF+PYK+ +AER
Sbjct  434   S-QQFSYEEKEISPIFELK-LTKKSASSGSEVINEKCPKGFVPYKKRIAER  482



>ref|XP_009782663.1| PREDICTED: protein REVEILLE 1-like isoform X2 [Nicotiana sylvestris]
Length=398

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 156/381 (41%), Positives = 199/381 (52%), Gaps = 61/381 (16%)
 Frame = +2

Query  62    IRSHAQKFFS----------KVERESNGDDAKTVKPIEIppprpkrkpmhpyprkLVITP  211
             +RS +Q+F +          +V RESN  D  +VK IEIPPPRPKRKPMHPYPRKL I P
Sbjct  2     LRSFSQRFAAPISHSIYMPFEVVRESNNGDVSSVKSIEIPPPRPKRKPMHPYPRKLAI-P  60

Query  212   VSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasadsspnaspscv  379
             V   G L PE   RS SPNL +SE EN+SPTSVL A  S+      +S  S   +  S  
Sbjct  61    VKS-GTLAPEISKRSASPNLCLSETENQSPTSVLSARGSDAFGTVDSSKPSESPSPVSSA  119

Query  380   ssaTGGGILFSKHCNVLVEENGSS------SPPPGN-----LELLPLDDGRVRE----SS  514
              S   G ++ S+  +  +E+  SS      S  P N     LEL P D+  V+E    +S
Sbjct  120   VSENCGDLVLSEQSDFNLEKRRSSPAQAYASSNPDNQACVKLELFPEDNDFVKEGSVEAS  179

Query  515   TAQYLKLFGKTVLVSGSHTLSSPTS-----RDLKAPMATHSFSWN---LSIGHGDYSECK  670
             +   LKLFGKTV V+ S  LSSPTS      D+    A+ + S N   +     D SEC 
Sbjct  180   STHSLKLFGKTVFVADSCVLSSPTSGQILLADVNDEPASRTLSQNSFPMKFSPSD-SECA  238

Query  671   PVPSLPWALPRAPSS-------------------SAGFPCVQVHSPVAIKARPFSFDSKD  793
             P     +  P A  S                   SA F C QVH+P+ +K R   FD KD
Sbjct  239   PSTVTMYHAPAANGSPRPNKSVSCHLLSWGSSYVSAAFSCTQVHNPIPMKGRAL-FDHKD  297

Query  794   NVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVILEQK  973
             + E++E  KEGSST SN+ SV+  + VDK+L  E Q  +   +    F     +  L ++
Sbjct  298   S-EDQEIQKEGSSTGSNTESVSAELSVDKSLGVEAQISRNQEARRELFSIRASVPSLFER  356

Query  974   TARSTKRTKGFMPYKRCLAER  1036
              A STKR KGF+PYKRCLAER
Sbjct  357   RANSTKRVKGFVPYKRCLAER  377



>ref|XP_009367121.1| PREDICTED: protein REVEILLE 1-like isoform X1 [Pyrus x bretschneideri]
Length=508

 Score =   147 bits (371),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 159/410 (39%), Positives = 205/410 (50%), Gaps = 85/410 (21%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWR+IEEH+GTKTAVQIRSHAQKFFSKV R  NG  A   +PI+IPPPRPK+KPM 
Sbjct  78    LYGRAWRKIEEHIGTKTAVQIRSHAQKFFSKVARYPNGGKAPAEEPIDIPPPRPKKKPMR  137

Query  182   pyprkLV--ITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadss  355
             PYPRKLV  +   + +G    E+PTRS SPNLSVSE+EN+SPTSVL  + S+   S DS+
Sbjct  138   PYPRKLVHPLDKETSIG----EQPTRSRSPNLSVSEQENQSPTSVLSVIGSDALGSTDSN  193

Query  356   pnaspscvssaTGG---GILFSKHCNVLVEENGSSSPPPGN-----------LELLPLDD  493
               +      S+  G     L     N L+EE+GS   P  N           LEL P DD
Sbjct  194   TPSDGLSPDSSAAGVNSENLIHSEPNPLLEESGS---PINNCSLPNEQLTMKLELFPTDD  250

Query  494   ----GRVRESSTAQYLKLFGKTVLVSGSHTLSSPTSRDLKAPMATHSFSWNLSIGHGDYS  661
                 G   + + A+ LKLFG+TVLV+ SH    P+SR      +  S          D  
Sbjct  251   VDASGGSAKEAFARSLKLFGRTVLVTDSHR---PSSRAAGTSQSLPS----------DVQ  297

Query  662   ECKPVP-SLPWALPRAPSSSAGFPCVQVHSPV----AIKARPFSFDSKDNVE--------  802
             E KPV  SLP+      S+S     V  + P      I    F   + D VE        
Sbjct  298   EEKPVQTSLPFNFTDMESASGNAEHVWDNFPYGGHQGIYFMQFQNQNSDAVESGTNAYPV  357

Query  803   -----------------------EKEDAK----EGSSTCSNSGSVNVGICVDKNLDTETQ  901
                                    E  D+K    EGS T S++GS +     DK+ +T+  
Sbjct  358   AWWTICPPFIPFHKQQQQQQPVNEHVDSKKVDGEGSCTGSDAGSASDEENRDKDDETQGD  417

Query  902   SGQRI----GSDSSCFK-RTTEIVILEQKTARSTKRTKGFMPYKRCLAER  1036
               Q++    G  +S  + + +      +  A + K  KGF+PYKRC+AER
Sbjct  418   HYQQVSDKDGEPNSVLQFKASANSAFSKIRASTGKYRKGFVPYKRCMAER  467



>ref|XP_002526589.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF35801.1| DNA binding protein, putative [Ricinus communis]
Length=468

 Score =   147 bits (370),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 166/402 (41%), Positives = 208/402 (52%), Gaps = 78/402 (19%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RE +G     V+PIEIPPPRPKRKPMH
Sbjct  56    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVREGSGSSTSAVEPIEIPPPRPKRKPMH  115

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
             PYPRK+       + +   E+P RS SPN S+SE+EN+SPTSVL A+ S+   S DS+P 
Sbjct  116   PYPRKMAHPLNKELSIT--EQPLRSSSPNFSISEQENQSPTSVLSAVGSDVLGSTDSNPP  173

Query  362   aspscvssaTGGGILFSKHC---NVLVEENGSSSPPPGN-------------LELLPLDD  493
                S   S  GG  L        N   E N S SP P               LEL P ++
Sbjct  174   NCSSSPMSCAGGSHLDDFQICEPNSAPENNESPSPAPATAEAHDEQSLKVQKLELFPEEN  233

Query  494   G----RVRESSTAQYLKLFGKTVLVSGSHTLSSPT-------SRDLK--APMATHSFSWN  634
                   V E ++ + LKLFGKTVLV+  +  SSP        + D K   P+     +  
Sbjct  234   AFAEEGVGEETSTRSLKLFGKTVLVNECNRPSSPANGSPTLDTNDEKPVQPLPWKPMAIE  293

Query  635   LSIGHGDYSECKPVPSLPWA-LPRAPSSSAGFPCVQ---VHSPVAIKARPFSF-------  781
             L +G+G   EC       W+ LP+ P  S  +  +Q    +S     A PF +       
Sbjct  294   LQLGNG---ECN------WSNLPQGPPGSLCYLQLQKENSNSGEVGSATPFPWWAFYGGM  344

Query  782   -------------------DSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQS  904
                                 S ++++ KE  KEGS T SNSGSVN G   DKN+D ET+S
Sbjct  345   PYPFIPCHKQEPATEEHLDSSGEDIQYKEIQKEGSWTGSNSGSVNEGENADKNMDGETES  404

Query  905   GQRIGSDSSC-FKRTTEIVILEQ--KTARSTKRTKGFMPYKR  1021
                     SC  K    ++ L+   KTA + K  KGF+PYK+
Sbjct  405   RHF-----SCEVKELYPVLELKTSVKTASTNKCMKGFVPYKK  441



>ref|XP_011085926.1| PREDICTED: protein REVEILLE 1 [Sesamum indicum]
Length=481

 Score =   146 bits (368),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 161/393 (41%), Positives = 210/393 (53%), Gaps = 62/393 (16%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWR+IEEHVGTKTAVQIRSHAQKFFSKV RESN  D  +VK IEIPPPRPKRKP H
Sbjct  79    LYGRAWRKIEEHVGTKTAVQIRSHAQKFFSKVVRESNTGDTSSVKSIEIPPPRPKRKPSH  138

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
             PYPRKLV  P    G+  PEKP+ S SPN   SE+EN+SPTSVL  + S+     DS   
Sbjct  139   PYPRKLV--PPVKTGIRIPEKPSSSASPN--TSEQENQSPTSVLSTIGSDSSVGLDSCMP  194

Query  362   aspscvssa----TGGGILFSKHCNVLVE----ENGSSSPP---PGNLELLPLDDGRVRE  508
              S     S+      G I  S+    L E    E+ +SSP    P  LEL   +   V+E
Sbjct  195   NSSPSPVSSGLPLNAGMISCSEAPKRLSEDADHEDENSSPDEKIPLELELSSQNTALVKE  254

Query  509   S---STAQYLKLFGKTVLVS---GSHTLSSPTSRDLKAPMATHSFSWNLSIGHGDYSECK  670
                 S AQ LKLFGKT+LV+   G   L+  T +     ++  S S+ L +    + +C 
Sbjct  255   DPSESAAQSLKLFGKTLLVADPRGPSYLTPETCKAESFDISDGSCSFPLRVVPLKFPKCN  314

Query  671   ------------PVP----------------SLPWALPRAPSSSAGFPCVQVHSPVAIKA  766
                         PVP                  PW    + +SS+     +VHSP+ IKA
Sbjct  315   YEYESSAFPDRSPVPVYTTDKLSPVDARHPVPFPWLTLCSDASSS---TQEVHSPIPIKA  371

Query  767   RPFSFDSKDNVEEKEDAKEGSSTCSNSGSVNVGICVD--KN--LDTETQSGQRIGSDSSC  934
             +    D K+ ++  E  KEGSST SN+ +  +G   D  KN  +++   S +R G++   
Sbjct  372   Q-LLCDKKEKLDNDEQ-KEGSSTSSNTDNF-LGASPDGGKNWGINSCHLSLKRKGTEGKS  428

Query  935   FKRTTEIVILEQKTARSTKRTKGFMPYKRCLAE  1033
             F   +   + ++ +A S    +GF+PYKRC AE
Sbjct  429   F---SSYKLSKRISANSLNCRQGFVPYKRCFAE  458



>ref|XP_006372412.1| hypothetical protein POPTR_0017s01380g [Populus trichocarpa]
 gb|ERP50209.1| hypothetical protein POPTR_0017s01380g [Populus trichocarpa]
Length=479

 Score =   145 bits (367),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 162/397 (41%), Positives = 204/397 (51%), Gaps = 67/397 (17%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEH+GTKTAVQIRSHAQKFFSKV RES G +  + +PIEIPPPRPKRKPMH
Sbjct  77    LYGRAWRRIEEHLGTKTAVQIRSHAQKFFSKVARESGGSNTSSEEPIEIPPPRPKRKPMH  136

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
             PYPRKL   P+    +L  E P RS SPN S+SE+EN+SPTSVL A+ S+   S DS   
Sbjct  137   PYPRKLA-HPLER-DLLILENPLRSSSPNFSISEQENQSPTSVLSAVGSDALGSTDSDMP  194

Query  362   aspscvssaTGGGILFSKHCNVLVEENGSSSPP----------PGNLELLPLDDGRVRES  511
             +      S+ GG     +H +   E+NGS SPP          P  L+  P ++    E 
Sbjct  195   SHSLSPVSSAGG----VRHVDSSPEDNGSPSPPTASSAPDEQFPKKLDSFPKENVSSEEP  250

Query  512   STAQYLKLFGKTVLVSGSHTLSSPT--SRDLKAPMATHS-----FSWNLSIG----HGDY  658
              T   LKLFG+T+LV+  H  S P   +  L  P AT        + N++        + 
Sbjct  251   IT---LKLFGRTLLVTECHKPSYPNMGTSKLSLPDATEEKLVQPLTLNITAAKLQSRNEE  307

Query  659   SECKPVPSLPWAL------------PRAPSSSAGFPCVQVHSPVAIKARPF--------S  778
             S   P+P                  P    S+A  P    +  +     PF        +
Sbjct  308   STWSPLPHGSHGALYQIQFKKENSSPTENDSAALMPWWGSYEGMPFPFIPFHKHEPAVEN  367

Query  779   FDSK-DNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEI  955
              DS  D V++KE  KE S T SNSGSVN G  VDK +D ET+S Q        ++     
Sbjct  368   LDSNGDEVQDKEIHKEVSWTGSNSGSVNEGENVDKIMDAETESHQ------FSYEEKEPS  421

Query  956   VILEQKTAR----------STKRTKGFMPYKRCLAER  1036
               LE K  +          + K TKGF+PYK+  AER
Sbjct  422   PFLELKPKKKSASSGSKAFNEKCTKGFVPYKKRTAER  458



>gb|AHZ13511.1| RVE1-like protein [Euphorbia esula]
Length=482

 Score =   144 bits (362),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 157/394 (40%), Positives = 208/394 (53%), Gaps = 69/394 (18%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEHVG+KTAVQIRSHAQKFFSKV RES+G +    +PIEIPPPRPKRKPMH
Sbjct  81    LYGRAWRRIEEHVGSKTAVQIRSHAQKFFSKVVRESSGSNTNPAEPIEIPPPRPKRKPMH  140

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
             PYPRK+ + P++    + PE+P RS SPN SVSE EN+SPTSVL  + S+   S DS+  
Sbjct  141   PYPRKM-MNPLTKETSI-PEQPLRSSSPNFSVSEHENQSPTSVLSGVCSDALGSTDSNTP  198

Query  362   aspscvssaTGG---GILFSKHCNVLVEENGSSSPPP-------------GNLELLPLDD  493
                    S   G   G L +   N+  E++GS S P                L L P +D
Sbjct  199   NCSLSPVSCVDGSNSGDLMTCEENLTPEDDGSRSAPMTIDAANDEHPPKVQKLNLFPSED  258

Query  494   G---RVRESSTAQYLKLFGKTVLVSGSH-------TLSSPTSRDLKAPMATHS------F  625
                  + E ++ + LKLFG+TVL+S SH       T++SP S     P  TH        
Sbjct  259   ASEDSLIEETSTRSLKLFGRTVLISESHGDGPSYQTIASPKS----PPSCTHDENPVQHT  314

Query  626   SWNLSIGHGD--YSECKPVPS-----LPW----ALPRAPSSSA---------GFPCVQVH  745
             + NL  G+G+  +      PS     LP+    + P    S A         G P   V 
Sbjct  315   ACNLMSGNGEGSWGHLPQGPSGGLYYLPFQNRDSFPAEAGSGATHPWWGLYGGLPFPLVP  374

Query  746   SPVAIKARPFSFDSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSD  925
             SP     +     + +   EKE  KEGS T SN GS N G  VD+N+D+E+ + +     
Sbjct  375   SPKQEPMKVIPDSNNEEFREKELQKEGSWTGSNFGSPNEGENVDRNMDSESYNDE-----  429

Query  926   SSCFKRTTEIVILE--QKTARSTKRTKGFMPYKR  1021
                 K   + ++L+  +++  S    KGF+PYK+
Sbjct  430   ----KEPNQFLVLKSLERSGSSNNCMKGFVPYKK  459



>gb|AIL81922.1| RVE1-like protein [Euphorbia esula]
Length=482

 Score =   143 bits (361),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 157/394 (40%), Positives = 208/394 (53%), Gaps = 69/394 (18%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEHVG+KTAVQIRSHAQKFFSKV RES+G +    +PIEIPPPRPKRKPMH
Sbjct  81    LYGRAWRRIEEHVGSKTAVQIRSHAQKFFSKVVRESSGTNTNPAEPIEIPPPRPKRKPMH  140

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
             PYPRK+ + P++    + PE+P RS SPN SVSE EN+SPTSVL  + S+   S DS+  
Sbjct  141   PYPRKM-MNPLTKETSI-PEQPLRSSSPNFSVSEHENQSPTSVLSGVCSDALGSTDSNTP  198

Query  362   aspscvssaTGG---GILFSKHCNVLVEENGSSSPPP-------------GNLELLPLDD  493
                    S   G   G L +   N+  E++GS S P                L L P +D
Sbjct  199   NCSLSPVSCVDGSNSGDLMTCEENLTPEDDGSRSAPMTIDAANDEHPPKVQKLNLFPSED  258

Query  494   G---RVRESSTAQYLKLFGKTVLVSGSH-------TLSSPTSRDLKAPMATHS------F  625
                  + E ++ + LKLFG+TVL+S SH       T++SP S     P  TH        
Sbjct  259   ASEDSLIEETSTRSLKLFGRTVLISESHGDGPSYQTIASPKS----PPSCTHDENPVQHT  314

Query  626   SWNLSIGHGD--YSECKPVPS-----LPW----ALPRAPSSSA---------GFPCVQVH  745
             + NL  G+G+  +      PS     LP+    + P    S A         G P   V 
Sbjct  315   ACNLMSGNGEGSWGHLPQGPSGGLYYLPFQNRDSFPAEAGSGATHPWWGLYGGLPFPLVP  374

Query  746   SPVAIKARPFSFDSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSD  925
             SP     +     + +   EKE  KEGS T SN GS N G  VD+N+D+E+ + +     
Sbjct  375   SPKQEPMKVIPDSNNEEFREKELQKEGSWTGSNFGSPNEGENVDRNMDSESYNDE-----  429

Query  926   SSCFKRTTEIVILE--QKTARSTKRTKGFMPYKR  1021
                 K   + ++L+  +++  S    KGF+PYK+
Sbjct  430   ----KEPNQFLVLKSLERSGSSNNCMKGFVPYKK  459



>ref|XP_008381387.1| PREDICTED: protein REVEILLE 1-like [Malus domestica]
Length=486

 Score =   143 bits (361),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 151/398 (38%), Positives = 198/398 (50%), Gaps = 63/398 (16%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWR+IE+HVGTKTAVQIRSHAQKFFSKV R  NG +A + +PI+IPPPRPK+KPM 
Sbjct  78    LYGRAWRKIEKHVGTKTAVQIRSHAQKFFSKVARYPNGGNATSEEPIDIPPPRPKKKPMR  137

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
             PYPRKLV        ++  E+PTRS SPNLSVSE+EN+SPTSVL  + S+   S DS+  
Sbjct  138   PYPRKLVHPLDKETSIV--EQPTRSASPNLSVSEQENQSPTSVLSVIGSDAMGSTDSNTP  195

Query  362   aspscvssaTGG---GILFSKHCNVLVEENGSSSPPPGN-----------LELLPLDD--  493
             +      S+  G     L     N L+EE+GS   P  N           LEL P DD  
Sbjct  196   SDGLSPDSSAAGVNSENLIHSEPNPLLEESGS---PIBNCSLPNKQLTMKLELFPTDDVD  252

Query  494   --GRVRESSTAQYLKLFGKTVLVSGSHTLSS---------PTSRDLKAPMATHSFSWNLS  640
               G   + + A+ LKLFG+TVLV+ SH  SS         P+    + P+ T     +L 
Sbjct  253   ASGGSAKEAFARSLKLFGRTVLVTDSHRPSSRAAGTSQSLPSDVQEEKPVQT-----SLP  307

Query  641   IGHGDYSECKPVPSLPW-ALPRAPSSSAGFPCVQVHSPVAIKAR----------------  769
             +   D           W   P        F   Q  +  A+++                 
Sbjct  308   VNFTDMESASGNVEHVWDNFPYGGHQGIYFMQFQNQNSDAVESGTNAYPXPWWTICPPFI  367

Query  770   PFSFDSKDNVEEKEDAK----EGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGS-----  922
             PF    +  V E  D+K    E S T S++GS +     DKN +T+    Q+        
Sbjct  368   PFHKQQQQPVNEHVDSKKVDREDSCTGSDAGSASDEENRDKNDETQGDHYQQXSDKDREP  427

Query  923   DSSCFKRTTEIVILEQKTARSTKRTKGFMPYKRCLAER  1036
             +S    + +      +  A + K  KGF+PYKRC AER
Sbjct  428   NSVLQFKASANSAFSKIRASTGKYRKGFVPYKRCTAER  465



>gb|AIL81923.1| RVE1-like protein [Euphorbia esula]
Length=482

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 156/394 (40%), Positives = 208/394 (53%), Gaps = 69/394 (18%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEHVG+KTAVQIRSHAQKFFSKV RES+G +    +PIEIPPPRPKRKPMH
Sbjct  81    LYGRAWRRIEEHVGSKTAVQIRSHAQKFFSKVVRESSGTNTNPAEPIEIPPPRPKRKPMH  140

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
             PYPRK+ + P++    + PE+P RS SPN SVSE EN+SPTSVL  + S+   S DS+  
Sbjct  141   PYPRKM-MNPLTKETSI-PEQPLRSSSPNFSVSEHENQSPTSVLSGVCSDALGSTDSNTP  198

Query  362   aspscvssaTGG---GILFSKHCNVLVEENGSSSPPP-------------GNLELLPLDD  493
                    S   G   G L +   N+  E++GS S P                L L P +D
Sbjct  199   NCSLSPVSCVDGSNSGDLMTCEENLTPEDDGSRSAPMTIDAANDEHPPKVQKLNLFPSED  258

