BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13154_g1_i1 len=1106 path=[1083:0-37 2182:38-38 @1121@!:39-518
1601:519-1105]

Length=1106
                                                                      Score     E

ref|XP_009625856.1|  PREDICTED: transcription factor ORG2-like          178   1e-49   
ref|XP_009625858.1|  PREDICTED: transcription factor ORG2-like is...    170   2e-46   
ref|XP_009625857.1|  PREDICTED: transcription factor ORG2-like is...    166   1e-44   
ref|XP_006351394.1|  PREDICTED: transcription factor ORG2-like          159   3e-42   
ref|XP_004249748.1|  PREDICTED: transcription factor bHLH100-like       151   3e-39   
ref|XP_010312405.1|  PREDICTED: transcription factor ORG3-like          150   5e-39   
ref|XP_009785053.1|  PREDICTED: transcription factor ORG3-like          147   5e-38   
ref|XP_006351395.1|  PREDICTED: importin subunit alpha-1-like           147   2e-35   
ref|XP_002271872.1|  PREDICTED: transcription factor ORG2               137   4e-34   Vitis vinifera
ref|XP_010023785.1|  PREDICTED: transcription factor bHLH101-like       137   4e-34   
gb|EYU18636.1|  hypothetical protein MIMGU_mgv1a012772mg                133   1e-32   
gb|KCW90048.1|  hypothetical protein EUGRSUZ_A02250                     131   4e-32   
ref|XP_007162129.1|  hypothetical protein PHAVU_001G126400g             132   4e-32   
ref|XP_003521149.1|  PREDICTED: transcription factor ORG3-like          130   7e-32   
emb|CBI29138.3|  unnamed protein product                                130   7e-32   
ref|XP_009339562.1|  PREDICTED: transcription factor ORG2-like          130   9e-32   
emb|CAN79614.1|  hypothetical protein VITISV_027441                     129   2e-31   Vitis vinifera
ref|XP_004290411.1|  PREDICTED: transcription factor ORG2-like          129   4e-31   
ref|XP_002531541.1|  DNA binding protein, putative                      125   2e-30   Ricinus communis
ref|XP_007204917.1|  hypothetical protein PRUPE_ppa024966mg             127   2e-30   
ref|XP_008243130.1|  PREDICTED: transcription factor ORG2-like          126   4e-30   
gb|KDP37831.1|  hypothetical protein JCGZ_06733                         126   4e-30   
ref|XP_010653965.1|  PREDICTED: transcription factor ORG2               124   2e-29   
ref|XP_007203008.1|  hypothetical protein PRUPE_ppa017407mg             123   4e-29   
ref|XP_010431420.1|  PREDICTED: transcription factor ORG2-like          123   5e-29   
gb|KHN14917.1|  Transcription factor ORG2                               122   9e-29   
gb|EYU29444.1|  hypothetical protein MIMGU_mgv1a022368mg                122   1e-28   
emb|CAN64266.1|  hypothetical protein VITISV_031510                     122   1e-28   Vitis vinifera
ref|XP_006291619.1|  hypothetical protein CARUB_v10017770mg             122   2e-28   
ref|XP_011078995.1|  PREDICTED: transcription factor ORG2-like          121   3e-28   
ref|XP_010412809.1|  PREDICTED: transcription factor ORG2               120   6e-28   
ref|XP_010504611.1|  PREDICTED: transcription factor ORG3               120   7e-28   
gb|AFK39552.1|  unknown                                                 119   1e-27   
ref|XP_006402926.1|  hypothetical protein EUTSA_v10006191mg             119   1e-27   
ref|XP_009774483.1|  PREDICTED: transcription factor bHLH100-like...    119   2e-27   
emb|CDX76026.1|  BnaA04g02900D                                          118   2e-27   
ref|XP_003520500.1|  PREDICTED: transcription factor ORG2-like          118   2e-27   
gb|KEH41328.1|  transcription factor ORG2-like protein                  118   3e-27   
ref|XP_009139056.1|  PREDICTED: transcription factor ORG3-like          118   4e-27   
ref|XP_008244842.1|  PREDICTED: transcription factor ORG2-like          117   5e-27   
ref|XP_010427553.1|  PREDICTED: transcription factor ORG3-like          117   7e-27   
ref|XP_010036348.1|  PREDICTED: transcription factor ORG2-like          117   1e-26   
gb|AFK46513.1|  unknown                                                 116   1e-26   
ref|XP_002878123.1|  OBP3-responsive gene 3                             116   1e-26   
ref|XP_008389283.1|  PREDICTED: transcription factor ORG2-like is...    116   2e-26   
ref|XP_010504610.1|  PREDICTED: transcription factor ORG2-like          116   2e-26   
ref|XP_009139054.1|  PREDICTED: transcription factor ORG2-like          116   2e-26   
ref|XP_007203926.1|  hypothetical protein PRUPE_ppa018670mg             115   2e-26   
ref|NP_191257.1|  transcription factor ORG3                             115   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007028476.1|  Basic helix-loop-helix DNA-binding superfami...    115   3e-26   
ref|XP_006402925.1|  hypothetical protein EUTSA_v10006189mg             115   3e-26   
emb|CDP09545.1|  unnamed protein product                                114   4e-26   
emb|CDX76031.1|  BnaA04g02950D                                          115   4e-26   
gb|AFK45714.1|  unknown                                                 114   6e-26   
gb|KEH41325.1|  transcription factor ORG2-like protein                  114   6e-26   
ref|XP_006402927.1|  hypothetical protein EUTSA_v10006491mg             114   6e-26   
ref|XP_010516301.1|  PREDICTED: transcription factor ORG3-like          114   8e-26   
ref|NP_191256.1|  transcription factor ORG2                             114   9e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002531540.1|  DNA binding protein, putative                      114   1e-25   Ricinus communis
ref|XP_010927034.1|  PREDICTED: transcription factor bHLH100-like       113   2e-25   
ref|XP_004249750.2|  PREDICTED: transcription factor bHLH100-like       114   2e-25   
ref|XP_009616457.1|  PREDICTED: transcription factor ORG2-like is...    112   2e-25   
gb|KDO40152.1|  hypothetical protein CISIN_1g025477mg                   113   2e-25   
ref|XP_006411389.1|  hypothetical protein EUTSA_v10017167mg             112   3e-25   
ref|XP_006292870.1|  hypothetical protein CARUB_v10019130mg             112   3e-25   
ref|XP_008389282.1|  PREDICTED: transcription factor ORG2-like is...    112   3e-25   
ref|XP_009616456.1|  PREDICTED: transcription factor ORG2-like is...    112   4e-25   
ref|XP_009142733.1|  PREDICTED: transcription factor bHLH100-like       112   4e-25   
ref|XP_009600422.1|  PREDICTED: transcription factor ORG2-like          112   4e-25   
ref|XP_002878122.1|  OBP3-responsive gene 3                             112   5e-25   
ref|XP_007028477.1|  Basic helix-loop-helix DNA-binding superfami...    111   6e-25   
gb|KFK34930.1|  hypothetical protein AALP_AA5G212600                    111   7e-25   
ref|XP_002323250.2|  basic helix-loop-helix family protein              112   7e-25   Populus trichocarpa [western balsam poplar]
ref|XP_006494391.1|  PREDICTED: transcription factor ORG2-like          109   8e-25   
emb|CDY47394.1|  BnaC04g24690D                                          111   9e-25   
gb|KFK24862.1|  hypothetical protein AALP_AA8G034700                    111   9e-25   
emb|CDY72354.1|  BnaA05g34220D                                          110   1e-24   
emb|CDY69684.1|  BnaCnng64770D                                          111   1e-24   
ref|XP_007202904.1|  hypothetical protein PRUPE_ppa016095mg             110   1e-24   
ref|XP_009139058.1|  PREDICTED: transcription factor ORG2-like          110   1e-24   
ref|XP_009141976.1|  PREDICTED: transcription factor bHLH100            110   2e-24   
emb|CDY06938.1|  BnaA04g23770D                                          110   2e-24   
ref|XP_002881763.1|  predicted protein                                  110   2e-24   
emb|CDY68089.1|  BnaCnng57560D                                          110   3e-24   
ref|XP_002307969.2|  hypothetical protein POPTR_0006s03590g             110   3e-24   Populus trichocarpa [western balsam poplar]
ref|XP_011040761.1|  PREDICTED: transcription factor ORG2-like          109   3e-24   
ref|XP_004513200.1|  PREDICTED: transcription factor ORG2-like          109   3e-24   
ref|XP_010108531.1|  Transcription factor ORG2                          111   3e-24   
ref|XP_011075620.1|  PREDICTED: transcription factor ORG2-like          109   5e-24   
ref|XP_010276688.1|  PREDICTED: transcription factor ORG2-like          109   5e-24   
ref|XP_008244848.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    107   9e-24   
emb|CDY14758.1|  BnaC04g47550D                                          107   1e-23   
gb|KEH41327.1|  transcription factor ORG2-like protein                  107   1e-23   
ref|XP_010554771.1|  PREDICTED: transcription factor ORG2-like          107   2e-23   
gb|KEH41330.1|  transcription factor ORG2-like protein                  107   2e-23   
ref|XP_002267985.1|  PREDICTED: transcription factor ORG2-like          107   2e-23   Vitis vinifera
ref|XP_010108530.1|  Transcription factor ORG2                          107   4e-23   
gb|KEH41324.1|  transcription factor ORG2-like protein                  105   7e-23   
ref|XP_010108529.1|  Transcription factor ORG2                          104   2e-22   
emb|CDY47396.1|  BnaC04g24670D                                          105   2e-22   
emb|CDX67670.1|  BnaA07g17100D                                          103   3e-22   
gb|KEH41326.1|  transcription factor ORG2-like protein                  103   4e-22   
ref|XP_006294890.1|  hypothetical protein CARUB_v10023940mg             103   5e-22   
ref|XP_011000433.1|  PREDICTED: transcription factor ORG2-like          103   5e-22   
ref|XP_004493429.1|  PREDICTED: transcription factor ORG3-like          102   1e-21   
ref|XP_010512914.1|  PREDICTED: transcription factor bHLH100-like       101   2e-21   
ref|XP_010673161.1|  PREDICTED: transcription factor bHLH101-like       101   3e-21   
ref|XP_009130803.1|  PREDICTED: transcription factor bHLH101 isof...    101   3e-21   
emb|CDX85121.1|  BnaC07g07850D                                          100   4e-21   
ref|XP_006398871.1|  hypothetical protein EUTSA_v10014371mg             100   5e-21   
ref|XP_010507675.1|  PREDICTED: transcription factor bHLH100-like       100   5e-21   
ref|XP_009774485.1|  PREDICTED: transcription factor bHLH100-like...  99.4    7e-21   
ref|NP_196035.1|  transcription factor bHLH101                        99.4    1e-20   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28679.1|  unknown                                               99.4    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010673162.1|  PREDICTED: transcription factor bHLH101-like     99.8    1e-20   
ref|XP_002873137.1|  predicted protein                                99.0    1e-20   
ref|XP_010412993.1|  PREDICTED: transcription factor bHLH100-like     99.0    2e-20   
ref|XP_009774484.1|  PREDICTED: transcription factor bHLH100-like...  99.0    2e-20   
ref|XP_009339564.1|  PREDICTED: transcription factor ORG2-like is...  98.6    2e-20   
emb|CDX80905.1|  BnaC03g01590D                                          100   3e-20   
ref|XP_009116401.1|  PREDICTED: transcription factor ORG3-like        98.2    3e-20   
ref|NP_181657.1|  transcription factor bHLH100                        97.1    8e-20   Arabidopsis thaliana [mouse-ear cress]
emb|CDX67671.1|  BnaA07g17110D                                        97.1    8e-20   
emb|CDX77489.1|  BnaA07g06270D                                        96.7    9e-20   
ref|XP_006288475.1|  hypothetical protein CARUB_v10001734mg           96.7    1e-19   
ref|XP_008674508.1|  PREDICTED: transcription factor bHLH100-like...  95.9    1e-19   
ref|XP_009779323.1|  PREDICTED: uncharacterized protein LOC104228545    100   1e-19   
tpg|DAA55783.1|  TPA: putative HLH DNA-binding domain superfamily...  96.3    1e-19   
emb|CDY06148.1|  BnaA09g36320D                                        96.3    1e-19   
ref|XP_009130802.1|  PREDICTED: transcription factor bHLH101 isof...  96.7    1e-19   
ref|XP_008656862.1|  PREDICTED: transcription factor ORG3-like        95.5    2e-19   
ref|XP_009102593.1|  PREDICTED: transcription factor ORG3-like        95.9    2e-19   
ref|XP_009104034.1|  PREDICTED: transcription factor ORG3-like        95.5    2e-19   
gb|AFW83935.1|  putative HLH DNA-binding domain superfamily protein   95.5    3e-19   
ref|XP_004971295.1|  PREDICTED: transcription factor ORG3-like is...  95.1    3e-19   
ref|XP_009339563.1|  PREDICTED: transcription factor ORG2-like is...  95.1    4e-19   
ref|XP_004170119.1|  PREDICTED: transcription factor ORG2-like        94.7    5e-19   
ref|XP_008243129.1|  PREDICTED: transcription factor ORG2-like        94.4    6e-19   
emb|CDX72085.1|  BnaC08g27890D                                        94.4    7e-19   
tpg|DAA55782.1|  TPA: putative HLH DNA-binding domain superfamily...  94.0    8e-19   
ref|XP_008674507.1|  PREDICTED: transcription factor bHLH100-like...  94.0    9e-19   
emb|CDM84248.1|  unnamed protein product                              93.2    1e-18   
ref|XP_007203256.1|  hypothetical protein PRUPE_ppa019552mg           93.2    1e-18   
ref|XP_003565088.1|  PREDICTED: transcription factor bHLH100-like     93.2    1e-18   
emb|CDY71118.1|  BnaUnng04210D                                        93.2    1e-18   
gb|AES81269.2|  transcription factor, putative                        93.2    2e-18   
ref|NP_850349.1|  transcription factor bHLH100                        92.8    2e-18   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK02408.1|  predicted protein                                    92.4    2e-18   
ref|XP_003625051.1|  Transcription factor ORG2                        92.8    2e-18   
ref|XP_004144337.1|  PREDICTED: transcription factor ORG2-like        91.3    2e-18   
ref|XP_010423622.1|  PREDICTED: transcription factor bHLH101-like     92.8    2e-18   
gb|EMT11155.1|  Transcription factor ORG2                             92.4    2e-18   
ref|XP_010490919.1|  PREDICTED: transcription factor bHLH101-like     92.8    3e-18   
gb|KCW84375.1|  hypothetical protein EUGRSUZ_B01226                   91.7    3e-18   
ref|XP_009124032.1|  PREDICTED: transcription factor ORG2-like        92.4    3e-18   
ref|XP_011040759.1|  PREDICTED: transcription factor ORG2-like is...  92.0    3e-18   
ref|XP_003565095.1|  PREDICTED: transcription factor bHLH100-like     92.0    4e-18   
ref|XP_003572517.1|  PREDICTED: transcription factor bHLH100-like     92.0    4e-18   
gb|KGN54724.1|  hypothetical protein Csa_4G434480                     91.7    4e-18   
gb|EMT09813.1|  Transcription factor ORG2                             92.0    5e-18   
ref|XP_004971296.1|  PREDICTED: transcription factor ORG3-like is...  91.7    6e-18   
gb|EMS54276.1|  Transcription factor ORG2                             91.3    6e-18   
ref|XP_009414172.1|  PREDICTED: transcription factor bHLH101-like     90.9    9e-18   
ref|XP_006854796.1|  hypothetical protein AMTR_s00063p00154030        90.5    1e-17   
emb|CDX77490.1|  BnaA07g06280D                                        90.1    2e-17   
dbj|BAJ93630.1|  predicted protein                                    90.1    2e-17   
ref|XP_007015050.1|  Basic helix-loop-helix (bHLH) DNA-binding su...  89.7    2e-17   
ref|XP_002308882.2|  hypothetical protein POPTR_0006s03560g           89.0    4e-17   Populus trichocarpa [western balsam poplar]
ref|XP_009105533.1|  PREDICTED: transcription factor ORG2-like        89.0    5e-17   
ref|XP_004144366.1|  PREDICTED: transcription factor ORG2-like        87.4    5e-17   
ref|XP_008455703.1|  PREDICTED: transcription factor bHLH100-like     88.2    9e-17   
ref|XP_011040760.1|  PREDICTED: transcription factor ORG2-like is...  88.2    9e-17   
ref|XP_009102594.1|  PREDICTED: transcription factor ORG3-like        88.2    9e-17   
ref|XP_006604330.1|  PREDICTED: transcription factor ORG2-like        85.5    1e-16   
emb|CBI25000.3|  unnamed protein product                              86.7    1e-16   
dbj|BAB64701.1|  bHLH transcription factor-like                       87.8    1e-16   Oryza sativa Japonica Group [Japonica rice]
emb|CDY47395.1|  BnaC04g24680D                                        87.4    1e-16   
emb|CDX72086.1|  BnaC08g27880D                                        87.4    1e-16   
emb|CDX76027.1|  BnaA04g02910D                                        87.0    2e-16   
dbj|BAF30424.1|  basic helix-loop-helix protein                       87.4    2e-16   Hordeum vulgare [barley]
ref|XP_009387039.1|  PREDICTED: transcription factor ORG2-like        87.0    2e-16   
emb|CDY71388.1|  BnaUnng04340D                                        85.9    6e-16   
gb|EMS47280.1|  Transcription factor ORG2                             85.9    6e-16   
ref|XP_010243481.1|  PREDICTED: transcription factor bHLH101-like     85.5    1e-15   
gb|ABD37969.1|  basic helix-loop-helix family protein                 83.2    2e-15   Noccaea caerulescens
ref|NP_001045424.1|  Os01g0952800                                     84.0    3e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EMS61479.1|  Transcription factor ORG2                             83.2    3e-15   
tpd|FAA00382.1|  TPA: bHLH transcription factor                       83.2    5e-15   
ref|XP_006645381.1|  PREDICTED: transcription factor bHLH100-like     82.8    7e-15   
ref|XP_009116400.1|  PREDICTED: transcription factor ORG3-like        82.8    8e-15   
ref|XP_009139052.1|  PREDICTED: transcription factor ORG2-like        81.6    1e-14   
gb|EMT13532.1|  Transcription factor ORG2                             82.0    1e-14   
ref|XP_008455701.1|  PREDICTED: transcription factor bHLH101-like     81.3    2e-14   
gb|KHN14918.1|  Transcription factor ORG2                             82.4    2e-14   
ref|XP_009796478.1|  PREDICTED: transcription factor bHLH101-like     78.6    1e-13   
ref|XP_010543098.1|  PREDICTED: transcription factor ORG3-like is...  79.3    1e-13   
gb|EEC72172.1|  hypothetical protein OsI_05220                        77.4    2e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_008803360.1|  PREDICTED: transcription factor bHLH101-like     79.0    3e-13   
ref|XP_004985006.1|  PREDICTED: transcription factor bHLH100-like     77.8    4e-13   
ref|XP_006838370.1|  hypothetical protein AMTR_s00002p00041060        76.3    2e-12   
emb|CBI23781.3|  unnamed protein product                              77.0    2e-12   
ref|XP_010543164.1|  PREDICTED: transcription factor ORG3-like is...  75.9    2e-12   
ref|XP_010030117.1|  PREDICTED: uncharacterized protein LOC104419969  75.1    2e-11   
ref|XP_002269173.3|  PREDICTED: uncharacterized protein LOC100258265  73.9    2e-11   Vitis vinifera
emb|CDY23861.1|  BnaC04g01760D                                        70.9    2e-11   
ref|XP_011087740.1|  PREDICTED: transcription factor bHLH100          72.4    7e-11   
ref|XP_010268963.1|  PREDICTED: transcription factor ORG2-like        68.6    3e-10   
ref|XP_006421111.1|  hypothetical protein CICLE_v10006413mg           67.8    4e-10   
gb|KCW84374.1|  hypothetical protein EUGRSUZ_B01225                   67.4    4e-10   
ref|XP_010679419.1|  PREDICTED: transcription factor bHLH101          67.8    1e-09   
gb|EPS74183.1|  hypothetical protein M569_00579                       65.9    2e-09   
emb|CDX76032.1|  BnaA04g02960D                                        66.2    3e-09   
emb|CDM84249.1|  unnamed protein product                              65.5    5e-09   
ref|XP_010543536.1|  PREDICTED: transcription factor bHLH101 isof...  64.3    2e-08   
ref|XP_006471125.1|  PREDICTED: uncharacterized protein LOC102625584  65.9    2e-08   
gb|KDO53475.1|  hypothetical protein CISIN_1g036457mg                 65.9    2e-08   
ref|XP_010507674.1|  PREDICTED: transcription factor bHLH100-like     62.0    5e-08   
gb|EYU26529.1|  hypothetical protein MIMGU_mgv1a019680mg              62.8    8e-08   
ref|XP_010543534.1|  PREDICTED: transcription factor bHLH101 isof...  60.1    4e-07   
gb|EMS55484.1|  Transcription factor ORG2                             59.3    5e-07   
gb|EMT11154.1|  hypothetical protein F775_52460                       59.3    8e-07   
ref|XP_010042285.1|  PREDICTED: transcription factor ORG2-like        57.4    2e-06   
ref|XP_006431857.1|  hypothetical protein CICLE_v10001998mg           58.9    2e-06   
ref|XP_002529548.1|  hypothetical protein RCOM_0407930                57.8    3e-06   Ricinus communis
ref|XP_008449406.1|  PREDICTED: transcription factor bHLH100          57.0    9e-06   
ref|XP_007203481.1|  hypothetical protein PRUPE_ppa022341mg           55.1    1e-05   
gb|EMS49002.1|  Transcription factor ORG2                             55.5    1e-05   
ref|XP_007042240.1|  Basic helix-loop-helix DNA-binding superfami...  53.9    2e-05   
ref|XP_002529549.1|  hypothetical protein RCOM_0408240                55.1    5e-05   Ricinus communis
emb|CDX72783.1|  BnaC06g32310D                                        52.0    2e-04   
ref|XP_009627446.1|  PREDICTED: transcription factor ORG3-like        50.1    4e-04   
ref|XP_010507673.1|  PREDICTED: transcription factor bHLH100-like     48.9    8e-04   



>ref|XP_009625856.1| PREDICTED: transcription factor ORG2-like [Nicotiana tomentosiformis]
Length=245

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 125/269 (46%), Positives = 176/269 (65%), Gaps = 30/269 (11%)
 Frame = +3

Query  45   SPMSFPNMGWSIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERCDSL  224
            SP+   + GW ++D ISH+      + N A +TS +          SS     ++ CDS 
Sbjct  7    SPLFSDHFGWLLEDPISHQ------FINTAAETSDNL---------SSSQTRLLQHCDSN  51

Query  225  KFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKAR  404
            KFD    +               MVKKL+HNASERDRRKK+N L+SSLRSLLPASD   +
Sbjct  52   KFDQIINNGDQPDQ---------MVKKLNHNASERDRRKKINTLYSSLRSLLPASDHTKK  102

Query  405  MSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHH  584
            +SIP+T+SRV+KYIPELQ E+ERL +KK+ELTSR  S +   ++  +FNK++R  GG+  
Sbjct  103  LSIPSTISRVLKYIPELQIEVERLIEKKEELTSRTISNK---ENSADFNKQKR-RGGNEI  158

Query  585  NRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFH  764
            +    +SA++VG++++VIQI + K  +  F +A+S LE EGL LL+SS F+T EDRV F+
Sbjct  159  SSL-VISASEVGDKEVVIQISTLKINKCSFGEAVSELEDEGLSLLNSSCFETFEDRV-FY  216

Query  765  TLHLQVQGIEMMEVDKLKEKLLSYFNEEQ  851
            TLH QVQG  ++E+D L++KL SYF E++
Sbjct  217  TLHFQVQGTMVVELDTLRDKLSSYFEEDK  245



>ref|XP_009625858.1| PREDICTED: transcription factor ORG2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=255

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 128/272 (47%), Positives = 173/272 (64%), Gaps = 25/272 (9%)
 Frame = +3

Query  45   SPMSFPNMGWSIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERCDSL  224
            SP+   N GW ++D ISHE             TS +      V+L S      ++ CDS 
Sbjct  7    SPLFSNNFGWLLEDPISHE----------LNMTSAETSSESVVALQSLSQTRVLQHCDSN  56

Query  225  KFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKAR  404
            KFD    +               MVKKL+HNASERDRRKK+N L+SSLRSLLPASD   +
Sbjct  57   KFDQIINNGDQPDQ---------MVKKLNHNASERDRRKKINTLYSSLRSLLPASDHAKK  107

Query  405  MSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHH  584
            +SIP+T+SRV+KYI ELQ E+ERL +KK+EL SR NS ++ S    +FNK++R   G   
Sbjct  108  LSIPSTISRVLKYIQELQNEVERLIQKKEELISRTNSNKENS---ADFNKQKR--RGGVE  162

Query  585  NRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFH  764
            +    +SA++VG+R++VIQI + K  +  FA+A+S LE EGL+LL+SS F+T EDRV F+
Sbjct  163  SSSLVISASEVGDREVVIQISTLKINKGSFAEAVSELEDEGLLLLNSSCFETLEDRV-FY  221

Query  765  TLHLQVQGIEMMEVDKLKEKLLSYFNEEQTCL  860
            TLH QVQG  ++E+D L++KL SYF +E   L
Sbjct  222  TLHFQVQGTMVVELDTLRDKLSSYFEKEDKLL  253



>ref|XP_009625857.1| PREDICTED: transcription factor ORG2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=256

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 128/273 (47%), Positives = 173/273 (63%), Gaps = 26/273 (10%)
 Frame = +3

Query  45   SPMSFPNMGWSIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERCDSL  224
            SP+   N GW ++D ISHE             TS +      V+L S      ++ CDS 
Sbjct  7    SPLFSNNFGWLLEDPISHE----------LNMTSAETSSESVVALQSLSQTRVLQHCDSN  56

Query  225  KFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKAR  404
            KFD    +               MVKKL+HNASERDRRKK+N L+SSLRSLLPASD   +
Sbjct  57   KFDQIINNGDQPDQ---------MVKKLNHNASERDRRKKINTLYSSLRSLLPASDHAKK  107

Query  405  MSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHH  584
            +SIP+T+SRV+KYI ELQ E+ERL +KK+EL SR NS ++ S    +FNK++R   G   
Sbjct  108  LSIPSTISRVLKYIQELQNEVERLIQKKEELISRTNSNKENS---ADFNKQKR--RGGVE  162

Query  585  NRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFH  764
            +    +SA++VG+R++VIQI + K  +  FA+A+S LE EGL+LL+SS F+T EDRV F+
Sbjct  163  SSSLVISASEVGDREVVIQISTLKINKGSFAEAVSELEDEGLLLLNSSCFETLEDRV-FY  221

Query  765  TLHL-QVQGIEMMEVDKLKEKLLSYFNEEQTCL  860
            TLH  QVQG  ++E+D L++KL SYF +E   L
Sbjct  222  TLHFQQVQGTMVVELDTLRDKLSSYFEKEDKLL  254



>ref|XP_006351394.1| PREDICTED: transcription factor ORG2-like [Solanum tuberosum]
Length=252

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 117/271 (43%), Positives = 169/271 (62%), Gaps = 28/271 (10%)
 Frame = +3

Query  36   PFFSPMSFPNMGWSIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERC  215
            P FS  ++ N GW ++D IS +            + +P   P H     SS     ++  
Sbjct  7    PMFST-NYNNFGWLLEDPISQQI-----------NINP-MEPLH----SSSSSQKNLQHS  49

Query  216  DSLKFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQ  395
            DS KFD  + + G              VKKL+HNASERDRRK +NGL+SSLRSLLP SD 
Sbjct  50   DSNKFDQITINGGDHHQSDQT------VKKLNHNASERDRRKNINGLYSSLRSLLPPSDH  103

Query  396  KARMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGG  575
              ++SIP+T+S+++KYIPELQ E+ERL +KK+E TS   S ++ S    +FNK++R  GG
Sbjct  104  TKKLSIPSTISKILKYIPELQSEVERLVQKKEEFTSTTISNKENS---GDFNKQKRRSGG  160

Query  576  HHHNRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRV  755
               N    +S +++GE++IV+QI + K  +    +A+S LE EGLVLL++++F+T EDRV
Sbjct  161  -IENSSLVISTSKLGEKEIVVQISTLKINKGSIGEAISQLEDEGLVLLNATSFETFEDRV  219

Query  756  NFHTLHLQVQGIEMMEVDKLKEKLLSYFNEE  848
             F+TLH QV+G  ++EVD L++KL  YF +E
Sbjct  220  -FYTLHFQVEGSMVVEVDMLRDKLSYYFEKE  249



>ref|XP_004249748.1| PREDICTED: transcription factor bHLH100-like [Solanum lycopersicum]
Length=250

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 137/185 (74%), Gaps = 7/185 (4%)
 Frame = +3

Query  297  VKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerl  476
            VKKL+HNASERDRRKK+N L+SSLRSLLP SD   + SIP+T+S+++KYIPELQ E+ERL
Sbjct  69   VKKLNHNASERDRRKKINDLYSSLRSLLPPSDHMKKPSIPSTISKILKYIPELQSEVERL  128

Query  477  qkkkqelTSR-VNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
             +KK+E TS  V + QK+     +F K++R  GG   N    +S +++ +++IV+QI + 
Sbjct  129  VQKKEEFTSTYVFNRQKLG----DFTKQKRTKGG-IENSSFVISTSKLSDKEIVVQISTL  183

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLLS  833
            K  +    +A+S LE EGLVLL++++F+T EDRV F+TLH QV+G  ++E+D L++KL S
Sbjct  184  KINKGSIGEAISQLEDEGLVLLNANSFETFEDRV-FYTLHFQVEGSMVVEIDMLRDKLSS  242

Query  834  YFNEE  848
            YF +E
Sbjct  243  YFEKE  247



>ref|XP_010312405.1| PREDICTED: transcription factor ORG3-like [Solanum lycopersicum]
Length=244

 Score =   150 bits (378),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 118/275 (43%), Positives = 166/275 (60%), Gaps = 40/275 (15%)
 Frame = +3

Query  36   PFFSPMSFPNMGWSIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERC  215
            P FS  +  N GW ++D ISHE   +   SN++                      +++ C
Sbjct  10   PLFSTTT-NNFGWLLEDLISHELTNSGETSNSS--------------------QKSLQHC  48

Query  216  DSLKFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQ  395
            DS KFD    + G              VKKL+HNASERDRRKK+N L+SSLRSLLP SD 
Sbjct  49   DSNKFDQIIINSGDQYQPDQT------VKKLNHNASERDRRKKINSLYSSLRSLLPPSDH  102

Query  396  KARMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGG  575
              ++SIP+TVSR++KYIPELQ E+ERL +KK+E TS+              NK +R+ GG
Sbjct  103  TKKLSIPSTVSRILKYIPELQSEVERLVQKKEEFTSK-----------NILNKPKRIKGG  151

Query  576  HHHNRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRV  755
               N    +S +++G+++IVIQI + K  +   ++A+S LE EGLVLL++++F+T EDRV
Sbjct  152  -IENSSFVISTSELGDKEIVIQISTLKINKGSISEAISQLEDEGLVLLNATSFETFEDRV  210

Query  756  NFHTLHLQVQGIEMMEVDKLKEKLLSYFNEEQTCL  860
             F+TLH QV+G  ++EVD L++KL SYF  E+  L
Sbjct  211  -FYTLHFQVEGSMVVEVDMLRDKLSSYFENEENLL  244



>ref|XP_009785053.1| PREDICTED: transcription factor ORG3-like [Nicotiana sylvestris]
Length=244

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 126/262 (48%), Positives = 174/262 (66%), Gaps = 29/262 (11%)
 Frame = +3

Query  63   NMGWSIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERCDSLKFdggs  242
            N GW ++D IS+E   T         TS D+      +L  S     +E CDS KFD  +
Sbjct  9    NFGWLLEDPISYELNMT---------TSSDS----VAALHPSSQTRLLEHCDSKKFDQIN  55

Query  243  tdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTT  422
             D               MVKKL+HNASERDRRKK+N L+SSLRSLLPASD   ++SIP+T
Sbjct  56   NDDQPDQ----------MVKKLNHNASERDRRKKINSLYSSLRSLLPASDHAKKLSIPST  105

Query  423  VSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYL  602
            +SRV+KYIPELQ E+E+L +KK++LTSR  S ++ S    +FNK++R   G + +    +
Sbjct  106  ISRVLKYIPELQNEVEKLIEKKEDLTSRTISNKENS---ADFNKQKR--RGGNDSSSLVI  160

Query  603  SATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQV  782
            SA++VG++++VIQI + K  +  FA+A+S LE EGL+LL+SS+F+T EDRV FHTLH QV
Sbjct  161  SASEVGDKEVVIQISTLKINKGSFAEAVSDLEDEGLLLLNSSSFETFEDRV-FHTLHFQV  219

Query  783  QGIEMMEVDKLKEKLLSYFNEE  848
            QG  ++E+D L++KL SYF +E
Sbjct  220  QGTMVVELDTLRDKLSSYFQKE  241



>ref|XP_006351395.1| PREDICTED: importin subunit alpha-1-like [Solanum tuberosum]
Length=740

 Score =   147 bits (372),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 108/251 (43%), Positives = 155/251 (62%), Gaps = 34/251 (14%)
 Frame = +3

Query  36   PFFSPMSFPNMGWSIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERC  215
            P FS  +  N GW ++D ISHE          +GDTS  +               +++ C
Sbjct  10   PLFSTTT-NNFGWLLEDLISHEL-------TNSGDTSNSSQK-------------SLQHC  48

Query  216  DSLKFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQ  395
            DS KFD    + G              VKKL+HNASERDRRKK+NGL+SSLRSLLP SD 
Sbjct  49   DSNKFDQIIINGGDHHQPDQT------VKKLNHNASERDRRKKINGLYSSLRSLLPPSDH  102

Query  396  KARMSIPTTVSRVVKYIPelqkelerlqkkkqelTS-RVNSWQKISKSPPEFNKRRRVMG  572
              ++SIP+TVSR++KYIPELQ E+ERL +KK++ TS  + + Q +     +F K++R+ G
Sbjct  103  TKKLSIPSTVSRILKYIPELQSEVERLVQKKEKFTSTTIFNRQNLG----DFTKQKRIKG  158

Query  573  GHHHNRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDR  752
            G   N    +S +++G+++IVIQI + K  +   ++A+S LE EGLVLL++++F+T EDR
Sbjct  159  G-IENSSFVISTSELGDKEIVIQISTLKINKGSISEAISQLEDEGLVLLNATSFETFEDR  217

Query  753  VNFHTLHLQVQ  785
            V F+TLH Q +
Sbjct  218  V-FYTLHFQFE  227



>ref|XP_002271872.1| PREDICTED: transcription factor ORG2 [Vitis vinifera]
Length=244

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 102/254 (40%), Positives = 151/254 (59%), Gaps = 32/254 (13%)
 Frame = +3

Query  42   FSPMSFPNMGWSIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERCDS  221
            FSP SFP +GW ++D ISH Q     Y     +TS       F+ L SS  P     C +
Sbjct  4    FSPPSFPTLGWPLEDPISHAQN----YIYGETETSES-----FLHLSSSQ-PQVELNCST  53

Query  222  LKFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKA  401
                                    MVKKL+HNASERDRRKK+N L+SS+RSLLP++DQ  
Sbjct  54   --------------PSAAVRGNPTMVKKLNHNASERDRRKKINSLYSSMRSLLPSADQVK  99

Query  402  RMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHH  581
            ++SIP+TVSRV+KYIPELQ+++ERL +KK+E  S+++        P     +R    G  
Sbjct  100  KLSIPSTVSRVLKYIPELQRQVERLIQKKEEFLSKISR----EGDPIHLENQR---NGTL  152

Query  582  HNRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNF  761
             +  S +SA ++ +R+IV+QI +    +N  ++ LS LE++GL+++++S+F++   RV F
Sbjct  153  GSSLSAVSARRLSDREIVVQISTFNVHENPLSEVLSNLEEDGLLVINASSFESFGGRV-F  211

Query  762  HTLHLQVQGIEMME  803
            + LHLQV+G + ME
Sbjct  212  YNLHLQVEGTQGME  225



>ref|XP_010023785.1| PREDICTED: transcription factor bHLH101-like [Eucalyptus grandis]
Length=263

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 105/265 (40%), Positives = 157/265 (59%), Gaps = 24/265 (9%)
 Frame = +3

Query  69   GWSIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERCDSLKFdggstd  248
             W  +D  SHEQ    +  +A   +SP  PP HF  L SSP P A    D L     +T+
Sbjct  8    NWPFEDSTSHEQENY-MRRDAHPFSSP--PPLHFAFL-SSPSPHAEVVLDHLNIPAAATN  63

Query  249  igsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVS  428
              +            MVKKL+HNA ERDRRKK+N L+S+LRSLLP++DQ  ++SIP TVS
Sbjct  64   GEAT-----------MVKKLNHNACERDRRKKINSLYSALRSLLPSADQTEKLSIPATVS  112

Query  429  RVVKYIPelqkelerlqkkkqelTSRVNSWQKISK-SPPEFNKRRRVMGGHHHNRQSYLS  605
            +V+KYIPELQ++++ L ++++EL SR+N+ Q I   +  E +K +  +     N    +S
Sbjct  113  QVLKYIPELQQQVQILAREREELLSRINATQGIDDCTHQEISKGKGALS----NPMPSIS  168

Query  606  ATQVGERDIVIQICSKK-GTQNL--FADALSCLEQEGLVLLDSSTFQT-SEDRVNFHTLH  773
               + E ++ IQIC+ K  TQN   F++ L  L+  G  L+ +STF++    R  F+ LH
Sbjct  169  TNCLSESEVAIQICTTKVMTQNTVDFSEILLNLDHHGFPLISASTFESFGGTRTTFYNLH  228

Query  774  LQVQGIEMMEVDKLKEKLLSYFNEE  848
            +QV+    ME + LKEKLL+ ++++
Sbjct  229  VQVERSRGMECEALKEKLLALYDQK  253



>gb|EYU18636.1| hypothetical protein MIMGU_mgv1a012772mg [Erythranthe guttata]
Length=240

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 102/265 (38%), Positives = 153/265 (58%), Gaps = 43/265 (16%)
 Frame = +3

Query  57   FPNMGWSIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVSL---PSSPLPPAMERCDSLK  227
            F ++GW +DD ISH+    ++ +  + D  P     + + L    SS   P +   D  K
Sbjct  8    FCSVGWLLDDPISHDHHQANMINYLSAD-RPQDTSEYSIDLHSPNSSRTNPKINGGDGNK  66

Query  228  FdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARM  407
                                   VKKL+HNASERDRRKK+N L+SSLRSLLP  DQ  ++
Sbjct  67   ----------------------TVKKLNHNASERDRRKKINNLYSSLRSLLPNEDQSRKL  104

Query  408  SIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHN  587
            SIP TVSRVVKYIPE+QKE+ERL  KK+ LTS++ S      +P  F  +++     ++ 
Sbjct  105  SIPATVSRVVKYIPEIQKEVERLTHKKEMLTSKITS----PSAPSSFGLKKQ-----NNI  155

Query  588  RQSYLSATQVGERDIVIQIC----SKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRV  755
              S ++ATQ+GER+IV QI      K+  Q   ++A++  E++G +L ++++F++ + R+
Sbjct  156  NSSAVTATQIGEREIVFQISKADYQKRALQ--ISEAVTTFEEQGFLLTNATSFESFDGRI  213

Query  756  NFHTLHLQVQGI-EMMEVDKLKEKL  827
             F  LH+Q QG  ++M  + LKEKL
Sbjct  214  -FFNLHIQAQGSHQVMNAEILKEKL  237



>gb|KCW90048.1| hypothetical protein EUGRSUZ_A02250 [Eucalyptus grandis]
Length=241

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 96/236 (41%), Positives = 144/236 (61%), Gaps = 21/236 (9%)
 Frame = +3

Query  156  PPPHFVSLPSSPLPPAMERCDSLKFdggstdigsggggggdsatagMVKKLSHNASERDR  335
            PP HF  L SSP P A    D L     +T+  +            MVKKL+HNA ERDR
Sbjct  12   PPLHFAFL-SSPSPHAEVVLDHLNIPAAATNGEAT-----------MVKKLNHNACERDR  59

Query  336  RKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNS  515
            RKK+N L+S+LRSLLP++DQ  ++SIP TVS+V+KYIPELQ++++ L ++++EL SR+N+
Sbjct  60   RKKINSLYSALRSLLPSADQTEKLSIPATVSQVLKYIPELQQQVQILAREREELLSRINA  119

Query  516  WQKISK-SPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKK-GTQNL--FADA  683
             Q I   +  E +K +  +     N    +S   + E ++ IQIC+ K  TQN   F++ 
Sbjct  120  TQGIDDCTHQEISKGKGALS----NPMPSISTNCLSESEVAIQICTTKVMTQNTVDFSEI  175

Query  684  LSCLEQEGLVLLDSSTFQT-SEDRVNFHTLHLQVQGIEMMEVDKLKEKLLSYFNEE  848
            L  L+  G  L+ +STF++    R  F+ LH+QV+    ME + LKEKLL+ ++++
Sbjct  176  LLNLDHHGFPLISASTFESFGGTRTTFYNLHVQVERSRGMECEALKEKLLALYDQK  231



>ref|XP_007162129.1| hypothetical protein PHAVU_001G126400g [Phaseolus vulgaris]
 gb|ESW34123.1| hypothetical protein PHAVU_001G126400g [Phaseolus vulgaris]
Length=251

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 125/186 (67%), Gaps = 6/186 (3%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            MVKKLSHNASERDRRKK+N L SSLRSLLP +DQ  +MSIP+TVSRV+KYIPELQ++++ 
Sbjct  69   MVKKLSHNASERDRRKKVNNLVSSLRSLLPLADQTKKMSIPSTVSRVLKYIPELQQQVQA  128

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L K+K+EL  R++  +++     +    R++    HHN    +S T++ + + V+ I S+
Sbjct  129  LTKRKEELLCRIS--RQLQGDAVKKESHRKI---SHHNSSFVVSTTRLNDCEAVVHISSQ  183

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLLS  833
            +  +   ++ L CLE +GL LLD+S+ QT   R  F+ LH QV   + +E D L EKLL 
Sbjct  184  ETHKAPLSEILQCLENDGLFLLDASSSQTFGGRF-FYNLHFQVAKADRLESDILTEKLLP  242

Query  834  YFNEEQ  851
             + +++
Sbjct  243  IYEKQR  248



>ref|XP_003521149.1| PREDICTED: transcription factor ORG3-like [Glycine max]
 gb|KHN30386.1| Transcription factor ORG2 [Glycine soja]
Length=241

 Score =   130 bits (328),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 121/186 (65%), Gaps = 6/186 (3%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            MVKKLSHNASERDRRKK+N L SSLRSLLP  DQ  +MSIP TVSRV+KYIPELQ +++ 
Sbjct  60   MVKKLSHNASERDRRKKVNDLVSSLRSLLPGPDQTKKMSIPATVSRVLKYIPELQHQVQA  119

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L KKK+EL  R++   K      E   +RR+    HHN    +S +++ + + V+ I S 
Sbjct  120  LTKKKEELLCRISKNLKGDSVNKE--SQRRI---SHHNSDFAVSTSRLNDCEAVVHISSY  174

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLLS  833
            +  +   +D L CLE  GL LL++S+ +T   RV F+ LH QV+    +E + L EKLLS
Sbjct  175  EAHKAPLSDILQCLENNGLYLLNASSSETFGGRV-FYNLHFQVEKTHRLESEILTEKLLS  233

Query  834  YFNEEQ  851
             + +++
Sbjct  234  IYEKQR  239



>emb|CBI29138.3| unnamed protein product [Vitis vinifera]
Length=225

 Score =   130 bits (327),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 100/248 (40%), Positives = 148/248 (60%), Gaps = 34/248 (14%)
 Frame = +3

Query  42   FSPMSFPNMGWSIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERCDS  221
            FSP SFP +GW ++D ISH Q     Y     +TS       F+ L SS  P     C +
Sbjct  4    FSPPSFPTLGWPLEDPISHAQN----YIYGETETSES-----FLHLSSSQ-PQVELNCST  53

Query  222  LKFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKA  401
                                    MVKKL+HNASERDRRKK+N L+SS+RSLLP++DQ  
Sbjct  54   --------------PSAAVRGNPTMVKKLNHNASERDRRKKINSLYSSMRSLLPSADQVK  99

Query  402  RMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEF-NKRRRVMGGH  578
            ++SIP+TVSRV+KYIPELQ+++ERL +KK+E  S+++        P    N+R   +G  
Sbjct  100  KLSIPSTVSRVLKYIPELQRQVERLIQKKEEFLSKISR----EGDPIHLENQRNGTLG--  153

Query  579  HHNRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVN  758
              +  S +SA ++ +R+IV+QI +    +N  ++ LS LE++GL+++++S+F++   RV 
Sbjct  154  --SSLSAVSARRLSDREIVVQISTFNVHENPLSEVLSNLEEDGLLVINASSFESFGGRV-  210

Query  759  FHTLHLQV  782
            F+ LHLQV
Sbjct  211  FYNLHLQV  218



>ref|XP_009339562.1| PREDICTED: transcription factor ORG2-like [Pyrus x bretschneideri]
Length=251

 Score =   130 bits (328),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 107/267 (40%), Positives = 150/267 (56%), Gaps = 21/267 (8%)
 Frame = +3

Query  42   FSPMSFPNMGWSID-DYISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERCD  218
             SP  F  +GWS+D D ISHE      YS     T+ D     F+ L    LP    + D
Sbjct  4    LSPPLFSTIGWSLDQDSISHENHNY-FYSKDITTTNDDQTADSFLHL----LPSHHPKVD  58

Query  219  SLKFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQK  398
                        S    G  S+   M KKL+HNASERDRRKK+N L++SLRSLLPA DQ 
Sbjct  59   ------LDRSTPSITVTGDYSSVCPMAKKLNHNASERDRRKKINNLYASLRSLLPA-DQT  111

Query  399  ARMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGH  578
             ++SIP T+S  +KYIPELQK++E L +K++EL SR       SK     +K +++    
Sbjct  112  KKLSIPNTISHALKYIPELQKQVEGLNRKREELLSRA------SKQEDAMHKEKKIKST-  164

Query  579  HHNRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVN  758
              + QS +S  ++ +R++ IQI + K   NL  + L  LE+EGL L ++S F++   RV 
Sbjct  165  ARSSQSAVSTYRLNDREVAIQISTFKTHNNLLFEILQHLEEEGLQLENASFFESYGGRV-  223

Query  759  FHTLHLQVQGIEMMEVDKLKEKLLSYF  839
            F+ LHLQV     +E + L EKL+S++
Sbjct  224  FYNLHLQVDRTYRLERENLSEKLMSFY  250



>emb|CAN79614.1| hypothetical protein VITISV_027441 [Vitis vinifera]
Length=244

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 100/254 (39%), Positives = 149/254 (59%), Gaps = 32/254 (13%)
 Frame = +3

Query  42   FSPMSFPNMGWSIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERCDS  221
            FSP  FP +GW ++D ISH Q     Y     +TS       F+ L SS  P     C +
Sbjct  4    FSPPLFPTLGWPLEDPISHAQN----YIYGETETSES-----FLHLSSSQ-PQVELNCST  53

Query  222  LKFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKA  401
                               S    MVKKL+HNASERDRRKK+N L+SS+RSLLP++DQ  
Sbjct  54   --------------PSAAVSGNPTMVKKLNHNASERDRRKKINSLYSSMRSLLPSADQXK  99

Query  402  RMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHH  581
            ++SIP+TVSRV+KYIPELQ+++ERL +KK+E  S++         P     +R    G  
Sbjct  100  KLSIPSTVSRVLKYIPELQRQVERLIQKKEEFLSKICR----EGDPIHLENQR---NGTL  152

Query  582  HNRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNF  761
             +  S +SA ++ +R+IV+QI +    ++  ++ L  LE++GL+++++S+F++   RV F
Sbjct  153  GSSLSAVSARRLSDREIVVQISTFNVHESPLSEVLLNLEEDGLLVINASSFESFGGRV-F  211

Query  762  HTLHLQVQGIEMME  803
            + LHLQV+G + ME
Sbjct  212  YNLHLQVEGTQGME  225



>ref|XP_004290411.1| PREDICTED: transcription factor ORG2-like [Fragaria vesca subsp. 
vesca]
Length=244

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 103/268 (38%), Positives = 156/268 (58%), Gaps = 30/268 (11%)
 Frame = +3

Query  42   FSPMSFPNMGWSIDDY-ISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERCD  218
             SP  F  +GW ++D+ ISH+    D Y +A      ++   HF   P++ L P  ++ D
Sbjct  4    LSPPLFSTIGWPLEDHSISHDH---DNYYSA------ESSLLHF---PTT-LQPQFDQLD  50

Query  219  SLKFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQK  398
                              G+S  + MVKKL+HNASERDRRKK+N L+SSLRSL+PA D  
Sbjct  51   ---------HSTPSTAVSGESNISSMVKKLNHNASERDRRKKINNLYSSLRSLVPA-DHA  100

Query  399  ARMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQK-ISKSPPEFNKRRRVMGG  575
             R+SIP TVSRV+KYIPELQ+++E L +K+ EL S ++  +  I +   +     R  G 
Sbjct  101  KRLSIPATVSRVLKYIPELQQQVEGLIQKRDELLSNMSKQENVILQEEKQLQSTARRSGS  160

Query  576  HHHNRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRV  755
                  S +S +++ + ++ IQI + K T N+ +  L  LE++GL +L++STF++S  RV
Sbjct  161  ----SLSAVSTSRLSDTELAIQISTVKSTHNIISRILQSLEEDGLEILNASTFESSGGRV  216

Query  756  NFHTLHLQVQGIEMMEVDKLKEKLLSYF  839
             F+ LHLQV     +E + L  KL+S++
Sbjct  217  -FYNLHLQVDMFYRLECENLSHKLMSFY  243



>ref|XP_002531541.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF30835.1| DNA binding protein, putative [Ricinus communis]
Length=184

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 91/187 (49%), Positives = 132/187 (71%), Gaps = 9/187 (5%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            MVKKL+HNASERDRRKKMN L+SSLRSLLPASDQ  ++SIP T+SRV+KYIPELQ++LER
Sbjct  1    MVKKLNHNASERDRRKKMNTLYSSLRSLLPASDQMKKLSIPATISRVLKYIPELQQQLER  60

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
              ++K+EL  R++    I    P+ N+R+    G  H+  S +SA Q+ ++++VIQ+ + 
Sbjct  61   FVQRKEELLLRISKQNHIIN--PQINQRK----GTTHSTLSVVSANQISDKEVVIQVSTY  114

Query  654  KGTQNL--FADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKL  827
              T +    ++ L  LE+EGL+L++SS+F++   RV F+ LHLQV G  ++E D L EKL
Sbjct  115  NNTIHTSPLSEILLLLEEEGLLLINSSSFESFGGRV-FYNLHLQVDGTYILECDALSEKL  173

Query  828  LSYFNEE  848
             + +  +
Sbjct  174  AALYERD  180



>ref|XP_007204917.1| hypothetical protein PRUPE_ppa024966mg [Prunus persica]
 gb|EMJ06116.1| hypothetical protein PRUPE_ppa024966mg [Prunus persica]
Length=243

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 99/266 (37%), Positives = 153/266 (58%), Gaps = 27/266 (10%)
 Frame = +3

Query  42   FSPMSFPNMGWSIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERCDS  221
             SP  F  +GW  +D I ++Q      +    D+S D     F+ +  S LP        
Sbjct  4    LSPPVFSTVGWPSEDPIGYDQ------NYFYRDSSTDQTAESFLHILPSQLP--------  49

Query  222  LKFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKA  401
                       S    G +S+ + M KKL+HNASERDRRKK+N L+SS+RSLLPA DQ  
Sbjct  50   -----QFELDLSTTISGDNSSGSTMAKKLNHNASERDRRKKINSLYSSMRSLLPA-DQAK  103

Query  402  RMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHH  581
            ++SIP T+SRV+KYIPELQK++E L +K++EL SR ++ + + +   +     R      
Sbjct  104  KLSIPDTISRVLKYIPELQKQVEGLIRKREELLSRASNQEDVMREEKDMKSTAR------  157

Query  582  HNRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNF  761
             +    +S  ++ +R++ IQI + K   NL ++ L  LE+EGL +L++S  ++S +RV F
Sbjct  158  SSSLPAVSTYRLSDRELAIQISTLKTHNNLLSEILLNLEEEGLQVLNASFLESSGERV-F  216

Query  762  HTLHLQVQGIEMMEVDKLKEKLLSYF  839
            + LHLQV+    +E + L EKL+S++
Sbjct  217  YNLHLQVERSYRLECENLSEKLMSFY  242



>ref|XP_008243130.1| PREDICTED: transcription factor ORG2-like [Prunus mume]
Length=243

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 98/266 (37%), Positives = 155/266 (58%), Gaps = 27/266 (10%)
 Frame = +3

Query  42   FSPMSFPNMGWSIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERCDS  221
             SP  F  +GW  +D I ++Q     Y +++ D + ++    F+ +  S LP        
Sbjct  4    LSPPLFSTVGWPSEDPIGYDQ--KYFYRDSSNDQTAES----FLHILPSQLP--------  49

Query  222  LKFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKA  401
                       S    G +S+   + KKL+HNASERDRRKK+N L+SS+RSLLPA DQ  
Sbjct  50   -----QFELDLSTTISGDNSSGFAVAKKLNHNASERDRRKKINSLYSSMRSLLPA-DQAK  103

Query  402  RMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHH  581
            ++SIP T+SRV+KYIPELQK++E L +K++EL SR +  + + +   +     R      
Sbjct  104  KLSIPNTISRVLKYIPELQKQVEGLIRKREELLSRASKQEDVMQEEKDMKSTAR------  157

Query  582  HNRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNF  761
             +  S +S  ++ +R++ IQI + K   NL ++ L  LE+EGL +L++S  ++S +RV F
Sbjct  158  SSSLSAVSTYRLSDREVAIQISTLKTHNNLLSEILLNLEEEGLQVLNASFLESSGERV-F  216

Query  762  HTLHLQVQGIEMMEVDKLKEKLLSYF  839
            + LHLQV+    +E + L EKL+S++
Sbjct  217  YNLHLQVERSYRLECENLSEKLMSFY  242



>gb|KDP37831.1| hypothetical protein JCGZ_06733 [Jatropha curcas]
Length=259

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 106/282 (38%), Positives = 158/282 (56%), Gaps = 45/282 (16%)
 Frame = +3

Query  33   LPFFSPMSFPNMGWSIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMER  212
            + F  P  FP+ GW ++D I ++Q    +Y +   + +       F +   S  PP + +
Sbjct  2    IAFCPPPVFPSYGWPLEDPIPNQQ----IYFSRENENNNSTLGQSFHNYLQSH-PPDISK  56

Query  213  CD-SLKFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPAS  389
             D S  F   + D               MVKKL+HNASERDRRKKMN LFSSLRSLLPA+
Sbjct  57   LDPSTSFTDYTGDPN-------------MVKKLNHNASERDRRKKMNCLFSSLRSLLPAA  103

Query  390  DQKARMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVM  569
            DQ  ++SIP TVSRV+KYIPELQKE+E L              QK  +   E +K+ + +
Sbjct  104  DQMKKLSIPATVSRVLKYIPELQKEVEML-------------LQKKEEILSEISKQDKHL  150

Query  570  GGHHHNRQ---------SYLSATQVGERDIVIQICSKKG---TQNLFADALSCLEQEGLV  713
              H   ++         S +SATQ+ + +IVIQI +      T   F++ +  L++EG V
Sbjct  151  LNHIAEQRKSNKKSSGSSVVSATQLSDTEIVIQISTHSNNVHTITPFSEIILHLQEEGFV  210

Query  714  LLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLLSYF  839
            L++SS+F++S  RV F+ L LQ++G + +E + L++KL+S +
Sbjct  211  LINSSSFESSGGRV-FYNLLLQMEGTQRLESEALRQKLVSLY  251



>ref|XP_010653965.1| PREDICTED: transcription factor ORG2 [Vitis vinifera]
 emb|CBI30114.3| unnamed protein product [Vitis vinifera]
Length=245

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 112/264 (42%), Positives = 157/264 (59%), Gaps = 32/264 (12%)
 Frame = +3

Query  42   FSPMSFPNMGWSIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERCDS  221
            FSP  F   GW  +D ISHEQ    +Y       S       F+ LPSS   P  E   S
Sbjct  4    FSPPLFSTFGWPWEDPISHEQ--NYIYQETEASES-------FLHLPSSE--PQAELNYS  52

Query  222  LKFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKA  401
                               S    MVKKL+HNASERDRRKK+N L+SSLRSLLPA+DQ  
Sbjct  53   -------------TPSAAVSGNPTMVKKLNHNASERDRRKKINSLYSSLRSLLPAADQAK  99

Query  402  RMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHH  581
            ++SIP+TVSRV+KYIPELQK++ERL +KK+EL S+++    I        K+R+      
Sbjct  100  KLSIPSTVSRVLKYIPELQKQVERLIQKKEELLSKISRQGDIIHQ----EKQRKATLA--  153

Query  582  HNRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNF  761
             +  S +SA ++ +R+IV+QI + K  ++  ++ L  LE++GL+++++S+F++   RV F
Sbjct  154  -SSLSAVSANRLSDREIVVQISTFKVHESPLSEVLLNLEEDGLLVINASSFESFGGRV-F  211

Query  762  HTLHLQVQGIEMMEVDKLKEKLLS  833
            + LHLQV+G   ME + L EKLLS
Sbjct  212  YNLHLQVEGTHRMECEVLSEKLLS  235



>ref|XP_007203008.1| hypothetical protein PRUPE_ppa017407mg [Prunus persica]
 gb|EMJ04207.1| hypothetical protein PRUPE_ppa017407mg [Prunus persica]
Length=232

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 98/248 (40%), Positives = 143/248 (58%), Gaps = 28/248 (11%)
 Frame = +3

Query  42   FSPMSFPNMGWSIDDYISHEQ--FGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERC  215
             SP SF   GW ++D  SH+Q  F  D +++   ++        F+ +  S LP  +E  
Sbjct  4    LSPPSFSTTGWPLEDSKSHDQNYFYRDSFTDQIAES--------FLRILPSQLP-QVEPA  54

Query  216  DSLKFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQ  395
             S           S    G  S  + MVKKL+HNASERDRR+K+N L+SSLRSLLPA DQ
Sbjct  55   RS---------TPSTTASGEYSGVSTMVKKLNHNASERDRRQKINRLYSSLRSLLPA-DQ  104

Query  396  KARMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGG  575
              ++SIP T+SRVVKY+PELQK++E L +K      R     +ISK   +     + M  
Sbjct  105  MKKLSIPNTISRVVKYVPELQKQVEGLIRK------REELLVRISKQEDQELHEEKKMKS  158

Query  576  HHHNRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRV  755
               +  S +S  ++ +R++ IQI + K   NL ++ L  LE+EGL +L++S+F++S +RV
Sbjct  159  TAGSSLSAVSTYRLNDREVAIQISTLKTHNNLLSEILLNLEEEGLQILNASSFESSGERV  218

Query  756  NFHTLHLQ  779
             F+ LHLQ
Sbjct  219  -FYNLHLQ  225



>ref|XP_010431420.1| PREDICTED: transcription factor ORG2-like [Camelina sativa]
Length=253

 Score =   123 bits (309),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 85/194 (44%), Positives = 128/194 (66%), Gaps = 29/194 (15%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            +VKKL+HNASERDRRKK+N LFSSLRS LPASDQ  ++SIP TVSR +KYIPELQ+++++
Sbjct  69   VVKKLNHNASERDRRKKLNSLFSSLRSCLPASDQSKKLSIPETVSRSLKYIPELQRQVKK  128

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQ------SYL---SATQVGER  626
            L +KK+EL  RV+  +                   HH++Q      SYL   SAT++GE 
Sbjct  129  LIQKKEELLERVSGQRDF----------------EHHDQQQPKAIASYLSTVSATRLGEN  172

Query  627  DIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIE---M  797
            ++++QI S K      ++ LS LE++G VL+D S+ ++  +R+ F+TLHLQV+ ++    
Sbjct  173  EVMVQISSSKTHNFSISNVLSGLEEDGFVLVDISSSRSQGERL-FYTLHLQVEKMDDYYK  231

Query  798  MEVDKLKEKLLSYF  839
            +  ++L E++L  +
Sbjct  232  INCEELSERMLYLY  245



>gb|KHN14917.1| Transcription factor ORG2 [Glycine soja]
Length=240

 Score =   122 bits (306),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 120/186 (65%), Gaps = 7/186 (4%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            MVKKLSHNASERDRRKK+N L SSLRSLLP +DQ  +MSIP TVSRV+KYIPELQ++++ 
Sbjct  60   MVKKLSHNASERDRRKKINNLVSSLRSLLPVADQTKKMSIPATVSRVIKYIPELQQQVQS  119

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L KKK+ L  R++  +++         +R++     HN +  +S +++ + ++V+ I S 
Sbjct  120  LTKKKEVLLWRIS--RQLQGDAVNKESQRKI---SQHNSEFVVSTSRLNDCEVVVHI-SY  173

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLLS  833
            +  +   ++ L CLE  GL LL+ S+ +T   R  FH LH QV+  + +E   L E LLS
Sbjct  174  EAQKAPLSEILHCLENNGLYLLNGSSSETFGGRA-FHNLHFQVEKTQRLESGILTENLLS  232

Query  834  YFNEEQ  851
             +  ++
Sbjct  233  IYQNQR  238



>gb|EYU29444.1| hypothetical protein MIMGU_mgv1a022368mg, partial [Erythranthe 
guttata]
Length=229

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 116/164 (71%), Gaps = 7/164 (4%)
 Frame = +3

Query  297  VKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerl  476
            VKKL+HNASERDRRKK+N L+SSLRSLLP  DQ  ++SIP TVSRVVKYIPE+QKE+E+L
Sbjct  70   VKKLNHNASERDRRKKINNLYSSLRSLLPNEDQSRKLSIPATVSRVVKYIPEIQKEVEKL  129

Query  477  qkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKK  656
              KK+ +T+++ S    S S   F  +   +  +  N  S ++ T +GER+IVIQ+ +K 
Sbjct  130  IHKKEMMTTKMTSS---SSSSSSFGLKENQIKQNRSNTNSAVTTTPIGEREIVIQMSTKA  186

Query  657  GTQN---LFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQ  779
              Q    L ++A+  LE+EG ++ ++++F++ + R+ F+TLH+Q
Sbjct  187  DYQKRVLLISEAVMSLEEEGFLVTNATSFESFDARI-FYTLHIQ  229



>emb|CAN64266.1| hypothetical protein VITISV_031510 [Vitis vinifera]
Length=245

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 111/264 (42%), Positives = 156/264 (59%), Gaps = 32/264 (12%)
 Frame = +3

Query  42   FSPMSFPNMGWSIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERCDS  221
            FSP  F   GW  +D  SHEQ    +Y       S       F+ LPSS   P  E   S
Sbjct  4    FSPPLFSTFGWPWEDPXSHEQ--NYIYQETEASES-------FLHLPSSE--PQAELNYS  52

Query  222  LKFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKA  401
                               S    MVKKL+HNASERDRRKK+N L+SSLRSLLPA+DQ  
Sbjct  53   -------------TPSAAVSGNPTMVKKLNHNASERDRRKKINSLYSSLRSLLPAADQAK  99

Query  402  RMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHH  581
            ++SIP+TVSRV+KYIPELQK++ERL +KK+EL S+++    I        K+R+      
Sbjct  100  KLSIPSTVSRVLKYIPELQKQVERLIQKKEELLSKISRQGDIIHQ----EKQRKATLA--  153

Query  582  HNRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNF  761
             +  S +SA ++ +R+IV+QI + K  ++  ++ L  LE++GL+++++S+F++   RV F
Sbjct  154  -SSLSAVSANRLSDREIVVQISTFKVHESPLSEVLLNLEEDGLLVINASSFESFGGRV-F  211

Query  762  HTLHLQVQGIEMMEVDKLKEKLLS  833
            + LHLQV+G   ME + L EKLLS
Sbjct  212  YNLHLQVEGTHRMECEVLSEKLLS  235



>ref|XP_006291619.1| hypothetical protein CARUB_v10017770mg, partial [Capsella rubella]
 gb|EOA24517.1| hypothetical protein CARUB_v10017770mg, partial [Capsella rubella]
Length=286

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 85/194 (44%), Positives = 126/194 (65%), Gaps = 26/194 (13%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            ++KKL+HNASERDRRKK+N LFSSLRS LPASDQ  ++SIP TVSR +KYIPELQ+++++
Sbjct  103  VIKKLNHNASERDRRKKINSLFSSLRSCLPASDQSKKLSIPATVSRSLKYIPELQEQVKK  162

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQ--------SYLSATQVGERD  629
            L KKK+EL  +V+  + I                HH   Q        S +SAT++G+ +
Sbjct  163  LIKKKEELLVQVSGQRNIE---------------HHVKPQPKAVVTYASTVSATRLGDSE  207

Query  630  IVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIE--MME  803
            +++QI S K      ++ LS LE +G VL+D S+ ++  +R+ FHTLHLQV+ IE   + 
Sbjct  208  VMVQISSSKVHNFSISNVLSGLEADGFVLVDISSSRSQGERL-FHTLHLQVEKIENQKLN  266

Query  804  VDKLKEKLLSYFNE  845
             ++L +++L  + E
Sbjct  267  CEELSQRILYLYEE  280



>ref|XP_011078995.1| PREDICTED: transcription factor ORG2-like [Sesamum indicum]
Length=258

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 122/186 (66%), Gaps = 13/186 (7%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            MVKKL+HNA ERDRR+KMN LFS+LRSLLP+ DQ  ++SI  TVSRV+KYIPEL+KE+ER
Sbjct  71   MVKKLNHNAVERDRRRKMNTLFSTLRSLLPSDDQSKKLSIAATVSRVLKYIPELRKEVER  130

Query  474  l-qkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICS  650
            L QKK+  +  R     ++S    +F  +          R S +SATQ+   +IV+QI  
Sbjct  131  LDQKKETLMMMRTKICSQVSIDDDDFRTKL--------ARLSAVSATQISGEEIVVQISV  182

Query  651  KKGTQN--LFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDK-LKE  821
             K  +   + ++ L  LE EG ++L +S+F+T + R+ F  LHLQ Q  E+ +VD  LKE
Sbjct  183  PKLDKGNLILSETLMHLEMEGFLVLTASSFETLQGRL-FCNLHLQAQESEVKDVDVWLKE  241

Query  822  KLLSYF  839
            K+LS+F
Sbjct  242  KILSFF  247



>ref|XP_010412809.1| PREDICTED: transcription factor ORG2 [Camelina sativa]
Length=258

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 81/193 (42%), Positives = 133/193 (69%), Gaps = 13/193 (7%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            +VKKL+HNASERDRRKK+N LFSSLRS LPASDQ  ++SIP TVSR +KYIPELQ+++++
Sbjct  69   VVKKLNHNASERDRRKKINYLFSSLRSCLPASDQSKKLSIPETVSRSLKYIPELQRQVKK  128

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRR-RVMGGHHHNRQSYLSATQVGERDIVIQICS  650
            L +KK+EL  RV+  +       +++K++ + +  +     S +SA ++GE ++++QI S
Sbjct  129  LIQKKEELLVRVSGQRDFE----QYDKQQPKAVASY----LSTVSAARLGENEVMVQISS  180

Query  651  KKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIE---MMEVDKLKE  821
             K      ++ LS LE++G VL+D S+ ++  +R+ F+TLHLQV+ ++    +  ++L E
Sbjct  181  SKTHNFSISNVLSGLEEDGFVLVDISSSRSQGERL-FYTLHLQVEKVDDYHKINCEELSE  239

Query  822  KLLSYFNEEQTCL  860
            ++L  + + +  L
Sbjct  240  RMLYLYEKYENSL  252



>ref|XP_010504611.1| PREDICTED: transcription factor ORG3 [Camelina sativa]
Length=258

 Score =   120 bits (300),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 125/186 (67%), Gaps = 10/186 (5%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            ++KKL+HNASERDRRKK+N LFSSLRS LPASDQ  ++SIP TVSR +KYIPELQ ++++
Sbjct  75   VIKKLNHNASERDRRKKINSLFSSLRSCLPASDQSKKLSIPATVSRSLKYIPELQDQVKK  134

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L K K+EL  +V+    I         + + +  +     S +SAT++G+ ++++QI S 
Sbjct  135  LIKNKEELLMQVSGQINIEGY---VKPQPKAVASY----VSTVSATRLGDNEVMVQISSS  187

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEV--DKLKEKL  827
            K      ++ LS LE++G VL+D S+ ++  +R+ F+TLHLQV  IE  E+  ++L +++
Sbjct  188  KIHNFPISNVLSGLEEDGFVLVDMSSLRSQGERL-FYTLHLQVDKIENYELICEELSQRM  246

Query  828  LSYFNE  845
            L  + E
Sbjct  247  LYLYEE  252



>gb|AFK39552.1| unknown [Lotus japonicus]
Length=256

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 105/277 (38%), Positives = 151/277 (55%), Gaps = 40/277 (14%)
 Frame = +3

Query  36   PFFSPMSFPNMGWSI--DDYISHEQFGTDLYSNAAGDTSPDAP-PPHFVSLPSSPLPPA-  203
            PFFS   + NM   +  D +IS  Q   D Y N    +SP+   P  F    SSP P   
Sbjct  12   PFFS---YSNMDCLLEEDPFISQNQ---DNYFNKDSVSSPEYSFPQQF----SSPQPQVE  61

Query  204  MERCDSLKFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLP  383
            +E   SL                  S    MVKKLSHNASERDRRKK+N L +SLRSLLP
Sbjct  62   VENSSSL------------------SPDTTMVKKLSHNASERDRRKKINSLIASLRSLLP  103

Query  384  ASDQKARMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRR  563
              DQ  +MSIP T+S+V+KYIPELQK+++ L KKK++L S+    +       E ++R++
Sbjct  104  GPDQTKKMSIPATISQVIKYIPELQKQVKGLTKKKEKLLSKTTRQRDAVN---EESQRKK  160

Query  564  VMGGHHHNRQSYLSATQVGERDIVIQICSKKGTQNL-FADALSCLEQEGLVLLDSSTFQT  740
            +    HHN    +S + + + +  I I S +       ++ L CLE  G +LL++S+ + 
Sbjct  161  I---PHHNPDFVVSNSWLNDTEAAIHISSYEAHHKTPLSEILLCLENNGYLLLNASSTKA  217

Query  741  SEDRVNFHTLHLQVQGIEMMEVDKLKEKLLSYFNEEQ  851
               R+ F+ LH QV+  + +E D L +KLLS + ++Q
Sbjct  218  FGGRI-FYNLHFQVEKTQRLEADILTQKLLSIYEKKQ  253



>ref|XP_006402926.1| hypothetical protein EUTSA_v10006191mg [Eutrema salsugineum]
 gb|ESQ44379.1| hypothetical protein EUTSA_v10006191mg [Eutrema salsugineum]
Length=253

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 96/269 (36%), Positives = 151/269 (56%), Gaps = 30/269 (11%)
 Frame = +3

Query  48   PMSFPNMGWSI-DDYISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERCDSL  224
            P  FPN GW +  +Y S+   G +L +              F+  P S         DSL
Sbjct  6    PPLFPNFGWPLTGEYESYYLAGENLNNGT------------FLDFPVSETYGVAHYQDSL  53

Query  225  KFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKAR  404
            +             G        ++KKL+HNASERDRRKK+N +FSSLRS LPASDQ  +
Sbjct  54   R-------ASVSSEGNEIDNNPVVIKKLNHNASERDRRKKINSMFSSLRSCLPASDQSKK  106

Query  405  MSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHH  584
            +SIP TVSR ++YIPELQ+++++L +KK+EL  RV+          ++NKR+      + 
Sbjct  107  LSIPQTVSRSLRYIPELQEQVKKLIQKKEELLVRVSG----QSDTEQYNKRQPKAVARY-  161

Query  585  NRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFH  764
               S +S T++G+ ++++QI S K      ++ LS LE++GLVL+D S+ ++  +R+ F+
Sbjct  162  --VSTVSTTRLGDNEVMVQISSSKIHNFSISNVLSGLEEDGLVLVDVSSSRSHCERL-FY  218

Query  765  TLHLQVQGIE--MMEVDKLKEKLLSYFNE  845
            TLHL+V  I+   +  + L +++L  + E
Sbjct  219  TLHLRVDKIDNYKLNCEDLSQRILYLYEE  247



>ref|XP_009774483.1| PREDICTED: transcription factor bHLH100-like isoform X1 [Nicotiana 
sylvestris]
Length=261

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 92/188 (49%), Positives = 132/188 (70%), Gaps = 4/188 (2%)
 Frame = +3

Query  297  VKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerl  476
            VKKL+HNASERDRRKK N L SSLRSLLPA+D   ++S P TV+RV+KYIP+L+KE+  L
Sbjct  68   VKKLNHNASERDRRKKFNSLCSSLRSLLPATDHTKKISFPVTVARVIKYIPDLKKEVGGL  127

Query  477  qkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKK  656
             +KK++LT R    ++ S    +FN ++ ++ G   +  S +SA QVG R+++I I   K
Sbjct  128  TQKKEDLTLRSIPKKEYS---ADFNNKQTIIKGGIQSSLSVISANQVGNREVIIHISILK  184

Query  657  GTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLLSY  836
              ++ FA+A+S LE+EGL+LL++S+F+T  DRV F+ LH Q QG   + V  L++KLLSY
Sbjct  185  TNKSSFAEAVSELEEEGLLLLNASSFETLGDRV-FYNLHFQAQGTLPINVQILRDKLLSY  243

Query  837  FNEEQTCL  860
            + +E   L
Sbjct  244  YEKEDKLL  251



>emb|CDX76026.1| BnaA04g02900D [Brassica napus]
Length=248

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 121/184 (66%), Gaps = 14/184 (8%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            KKL HNASERDRRKK+N LFSSLRS LPASDQ  ++SIP TVSR +KYI ELQ+E++ L 
Sbjct  72   KKLKHNASERDRRKKINSLFSSLRSCLPASDQSKKLSIPQTVSRSLKYILELQEEVKMLI  131

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKKG  659
            +KK+EL  RV+  + I + P         +  H+    S +SAT++G+ ++++QI S K 
Sbjct  132  QKKEELLVRVSGQRAIEQQPK--------VVAHY---VSTVSATRLGDHEMMVQISSSKI  180

Query  660  TQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGI--EMMEVDKLKEKLLS  833
                 ++ LS LE++G VL+D S  ++  +RV F+TLHLQV  I  + +   +L +++L 
Sbjct  181  NNFSISNVLSGLEEDGFVLVDVSLSRSQGERV-FYTLHLQVDNIDNDKLNCTELSQRMLY  239

Query  834  YFNE  845
             + E
Sbjct  240  LYEE  243



>ref|XP_003520500.1| PREDICTED: transcription factor ORG2-like [Glycine max]
 gb|KHN30385.1| Transcription factor ORG2 [Glycine soja]
Length=241

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 128/186 (69%), Gaps = 6/186 (3%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            MVKKLSHNASERDRRKK+N L SSLRSLLP +DQ  +MSIPTTVSRV+KYIPELQ+++E 
Sbjct  60   MVKKLSHNASERDRRKKVNHLVSSLRSLLPVADQTKKMSIPTTVSRVIKYIPELQQQVEA  119

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L KKK++L  R++  +++       + +RR+    HHN    +S +++ + + V+ I S 
Sbjct  120  LSKKKEDLLCRIS--RQLQGDAVNKDSQRRI---SHHNSDFVVSTSRLNDCEAVVHISSY  174

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLLS  833
            +  +   ++ L CLE  GL+LL++S+ +T   RV F+ LH QV+  + +E + L EKLLS
Sbjct  175  EAHKAPLSEILQCLENNGLLLLNASSSETFGGRV-FYNLHFQVEKTQRLESEILTEKLLS  233

Query  834  YFNEEQ  851
             + +++
Sbjct  234  IYEKQR  239



>gb|KEH41328.1| transcription factor ORG2-like protein [Medicago truncatula]
Length=247

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 119/190 (63%), Gaps = 16/190 (8%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            MVKKL HNASERDRRKK+N L+SSLRSLLP  DQ  ++SIP T+SRV+KYIPELQ ++E 
Sbjct  63   MVKKLVHNASERDRRKKINNLYSSLRSLLPVFDQMKKLSIPATISRVLKYIPELQNQVEG  122

Query  474  lqkkkqelTSRVNSWQKISKSPPEF-----NKRRRVMGGHHHNRQSYLSATQVGERDIVI  638
            L K+K E+  R      +S    EF     ++R++    H +N    +S +++ + +I I
Sbjct  123  LIKRKDEILLR------LSPQVEEFILSKESQRKK----HSYNSGFVVSISRLNDSEITI  172

Query  639  QICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLK  818
            QI      +   ++ L CLE +GL+LL+ S+ +T   RV F+ LH QV   +++E   L 
Sbjct  173  QISCYTVQKIPLSEILICLENDGLLLLNVSSSKTFGGRV-FYNLHFQVDKTQILESHILN  231

Query  819  EKLLSYFNEE  848
            EKLLS   +E
Sbjct  232  EKLLSIMEKE  241



>ref|XP_009139056.1| PREDICTED: transcription factor ORG3-like [Brassica rapa]
Length=248

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 121/184 (66%), Gaps = 14/184 (8%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            KKL HNASERDRRKK+N LFSSLRS LPASDQ  ++SIP TVSR +KYI ELQ+E++ L 
Sbjct  72   KKLKHNASERDRRKKINSLFSSLRSCLPASDQSKKLSIPQTVSRSLKYILELQEEVKMLI  131

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKKG  659
            +KK+EL  RV+  + I + P         +  H+    S +SAT++G+ ++++QI S K 
Sbjct  132  QKKEELLVRVSGQRAIEQQPK--------VVAHY---VSTVSATRLGDHEMMVQISSSKI  180

Query  660  TQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGI--EMMEVDKLKEKLLS  833
                 ++ LS LE +G VL+D S+ ++  +RV F+TLHLQV  I  + +   +L +++L 
Sbjct  181  NNFSISNVLSGLEDDGCVLVDVSSSRSQGERV-FYTLHLQVDNIDNDKLNCTELSQRMLY  239

Query  834  YFNE  845
             + E
Sbjct  240  LYEE  243



>ref|XP_008244842.1| PREDICTED: transcription factor ORG2-like [Prunus mume]
Length=246

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 105/268 (39%), Positives = 157/268 (59%), Gaps = 28/268 (10%)
 Frame = +3

Query  42   FSPMSFPNMGWSIDDYISHEQ--FGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERC  215
             SP SF  +GW ++D  SH+Q  F  D +++   ++        F+ +  S LP  +E  
Sbjct  4    LSPPSFSTIGWPLEDPKSHDQNYFYRDSFTDQIAES--------FLHILPSQLP-QVEPA  54

Query  216  DSLKFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQ  395
             S           S    G  +  + MVKKL+HNASERDRR+K+N L+SSLRSLLPA DQ
Sbjct  55   RS---------TPSTTLSGEYAGDSTMVKKLNHNASERDRRQKINSLYSSLRSLLPA-DQ  104

Query  396  KARMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGG  575
              ++SIP T+SRVVKYIPELQK++E L +K      R     +ISK   +     + M  
Sbjct  105  MKKLSIPNTISRVVKYIPELQKQVEGLIRK------REELLVRISKQEDQELHEEKKMKS  158

Query  576  HHHNRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRV  755
               +  S +S  ++ +R++ IQI + K   NL ++ L  LE+EGL +L++S+F++S +RV
Sbjct  159  TAGSSLSAVSTYRLNDREVAIQISTFKTHNNLLSEILLNLEEEGLQILNASSFESSGERV  218

Query  756  NFHTLHLQVQGIEMMEVDKLKEKLLSYF  839
             F+ LHLQV+    +E + L EKL+S++
Sbjct  219  -FYNLHLQVERSYRLESENLSEKLMSFY  245



>ref|XP_010427553.1| PREDICTED: transcription factor ORG3-like [Camelina sativa]
Length=258

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 126/186 (68%), Gaps = 10/186 (5%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            ++KKL+HNASERDRRKK+N LFSSLRS LPASDQ  ++SIP TV+R +KYIPELQ ++++
Sbjct  75   VIKKLNHNASERDRRKKINSLFSSLRSCLPASDQSKKLSIPATVTRSLKYIPELQDQVKK  134

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L KKK+EL  +V+    I         + + +  +     S +SAT++G+ ++++QI S 
Sbjct  135  LIKKKEELMMQVSGQINIEDY---VKPQPKAVASY----VSTVSATRLGDNEVMVQISST  187

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEV--DKLKEKL  827
            K      ++ LS LE++G VL+D S+ ++  +R+ F+TLHLQV  IE  E+  ++L +++
Sbjct  188  KIHNFPISNVLSGLEEDGFVLVDMSSSRSQGERL-FYTLHLQVDRIEHYELNCEELSQRM  246

Query  828  LSYFNE  845
            L  + E
Sbjct  247  LYLYEE  252



>ref|XP_010036348.1| PREDICTED: transcription factor ORG2-like [Eucalyptus grandis]
Length=273

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 124/189 (66%), Gaps = 10/189 (5%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            MVKKL+HNASERDRRKKMNGL+S+LRSLLPA+D+  ++S+PTTVSR +KYIPE+Q+++E+
Sbjct  71   MVKKLNHNASERDRRKKMNGLYSTLRSLLPAADRMKKLSVPTTVSRALKYIPEMQQQVEK  130