Query  494   G---RVRESSTAQYLKLFGKTVLVSGSH-------TLSSPTSRDLKAPMATHS------F  625
                  + E ++ + LKLFG+TVL+S SH       T++SP S     P  TH        
Sbjct  259   ASEDSLIEETSTRSLKLFGRTVLISESHGDGPSYQTIASPKS----PPSCTHDENPVQHT  314

Query  626   SWNLSIGHGD--YSECKPVPS-----LPW----ALPRAPSSSA---------GFPCVQVH  745
             + NL  G+G+  +      PS     LP+    + P    S A         G P   V 
Sbjct  315   ACNLMSGNGEGSWGHLPQGPSGGLYYLPFQNRDSFPAEAGSGATHPWWGLYGGLPFPLVP  374

Query  746   SPVAIKARPFSFDSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSD  925
             SP     +     + +   EK+  KEGS T SN GS N G  VD+N+D+E+ + +     
Sbjct  375   SPKQEPMKVIPDSNNEEFREKDLQKEGSWTGSNFGSPNEGENVDRNMDSESYNDE-----  429

Query  926   SSCFKRTTEIVILE--QKTARSTKRTKGFMPYKR  1021
                 K   + ++L+  +++  S    KGF+PYK+
Sbjct  430   ----KEPNQFLVLKSLERSGSSNNCMKGFVPYKK  459



>ref|XP_010675239.1| PREDICTED: protein REVEILLE 2 isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=443

 Score =   139 bits (350),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 154/380 (41%), Positives = 208/380 (55%), Gaps = 57/380 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWR+IEEHVG+KTAVQIRSHAQKFFSKV RE+N  +A +V PIEIPPPRPKRKP H
Sbjct  65    LYGRAWRKIEEHVGSKTAVQIRSHAQKFFSKVVRETNNTNANSVDPIEIPPPRPKRKPSH  124

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
             PYPRKLV+   + + M   E+  RS SPN  +SE+EN+SPTSVL A+ S+   +  S+ +
Sbjct  125   PYPRKLVLPSRNDMAM---EQQARSASPNSWISEQENQSPTSVLSAVASD---TLASAES  178

Query  362   aspscvssaTGGGILFSKHCNVLVEENG-------SSSPP--PGNLELLPLDDGRV---R  505
             A+P+   S    G    +      E+N        S+S P  P +++L    D       
Sbjct  179   ATPNTSPSPMSSGDFADQVAMFESEDNAPQGEVHVSNSVPIVPASVKLELFSDKESFDKD  238

Query  506   ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDLKAPMATHSFSWNLSIGHG---DYSECKPV  676
             ES++ +  KLFGK V+V GS + S   S   K+P +         +G G    Y E    
Sbjct  239   ESASTKVFKLFGKDVVVPGSSSDS--PSCLSKSPSS--------DMGEGVLQAYPEDYKS  288

Query  677   PSLPWALPRAPSSSAGFPCV--------QVHSPVAIKA----RPFSFDSKDNVEEKEDAK  820
               +P    R+  +S   P          QV  P  +      R  S     + +EK  A+
Sbjct  289   ADIPM---RSVETSEDLPTFYYMNRSANQVEKPTPLPWWVFFRGISVPPFGDTQEKGSAR  345

Query  821   EGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGS--------DSSCFKRTTEIVILEQKT  976
             EGSS  S+S SVN G  +DKN +TET+SGQ   S        +  C ++  E  +LE++ 
Sbjct  346   EGSSADSDSDSVNGGETLDKNWETETESGQCGPSSHKESKFLEDPCPEK--ECTLLEKRI  403

Query  977   ARSTKRTKGFMPYKRCLAER  1036
             +    R KGF+PYKRC++ER
Sbjct  404   SVDKAR-KGFVPYKRCVSER  422



>ref|NP_001236066.1| MYB transcription factor MYB177 [Glycine max]
 gb|ABH02866.1| MYB transcription factor MYB177 [Glycine max]
Length=436

 Score =   135 bits (339),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 143/358 (40%), Positives = 185/358 (52%), Gaps = 32/358 (9%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSK+ RES+G+     + IEIPPPRPKRKP+H
Sbjct  77    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKILRESSGNSTTLEESIEIPPPRPKRKPIH  136

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
             PYPRKLV  P +  G+ + E P RS S   S   +EN SP SVL  + SE   S+DS  +
Sbjct  137   PYPRKLVEFPKT--GISNSEHPLRSNSLKSSDFGQENNSPKSVLSTVVSETVGSSDSDTS  194

Query  362   aspscvssaTGG----GILFSKHCNVLVEENGSSS-----PPPGNLELLPLDDGRVR---  505
             +     +S+  G        ++      EE  + S      PP  LE L  +    R   
Sbjct  195   SRCLSPASSISGVPTNRFPLAEPKTSFKEEGSAPSSAHDEQPPVKLEFLHKESVSTRDDA  254

Query  506   -ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDLKAPMATHSFSWNLSIGHGDYSECKPVPS  682
              E S+ + LKLFG T+LV+ +   SSPT+   K   A   +   L  G  D +E      
Sbjct  255   TEESSGRTLKLFGTTLLVTDTCKPSSPTTEPCKPTPAAAMYLMQLQNGCSDVTEGHASIV  314

Query  683   LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSFDSKDNVEEKEDAKEGSSTCSNSGSVNV  862
               W LP         P + +H     K     + +    E KE  KEGS T SN+ S++ 
Sbjct  315   PWWTLPH------NTPFMPLHKEPKGKHL---YSNLGEFEHKEVQKEGSWTGSNTSSIDD  365

Query  863   GICVDKNLDTETQSGQRIGSDSSCFKRTTEIVILEQKTARSTKRTKGFMPYKRCLAER  1036
             G       D   +SG +  S    F ++  + I E +  R     KGF+PYKRC+AER
Sbjct  366   G-------DNTEKSGDQAKSHVHGFSKSETLTISELR-VRPKTCGKGFVPYKRCMAER  415



>ref|XP_009370571.1| PREDICTED: protein REVEILLE 1 [Pyrus x bretschneideri]
Length=482

 Score =   135 bits (339),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 148/395 (37%), Positives = 197/395 (50%), Gaps = 60/395 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWR+IE+HV TKTAVQIRSHAQKFFSKV R+ NG +  + +PI+IPPPRPKRKPM 
Sbjct  77    LYGRAWRKIEDHVVTKTAVQIRSHAQKFFSKVARDPNGGNTASEEPIDIPPPRPKRKPMR  136

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
             PYPRKLV         +  E+   S SPNLSV E+EN+SP SVL  + S+   S DSS  
Sbjct  137   PYPRKLVHPLNKETSTV--EQSAMSTSPNLSVLEQENQSPKSVLSVIGSDAMGSTDSSTP  194

Query  362   aspscvssaTGG---GILFSKHCNVLVEENGSS----SPPPGN----LELLPLDD----G  496
             +      S+  G   G L     N  +EE+GS+    S P       LEL P DD    G
Sbjct  195   SDGLSPDSSAAGVNSGNLIPSEPNPSLEESGSTINNCSLPNKQLKMKLELFPTDDVDASG  254

Query  497   RVRESSTAQYLKLFGKTVLVSGSHTLSSPTSRDLKA---------PMATHSFSWNLSIGH  649
                E ++A+ LKLFG+TVLV+ SH  SS  + D K+         P+ T     +L   H
Sbjct  255   GSAEEASARTLKLFGRTVLVTDSHRPSSRAAGDSKSLPSDVQEEKPVQT-----SLPCNH  309

Query  650   GDYSECKPVPSLPW-ALPRAPSSSAGFPCVQVHSPVAIKAR----------------PFS  778
              D           W   P        F   Q  +   +++                 PF 
Sbjct  310   TDMESASGSVEHVWDNFPYGRHQGIYFMQFQNQNSNVVESGTNAYPVPWWNICPPFIPFH  369

Query  779   FDSK---DNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTT  949
                +   ++V+ K+  +EGS T S++G+ +     DK ++T+   G R  SD      + 
Sbjct  370   MQQQPVNEDVDSKKVEREGSCTGSDAGTASDDEICDKEVETQ---GDRHVSDKEREPNSV  426

Query  950   EIVILEQKTARSTKRT------KGFMPYKRCLAER  1036
                 +   +A S  R       KGF+PYKRC+AER
Sbjct  427   LQFKVSANSAFSVLRASTGQYRKGFVPYKRCVAER  461



>ref|XP_011013212.1| PREDICTED: protein REVEILLE 1-like [Populus euphratica]
Length=481

 Score =   135 bits (339),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 159/407 (39%), Positives = 198/407 (49%), Gaps = 85/407 (21%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEH+GTKTAVQIRSHAQKFFSKV RES G +  + +PIEIPPPRPKRKPMH
Sbjct  77    LYGRAWRRIEEHLGTKTAVQIRSHAQKFFSKVARESGGSNTSSEEPIEIPPPRPKRKPMH  136

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
             PYPRKL   P+    +L  E P RS SPN S+SE EN+SPTSVL A+ S+   S DS   
Sbjct  137   PYPRKLA-HPLE-RDLLILENPLRSSSPNFSISEHENQSPTSVLSAVGSDALGSTDSDMP  194

Query  362   aspscvssaTGGGILFSKHCNVLVEENGSSSPPPGN------------LELLPLDDGRVR  505
             +      S+ GG      H +   E+NGS SPP  +             +  P ++    
Sbjct  195   SHSLSPVSSAGG----VHHVDSSPEDNGSPSPPTASSAPDEQFPKVQKFDSFPKENVSSE  250

Query  506   ESSTAQYLKLFGKTVLVSGSHTLSSP------------TSRDLKAPMATHSFSWNLS---  640
             E  T   LKLFG+T+LV+  H  S P            T   L  P+  +  +  L    
Sbjct  251   EPIT---LKLFGRTLLVTECHKPSYPSMGTSKLSLTDATEEKLVQPLTLNITAAKLQSRN  307

Query  641   -------IGHGDY---------------SECKPVPSLPWALPRAPSSSAGFPCVQVHSPV  754
                    + HG +               +E      +PW           FP +  H   
Sbjct  308   EESTWSPLPHGSHGALYQMQFKKENSSPTENDSAALMPWW---GSYEGMPFPFITFH---  361

Query  755   AIKARPFS--FDSK-DNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSD  925
               K  P     DS  D V++KE  KE S T SNS SVN G  VDK +D ET+S Q     
Sbjct  362   --KHEPAVEILDSNGDEVQDKEIHKEVSWTGSNSESVNEGENVDKIMDAETESHQF----  415

Query  926   SSCFKRTTEIVILEQKTAR----------STKRTKGFMPYKRCLAER  1036
                ++       LE K  +          + K TKGF+PYK+  AER
Sbjct  416   --SYEENEPSPFLELKPKKKSASSGSKAFNEKCTKGFVPYKKRTAER  460



>gb|KHN39497.1| Protein CCA1 [Glycine soja]
Length=436

 Score =   130 bits (328),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 141/358 (39%), Positives = 183/358 (51%), Gaps = 32/358 (9%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSK+ RES+G+     + IEIPPPRPKRKP+H
Sbjct  77    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKILRESSGNSTTLEESIEIPPPRPKRKPIH  136

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
             PYPRKLV  P +  G+ + E P RS S   S   +EN SP SVL  + SE   S+DS  +
Sbjct  137   PYPRKLVEFPKT--GISNSEHPLRSNSLKSSDFGQENNSPKSVLSTVVSETVGSSDSDTS  194

Query  362   aspscvssaTGG----GILFSKHCNVLVEENGSSS-----PPPGNLELLPLDDGRVR---  505
             +     +S+  G        ++      EE  + S      PP  LE    +    R   
Sbjct  195   SRCLSPASSISGVPTNRFPLAEPKTSFKEEGSAPSSAHDEQPPVKLEFFHKESVSTRDDA  254

Query  506   -ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDLKAPMATHSFSWNLSIGHGDYSECKPVPS  682
              E S+ + LKLFG T+LV+ +   SSPT+   K   A   +   L  G  D +E      
Sbjct  255   TEESSGRTLKLFGTTLLVTDTCKPSSPTTEPCKPTPAAAMYLMQLQNGCSDVTEGHASIV  314

Query  683   LPWALPRAPSSSAGFPCVQVHSPVAIKARPFSFDSKDNVEEKEDAKEGSSTCSNSGSVNV  862
               W LP         P + +H     K     + +    E KE  KEGS T SN+ S++ 
Sbjct  315   PWWTLPH------NTPFMPLHKEPKGKHL---YSNLGEFEHKEVQKEGSWTGSNTSSIDD  365

Query  863   GICVDKNLDTETQSGQRIGSDSSCFKRTTEIVILEQKTARSTKRTKGFMPYKRCLAER  1036
             G       D   +S  +  S    F ++  + I E +  R     KGF+PYKRC+AER
Sbjct  366   G-------DNTEKSDDQAKSHVHGFSKSETLTISELR-VRPKTCGKGFVPYKRCMAER  415



>ref|XP_010525035.1| PREDICTED: protein REVEILLE 1 [Tarenaya hassleriana]
Length=447

 Score =   129 bits (325),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 142/369 (38%), Positives = 191/369 (52%), Gaps = 57/369 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKV R++ G +  +V+PI IPPPRPKRKP+H
Sbjct  79    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVARDTTGSNGSSVEPIVIPPPRPKRKPVH  138

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
             PYPRKL  T V  +   D  +  RS+SPNLS  E++N+SPTSVL ++ S+          
Sbjct  139   PYPRKLGNTSVKEISSTDQSR--RSVSPNLSALERDNQSPTSVLSSVGSDA-------FG  189

Query  362   aspscvssaTGGGILFSKHCNVLVEE-NGSSSPPPG----------------NLELLPLD  490
             ++ S   +++   + ++  C +++ E  GS+   P                  LEL P  
Sbjct  190   SADSNSPNSSLSPVSYALQCELMLSEPYGSAEASPSAALTTATTAAEEPESLKLELFPRQ  249

Query  491   DGRVRESS----TAQYLKLFGKTVLVS---GSHTLSSPTSRDLKAPMATHSFSWNLSIGH  649
                 RE S      Q LKLFGKTVL+S   GS  LS  TS   K+P              
Sbjct  250   RLLSREESINQPMKQSLKLFGKTVLLSDPNGSSALS--TSCFCKSPQ-------------  294

Query  650   GDYSECKPVPSLPWALPRAPSS---SAGFPC-VQVHSPVAIKARPFSFDSKD-NVEEKED  814
              + +E KP+  LP  L  A +S   +    C +Q +   A  A     +  D   +EK  
Sbjct  295   -EANEGKPIQPLPRKLTPAETSALNAENILCWIQQNRQEATNA---CIEISDLGGKEKGL  350

Query  815   AKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVILEQKTARSTKR  994
               EGSST SN+ S +     DK+ + ET S +      S FK +      + K   S  R
Sbjct  351   QIEGSSTGSNTCSDDDTGDADKSSEVETPSSETNMEKKSEFKPSERSAFSQLKRTDSETR  410

Query  995   TKGFMPYKR  1021
              + F+PY++
Sbjct  411   ARAFVPYRK  419



>gb|ABL63123.1| MYB transcription factor, partial [Catharanthus roseus]
Length=455

 Score =   129 bits (325),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 142/363 (39%), Positives = 184/363 (51%), Gaps = 71/363 (20%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGRAWRRIEEHVG+KTAVQIRSHAQKFFSKV RES   D+ + K IEIPPPRPKRKP+H
Sbjct  64   LYGRAWRRIEEHVGSKTAVQIRSHAQKFFSKVVRESTNGDSGSGKVIEIPPPRPKRKPLH  123

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFA--LDSEGQasadss  355
            PYPRKLV    S  G    +K T+++SPN+S   +E++SPTSVL A   D+ G   + +S
Sbjct  124  PYPRKLVSPAKS--GTATSQKLTQTVSPNISSPAEEHQSPTSVLSAPCSDTPGTTDSATS  181

Query  356  pnaspscvssaTGG----GILFSKHCNVLVE--------------ENGSSSPPPGN----  469
              +      S+  G    G + S+  ++  E              +N S S    N    
Sbjct  182  DGSESLSPISSVVGAKSVGFVLSELPDLTSETKRSPSSSQVNSSADNKSPSTSQVNNCAN  241

Query  470  --------LELLPLDDGRVRES----STAQYLKLFGKTVLVSGSHTLSSPT---------  586
                    LEL P D+   +E     S++Q  KLFGKTVLV      SS T         
Sbjct  242  QADQLHLKLELFPQDNAFDKEGSVEVSSSQIFKLFGKTVLVIDPSRPSSSTPGAGKVQPS  301

Query  587  ------SRDLKAPMATHS--------------FSWNLSIGHGDYSECKPVPSLPWALPRA  706
                  S   K P+                  +  +L     D   C P  SLPW +   
Sbjct  302  HQNDGKSNSTKVPLGESECLRRALPCKARGNLYPSSLQRECPDTLLCGPFHSLPWLMMYQ  361

Query  707  PSSSAGFPCVQVHSPVAIKARPFSFDSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNL  886
              SSA F  VQVHSP+AIKA+P   D K+ +   +  K GSST S++ S ++    DKN+
Sbjct  362  GDSSASF--VQVHSPIAIKAQPL-LDKKE-LHRVQSCKGGSSTGSDAESESIETVEDKNI  417

Query  887  DTE  895
            + +
Sbjct  418  EVK  420



>ref|XP_006430409.1| hypothetical protein CICLE_v10011554mg [Citrus clementina]
 gb|ESR43649.1| hypothetical protein CICLE_v10011554mg [Citrus clementina]
Length=496

 Score =   129 bits (325),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 161/421 (38%), Positives = 209/421 (50%), Gaps = 93/421 (22%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWR+IEEHVGTKTAVQIRSHAQKFFSKV RESNG     V+P+EIPPPRPKRKPMH
Sbjct  77    LFGRAWRKIEEHVGTKTAVQIRSHAQKFFSKVVRESNGCSTSPVEPVEIPPPRPKRKPMH  136

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRKL   PV     L+PE    SLSP LSVSE+EN+SPTSVLFA+ S+      +++ 
Sbjct  137   PYPRKLAHPPVKE--SLNPELSRTSLSPILSVSERENQSPTSVLFAIGSDAFGSSDSNSP  194

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGS-SSPP--PGNL----------------  472
             +   +  S       GG+  S H +   EE GS SS P  PG++                
Sbjct  195   NGSLSPVSSAVPEQLGGLTLS-HPSSSPEERGSPSSDPVTPGSVTDEQSPKCVLKMGLSP  253

Query  473   ELLPLDDGRVRESSTAQYLKLFGKTVLVSGSHTLSSPTSRDLK-----------------  601
             +    +   VR SS +  LKLFG  VLV+ S  LSSPT+   K                 
Sbjct  254   QRFDKEVSDVRASSRS--LKLFGTIVLVTDSQRLSSPTAGTCKLFESFPSEALEGKPLQL  311

Query  602   ---APMATHS------FSWNLSIGHGDYSECKPVPS---------------LPW-----A  694
                  M T S      ++W  ++ HG       + S               LPW      
Sbjct  312   LPLEVMHTESLSEDAKYAWRRTLPHGGSGAFSCMQSTDDDSNMVDTGSGAHLPWWNFSHG  371

Query  695   LPRAPS-SSAGFPCVQVHSPVAIKARPFSFDSKDNVEEKEDAKEGSSTCSNSGSVNVGIC  871
             LP A + ++     +++HS V              V+ +E  KEGS T SNS SVN    
Sbjct  372   LPYAVTPNNQQVQNLRLHSSVK------------EVQGREFKKEGSLTGSNSKSVNEEDS  419

Query  872   VDKNLDTETQSG-QRIGSDSSCFKRTTEIVILEQKT-----ARSTKRTKGFMPYKRCLAE  1033
             +DK+ D ++QS  Q +  +    +   E+   E         R+ K  KGF+PYK+ + E
Sbjct  420   IDKSSDVDSQSSRQSLDKEDKWPEVAFELKPSENSAFSVIRTRTDKHMKGFVPYKKRIVE  479

Query  1034  R  1036
             R
Sbjct  480   R  480



>ref|XP_006481961.1| PREDICTED: uncharacterized protein LOC102630458 [Citrus sinensis]
Length=498

 Score =   129 bits (323),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 160/419 (38%), Positives = 210/419 (50%), Gaps = 89/419 (21%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWR+IEEHVGTKTAVQIRSHAQKFFSKV RESNG     V+P+EIPPPRPKRKPMH
Sbjct  79    LFGRAWRKIEEHVGTKTAVQIRSHAQKFFSKVVRESNGCSTSPVEPVEIPPPRPKRKPMH  138

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG----Qasad  349
             PYPRKL   PV     L+PE    SLSP LSVSE+EN+SPTSV+FA+ S+      +++ 
Sbjct  139   PYPRKLAHPPVKES--LNPELSRTSLSPILSVSERENQSPTSVMFAMGSDAFGSSDSNSP  196

Query  350   sspnaspscvssaTGGGILFSKHCNVLVEENGS-SSPP--PGN----------LELLPLD  490
             +   +  S       GG+  S H +   EE GS SS P  PG+          L++    
Sbjct  197   NGSLSPVSSAVPEQLGGLTLS-HPSSSPEERGSPSSGPVTPGSVTDEQSPKCVLKMGLSP  255

Query  491   DGRVRESS----TAQYLKLFGKTVLVSGSHTLSSPTSRDLK-------------------  601
              G  +E S    +++ LKLFG  VLV+ S  LSSPT+   K                   
Sbjct  256   QGFDKEVSDVRASSRTLKLFGTIVLVTDSQRLSSPTAGTCKLFESFPSEALEGKPLQLLP  315

Query  602   -APMATHS------FSWNLSIGHGDYS--ECKPVPS-------------LPW-----ALP  700
                M T S      ++W  ++ HG      C   P              LPW      LP
Sbjct  316   LEVMHTESLSEDTKYAWRCTLPHGGSGAFSCMQSPDDDSNMVDTGSGAHLPWWNFSHGLP  375

Query  701   RAPS-SSAGFPCVQVHSPVAIKARPFSFDSKDNVEEKEDAKEGSSTCSNSGSVNVGICVD  877
              A + ++     + +HS V              V+ +E  KEGS T SNS SVN    +D
Sbjct  376   YAVTPNNQQVQNLHLHSSVK------------EVQGREFKKEGSLTGSNSKSVNEEDSID  423

Query  878   KNLDTETQSGQRIGSDSSCFKRTTEIVILEQKTARSTKRT------KGFMPYKRCLAER  1036
             K+ D ++QS ++       +      +   + +A S  RT      KGF+PYK+ + ER
Sbjct  424   KSSDVDSQSRRQSLDKEDNWPEVAFELKPSENSAFSVIRTSTDKHMKGFVPYKKRIVER  482



>ref|XP_010101053.1| Myb-like protein G [Morus notabilis]
 gb|EXB86763.1| Myb-like protein G [Morus notabilis]
Length=469

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 132/221 (60%), Gaps = 24/221 (11%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGRAWR+IEEHVGTKTAVQIRSHAQKFF KV R+ NG +  +  PIEIPPPRPKRKPMH
Sbjct  75   LYGRAWRKIEEHVGTKTAVQIRSHAQKFFYKVARDPNGGNTNSEDPIEIPPPRPKRKPMH  134

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
            PYPRKLV +P   + +   E  T +LSPNLS+SE+EN+SP SVLFA+ S+   S  S   
Sbjct  135  PYPRKLVDSPKKEIPLA--EHTTSALSPNLSLSEQENQSPKSVLFAMGSDTIGSGGSDTP  192

Query  362  aspscvssaTGGGILFSKHCNVLVEENGSS----SPP-----------PGNLELLPLDDG  496
                   S+  G         ++ E N SS    SPP           P  LE    D  
Sbjct  193  DGSLSPVSSAPG---IHDGSFIISEPNPSSEFSRSPPAATVSVPDVRFPMKLESSSQDTA  249

Query  497  RVRESST----AQYLKLFGKTVLVSGSHTLSSPTSRDLKAP  607
             V+ES+     A+ LKLFG TVLV+ S   SSPT+   + P
Sbjct  250  YVKESAAEEVCARSLKLFGMTVLVTDSQRPSSPTTETCEPP  290



>ref|XP_010062320.1| PREDICTED: protein REVEILLE 2 [Eucalyptus grandis]
Length=438

 Score =   122 bits (307),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 145/376 (39%), Positives = 185/376 (49%), Gaps = 72/376 (19%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKV ++    D K V+ IEIPPPRPKRKPMH
Sbjct  77    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVKDPT--DGK-VETIEIPPPRPKRKPMH  133

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
             PYPRKL+  P++    L  E+P RS SPN SVSE EN+SP SVL  L S+G  S+ +S  
Sbjct  134   PYPRKLLAHPINKES-LPQEQPIRSGSPNFSVSELENQSPMSVLSTLGSDGLGSSGASTP  192

Query  362   aspscvssaT-----GGGILFSKHCNVLVEENGSSSPPPGNLELLPLD------DGRVRE  508
             +  S  SS+       G  LF        EENG     P   E L L        G   E
Sbjct  193   SGSSSPSSSGGAACRAGLSLFESPA----EENG-----PITSEKLELHARGCEASGGAME  243

Query  509   SSTAQYLKLFGKTVLVSGSHTLSSPTSRD------LKAPMATHSFS----------WNLS  640
              + ++ LKLFG TV V+ SH  SS   +       L+ P++  + S           NL 
Sbjct  244   EAPSRTLKLFGMTVSVTDSHWQSSSAIKSESKEMKLQDPLSQDTLSATSPAKTNRVLNLV  303

Query  641   IGHG---DYSECKPVPSLPWALPRAPSSSAGFPCVQVHSPVAIKARPFSFDSKDNVEEKE  811
                    D  E  P PS PW              + ++  + I   P     ++ V  + 
Sbjct  304   QPRDTSTDRMEAGPAPSAPW--------------LNLYGNLTISLSPI----RNKVAPR-  344

Query  812   DAKEGSSTCSNSGSVNV-GICVDKNLDTETQSGQRIGSDSSCFKRTTEIVILEQKTARST  988
                   STC   G +N  GI   +N  T  +         S   + +   +  +   R  
Sbjct  345   ------STC---GDINKNGIPESRNGVTSNEFHSGFDLKLSFLSKPSSTSVAPELMTRQE  395

Query  989   KRTKGFMPYKRCLAER  1036
             +R +GFMPYKRC+AE+
Sbjct  396   RRGRGFMPYKRCMAEK  411



>gb|KCW69450.1| hypothetical protein EUGRSUZ_F02906 [Eucalyptus grandis]
Length=646

 Score =   122 bits (305),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 145/376 (39%), Positives = 185/376 (49%), Gaps = 72/376 (19%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKV ++    D K V+ IEIPPPRPKRKPMH
Sbjct  285   LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVKDPT--DGK-VETIEIPPPRPKRKPMH  341

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
             PYPRKL+  P++    L  E+P RS SPN SVSE EN+SP SVL  L S+G  S+ +S  
Sbjct  342   PYPRKLLAHPINKES-LPQEQPIRSGSPNFSVSELENQSPMSVLSTLGSDGLGSSGASTP  400

Query  362   aspscvssaT-----GGGILFSKHCNVLVEENGSSSPPPGNLELLPLD------DGRVRE  508
             +  S  SS+       G  LF        EENG     P   E L L        G   E
Sbjct  401   SGSSSPSSSGGAACRAGLSLFESPA----EENG-----PITSEKLELHARGCEASGGAME  451

Query  509   SSTAQYLKLFGKTVLVSGSHTLSSPTSRD------LKAPMATHSFS----------WNLS  640
              + ++ LKLFG TV V+ SH  SS   +       L+ P++  + S           NL 
Sbjct  452   EAPSRTLKLFGMTVSVTDSHWQSSSAIKSESKEMKLQDPLSQDTLSATSPAKTNRVLNLV  511

Query  641   IGHG---DYSECKPVPSLPWALPRAPSSSAGFPCVQVHSPVAIKARPFSFDSKDNVEEKE  811
                    D  E  P PS PW              + ++  + I   P     ++ V  + 
Sbjct  512   QPRDTSTDRMEAGPAPSAPW--------------LNLYGNLTISLSPI----RNKVAPR-  552

Query  812   DAKEGSSTCSNSGSVNV-GICVDKNLDTETQSGQRIGSDSSCFKRTTEIVILEQKTARST  988
                   STC   G +N  GI   +N  T  +         S   + +   +  +   R  
Sbjct  553   ------STC---GDINKNGIPESRNGVTSNEFHSGFDLKLSFLSKPSSTSVAPELMTRQE  603

Query  989   KRTKGFMPYKRCLAER  1036
             +R +GFMPYKRC+AE+
Sbjct  604   RRGRGFMPYKRCMAEK  619



>ref|XP_010246196.1| PREDICTED: protein REVEILLE 1-like [Nelumbo nucifera]
Length=510

 Score =   119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 148/418 (35%), Positives = 203/418 (49%), Gaps = 78/418 (19%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RES G +A +VKPIEIPPPRPKRKPMH
Sbjct  77    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESTGSNASSVKPIEIPPPRPKRKPMH  136

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFAL--DSEGQasadss  355
             PYPRKLV +     G+  PE+P RS SPNLS SE  N+SP SVL  +  D+ G  +++  
Sbjct  137   PYPRKLVHSLQK--GISVPEQPERSRSPNLSTSEA-NQSPKSVLSTVVSDTIGSVASNPH  193

Query  356   pnaspscvssaTG--GGILFSKHCN-------VLVEENGSSSPPPGNLELLPLDDGRV--  502
              ++     S+A    G ++ ++  N        + E++G  S  P      P D      
Sbjct  194   NDSPSPVSSAADANPGSLVLAEQENGNLPSTSSVEEDSGYPSSVPVTATSSPQDQSSTKV  253

Query  503   ----------RESSTAQY----LKLFGKTVLVSGSHTLSSPTSRDLKAPMA---------  613
                       +E +T++     LKLFG+TVLV+ S+  SS      K+P +         
Sbjct  254   DWGSKDNACDKEGATSEASMISLKLFGRTVLVTDSNRPSSSNLGSRKSPPSESCKDSDKN  313

Query  614   ---------THSFSWNLSIGHGDYSECKP----VPSLPWALP-------RAPSSSAGFPC  733
                       +S   N S+     S   P     P + + +P          ++S+  P 
Sbjct  314   DEKPGKTPQQNSTQINFSM-EASRSAWSPWPCGAPPMFYCMPFQKEDPNLVEATSSTLPW  372

Query  734   VQVHSPVAIKARP-FSFDS--------KDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNL  886
               ++  +     P F+ +S         +   +K+  +E S T SN+ S N     +KN 
Sbjct  373   WALYGGLPYPVMPSFNLNSIQTYPDTCLEETSKKDINREESRTGSNTSSTNDAGVGEKNE  432

Query  887   DTETQSGQRIGSDSSCFKRTTEIVILEQKTARS--------TKRTKGFMPYKRCLAER  1036
             D      Q   S+    K    + +L+     +         K TKGF+PYKRCL ER
Sbjct  433   DVVDFQNQEPSSE-DVEKEPASVFLLKPSETSAFSVLKPIPNKCTKGFVPYKRCLTER  489



>gb|EYU38934.1| hypothetical protein MIMGU_mgv1a008764mg [Erythranthe guttata]
Length=363

 Score =   116 bits (290),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 135/349 (39%), Positives = 170/349 (49%), Gaps = 71/349 (20%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWR+IEEHVGTKTAVQIRSHAQKFFSKV RESN  D   VKPIEIPPPRPKRKPMH
Sbjct  60    LYGRAWRKIEEHVGTKTAVQIRSHAQKFFSKVVRESNTIDGIPVKPIEIPPPRPKRKPMH  119

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
             PYPRKLV +P+  +G+   E+   + SP  S SE EN+SPTSVL A+ S+          
Sbjct  120   PYPRKLV-SPLK-MGISIQEENIPAASP--STSEDENQSPTSVLSAVASDSS--------  167

Query  362   aspscvssaTGGGILFSKHCNVLVEENGSSSPPPGNLE-LLPLDDGRVRESSTAQYLKLF  538
             +  +   S T       + C +      SS     NLE  +    G+    S+AQ LKLF
Sbjct  168   SDLALNDSDTEAPKFLPEDCQI----GNSSEDERKNLESEISSSCGQESNESSAQSLKLF  223

Query  539   GKTVLVSGS-HTLSSPTSRDLKAPMATHSFSWNLSIGHGDYSECKPVPSLPWALPRAPSS  715
             GK +L++ +  T    T+      + T + S            C    S  W        
Sbjct  224   GKILLINSTVETCDRSTTPVYSNEIKTSNIS------------CTQTTSDKW--------  263

Query  716   SAGFP--CVQVHSPVAIKARPFSFDSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLD  889
                FP   ++VH+P  +KA+P   D K            SST SNS              
Sbjct  264   -GPFPWLTLEVHNPTPVKAQPLYNDEKTF---------SSSTGSNS--------------  299

Query  890   TETQSGQRIGSDSSCFKRTTEIVILEQKTARSTKRTKGFMPYKRCLAER  1036
                   QR G D   F       +  + +  S    +GFMPYKRCL ++
Sbjct  300   ----CPQRRGEDERAFSSNK---LSRKISGSSVNSRRGFMPYKRCLVKQ  341



>ref|XP_006400263.1| hypothetical protein EUTSA_v10013821mg [Eutrema salsugineum]
 dbj|BAJ34195.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ41716.1| hypothetical protein EUTSA_v10013821mg [Eutrema salsugineum]
Length=380

 Score =   116 bits (290),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 129/343 (38%), Positives = 168/343 (49%), Gaps = 57/343 (17%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RE+ G +  +++PI IPPPRPKRK   
Sbjct  72    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVAREATGGNGSSLEPIVIPPPRPKRK---  128

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSE--GQasadss  355
                    + P       + ++ +RS+SP    SE++NRSPTSVL  + SE  G + ++S 
Sbjct  129   ------PMHPYPRKFGNEADQTSRSVSP----SERDNRSPTSVLSTVGSEALGSSDSNSP  178

Query  356   pnaspscvssaTGGGILFSKHCNVLVEENGSSSPPPGNLELLPLDDGRVRESSTAQYLKL  535
               +     S++    +  + +    +E       P    E L   +  V+E  T Q LKL
Sbjct  179   DRSLSPVSSASPPAALTTTANAPEELETLKLELFP---RERLLYRESLVKE-PTKQSLKL  234

Query  536   FGKTVLVSGSHTLSSPTSRDLKAPMATHSFSWNLSIGHGDYSECKPVPSLPWALPRAPSS  715
             FGKTVLVS S   SS T+                       S C   P  P  LPR  S 
Sbjct  235   FGKTVLVSDSGMSSSLTT-----------------------STCCKSPIQP--LPRKLSR  269

Query  716   SAGFP-CVQVHSPVAIKARPFSFDSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDT  892
             S  FP  +       ++ R    DS   V+      EGSST SN+GSV+     DKN + 
Sbjct  270   SETFPMIINPQKEEEVENRCL-VDSGKAVQ-----NEGSSTGSNTGSVDDTGHTDKNSEP  323

Query  893   ETQSGQRIGSDSSCFKRTTEIVILEQKTARSTKRTKGFMPYKR  1021
             ET   Q        FK +      E +   S   ++GF PYK+
Sbjct  324   ETMVCQWE------FKPSERSAFSELRRTNSESNSRGFGPYKK  360



>ref|XP_007141962.1| hypothetical protein PHAVU_008G240700g [Phaseolus vulgaris]
 gb|ESW13956.1| hypothetical protein PHAVU_008G240700g [Phaseolus vulgaris]
Length=449

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 141/371 (38%), Positives = 175/371 (47%), Gaps = 45/371 (12%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSK+ RES+G+     + IEIPPPRPKRKP+H
Sbjct  77    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKIVRESSGNSTVLEESIEIPPPRPKRKPIH  136

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
             PYPRKL+  P   +   D     RS S   S   +EN SP SVL  + SE   S+DS   
Sbjct  137   PYPRKLIEIPKKEISNSD--HTPRSNSLKSSDFGQENNSPKSVLSTVVSENLGSSDSDTP  194

Query  362   aspscvssaTGG---GILFSKHCNVLVEENGS------SSPPPGNLELLPLDD----GRV  502
                    S+  G               EE GS         P   LEL   +        
Sbjct  195   TGSLSPVSSISGVPTNRFPLAGPKTSFEEEGSLPNSAHDEQPLVKLELFHKESVSNKDDA  254

Query  503   RESSTAQYLKLFGKTVLVSGSHTLSSPTSRDLKAPMATHSFSWNLSIGHGDYSECKPVPS  682
              E S+ + LKLFG T+LV+ +    S  +   K   A  ++   L  G  D +E  P   
Sbjct  255   AEESSGRTLKLFGTTLLVTDTSKPFSLRTEPFKPVPAAATYLMQLQNGCSDLAEG-PASI  313

Query  683   LP-WALPRAPSSSAGFPCVQVHSPVAIKARPFSFDSKDNVEEKEDAKEGSSTCSNSGSVN  859
             +P W        S   P V +H     K     + +  + E KE  KEGS T SN+ SVN
Sbjct  314   VPRWTF------SHNAPSVPLHRETKGKHL---YSNLGDFEHKEVQKEGSWTGSNTSSVN  364

Query  860   VGICVDKNLDTETQSGQRIGSDSSCF-KRTTEIVILEQKT-----------ARSTKRTKG  1003
              G   DK+ D       +  S   CF KR  ++  L                R+    KG
Sbjct  365   DGDNTDKSDD-------QAKSHVHCFSKRDGQLHFLGHTKPSETSAIFELRVRAKTCGKG  417

Query  1004  FMPYKRCLAER  1036
             F+PYKRC+A R
Sbjct  418   FVPYKRCMAGR  428



>ref|XP_006287913.1| hypothetical protein CARUB_v10001147mg [Capsella rubella]
 gb|EOA20811.1| hypothetical protein CARUB_v10001147mg [Capsella rubella]
Length=390

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 103/222 (46%), Positives = 118/222 (53%), Gaps = 52/222 (23%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RE+ G D  +V+PI IPPPRPKRKP H
Sbjct  72   LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVAREATGGDGSSVEPIVIPPPRPKRKPAH  131

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
                     P       + ++ +RS+SP    SE+ENRSPTSVL  + SE          
Sbjct  132  ---------PYPRKFGNEADRTSRSVSP----SERENRSPTSVLSNVGSEAL--------  170

Query  362  aspscvssaTGGGILFSKHCNVLVEENGSSSPPPG--------------NLELLPLDDGR  499
                        G L S   N  +    S+SPP                 LEL P +   
Sbjct  171  ------------GSLDSSSPNRSLSPVSSASPPAALTTTANAPEEHETLKLELFPKESLL  218

Query  500  VRESS----TAQYLKLFGKTVLVSGSHTLSS-PTSRDLKAPM  610
              ESS    T Q LKLFGKTVLVS S   SS  TS   K+P+
Sbjct  219  NTESSVKEPTKQSLKLFGKTVLVSDSGMSSSLTTSTYCKSPI  260



>emb|CDY02714.1| BnaC02g07210D [Brassica napus]
Length=369

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 167/345 (48%), Gaps = 60/345 (17%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWR+IEEHVGTKTAVQIRSHAQKFFSKV RES+G +  +++PI IPPPRPKR+   
Sbjct  63    LYGRAWRKIEEHVGTKTAVQIRSHAQKFFSKVARESSGGNGNSLEPIVIPPPRPKRR---  119

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
                    + P       + ++ +RS+SP    SE++NRS TSVL  + SE   S+DS   
Sbjct  120   ------PMHPYPRKLGNEGDQTSRSVSP----SERDNRSLTSVLSTVGSEAFGSSDSHSP  169

Query  362   aspscvssaTGGGILFSKHCNVLVEENGSSSPPPGNLELLPLDDGRVRESSTAQYLKLFG  541
                    S+       S    ++   N         LEL P +    RE    Q LKLFG
Sbjct  170   NRSLSPVSSA------SPPAALVTTANAPEELETLKLELFPAERLLNREEPKKQSLKLFG  223

Query  542   KTVLVSGSHTLSSPTSRDLKAPMATHSFSWNLSIGHGDYSECK-PVPSLPWALPRAPSSS  718
             KTVLVS S   SSPT+                         CK P+  LP  L R  +  
Sbjct  224   KTVLVSDSDMSSSPTTY------------------------CKSPIQPLPRKLSRLET--  257

Query  719   AGFPCV----QVHSPVAIKARPFSFDSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNL  886
               FP V    +      I+  P   +  D+  EK    EGSST SN+GSV+     +K+ 
Sbjct  258   --FPVVINPQEELLSCWIQVPPKQEECLDS--EKGVQNEGSSTGSNTGSVDDTGHTEKSS  313

Query  887   DTETQSGQRIGSDSSCFKRTTEIVILEQKTARSTKRTKGFMPYKR  1021
             + ET    R       FK + +    E +   S   ++GF PYK+
Sbjct  314   EPETMVCPRE------FKPSEKSAFSELRRRNSESNSRGFGPYKK  352



>ref|XP_003519315.1| PREDICTED: myb-like protein H-like [Glycine max]
 gb|KHN41033.1| Protein CCA1 [Glycine soja]
Length=436

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 140/362 (39%), Positives = 180/362 (50%), Gaps = 40/362 (11%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSK+ RES+ +     + IEIPPPRPKRKP+H
Sbjct  77    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKILRESSRNSTTLEESIEIPPPRPKRKPIH  136

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSE--GQasadss  355
             PYPRKLV  P + +   + E P RS S   S   +EN SP SVL  + SE  G + +D+ 
Sbjct  137   PYPRKLVEIPKTEIS--NSELPLRSNSLKPSDFGQENNSPKSVLSTVVSETLGSSDSDTP  194

Query  356   pnaspscvssaTGGGILFS-KHCNVLVEENGS------SSPPPGNLELLPLDDGRVR---  505
                     S +      F         EE GS         PP  LE    +    +   
Sbjct  195   TRCLSPTSSISDVPTNRFPLAEPKTSFEEEGSPPSSAHDKQPPVKLEFFHKESVSTKDDA  254