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSY--LSATQVGERDIVIQIC  647
            L ++K++L SR+N+    S+    +   + +  G    +     +S T++ E ++ IQI 
Sbjct  131  LTQEKEKLLSRINA----SRDGDYYTSHQEISRGKGSLQILVPSISTTRLSESEVAIQIS  186

Query  648  SKKGTQNL---FADALSCLEQEGLVLLDSSTFQTSED-RVNFHTLHLQVQGIEMMEVDKL  815
            + K   +    F++ L  L+  G  ++ SSTF++    +  F+ LH+QV+    +E   L
Sbjct  187  TGKVMTHKTVDFSEVLLALDYLGFPVISSSTFESCGGMKTTFYNLHVQVERSTGVECGDL  246

Query  816  KEKLLSYFN  842
            KEKL + F+
Sbjct  247  KEKLSALFD  255



>gb|AFK46513.1| unknown [Lotus japonicus]
Length=250

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 115/187 (61%), Gaps = 8/187 (4%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            MVKKLSHNASERDRRKK+N L +SLRSLLP  DQ  +MSIP T+S+V+KYIPELQK+++ 
Sbjct  68   MVKKLSHNASERDRRKKINTLIASLRSLLPGQDQTKKMSIPATISQVIKYIPELQKQVKG  127

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
              KKK++L  ++     IS+     N+        HHN    +S + + + +  I I S 
Sbjct  128  QTKKKEKLLPKI-----ISQGDA-VNEESPGKKIPHHNSDFIVSNSWLNDSEAAIHISSY  181

Query  654  KGTQNL-FADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLL  830
            +        + L CLE  G  LL++S+ +T   R+ F+ LH QV+  + +E D L +KLL
Sbjct  182  EAHHKTPLTEILLCLENNGYFLLNASSTETFGGRI-FYNLHFQVEKTQRLESDILTQKLL  240

Query  831  SYFNEEQ  851
            S + ++Q
Sbjct  241  SIYEKKQ  247



>ref|XP_002878123.1| OBP3-responsive gene 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54382.1| OBP3-responsive gene 3 [Arabidopsis lyrata subsp. lyrata]
Length=258

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 126/186 (68%), Gaps = 10/186 (5%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            +VKKL+HNASERDRRKK+N LFSSLRS LPASDQ  ++SIP TVSR +KYIPELQ+++++
Sbjct  74   VVKKLNHNASERDRRKKINSLFSSLRSCLPASDQSKKLSIPATVSRSLKYIPELQEQVKK  133

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L KKK+EL  +V+  + I         + + +  +     S +SAT++G+ ++++QI S 
Sbjct  134  LIKKKEELLVQVSGQRNIEHY---VKPQPKAVASY----ISTVSATRLGDNEVMVQISSS  186

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIE--MMEVDKLKEKL  827
            K      ++ LS LE++G VL+D S+ ++  +R+ F+T HLQ+  IE   +  ++L +++
Sbjct  187  KIHNFSISNVLSGLEEDGFVLVDISSSRSQGERL-FYTFHLQMDKIENYKLNCEELSQRM  245

Query  828  LSYFNE  845
            L  + E
Sbjct  246  LYLYEE  251



>ref|XP_008389283.1| PREDICTED: transcription factor ORG2-like isoform X2 [Malus domestica]
Length=251

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 126/185 (68%), Gaps = 8/185 (4%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            + KKL+HNASERDRRKK+N L+SSLRSLLPA DQ  ++SIP TVSRVVKY+PELQK++E 
Sbjct  74   VAKKLNHNASERDRRKKINSLYSSLRSLLPA-DQPKKLSIPNTVSRVVKYVPELQKQVEG  132

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L +K++EL SR      I K     ++ +  +     +  S +SA Q+ +R++ IQI S 
Sbjct  133  LIRKREELLSR------IXKQESALHEEKNQIKSAARSSLSAVSACQLNDREVAIQISSL  186

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLLS  833
            K   NL +D L  LE+EGL +L++S+F++S  RV F+ L  QV+    +E + L +KL+S
Sbjct  187  KTKNNLLSDILLNLEEEGLQILNASSFESSGGRV-FYNLQFQVERTYRLECESLSDKLMS  245

Query  834  YFNEE  848
            ++ +E
Sbjct  246  FYGQE  250



>ref|XP_010504610.1| PREDICTED: transcription factor ORG2-like [Camelina sativa]
Length=258

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 131/193 (68%), Gaps = 13/193 (7%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            +VKKL+HNASERDRRKK+N LFSSLRS LPASDQ  + SIP TVSR +KYIPELQ+++++
Sbjct  69   VVKKLNHNASERDRRKKINSLFSSLRSCLPASDQSKKPSIPETVSRSLKYIPELQRQVKK  128

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRR-RVMGGHHHNRQSYLSATQVGERDIVIQICS  650
            L +KK+EL  RV+  +       ++NK++ + +  +     S +SA ++ E ++++QI S
Sbjct  129  LIQKKEELLVRVSGQRDFE----QYNKQQPKAVASY----LSTVSAARLEENEVMVQISS  180

Query  651  KKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIE---MMEVDKLKE  821
             K      ++ +S LE++G VL+D S+ ++  +R+ F+TLHLQV+ ++    +  ++L E
Sbjct  181  SKTHNFSISNVVSGLEEDGFVLVDISSSRSQGERL-FYTLHLQVEKVDDYHKINCEELSE  239

Query  822  KLLSYFNEEQTCL  860
            ++L  + + +  L
Sbjct  240  RMLYLYEKYENSL  252



>ref|XP_009139054.1| PREDICTED: transcription factor ORG2-like [Brassica rapa]
Length=251

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 125/187 (67%), Gaps = 12/187 (6%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            + KKL+HNASERDRRKK+N LFSSLRS LPASDQ  ++SIP TVSR +KYIPELQ+++++
Sbjct  68   VTKKLNHNASERDRRKKINSLFSSLRSCLPASDQSKKLSIPQTVSRSLKYIPELQEQVKK  127

Query  474  lqkkkqelTSRVNSWQKISK-SPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICS  650
            L +KK+EL  RV+  + I     P      R +        S +SAT++G+ ++++QI S
Sbjct  128  LIQKKEELLVRVSGQRDIEHYVEPHPKAVARYV--------STISATKLGDNEVMVQISS  179

Query  651  KKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIE--MMEVDKLKEK  824
             K      ++ LS LE++G VL+D S+ ++  +R+ F+TLHLQ+   +   +  ++L+++
Sbjct  180  SKNHNFSISNVLSGLEEDGFVLVDVSSSRSHGERL-FYTLHLQMGNKDDYKLTCEELRQR  238

Query  825  LLSYFNE  845
            +L  + E
Sbjct  239  MLYLYEE  245



>ref|XP_007203926.1| hypothetical protein PRUPE_ppa018670mg [Prunus persica]
 gb|EMJ05125.1| hypothetical protein PRUPE_ppa018670mg [Prunus persica]
Length=248

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 102/268 (38%), Positives = 158/268 (59%), Gaps = 26/268 (10%)
 Frame = +3

Query  42   FSPMSFPNMGWSIDDYISHEQ--FGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERC  215
             SP SF  +GW ++D  SH+Q  F  D +++   ++     P     +  +   P+    
Sbjct  4    LSPPSFSTIGWPLEDPKSHDQNYFYRDSFTDQIAESFLHTLPSQLPQVEPTRSTPS----  59

Query  216  DSLKFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQ  395
                              GG +  + MVKKL+HNASERDRR+K+N L+SSLRSLLPA DQ
Sbjct  60   --------------TTVSGGYAGVSTMVKKLNHNASERDRRQKINSLYSSLRSLLPA-DQ  104

Query  396  KARMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGG  575
              ++SIP T+SRVVKYIPELQK++E L +K++EL  R++  +   +   E  K +   G 
Sbjct  105  MKKLSIPNTISRVVKYIPELQKQVEGLIRKREELLVRISKQE--DQELHEEKKMKSTAGT  162

Query  576  HHHNRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRV  755
               +  S +S  ++ +R++ IQI + K   NL ++ L  LE+EGL +L++S+F++S +RV
Sbjct  163  --GSSLSAVSTYRLNDREVAIQISTLKTHNNLLSEILLNLEEEGLQILNASSFESSGERV  220

Query  756  NFHTLHLQVQGIEMMEVDKLKEKLLSYF  839
             F+ LHLQV+    +E + L EKL+S++
Sbjct  221  -FYNLHLQVERSYRLECENLSEKLMSFY  247



>ref|NP_191257.1| transcription factor ORG3 [Arabidopsis thaliana]
 sp|Q9M1K0.1|ORG3_ARATH RecName: Full=Transcription factor ORG3; AltName: Full=Basic 
helix-loop-helix protein 39; Short=AtbHLH39; Short=bHLH 39; 
AltName: Full=OBP3-responsive gene 3; AltName: Full=Transcription 
factor EN 9; AltName: Full=bHLH transcription factor bHLH039 
[Arabidopsis thaliana]
 gb|AAM10941.1|AF488577_1 putative bHLH transcription factor [Arabidopsis thaliana]
 emb|CAB72168.1| putative protein [Arabidopsis thaliana]
 gb|AEE79595.1| transcription factor ORG3 [Arabidopsis thaliana]
Length=258

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 126/189 (67%), Gaps = 16/189 (8%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            +VKKL+HNASERDRR+K+N LFSSLRS LPAS Q  ++SIP TVSR +KYIPELQ+++++
Sbjct  75   VVKKLNHNASERDRRRKINSLFSSLRSCLPASGQSKKLSIPATVSRSLKYIPELQEQVKK  134

Query  474  lqkkkqelTSRVNSWQKIS---KSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQI  644
            L KKK+EL  +++  +      K PP+             N  S +SAT++G+ ++++QI
Sbjct  135  LIKKKEELLVQISGQRNTECYVKQPPK----------AVANYISTVSATRLGDNEVMVQI  184

Query  645  CSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIE--MMEVDKLK  818
             S K      ++ LS LE++  VL+D S+ ++  +R+ F+TLHLQV+ IE   +  ++L 
Sbjct  185  SSSKIHNFSISNVLSGLEEDRFVLVDMSSSRSQGERL-FYTLHLQVEKIENYKLNCEELS  243

Query  819  EKLLSYFNE  845
            +++L  + E
Sbjct  244  QRMLYLYEE  252



>ref|XP_007028476.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY08978.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=233

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 120/186 (65%), Gaps = 13/186 (7%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            ++KKL+HNA ERDRRKK+N L++SLRSLLP S+Q  R+SIP T+SRV+KYIPELQ  +ER
Sbjct  61   VLKKLNHNARERDRRKKINSLYTSLRSLLPLSEQTKRLSIPATISRVLKYIPELQAHVER  120

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L +KK+E+ SR   +     S  + NKR+        +    +S ++V ER++V+QI + 
Sbjct  121  LVQKKEEILSRQEEF-----SCDQENKRK-------GSSSFAISVSRVSEREVVVQISTF  168

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLLS  833
            +  +   +  L  LE++GL L ++S F++   RV F+ LH QV+    +E   L EKLLS
Sbjct  169  RAFETPLSHVLFNLEEDGLFLTEASCFESFGGRV-FYNLHFQVERTYNLEGVVLNEKLLS  227

Query  834  YFNEEQ  851
             + + +
Sbjct  228  LYEKRK  233



>ref|XP_006402925.1| hypothetical protein EUTSA_v10006189mg [Eutrema salsugineum]
 gb|ESQ44378.1| hypothetical protein EUTSA_v10006189mg [Eutrema salsugineum]
Length=254

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 99/270 (37%), Positives = 154/270 (57%), Gaps = 31/270 (11%)
 Frame = +3

Query  48   PMSFPNMGW-SIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERCDSL  224
            P  FPN GW +  +Y S+   G +L +     T  D P P    +       A    DSL
Sbjct  6    PPMFPNFGWPTTGEYESYYLAGENLNNG----TFLDFPVPETYGV-------AHHDQDSL  54

Query  225  KFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKAR  404
            +             G        ++KKL+HNASERDRRKK+N +FSSLRS LPASDQ  +
Sbjct  55   R-------ASVSSEGNEIDNNPVVIKKLNHNASERDRRKKINSMFSSLRSCLPASDQSKK  107

Query  405  MSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKS-PPEFNKRRRVMGGHH  581
            +SIP TVSR +KYIPELQ+E+++L +KK+EL  RV+  + I  +  P+     R +    
Sbjct  108  LSIPQTVSRSLKYIPELQEEVKKLIQKKEELLVRVSGQRDIEHNVKPQPKAVARYV----  163

Query  582  HNRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNF  761
                S +SAT++G+ ++++QI S K      ++ LS LE++G VL+  S+ ++  +R+ F
Sbjct  164  ----STVSATRLGDNEVMVQISSSKIHNFSISNVLSGLEEDGFVLVGVSSSRSHGERL-F  218

Query  762  HTLHLQVQGIEMMEVD--KLKEKLLSYFNE  845
            +TLHL+V  I+  +++  +L +++L  + E
Sbjct  219  YTLHLRVDEIDNHKLNCAELSQRMLYLYEE  248



>emb|CDP09545.1| unnamed protein product [Coffea canephora]
Length=221

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 116/162 (72%), Gaps = 6/162 (4%)
 Frame = +3

Query  297  VKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerl  476
            VKKL+HNASERDRRK++NGL+SSL      + Q  ++SIPTTVSRV+KYIPELQKE+E L
Sbjct  64   VKKLNHNASERDRRKRINGLYSSLPIYTNCAQQSKKLSIPTTVSRVLKYIPELQKEVESL  123

Query  477  qkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKK  656
             +KK+ L ++++  +  + SP    +++R +G       S +SA+++ +R++++QI + K
Sbjct  124  IEKKECLKTKISEQE--NSSPL---RKQRNLGSSTQIPSSTVSASRLSDREVMVQISTMK  178

Query  657  GTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQV  782
             ++  +AD LS LEQ+G   L+SS F++  +RV FH+LHL+V
Sbjct  179  FSKCSYADVLSSLEQDGFFSLNSSCFESFGERV-FHSLHLEV  219



>emb|CDX76031.1| BnaA04g02950D [Brassica napus]
Length=251

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 122/188 (65%), Gaps = 15/188 (8%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            + KKL HNASERDRRKK+N LFSSLRS LPASDQ  ++SIP TVSR +KYIPELQ+E+++
Sbjct  68   VTKKLKHNASERDRRKKINSLFSSLRSCLPASDQSKKLSIPQTVSRSLKYIPELQEEVKK  127

Query  474  lqkkkqelTSRVNSWQKIS---KSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQI  644
            L +KK+E   RV+  + I    K  P+   R            S +S T++G+  +++QI
Sbjct  128  LIQKKEEFLVRVSGQRDIEHHVKQQPKVVAR----------YVSTVSVTRLGDNKVMVQI  177

Query  645  CSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEM-MEVDKLKE  821
             S K      ++ LS LE++G VL+D S+ ++ ++R+ F+TLHLQ+  I+  M   +L +
Sbjct  178  SSSKIHSFSISNVLSGLEEDGFVLVDVSSPRSHDERL-FYTLHLQMGYIDYKMNCTELSQ  236

Query  822  KLLSYFNE  845
            ++L  + E
Sbjct  237  RILYLYEE  244



>gb|AFK45714.1| unknown [Medicago truncatula]
Length=246

 Score =   114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 120/190 (63%), Gaps = 17/190 (9%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            MVKKL HNASERDRRKK+N L+SSLRSLLP SDQ  ++SIP T+SRV+KYIPELQ ++E 
Sbjct  63   MVKKLVHNASERDRRKKINNLYSSLRSLLPVSDQ-MKLSIPGTISRVLKYIPELQNQVEG  121

Query  474  lqkkkqelTSRVNSWQKISKSPPEF-----NKRRRVMGGHHHNRQSYLSATQVGERDIVI  638
            L K+K E+         +S    EF     ++R++    H +N    +S++++ + +I I
Sbjct  122  LIKRKDEI------LLGLSPQVEEFILSKESQRKK----HSYNSGFVVSSSRLNDSEITI  171

Query  639  QICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLK  818
            QI      +   ++ L CLE +GL+LL+ S+ +T   RV F+ LH QV   +++E   L 
Sbjct  172  QISCYTVQKIPLSEILICLENDGLLLLNVSSSKTFGGRV-FYNLHFQVDKTQILESHILN  230

Query  819  EKLLSYFNEE  848
            EKLLS   +E
Sbjct  231  EKLLSIMEKE  240



>gb|KEH41325.1| transcription factor ORG2-like protein [Medicago truncatula]
Length=246

 Score =   114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 119/190 (63%), Gaps = 17/190 (9%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            MVKKL HNASERDRRKK+N L+SSLRSLLP  DQ  ++SIP T+SRV+KYIPELQ ++E 
Sbjct  63   MVKKLVHNASERDRRKKINNLYSSLRSLLPVFDQ-MKLSIPATISRVLKYIPELQNQVEG  121

Query  474  lqkkkqelTSRVNSWQKISKSPPEF-----NKRRRVMGGHHHNRQSYLSATQVGERDIVI  638
            L K+K E+  R      +S    EF     ++R++    H +N    +S +++ + +I I
Sbjct  122  LIKRKDEILLR------LSPQVEEFILSKESQRKK----HSYNSGFVVSISRLNDSEITI  171

Query  639  QICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLK  818
            QI      +   ++ L CLE +GL+LL+ S+ +T   RV F+ LH QV   +++E   L 
Sbjct  172  QISCYTVQKIPLSEILICLENDGLLLLNVSSSKTFGGRV-FYNLHFQVDKTQILESHILN  230

Query  819  EKLLSYFNEE  848
            EKLLS   +E
Sbjct  231  EKLLSIMEKE  240



>ref|XP_006402927.1| hypothetical protein EUTSA_v10006491mg [Eutrema salsugineum]
 gb|ESQ44380.1| hypothetical protein EUTSA_v10006491mg [Eutrema salsugineum]
Length=255

 Score =   114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 100/275 (36%), Positives = 153/275 (56%), Gaps = 31/275 (11%)
 Frame = +3

Query  48   PMSFPNMGW-SIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERCDSL  224
            P  FPN GW S  +Y  +   G +L S    DT  D P P    + +          +SL
Sbjct  6    PPLFPNFGWPSTGEYEGYYVPGENLKS----DTFLDFPVPETYGVAAHQ--------NSL  53

Query  225  KFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKAR  404
                 S   G             ++KKL+HNASERDRRKK+N LFSSLRS LP SD   +
Sbjct  54   GVSVSSEGNGIDNNHV-------VIKKLNHNASERDRRKKINSLFSSLRSCLPVSDHSKK  106

Query  405  MSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHH  584
            +SIP TVSR +KYIPELQ+E+++L +KK+EL  +V   + I      ++K +      + 
Sbjct  107  LSIPATVSRSLKYIPELQEEVKKLIEKKEELLIQVTGQRDID----HYDKPQPKAAASY-  161

Query  585  NRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFH  764
               S +SAT++GE ++++QI S K      ++ L  LE++G VL+D S+ ++  +R+ F+
Sbjct  162  --LSTVSATRLGENEVMVQISSSKVHNFSISNVLRGLEEDGFVLVDVSSSRSHGERL-FY  218

Query  765  TLHLQVQGIEM---MEVDKLKEKLLSYFNEEQTCL  860
            TLHLQV+ ++    M  ++L E++L  + + +  L
Sbjct  219  TLHLQVEIMDAYYKMNCEELSERMLYLYEKCENSL  253



>ref|XP_010516301.1| PREDICTED: transcription factor ORG3-like [Camelina sativa]
Length=259

 Score =   114 bits (285),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 123/186 (66%), Gaps = 10/186 (5%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            ++KKL+HNASERDRRKK+N LFSSLRS LPASDQ  ++SIP TV+R + YIPELQ ++++
Sbjct  75   VIKKLNHNASERDRRKKINSLFSSLRSCLPASDQSKKLSIPATVTRSLNYIPELQDQVKK  134

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L K K+EL  +V+    I         + + +  +     S +SAT++G+ ++++QI S 
Sbjct  135  LIKNKEELLMQVSGQINIEDY---VKPQPKAVASY----VSTVSATRLGDNEVMVQISSS  187

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEV--DKLKEKL  827
            K      ++ LS LE++G VL+D S+ ++  +R+ F+TLHLQ+  IE  E+  + L +++
Sbjct  188  KIYNFPISNVLSGLEEDGFVLVDMSSSRSQGERL-FYTLHLQMDKIENYELNCEALSQRM  246

Query  828  LSYFNE  845
            L  + E
Sbjct  247  LYLYEE  252



>ref|NP_191256.1| transcription factor ORG2 [Arabidopsis thaliana]
 sp|Q9M1K1.1|ORG2_ARATH RecName: Full=Transcription factor ORG2; AltName: Full=Basic 
helix-loop-helix protein 38; Short=AtbHLH38; Short=bHLH 38; 
AltName: Full=OBP3-responsive gene 2; AltName: Full=Transcription 
factor EN 8; AltName: Full=bHLH transcription factor bHLH038 
[Arabidopsis thaliana]
 gb|AAM10940.1|AF488576_1 putative bHLH transcription factor [Arabidopsis thaliana]
 emb|CAB72167.1| putative protein [Arabidopsis thaliana]
 dbj|BAD94899.1| putative bHLH transcription factor [Arabidopsis thaliana]
 gb|ABH04526.1| At3g56970 [Arabidopsis thaliana]
 gb|AEE79594.1| transcription factor ORG2 [Arabidopsis thaliana]
Length=253

 Score =   114 bits (285),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 128/187 (68%), Gaps = 16/187 (9%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            +VKKL+HNASERDRRKK+N LFSSLRS LPASDQ  ++SIP TVS+ +KYIPELQ++++R
Sbjct  70   VVKKLNHNASERDRRKKINTLFSSLRSCLPASDQSKKLSIPETVSKSLKYIPELQQQVKR  129

Query  474  lqkkkqelTSRVNS---WQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQI  644
            L +KK+E+  RV+    ++   K  P      + +  +     S +SAT++G+ ++++Q+
Sbjct  130  LIQKKEEILVRVSGQRDFELYDKQQP------KAVASY----LSTVSATRLGDNEVMVQV  179

Query  645  CSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEV--DKLK  818
             S K      ++ L  +E++G VL+D S+ ++  +R+ F+TLHLQV+ ++  ++  ++L 
Sbjct  180  SSSKIHNFSISNVLGGIEEDGFVLVDVSSSRSQGERL-FYTLHLQVENMDDYKINCEELS  238

Query  819  EKLLSYF  839
            E++L  +
Sbjct  239  ERMLYLY  245



>ref|XP_002531540.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF30834.1| DNA binding protein, putative [Ricinus communis]
Length=257

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 86/184 (47%), Positives = 127/184 (69%), Gaps = 9/184 (5%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            MVKKL+HNASERDRRKKMN L+SSLRSL PA+D+  ++SIP T+SRV+KYIPELQ++LER
Sbjct  73   MVKKLNHNASERDRRKKMNTLYSSLRSLFPAADEMKKLSIPATISRVLKYIPELQEQLER  132

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L ++K+E+  R++    I    P+ N+R+    G  H+  S +SA Q+ +++ +IQI + 
Sbjct  133  LVQRKEEILLRISKQNHIVN--PQINQRK----GTSHSSLSVVSANQISDKEAIIQISTY  186

Query  654  KGTQNL--FADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKL  827
              T +    ++ L  LE+EGL+L++SS+ ++   RV F+ LH+QV     +E D L EKL
Sbjct  187  SNTIHTSPLSEILLLLEEEGLLLINSSSAESFGGRV-FNNLHVQVDDTYTLECDALSEKL  245

Query  828  LSYF  839
             S +
Sbjct  246  ASLY  249



>ref|XP_010927034.1| PREDICTED: transcription factor bHLH100-like [Elaeis guineensis]
Length=260

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 94/273 (34%), Positives = 132/273 (48%), Gaps = 35/273 (13%)
 Frame = +3

Query  66   MGWSIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERCDSLKFdggst  245
            MGW  +D ISH    T+    A    +P      + SL  SP  P  E  D L+    S 
Sbjct  1    MGWQEEDNISH-VLNTE---EAFASHTPKETETSYQSLGLSPTQPEFE-LDDLQNSTLSP  55

Query  246  digsggggggdsatagM------VKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARM  407
                       ++T  +       +KL+HNA ERDRRKK+N L+SSLRSLLP +DQ  ++
Sbjct  56   TQAEFELDDLQNSTFSIRDPSNPTRKLNHNAYERDRRKKLNTLYSSLRSLLPETDQSKKL  115

Query  408  SIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHN  587
            SIP+TVSRV+KYIPELQ                    +K+++   E          H HN
Sbjct  116  SIPSTVSRVLKYIPELQ-----------------RQVEKLTRRKEEILLMVSRQEEHGHN  158

Query  588  RQS-----YLSATQVGERDIVIQICSKKGTQNL-FADALSCLEQEGLVLLDSSTFQTSED  749
                     +SAT +  +++++QIC       L F+  L  LE EGL L+++STF T  D
Sbjct  159  STGGIIYPIVSATCLNNKEVMLQICFLHKAVCLPFSKVLRVLEGEGLQLMNASTFTTHAD  218

Query  750  RVNFHTLHLQVQGIEMMEVDKLKEKLLSYFNEE  848
            +  F+TLHLQ +    +E     E L+    E+
Sbjct  219  KT-FYTLHLQARESRSIECQIFCEHLIKTIREQ  250



>ref|XP_004249750.2| PREDICTED: transcription factor bHLH100-like [Solanum lycopersicum]
Length=281

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 98/289 (34%), Positives = 152/289 (53%), Gaps = 45/289 (16%)
 Frame = +3

Query  33   LPFFSPMSFPNM---GWSIDDYISHE------------QFGTD----LYSNAAGDTSPDA  155
            L F S   FP M    WS+++ +S++            QF TD    L+     D + D 
Sbjct  2    LAFSSSNMFPTMNSIAWSLEEPLSYDDHHKNTTIITTPQFQTDQNNKLFEGLRADNTIDL  61

Query  156  PPPHFVSLPSSPLPPAMERCDSLKFdggstdigsggggggdsatagMVKKLSHNASERDR  335
            P  H        L  +    D L  +                    M KKL+HNASER+R
Sbjct  62   PSSHHYQ--QQCLKGSEFDVDELGVERSL-----------------MEKKLNHNASERNR  102

Query  336  RKKMNGLFSSLRSLLP---ASDQKARMSIPTTVSRVVKYIPelqkelerlqkkkqelTSR  506
            RKKMN L+S+LRSLLP      QK ++S P TVS V +YIPEL+KE+ERL K K  L S+
Sbjct  103  RKKMNFLYSTLRSLLPPPTNKHQKKKLSFPATVSYVQEYIPELKKEIERLSKTKDLLLSK  162

Query  507  VNSWQKISKSPPEFNKRRRVMGGHHHNRQSY-LSATQVGERDIVIQICSKKGTQNLFADA  683
             +++  +     + NKR+ ++GG   N  +  + A+Q+    +++QI + +      +  
Sbjct  163  KSNYSLL--KIDDNNKRKLIIGGTSCNSSTTSICASQLSNSQVLVQISTTQENNFPISQV  220

Query  684  LSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLL  830
             + +E++GL+LL++S+F++  D++ FH+LH Q+QG   M++  LK KLL
Sbjct  221  FASVEEDGLILLNASSFKSFGDKI-FHSLHFQMQGPIEMDIQVLKTKLL  268