Query  506   -ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDLKAPMATHSFSWNLSIGHGDYSECKPVPS  682
              E S+ + LKLFG T+L++ +   SSPT    K   A   +   L  G  D +E  P   
Sbjct  255   TEESSGRTLKLFGTTLLITDTCKPSSPTMEPWKPTPAAAMYLMQLQNGCSDITE-GPASI  313

Query  683   LP-WALPRAPSSSAGFPCVQVHSPVAIKARPFSFDSKDNVEE---KEDAKEGSSTCSNSG  850
             +P W+LP         P + +H        P       N+ E   KE  KEGS T SN+ 
Sbjct  314   VPWWSLPH------NTPFMPLH------KEPKGNHIYSNLGEFVHKEVQKEGSWTGSNTS  361

Query  851   SVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVILEQKTARSTKRTKGFMPYKRCLA  1030
             S+N G  ++K+ D       +  S   CF ++    I E +  R     KGF+P KR +A
Sbjct  362   SINDGDNIEKSDD-------QAKSHVHCFSKSEISSISELR-VRPKTCGKGFVPCKRRMA  413

Query  1031  ER  1036
             ER
Sbjct  414   ER  415



>ref|XP_002526271.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36108.1| conserved hypothetical protein [Ricinus communis]
Length=463

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 142/389 (37%), Positives = 180/389 (46%), Gaps = 60/389 (15%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAK-TVKPIEIppprpkrkpm  178
             LYGR WR+I+  +GTK+AVQIRSHAQKFFSKV RESNG  A+ +VK IEIPPPRPKRKPM
Sbjct  33    LYGRGWRKIQGFIGTKSAVQIRSHAQKFFSKVVRESNGGGAESSVKTIEIPPPRPKRKPM  92

Query  179   hpyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFAL-----DSEGQas  343
             HPYPRK      SV GML   +  RS SPNLSVSE+EN+SP SVL  L           S
Sbjct  93    HPYPRK------SVEGMLVSNQLERSPSPNLSVSEEENQSPNSVLSPLGFSDSLGSSSIS  146

Query  344   adsspnaspscvssaTGGGILFSKHCNVLVEENG-------SSSPPPGN----LELLPLD  490
                + ++  + + SAT   I   +H +     NG       SS+P   N    LEL P+D
Sbjct  147   EQHNGSSCATDMYSATLLPIQKQEHSSSTEHHNGSSPLLQFSSAPFEDNCLSKLELDPMD  206

Query  491   ----DGRVRESSTAQYLKLFGKTVLVSGSHTLSSPTSRDLKA------------------  604
                 +G          +KLFG+TV V+ S       S +L +                  
Sbjct  207   VVCTEGDAATIVPFTSIKLFGRTVSVTHSPKQCLEDSENLLSVTYKISEDDPDIGNDKGV  266

Query  605   -PMATHSFSWNLSIGHGDYSECKPVPSLPWALPRAPSSSA-GFPCVQVHSPV---AIKAR  769
               +        LS+G G  + C  +P     + +          C+Q   P+     +  
Sbjct  267   QTLTRKQLDTQLSLGIGTAANCNSLPFSTTPVHQVLEQQGDNVNCLQSSPPLPWAVFQDL  326

Query  770   PFSFDSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTT  949
             PFSF          D +   + C    S    I      D  + SG   GS S       
Sbjct  327   PFSFLDSCGQSSHGDPR---NCCVEERSKEKDI-----HDERSCSGLNTGSASDVEHHCQ  378

Query  950   EIVILEQKTARSTKRTKGFMPYKRCLAER  1036
              +       AR  KRT GF+PYKRCLAER
Sbjct  379   SLSA--NGRARLHKRTNGFVPYKRCLAER  405



>ref|NP_568344.2| myb family transcription factor RVE1 [Arabidopsis thaliana]
 sp|F4KGY6.1|RVE1_ARATH RecName: Full=Protein REVEILLE 1 [Arabidopsis thaliana]
 gb|AED92410.1| myb family transcription factor [Arabidopsis thaliana]
Length=387

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 134/364 (37%), Positives = 168/364 (46%), Gaps = 88/364 (24%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEHVG+KTAVQIRSHAQKFFSKV RE+ G D  +V+PI IPPPRPKRKP H
Sbjct  72    LYGRAWRRIEEHVGSKTAVQIRSHAQKFFSKVAREATGGDGSSVEPIVIPPPRPKRKPAH  131

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
                      P       + ++ +RS+SP    SE++ +SPTSVL  + SE   S      
Sbjct  132   ---------PYPRKFGNEADQTSRSVSP----SERDTQSPTSVLSTVGSEALCS------  172

Query  362   aspscvssaTGGGILFSKHCNVLVEENGSSSPPPG--------------NLELLPLDDGR  499
                           L S   N  +    S+SPP                 LEL P +   
Sbjct  173   --------------LDSSSPNRSLSPVSSASPPAALTTTANAPEELETLKLELFPSERLL  218

Query  500   VRESS----TAQYLKLFGKTVLVSGSHTLSSPTSRDLKAPMATHSFSWNLSIGHGDYSEC  667
              RESS    T Q LKLFGKTVLVS S   SS         + T ++             C
Sbjct  219   NRESSIKEPTKQSLKLFGKTVLVSDSGMSSS---------LTTSTY-------------C  256

Query  668   KPVPSLPWALPRAPSSSAGFPCVQVHSPVAIKARPFSFDSKDNVEE------KEDAKEGS  829
             K  P  P  LPR  SSS   P ++      +         +++VE       K    EGS
Sbjct  257   K-SPIQP--LPRKLSSSKTLPIIRNSQEELLSCWIQVPLKQEDVENRCLDSGKAVQNEGS  313

Query  830   STCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVILEQKTARSTKRTKGFM  1009
             ST SN+GSV+     +K  + ET   Q        FK +      E +   S   ++GF 
Sbjct  314   STGSNTGSVDDTGHTEKTTEPETMLCQWE------FKPSERSAFSELRRTNSESNSRGFG  367

Query  1010  PYKR  1021
             PYK+
Sbjct  368   PYKK  371



>emb|CDX85462.1| BnaA02g03510D [Brassica napus]
Length=373

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 124/356 (35%), Positives = 161/356 (45%), Gaps = 79/356 (22%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWR+IEEHVGTKTAVQIRSHAQKFFSKV RE++G +  +++PI IPPPRPKR+   
Sbjct  63    LYGRAWRKIEEHVGTKTAVQIRSHAQKFFSKVAREASGGNVSSLEPIVIPPPRPKRR---  119

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
                    + P       + ++ +RS+SP    SE++NRSP+SVL  ++SE          
Sbjct  120   ------PMHPYPRKLGNEGDQTSRSVSP----SERDNRSPSSVLSTVESE----------  159

Query  362   aspscvssaTGGGILFSKHCNVLVEENGSSSPPPG--------------NLELLPLDDGR  499
                         G   S   N  +    S+SPP                 LEL P +   
Sbjct  160   ----------AFGSSDSHSPNRSLSPVSSASPPAALATTANAPEEFETLKLELFPAERLL  209

Query  500   VRESSTAQYLKLFGKTVLVSGSHTLSSPTSRDLKAPMATHSFSWNLSIGHGDYSECKPVP  679
              RE  T Q LKLFGKTVLV      S P          T+               CK  P
Sbjct  210   NREEPTKQSLKLFGKTVLV------SDPDMSSSPTTSTTY---------------CK-SP  247

Query  680   SLPWALPRAPSSSAGFPCVQVHSPVAIKARPFSFDSKDNVEEKEDA--KEGSSTCSNSGS  853
               P  LPR  S+S  FP V       +         ++   E E     EGSST SN+GS
Sbjct  248   IQP--LPRKLSTSETFPMVINPQEERLSCWLQVPHKQEECLESEKGVQNEGSSTGSNTGS  305

Query  854   VNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVILEQKTARSTKRTKGFMPYKR  1021
             V+     +K+ + ET   Q        FK +      E +   S   ++GF  YK+
Sbjct  306   VDDTGHTEKSSEPETMVCQW------KFKPSERSAFSELRRRNSESNSRGFGSYKK  355



>dbj|BAB10517.1| unnamed protein product [Arabidopsis thaliana]
Length=385

 Score =   107 bits (266),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 134/364 (37%), Positives = 168/364 (46%), Gaps = 88/364 (24%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEHVG+KTAVQIRSHAQKFFSKV RE+ G D  +V+PI IPPPRPKRKP H
Sbjct  70    LYGRAWRRIEEHVGSKTAVQIRSHAQKFFSKVAREATGGDGSSVEPIVIPPPRPKRKPAH  129

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
                      P       + ++ +RS+SP    SE++ +SPTSVL  + SE   S      
Sbjct  130   ---------PYPRKFGNEADQTSRSVSP----SERDTQSPTSVLSTVGSEALCS------  170

Query  362   aspscvssaTGGGILFSKHCNVLVEENGSSSPPPG--------------NLELLPLDDGR  499
                           L S   N  +    S+SPP                 LEL P +   
Sbjct  171   --------------LDSSSPNRSLSPVSSASPPAALTTTANAPEELETLKLELFPSERLL  216

Query  500   VRESS----TAQYLKLFGKTVLVSGSHTLSSPTSRDLKAPMATHSFSWNLSIGHGDYSEC  667
              RESS    T Q LKLFGKTVLVS S   SS         + T ++             C
Sbjct  217   NRESSIKEPTKQSLKLFGKTVLVSDSGMSSS---------LTTSTY-------------C  254

Query  668   KPVPSLPWALPRAPSSSAGFPCVQVHSPVAIKARPFSFDSKDNVEE------KEDAKEGS  829
             K  P  P  LPR  SSS   P ++      +         +++VE       K    EGS
Sbjct  255   K-SPIQP--LPRKLSSSKTLPIIRNSQEELLSCWIQVPLKQEDVENRCLDSGKAVQNEGS  311

Query  830   STCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVILEQKTARSTKRTKGFM  1009
             ST SN+GSV+     +K  + ET   Q        FK +      E +   S   ++GF 
Sbjct  312   STGSNTGSVDDTGHTEKTTEPETMLCQWE------FKPSERSAFSELRRTNSESNSRGFG  365

Query  1010  PYKR  1021
             PYK+
Sbjct  366   PYKK  369



>ref|XP_002873821.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50080.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata]
Length=387

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 133/364 (37%), Positives = 166/364 (46%), Gaps = 88/364 (24%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEHVG+KTAVQIRSHAQKFFSKV RE+ G D  +V+PI IPPPRPKRKP H
Sbjct  72    LYGRAWRRIEEHVGSKTAVQIRSHAQKFFSKVAREATGGDGSSVEPIVIPPPRPKRKPAH  131

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
                      P       D ++ +R +SP    SE++N+SPTSVL  + SE          
Sbjct  132   ---------PYPRKFGNDADQTSRPVSP----SERDNQSPTSVLSTVGSEAL--------  170

Query  362   aspscvssaTGGGILFSKHCNVLVEENGSSSPPPG--------------NLELLPLDDGR  499
                         G L S   N  +    S+SPP                 LEL P +   
Sbjct  171   ------------GSLDSSSPNRSLSPVSSASPPAALTTTANAPEELETLKLELFPREILL  218

Query  500   VRESS----TAQYLKLFGKTVLVSGSHTLSSPTSRDLKAPMATHSFSWNLSIGHGDYSEC  667
              RESS    T + LKLFGKTVLVS           D     +  S ++           C
Sbjct  219   NRESSIKEPTKRSLKLFGKTVLVS-----------DSGMSSSLTSSTY-----------C  256

Query  668   KPVPSLPWALPRAPSSSAGFPCVQVHSPVAIKARPFSFDSKDNVEE------KEDAKEGS  829
             K  P  P  LPR  SSS   P ++      +         +++VE       K    EGS
Sbjct  257   K-SPIQP--LPRKLSSSKTLPIIRNSQEELLSCWIQVPLKQEDVENRCLDSGKAVQNEGS  313

Query  830   STCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVILEQKTARSTKRTKGFM  1009
             ST SN+GSV+     DK  + ET   Q        FK +      E +   S   ++GF 
Sbjct  314   STGSNTGSVDDTGHTDKTSEPETMVWQW------EFKPSERSAFSELRRTNSESNSRGFG  367

Query  1010  PYKR  1021
             PYK+
Sbjct  368   PYKK  371



>gb|KDO57321.1| hypothetical protein CISIN_1g0126251mg, partial [Citrus sinensis]
Length=335

 Score =   104 bits (260),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 90/111 (81%), Gaps = 2/111 (2%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            L+GRAWR+IEEHVGTKTAVQIRSHAQKFFSKV RESNG     V+P+EIPPPRPKRKPMH
Sbjct  77   LFGRAWRKIEEHVGTKTAVQIRSHAQKFFSKVVRESNGCSTSPVEPVEIPPPRPKRKPMH  136

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG  334
            PYPRKL   PV     L+PE    SLSP LSVSE+EN+SPTSVLFA+ S+ 
Sbjct  137  PYPRKLAHPPVK--ESLNPELSRTSLSPILSVSERENQSPTSVLFAIGSDA  185



>gb|KDO57322.1| hypothetical protein CISIN_1g0126251mg, partial [Citrus sinensis]
Length=353

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 90/111 (81%), Gaps = 2/111 (2%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            L+GRAWR+IEEHVGTKTAVQIRSHAQKFFSKV RESNG     V+P+EIPPPRPKRKPMH
Sbjct  77   LFGRAWRKIEEHVGTKTAVQIRSHAQKFFSKVVRESNGCSTSPVEPVEIPPPRPKRKPMH  136

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG  334
            PYPRKL   PV     L+PE    SLSP LSVSE+EN+SPTSVLFA+ S+ 
Sbjct  137  PYPRKLAHPPVK--ESLNPELSRTSLSPILSVSERENQSPTSVLFAIGSDA  185



>ref|XP_004490782.1| PREDICTED: uncharacterized protein LOC101488702 isoform X1 [Cicer 
arietinum]
Length=427

 Score =   105 bits (261),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 135/373 (36%), Positives = 186/373 (50%), Gaps = 58/373 (16%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSK+ R+++G+    V+ IEIPPPRPKRKP+H
Sbjct  64    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKINRDTDGNTTTLVESIEIPPPRPKRKPIH  123

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFAL--------DSE--  331
             PYPRKLV    + +  L  E+P RS S       +EN+SP SVL ++        DS+  
Sbjct  124   PYPRKLVEIRKNEISNL--EQPLRSNSIVSLDFGQENKSPKSVLSSVALETLGFSDSDSP  181

Query  332   -GQasadsspnaspscvssaTGGGILFSKHCNVLVEE--NGSS-------SPPPGNLELL  481
              G  S  SS +A  +         + F +     ++E  +GS+        P   + E +
Sbjct  182   TGSLSPVSSMSAVHTSSFPLLERKLSFEQDMPPQIDELNDGSAHDEQLLEKPELFSKEHV  241

Query  482   PLDDGRVRESSTAQYLKLFGKTVLVSGSHTLSSPTSRDLKAPMATHSFSWNLSIGHGDYS  661
                D  V ES   + LKLFG T+LV  +     P+S  ++A  +  + + +L       S
Sbjct  242   STKDEAVDESP-GRTLKLFGTTLLVKDT---CKPSSTSMEASNSKQTTTMHLL--QQPQS  295

Query  662   ECKPVPSLP----WALPRAPSSSAGFPCVQVHSPVAIKARPFSFDSKDNVEEKEDAKEGS  829
             EC  +        W + R   +SA  P  + H     + +P    + +  E+KE  KEGS
Sbjct  296   ECSDISHTTVVPWWTISR---NSAFKPLHKEH-----EEKPL-HSNHEECEDKETQKEGS  346

Query  830   STCSNSGSVNVGICVDKNLDTETQSGQ--RIGSDSSCFKRTTEIV--ILEQKTARSTKRT  997
                          CV  N  + T  G+   I +D         +V  I   +T R     
Sbjct  347   -------------CVGSNNTSSTNDGESNEISNDQDKIDHVNYLVGHITPSETVRHKTFG  393

Query  998   KGFMPYKRCLAER  1036
             KGF+PYKRC+AER
Sbjct  394   KGFVPYKRCMAER  406



>ref|XP_009126176.1| PREDICTED: protein REVEILLE 1-like [Brassica rapa]
Length=371

 Score =   104 bits (259),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 125/357 (35%), Positives = 165/357 (46%), Gaps = 82/357 (23%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWR+IEEHVGTKTAVQIRSHAQKFFSKV RES+G +  +++PI IPPPRPKR+   
Sbjct  63    LYGRAWRKIEEHVGTKTAVQIRSHAQKFFSKVARESSGGNVSSLEPIVIPPPRPKRR---  119

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
                    + P       + ++ +RS+SP    SE++NRSPTSVL  + SE          
Sbjct  120   ------PMHPYPRKLGNEGDQTSRSVSP----SERDNRSPTSVLSTVGSE----------  159

Query  362   aspscvssaTGGGILFSKHCNVLVEENGSSSPP---------PGNLELLPLD----DGRV  502
                         G   S   N  +    S+SPP         P   E L L+    +  +
Sbjct  160   ----------AFGSSDSYSPNRSLSPVSSASPPAALATTANAPEEFETLKLELFPAERLL  209

Query  503   RESSTAQYLKLFGKTVLVSGSHTLSSPTSRDLKAPMATHSFSWNLSIGHGDYSECKPVPS  682
              +    Q LKLFGKTVLV      S P          T+               CK  P 
Sbjct  210   NKELKKQSLKLFGKTVLV------SDPDMSSSPTTSTTY---------------CK-SPI  247

Query  683   LPWALPRAPSSSAGFPCV----QVHSPVAIKARPFSFDSKDNVEEKEDAKEGSSTCSNSG  850
              P  LPR  S+S  FP V    +      ++  P   +  ++  EK    EGSST SN+G
Sbjct  248   QP--LPRKLSTSETFPMVINPQEERLSCWLQVPPKQEECLES--EKGVQNEGSSTGSNTG  303

Query  851   SVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVILEQKTARSTKRTKGFMPYKR  1021
             SV+     +K+ + ET   Q        FK +      E +   S   ++GF PYK+
Sbjct  304   SVDDTGHTEKSSEPETMVCQW------EFKPSERSAFSELRRRNSESNSRGFGPYKK  354



>ref|XP_008368744.1| PREDICTED: protein REVEILLE 1-like [Malus domestica]
Length=238

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 82/116 (71%), Gaps = 12/116 (10%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGRAWR+IEEHVG KTAVQIRSHAQKFFSKV R  NG +  + +PI+IPPPRPKRKPM 
Sbjct  111  LYGRAWRKIEEHVGAKTAVQIRSHAQKFFSKVARXPNGGNTASEEPIDIPPPRPKRKPMR  170

Query  182  pyprkLVITPVSVVGMLDPEKPT-----RSLSPNLSVSEKENRSPTSVLFALDSEG  334
            PY       P  +V  L+ E  T     RS SPNLSVSE+EN+SP SVL  + S+ 
Sbjct  171  PY-------PRKLVHPLNKETSTVEQSARSASPNLSVSEQENQSPKSVLCVIGSDA  219



>ref|XP_011000774.1| PREDICTED: protein REVEILLE 7-like [Populus euphratica]
Length=488

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 87/111 (78%), Gaps = 5/111 (5%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGR WRRI+EHVGTKTAVQIRSHAQK+FSKV R S G +  ++KPIEIPPPRPKRKP H
Sbjct  78   LYGRGWRRIQEHVGTKTAVQIRSHAQKYFSKVVRYSGGSNESSLKPIEIPPPRPKRKPAH  137

Query  182  pyprkLVITPVSVV-GMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSE  331
            PYPRK    PV+V+ G     +  RS SPN SVSEKEN+SPTSVL A+ S+
Sbjct  138  PYPRK----PVNVLEGTGASSQLERSPSPNSSVSEKENQSPTSVLSAMASD  184



>gb|KHG08399.1| Protein LHY -like protein [Gossypium arboreum]
Length=478

 Score =   103 bits (256),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 86/113 (76%), Gaps = 5/113 (4%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGR WR+IEEHVGTKTAVQIRSHAQKFFSKV RESN     +VK IEIPPPRPKRKP H
Sbjct  76   LYGRGWRQIEEHVGTKTAVQIRSHAQKFFSKVARESNDGFESSVKSIEIPPPRPKRKPTH  135

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVL--FALDSEG  334
            PYPRK V    +V G+    +  RSLSPN SVSE++N+SP+SVL  F  D+ G
Sbjct  136  PYPRKSV---TAVKGISPLSQLERSLSPNHSVSEQDNKSPSSVLSPFVFDAMG  185



>ref|XP_004162953.1| PREDICTED: uncharacterized LOC101217341 [Cucumis sativus]
Length=480

 Score =   102 bits (255),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 87/112 (78%), Gaps = 3/112 (3%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGR WR+I+EHVGTKTAVQIRSHAQKFFSKV RES+G +  ++ PIEIPPPRPKRKP+H
Sbjct  76   LYGRGWRQIKEHVGTKTAVQIRSHAQKFFSKVVRESSGSNESSINPIEIPPPRPKRKPLH  135

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQ  337
            PYPRK V +  ++    + E   RS SPNLS++EKE  SPTSVL A  S+ Q
Sbjct  136  PYPRKAVDSLKAISVARESE---RSPSPNLSLAEKETHSPTSVLTAFSSDDQ  184