>ref|XP_009616457.1| PREDICTED: transcription factor ORG2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=227

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 132/188 (70%), Gaps = 6/188 (3%)
 Frame = +3

Query  297  VKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerl  476
            VKKL+HNASERDRRK  N L SSLRSLLPA+D   ++S P TV+RV+KYIP+L+K++ERL
Sbjct  37   VKKLNHNASERDRRKVFNSLCSSLRSLLPATDHTKKLSFPATVARVIKYIPDLKKDVERL  96

Query  477  qkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKK  656
             +KK++LT R    ++ S    +FNK  + + G   +  S +SA QVG R+++I I + K
Sbjct  97   TQKKEDLTLRSIPKKEYS---ADFNK--QTIRGGIQSSLSVISANQVGNREVIIHISTLK  151

Query  657  GTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLLSY  836
              ++ FA+A+S LE EGL+LL++S+F+T  DRV F+ LH Q QG   + V  L++KLLSY
Sbjct  152  INKSSFAEAVSELEDEGLLLLNASSFETLGDRV-FYNLHFQAQGTLPINVQILRDKLLSY  210

Query  837  FNEEQTCL  860
            + +E   L
Sbjct  211  YEKEDKLL  218



>gb|KDO40152.1| hypothetical protein CISIN_1g025477mg [Citrus sinensis]
Length=252

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 133/186 (72%), Gaps = 8/186 (4%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            MVKKL HNASERDRRKK+N L+SSLRSLLP +DQ  ++SIP TVSRV+KYIPELQ+++ER
Sbjct  63   MVKKLYHNASERDRRKKINSLYSSLRSLLPVADQTKKLSIPATVSRVLKYIPELQQQVER  122

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L +KK+EL S+++   +IS        +R++  G   +  + +SA+++ + +I+IQI S 
Sbjct  123  LMQKKEELLSKISKPGEISHQ----QHQRKIAIG---SSLASISASRLSDMEILIQISSY  175

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLLS  833
            K  +   +  L  LE++GLVL+++S F++ + RV F+ LHLQV+    ++ + L EKL S
Sbjct  176  KVHKCPLSKILFNLEEDGLVLVNASFFESFQGRV-FYNLHLQVKSTYGLDCEVLNEKLKS  234

Query  834  YFNEEQ  851
            ++NE++
Sbjct  235  FYNEKR  240



>ref|XP_006411389.1| hypothetical protein EUTSA_v10017167mg [Eutrema salsugineum]
 gb|ESQ52842.1| hypothetical protein EUTSA_v10017167mg [Eutrema salsugineum]
Length=243

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 93/266 (35%), Positives = 152/266 (57%), Gaps = 35/266 (13%)
 Frame = +3

Query  48   PMSFPNMGWSIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERCDSLK  227
            P  FPN GW   D   H  +  D  SN    T  D P P F     +    ++ER   L+
Sbjct  6    PPLFPNFGWPCGD---HGLYENDDVSN----TFLDFPLPEF---QVAHRNVSLERNTILE  55

Query  228  FdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARM  407
             +                     +KKL+HNASERDRRKK+N +FSSLR  LPA+DQ  ++
Sbjct  56   IENPVA-----------------MKKLNHNASERDRRKKINAMFSSLRDCLPATDQSKKL  98

Query  408  SIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHN  587
            S+  TVS+ +KYIPELQ+++++L KKK+EL+ +++  + +  +      ++ V      +
Sbjct  99   SVSATVSQALKYIPELQEQVKKLVKKKEELSFQISGQRDLVYTDQNGEPKKGVT-----S  153

Query  588  RQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHT  767
              S +SAT++GE ++++QI S +  +  F + L+ +E++GLVLLD+S+ ++  +R+ F+T
Sbjct  154  YASTVSATKLGETEVMVQISSLQTEKCSFGNVLNGVEEDGLVLLDASSSRSQGERL-FYT  212

Query  768  LHLQVQGIEMMEVDKLKEKLLSYFNE  845
            LHLQ+     +  ++L ++ LSY  E
Sbjct  213  LHLQMDNCN-LNSEELSDR-LSYLYE  236



>ref|XP_006292870.1| hypothetical protein CARUB_v10019130mg [Capsella rubella]
 gb|EOA25768.1| hypothetical protein CARUB_v10019130mg [Capsella rubella]
Length=257

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 76/192 (40%), Positives = 129/192 (67%), Gaps = 11/192 (6%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            +VKKL+HNASERDRRKK+N LFS+LRS LPAS+   ++SIP T+SR +KYIPELQ++++ 
Sbjct  73   VVKKLNHNASERDRRKKINSLFSTLRSCLPASNHSKKLSIPETISRSLKYIPELQQQVKN  132

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L +KK+EL  RV+  +        ++K+++     +    S +SAT++GE ++++QI S 
Sbjct  133  LIQKKEELLVRVSGQRDF----KHYDKQQQKAIASY---LSTVSATRLGESEVMVQISSS  185

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIE---MMEVDKLKEK  824
            K      ++ LS LE++G  L+D S+ ++  +R+ F+TLHLQ++ ++    +  ++L E+
Sbjct  186  KIHNFSISNVLSGLEEDGFALVDVSSSRSHGERL-FYTLHLQMENMDDYYKINCEELSER  244

Query  825  LLSYFNEEQTCL  860
            +L  + + +  L
Sbjct  245  MLYLYEKYEKSL  256



>ref|XP_008389282.1| PREDICTED: transcription factor ORG2-like isoform X1 [Malus domestica]
Length=253

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 127/187 (68%), Gaps = 10/187 (5%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQ--KARMSIPTTVSRVVKYIPelqkel  467
            + KKL+HNASERDRRKK+N L+SSLRSLLPA DQ  + ++SIP TVSRVVKY+PELQK++
Sbjct  74   VAKKLNHNASERDRRKKINSLYSSLRSLLPA-DQPLQKKLSIPNTVSRVVKYVPELQKQV  132

Query  468  erlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQIC  647
            E L +K++EL SR      I K     ++ +  +     +  S +SA Q+ +R++ IQI 
Sbjct  133  EGLIRKREELLSR------IXKQESALHEEKNQIKSAARSSLSAVSACQLNDREVAIQIS  186

Query  648  SKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKL  827
            S K   NL +D L  LE+EGL +L++S+F++S  RV F+ L  QV+    +E + L +KL
Sbjct  187  SLKTKNNLLSDILLNLEEEGLQILNASSFESSGGRV-FYNLQFQVERTYRLECESLSDKL  245

Query  828  LSYFNEE  848
            +S++ +E
Sbjct  246  MSFYGQE  252



>ref|XP_009616456.1| PREDICTED: transcription factor ORG2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=256

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 132/188 (70%), Gaps = 6/188 (3%)
 Frame = +3

Query  297  VKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerl  476
            VKKL+HNASERDRRK  N L SSLRSLLPA+D   ++S P TV+RV+KYIP+L+K++ERL
Sbjct  66   VKKLNHNASERDRRKVFNSLCSSLRSLLPATDHTKKLSFPATVARVIKYIPDLKKDVERL  125

Query  477  qkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKK  656
             +KK++LT R    ++ S    +FNK  + + G   +  S +SA QVG R+++I I + K
Sbjct  126  TQKKEDLTLRSIPKKEYS---ADFNK--QTIRGGIQSSLSVISANQVGNREVIIHISTLK  180

Query  657  GTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLLSY  836
              ++ FA+A+S LE EGL+LL++S+F+T  DRV F+ LH Q QG   + V  L++KLLSY
Sbjct  181  INKSSFAEAVSELEDEGLLLLNASSFETLGDRV-FYNLHFQAQGTLPINVQILRDKLLSY  239

Query  837  FNEEQTCL  860
            + +E   L
Sbjct  240  YEKEDKLL  247



>ref|XP_009142733.1| PREDICTED: transcription factor bHLH100-like [Brassica rapa]
Length=243

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 123/182 (68%), Gaps = 7/182 (4%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            ++KKL+HNASERDRRKK+N +FSSLRS LPASDQ  ++S+  TVS  + YIPELQ+++++
Sbjct  61   VMKKLNHNASERDRRKKINTMFSSLRSCLPASDQSKKLSVSATVSHALNYIPELQEQVKQ  120

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L KKK +L  +++  + +  +    N  +   GG  +   S +SAT++GE ++++QI S 
Sbjct  121  LIKKKDDLCFQISGQKDLVYADQNGNPEK---GGTRY--ASTVSATRLGETEVMVQISSL  175

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLLS  833
            +  +  F + LS  E++GLVL+D+S+ ++  +R+ F+TLH Q+     +  ++L ++LL 
Sbjct  176  QTVKCSFGNLLSGTEEDGLVLMDASSSRSQGERL-FYTLHFQMNNCN-LNFEELNDRLLY  233

Query  834  YF  839
             +
Sbjct  234  LY  235



>ref|XP_009600422.1| PREDICTED: transcription factor ORG2-like [Nicotiana tomentosiformis]
Length=252

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 120/188 (64%), Gaps = 6/188 (3%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASD-QKARMSIPTTVSRVVKYIPelqkele  470
            M KKLSHNASER+RRKKMN L+S+LRSLLPA++ QK ++S P TVS V +YIPEL+KE+E
Sbjct  64   MAKKLSHNASERNRRKKMNFLYSTLRSLLPAANHQKKKLSFPATVSYVQEYIPELKKEIE  123

Query  471  rlqkkkqelTSRVNSWQKIS-KSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQIC  647
            RL + K  L S + S +  S   P  +N +R           + + A+ +    +++ I 
Sbjct  124  RLSQTKDLLLSTILSKKADSLVQPNNYNNKRNTTSSA---SSTSIFASPLCNGQVLVHIS  180

Query  648  SKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKL  827
            + +      ++A   LE++G++LL++++F++  D++ FH+LH Q+QG   ME+  L+ KL
Sbjct  181  TTQTNGFPISEAFQTLEEDGILLLNATSFKSFGDKI-FHSLHFQMQGTVGMEIQNLETKL  239

Query  828  LSYFNEEQ  851
            L  + E Q
Sbjct  240  LVMYEENQ  247



>ref|XP_002878122.1| OBP3-responsive gene 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54381.1| OBP3-responsive gene 3 [Arabidopsis lyrata subsp. lyrata]
Length=254

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 124/185 (67%), Gaps = 11/185 (6%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            + KKL+HNASERDRRKK+N LFSSLRS LP SDQ  ++SIP TVS+ +KYIPELQ+++++
Sbjct  71   VAKKLNHNASERDRRKKINSLFSSLRSCLPVSDQSKKLSIPETVSKSLKYIPELQQQVKK  130

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L +KK+EL  RV+  +       +F    +       +  S +SAT++G+ ++++QI S 
Sbjct  131  LLQKKEELLVRVSGHR-------DFEIYDKQQSKAVASYLSTVSATRLGDNEVMVQISSS  183

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIE---MMEVDKLKEK  824
            K      ++ L  +E++G+VL+D S+ ++  +R+ F+TLHLQV+ ++    +  ++L E+
Sbjct  184  KIHNFSISNVLGGIEEDGVVLVDVSSSRSQGERL-FYTLHLQVENMDDYYKINCEELSER  242

Query  825  LLSYF  839
            +L  +
Sbjct  243  MLYLY  247



>ref|XP_007028477.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 2 [Theobroma cacao]
 gb|EOY08979.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 2 [Theobroma cacao]
Length=232

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 120/186 (65%), Gaps = 14/186 (8%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            ++KKL+HNA ERDRRKK+N L++SLRSLLP S+Q  R+SIP T+SRV+KYIPELQ  +ER
Sbjct  61   VLKKLNHNARERDRRKKINSLYTSLRSLLPLSEQ-TRLSIPATISRVLKYIPELQAHVER  119

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L +KK+E+ SR   +     S  + NKR+        +    +S ++V ER++V+QI + 
Sbjct  120  LVQKKEEILSRQEEF-----SCDQENKRK-------GSSSFAISVSRVSEREVVVQISTF  167

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLLS  833
            +  +   +  L  LE++GL L ++S F++   RV F+ LH QV+    +E   L EKLLS
Sbjct  168  RAFETPLSHVLFNLEEDGLFLTEASCFESFGGRV-FYNLHFQVERTYNLEGVVLNEKLLS  226

Query  834  YFNEEQ  851
             + + +
Sbjct  227  LYEKRK  232



>gb|KFK34930.1| hypothetical protein AALP_AA5G212600 [Arabis alpina]
Length=253

 Score =   111 bits (278),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 96/270 (36%), Positives = 151/270 (56%), Gaps = 32/270 (12%)
 Frame = +3

Query  48   PMSFPNMGW-SIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERCDSL  224
            P  FPN GW S  DY S+   G +L +N+            F+  P           D L
Sbjct  6    PPLFPNFGWPSTGDYESYYLAGENLNNNS------------FLDFPVPETYGVTHHQDLL  53

Query  225  KFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKAR  404
                 S                 + KKL+HNASERDRRKK+N LFSSLRS LPASDQ  +
Sbjct  54   GVSVSSEGNEIDNNPV-------VAKKLNHNASERDRRKKINSLFSSLRSCLPASDQSKK  106

Query  405  MSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNK-RRRVMGGHH  581
            +SIP TVS+ +KYIPELQ+E+++L +KKQEL  +V+  + I      +NK   + +  + 
Sbjct  107  LSIPQTVSKSLKYIPELQQEVKKLMQKKQELLVQVSGQRDIEN----YNKPVPKAVTSY-  161

Query  582  HNRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNF  761
                S +S T++G+ ++++QI S K      ++ LS LE++G VL+D S+ ++  +R+ F
Sbjct  162  ---VSTVSTTRLGDNEVMVQISSSKIHNFSISNVLSGLEEDGFVLVDVSSSRSQGERL-F  217

Query  762  HTLHLQVQGIEMMEV--DKLKEKLLSYFNE  845
            +TLHLQ+  ++  ++  ++L +++L  + +
Sbjct  218  YTLHLQMGNMDNYQLNGEELSQRMLYLYED  247



>ref|XP_002323250.2| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEF05011.2| basic helix-loop-helix family protein [Populus trichocarpa]
Length=264

 Score =   112 bits (279),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 105/266 (39%), Positives = 159/266 (60%), Gaps = 30/266 (11%)
 Frame = +3

Query  42   FSPMS-FPNMGWSIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERCD  218
             SP+S F   GW +++ ISHEQ    LYS   G+T     P  F   P  P  P + + D
Sbjct  5    LSPISLFSTFGWPLEEAISHEQ----LYSFRDGET-----PESFTHFP--PSQPDVRQLD  53

Query  219  SLKFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQK  398
                        +       S    M KKL+HNASERDRRKK+N L+SSLRSLLPA+DQ+
Sbjct  54   ----------RSTSFTAHSGSGDPSMAKKLNHNASERDRRKKINSLYSSLRSLLPAADQR  103

Query  399  ARMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGH  578
             ++SIP TVSRV+ YIP+LQ+++ERL ++K+EL S      K+S+   +   +     G 
Sbjct  104  KKLSIPYTVSRVLVYIPKLQQQVERLIQRKEELLS------KLSRQADDLTHQENQRKGT  157

Query  579  HHNRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVN  758
             ++  S +SA+++ +R++VI I + K  ++  ++ L  LE+ GL+LL+SS+F++   RV 
Sbjct  158  MYSSLSSVSASRLSDREVVIHISTNKLHRSSLSEILVNLEEAGLLLLNSSSFESFGGRV-  216

Query  759  FHTLHLQ-VQGIEMMEVDKLKEKLLS  833
            F+ LHLQ ++G   +E + L E+L+S
Sbjct  217  FYNLHLQAMEGTYTVECEALNERLVS  242



>ref|XP_006494391.1| PREDICTED: transcription factor ORG2-like [Citrus sinensis]
Length=190

 Score =   109 bits (273),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 131/184 (71%), Gaps = 8/184 (4%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            MVKKL HNASERDRRKK+N L+SSLRSLLP +DQ  ++SIP TVSRV+KYIPELQ+++ER
Sbjct  1    MVKKLYHNASERDRRKKINSLYSSLRSLLPVADQTKKLSIPATVSRVLKYIPELQQQVER  60

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L +KK+EL S+++   +IS      ++R+  +G    +  + +SA+++ + +I+IQI S 
Sbjct  61   LMQKKEELLSKISKQGEISHQQ---HQRKIAIG----SSLASISASRLSDMEILIQISSY  113

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLLS  833
            K  +   +  L  LE++GLVL+++S F++ + RV F  LHLQV+    ++ + L EKL S
Sbjct  114  KVHKCPLSKILFNLEEDGLVLVNASFFESFQGRV-FCNLHLQVESAYGLDCEVLNEKLKS  172

Query  834  YFNE  845
            ++NE
Sbjct  173  FYNE  176



>emb|CDY47394.1| BnaC04g24690D [Brassica napus]
Length=255

 Score =   111 bits (277),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 124/188 (66%), Gaps = 17/188 (9%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            KKL+HNASERDRRKK+N LF+SLRS LP SDQ  ++SI  TVSR +KYIPELQ+++++L 
Sbjct  73   KKLNHNASERDRRKKINSLFASLRSCLPTSDQSKKLSISATVSRSLKYIPELQEQVKKLL  132

Query  480  kkkqelTSRVNSWQKIS---KSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICS  650
            +KK+EL  RV+  + I    K  P      + +  +     S +SAT++G+ ++++QI S
Sbjct  133  QKKEELLVRVSGQRDIELYVKPQP------KAIASY----VSTVSATRLGDNEVMVQISS  182

Query  651  KKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIE---MMEVDKLKE  821
             K      ++ L+ LE++  VL+D S+ ++  +R+ F+TLHLQV+ ++    M  ++L E
Sbjct  183  SKINNFSISNVLTGLEEDDFVLVDVSSSRSQGERL-FYTLHLQVENMDDHYKMNCEELSE  241

Query  822  KLLSYFNE  845
            ++L  + E
Sbjct  242  RMLYLYEE  249



>gb|KFK24862.1| hypothetical protein AALP_AA8G034700 [Arabis alpina]
Length=273

 Score =   111 bits (278),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 106/184 (58%), Gaps = 30/184 (16%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            KKL+HNASERDRR+K+NGL+SSLR LLP SDQK ++SIP TV+RVVKYIPE +       
Sbjct  101  KKLNHNASERDRRRKLNGLYSSLRDLLPPSDQKRKLSIPMTVARVVKYIPEQK-------  153

Query  480  kkkqelTSRVNSWQKISKSPPEFNK---RRRVMGGHHHNRQ-------SYLSATQVGERD  629
                         Q++S+   E  K   R+     HHH  Q       S +SA  + + +
Sbjct  154  ----------QELQRLSRKKEELLKRISRKTATLNHHHQEQLRNRTMDSSMSANWITDTE  203

Query  630  IVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVD  809
            I +QI + K T    +D L  LE+ GL +++ S+  +S  R+ F+TLHLQ+     + ++
Sbjct  204  IAVQIATSKWTS--ISDMLLRLEENGLNVINVSSSVSSTARI-FYTLHLQMSEYSKVRLE  260

Query  810  KLKE  821
            +L +
Sbjct  261  ELND  264



>emb|CDY72354.1| BnaA05g34220D [Brassica napus]
 emb|CDX97997.1| BnaA06g07480D [Brassica napus]
Length=243

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 124/182 (68%), Gaps = 7/182 (4%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            ++KKL+HNASERDRRKK+N +FSSLRS LPASDQ  ++S+  TVS  + YIPELQ+++++
Sbjct  61   VMKKLNHNASERDRRKKINTMFSSLRSCLPASDQSKKLSVSATVSHALNYIPELQEQVKQ  120

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L KKK +L+ +++  + +  +    N  +   GG  +   S +S+T++GE ++++QI S 
Sbjct  121  LIKKKDDLSFQISGQKDLVYADQNGNPEK---GGTRY--ASTVSSTRLGETEVMVQISSL  175

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLLS  833
            +  +  F + LS  E++GLVL+D+S+ ++  +R+ F+TLH Q+     +  ++L ++LL 
Sbjct  176  QTVKCSFGNLLSGTEEDGLVLMDASSSRSQGERL-FYTLHFQMDNCN-LNFEELNDRLLY  233

Query  834  YF  839
             +
Sbjct  234  LY  235



>emb|CDY69684.1| BnaCnng64770D [Brassica napus]
Length=251

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 124/187 (66%), Gaps = 12/187 (6%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            + KKL+HNASERDRRKK+N LFSSLRS LPASDQ  ++SIP TVSR +KYIPELQ+++++
Sbjct  68   LTKKLNHNASERDRRKKINSLFSSLRSCLPASDQTKKLSIPQTVSRSLKYIPELQEQVKK  127

Query  474  lqkkkqelTSRVNSWQKISK-SPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICS  650
            L +KK+EL  RV+  + I     P+     R +        S +SAT++G+ ++++QI S
Sbjct  128  LIQKKEELLVRVSGQRAIEHYVEPQPKAVARYV--------STISATKLGDNEVMVQISS  179

Query  651  KKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIE--MMEVDKLKEK  824
             K      ++ LS LE++G VL+D S+ +   + + F++LHLQ+   +   ++ ++L ++
Sbjct  180  SKNHNFSISNVLSGLEEDGFVLVDVSSSRYHGEWL-FYSLHLQMGNKDNHKLKCEELGQR  238

Query  825  LLSYFNE  845
            +L  + E
Sbjct  239  ILYLYEE  245



>ref|XP_007202904.1| hypothetical protein PRUPE_ppa016095mg [Prunus persica]
 gb|EMJ04103.1| hypothetical protein PRUPE_ppa016095mg [Prunus persica]
Length=242

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 103/267 (39%), Positives = 150/267 (56%), Gaps = 30/267 (11%)
 Frame = +3

Query  42   FSPMSFPNMGWSIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVS-LPSSPLPPAMERCD  218
             SP  F  + W  +D +SH+Q     Y     D+S D     F+  LPS      ++R  
Sbjct  4    LSPPLFSTIAWPSEDLLSHDQ--NYFYR----DSSIDQSAESFLHILPSHQPQVDLDRST  57

Query  219  SLKFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQK  398
            ++               G  S  + M KKL+HNASERDRRKKMN L+SSLRSLLP  DQ 
Sbjct  58   TI--------------SGDYSGVSTMAKKLNHNASERDRRKKMNSLYSSLRSLLPV-DQG  102

Query  399  ARMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGH  578
             ++SIP T+S V+KYIPELQK +E L +K+ EL SR        K     ++ +R+    
Sbjct  103  KKLSIPNTISHVLKYIPELQKLVEGLIRKRGELLSRA------CKQEAAMHEEKRIKST-  155

Query  579  HHNRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVN  758
              +  S +S  ++ +R + IQI + K   NL ++ L  LE+EGL +L++S+FQ+S  RV 
Sbjct  156  ARSSSSAVSTYRLSDRAVAIQISTLKTHNNLLSEILLNLEEEGLQVLNASSFQSSGGRV-  214

Query  759  FHTLHLQVQGIEMMEVDKLKEKLLSYF  839
            F+ +HLQV+  + +E   L EKL+S++
Sbjct  215  FYNIHLQVERADRLECKNLSEKLMSFY  241



>ref|XP_009139058.1| PREDICTED: transcription factor ORG2-like [Brassica rapa]
 emb|CDY47392.1| BnaC04g24710D [Brassica napus]
 emb|CDX76025.1| BnaA04g02890D [Brassica napus]
Length=256

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 124/188 (66%), Gaps = 17/188 (9%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            KKL+HNASERDRRKK+N LF+SLRS LP SDQ  ++SI  TVSR +KYIPELQ+++++L 
Sbjct  74   KKLNHNASERDRRKKINSLFASLRSCLPTSDQSKKLSISATVSRSLKYIPELQEQVKKLL  133

Query  480  kkkqelTSRVNSWQKIS---KSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICS  650
            +KK+EL  RV+  + I    K  P      + +  +     S +SAT++G+ ++++QI S
Sbjct  134  QKKEELLVRVSGQRDIELYVKPQP------KTVASY----VSTVSATRLGDNEVMVQISS  183

Query  651  KKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIE---MMEVDKLKE  821
             K      ++ L+ LE++  VL+D S+ ++  +R+ F+TLHLQV+ ++    M  ++L E
Sbjct  184  SKINNFSISNVLTGLEEDDFVLVDVSSSRSQGERL-FYTLHLQVENMDDHYKMNCEELSE  242

Query  822  KLLSYFNE  845
            ++L  + E
Sbjct  243  RMLYLYEE  250



>ref|XP_009141976.1| PREDICTED: transcription factor bHLH100 [Brassica rapa]
Length=238

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 120/182 (66%), Gaps = 7/182 (4%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            ++KKL+HNASER RRKK+N +FS+LRS LP+++Q  ++S+  TVS+ ++YIPELQ++   
Sbjct  61   VMKKLNHNASERGRRKKINAMFSALRSCLPSTNQSKKLSVSATVSQALEYIPELQEQFNM  120

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L KKK EL+ R++  + +  +       + V G       S +SAT +GE  +++QI S 
Sbjct  121  LIKKKDELSFRISGQKDLLNTNQNAKPEKGVTG-----YASTVSATNLGETGLMVQISSL  175

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLLS  833
            +  +  F + LS LE++GLVL+D+S+ ++  +R+ F+TLHLQ+     +  ++L+ +LL 
Sbjct  176  QTVKCSFGNVLSGLEEDGLVLVDASSSRSQGERL-FYTLHLQMDNCN-LNFEELRSRLLY  233

Query  834  YF  839
             +
Sbjct  234  LY  235



>emb|CDY06938.1| BnaA04g23770D [Brassica napus]
Length=238

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 120/182 (66%), Gaps = 7/182 (4%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            ++KKL+HNASER RRKK+N +FS+LRS LP+++Q  ++S+  TVS+ ++YIPELQ++   
Sbjct  61   VMKKLNHNASERGRRKKINAMFSALRSCLPSTNQSKKLSVSATVSQALEYIPELQEQFNM  120

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L KKK EL+ R++  + +  +       + V G       S +SAT +GE  +++QI S 
Sbjct  121  LIKKKDELSFRISGQKDLLNTNQNAKPEKGVTG-----YASTVSATNLGETGLMVQISSL  175

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLLS  833
            +  +  F + LS LE++GLVL+D+S+ ++  +R+ F+TLHLQ+     +  ++L+ +LL 
Sbjct  176  QTVKCSFGNVLSGLEEDGLVLVDASSSRSQGERL-FYTLHLQMDNCN-LNFEELRSRLLY  233

Query  834  YF  839
             +
Sbjct  234  LY  235



>ref|XP_002881763.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58022.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=242

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 131/182 (72%), Gaps = 7/182 (4%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            ++KKL+HNASER+RRKK+N +FSSLRS LPA++Q  ++S+  TVS+ +KYIPELQ++++ 
Sbjct  60   VMKKLNHNASERERRKKINAMFSSLRSCLPATNQSKKLSVSATVSQALKYIPELQEQVKN  119

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L KKK+EL+ +++  + +  S  + +K  + +  +     S +SAT++GE ++++QI S 
Sbjct  120  LIKKKEELSFQISGRRDLV-STGQNSKPEKTITSY----ASTVSATRLGETEVMVQISSL  174

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLLS  833
            +  +  F + LS +E++GLVL+D+S+ ++  +R+ F++LHLQ++  + +  ++L ++LL 
Sbjct  175  QAEKCSFGNVLSGVEEDGLVLVDASSSRSQGERL-FYSLHLQMENGQ-VNSEELGDRLLY  232