>ref|XP_008439595.1| PREDICTED: protein REVEILLE 2-like [Cucumis melo]
Length=482

 Score =   102 bits (254),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 87/112 (78%), Gaps = 3/112 (3%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGR WR+I+EHVGTKTAVQIRSHAQKFFSKV RES+G +  ++ PIEIPPPRPKRKP+H
Sbjct  76   LYGRGWRQIKEHVGTKTAVQIRSHAQKFFSKVVRESSGSNESSINPIEIPPPRPKRKPLH  135

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQ  337
            PYPRK V +  ++    + E   RS SPNLS++EKE  SPTSVL A  S+ Q
Sbjct  136  PYPRKAVDSLKAISVARESE---RSPSPNLSLAEKETHSPTSVLTAFSSDDQ  184



>ref|XP_004137575.1| PREDICTED: uncharacterized protein LOC101217341 [Cucumis sativus]
Length=490

 Score =   102 bits (255),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 87/112 (78%), Gaps = 3/112 (3%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGR WR+I+EHVGTKTAVQIRSHAQKFFSKV RES+G +  ++ PIEIPPPRPKRKP+H
Sbjct  86   LYGRGWRQIKEHVGTKTAVQIRSHAQKFFSKVVRESSGSNESSINPIEIPPPRPKRKPLH  145

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQ  337
            PYPRK V +  ++    + E   RS SPNLS++EKE  SPTSVL A  S+ Q
Sbjct  146  PYPRKAVDSLKAISVARESE---RSPSPNLSLAEKETHSPTSVLTAFSSDDQ  194



>ref|XP_002317724.1| EARLY-PHYTOCHROME-RESPONSIVE1 family protein [Populus trichocarpa]
 gb|EEE95944.1| EARLY-PHYTOCHROME-RESPONSIVE1 family protein [Populus trichocarpa]
Length=487

 Score =   102 bits (254),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 87/111 (78%), Gaps = 5/111 (5%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGR WRRI+EHVGTKTAVQIRSHAQK+FSKV RE  G +  ++KPIEIPPPRPKRKP H
Sbjct  78   LYGRGWRRIQEHVGTKTAVQIRSHAQKYFSKVVREPGGINESSLKPIEIPPPRPKRKPAH  137

Query  182  pyprkLVITPVSVVGMLDP-EKPTRSLSPNLSVSEKENRSPTSVLFALDSE  331
            PYPRK    PV+V+ +     +  RS SPN SVSEKEN+SPTSVL AL S+
Sbjct  138  PYPRK----PVNVLEVTGASSQLERSPSPNSSVSEKENQSPTSVLSALASD  184



>ref|XP_010492675.1| PREDICTED: protein REVEILLE 1-like [Camelina sativa]
Length=392

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 141/372 (38%), Positives = 175/372 (47%), Gaps = 103/372 (28%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEHVG+KTAVQIRSHAQKFFSKV RE+ G D  +V+PI IPPPRPKRKP H
Sbjct  73    LYGRAWRRIEEHVGSKTAVQIRSHAQKFFSKVAREATGGDGSSVEPIVIPPPRPKRKPAH  132

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
             PYPRKL           + +  +RS+SP    SE++NRSPTSVL  + SE          
Sbjct  133   PYPRKL---------GNEADGTSRSVSP----SERDNRSPTSVLSTVGSEAL--------  171

Query  362   aspscvssaTGGGILFSKHCNVLVEENGSSSPPPG--------------NLELLPLD---  490
                         G L S   N  +    S+SPP                 LEL P +   
Sbjct  172   ------------GSLDSSSPNRSLSPVSSASPPATLTTTANAPEEHETLKLELFPRERLL  219

Query  491   --DGRVRESSTAQYLKLFGKTVLVSGSHTLSSPTSRDLKAPMATHSFSWNLSIGHGDYSE  664
               +  V+E +    +KLFGKTVLVS S   SS         + T ++             
Sbjct  220   NTESSVKEPTKQSLIKLFGKTVLVSDSGMSSS---------LTTSTY-------------  257

Query  665   CKPVPSLPWALPRAPSSSAGFPCVQ----------VHSPVA---IKARPFSFDSKDNVEE  805
             CK  P  P  LPR  SSS   P ++          +  P+    ++ R    DS   V+ 
Sbjct  258   CK-SPIQP--LPRKLSSSKTLPIIKNGQEELSSCWIQVPLKQEDVENR--CLDSGKAVQ-  311

Query  806   KEDAKEGSSTCSNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVILEQKTARS  985
                  EGSST SNSGSV+     DK  + ET   Q        FK +      E + A S
Sbjct  312   ----NEGSSTGSNSGSVDDTGHTDKTSEPETMVCQWE------FKPSERSAFSELRRANS  361

Query  986   TKRTKGFMPYKR  1021
                 +GF PYK+
Sbjct  362   ESNARGFGPYKK  373



>ref|XP_007037069.1| Homeodomain-like superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY21570.1| Homeodomain-like superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=484

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 86/111 (77%), Gaps = 3/111 (3%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGR WR+IEEHVGTKTAVQIRSHAQKFFSKV RESNG    ++ PIEIPPPRPKRKP+H
Sbjct  76   LYGRGWRQIEEHVGTKTAVQIRSHAQKFFSKVVRESNGGFEGSINPIEIPPPRPKRKPVH  135

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG  334
            PYPRK V    S+ G+    +P RS SP+  V E++N+SPTSVL AL S+ 
Sbjct  136  PYPRKSVD---SLKGISPSSEPERSPSPSQFVREQDNKSPTSVLSALTSDA  183



>ref|XP_010420440.1| PREDICTED: protein REVEILLE 1-like [Camelina sativa]
 ref|XP_010420441.1| PREDICTED: protein REVEILLE 1-like [Camelina sativa]
Length=392

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 107/193 (55%), Gaps = 24/193 (12%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RE+ G D  +V+PI IPPPRPKRKP H
Sbjct  73   LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVAREATGGDGSSVEPIVIPPPRPKRKPAH  132

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
                     P       + +  +R +SP    SE++NRSPTSVL  + SE   S DSS  
Sbjct  133  ---------PYPRKFGNEADGTSRPVSP----SEQDNRSPTSVLSTVGSEALCSLDSSSP  179

Query  362  aspscvssaTGGGILFSKHCNVLVEENGSSSPPPGNLELLPLD-----DGRVRESSTAQY  526
                   S+       +   N   E           LEL P +     +  V+E +    
Sbjct  180  NQSLSPVSSASPPAALTTTANAPEEHETL------KLELFPRERLLHKESSVKEPTKQSL  233

Query  527  LKLFGKTVLVSGS  565
            +KLFGKTV+VS S
Sbjct  234  IKLFGKTVVVSDS  246



>ref|XP_010099675.1| Myb-like protein G [Morus notabilis]
 gb|EXB80252.1| Myb-like protein G [Morus notabilis]
Length=447

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 77/108 (71%), Gaps = 11/108 (10%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpm-  178
            LYGR WR+IEEHVGTK+AVQIRSHAQKFFSKV R S G    ++KPIEIPPPRPKRKPM 
Sbjct  56   LYGRGWRQIEEHVGTKSAVQIRSHAQKFFSKVVRGSTGSVESSIKPIEIPPPRPKRKPMH  115

Query  179  ---hpyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVL  313
                     L +TPVS+       +P RS SPNLS ++K  +SPTSVL
Sbjct  116  PYPRKSAESLNLTPVSI-------QPERSPSPNLSAADKGTKSPTSVL  156



>gb|KGN63974.1| hypothetical protein Csa_1G032440 [Cucumis sativus]
Length=810

 Score =   102 bits (253),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 87/114 (76%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGR WR+I+EHVGTKTAVQIRSHAQKFFSKV RES+G +  ++ PIEIPPPRPKRKP+H
Sbjct  406  LYGRGWRQIKEHVGTKTAVQIRSHAQKFFSKVVRESSGSNESSINPIEIPPPRPKRKPLH  465

Query  182  pyprkLV--ITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQ  337
            PYPRK V  +  +SV       +  RS SPNLS++EKE  SPTSVL A  S+ Q
Sbjct  466  PYPRKAVDSLKAISVA-----RESERSPSPNLSLAEKETHSPTSVLTAFSSDDQ  514



>ref|XP_004150543.1| PREDICTED: uncharacterized protein LOC101212264 [Cucumis sativus]
Length=406

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 126/355 (35%), Positives = 168/355 (47%), Gaps = 75/355 (21%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGR WR+IEEHVGTKTAVQIRSHAQKFFSKV R SNG    ++  IEIPPPRPKRKP H
Sbjct  75   LYGRDWRQIEEHVGTKTAVQIRSHAQKFFSKVTRNSNGCSTTSIGCIEIPPPRPKRKPAH  134

Query  182  pyprkLV-----ITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasa  346
            PYPRK V      +P+S        + TRSLSP L  SEKE +SPTS++ A    G  S 
Sbjct  135  PYPRKEVPQSHKASPIS--------EQTRSLSPQL--SEKECQSPTSIVVA----GSGSD  180

Query  347  dsspnaspscvssaTGGGILFSKHCNVLVEENGSSSPP------------PGNLELLPLD  490
                  S     S +    + S   N    +N S +              P NLEL   D
Sbjct  181  TLMFTDSRIHHDSGSPDSSIPSTEPNSSSLDNESPTAALGIENSIPHEKIPTNLELFTKD  240

Query  491  DGRVRESSTA----QYLKLFGKTVLVSGSH----------------------TLSSPTSR  592
            +   ++ ST     Q LKLFG+TVL++  H                       +S   S 
Sbjct  241  NVIEKDDSTKEVSIQSLKLFGRTVLITDPHKHTPILENSMPEADRKPGENQKQVSPWNSI  300

Query  593  DLKAPMATHSFSWN------LSIGHGDYSECKPVPSLPWALPRAPSSSAGFPCVQVHSPV  754
             + +       +WN      + + +GD  +      + W      SS   +P   VH   
Sbjct  301  VMDSSTGNTDCTWNHGAFYFIQLNNGDSKQGDSAVPVSWW-----SSYGSYPFSFVHCFK  355

Query  755  AIKARPFSFDSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDK-NLDTETQSGQRI  916
               + P      + V +KE  K+ S   SN+GSVN G   DK + + +T++G+++
Sbjct  356  QADSNP------NQVNDKETHKDQSWCGSNTGSVNSGENGDKVSENDKTKNGEKL  404



>ref|XP_010453914.1| PREDICTED: protein REVEILLE 1 isoform X1 [Camelina sativa]
 ref|XP_010453915.1| PREDICTED: protein REVEILLE 1 isoform X2 [Camelina sativa]
Length=392

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 113/204 (55%), Gaps = 15/204 (7%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RE+ G D  +V+PI IPPPRPKRKP H
Sbjct  73   LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVAREATGGDGCSVEPIVIPPPRPKRKPAH  132

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
                     P       + +  +RS+SP    SE++NRSPTSVL  + SE   S DSS  
Sbjct  133  ---------PYPRKFGNEADGTSRSVSP----SERDNRSPTSVLSTVGSEALCSLDSSSP  179

Query  362  aspscvssaTGGGILFSKHCNVLVEENGSSSPPPGNLELLPLDDGRVRESSTAQYLKLFG  541
                   S+       +   N   E             LL  +   V+E +    +KLFG
Sbjct  180  NRSLSPVSSASPPAALTTTANAPEELETLKLELFPRERLLHTESS-VKEPTKQSLIKLFG  238

Query  542  KTVLVSGSHTLSS-PTSRDLKAPM  610
            KTVLVS S   SS  TS   K+P+
Sbjct  239  KTVLVSDSGMSSSLTTSTYCKSPI  262



>ref|XP_010453916.1| PREDICTED: protein REVEILLE 1 isoform X3 [Camelina sativa]
Length=390

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 113/204 (55%), Gaps = 15/204 (7%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RE+ G D  +V+PI IPPPRPKRKP H
Sbjct  71   LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVAREATGGDGCSVEPIVIPPPRPKRKPAH  130

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
                     P       + +  +RS+SP    SE++NRSPTSVL  + SE   S DSS  
Sbjct  131  ---------PYPRKFGNEADGTSRSVSP----SERDNRSPTSVLSTVGSEALCSLDSSSP  177

Query  362  aspscvssaTGGGILFSKHCNVLVEENGSSSPPPGNLELLPLDDGRVRESSTAQYLKLFG  541
                   S+       +   N   E             LL  +   V+E +    +KLFG
Sbjct  178  NRSLSPVSSASPPAALTTTANAPEELETLKLELFPRERLLHTESS-VKEPTKQSLIKLFG  236

Query  542  KTVLVSGSHTLSS-PTSRDLKAPM  610
            KTVLVS S   SS  TS   K+P+
Sbjct  237  KTVLVSDSGMSSSLTTSTYCKSPI  260



>ref|XP_008804812.1| PREDICTED: protein REVEILLE 7-like [Phoenix dactylifera]
Length=510

 Score =   100 bits (249),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 138/426 (32%), Positives = 197/426 (46%), Gaps = 95/426 (22%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEH+GTKTAVQIRSHAQKFFSKV RE       T K +EIPPPRPKRKP+H
Sbjct  77    LYGRAWRRIEEHIGTKTAVQIRSHAQKFFSKVVREPG-----TAKAVEIPPPRPKRKPLH  131

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
             PYPRKL  +P   + ++  E+P  S  P  S  E EN SP SVL A+ S+   S  S+P 
Sbjct  132   PYPRKLGNSPSKGLPVM--ERPEWSSLPIPSAFEPENSSPVSVLSAVGSDAVGSTVSNPT  189

Query  362   aspscvssaTGG----GILFSKHCN-------VLVEENGSSSPPPGNLELLPLD------  490
              + +    +       G LF++  N        + +EN S+SP P +  L+  D      
Sbjct  190   HACTSPVLSAARSDLIGTLFTEQENGCQSPTPSVEDENRSTSPGPASTCLVAEDKSQMEV  249

Query  491   ---------DGRVRESSTAQYLKLFGKTVLVSGSHT------------------------  571
                       G  +  + A  LKLFG+TVLV+ +                          
Sbjct  250   DLSSKDETPKGGCQIETQATSLKLFGRTVLVTDAQKPCSSSVGNTMQSCKSLPAVGSSRS  309

Query  572   ------LSSPTSRDLKAPMATHSFS------WNLSIG-----------HGDY-SECKPVP  679
                   L +PT   L+ P   + +       W+   G           HGD+ +  +   
Sbjct  310   VSTDVDLQTPTKPVLQTPAQGNLWGGPGKSVWSAFNGGTCPMFYRLPPHGDFMNSTEAAC  369

Query  680   SLPWALPRAPSSSAGFPCVQVHSPVAIKARPFSFDSKDNVEEKEDAKEGSSTCSNSGSVN  859
              LPW    +  +    P +   +  +++  P +    +  ++K+  KEGS T  N+ +  
Sbjct  370   PLPWWWAFS-GTQPTLPFINPQNMNSVQIMPQT--CIEASDDKDSRKEGSWTGFNTPACT  426

Query  860   VGICVDKNL-DTETQSG-QRIGSDSSCFKR-----TTEIVILEQKTARSTKRTKGFMPYK  1018
               I VDKN  D +++ G + +   +    R      +  V L   T +S    +GF+PY 
Sbjct  427   ASI-VDKNSDDVDSKRGVEHLKEPAPALLRLKHSENSAFVSLRVNTEKS---PRGFVPYN  482

Query  1019  RCLAER  1036
             RCLAE+
Sbjct  483   RCLAEK  488



>ref|XP_004164974.1| PREDICTED: uncharacterized LOC101212264 [Cucumis sativus]
Length=406

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 125/351 (36%), Positives = 170/351 (48%), Gaps = 67/351 (19%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGR WR+IEEHVGTKTAVQIRSHAQKFFSKV R SNG    ++  IEIPPPRPKRKP H
Sbjct  75   LYGRDWRQIEEHVGTKTAVQIRSHAQKFFSKVTRNSNGCSTTSIGCIEIPPPRPKRKPAH  134

Query  182  pyprkLV-----ITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFA---LD----  325
            PYPRK V      +P+S        + TRSLSP L  SEKE +SPTS++ A   LD    
Sbjct  135  PYPRKEVPQSHKASPIS--------EQTRSLSPQL--SEKECQSPTSIVVAGSGLDTLMF  184

Query  326  SEGQasadsspnaspscvssaTGGGILFSKHCNVL-VEENGSSSPPPGNLELLPLDDGRV  502
            ++ +   DS    S    +      +        L +E +      P NLEL   D+   
Sbjct  185  TDSRIHHDSGSPDSSIPSTEPNSSSLDNESPTAALGIENSIPHEKIPTNLELFTKDNVIE  244

Query  503  RESSTA----QYLKLFGKTVLVSGSH----------------------TLSSPTSRDLKA  604
            ++ ST     Q LKLFG+TVL++  H                       +S   S  + +
Sbjct  245  KDDSTKEVSIQSLKLFGRTVLITDPHKHTPILENSMPEADRKPGENQKQVSPWNSIVMDS  304

Query  605  PMATHSFSWN------LSIGHGDYSECKPVPSLPWALPRAPSSSAGFPCVQVHSPVAIKA  766
                   +WN      + + +GD  +      + W      SS   +P   VH      +
Sbjct  305  STGNTDCTWNHGAFYFIQLNNGDSKQGDSAVPVSWW-----SSYGSYPFSFVHCFNQADS  359

Query  767  RPFSFDSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDK-NLDTETQSGQRI  916
             P      + V +KE  K+ S   SN+GSVN G   DK + + +T++G+++
Sbjct  360  NP------NQVNDKETHKDQSWCGSNTGSVNSGENGDKVSENDKTKNGEKL  404



>gb|KHN24174.1| Myb-like protein G [Glycine soja]
Length=287

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 82/104 (79%), Gaps = 2/104 (2%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKV  +  G++  TV+ IEIPPPRPKRKPMH
Sbjct  76   LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVLHDPTGNNTNTVESIEIPPPRPKRKPMH  135

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVL  313
            PYPRKLV TP   + +  PE+P +S S   S  ++EN+SP SVL
Sbjct  136  PYPRKLVETPNKEISI--PEQPMKSNSLKSSDFDQENQSPKSVL  177



>ref|NP_001236032.1| MYB transcription factor MYB173 [Glycine max]
 gb|ABH02863.1| MYB transcription factor MYB173 [Glycine max]
Length=287

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 82/104 (79%), Gaps = 2/104 (2%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKV  +  G++  TV+ IEIPPPRPKRKPMH
Sbjct  76   LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVLHDPTGNNTNTVESIEIPPPRPKRKPMH  135

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVL  313
            PYPRKLV TP   + +  PE+P +S S   S  ++EN+SP SVL
Sbjct  136  PYPRKLVETPNKEISI--PEQPMKSNSLKSSDFDQENQSPKSVL  177



>ref|XP_008463161.1| PREDICTED: protein REVEILLE 1-like isoform X1 [Cucumis melo]
Length=469

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 137/348 (39%), Positives = 164/348 (47%), Gaps = 69/348 (20%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGR WR+IEEHVGTKTAVQIRSHAQKFFSKV R SNG    +V  IEIPPPRPKRKP H
Sbjct  75   LYGRDWRQIEEHVGTKTAVQIRSHAQKFFSKVTRNSNGCSTTSVGCIEIPPPRPKRKPAH  134

Query  182  pyprkLV-----ITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasa  346
            PYPRK V      +P+S        + TRSLSP L  SEKE  SPTS++ A    G  S 
Sbjct  135  PYPRKEVPQSRKASPIS--------EQTRSLSPQL--SEKECPSPTSIVVA----GNGSD  180

Query  347  dsspnaspscvssaTGGGILFSKHCNVLVEENGS--------SSPP----PGNLELLPLD  490
                  S     S +    + S   N    +N S        +S P    P NLEL   D
Sbjct  181  TLMFTDSRIHHDSGSPDSSIPSTEPNSSSLDNESLTAALGTENSIPHDNIPTNLELFTKD  240

Query  491  DGRVRESSTA----QYLKLFGKTVLVSGSHTLS-----SPTSRDLKAPMATHSFS-WN--  634
            D   ++ ST     Q LKLFG+TVL++  H  S     S    D K        S WN  
Sbjct  241  DVIEKDDSTKEVSIQSLKLFGRTVLITDPHKQSPILENSMPEADRKPGDNQKQVSPWNSI  300

Query  635  ----------LSIGHGDYSECKPVPSLPWALPRAPSSSAGFPCVQVHSPVAIKARPFSF-  781
                       +  HG +   +        L    S       V V    +  + PFSF 
Sbjct  301  VMDSSTGNTDCTWNHGAFYFIQ--------LNNGDSKQGPGSAVPVSWWSSYGSYPFSFV  352

Query  782  ------DSKDN-VEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQS  904
                  DS  N V++KE  K+ S   SN+GSVN G   DK  + + QS
Sbjct  353  HCFKQADSNANQVDDKETHKDQSWCGSNTGSVNSGENGDKASENDIQS  400