Query  834  YF  839
             F
Sbjct  233  LF  234



>emb|CDY68089.1| BnaCnng57560D [Brassica napus]
Length=251

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 123/187 (66%), Gaps = 12/187 (6%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            + KKL+HNASERDRRKK+N LFSSLRS LPASDQ  ++SIP TVSR +KYIPELQ+++++
Sbjct  68   VTKKLNHNASERDRRKKINSLFSSLRSCLPASDQTKKLSIPQTVSRSLKYIPELQEQVKK  127

Query  474  lqkkkqelTSRVNSWQKISK-SPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICS  650
            L +KK+EL  RV+  + I     P+     R +        S +SAT++G+ ++++QI S
Sbjct  128  LIQKKEELLVRVSGQRAIEHYVEPQPKAVARYV--------STISATKLGDNEVLVQISS  179

Query  651  KKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIE--MMEVDKLKEK  824
             K      ++ LS LE++G VL+D S+ +    +  F++LHLQ+   +   ++ ++L ++
Sbjct  180  SKNHNFSISNVLSGLEEDGFVLVDVSSSRY-HGKWLFYSLHLQMGNKDNHKLKCEELSQR  238

Query  825  LLSYFNE  845
            +L  + E
Sbjct  239  ILYLYEE  245



>ref|XP_002307969.2| hypothetical protein POPTR_0006s03590g [Populus trichocarpa]
 gb|EEE91492.2| hypothetical protein POPTR_0006s03590g [Populus trichocarpa]
Length=250

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 108/273 (40%), Positives = 161/273 (59%), Gaps = 31/273 (11%)
 Frame = +3

Query  42   FSPMS-FPNMGWSIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERCD  218
            FSP + F   GW +++ ISHEQ     YS    +T     P  F   P  P  P +   D
Sbjct  4    FSPTTLFSTFGWPLEEPISHEQN----YSFRDCET-----PGSFTHFP--PSQPNIRELD  52

Query  219  SLKFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQK  398
                        +       S    MVKKL+HNASERDRRKK+N L+SSLRSLLPASD  
Sbjct  53   ----------HSTSFTAYSGSGDPNMVKKLNHNASERDRRKKINSLYSSLRSLLPASDGM  102

Query  399  ARMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGH  578
             ++SIP+T+SRV+KYIPELQ+++ER  ++K+EL S ++    +       N+R+  M   
Sbjct  103  KKLSIPSTISRVLKYIPELQQQVERRIQRKEELLSNLSRQDDLIHQE---NQRKDTM---  156

Query  579  HHNRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVN  758
             ++  S +SA+++G+R++V+QI + K  ++  ++ L  LE+ GLVL++SS+F++    V 
Sbjct  157  -YSSLSSVSASRLGDREVVVQISTCKVLKSPISEILLNLEENGLVLINSSSFESFGGNVF  215

Query  759  FHTLHLQV-QGIEMMEVDKLKEKLLSYFNEEQT  854
            +H LHLQV +G   +E + L EKLLS   + +T
Sbjct  216  YH-LHLQVMEGNCTLECEALNEKLLSLCTKRET  247



>ref|XP_011040761.1| PREDICTED: transcription factor ORG2-like [Populus euphratica]
Length=248

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 107/273 (39%), Positives = 163/273 (60%), Gaps = 33/273 (12%)
 Frame = +3

Query  42   FSPMS-FPNMGWSIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERCD  218
            FSP + F   GW +++ ISHEQ     YS    +T     P  F  +P  P    ++R  
Sbjct  4    FSPTTLFSTFGWPLEEPISHEQN----YSFRDCET-----PGSFTHIPQ-PNIRELDRST  53

Query  219  SLKFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQK  398
            S                   +    MVKKL+HNASERDRRKK+N L+SSLRSLLPASD  
Sbjct  54   SF-------------TAYSGNGDPNMVKKLNHNASERDRRKKINSLYSSLRSLLPASDGM  100

Query  399  ARMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGH  578
             ++SIP+T+SRV+KYIPELQ+++ER  ++K+EL S+++    +       N+R+  M   
Sbjct  101  KKLSIPSTISRVLKYIPELQQKVERQIQRKEELLSKLSRQDDLIYQE---NQRKDTM---  154

Query  579  HHNRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVN  758
             ++  S +SA+++G+R++V+QI + K  ++  ++ L  LE+ GLVL++SS+F++    V 
Sbjct  155  -YSSLSSVSASRLGDREVVVQISTCKVLKSPISEILLNLEENGLVLINSSSFESFGGNVF  213

Query  759  FHTLHLQV-QGIEMMEVDKLKEKLLSYFNEEQT  854
            +H LHLQV +G   +E + L EKLLS   + +T
Sbjct  214  YH-LHLQVMEGNCTLECEALNEKLLSICTKRET  245



>ref|XP_004513200.1| PREDICTED: transcription factor ORG2-like [Cicer arietinum]
Length=242

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 104/180 (58%), Gaps = 7/180 (4%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            MVKKL HNASERDRRKK+N L+SSLRSLLP ++Q  ++S P T+SRV+KYIP      E 
Sbjct  59   MVKKLIHNASERDRRKKINTLYSSLRSLLPVAEQMKKLSNPATISRVLKYIP------EL  112

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
             ++ +  LT +     K+S    E   +      H  N    +S +++ + +  IQI S 
Sbjct  113  QKQVEGLLTRKEAILLKLSPQVDEVKSKESERKKHSKNSGFVVSTSRLNDSEAAIQISSY  172

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLLS  833
               +   ++ L CLE +GL+LL+ S+ QT   +V F+  H QV   + +E +   EKLL+
Sbjct  173  SIHKIPLSEILMCLENDGLLLLNISSSQTFGGKV-FYNFHFQVDKEQRLESEIFSEKLLA  231



>ref|XP_010108531.1| Transcription factor ORG2 [Morus notabilis]
 gb|EXC19631.1| Transcription factor ORG2 [Morus notabilis]
Length=396

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 112/163 (69%), Gaps = 7/163 (4%)
 Frame = +3

Query  297  VKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerl  476
            V+KL+HN SERDRRKK+N L+SSLR+LLPASD   ++SIP TVSRVVKYIPELQ+E+E L
Sbjct  84   VRKLNHNVSERDRRKKINHLYSSLRALLPASDHTKKLSIPATVSRVVKYIPELQQEVEGL  143

Query  477  qkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKK  656
             +K++EL S  NS Q   +   E   + + +        S +SA+Q+  +D+ +QI + K
Sbjct  144  IRKREELLSITNSRQL--QVGQEIKNQIKSIS---RTSLSSVSASQLNNKDVAVQISTLK  198

Query  657  GTQNL-FADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQV  782
              +N   ++ L  LE++GL +L+ S+F++S  RV FH LHLQ+
Sbjct  199  ADKNYTLSEILHNLEEDGLSVLNISSFESSCGRV-FHNLHLQM  240



>ref|XP_011075620.1| PREDICTED: transcription factor ORG2-like [Sesamum indicum]
Length=257

 Score =   109 bits (272),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 123/180 (68%), Gaps = 10/180 (6%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            M KKL+HNASERDRRK+MN L+SSLRSLLP  DQ  ++SIP TVSRVVKYIPELQ+E+ER
Sbjct  73   MAKKLNHNASERDRRKRMNSLYSSLRSLLPPEDQTRKLSIPATVSRVVKYIPELQREVER  132

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSA-TQVGERDIVIQICS  650
            L +KK++L         +SK      K   +     H + +  SA TQ+ +R+I++Q  +
Sbjct  133  LTEKKEKLM--------MSKKICRQEKYTSMKKQQRHRKATQSSAITQISDREIIVQSSA  184

Query  651  KKGTQNLFADALSCLE-QEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKL  827
            +KG  + F +A+  LE QEG +LL++S+FQ+ +    F+TLHLQ Q  ++++ + LKEK+
Sbjct  185  EKGNYSSFCEAVMRLEVQEGFLLLNASSFQSLDATTLFYTLHLQAQENQVIDTEMLKEKV  244



>ref|XP_010276688.1| PREDICTED: transcription factor ORG2-like [Nelumbo nucifera]
Length=251

 Score =   109 bits (272),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 123/183 (67%), Gaps = 8/183 (4%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            MVKKL+HNASERDRRKKMN L+SSLRSLLP +DQ  + SIP TVSRV+KYIPELQK +ER
Sbjct  73   MVKKLNHNASERDRRKKMNSLYSSLRSLLPETDQTTKQSIPATVSRVLKYIPELQKRVER  132

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L+++KQE+ S +   +       + N + +            +SA++ G+ +IVIQIC+ 
Sbjct  133  LKQRKQEILSSITRHR-------DHNHQEKRRKATVQTSSPTVSASRAGDGEIVIQICAV  185

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLLS  833
            K  ++  ++ L  LEQEGL +L++S F T  +   F+ LHLQV+  + +E + L +KL+S
Sbjct  186  KVKKSPLSEVLLHLEQEGLQVLNASAFATFGE-TAFYNLHLQVRESQGVECEVLSQKLMS  244

Query  834  YFN  842
             ++
Sbjct  245  MYH  247



>ref|XP_008244848.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor ORG2-like 
[Prunus mume]
Length=214

 Score =   107 bits (268),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 112/166 (67%), Gaps = 21/166 (13%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            +VKKL+HN SERDRRKK+N L+S+LRSLLPASDQ  ++S P  +SR VKYIPELQ++++ 
Sbjct  64   VVKKLNHNVSERDRRKKINTLYSTLRSLLPASDQMKKLSNPAAISRAVKYIPELQQQVKG  123

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L ++K+EL SR+   Q+  +  P +N+                    + +R++V+QI S 
Sbjct  124  LIQRKEELLSRLRRLQQ--QGDPIYNE------------------LXLNDREVVLQISSY  163

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGI  791
               ++ F+  L  L+++GL+LL++S+F++ E R+ F++LHL+VQ +
Sbjct  164  VVQKSPFSQILVDLKEDGLLLLNASSFESFEGRL-FYSLHLRVQEL  208



>emb|CDY14758.1| BnaC04g47550D [Brassica napus]
Length=238

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 125/182 (69%), Gaps = 7/182 (4%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            ++KKL+HNASER RRKK+N +FS+LRS LP+++Q  ++S+  TVS+ ++YIPELQ+++  
Sbjct  61   LMKKLNHNASERGRRKKINEMFSALRSCLPSTNQSKKLSVSATVSQALEYIPELQEQVNM  120

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L KKK EL+ ++ S QK   +  + +K  + + G+     S +SAT +GE  +++QI S 
Sbjct  121  LIKKKDELSFQI-SGQKDLLNTNQNDKPEKGVTGY----ASTVSATNLGETGLMVQISSL  175

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLLS  833
            +  +  F + LS LE++GLVL+D+S+ ++  +R+ F+TLHLQ+     +  ++L+ +LL 
Sbjct  176  QTVKCSFGNVLSGLEEDGLVLVDASSSRSQGERL-FYTLHLQMDNCN-LNFEELRSRLLY  233

Query  834  YF  839
             +
Sbjct  234  LY  235



>gb|KEH41327.1| transcription factor ORG2-like protein [Medicago truncatula]
Length=220

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 107/168 (64%), Gaps = 16/168 (10%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            MVKKL HNASERDRRKK+N L+SSLRSLLP  DQ  ++SIP T+SRV+KYIPELQ ++E 
Sbjct  63   MVKKLVHNASERDRRKKINNLYSSLRSLLPVFDQMKKLSIPATISRVLKYIPELQNQVEG  122

Query  474  lqkkkqelTSRVNSWQKISKSPPEF-----NKRRRVMGGHHHNRQSYLSATQVGERDIVI  638
            L K+K E+  R      +S    EF     ++R++    H +N    +S +++ + +I I
Sbjct  123  LIKRKDEILLR------LSPQVEEFILSKESQRKK----HSYNSGFVVSISRLNDSEITI  172

Query  639  QICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQV  782
            QI      +   ++ L CLE +GL+LL+ S+ +T   RV F+ LH QV
Sbjct  173  QISCYTVQKIPLSEILICLENDGLLLLNVSSSKTFGGRV-FYNLHFQV  219



>ref|XP_010554771.1| PREDICTED: transcription factor ORG2-like [Tarenaya hassleriana]
Length=243

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 114/182 (63%), Gaps = 2/182 (1%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            + KK++HNASERDRRKK+N LFSSLRSLLP SD   ++SIP TVS  +KYIPEL +++++
Sbjct  55   VAKKMNHNASERDRRKKINALFSSLRSLLPPSDCSKKLSIPATVSHALKYIPELVEQIKK  114

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L +KK+EL  R+ S Q+      + +  ++          S ++  ++ E + V+QI S 
Sbjct  115  LLQKKEELMVRL-SGQRDLLCENDKDDEKKSEPTKATGFGSIVTVARINETEAVVQISSL  173

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLLS  833
            K  +  F + L  LE++G V++D+S+  +  DR+ F+T+H Q +    +    L++KLLS
Sbjct  174  KAHKCSFPNVLRGLEEDGFVIIDASSSLSRGDRL-FYTVHFQAEAHHKLSCGDLRDKLLS  232

Query  834  YF  839
              
Sbjct  233  LI  234



>gb|KEH41330.1| transcription factor ORG2-like protein [Medicago truncatula]
Length=271

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 105/162 (65%), Gaps = 6/162 (4%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            MVKKL HNASERDRRKK+N L+SSLRSLLP SDQ  ++SIP T+SRV+KYIPE+QK +E 
Sbjct  55   MVKKLVHNASERDRRKKINNLYSSLRSLLPISDQMKKLSIPATISRVLKYIPEIQKHVEG  114

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L K+K+E+  R++          E  K++     H +N    +S + + + ++ IQI   
Sbjct  115  LVKRKEEILLRLSPQVNEVNITKESQKKK-----HSYNSGFVVSTSWLNDSEVAIQISCY  169

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQ  779
               +   ++ L CLE +G++LL+ S+ QT  +R+ F+ LH Q
Sbjct  170  TVHKIPLSEILLCLENDGILLLNVSSSQTFGERI-FYNLHFQ  210



>ref|XP_002267985.1| PREDICTED: transcription factor ORG2-like [Vitis vinifera]
Length=244

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 101/254 (40%), Positives = 154/254 (61%), Gaps = 32/254 (13%)
 Frame = +3

Query  42   FSPMSFPNMGWSIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERCDS  221
            FSP  FP +GW ++D ISH Q     Y     +TS       F+ LPSS   P +E   S
Sbjct  4    FSPPLFPTLGWPLEDPISHAQN----YIYGETETSES-----FLHLPSSQ--PQVELNCS  52

Query  222  LKFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKA  401
              +   S +               MVKKL+HN S RDRRKK+N L+SSLRSLLP++DQ  
Sbjct  53   TPYAAVSGNPT-------------MVKKLNHNVSVRDRRKKINSLYSSLRSLLPSADQVK  99

Query  402  RMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHH  581
            ++SIP+TVS V+KYIPELQ+++ERL +KK+E  S+++    +       N+R   +G   
Sbjct  100  KLSIPSTVSCVLKYIPELQRQVERLIQKKEEFLSKISREGDLIHLE---NQRNGTLG---  153

Query  582  HNRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNF  761
             +  S +SA ++ +R+IV+QI + K  ++  ++ L  LE++GL+++++S+F++   RV F
Sbjct  154  -SSLSAVSARRLSDREIVVQISTFKVHESPLSEVLLNLEEDGLLVINASSFESFGGRV-F  211

Query  762  HTLHLQVQGIEMME  803
            + LHLQV+G + ME
Sbjct  212  YNLHLQVEGTQGME  225



>ref|XP_010108530.1| Transcription factor ORG2 [Morus notabilis]
 gb|EXC19630.1| Transcription factor ORG2 [Morus notabilis]
Length=294

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 81/216 (38%), Positives = 130/216 (60%), Gaps = 31/216 (14%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQ--------------------------  395
            +VKKL+HNASERDRRKK+N L+SSLR+LLPASD                           
Sbjct  82   VVKKLNHNASERDRRKKINHLYSSLRALLPASDHTEEKDDLNRSVTIMATEEYLYISFYL  141

Query  396  KARMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKIS-KSPPEFNKRRRVMG  572
              +MSIP TVSRV+KYIPELQ+E+E L +K++ L S   S Q+ + +   E N + +   
Sbjct  142  NKKMSIPGTVSRVLKYIPELQQEVEGLIQKREALLSMTKSKQQENLQVHQEINYQTK---  198

Query  573  GHHHNRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDR  752
                   S +SA+Q+  +++++QI + K  ++  ++ L  LE++GL +L++S+F++ + R
Sbjct  199  STTRTPLSSVSASQLNNKEVLLQISAFKLNKDPLSEILHNLEEDGLSVLNASSFESFDGR  258

Query  753  VNFHTLHLQVQGIEMMEVDKLKEKLLSYFNEEQTCL  860
            + F+ LHLQV+G   +E   L  K +S +++++  L
Sbjct  259  I-FYNLHLQVEGPYNVECGTLGGKFVSLYDDKKELL  293



>gb|KEH41324.1| transcription factor ORG2-like protein [Medicago truncatula]
Length=240

 Score =   105 bits (263),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 118/190 (62%), Gaps = 17/190 (9%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            MVKKL HNASERDRRKK+N L+SSLRSLLP SDQ  ++SIP T+SRV+KYIPELQ ++E 
Sbjct  55   MVKKLVHNASERDRRKKINNLYSSLRSLLPVSDQ-MKLSIPGTISRVLKYIPELQNQVEG  113

Query  474  lqkkkqelTSRVNSWQKISKSPPEF-----NKRRRVMGGHHHNRQSYLSATQVGERDIVI  638
            L K+K E+         +S    EF     ++R++    H +N    +S + + + +I I
Sbjct  114  LIKRKDEI------LLGLSPQVEEFILSKESQRKK----HSYNSGFVVSTSWLNDSEITI  163

Query  639  QICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLK  818
            QI      +   ++ L CLE +GL+LL+ S+ QT   RV F+ LH QV     +E D L 
Sbjct  164  QISCYTVHKIPLSEILMCLENDGLLLLNLSSSQTFGGRV-FYNLHFQVDKTHRLESDILN  222

Query  819  EKLLSYFNEE  848
            EKLLS  ++E
Sbjct  223  EKLLSVMDKE  232



>ref|XP_010108529.1| Transcription factor ORG2 [Morus notabilis]
 gb|EXC19629.1| Transcription factor ORG2 [Morus notabilis]
Length=235

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 104/174 (60%), Gaps = 28/174 (16%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            ++KKLSHNASERDRRKK+NGL+S+LRSLLPA+DQ  + S P +VSR +KYIPEL+     
Sbjct  63   IIKKLSHNASERDRRKKINGLYSTLRSLLPAADQMKKQSYPASVSRTLKYIPELE-----  117

Query  474  lqkkkqelTSRVNSWQKISKSPPEF--NKRRRVMGGHHHNRQ--------SYLSATQVGE  623
                        N  Q + +   E   N  R+V   +H  ++        S +SA ++ +
Sbjct  118  ------------NQVQALIQKKEELLSNISRKVDLIYHERQKKSSAWRSLSAVSAARLND  165

Query  624  RDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQ  785
            R++V+QI + K  +   +  L  LE++G  LL++++ ++   RV F ++HLQV+
Sbjct  166  REVVLQISTFKDQETPLSHILLDLEEDGFSLLNATSHESFGGRV-FCSVHLQVE  218



>emb|CDY47396.1| BnaC04g24670D [Brassica napus]
Length=295

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 122/187 (65%), Gaps = 13/187 (7%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            + KKL+HNASER RRKK+N LFSSLRS LPASDQ  ++SIP TVSR +KYIPELQ+++++
Sbjct  113  VTKKLNHNASERVRRKKINSLFSSLRSCLPASDQ-TKLSIPQTVSRSLKYIPELQEQVKK  171

Query  474  lqkkkqelTSRVNSWQKISK-SPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICS  650
            L +KK EL  RV+  + I     P+     R +        S +SAT++G+ ++++QI S
Sbjct  172  LIQKKDELLVRVSGQKAIEHYVEPQPKAVARYV--------STISATKLGDNELMVQISS  223

Query  651  KKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIE--MMEVDKLKEK  824
             +      ++ LS LE++G VL+D S+ ++  +R+ F+TLHLQ+       +  ++L ++
Sbjct  224  SRNHNFSISNVLSGLEEDGFVLVDVSSSRSQGERL-FYTLHLQMGNKHNYKLTCEELSQR  282

Query  825  LLSYFNE  845
            +L  + E
Sbjct  283  MLYLYEE  289



>emb|CDX67670.1| BnaA07g17100D [Brassica napus]
Length=249

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 120/189 (63%), Gaps = 16/189 (8%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            M+KKL HNA+ER+RRKK+N LFS+LRS LPASDQ  ++SIP TV R VKYIPELQ++++R
Sbjct  65   MIKKLCHNANERNRRKKINSLFSTLRSCLPASDQLKKLSIPQTVLRTVKYIPELQEQVKR  124

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLS---ATQVGERDIVIQI  644
            L +KK++L  RV+  +             R +        SY+S   AT+ G+ ++++QI
Sbjct  125  LTQKKEDLMGRVSGQRDTD----------RYIKPQPQAVASYVSTVFATKHGDNEVMVQI  174

Query  645  CSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEV--DKLK  818
             S K  +    + L+ LE++G ++ D S+  +  +R+ F+TLHLQV   +  ++  ++L 
Sbjct  175  SSSKIHKFSIYNVLNGLEEDGFIVADVSSSSSRGERL-FYTLHLQVGKTDSYKLICEELS  233

Query  819  EKLLSYFNE  845
            +++L  + E
Sbjct  234  QRILYLYEE  242



>gb|KEH41326.1| transcription factor ORG2-like protein [Medicago truncatula]
Length=219

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 105/163 (64%), Gaps = 7/163 (4%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            MVKKL HNASERDRRKK+N L+SSLRSLLP  DQ  ++SIP T+SRV+KYIPELQ ++E 
Sbjct  63   MVKKLVHNASERDRRKKINNLYSSLRSLLPVFDQ-MKLSIPATISRVLKYIPELQNQVEG  121

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L K+K E+  R++   +      E  +++     H +N    +S +++ + +I IQI   
Sbjct  122  LIKRKDEILLRLSPQVEEFILSKESQRKK-----HSYNSGFVVSISRLNDSEITIQISCY  176

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQV  782
               +   ++ L CLE +GL+LL+ S+ +T   RV F+ LH QV
Sbjct  177  TVQKIPLSEILICLENDGLLLLNVSSSKTFGGRV-FYNLHFQV  218



>ref|XP_006294890.1| hypothetical protein CARUB_v10023940mg [Capsella rubella]
 gb|EOA27788.1| hypothetical protein CARUB_v10023940mg [Capsella rubella]
Length=242

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 65/168 (39%), Positives = 118/168 (70%), Gaps = 6/168 (4%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            +++KL+HNASERDRRKK+N +FSSLRS LP S+Q  ++S+  TVS+ +KYIPELQ+++++
Sbjct  60   VMRKLNHNASERDRRKKINSMFSSLRSRLPPSNQSKKLSVSATVSQALKYIPELQEQVKK  119

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L K K+EL+ +++  + +  +       + V      + +S +SAT++GE ++++QI S 
Sbjct  120  LIKMKEELSYQISGQRDLVHTEQNGKPEKGVT-----SYRSAVSATRLGETEVMVQISSL  174

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEM  797
            +     F + LS +E++GLV++D+S+ ++  +R+ F+TLHL++   ++
Sbjct  175  ETGNFSFGNVLSGVEEDGLVIVDASSSRSQGERL-FYTLHLRMDSCKL  221



>ref|XP_011000433.1| PREDICTED: transcription factor ORG2-like [Populus euphratica]
Length=264

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 101/264 (38%), Positives = 156/264 (59%), Gaps = 30/264 (11%)
 Frame = +3

Query  48   PMS-FPNMGWSIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERCDSL  224
            P+S F   GW +++ ISHEQ      S   G+T     P  F   P  P  P + + D  
Sbjct  7    PISLFSTFGWPLEETISHEQHC----SFRDGET-----PESFTHFP--PSQPDVRQLD--  53

Query  225  KFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKAR  404
                      +       S    MVKKL+HNASERDRRKK+N L+SSLRSLLPA+D++ +
Sbjct  54   --------RSTSFTAHSGSGDPSMVKKLNHNASERDRRKKINSLYSSLRSLLPAADRRKK  105

Query  405  MSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHH  584
            +SIP TVSRV++YIP+LQ+E+ERL + K+EL S      K+S+   +   +     G  +
Sbjct  106  LSIPCTVSRVIEYIPQLQQEVERLIQMKEELLS------KLSRQADDLTHQENQRKGTMY  159

Query  585  NRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFH  764
            +  S +SA+++ +R++ +QI + K  ++  ++ L  LE+ GL+L++SS F++   RV F+
Sbjct  160  SSLSSVSASRLSDREVAVQISTNKLPRSPLSEILVNLEEAGLLLINSSFFESLGGRV-FY  218

Query  765  TLHLQ-VQGIEMMEVDKLKEKLLS  833
             LHLQ ++G   +E + L E+L+S
Sbjct  219  NLHLQAMEGTYTVECEALNERLVS  242



>ref|XP_004493429.1| PREDICTED: transcription factor ORG3-like [Cicer arietinum]
Length=254

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 101/275 (37%), Positives = 152/275 (55%), Gaps = 33/275 (12%)
 Frame = +3

Query  33   LPFFSP-MSFPNMGWSIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAME  209
            + F SP +S+ NMGW +++     +  + L S+     S D   PH  S  S      +E
Sbjct  2    VAFCSPQLSYSNMGWLLEEV----EAESLLLSHKKNYVSLDYSLPHQFS--SQKQHVEIE  55

Query  210  RCDSLKFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPAS  389
            R                       +   +VKKL+HNASERDRRKK+N L SSLRSLLP  
Sbjct  56   RTSP------------------SPSPNLVVKKLNHNASERDRRKKINSLISSLRSLLPGE  97

Query  390  DQKARMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVM  569
            D   +MSIP T+SRV+KYIPELQK++E L K+K+EL SR      IS+   + NK  +  
Sbjct  98   DHTKKMSIPVTISRVLKYIPELQKQVEGLIKQKEELLSR------ISRQEYKVNKESQ-K  150

Query  570  GGHHHNRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSED  749
               ++N    +S +++ + ++ I I S +  +   ++ L CLE  GL LL+SS+ +T   
Sbjct  151  KIPNYNSSFVVSTSRLNDTELAIHISSYEAHKIPLSEILLCLEDNGLFLLNSSSSKTFGG  210

Query  750  RVNFHTLHLQVQGIEMMEVDKLKEKLLSYFNEEQT  854
            R+ F+ LH QV   +++E D L +KLLS + ++++
Sbjct  211  RL-FYNLHFQVTKTQILESDVLIQKLLSIYEKQRS  244



>ref|XP_010512914.1| PREDICTED: transcription factor bHLH100-like [Camelina sativa]
Length=242

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 125/182 (69%), Gaps = 7/182 (4%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            +++KL+HNASERDRRKK+N +FSSLRS LP ++Q  ++S+  TVS+ +KYIPELQ+++++
Sbjct  60   VMRKLNHNASERDRRKKINTMFSSLRSCLPPNNQSKQLSVSATVSQALKYIPELQEQVKK  119