>gb|KGN50924.1| hypothetical protein Csa_5G341040 [Cucumis sativus]
Length=468

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 125/350 (36%), Positives = 162/350 (46%), Gaps = 74/350 (21%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGR WR+IEEHVGTKTAVQIRSHAQKFFSKV R SNG    ++  IEIPPPRPKRKP H
Sbjct  75   LYGRDWRQIEEHVGTKTAVQIRSHAQKFFSKVTRNSNGCSTTSIGCIEIPPPRPKRKPAH  134

Query  182  pyprkLV-----ITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasa  346
            PYPRK V      +P+S        + TRSLSP L  SEKE +SPTS++ A    G  S 
Sbjct  135  PYPRKEVPQSHKASPIS--------EQTRSLSPQL--SEKECQSPTSIVVA----GSGSD  180

Query  347  dsspnaspscvssaTGGGILFSKHCNVLVEENGSSSPP------------PGNLELLPLD  490
                  S     S +    + S   N    +N S +              P NLEL   D
Sbjct  181  TLMFTDSRIHHDSGSPDSSIPSTEPNSSSLDNESPTAALGIENSIPHEKIPTNLELFTKD  240

Query  491  DGRVRESSTA----QYLKLFGKTVLVSGSH----------------------TLSSPTSR  592
            +   ++ ST     Q LKLFG+TVL++  H                       +S   S 
Sbjct  241  NVIEKDDSTKEVSIQSLKLFGRTVLITDPHKHTPILENSMPEADRKPGENQKQVSPWNSI  300

Query  593  DLKAPMATHSFSWN------LSIGHGDYSECKPVPSLPWALPRAPSSSAGFPCVQVHSPV  754
             + +       +WN      + + +GD  +      + W      SS   +P   VH   
Sbjct  301  VMDSSTGNTDCTWNHGAFYFIQLNNGDSKQGDSAVPVSWW-----SSYGSYPFSFVHCFK  355

Query  755  AIKARPFSFDSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTETQS  904
               + P      + V +KE  K+ S   SN+GSVN G   DK  + + +S
Sbjct  356  QADSNP------NQVNDKETHKDQSWCGSNTGSVNSGENGDKVSENDVES  399



>ref|XP_008794529.1| PREDICTED: uncharacterized protein LOC103710542 [Phoenix dactylifera]
Length=524

 Score = 97.4 bits (241),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 87/111 (78%), Gaps = 4/111 (4%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGRAWRRIEE++GTKTAVQIRSHAQKFFSKV RES G+ A T++PIEIPPPRPKRKP+H
Sbjct  77   LYGRAWRRIEEYIGTKTAVQIRSHAQKFFSKVVRESTGNSACTLQPIEIPPPRPKRKPLH  136

Query  182  pyprkLVITPVSVVGMLDP-EKPTRSLSPNLSVSEKENRSPTSVLFALDSE  331
            PYPRKL  +    + +L   EKP+  +    S +E+EN SPTSVL A+ S+
Sbjct  137  PYPRKLGHSSSKRIAILKQLEKPSLQIP---SANEQENGSPTSVLSAIGSD  184



>gb|ABH02880.1| MYB transcription factor MYB174 [Glycine max]
Length=312

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 82/104 (79%), Gaps = 2/104 (2%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSK+ R+  G++  TV+ IEIPPPRPKRKP+H
Sbjct  28   LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKLLRDPTGNNTNTVESIEIPPPRPKRKPVH  87

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVL  313
            PYPRKLV TP   +  L PE+  +S S   S  ++EN+SP SVL
Sbjct  88   PYPRKLVETPNKEI--LIPEQLMKSNSLKSSDFDQENQSPKSVL  129



>gb|KFK25943.1| hypothetical protein AALP_AA8G183100 [Arabis alpina]
Length=378

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 127/345 (37%), Positives = 164/345 (48%), Gaps = 57/345 (17%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKV RE  G +  +++PI IPPPRPKRK   
Sbjct  68    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVAREVTGGNGSSLEPIVIPPPRPKRK---  124

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
                    + P       + ++ +RS+SP    SE++NRSPTSVL  + SE   S+DS   
Sbjct  125   ------PMHPYPRKFGNEADQTSRSVSP----SERDNRSPTSVLSTVGSEALGSSDSHSP  174

Query  362   aspscvssaTGGGILFSKHCNVLVEENGSSSPPPGNLELLPLDDGRVRESSTAQYLKLFG  541
                    S+       +      +E       P   L    L    + +  T Q LKLFG
Sbjct  175   NRSVSPVSSASPPTATTATAPEELESLKLELFPRERL----LSRESLIKEPTKQSLKLFG  230

Query  542   KTVLVSGSHTLSSPTSRDLKAPMATHSFSWNLSIGHGDYSECKPVPSLPWALPRAPSSSA  721
             KTV+VS S   SS         + T ++             CK  P  P  LPR  S + 
Sbjct  231   KTVMVSDSDMSSS---------LTTSTY-------------CKS-PIQP--LPRKLSQAE  265

Query  722   GFPCVQVHSPVAIKARPFSFDSK-DNVE-EKEDAKEGSSTCSNSGSVNVGICVDKNLDTE  895
              FP + ++S   + +       K D V+ EK    EGSST SN+GSV+     DK  + E
Sbjct  266   TFP-ITINSQEELMSSWIQVPHKQDEVDSEKALQNEGSSTGSNTGSVDDTGHTDKISEAE  324

Query  896   TQSGQRIGSDSSC---FKRTTEIVILEQKTARSTKRTKGFMPYKR  1021
             T           C   FK +      E +   S   + GF PYK+
Sbjct  325   TM---------VCKWEFKPSERSAFSELRRRNSDSNSIGFGPYKK  360



>gb|KHN08771.1| Myb-like protein G [Glycine soja]
Length=361

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 82/104 (79%), Gaps = 2/104 (2%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSK+ R+  G++  TV+ IEIPPPRPKRKP+H
Sbjct  77   LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKLLRDPTGNNTNTVESIEIPPPRPKRKPVH  136

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVL  313
            PYPRKLV TP   +  L PE+  +S S   S  ++EN+SP SVL
Sbjct  137  PYPRKLVETPNKEI--LIPEQLMKSNSLKSSDFDQENQSPKSVL  178



>ref|XP_003553057.1| PREDICTED: protein LHY [Glycine max]
Length=361

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 82/104 (79%), Gaps = 2/104 (2%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSK+ R+  G++  TV+ IEIPPPRPKRKP+H
Sbjct  77   LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKLLRDPTGNNTNTVESIEIPPPRPKRKPVH  136

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVL  313
            PYPRKLV TP   +  L PE+  +S S   S  ++EN+SP SVL
Sbjct  137  PYPRKLVETPNKEI--LIPEQLMKSNSLKSSDFDQENQSPKSVL  178



>ref|XP_009385655.1| PREDICTED: protein REVEILLE 1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=436

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 126/223 (57%), Gaps = 27/223 (12%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERES-NGDDAKTVKPIEIppprpkrkpm  178
            LYGRAWRRIEEH+GTKTAVQIRSHAQKFFSKV RES +GD   T+K IEIPPPRPKRKP+
Sbjct  32   LYGRAWRRIEEHIGTKTAVQIRSHAQKFFSKVVRESGSGDSTGTLKAIEIPPPRPKRKPV  91

Query  179  hpyprkLV-ITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSE--------  331
            HPYPRKL  +       +   ++P   +S   ++ E ENRSPTSVL A+ SE        
Sbjct  92   HPYPRKLCNLLNKGTPALKQLQRPPLQIS---AICEHENRSPTSVLSAVGSETLESTLSN  148

Query  332  GQasadsspnaspscvssaTGG-GILFSKHCNVLVEENGSSSPPPGNLEL-----LPLDD  493
            GQ    S   ++        GG  +  +   ++ +  +G   P    L +     + +D 
Sbjct  149  GQMGCSSPVTSAAGSNDQDDGGQSLTVTDEADIKLPHSG---PAFSGLTVQDQPRMEIDQ  205

Query  494  GR----VRESSTAQYLKLFGKTVLVSGSHTLSS-PTSRDLKAP  607
             R      + S    LKLFGK V+V+  +  S+ PT+ DL  P
Sbjct  206  CRHHAHALDESRLPTLKLFGKMVVVTDPNMSSAPPTAGDLAQP  248



>ref|XP_007209215.1| hypothetical protein PRUPE_ppa006715mg [Prunus persica]
 gb|EMJ10414.1| hypothetical protein PRUPE_ppa006715mg [Prunus persica]
Length=399

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 83/110 (75%), Gaps = 8/110 (7%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGR WR+IEEHVGTKTAVQIRSHAQKFFSKV +ES+G    ++ PIEIPPPRPKRKP+H
Sbjct  32   LYGRGWRQIEEHVGTKTAVQIRSHAQKFFSKVSKESSGPSEGSITPIEIPPPRPKRKPVH  91

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSE  331
            PYPRK V    S++G      P RS SP+ SVS K   SPTSVL AL S+
Sbjct  92   PYPRKSVD---SLIG-----SPERSPSPHFSVSGKGQESPTSVLSALGSD  133



>ref|XP_008240377.1| PREDICTED: protein REVEILLE 7-like isoform X2 [Prunus mume]
Length=454

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 83/110 (75%), Gaps = 8/110 (7%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGR WR+IEEHVGTKTAVQIRSHAQKFFSKV +ES+G    ++ PIEIPPPRPKRKP+H
Sbjct  76   LYGRGWRQIEEHVGTKTAVQIRSHAQKFFSKVSKESSGPSEGSITPIEIPPPRPKRKPVH  135

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSE  331
            PYPRK V    S++G      P RS SP+ SVS K   SPTSVL AL S+
Sbjct  136  PYPRKSVD---SLIG-----SPERSPSPHFSVSGKGQESPTSVLSALGSD  177



>ref|XP_009385654.1| PREDICTED: protein REVEILLE 1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=481

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 126/223 (57%), Gaps = 27/223 (12%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERES-NGDDAKTVKPIEIppprpkrkpm  178
            LYGRAWRRIEEH+GTKTAVQIRSHAQKFFSKV RES +GD   T+K IEIPPPRPKRKP+
Sbjct  77   LYGRAWRRIEEHIGTKTAVQIRSHAQKFFSKVVRESGSGDSTGTLKAIEIPPPRPKRKPV  136

Query  179  hpyprkLV-ITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSE--------  331
            HPYPRKL  +       +   ++P   +S   ++ E ENRSPTSVL A+ SE        
Sbjct  137  HPYPRKLCNLLNKGTPALKQLQRPPLQIS---AICEHENRSPTSVLSAVGSETLESTLSN  193

Query  332  GQasadsspnaspscvssaTGG-GILFSKHCNVLVEENGSSSPPPGNLEL-----LPLDD  493
            GQ    S   ++        GG  +  +   ++ +  +G   P    L +     + +D 
Sbjct  194  GQMGCSSPVTSAAGSNDQDDGGQSLTVTDEADIKLPHSG---PAFSGLTVQDQPRMEIDQ  250

Query  494  GR----VRESSTAQYLKLFGKTVLVSGSHTLSS-PTSRDLKAP  607
             R      + S    LKLFGK V+V+  +  S+ PT+ DL  P
Sbjct  251  CRHHAHALDESRLPTLKLFGKMVVVTDPNMSSAPPTAGDLAQP  293



>ref|XP_008240374.1| PREDICTED: protein REVEILLE 7-like isoform X1 [Prunus mume]
 ref|XP_008240375.1| PREDICTED: protein REVEILLE 7-like isoform X1 [Prunus mume]
 ref|XP_008240376.1| PREDICTED: protein REVEILLE 7-like isoform X1 [Prunus mume]
Length=465

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 83/110 (75%), Gaps = 8/110 (7%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGR WR+IEEHVGTKTAVQIRSHAQKFFSKV +ES+G    ++ PIEIPPPRPKRKP+H
Sbjct  76   LYGRGWRQIEEHVGTKTAVQIRSHAQKFFSKVSKESSGPSEGSITPIEIPPPRPKRKPVH  135

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSE  331
            PYPRK V    S++G      P RS SP+ SVS K   SPTSVL AL S+
Sbjct  136  PYPRKSVD---SLIG-----SPERSPSPHFSVSGKGQESPTSVLSALGSD  177



>ref|XP_010099677.1| Myb-like protein G [Morus notabilis]
 gb|EXB80254.1| Myb-like protein G [Morus notabilis]
Length=475

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 80/104 (77%), Gaps = 3/104 (3%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGR WR+IEEHVGTKTAVQIRSHAQKFFSKV R S G    ++K IEIPPPRPKRKP+H
Sbjct  77   LYGRGWRQIEEHVGTKTAVQIRSHAQKFFSKVVRGSTGTVESSIKRIEIPPPRPKRKPVH  136

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVL  313
            PYPRK   +  S  G+L   +P RS SPNLS ++K  +SPTSVL
Sbjct  137  PYPRK---SAESFNGILVSNQPERSPSPNLSAADKGTKSPTSVL  177


 Score = 54.3 bits (129),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 62/194 (32%), Positives = 84/194 (43%), Gaps = 46/194 (24%)
 Frame = +2

Query  527   LKLFGKTVLVSGSHTLSSPTSRD---------LKAPMATHSFSWNLSIGHGDYSECKPV-  676
              KLFG+TVL+SG    S P +++         L   +++     NLS+G G  S C  + 
Sbjct  284   FKLFGRTVLLSGFQKESPPGAKNSQTSKTDEGLVLTLSSDQLDTNLSLG-GAVSNCNQLE  342

Query  677   -------------PSLPWALPRAPSSSAGFPCVQVHSPVAIKARPFSFDSKDNVEEKEDA  817
                          P L W L + P       C Q      +   P +  S+   E+K+  
Sbjct  343   QPKESCNTETANSPMLWWTLYQFPFHYLA-ACNQT-----LDQTPRNSCSEHREEDKDIP  396

Query  818   KEGSSTCSNSGSVN-VGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVILEQKTARSTKR  994
             KE SST SN GS + V    DKNL+      Q+      C K     V +E   +R    
Sbjct  397   KERSSTGSNDGSASGVETAGDKNLEAVDSFPQK-----PCTK-----VSVEPSNSR----  442

Query  995   TKGFMPYKRCLAER  1036
              KGF+PYKRCLAER
Sbjct  443   -KGFVPYKRCLAER  455



>ref|XP_004515250.1| PREDICTED: uncharacterized protein LOC101509066 [Cicer arietinum]
Length=459

 Score = 95.1 bits (235),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 82/111 (74%), Gaps = 3/111 (3%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGR WR+IEEH+GTKTAVQIRSHAQKFFSKV RE +G    +++PI IPPPRPKRKP+H
Sbjct  78   LYGRGWRQIEEHIGTKTAVQIRSHAQKFFSKVVREHDGSAESSIQPIVIPPPRPKRKPLH  137

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG  334
            PYPRK V    S+ G   P K   S S NLSV+E + +SPTSVL A  SE 
Sbjct  138  PYPRKSVD---SIKGQPVPNKSETSPSVNLSVAENDTQSPTSVLSAFASEA  185



>gb|KHG17751.1| Protein LHY -like protein [Gossypium arboreum]
Length=457

 Score = 94.4 bits (233),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 79/104 (76%), Gaps = 3/104 (3%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGR WR+IEEH+GTK+AVQIRSHAQKFFSKV RESNG    ++KPI IPPPRPKRKP+H
Sbjct  71   LYGRGWRQIEEHIGTKSAVQIRSHAQKFFSKVARESNGGFDGSIKPIVIPPPRPKRKPVH  130

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVL  313
            PYPRK V     V G     +P RS SPN    E++N+SPTSVL
Sbjct  131  PYPRKSVDL---VKGKSPSSQPERSPSPNQFFREQDNKSPTSVL  171



>emb|CDY16939.1| BnaC09g40660D [Brassica napus]
Length=300

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 115/196 (59%), Gaps = 45/196 (23%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            L+GRAWR+IEEHVGTKTAVQIRSHAQKFFSKV +E++G +  +++PI IPPPRPKRKP H
Sbjct  62   LHGRAWRKIEEHVGTKTAVQIRSHAQKFFSKVAKEASGGNGSSLEPIVIPPPRPKRKPSH  121

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
            PYPRKL           + ++ +RS+SP    SE++N SPTSVL  + SE   S+DS   
Sbjct  122  PYPRKL---------GNEGDQASRSVSP----SERDNGSPTSVLSTVGSEALGSSDSHSP  168

Query  362  aspscvssaTGGGILFSKHCNVLVEENGSSSPPPGNLELLPLDDGRVRESSTAQYLKLFG  541
                                      N S SP    LEL P +   + +  T Q L+LFG
Sbjct  169  --------------------------NRSLSP----LELFPRES--LVKEPTKQSLRLFG  196

Query  542  KTVLVSGSHTLSSPTS  589
             TVLVS S   SS T+
Sbjct  197  NTVLVSDSGVSSSLTT  212



>ref|XP_010537507.1| PREDICTED: protein REVEILLE 7 isoform X1 [Tarenaya hassleriana]
Length=388

 Score = 93.2 bits (230),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 82/110 (75%), Gaps = 10/110 (9%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGR WR+IEEHVGTKTAVQIRSHAQKFFSKV RE++  +   VK I IPPPRPKRKP H
Sbjct  67   LYGRGWRQIEEHVGTKTAVQIRSHAQKFFSKVARETDNVNDSPVKAIVIPPPRPKRKPTH  126

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSE  331
            PYPRK+   PV+        +P ++ SP LSV+EK N+SPTSVL A  S+
Sbjct  127  PYPRKM---PVA-------NQPDKTPSPTLSVTEKGNKSPTSVLSAFPSD  166



>ref|XP_003616176.1| MYB transcription factor [Medicago truncatula]
 gb|AES99134.1| myb transcription factor [Medicago truncatula]
Length=420

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 84/110 (76%), Gaps = 2/110 (2%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGRAWR+IEEHVGTKTAVQIRSHAQKFFSK+ R+++G+D   V+ IEIPPPRPKRKP+H
Sbjct  60   LYGRAWRKIEEHVGTKTAVQIRSHAQKFFSKINRDTDGNDTTMVETIEIPPPRPKRKPIH  119

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSE  331
            PYPRKLV  P + +  L  E+P RS S       +EN SP SVL A+ SE
Sbjct  120  PYPRKLVEIPKNEISNL--EQPLRSNSLVSLDFGQENNSPKSVLSAVASE  167



>ref|XP_004299482.1| PREDICTED: uncharacterized protein LOC101292702 [Fragaria vesca 
subsp. vesca]
Length=362

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 70/104 (67%), Gaps = 11/104 (11%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGR WR+IEEHVGTKTAVQIRSHAQKFFSKV +E  G    ++KPIEIPPPRPKRK   
Sbjct  77   LYGRGWRQIEEHVGTKTAVQIRSHAQKFFSKVAKELPGTGEGSLKPIEIPPPRPKRK---  133

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVL  313
                   + P        PE+  RS SPN SV+EK   SPTSVL
Sbjct  134  ------PMHPYPRKHNGSPER--RSPSPNFSVAEKGQESPTSVL  169



>emb|CDX69388.1| BnaA10g17370D [Brassica napus]
Length=374

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 112/303 (37%), Positives = 154/303 (51%), Gaps = 55/303 (18%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            L+GRAWR+IEEHVGTKTAVQIRSHAQKFFSKV +E++G +  +++PI IPPPRPKRK   
Sbjct  58   LHGRAWRKIEEHVGTKTAVQIRSHAQKFFSKVAKEASGGNGSSLEPILIPPPRPKRK---  114

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSE--GQasadss  355
                   + P       + ++ +RS+SP    SE++N SPTSVL  + SE  G + + S 
Sbjct  115  ------PMHPYPRKLGNEGDQASRSVSP----SERDNGSPTSVLSTVGSEALGSSDSHSP  164

Query  356  pnaspscvssaTGGGILFSKHCNVLVEENGSSSPPPGNLELLPLDDGRVRESSTAQYLKL  535
              +     S++     L +   N   E   S++     LEL P  +  V+E    Q L+L
Sbjct  165  NRSLSPVSSASPPAAPLATTE-NAPEELETSAT----KLELFP-RESLVKEPK-KQSLRL  217

Query  536  FGKTVLVSGSHTLSSPTSRDLKAPMATHSFSWNLSIGHGDYSECKPVPSLPWALPRAPSS  715
            FG TVLVS S   SS T+   K+P+                            LPR  S 
Sbjct  218  FGNTVLVSDSGVSSSLTTY-CKSPIIQ-------------------------PLPRKLSR  251

Query  716  SAGFPCV-----QVHSPVAIKARPFSFDSKDNVEEKEDA--KEGSSTCSNSGSVNVGICV  874
            S  FP V     ++ S    +  P   + ++   + E A   EGSST SN+GSV+     
Sbjct  252  SETFPMVINPQEKLLSCWIQQVPPKQEEVENRCSDSEKAVQNEGSSTGSNTGSVDDTGHT  311

Query  875  DKN  883
            DK+
Sbjct  312  DKS  314



>ref|XP_002868495.1| hypothetical protein ARALYDRAFT_493689 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44754.1| hypothetical protein ARALYDRAFT_493689 [Arabidopsis lyrata subsp. 
lyrata]
Length=289

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 105/186 (56%), Gaps = 44/186 (24%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGRAWRRIEEHVGTKTAVQIRSHAQKFF+KV R    D   + + IEIPPPRPKRKPMH
Sbjct  52   LYGRAWRRIEEHVGTKTAVQIRSHAQKFFTKVAR----DFGVSSESIEIPPPRPKRKPMH  107