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L KKK+EL+ +++  + +  +       + V      +  S +SAT++GE ++++QI S 
Sbjct  120  LIKKKEELSFQISGPRDLVYTEQNGKPEKGVT-----SYASTVSATRLGETEVMVQISSL  174

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLLS  833
            +     F + L+ +E++GLVL+D+S+ ++  +R+ F+TLHL +   + +  ++L ++LL 
Sbjct  175  QTCNCSFGNVLNGVEEDGLVLVDASSSRSQGERL-FYTLHLWMDNCK-LNSEELSDRLLY  232

Query  834  YF  839
             +
Sbjct  233  LY  234



>ref|XP_010673161.1| PREDICTED: transcription factor bHLH101-like [Beta vulgaris subsp. 
vulgaris]
Length=259

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 118/191 (62%), Gaps = 9/191 (5%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            + KKL+HNASERDRRKK+N ++SSLR+LLPA+ Q+ ++SIP TV  V++YIP+LQKE++ 
Sbjct  74   LAKKLNHNASERDRRKKINDMYSSLRALLPATHQRKKLSIPATVGWVLEYIPQLQKEVDD  133

Query  474  lqkkkqelTSRVNSWQKISKSPPEF--NKRRRVMGGHHHNRQSYLSATQVGERDIVIQIC  647
            L  KK+ + S ++       +P EF   K+ R            +SA ++G++++VIQI 
Sbjct  134  LNHKKEHILSTISVQ---DGNPMEFIQEKKPRRSTIKKTTSSCTISANRLGDKEMVIQIS  190

Query  648  SKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKL  827
            + +      ++ L  LE+ G V++D S FQ S     F+ +HL ++G   + ++KL   L
Sbjct  191  AFERIS--ISEVLLVLEKNGYVVIDVSCFQ-SFGGTTFYNIHLWMEGSYNVNLEKLNGVL  247

Query  828  LSYFNEE-QTC  857
            LS   ++ Q C
Sbjct  248  LSMLQKQMQIC  258



>ref|XP_009130803.1| PREDICTED: transcription factor bHLH101 isoform X2 [Brassica 
rapa]
Length=264

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 115/176 (65%), Gaps = 8/176 (5%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            KKL+HNASERDRR+K+N L++SLR+LLP SDQK ++SIP TV+ VVKYIPE ++EL+RL 
Sbjct  85   KKLNHNASERDRRRKLNALYASLRALLPPSDQKRKLSIPKTVAGVVKYIPEQKQELQRLY  144

Query  480  kkkqelTSRV-NSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKK  656
            ++K+EL  R+ N  + ++    +   R  +M     + Q  ++A  +   +I +QI + K
Sbjct  145  RRKEELMKRISNKIETLNHQQEQLRNRALMMESIDSSSQK-IAANWITNTEIAVQIATWK  203

Query  657  GTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQG---IEMMEVDKL  815
             T    +D L  LE+ GL ++  S+  +S  R+ F+TLHLQ++G   + + E+D +
Sbjct  204  WTS--ISDMLLRLEENGLNVISVSSSVSSTARI-FYTLHLQMRGDCRVRLEELDSM  256



>emb|CDX85121.1| BnaC07g07850D [Brassica napus]
Length=246

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 124/186 (67%), Gaps = 12/186 (6%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            ++KKL+HNA+ER+RRKK N LFS+LRS LP+SD+  ++SIP T+SR V+YIPELQ+E+++
Sbjct  70   VIKKLNHNANERNRRKKTNSLFSTLRSCLPSSDEPKKLSIPQTISRSVQYIPELQEEVKK  129

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L +KK+ L  R  S Q+   + PE     +V   +     S + AT++ + ++++QI S 
Sbjct  130  LIQKKEHLMLR-ESGQRERYAKPE----PKVAASYF----STVFATKLRDNEVMVQISSS  180

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEV--DKLKEKL  827
            K       + LS LE++GLVL+D S+  +  +++ F+TLHLQV  I+  ++  ++L +++
Sbjct  181  KIRNFSIYNVLSGLEKDGLVLVDVSSSSSRREQL-FYTLHLQVDKIDNYKLICEELSQRI  239

Query  828  LSYFNE  845
            L  + E
Sbjct  240  LYLYEE  245



>ref|XP_006398871.1| hypothetical protein EUTSA_v10014371mg [Eutrema salsugineum]
 dbj|BAJ34136.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ40324.1| hypothetical protein EUTSA_v10014371mg [Eutrema salsugineum]
Length=272

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 112/175 (64%), Gaps = 7/175 (4%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            KKL+HNASERDRR+K+N L+SSLR+LLP SDQK ++SIP TVS VVKYIPE ++EL+RL 
Sbjct  93   KKLNHNASERDRRRKLNALYSSLRALLPPSDQKRKLSIPMTVSGVVKYIPEQKQELQRLS  152

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKKG  659
            ++K+EL  R++          E    R  M     + Q++ +A  + + +I +QI + K 
Sbjct  153  RRKEELLKRISRKTATLNHQQEQLGNRAKMDSIDSSSQTF-AANWITDTEIAVQIATSKW  211

Query  660  TQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQG---IEMMEVDKL  815
                 +D L  LEQ GL ++  S+  +S  R+ F+TLHLQ++G   + + E+D +
Sbjct  212  AS--ISDMLLRLEQNGLDVISVSSSVSSTARI-FYTLHLQMRGDCKVRLEELDGM  263



>ref|XP_010507675.1| PREDICTED: transcription factor bHLH100-like [Camelina sativa]
 ref|XP_010507676.1| PREDICTED: transcription factor bHLH100-like [Camelina sativa]
Length=242

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 124/182 (68%), Gaps = 7/182 (4%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            +++KL+HNASERDRRKK+N +FSSLRS LP ++Q  ++S+  TVS+ +KYIPELQ+++++
Sbjct  60   VMRKLNHNASERDRRKKINTMFSSLRSCLPPNNQSKQLSVSATVSQALKYIPELQEQVKK  119

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L KKK+EL+ +++  + +  +       + V      +  S +SAT++GE ++++QI S 
Sbjct  120  LMKKKEELSFQISGPRDLVYTEQNGKPEKGVT-----SYASTVSATRLGETEVMVQISSL  174

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLLS  833
                  F + L+ +E++GLVL+D+S+ ++  +R+ F+TLHL +   + +  ++L ++LL 
Sbjct  175  HTCNCSFGNVLNGVEEDGLVLVDASSSRSQGERL-FYTLHLWMDNCK-LNSEELSDRLLY  232

Query  834  YF  839
             +
Sbjct  233  LY  234



>ref|XP_009774485.1| PREDICTED: transcription factor bHLH100-like isoform X3 [Nicotiana 
sylvestris]
Length=224

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 116/161 (72%), Gaps = 4/161 (2%)
 Frame = +3

Query  297  VKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerl  476
            VKKL+HNASERDRRKK N L SSLRSLLPA+D   ++S P TV+RV+KYIP+L+KE+  L
Sbjct  68   VKKLNHNASERDRRKKFNSLCSSLRSLLPATDHTKKISFPVTVARVIKYIPDLKKEVGGL  127

Query  477  qkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKK  656
             +KK++LT R    ++ S    +FN ++ ++ G   +  S +SA QVG R+++I I   K
Sbjct  128  TQKKEDLTLRSIPKKEYS---ADFNNKQTIIKGGIQSSLSVISANQVGNREVIIHISILK  184

Query  657  GTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQ  779
              ++ FA+A+S LE+EGL+LL++S+F+T  DRV F+ LH Q
Sbjct  185  TNKSSFAEAVSELEEEGLLLLNASSFETLGDRV-FYNLHFQ  224



>ref|NP_196035.1| transcription factor bHLH101 [Arabidopsis thaliana]
 sp|Q9FYE6.1|BH101_ARATH RecName: Full=Transcription factor bHLH101; AltName: Full=Basic 
helix-loop-helix protein 101; Short=AtbHLH101; Short=bHLH 
101; AltName: Full=Transcription factor EN 10; AltName: Full=bHLH 
transcription factor bHLH101 [Arabidopsis thaliana]
 emb|CAC05497.1| myc-like protein [Arabidopsis thaliana]
 emb|CAD58594.1| putative bHLH transcription factor [Arabidopsis thaliana]
 gb|ABE66128.1| basic helix-loop-helix family protein [Arabidopsis thaliana]
 gb|AED90705.1| transcription factor bHLH101 [Arabidopsis thaliana]
Length=240

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 110/163 (67%), Gaps = 8/163 (5%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            KKL+HNASERDRR+K+N L+SSLR+LLP SDQK ++SIP TV+RVVKYIPE ++EL+RL 
Sbjct  66   KKLNHNASERDRRRKLNALYSSLRALLPLSDQKRKLSIPMTVARVVKYIPEQKQELQRLS  125

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKKG  659
            ++K+EL  R++      K+  E  + + +M     +    ++A  + + +I +QI + K 
Sbjct  126  RRKEELLKRIS-----RKTHQEQLRNKAMMDSIDSSSSQRIAANWLTDTEIAVQIATSKW  180

Query  660  TQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQG  788
            T    +D L  LE+ GL ++  S+  +S  R+ F+TLHLQ++G
Sbjct  181  TS--VSDMLLRLEENGLNVISVSSSVSSTARI-FYTLHLQMRG  220



>gb|ABK28679.1| unknown [Arabidopsis thaliana]
Length=241

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 110/163 (67%), Gaps = 8/163 (5%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            KKL+HNASERDRR+K+N L+SSLR+LLP SDQK ++SIP TV+RVVKYIPE ++EL+RL 
Sbjct  66   KKLNHNASERDRRRKLNALYSSLRALLPLSDQKRKLSIPMTVARVVKYIPEQKQELQRLS  125

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKKG  659
            ++K+EL  R++      K+  E  + + +M     +    ++A  + + +I +QI + K 
Sbjct  126  RRKEELLKRIS-----RKTHQEQLRNKAMMDSIDSSSSQRIAANWLTDTEIAVQIATSKW  180

Query  660  TQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQG  788
            T    +D L  LE+ GL ++  S+  +S  R+ F+TLHLQ++G
Sbjct  181  TS--VSDMLLRLEENGLNVISVSSSVSSTARI-FYTLHLQMRG  220



>ref|XP_010673162.1| PREDICTED: transcription factor bHLH101-like [Beta vulgaris subsp. 
vulgaris]
Length=267

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 115/178 (65%), Gaps = 8/178 (4%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            + KKL+HNASERDRRKK+N ++ SLR+LLP++DQ+ ++SIP TV RV++YIP+LQKE++ 
Sbjct  77   LAKKLNHNASERDRRKKINDMYMSLRALLPSNDQRKKLSIPATVGRVLEYIPKLQKEVDD  136

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQS--YLSATQVGERDIVIQIC  647
            L  KK  L+S++++   +  +  EF +  +        + S   +SA ++G++++VIQ+ 
Sbjct  137  LTHKKDVLSSKLSA---LEGNIGEFIQDEKPKNSIIKEKISSCTISANKLGDKELVIQVS  193

Query  648  SKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKE  821
            + +      ++ L  LE+ G V++D S FQ S     F+ LHL + G   + ++K+ E
Sbjct  194  AFEKVS--ISEVLLLLEKNGYVVIDISCFQ-SFGGTTFYNLHLWMNGNYNVNLEKMNE  248



>ref|XP_002873137.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49396.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=242

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 110/165 (67%), Gaps = 8/165 (5%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            + KKL+HNASERDRR+K+N L+SSLR LLP SDQK ++SIP TV+RVVKYIPE ++EL+R
Sbjct  67   LEKKLNHNASERDRRRKLNALYSSLRDLLPLSDQKRKLSIPMTVARVVKYIPEQKQELQR  126

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L ++K+EL  R++      K+  E  + + +M     +    ++A  + + +I +QI + 
Sbjct  127  LSRRKEELLKRIS-----RKTHQEQLRNKAMMDSIDSSSSQRIAANWLTDTEIAVQIATS  181

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQG  788
            K T    +D L  LE+ GL ++  S+  +S  R+ F+TLHLQ++G
Sbjct  182  KWTS--VSDMLLRLEENGLNVISVSSSVSSTARI-FYTLHLQMRG  223



>ref|XP_010412993.1| PREDICTED: transcription factor bHLH100-like [Camelina sativa]
Length=248

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 123/182 (68%), Gaps = 7/182 (4%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            +++KL+HNASERDRRKK+N +FSSLRS LP ++Q  ++S+  TVS+ +KYIPELQ+++++
Sbjct  61   VMRKLNHNASERDRRKKINTMFSSLRSCLPPNNQSKQLSVSATVSQALKYIPELQEQVKK  120

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L KKK+EL+ +++  + +  +       + V         S +SAT++GE ++++QI S 
Sbjct  121  LIKKKEELSFQISGPRDLVYTEKNGKPEKGVTS-----YASTVSATRLGETEVMVQISSL  175

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLLS  833
            +     F + L+ +E+ GLVL+D+S+ ++  +R+ F+TLHL +   + +  +++ ++LL 
Sbjct  176  QTCNCSFVNVLNGVEEYGLVLVDASSSRSQGERL-FYTLHLWMDNCK-LNSEEISDRLLY  233

Query  834  YF  839
             +
Sbjct  234  LY  235



>ref|XP_009774484.1| PREDICTED: transcription factor bHLH100-like isoform X2 [Nicotiana 
sylvestris]
Length=245

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 116/162 (72%), Gaps = 4/162 (2%)
 Frame = +3

Query  297  VKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerl  476
            VKKL+HNASERDRRKK N L SSLRSLLPA+D   ++S P TV+RV+KYIP+L+KE+  L
Sbjct  68   VKKLNHNASERDRRKKFNSLCSSLRSLLPATDHTKKISFPVTVARVIKYIPDLKKEVGGL  127

Query  477  qkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKK  656
             +KK++LT R    ++ S    +FN ++ ++ G   +  S +SA QVG R+++I I   K
Sbjct  128  TQKKEDLTLRSIPKKEYS---ADFNNKQTIIKGGIQSSLSVISANQVGNREVIIHISILK  184

Query  657  GTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQV  782
              ++ FA+A+S LE+EGL+LL++S+F+T  DRV F+ LH Q 
Sbjct  185  TNKSSFAEAVSELEEEGLLLLNASSFETLGDRV-FYNLHFQA  225



>ref|XP_009339564.1| PREDICTED: transcription factor ORG2-like isoform X2 [Pyrus x 
bretschneideri]
Length=252

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 104/271 (38%), Positives = 154/271 (57%), Gaps = 25/271 (9%)
 Frame = +3

Query  42   FSPMSFPNMGWSID-DYISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERCD  218
             SP  F  +GW ID D  SH+ +   +      D + ++   H   LPS      ++R  
Sbjct  4    LSPPMFSTIGWPIDQDLTSHDYYKDHI--TTTNDQTAESSSLHI--LPSGHPQSELDRS-  58

Query  219  SLKFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQK  398
                        S    G  S+ + + KKL+HNASERDRRKK+N L+SSLRSLLPA DQ 
Sbjct  59   ----------TPSTTISGEYSSVSPVAKKLNHNASERDRRKKINSLYSSLRSLLPA-DQP  107

Query  399  ARMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGH  578
             ++SIP TVSRVVKYIPELQK++E L +K++EL SR      I+K      + +  +   
Sbjct  108  KKLSIPNTVSRVVKYIPELQKQVEGLIRKREELLSR------ITKQESALREEKNQIKSA  161

Query  579  HHNRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLV-LLDSSTFQTSEDRV  755
              +  S +SA Q+ ++++ IQI S K   NL +D L  LE+E  + +L++S+F++S  RV
Sbjct  162  ARSSLSAVSAYQLNDKEVAIQISSLKTKNNLLSDILLNLEEEEGLQILNASSFESSGGRV  221

Query  756  NFHTLHLQVQGIEMMEVDKLKEKLLSYFNEE  848
             F+ L  QV+    +E + L +KL+S+  +E
Sbjct  222  -FYNLQFQVERTYRLEYESLSDKLMSFSGQE  251



>emb|CDX80905.1| BnaC03g01590D [Brassica napus]
Length=389

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 113/173 (65%), Gaps = 6/173 (3%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            KKL+HNASERDRR+K+N L++SLR+LLP SDQK ++SIP T++ VVKYIPE ++EL+RL 
Sbjct  81   KKLNHNASERDRRRKLNALYASLRALLPPSDQKRKLSIPKTIAGVVKYIPEQKQELQRLS  140

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKKG  659
            ++K+EL  R+++  +      E  + R +M     +    ++A  + + +I +QI + K 
Sbjct  141  RRKEELMKRISNKTETLNHQQEQLRNRALMMESIDSSSQKIAANWITDTEIAVQIATWKW  200

Query  660  TQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQG---IEMMEVD  809
            T    +D L  LE+ GL  +  S+  +S  R+ F+TLHLQ++G   + + E+D
Sbjct  201  TS--ISDILLRLEENGLNAISVSSSVSSTARI-FYTLHLQMRGGCRVRLEELD  250



>ref|XP_009116401.1| PREDICTED: transcription factor ORG3-like [Brassica rapa]
Length=249

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 92/265 (35%), Positives = 147/265 (55%), Gaps = 36/265 (14%)
 Frame = +3

Query  57   FPNMGW-SIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVS-LPSSPLPPAMERCDSLKF  230
            FPN  W S+ +Y S+   G   +SN   DT  D P P  V   PS  +    ER  +   
Sbjct  9    FPNCQWGSMVEYESYNVVGDKYHSN---DTFLDFPVPKTVHHQPSLGVSVPSERNGT---  62

Query  231  dggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMS  410
                               + M+KKL+HNA+ER+RRKK+N LFSSL S LP S++  ++S
Sbjct  63   ----------------DNDSVMIKKLNHNANERNRRKKINYLFSSLSSCLPGSNETKKLS  106

Query  411  IPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNR  590
            IP TVSR V+YIPELQ+++++L++KK++L  RV   ++    P     + +V+       
Sbjct  107  IPQTVSRSVQYIPELQEQVKKLKQKKEDLLVRVLGQRERHVKP-----QPKVVASD----  157

Query  591  QSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTL  770
             S + AT + + ++++QI S K         LS LE++G VL+D S+  +  +R+ F+TL
Sbjct  158  VSTVFATMLRDNEVMVQISSSKIHNFSIYHVLSGLEEDGFVLVDVSSSSSRGERL-FYTL  216

Query  771  HLQVQGIEMMEV--DKLKEKLLSYF  839
            HLQV  I+  ++  ++L +++L  +
Sbjct  217  HLQVDKIDHYKLICEELSQRVLYLY  241



>ref|NP_181657.1| transcription factor bHLH100 [Arabidopsis thaliana]
 sp|Q9ZVB5.1|BH100_ARATH RecName: Full=Transcription factor bHLH100; AltName: Full=Basic 
helix-loop-helix protein 100; Short=AtbHLH100; Short=bHLH 
100; AltName: Full=Transcription factor EN 7; AltName: Full=bHLH 
transcription factor bHLH100 [Arabidopsis thaliana]
 gb|AAC78547.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAL69451.1| At2g41240/F13H10.21 [Arabidopsis thaliana]
 dbj|BAH30423.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC09951.1| transcription factor bHLH100 [Arabidopsis thaliana]
Length=242

 Score = 97.1 bits (240),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 81/264 (31%), Positives = 144/264 (55%), Gaps = 35/264 (13%)
 Frame = +3

Query  48   PMSFPNMGWSIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERCDSLK  227
            P  +PN GW   D   H  + TD  SN             F+  P   L    E   S  
Sbjct  6    PPLYPNFGWPCGD---HSFYETDDVSNT------------FLDFPLPDLTVTHENVSS--  48

Query  228  FdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARM  407
                                  ++KKL+HNASER+RRKK+N +FSSLRS LP ++Q  ++
Sbjct  49   -----------ENNRTLLDNPVVMKKLNHNASERERRKKINTMFSSLRSCLPPTNQTKKL  97

Query  408  SIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHN  587
            S+  TVS+ +KYIPELQ+++++L KKK+EL+ +++  + +  +         V      +
Sbjct  98   SVSATVSQALKYIPELQEQVKKLMKKKEELSFQISGQRDLVYTDQNSKSEEGVT-----S  152

Query  588  RQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHT  767
              S +S+T++ E ++++QI S +  +  F + LS +E++GLVL+ +S+ ++  +R+ F++
Sbjct  153  YASTVSSTRLSETEVMVQISSLQTEKCSFGNVLSGVEEDGLVLVGASSSRSHGERL-FYS  211

Query  768  LHLQVQGIEMMEVDKLKEKLLSYF  839
            +HLQ++  + +  ++L ++LL  +
Sbjct  212  MHLQIKNGQ-VNSEELGDRLLYLY  234



>emb|CDX67671.1| BnaA07g17110D [Brassica napus]
Length=249

 Score = 97.1 bits (240),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 91/280 (33%), Positives = 143/280 (51%), Gaps = 52/280 (19%)
 Frame = +3

Query  42   FSPMSFPNMGWSIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERCDS  221
              P+ FP  GW+             L  N A  ++ D    H      SP+P        
Sbjct  4    LGPVLFPKFGWA-------------LTGNCASYSTNDGTSFH-----DSPVPKTY----G  41

Query  222  LKFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKA  401
            +     S  + +   G G    + M+KKLSHNA+ER+RRKKMN LFS+LRS LPASDQ  
Sbjct  42   VAHHQTSLGVSASSEGNGIDNNSVMIKKLSHNANERNRRKKMNSLFSTLRSCLPASDQLN  101

Query  402  RMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKR---RRVMG  572
            ++SIP TV R VKYIP+LQ+++                 +K+++   +   R   +R M 
Sbjct  102  KLSIPQTVLRTVKYIPDLQEQV-----------------KKLTQKKEDLLVRALGQRDME  144

Query  573  GHHHNR----QSYLS---ATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSST  731
             +   R     SY+S   AT+ G+ ++++QI S K  +    + LS LE++  V++D S+
Sbjct  145  SYVKQRPQAVASYVSTVFATKNGDNEVMVQISSSKIHKFSIYNVLSGLEEDRFVVVDVSS  204

Query  732  FQTSEDRVNFHTLHLQVQGIEMMEV--DKLKEKLLSYFNE  845
              +  +R+ F+TLHLQV   +  ++  ++L +K+L  + E
Sbjct  205  SSSRGERL-FYTLHLQVGKTDSNKIICEELSQKILYLYEE  243



>emb|CDX77489.1| BnaA07g06270D [Brassica napus]
Length=246

 Score = 96.7 bits (239),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 122/186 (66%), Gaps = 12/186 (6%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            ++KKL+HNA+ER+RRKK N LFSSLRS LP+SD+  ++SIP T+SR V+YIPELQ+E+++
Sbjct  70   VIKKLNHNANERNRRKKTNSLFSSLRSCLPSSDEPKKLSIPQTISRSVQYIPELQEEVKK  129

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L +KK++L  R  S Q+   + PE     +V   +     S + AT++ + +++IQI S 
Sbjct  130  LIQKKEDLLLR-ESGQRERYAKPE----PKVAASYF----STVFATKLRDNEVMIQISSS  180

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEV--DKLKEKL  827
                    + LS LE++G VL+D S+  +  +++ F TLHLQV  I+  ++  ++L +++
Sbjct  181  NIRNFSIYNVLSGLEKDGFVLVDVSSSSSRREQL-FCTLHLQVDKIDNYKLICEELSQRI  239

Query  828  LSYFNE  845
            L  + E
Sbjct  240  LYLYEE  245



>ref|XP_006288475.1| hypothetical protein CARUB_v10001734mg [Capsella rubella]
 gb|EOA21373.1| hypothetical protein CARUB_v10001734mg [Capsella rubella]
Length=264

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 105/163 (64%), Gaps = 8/163 (5%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            KKL+HNASERDRR+K+N L+SSLR+LLP +DQK ++SIP TV+RVVKYIPE ++EL+RL 
Sbjct  90   KKLNHNASERDRRRKLNALYSSLRALLPPADQKRKLSIPMTVARVVKYIPEQKQELQRLS  149

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKKG  659
            ++K EL  R++      K+  E  + +  M     +    + A  + + +I +QI + K 
Sbjct  150  RRKVELLKRIS-----RKTHQEQLRNKATMESIDSSSSQPIVANWLTDTEIAVQIATSKW  204

Query  660  TQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQG  788
            T    +D L  LE+ GL ++  S+  +S  R+ F TLHLQ+ G
Sbjct  205  TS--VSDMLLRLEENGLHVISVSSSVSSTARI-FSTLHLQMIG  244



>ref|XP_008674508.1| PREDICTED: transcription factor bHLH100-like isoform X2 [Zea 
mays]
Length=224

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 96/164 (59%), Gaps = 18/164 (11%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            +KLSHNA ERDRRK++N L+SSLRSLLP +D   ++SIPTTVSRV+KYIPELQK      
Sbjct  75   RKLSHNAYERDRRKQLNDLYSSLRSLLPDADHTKKLSIPTTVSRVLKYIPELQK------  128

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQI---CS  650
                    +V++ ++  +     N +  V+          +SAT + + +I++Q+    +
Sbjct  129  --------QVDNLERRKRELTNANCKPGVLNTSEIVTTPIVSATCLNDTEIMVQVSLHSN  180

Query  651  KKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQV  782
               T    +  +  LE  GL L+ SST+ T  ++  F++LHLQV
Sbjct  181  VAATALPLSKCIKVLEDAGLHLISSSTYSTFGNKT-FYSLHLQV  223



>ref|XP_009779323.1| PREDICTED: uncharacterized protein LOC104228545 [Nicotiana sylvestris]
Length=730

 Score =   100 bits (249),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/194 (36%), Positives = 115/194 (59%), Gaps = 27/194 (14%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLL-PASDQKARMSIPTTVSRVVKYIPelqkele  470
            M KKLSHNASER+RRKKMN L+S+LRSL+ PA+ +K ++S P TVS V +YIP       
Sbjct  69   MAKKLSHNASERNRRKKMNFLYSTLRSLIPPANLKKKKLSFPATVSYVQQYIP-------  121

Query  471  rlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQ-----VGERDIV  635
                + ++   R++  + +  S    NK   ++  ++ N+++  S+       +    ++
Sbjct  122  ----ELKKEIERLSQTKDLLLS----NKAGSLVQSNNINQRNTTSSASISASPLCNGQVL  173

Query  636  IQICSKKGTQNLF--ADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVD  809
            +QI +   TQ  F  +     LE++G++LL++++F++S +++ FH LH Q+QG   ME+ 
Sbjct  174  VQIST---TQTSFPISQVFQTLEEDGILLLNATSFKSSGEKI-FHNLHFQMQGTVGMEIQ  229

Query  810  KLKEKLLSYFNEEQ  851
             LK KLL  + E Q
Sbjct  230  SLKTKLLVMYEENQ  243



>tpg|DAA55783.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB05496.1| bHLH transcription factor, partial [Zea mays]
Length=240

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 95/164 (58%), Gaps = 18/164 (11%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            +KLSHNA ERDRRK++N L+SSLRSLLP +D   ++SIPTTVSRV+KYIPELQ       
Sbjct  75   RKLSHNAYERDRRKQLNDLYSSLRSLLPDADHTKKLSIPTTVSRVLKYIPELQ-------  127

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQI---CS  650
                    +V++ ++  +     N +  V+          +SAT + + +I++Q+    +
Sbjct  128  -------KQVDNLERRKRELTNANCKPGVLNTSEIVTTPIVSATCLNDTEIMVQVSLHSN  180