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
            PYPRKLVI     +  ++       L+ +  V +++NRSPTSVL A  S+G         
Sbjct  108  PYPRKLVIPDAKEMAYVE-------LTGSKMVQDEDNRSPTSVLSAHGSDGL--------  152

Query  362  aspscvssaTGGGILFSKHCNVLVEENGSSSPPPGNLELLPLDDGRVR-ESSTAQYLKLF  538
                       G I             GS+SP   + EL    +  +  E+ T Q LKLF
Sbjct  153  -----------GSI-------------GSNSPNSSSAELSSHTEESLSPEAETKQSLKLF  188

Query  539  GKTVLV  556
            GKT +V
Sbjct  189  GKTFIV  194



>gb|KDO44080.1| hypothetical protein CISIN_1g021851mg [Citrus sinensis]
Length=264

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 76/114 (67%), Gaps = 11/114 (10%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            +YGR WR+IEEHVGTKTAVQIRSHAQKFFSKV RESNG    ++ PIEIPPPRPKRKP+H
Sbjct  1    MYGRGWRQIEEHVGTKTAVQIRSHAQKFFSKVVRESNGSSESSIMPIEIPPPRPKRKPVH  60

Query  182  ----pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSE  331
                     L  T VS        +     S N  VS+K+ +SPTSV+ A +S+
Sbjct  61   PYPRKSVDSLKATSVS-------NQQENFTSSNALVSDKDRQSPTSVVSAFNSD  107



>emb|CDX70747.1| BnaC03g08310D [Brassica napus]
Length=361

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 112/342 (33%), Positives = 156/342 (46%), Gaps = 63/342 (18%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESN-GDDAKTVKPIEIppprpkrkpm  178
             L+GRAWRRI+ HVGTKTAVQIRSHAQKFFSKV RE+  G +  +V+PI I          
Sbjct  65    LHGRAWRRIQGHVGTKTAVQIRSHAQKFFSKVAREATGGSNGSSVEPIVI---------P  115

Query  179   hpyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadssp  358
              P P++  + P       + ++ +RS+SP    SE++N+SPTSVL  + SE   S+DS  
Sbjct  116   PPRPKRRPMHPYPRKLGNEGDQASRSVSP----SERDNQSPTSVLSPVGSEALDSSDSHS  171

Query  359   naspscvssaTGGGILFSKHCNVLVEENGSSSPPPGNLELLPLDDGRVRESSTAQYLKLF  538
                     S+       S    +    N         LEL P +  R  +  T + LKLF
Sbjct  172   PDRSLPPVSSA------SPQAALASTSNAPEELETLKLELFPRE--RSIKEPTKKSLKLF  223

Query  539   GKTVLVSGSHTLSSPTSRDLKAPMATHSFSWNLSIGHGDYSECK-PVPSLPWALPRAPSS  715
             GK VLVS S         D+ + + T +            + CK P+  LP         
Sbjct  224   GKIVLVSDS---------DMSSSLTTST------------AYCKSPIQPLP--------Q  254

Query  716   SAGFPCVQVHSPVAIKARPFSFDSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDTE  895
                  C      + +  R    +++    EK    EGSST SN+GSV+     DK+ + E
Sbjct  255   EELLSCW-----IQVPPRKEEVENRCLDSEKAFQNEGSSTGSNTGSVDDTGHTDKSSEPE  309

Query  896   TQSGQRIGSDSSCFKRTTEIVILEQKTARSTKRTKGFMPYKR  1021
             T   Q        FK +      E +   S   ++GF PYK+
Sbjct  310   TMVCQWE------FKPSERSAFSELRRETSESNSRGFSPYKK  345



>ref|XP_009121398.1| PREDICTED: protein REVEILLE 1-like [Brassica rapa]
Length=374

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 111/303 (37%), Positives = 154/303 (51%), Gaps = 55/303 (18%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            L+GRAWR+IEEH+GTKTAVQIRSHAQKFFSKV +E++G +  +++PI IPPPRPKRK   
Sbjct  58   LHGRAWRKIEEHLGTKTAVQIRSHAQKFFSKVAKEASGGNGSSLEPILIPPPRPKRK---  114

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSE--GQasadss  355
                   + P       + ++ +RS+SP    SE++N SPTSVL  + SE  G + + S 
Sbjct  115  ------PMHPYPRKLGNEGDQASRSVSP----SERDNGSPTSVLSTVGSEALGSSDSHSP  164

Query  356  pnaspscvssaTGGGILFSKHCNVLVEENGSSSPPPGNLELLPLDDGRVRESSTAQYLKL  535
              +     S++     L +   N   E   S++     LEL P  +  V+E    Q L+L
Sbjct  165  NRSLSPVSSASPPAAPLATTE-NAPEELETSAT----KLELFP-RESLVKEPK-KQSLRL  217

Query  536  FGKTVLVSGSHTLSSPTSRDLKAPMATHSFSWNLSIGHGDYSECKPVPSLPWALPRAPSS  715
            FG TVLVS S   SS T+   K+P+                            LPR  S 
Sbjct  218  FGNTVLVSDSGVSSSLTTY-CKSPIIQ-------------------------PLPRKLSR  251

Query  716  SAGFPCV-----QVHSPVAIKARPFSFDSKDNVEEKEDA--KEGSSTCSNSGSVNVGICV  874
            S  FP V     ++ S    +  P   + ++   + E A   EGSST SN+GSV+     
Sbjct  252  SETFPMVINPQEKLLSCWIQQVPPKQEEVENRCSDSEKAVQNEGSSTGSNTGSVDDTGHT  311

Query  875  DKN  883
            DK+
Sbjct  312  DKS  314



>ref|XP_010935334.1| PREDICTED: protein CCA1 [Elaeis guineensis]
Length=510

 Score = 92.0 bits (227),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 97/215 (45%), Positives = 123/215 (57%), Gaps = 33/215 (15%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGRAWRRIEEH+GTKTAVQIRSHAQKFFSKV RE       T K IEIPPPRPKRKP+H
Sbjct  77   LYGRAWRRIEEHIGTKTAVQIRSHAQKFFSKVVREPG-----TAKAIEIPPPRPKRKPLH  131

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
            PYPRKL  +P   + ++  E+P  S  P  SV E EN SP SVL A+ S+   S  S+P 
Sbjct  132  PYPRKLGNSPSKGLPVM--EQPEWSSLPVPSVFEPENGSPVSVLSAVGSDTTGSTASNPT  189

Query  362  aspscvssaTGG----GILFSKHCN-------VLVEENGSSSPPPGNLELLPLDDGRV--  502
               +  + +       G L ++  N        + +EN S+SP P +  L+  D  ++  
Sbjct  190  HGCTSPALSAARSDLVGTLLTEQENGCQSPTPSVQDENRSTSPGPASTCLVTEDKSQMEV  249

Query  503  ---------RESS----TAQYLKLFGKTVLVSGSH  568
                     +E S     A  LKLFG+TVLV+ + 
Sbjct  250  DLSSKDETPKEGSQMEVQATCLKLFGRTVLVTDAQ  284



>ref|XP_007152597.1| hypothetical protein PHAVU_004G143400g [Phaseolus vulgaris]
 gb|ESW24591.1| hypothetical protein PHAVU_004G143400g [Phaseolus vulgaris]
Length=472

 Score = 92.0 bits (227),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 80/111 (72%), Gaps = 3/111 (3%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGR WR+IEEH+GTKTAVQIRSHAQKFFSKV RES G    +V+PI IPPPRPKRKP+H
Sbjct  70   LYGRGWRQIEEHIGTKTAVQIRSHAQKFFSKVVRESEGSAESSVQPINIPPPRPKRKPLH  129

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG  334
            PYPRK +    +  G   P +   S S NL V+EK+  SPTSVL  + SE 
Sbjct  130  PYPRKSLD---AFKGHTTPNETETSQSTNLLVAEKDTPSPTSVLSTVGSEA  177



>gb|AAX33631.1| Myb2 [Pisum sativum]
Length=68

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPI  142
            LYGRAWR+IEEHVGTKTAVQIRSHAQKFFSK+ R++NG+D   V+ I
Sbjct  22   LYGRAWRKIEEHVGTKTAVQIRSHAQKFFSKINRDTNGNDTTLVESI  68



>ref|XP_010558668.1| PREDICTED: protein REVEILLE 1-like isoform X2 [Tarenaya hassleriana]
Length=400

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 101/223 (45%), Positives = 130/223 (58%), Gaps = 20/223 (9%)
 Frame = +2

Query  5    YGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmhp  184
            YGRAWRRI+EH+GTKTAVQIRSHAQKFFSK+ RE+ G +  +V+ I IPPPRPKRKPMHP
Sbjct  46   YGRAWRRIQEHIGTKTAVQIRSHAQKFFSKIARETAGSNGSSVERIVIPPPRPKRKPMHP  105

Query  185  yprkLVITPVSVVGMLDPEKPTRSLS-PNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
            YPRKL       +   D  +  RS+S P+LSVSE +++SPTSVL ++ S+   SAD++  
Sbjct  106  YPRKLGNPSAKEISGTDQSR--RSVSPPDLSVSEGDDQSPTSVLSSVCSDAFGSADTNSP  163

Query  362  aspscvssaTGGGIL-----FSKHCNVLVEENGSSSPPPGNLELLPLDDGRV-RESS---  514
             S     S+T    L     +       +EE  S +     LEL   +   + RE S   
Sbjct  164  NSILSPVSSTLPCELTLSGPYGSTTTFAIEEAESLT-----LELFGRERRLLSREESINP  218

Query  515  -TAQYLKLFGKTVLVSGSHTLSSPTSRDLKAPMATHSFSWNLS  640
               Q LKLFGKTV V  +    SP   + + P+    F W LS
Sbjct  219  PKKQSLKLFGKTVEVKDTCCTRSPLDSNEEKPI--QPFLWKLS  259



>ref|XP_010558667.1| PREDICTED: protein REVEILLE 1-like isoform X1 [Tarenaya hassleriana]
Length=423

 Score = 91.3 bits (225),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 101/223 (45%), Positives = 130/223 (58%), Gaps = 20/223 (9%)
 Frame = +2

Query  5    YGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmhp  184
            YGRAWRRI+EH+GTKTAVQIRSHAQKFFSK+ RE+ G +  +V+ I IPPPRPKRKPMHP
Sbjct  69   YGRAWRRIQEHIGTKTAVQIRSHAQKFFSKIARETAGSNGSSVERIVIPPPRPKRKPMHP  128

Query  185  yprkLVITPVSVVGMLDPEKPTRSLS-PNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
            YPRKL       +   D  +  RS+S P+LSVSE +++SPTSVL ++ S+   SAD++  
Sbjct  129  YPRKLGNPSAKEISGTDQSR--RSVSPPDLSVSEGDDQSPTSVLSSVCSDAFGSADTNSP  186

Query  362  aspscvssaTGGGIL-----FSKHCNVLVEENGSSSPPPGNLELLPLDDGRV-RESS---  514
             S     S+T    L     +       +EE  S +     LEL   +   + RE S   
Sbjct  187  NSILSPVSSTLPCELTLSGPYGSTTTFAIEEAESLT-----LELFGRERRLLSREESINP  241

Query  515  -TAQYLKLFGKTVLVSGSHTLSSPTSRDLKAPMATHSFSWNLS  640
               Q LKLFGKTV V  +    SP   + + P+    F W LS
Sbjct  242  PKKQSLKLFGKTVEVKDTCCTRSPLDSNEEKPI--QPFLWKLS  282



>ref|XP_006374255.1| hypothetical protein POPTR_0015s05430g [Populus trichocarpa]
 gb|ERP52052.1| hypothetical protein POPTR_0015s05430g [Populus trichocarpa]
Length=472

 Score = 91.3 bits (225),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 83/114 (73%), Gaps = 11/114 (10%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGR WR+I+EHVGTKTAVQIRSHAQK FSKV  ES+G +  ++KPIEIPPPRPKRKP H
Sbjct  78   LYGRGWRKIQEHVGTKTAVQIRSHAQKIFSKVVWESSGGNESSLKPIEIPPPRPKRKPAH  137

Query  182  pyprkLVI----TPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSE  331
            PYPRK V     TP S    LD      S SPN S SEK+N SPTSVL AL S+
Sbjct  138  PYPRKSVDIRKGTPAS--SQLD-----GSPSPNSSASEKDNLSPTSVLSALASD  184



>gb|KDO44076.1| hypothetical protein CISIN_1g021851mg [Citrus sinensis]
 gb|KDO44077.1| hypothetical protein CISIN_1g021851mg [Citrus sinensis]
 gb|KDO44078.1| hypothetical protein CISIN_1g021851mg [Citrus sinensis]
Length=306

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 75/114 (66%), Gaps = 11/114 (10%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpm-  178
            +YGR WR+IEEHVGTKTAVQIRSHAQKFFSKV RESNG    ++ PIEIPPPRPKRKP+ 
Sbjct  43   MYGRGWRQIEEHVGTKTAVQIRSHAQKFFSKVVRESNGSSESSIMPIEIPPPRPKRKPVH  102

Query  179  ---hpyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSE  331
                     L  T VS        +     S N  VS+K+ +SPTSV+ A +S+
Sbjct  103  PYPRKSVDSLKATSVS-------NQQENFTSSNALVSDKDRQSPTSVVSAFNSD  149



>ref|NP_198542.1| MYB family transcription factor Circadian 1 [Arabidopsis thaliana]
 sp|F4K5X6.1|RVE2_ARATH RecName: Full=Protein REVEILLE 2; AltName: Full=MYB family transcription 
factor Circadian 1 [Arabidopsis thaliana]
 gb|AED94158.1| MYB family transcription factor Circadian 1 [Arabidopsis thaliana]
Length=287

 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 96/229 (42%), Positives = 121/229 (53%), Gaps = 45/229 (20%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGRAWRRIEEHVGTKTAVQIRSHAQKFF+KV R    D   + + IEIPPPRPKRKPMH
Sbjct  53   LYGRAWRRIEEHVGTKTAVQIRSHAQKFFTKVAR----DFGVSSESIEIPPPRPKRKPMH  108

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
            PYPRKLVI           E     L+ +  + +++NRSPTSVL A  S+G         
Sbjct  109  PYPRKLVIPDA-------KEMVYAELTGSKLIQDEDNRSPTSVLSAHGSDGL--------  153

Query  362  aspscvssaTGGGILFSKHCNVLVEENGSSSPPPGNLELLP-LDDGRVRESSTAQYLKLF  538
                       G I             GS+SP   + EL    ++    E+ T Q LKLF
Sbjct  154  -----------GSI-------------GSNSPNSSSAELSSHTEESLSLEAETKQSLKLF  189

Query  539  GKTVLVSGSH-TLSSPTSRDLKAPMATHSFSWNLSIGHGDYSECKPVPS  682
            GKT +V   + ++S   S D K  + + + S   S    + +E + V S
Sbjct  190  GKTFVVGDYNSSMSCDDSEDGKKKLYSETQSLQCSSSTSENAETEVVVS  238



>ref|XP_009382073.1| PREDICTED: protein REVEILLE 1-like [Musa acuminata subsp. malaccensis]
Length=459

 Score = 90.9 bits (224),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 77/117 (66%), Gaps = 12/117 (10%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAK-TVKPIEIppprpkrkp-  175
            LYGRAWRRIEEH+GTKTAVQIRSHAQKFFSKV RES  +D+  T+K IEIPPPRPKRKP 
Sbjct  69   LYGRAWRRIEEHIGTKTAVQIRSHAQKFFSKVVRESGSNDSTVTLKAIEIPPPRPKRKPL  128

Query  176  ----mhpyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG  334
                          TP ++  +  P   T       ++ E+ENRSPTSVL A+ SE 
Sbjct  129  RPYPRKSGNSSSKETPAALKQLERPPLQTH------TICEEENRSPTSVLSAVGSEA  179



>gb|AAS09985.1| MYB transcription factor [Arabidopsis thaliana]
Length=287

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 96/229 (42%), Positives = 121/229 (53%), Gaps = 45/229 (20%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGRAWRRIEEHVGTKTAVQIRSHAQKFF+KV R    D   + + IEIPPPRPKRKPMH
Sbjct  53   LYGRAWRRIEEHVGTKTAVQIRSHAQKFFTKVAR----DFGVSSESIEIPPPRPKRKPMH  108

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
            PYPRKLVI           E     L+ +  + +++NRSPTSVL A  S+G         
Sbjct  109  PYPRKLVIPDA-------KEMVYAELTGSKLIQDEDNRSPTSVLSAHGSDGL--------  153

Query  362  aspscvssaTGGGILFSKHCNVLVEENGSSSPPPGNLELLP-LDDGRVRESSTAQYLKLF  538
                       G I             GS+SP   + EL    ++    E+ T Q LKLF
Sbjct  154  -----------GSI-------------GSNSPNSSSAELSSHTEESLSLEAETKQSLKLF  189

Query  539  GKTVLVSGSH-TLSSPTSRDLKAPMATHSFSWNLSIGHGDYSECKPVPS  682
            GKT +V   + ++S   S D K  + + + S   S    + +E + V S
Sbjct  190  GKTFVVGDYNSSMSCDDSEDGKKKLYSETQSLQCSSSTSEDAETEVVVS  238



>emb|CDX78737.1| BnaA03g06490D [Brassica napus]
Length=365

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 114/353 (32%), Positives = 150/353 (42%), Gaps = 80/353 (23%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESN-GDDAKTVKPIEIppprpkrkpm  178
             L+GRAWRRI+ HVGTKTAVQIRSHAQKFFSKV RE+  G +  +V+ I            
Sbjct  65    LHGRAWRRIQGHVGTKTAVQIRSHAQKFFSKVAREATGGSNEGSVEAI------------  112

Query  179   hpyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadssp  358
                   ++  P      + P    R L      +E++N SPTSVL  + SE   S DS  
Sbjct  113   ------VIPPPRPKRRPMHPY--PRKLGNKGDHTERDNSSPTSVLSPVGSEALGSLDSHS  164

Query  359   naspscvssaTGGGILFSKHCNVLVEENGSSSPPPGNLELLPLDDGRVRESS----TAQY  526
                     S        S    +    N         LEL P +    RESS    T Q 
Sbjct  165   PNRSLSPVS------FASPQAALATTSNAPEELETLKLELFPRERLVNRESSIKEPTKQS  218

Query  527   LKLFGKTVLVSGSHTLSSPTSRDLKAPMATHSFSWNLSIGHGDYSECK-PVPSLPWAL--  697
             LKLFGK VLVS S         D+ + + T+               CK P   LPW L  
Sbjct  219   LKLFGKIVLVSDS---------DMSSSLTTY---------------CKSPTQPLPWKLSM  254

Query  698   ---PRAPSSSAGFPCVQVHSPVAIKARPFSFDSKDNVEEKEDAKEGSSTCSNSGSVNVGI  868
                P+  S S    C+     + + ++    +++    EK    EGSST SN+GSV+   
Sbjct  255   VIDPQEESLS----CL-----IQVPSKQEEVENRCLDSEKAFQNEGSSTGSNTGSVDDTG  305

Query  869   CVDKNLDTETQSGQR--IGSDSSCFKRTTEIVILEQKTARSTKRTKGFMPYKR  1021
               DK+ + E    Q     S+ S F   T           S   ++GF PYK+
Sbjct  306   HTDKSSEPEAMVSQWEFTPSERSAFSELTR--------GTSEPNSRGFCPYKK  350



>ref|XP_011047787.1| PREDICTED: protein REVEILLE 7-like [Populus euphratica]
Length=485

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 83/114 (73%), Gaps = 11/114 (10%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGR WR+I+EHVGTKTAVQIRSHAQK FSKV  ES+G +  ++KPIEIPPPRPKRKP H
Sbjct  78   LYGRGWRKIQEHVGTKTAVQIRSHAQKIFSKVVWESSGGNESSLKPIEIPPPRPKRKPAH  137

Query  182  pyprkLVI----TPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSE  331
            PYPRK V     TP S    LD      S SPN S SEK+N SPTSVL A+ S+
Sbjct  138  PYPRKSVDIHKGTPAS--SQLDG-----SPSPNSSASEKDNLSPTSVLSAVASD  184



>ref|NP_001053666.1| Os04g0583900 [Oryza sativa Japonica Group]
 emb|CAD41380.2| OSJNBa0088A01.20 [Oryza sativa Japonica Group]
 dbj|BAF15580.1| Os04g0583900 [Oryza sativa Japonica Group]
Length=463

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 116/348 (33%), Positives = 164/348 (47%), Gaps = 77/348 (22%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTV---KPIEIppprpkrk  172
            L+GRAWRRI+EH+GTKTAVQIRSHAQKFFSKV +ES+GD+  ++     I+IPPPRPKRK
Sbjct  76   LHGRAWRRIQEHIGTKTAVQIRSHAQKFFSKVIKESSGDNCNSLGAASSIQIPPPRPKRK  135

Query  173  pmhpyprkLVITPVSVVGMLDP-EKPTRSLSPNLSVSEKENRSPTSVL----FALDSEGQ  337
            P+HPYPR L  T    V  L   EKP   +    S+ +++N SPTSVL       D+ G 
Sbjct  136  PVHPYPRNLGSTASKNVPALKQLEKPQLQVQ---SLYDQDNGSPTSVLTVPQIRADTLG-  191

Query  338  asadsspnaspscvssaTGGGILFSKHCNVLVEENGSSSPPPG------NLELLPLDDGR  499
                           S +GG    S    + +EE     P P        +EL P +D  
Sbjct  192  ---------------SESGG----SPTSTIDIEER---CPTPSIATAELAMELPPTNDEE  229

Query  500  VR----------ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDLK--APMATHSFSWNLSI  643
            V+          + S    L+LFGK V+V+  H +S+P + +L+  A M   + +   + 
Sbjct  230  VKGNGDHEEVTCDRSGVPVLRLFGKRVMVNDLHQMSAPDAGNLQTVADMEVDASAETPTS  289

Query  644  GHGDYSECKPVPSLPW------------------------ALPRAPSSSAGFPCVQVHSP  751
            G G +S      +  W                        ALP     + G  C Q  +P
Sbjct  290  GTGKFSSHGAAEANTWNPWLTNTQQFLYYLPNGQIFSVHSALPCFTYHNEGVTCTQFSNP  349

Query  752  VAIKA-RPFSFDSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDT  892
              + + +     + + V+ K   +EGS T SN+ S +V      N +T
Sbjct  350  QVVASDQQHQHQTSEAVDYKGIQREGSWTESNTSSSSVPETATHNSET  397



>ref|XP_003548314.1| PREDICTED: protein CCA1 [Glycine max]
 gb|KHN24535.1| Myb-like protein G [Glycine soja]
Length=477

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 79/111 (71%), Gaps = 3/111 (3%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGR WR+IEEH+GTK AVQIRSHAQKFFSKV RES G    +++PI IPPPRPKRKP+H
Sbjct  73   LYGRGWRQIEEHIGTKNAVQIRSHAQKFFSKVVRESEGSAESSIQPINIPPPRPKRKPLH  132

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG  334
            PYPRK V    S  G   P +   S S NL V+EK+  SPTSVL  + SE 
Sbjct  133  PYPRKSV---NSFKGHCIPNETEISPSTNLLVAEKDTPSPTSVLSTVGSEA  180



>ref|XP_006441350.1| hypothetical protein CICLE_v10020130mg [Citrus clementina]
 ref|XP_006441351.1| hypothetical protein CICLE_v10020130mg [Citrus clementina]
 gb|ESR54590.1| hypothetical protein CICLE_v10020130mg [Citrus clementina]
 gb|ESR54591.1| hypothetical protein CICLE_v10020130mg [Citrus clementina]
Length=448

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 75/114 (66%), Gaps = 11/114 (10%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpm-  178
            +YGR WR+IEEHVGTKTAVQIRSHAQKFFSKV RESNG    ++ PIEIPPPRPKRKP+ 
Sbjct  43   MYGRGWRQIEEHVGTKTAVQIRSHAQKFFSKVVRESNGSSESSIMPIEIPPPRPKRKPVH  102

Query  179  ---hpyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSE  331
                     L  T VS        +     S N  VS+K+ +SPTSVL + +S+
Sbjct  103  PYPRKSVDSLKATSVS-------NQQENFTSSNALVSDKDRQSPTSVLSSFNSD  149



>ref|XP_006652697.1| PREDICTED: uncharacterized protein LOC102715571 [Oryza brachyantha]
Length=463

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 120/344 (35%), Positives = 166/344 (48%), Gaps = 69/344 (20%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKP---IEIppprpkrk  172
            L+GRAWRRI+EH+GTKTAVQIRSHAQKFFSKV +ES+GD+  ++     I+IPPPRPKRK
Sbjct  76   LHGRAWRRIQEHIGTKTAVQIRSHAQKFFSKVIKESSGDNCNSLGAAPSIQIPPPRPKRK  135

Query  173  pmhpyprkLVITPVSVVGMLDP-EKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasad  349
            P+HPYPRKL  T    V  L   EKP   +    S+ +++N SPTSVL            
Sbjct  136  PVHPYPRKLGSTASKNVSALKQLEKPQLQVQ---SLYDQDNGSPTSVL------------  180

Query  350  sspnaspscvssaTGGGILFSKHCNVLVEENGSSSP-----------PPGNLELLPLDDG  496
            +        + S +GG    S    + +EE  S +P           PP N E +   +G
Sbjct  181  TVAQIRHDTLGSDSGG----SPASTIDIEER-SPTPSTTTAELAVELPPANAEEVK-GNG  234

Query  497  RVRE----SSTAQYLKLFGKTVLVSGSHTLSSPTSRDLK--APMATHSFSWNLSIGHGDY  658
              +E     S A  L+LFGK V+VS  H +S+P + +L+  A M   + +   + G G +
Sbjct  235  NCKEVTCDKSGAPVLRLFGKRVMVSDLHQMSTPDTGNLQTVADMEVDASAETPTSGTGKF  294

Query  659  SECKPVPSL----PW---------ALPRAP--SSSAGFPCVQVHS-----------PVAI  760
            S C          PW          LP     S  +  PC   H+            V  
Sbjct  295  S-CHGAAEANTWNPWLTNTHQFLYYLPNGQFFSVHSALPCFSYHTEGASSPQMSHPQVVA  353

Query  761  KARPFSFDSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDT  892
              +     + + V+ K   +EGS T S+S S +V     +N +T
Sbjct  354  SNQHHQHQAYEAVDYKCMQREGSWTESHSASSSVAETTARNSET  397



>gb|EAY95301.1| hypothetical protein OsI_17126 [Oryza sativa Indica Group]
Length=463

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 117/348 (34%), Positives = 165/348 (47%), Gaps = 77/348 (22%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKP---IEIppprpkrk  172
            L+GRAWRRI+EH+GTKTAVQIRSHAQKFFSKV +ES+GD+  ++     I+IPPPRPKRK
Sbjct  76   LHGRAWRRIQEHIGTKTAVQIRSHAQKFFSKVIKESSGDNCNSLGAAPSIQIPPPRPKRK  135

Query  173  pmhpyprkLVITPVSVVGMLDP-EKPTRSLSPNLSVSEKENRSPTSVL----FALDSEGQ  337
            P+HPYPRKL  T    V  L   EKP   +    S+ +++N SPTSVL       D+ G 
Sbjct  136  PVHPYPRKLGSTASKNVPALKQLEKPQLQVQ---SLYDQDNGSPTSVLTVPQIRADTLG-  191

Query  338  asadsspnaspscvssaTGGGILFSKHCNVLVEENGSSSPPPG------NLELLPLDDGR  499
                           S +GG    S    + +EE     P P        +EL P +D  
Sbjct  192  ---------------SESGG----SPTSTIDIEER---CPTPSIATAELAVELPPTNDEE  229

Query  500  VR----------ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDLK--APMATHSFSWNLSI  643
            V+          + S    L+LFGK V+V+  H +S+P + +L+  A M   + +   + 
Sbjct  230  VKGNGDHEEVTCDRSGVPVLRLFGKRVMVNDLHQMSAPDAGNLQTVADMEVDASAETPTS  289

Query  644  GHGDYSECKPVPSLPW------------------------ALPRAPSSSAGFPCVQVHSP  751
            G G +S      +  W                        ALP     + G  C Q  +P
Sbjct  290  GTGKFSSHGAAEANTWNPWLTNTQQFLYYLPNGQIFSVHSALPCFTYHNEGVTCTQFSNP  349

Query  752  VAIKA-RPFSFDSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDT  892
              + + +     + + V+ K   +EGS T SN+ S +V      N +T
Sbjct  350  QVVASDQQHQHQTSEAVDYKGIQREGSWTESNTSSSSVPETATHNSET  397



>gb|EAZ31766.1| hypothetical protein OsJ_15918 [Oryza sativa Japonica Group]
Length=463

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 115/348 (33%), Positives = 164/348 (47%), Gaps = 77/348 (22%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTV---KPIEIppprpkrk  172
            L+GRAWRRI+EH+GTKTAVQIRSHAQKFFSKV +ES+GD+  ++     I+IPPPRPKRK
Sbjct  76   LHGRAWRRIQEHIGTKTAVQIRSHAQKFFSKVIKESSGDNCNSLGAASSIQIPPPRPKRK  135

Query  173  pmhpyprkLVITPVSVVGMLDP-EKPTRSLSPNLSVSEKENRSPTSVL----FALDSEGQ  337
            P+HPYPR L  T    +  L   EKP   +    S+ +++N SPTSVL       D+ G 
Sbjct  136  PVHPYPRNLGSTASKNIPALKQLEKPQLQVQ---SLYDQDNGSPTSVLTVPQIRADTLG-  191

Query  338  asadsspnaspscvssaTGGGILFSKHCNVLVEENGSSSPPPG------NLELLPLDDGR  499
                           S +GG    S    + +EE     P P        +EL P +D  
Sbjct  192  ---------------SESGG----SPTSTIDIEER---CPTPSIATAELAMELPPTNDEE  229

Query  500  VR----------ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDLK--APMATHSFSWNLSI  643
            V+          + S    L+LFGK V+V+  H +S+P + +L+  A M   + +   + 
Sbjct  230  VKGNGDHEEVTCDRSGVPVLRLFGKRVMVNDLHQMSAPDAGNLQTVADMEVDASAETPTS  289

Query  644  GHGDYSECKPVPSLPW------------------------ALPRAPSSSAGFPCVQVHSP  751
            G G +S      +  W                        ALP     + G  C Q  +P
Sbjct  290  GTGKFSSHGAAEANTWNPWLTNTQQFLYYLPNGQIFSVHSALPCFTYHNEGVTCTQFSNP  349

Query  752  VAIKA-RPFSFDSKDNVEEKEDAKEGSSTCSNSGSVNVGICVDKNLDT  892
              + + +     + + V+ K   +EGS T SN+ S +V      N +T
Sbjct  350  QVVASDQQHQHQTSEAVDYKGIQREGSWTESNTSSSSVPETATHNSET  397



>ref|XP_003534089.1| PREDICTED: protein CCA1 isoform 1 [Glycine max]
 gb|KHN23589.1| Protein LHY [Glycine soja]
Length=466

 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 80/111 (72%), Gaps = 3/111 (3%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGR WR+IEEH+GTKTAVQIRSHAQKFFSKV RES   D  +++PI IPPPRPKRKP+H
Sbjct  63   LYGRGWRQIEEHIGTKTAVQIRSHAQKFFSKVVRESEVSDEGSIQPINIPPPRPKRKPLH  122

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG  334
            PYPRK V    S  G   P +   S S NL V+EK+  SPTSVL  + SE 
Sbjct  123  PYPRKSV---NSFRGPTIPNETEISPSTNLLVAEKDTPSPTSVLSTVGSEA  170



>emb|CDO98602.1| unnamed protein product [Coffea canephora]
Length=535

 Score = 89.4 bits (220),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 83/110 (75%), Gaps = 3/110 (3%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGRAWR+IEEHVGTKTA+QIRSHAQKFF+KV R+SN  +  ++ PIEIPPPRPK+KP H
Sbjct  131  LYGRAWRQIEEHVGTKTAIQIRSHAQKFFAKVARDSNECEG-SLNPIEIPPPRPKKKPAH  189

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSE  331
            PYPRK  +  V+   + DP +P ++     S  E+ +RSPTSVL AL S+
Sbjct  190  PYPRK--VMDVTKTTLDDPHQPEQAPPFKRSGEERNSRSPTSVLSALGSD  237



>gb|KFK33315.1| hypothetical protein AALP_AA6G359200 [Arabis alpina]
Length=298

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 112/201 (56%), Gaps = 25/201 (12%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGRAWRRIEEHVGTKTAVQIRSHAQKFF+KV R+    D  + K IEIPPPRPKRKPMH
Sbjct  55   LYGRAWRRIEEHVGTKTAVQIRSHAQKFFTKVARDY---DVSSEKSIEIPPPRPKRKPMH  111

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
            PYPRKLVI     +   +       L+    V +++NRSPTSVL A  S+G         
Sbjct  112  PYPRKLVIPDAKEMAYAE-------LTGAKLVPDEDNRSPTSVLSAHGSDG-------LG  157

Query  362  aspscvssaTGGGILFSKHCNVLVEENGSSSPPPGNLELLPLDDGRVRESSTAQYLKLFG  541
            +  S   +++      S + ++     G          L P       E+ T Q LKLFG
Sbjct  158  SMGSNSPNSSSADYQLSPYSDITEFSQGLELSSHTEESLSP-------EAETKQSLKLFG  210

Query  542  KTVLVSGSH-TLSSPTSRDLK  601
            KT +V   + + SS  S D+K
Sbjct  211  KTFVVGDYNSSTSSNDSEDVK  231



>ref|XP_008393486.1| PREDICTED: protein REVEILLE 7-like [Malus domestica]
Length=441

 Score = 88.6 bits (218),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 67/110 (61%), Gaps = 8/110 (7%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGR WR+IEE+VGTKTAVQIRSHAQKFFSKV +ES G    + + IEI        P  
Sbjct  71   LYGRGWRQIEEYVGTKTAVQIRSHAQKFFSKVSKESCGPSEGSTRLIEI-------PPPR  123

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSE  331
            P  + +   P   V  L+   P RS SP  S   K+ +SPTSVL A DS+
Sbjct  124  PKRKPVHPYPRKSVDYLNG-SPERSPSPQFSAQGKDQQSPTSVLSAYDSD  172



>gb|ABH02924.1| MYB transcription factor MYB131 [Glycine max]
Length=321

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 78/111 (70%), Gaps = 3/111 (3%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGR WR+IEEH+GTK AVQIRSHAQKFFSKV RES G    +++PI IP PRPKRKP+H
Sbjct  113  LYGRGWRQIEEHIGTKNAVQIRSHAQKFFSKVVRESEGSAESSIQPINIPXPRPKRKPLH  172

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEG  334
            PYPRK V    S  G   P +   S S NL V+EK+  SPTSVL  + SE 
Sbjct  173  PYPRKSV---NSFRGPTIPNETEISPSTNLLVAEKDTPSPTSVLSTVGSEA  220



>ref|XP_009413064.1| PREDICTED: protein REVEILLE 5-like [Musa acuminata subsp. malaccensis]
Length=501

 Score = 88.6 bits (218),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 82/110 (75%), Gaps = 3/110 (3%)
 Frame = +2

Query  5    YGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERES-NGDDAKTVKPIEIppprpkrkpmh  181
            YGRAWRRIEEH+GTKTAVQIRSHAQKFFSKV RES + D+  T K IEIPPPRPKRKP+H
Sbjct  85   YGRAWRRIEEHIGTKTAVQIRSHAQKFFSKVVRESGSNDNTGTSKGIEIPPPRPKRKPVH  144

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSE  331
            PYPRKL  +    +  L   +  R  SP   + E++NRSPTSVL A+ SE
Sbjct  145  PYPRKLSHSSNKEIPALKQLERPRLQSP--IICEQDNRSPTSVLSAVGSE  192



>ref|XP_011086968.1| PREDICTED: protein REVEILLE 2-like isoform X1 [Sesamum indicum]
 ref|XP_011086971.1| PREDICTED: protein REVEILLE 2-like isoform X1 [Sesamum indicum]
Length=474

 Score = 87.8 bits (216),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 84/110 (76%), Gaps = 2/110 (2%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGRAWR IEE+VGTKTA+QIRSHAQKFF+KV R+S+ D   ++ PI+IPPPRPK+KP+H
Sbjct  72   LYGRAWRHIEEYVGTKTAIQIRSHAQKFFAKVTRDSSMDAEGSLDPIQIPPPRPKKKPLH  131

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSE  331
            PYPRK V  PV+   +  P +   S SP+ SV EK+N SPTSVL  + S+
Sbjct  132  PYPRKFV-DPVN-REITVPNRLEISHSPDASVPEKDNLSPTSVLSVVGSD  179



>ref|XP_011086969.1| PREDICTED: protein REVEILLE 2-like isoform X2 [Sesamum indicum]
Length=456

 Score = 87.8 bits (216),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 84/110 (76%), Gaps = 2/110 (2%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGRAWR IEE+VGTKTA+QIRSHAQKFF+KV R+S+ D   ++ PI+IPPPRPK+KP+H
Sbjct  54   LYGRAWRHIEEYVGTKTAIQIRSHAQKFFAKVTRDSSMDAEGSLDPIQIPPPRPKKKPLH  113

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSE  331
            PYPRK V  PV+   +  P +   S SP+ SV EK+N SPTSVL  + S+
Sbjct  114  PYPRKFV-DPVN-REITVPNRLEISHSPDASVPEKDNLSPTSVLSVVGSD  161



>gb|EMT17444.1| Myb-like protein G [Aegilops tauschii]
Length=396

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 108/365 (30%), Positives = 155/365 (42%), Gaps = 47/365 (13%)
 Frame = +2

Query  2     LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
             L+GRAWRRI+EH+GTKTAVQIRSHAQKFFSKV R+S+GD   +      P   P  +P  
Sbjct  36    LHGRAWRRIQEHIGTKTAVQIRSHAQKFFSKVTRDSSGDSGGSSSGAGPPIQIPPPRPKR  95

Query  182   pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
                R       S           R   P LS+ E+ N SPTSV+                
Sbjct  96    KSVRPYPCNLRSAQPGKRAPALLRVDKPQLSMCEQGNGSPTSVV----------------  139

Query  362   aspscvssaTGGGILFSKHCNVLVEENGSSSPPPGNLELL----PLDDGRVR--------  505
                +      GG   F    + +  E    +P  G  E+     P +D +          
Sbjct  140   ---TTSQIGLGGSESFDSDTSTIDVEERCPTPSTGTAEVAVQAPPTNDSKKSKGSSSTSE  196

Query  506   -----ESSTAQYLKLFGKTVLVSGSHTLSSPTSRDLK--APMATHSFSWNLSIGHGDYSE  664
                   +S A  LKLFGKTV+V+ SH L SP + DL+  A M   + S  L+      + 
Sbjct  197   EVVCDNASDAPVLKLFGKTVVVNESHQLPSPGTCDLQTAADMELDTSSETLTSAPEANTW  256

Query  665   CKPVPSLPWALPRAPSSSAGFPCVQVHSPVAIKARPFSFDSKDNVEEKEDAKE--GSSTC  838
                + +    +   P  +  F       P  + + P + D +   +  E A E       
Sbjct  257   SPWLANSQQFMYYVPQGAVFFGYNNGSVPYPMSSSPKA-DQQHQHQASEAAAELRRREAS  315

Query  839   SNSGSVNVGICVDKNLDTETQSGQRIGSDSSCFKRTTEIVILEQKTARSTKRTKGFMPYK  1018
             SN+ S +V     +N   E+ +G  +G D+           L ++ + +  + +GFMPYK
Sbjct  316   SNTASSSVAETTARN-SAESCTGA-VGDDN----EMVHAAGLRERVSPAFVQQRGFMPYK  369

Query  1019  RCLAE  1033
             RC AE
Sbjct  370   RCAAE  374



>ref|XP_006478113.1| PREDICTED: uncharacterized protein LOC102614255 isoform X1 [Citrus 
sinensis]
 ref|XP_006478114.1| PREDICTED: uncharacterized protein LOC102614255 isoform X2 [Citrus 
sinensis]
Length=448

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 74/114 (65%), Gaps = 11/114 (10%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpm-  178
            +YGR WR+IEEHVGTKTAVQIRSHAQKFFSKV RESNG    ++  IEIPPPRPKRKP+ 
Sbjct  43   MYGRGWRQIEEHVGTKTAVQIRSHAQKFFSKVVRESNGSSESSIMAIEIPPPRPKRKPVH  102

Query  179  ---hpyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSE  331
                     L  T VS        +     S N  VS+K+ +SPTSV+ A +S+
Sbjct  103  PYPRKSVDSLKATSVS-------NQQENFTSSNALVSDKDRQSPTSVVSAFNSD  149



>ref|XP_006284219.1| hypothetical protein CARUB_v10005376mg [Capsella rubella]
 gb|EOA17117.1| hypothetical protein CARUB_v10005376mg [Capsella rubella]
Length=295

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 105/185 (57%), Gaps = 33/185 (18%)
 Frame = +2

Query  2    LYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVERESNGDDAKTVKPIEIppprpkrkpmh  181
            LYGRAWRRIEEHVGTKTAVQIRSHAQKFF+KV R    D   + + IEIPPPRPKRKPMH
Sbjct  53   LYGRAWRRIEEHVGTKTAVQIRSHAQKFFTKVAR----DFGVSSETIEIPPPRPKRKPMH  108

Query  182  pyprkLVITPVSVVGMLDPEKPTRSLSPNLSVSEKENRSPTSVLFALDSEGQasadsspn  361
            PYPRKLVI     +   D       L+    V +++NRSPTSVL A  S+G  S  S+  
Sbjct  109  PYPRKLVIPDAKEMVYGD-------LTGAKLVQDEDNRSPTSVLSAHGSDGLDSIGSNSP  161

Query  362  aspscvssaTGGGILFSKHCNVLVEENGSSSPPPGNLELLPLDDGRVRESSTAQYLKLFG  541
             S S     + G    S H     EE  S SP                E+ T Q LKLFG
Sbjct  162  NSSSADYQHSPGHNELSSHT----EE--SLSP----------------EAETKQSLKLFG  199

Query  542  KTVLV  556
            KT +V
Sbjct  200  KTFVV  204



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2375559402664