Query  651  KKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQV  782
               T    +  +  LE  GL L+ SST+ T  ++  F++LHLQV
Sbjct  181  VAATALPLSKCIKVLEDAGLHLISSSTYSTFGNK-TFYSLHLQV  223



>emb|CDY06148.1| BnaA09g36320D [Brassica napus]
Length=249

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 91/265 (34%), Positives = 146/265 (55%), Gaps = 36/265 (14%)
 Frame = +3

Query  57   FPNMGW-SIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVS-LPSSPLPPAMERCDSLKF  230
            FPN  W S+ +Y S+   G   +SN   DT  D P P  V   PS  +    ER  +   
Sbjct  9    FPNCQWGSMVEYESYNVVGDKYHSN---DTFLDFPVPKTVHHQPSLGVSVPSERNGT---  62

Query  231  dggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMS  410
                               + M+KKL+HNA+ER+RRKK+N LFSSL S LP S++  ++S
Sbjct  63   ----------------DNDSVMIKKLNHNANERNRRKKINYLFSSLSSCLPGSNETKKLS  106

Query  411  IPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNR  590
            IP TVSR V+YIPELQ+++++L++KK++L  RV   ++    P     + +V+       
Sbjct  107  IPQTVSRSVQYIPELQEQVKKLKQKKEDLLVRVLGQRERHVKP-----QPKVVASD----  157

Query  591  QSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTL  770
             S +  T + + ++++QI S K         LS LE++G VL+D S+  +  +R+ F+TL
Sbjct  158  VSTVFTTMLRDNEVMVQISSSKIHNFSIYHVLSGLEEDGFVLVDVSSSSSRGERL-FYTL  216

Query  771  HLQVQGIEMMEV--DKLKEKLLSYF  839
            HLQV  I+  ++  ++L +++L  +
Sbjct  217  HLQVDKIDHYKLICEELSQRVLYLY  241



>ref|XP_009130802.1| PREDICTED: transcription factor bHLH101 isoform X1 [Brassica 
rapa]
Length=268

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 116/180 (64%), Gaps = 12/180 (7%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKA----RMSIPTTVSRVVKYIPelqkel  467
            KKL+HNASERDRR+K+N L++SLR+LLP SDQK+    ++SIP TV+ VVKYIPE ++EL
Sbjct  85   KKLNHNASERDRRRKLNALYASLRALLPPSDQKSANQRKLSIPKTVAGVVKYIPEQKQEL  144

Query  468  erlqkkkqelTSRV-NSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQI  644
            +RL ++K+EL  R+ N  + ++    +   R  +M     + Q  ++A  +   +I +QI
Sbjct  145  QRLYRRKEELMKRISNKIETLNHQQEQLRNRALMMESIDSSSQK-IAANWITNTEIAVQI  203

Query  645  CSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQG---IEMMEVDKL  815
             + K T    +D L  LE+ GL ++  S+  +S  R+ F+TLHLQ++G   + + E+D +
Sbjct  204  ATWKWTS--ISDMLLRLEENGLNVISVSSSVSSTARI-FYTLHLQMRGDCRVRLEELDSM  260



>ref|XP_008656862.1| PREDICTED: transcription factor ORG3-like [Zea mays]
Length=229

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/165 (39%), Positives = 95/165 (58%), Gaps = 18/165 (11%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            +KLSHNA ER RRK++N L+SSLRSLLP +DQ  ++SIPTTVSRV+KYIPELQ       
Sbjct  73   RKLSHNAYERGRRKQLNELYSSLRSLLPDADQTKKLSIPTTVSRVLKYIPELQ-------  125

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQI---CS  650
                    +V++ ++  K     N +  V+          +SAT + + +I++Q+     
Sbjct  126  -------KQVDNLERRKKELTNANCKPGVLKT-TKAVTPIVSATCLNDTEIMVQVSLHSD  177

Query  651  KKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQ  785
               T    +  +  LE EGL L+ SST+ ++ +   F++LHLQV 
Sbjct  178  VAATALPLSKCIKVLENEGLHLVSSSTYSSAFENKTFYSLHLQVH  222



>ref|XP_009102593.1| PREDICTED: transcription factor ORG3-like [Brassica rapa]
Length=246

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 121/186 (65%), Gaps = 12/186 (6%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            ++KKL+HNA+ER RRKK N LFSSLRS LP+SD+  ++SIP T+SR V+YIPELQ+E+++
Sbjct  70   VIKKLNHNANERSRRKKTNSLFSSLRSCLPSSDEPKKLSIPQTISRSVQYIPELQEEVKK  129

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L +KK++L  R  S Q+   + PE     +V   +     S + AT++ + +++IQI S 
Sbjct  130  LIQKKEDLLLR-ESGQRERYAKPE----PKVAASYF----STVFATKLRDNEVMIQISSS  180

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEV--DKLKEKL  827
                    + LS LE++G VL+D S+  +  +++ F TLHLQV  I+  ++  ++L +++
Sbjct  181  NIRNFSIYNVLSGLEKDGFVLVDVSSSSSRREQL-FCTLHLQVDKIDNYKLICEELSQRI  239

Query  828  LSYFNE  845
            L  + E
Sbjct  240  LYLYEE  245



>ref|XP_009104034.1| PREDICTED: transcription factor ORG3-like [Brassica rapa]
Length=249

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 120/189 (63%), Gaps = 16/189 (8%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            M+KKL HNA+ER+RRKK+N LFS+LRS LPASDQ  ++SIP TV R VKYIPELQ+++++
Sbjct  65   MIKKLCHNANERNRRKKINSLFSTLRSCLPASDQLKKLSIPQTVLRTVKYIPELQEQVKK  124

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLS---ATQVGERDIVIQI  644
            L +KK++L  RV+  +             R +        SY+S   AT+ G+ ++++QI
Sbjct  125  LTQKKEDLMGRVSGQRDTD----------RYIKPQPQAVASYVSTVFATKHGDNEVMVQI  174

Query  645  CSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEV--DKLK  818
             S K  +    + L+ LE++G V++D S+  +  +R+ F+TLH QV   +  ++  ++L 
Sbjct  175  SSSKIHKFSIYNVLNGLEEDGFVVVDVSSSSSRGERL-FYTLHFQVGKTDSYKLICEELS  233

Query  819  EKLLSYFNE  845
            +++L  + E
Sbjct  234  QRILYLYEE  242



>gb|AFW83935.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=247

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 96/166 (58%), Gaps = 18/166 (11%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            +KLSHNA ER RRK++N L+SSLRSLLP +DQ  ++SIPTTVSRV+KYIPELQK      
Sbjct  72   RKLSHNAYERGRRKQLNELYSSLRSLLPDADQTKKLSIPTTVSRVLKYIPELQK------  125

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQI---CS  650
                    +V++ ++  K     N +  V+          +SAT + + +I++Q+     
Sbjct  126  --------QVDNLERRKKELTNANCKPGVLKTTKA-VTPIVSATCLNDTEIMVQVSLHSD  176

Query  651  KKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQG  788
               T    +  +  LE EGL L+ SST+ ++ +   F++LHLQ Q 
Sbjct  177  VAATALPLSKCIKVLENEGLHLVSSSTYSSAFENKTFYSLHLQFQA  222



>ref|XP_004971295.1| PREDICTED: transcription factor ORG3-like isoform X1 [Setaria 
italica]
Length=242

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 98/171 (57%), Gaps = 19/171 (11%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            +KLSHNA ERDRRK++N L+SSLRSLLP +D   ++SIPTTVSRV+KYIPELQ       
Sbjct  69   RKLSHNAYERDRRKQLNELYSSLRSLLPDADHTKKLSIPTTVSRVLKYIPELQ-------  121

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQI---CS  650
                    +V++ ++  K     N +  V+          +SAT + + +I++Q+    +
Sbjct  122  -------KQVDNLERRKKELTNANCKPGVLNASEI-ITPIVSATCLNDTEIMVQVSLQSN  173

Query  651  KKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMME  803
               T    +  +  LE EGL L+ SST+ T +++  F++LHLQ     M E
Sbjct  174  MAATTLPLSKCIKVLENEGLHLISSSTYSTLDNKT-FYSLHLQRSQRTMKE  223



>ref|XP_009339563.1| PREDICTED: transcription factor ORG2-like isoform X1 [Pyrus x 
bretschneideri]
Length=254

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 104/273 (38%), Positives = 155/273 (57%), Gaps = 27/273 (10%)
 Frame = +3

Query  42   FSPMSFPNMGWSID-DYISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERCD  218
             SP  F  +GW ID D  SH+ +   +      D + ++   H   LPS      ++R  
Sbjct  4    LSPPMFSTIGWPIDQDLTSHDYYKDHI--TTTNDQTAESSSLHI--LPSGHPQSELDRS-  58

Query  219  SLKFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQ-  395
                        S    G  S+ + + KKL+HNASERDRRKK+N L+SSLRSLLPA DQ 
Sbjct  59   ----------TPSTTISGEYSSVSPVAKKLNHNASERDRRKKINSLYSSLRSLLPA-DQP  107

Query  396  -KARMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMG  572
             + ++SIP TVSRVVKYIPELQK++E L +K++EL SR      I+K      + +  + 
Sbjct  108  LQKKLSIPNTVSRVVKYIPELQKQVEGLIRKREELLSR------ITKQESALREEKNQIK  161

Query  573  GHHHNRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLV-LLDSSTFQTSED  749
                +  S +SA Q+ ++++ IQI S K   NL +D L  LE+E  + +L++S+F++S  
Sbjct  162  SAARSSLSAVSAYQLNDKEVAIQISSLKTKNNLLSDILLNLEEEEGLQILNASSFESSGG  221

Query  750  RVNFHTLHLQVQGIEMMEVDKLKEKLLSYFNEE  848
            RV F+ L  QV+    +E + L +KL+S+  +E
Sbjct  222  RV-FYNLQFQVERTYRLEYESLSDKLMSFSGQE  253



>ref|XP_004170119.1| PREDICTED: transcription factor ORG2-like [Cucumis sativus]
Length=252

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 98/272 (36%), Positives = 146/272 (54%), Gaps = 31/272 (11%)
 Frame = +3

Query  36   PFFSPMSFPNMGWSIDDYISHEQFGTDLYSNAAGDTSPDAPPPH--FVSLPSSPLPPAME  209
            P FSP       W  +D IS       L+S       P  P  H  ++  P  PL P+  
Sbjct  7    PLFSPHQ-----WQFEDPISLHHQHNSLFS-------PFEPSDHSFYLQFPPPPLDPSHG  54

Query  210  RCDSLKFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPAS  389
              D            +     G S  + M KKLSHNASERDRRKK+N L+SSLR+LLP+S
Sbjct  55   EHDHYP-------SSAAPSPEGVSNVSKMAKKLSHNASERDRRKKINSLYSSLRALLPSS  107

Query  390  DQKARMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVM  569
            DQ  ++S P T+SR++ YIPELQ+++E   +KK+EL + +   Q++       N   + M
Sbjct  108  DQMKKLSNPATISRILSYIPELQQQVEEQMRKKEELMAAM-VGQEVK------NDEEKKM  160

Query  570  GGHHHNRQSYLSATQVGERDIVIQICS--KKGTQNLFADALSCLEQEGLVLLDSSTFQTS  743
                 +  S +SA+++   ++ IQI +    G +N  ++ L CLE+EGL+LL++S+F++ 
Sbjct  161  KSAVSSSSSIISASRLSRHEMAIQISTDINGGQRNYLSEILICLEEEGLLLLNASSFESF  220

Query  744  EDRVNFHTLHLQVQGIEMMEVDKLKEKLLSYF  839
            + ++ FH LHLQ+     ME   L   LL  F
Sbjct  221  DGKI-FHNLHLQMGSNCRMEPKMLSNMLLEMF  251



>ref|XP_008243129.1| PREDICTED: transcription factor ORG2-like [Prunus mume]
Length=242

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 102/267 (38%), Positives = 150/267 (56%), Gaps = 30/267 (11%)
 Frame = +3

Query  42   FSPMSFPNMGWSIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVS-LPSSPLPPAMERCD  218
             SP  F  + W  +D +SH+Q     Y N   D+S D     F+  LPS      ++R  
Sbjct  4    LSPPLFSTIAWPSEDLLSHDQN----YFN--RDSSIDQSAESFLHILPSHQPQVDLDRST  57

Query  219  SLKFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQK  398
            ++                  S  + M KKL+HNASERDRRKKMN L+SSLRSLLPA DQ 
Sbjct  58   TI--------------SRDYSGVSTMAKKLNHNASERDRRKKMNSLYSSLRSLLPA-DQG  102

Query  399  ARMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGH  578
             ++SIP T+S V+KYIPELQK++E L + ++EL SR    +       +     R     
Sbjct  103  KKLSIPNTISHVLKYIPELQKQVEGLIQNREELLSRACKQEAAMHEEKQIKSTAR-----  157

Query  579  HHNRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVN  758
              +  S +S  ++ +R + IQI + K   NL ++ L  LE+EGL +L++S+FQ+S  RV 
Sbjct  158  --SSLSAVSTYRLSDRAVAIQISTLKTHNNLLSEILLILEEEGLQVLNASSFQSSGGRV-  214

Query  759  FHTLHLQVQGIEMMEVDKLKEKLLSYF  839
            F+ +HLQV+  + +E + L EKL+S++
Sbjct  215  FYNIHLQVERADRLECENLSEKLMSFY  241



>emb|CDX72085.1| BnaC08g27890D [Brassica napus]
Length=251

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 118/184 (64%), Gaps = 12/184 (7%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            ++KKL+HNA+ER+RRKK+N LFSSLRS LP SD+  ++SIP TVSR V+YI EL+++  +
Sbjct  70   VMKKLNHNANERNRRKKINSLFSSLRSYLPDSDELKKLSIPKTVSRSVQYITELKEQANK  129

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L++KK +L  RV   QK     P+     +V+  +     S + AT++ + ++++QI S 
Sbjct  130  LRQKKDDLLVRV-LVQKERYVQPQ----PKVIASY----VSIVFATKLRDNEVMVQISSS  180

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEV--DKLKEKL  827
            K       + LS LE++G +++D S   +  +R+ F+TLHLQ+   +  ++  ++L +++
Sbjct  181  KIHNFSIYNVLSGLEEDGFLIVDVSFLSSQGERI-FYTLHLQLDKFDNYKLICEELSQRI  239

Query  828  LSYF  839
            L  +
Sbjct  240  LYLY  243



>tpg|DAA55782.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=248

 Score = 94.0 bits (232),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 94/163 (58%), Gaps = 18/163 (11%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            +KLSHNA ERDRRK++N L+SSLRSLLP +D   ++SIPTTVSRV+KYIPELQ       
Sbjct  75   RKLSHNAYERDRRKQLNDLYSSLRSLLPDADHTKKLSIPTTVSRVLKYIPELQ-------  127

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQI---CS  650
                    +V++ ++  +     N +  V+          +SAT + + +I++Q+    +
Sbjct  128  -------KQVDNLERRKRELTNANCKPGVLNTSEIVTTPIVSATCLNDTEIMVQVSLHSN  180

Query  651  KKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQ  779
               T    +  +  LE  GL L+ SST+ T  ++  F++LHLQ
Sbjct  181  VAATALPLSKCIKVLEDAGLHLISSSTYSTFGNKT-FYSLHLQ  222



>ref|XP_008674507.1| PREDICTED: transcription factor bHLH100-like isoform X1 [Zea 
mays]
Length=250

 Score = 94.0 bits (232),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 94/163 (58%), Gaps = 18/163 (11%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            +KLSHNA ERDRRK++N L+SSLRSLLP +D   ++SIPTTVSRV+KYIPELQ       
Sbjct  75   RKLSHNAYERDRRKQLNDLYSSLRSLLPDADHTKKLSIPTTVSRVLKYIPELQ-------  127

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQI---CS  650
                    +V++ ++  +     N +  V+          +SAT + + +I++Q+    +
Sbjct  128  -------KQVDNLERRKRELTNANCKPGVLNTSEIVTTPIVSATCLNDTEIMVQVSLHSN  180

Query  651  KKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQ  779
               T    +  +  LE  GL L+ SST+ T  ++  F++LHLQ
Sbjct  181  VAATALPLSKCIKVLEDAGLHLISSSTYSTFGNKT-FYSLHLQ  222



>emb|CDM84248.1| unnamed protein product [Triticum aestivum]
Length=225

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 91/165 (55%), Gaps = 25/165 (15%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            +K+SHNA ERDRRK++N  +SSLRSLLP  D   +MSIPTTVSRV+ YIPELQKE+    
Sbjct  65   RKMSHNAYERDRRKQLNEQYSSLRSLLPDDDHTKKMSIPTTVSRVINYIPELQKEV----  120

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQI--CSK  653
                          ++ K   E  +     G    N    +SAT + +R+I++Q+   S 
Sbjct  121  -------------DRLEKKKEELRRGSCEQGAMRQNTAPIVSATCLDDREIMVQVSLVST  167

Query  654  KGTQNLFADALSCLEQEGLVLLDSST--FQTSEDRVNFHTLHLQV  782
                   +  +  LE +GL L++SST  FQ       F++LHLQV
Sbjct  168  MAGALPMSKCIKVLENQGLRLINSSTSAFQNR----TFYSLHLQV  208



>ref|XP_007203256.1| hypothetical protein PRUPE_ppa019552mg, partial [Prunus persica]
 gb|EMJ04455.1| hypothetical protein PRUPE_ppa019552mg, partial [Prunus persica]
Length=231

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 119/177 (67%), Gaps = 3/177 (2%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            +VKKL+HNASERD RKK+N L+S+LRSLLPAS Q  ++S P  +SR VKYIPELQ++++ 
Sbjct  42   VVKKLNHNASERDDRKKINTLYSTLRSLLPASYQMKKLSNPAAISRAVKYIPELQQQVKG  101

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L +KK+EL SR+   Q+  +  P +N+++           S  + + + +R++V+QI S 
Sbjct  102  LIQKKEELLSRLRRLQQ--QGDPIYNEKQSRSAALSSLSASAFAVSWLNDREVVLQISSY  159

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEK  824
               ++  +  L  LE++GL+LL++S+F++ E R+ F +LH+QV+    ME + L EK
Sbjct  160  VVQKSPLSQILVDLEEDGLLLLNASSFESFEGRL-FCSLHIQVERTCRMECNILNEK  215



>ref|XP_003565088.1| PREDICTED: transcription factor bHLH100-like [Brachypodium distachyon]
Length=242

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 90/164 (55%), Gaps = 20/164 (12%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            +K+SHNA ERDRRK++N L+SSLRSLLP +D   ++SIP TVSRV+KYIPELQ       
Sbjct  64   RKMSHNAYERDRRKQLNELYSSLRSLLPDADHTKKLSIPITVSRVLKYIPELQ-------  116

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKKG  659
                     V+  ++  +     N +  V+     N    +SAT + ++DI++Q+    G
Sbjct  117  -------KEVDGLERKKEELTRANCKPGVIAMKDQNVAPVVSATCLDDKDIMVQVSLLSG  169

Query  660  TQNLFA----DALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQ  779
                 A      +  LE EGL L+ SST  ++     F+ LHLQ
Sbjct  170  MAAAAALPMSTCIKVLENEGLRLISSST--SAFGNRTFYNLHLQ  211



>emb|CDY71118.1| BnaUnng04210D [Brassica napus]
Length=248

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 106/170 (62%), Gaps = 18/170 (11%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            ++KKL HNA+ER+RRKK N LFS+LRS LP SD+  R+S P T+SR ++YIPEL++++++
Sbjct  69   VIKKLIHNANERNRRKKTNSLFSTLRSCLPGSDE--RLSNPQTISRSMQYIPELKEQVKK  126

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLS---ATQVGERDIVIQI  644
            L +       + N   +IS+      +R R +        SY+S   AT++ + ++++QI
Sbjct  127  LTQ------KKENLLLRISR------QRERYVMPQPKVVSSYVSTVFATELRDNEVMVQI  174

Query  645  CSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIE  794
             S K       + LS LE++G VL+D S+     +R+ F+TLHLQV  I+
Sbjct  175  SSSKNHNFSIYNVLSGLEEDGFVLVDVSSSNPRGERL-FYTLHLQVDKID  223



>gb|AES81269.2| transcription factor, putative [Medicago truncatula]
Length=260

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 122/187 (65%), Gaps = 6/187 (3%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            M KKL+HNASERDRRKK+N L SSLRSLLP  DQ  +MSIP T+SRV+KYIP+LQK+++ 
Sbjct  64   MAKKLNHNASERDRRKKINSLISSLRSLLPGEDQTKKMSIPVTISRVLKYIPDLQKQVQG  123

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L KKK+EL SR++  Q+ +      NK  +     ++N    +S +++ + ++VI I S 
Sbjct  124  LTKKKEELLSRISHRQEYA-----VNKESQRKKIPNYNSAFVVSTSRLNDTELVIHISSY  178

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLLS  833
            +  +   ++ L CLE  GL+LL+SS+ +T   R+ F+ LH QV   +  E D L +KL S
Sbjct  179  EANKIPLSEILMCLENNGLLLLNSSSSKTFGGRL-FYNLHFQVDKTQRYECDDLIQKLSS  237

Query  834  YFNEEQT  854
             + ++Q 
Sbjct  238  IYEKQQN  244



>ref|NP_850349.1| transcription factor bHLH100 [Arabidopsis thaliana]
 gb|AEC09952.1| transcription factor bHLH100 [Arabidopsis thaliana]
Length=241

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 81/264 (31%), Positives = 144/264 (55%), Gaps = 36/264 (14%)
 Frame = +3

Query  48   PMSFPNMGWSIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVSLPSSPLPPAMERCDSLK  227
            P  +PN GW   D   H  + TD  SN             F+  P   L    E   S  
Sbjct  6    PPLYPNFGWPCGD---HSFYETDDVSNT------------FLDFPLPDLTVTHENVSS--  48

Query  228  FdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARM  407
                                  ++KKL+HNASER+RRKK+N +FSSLRS LP ++Q  ++
Sbjct  49   -----------ENNRTLLDNPVVMKKLNHNASERERRKKINTMFSSLRSCLPPTNQ-TKL  96

Query  408  SIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHN  587
            S+  TVS+ +KYIPELQ+++++L KKK+EL+ +++  + +  +         V      +
Sbjct  97   SVSATVSQALKYIPELQEQVKKLMKKKEELSFQISGQRDLVYTDQNSKSEEGVT-----S  151

Query  588  RQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHT  767
              S +S+T++ E ++++QI S +  +  F + LS +E++GLVL+ +S+ ++  +R+ F++
Sbjct  152  YASTVSSTRLSETEVMVQISSLQTEKCSFGNVLSGVEEDGLVLVGASSSRSHGERL-FYS  210

Query  768  LHLQVQGIEMMEVDKLKEKLLSYF  839
            +HLQ++  + +  ++L ++LL  +
Sbjct  211  MHLQIKNGQ-VNSEELGDRLLYLY  233



>dbj|BAK02408.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=227

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 94/169 (56%), Gaps = 29/169 (17%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            +K+SHNA ERDRRK++N  +SSLRSLLP  D   +MSIPTTVSRV+KYIPELQ       
Sbjct  65   RKMSHNAYERDRRKQLNEQYSSLRSLLPDDDHNKKMSIPTTVSRVIKYIPELQ-------  117

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQS---YLSATQVGERDIVIQI--  644
                     V+  +K      E  +R     G    RQ+    +SAT + ER+I++Q+  
Sbjct  118  -------KEVDGLEK----KKEELRRASCEQGLLTMRQNTAPVVSATCLDEREIMVQVSL  166

Query  645  CSKKGTQNLFADALSCLEQEGLVLLDSST--FQTSEDRVNFHTLHLQVQ  785
             S        +  +  LE EGL L++SST  FQ       F++LHLQV+
Sbjct  167  VSTMAAALPMSKCIKVLENEGLRLINSSTSAFQNR----TFYSLHLQVR  211



>ref|XP_003625051.1| Transcription factor ORG2 [Medicago truncatula]
Length=247

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 122/186 (66%), Gaps = 6/186 (3%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            M KKL+HNASERDRRKK+N L SSLRSLLP  DQ  +MSIP T+SRV+KYIP+LQK+++ 
Sbjct  51   MAKKLNHNASERDRRKKINSLISSLRSLLPGEDQTKKMSIPVTISRVLKYIPDLQKQVQG  110

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L KKK+EL SR++  Q+ +      NK  +     ++N    +S +++ + ++VI I S 
Sbjct  111  LTKKKEELLSRISHRQEYA-----VNKESQRKKIPNYNSAFVVSTSRLNDTELVIHISSY  165

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLLS  833
            +  +   ++ L CLE  GL+LL+SS+ +T   R+ F+ LH QV   +  E D L +KL S
Sbjct  166  EANKIPLSEILMCLENNGLLLLNSSSSKTFGGRL-FYNLHFQVDKTQRYECDDLIQKLSS  224

Query  834  YFNEEQ  851
             + ++Q
Sbjct  225  IYEKQQ  230



>ref|XP_004144337.1| PREDICTED: transcription factor ORG2-like [Cucumis sativus]
Length=177

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 119/184 (65%), Gaps = 10/184 (5%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            M KKLSHNASERDRRKK+N L+SSLR+LLP+SDQ  ++S P T+SR++ YIPELQ+++E 
Sbjct  1    MAKKLSHNASERDRRKKINSLYSSLRALLPSSDQMKKLSNPATISRILSYIPELQQQVEE  60

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICS-  650
              +KK+EL + +   Q++       N   + M     +  S +SA+++   ++ IQI + 
Sbjct  61   QMRKKEELMAAM-VGQEVK------NDEEKKMKSAVSSSSSIISASRLSRHEMAIQISTD  113

Query  651  -KKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKL  827
               G +N  ++ L CLE+EGL+LL++S+F++ + ++ FH LHLQ+     ME   L   L
Sbjct  114  INGGQRNYLSEILICLEEEGLLLLNASSFESFDGKI-FHNLHLQMGSNCRMEPKMLSNML  172

Query  828  LSYF  839
            L  F
Sbjct  173  LEMF  176



>ref|XP_010423622.1| PREDICTED: transcription factor bHLH101-like [Camelina sativa]
 ref|XP_010452311.1| PREDICTED: transcription factor bHLH101-like [Camelina sativa]
Length=261

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 113/177 (64%), Gaps = 8/177 (5%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            KKL+HNA+ER RR+K+N L+SSLR LLP +DQK ++SIP TV+RVVKYIPE + EL+RL 
Sbjct  87   KKLNHNANERGRRRKLNALYSSLRDLLPPADQKRKLSIPMTVARVVKYIPEQKHELQRLS  146

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKKG  659
            ++K+EL  R++      K+  E  + + +M     +    +SA  + + +I +QI + K 
Sbjct  147  RRKEELLKRIS-----RKTNQERLRNKAMMDSIDSSSSQQISANWLTDTEIAVQIATSKY  201

Query  660  TQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLL  830
            T    +D L  LE+ GL ++  S+  +S  R+ F+TLHLQ+ G   + +++L   +L
Sbjct  202  TS--ISDMLLTLEENGLNVISVSSSVSSTARI-FYTLHLQMIGDCKVRLEELINGML  255



>gb|EMT11155.1| Transcription factor ORG2 [Aegilops tauschii]
Length=238

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/164 (40%), Positives = 89/164 (54%), Gaps = 25/164 (15%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            +K+SHNA ERDRRK++N  +SSLRSLLP  D   +MSIPTTVSRV+KYIPELQKE+    
Sbjct  65   RKMSHNAYERDRRKQLNEQYSSLRSLLPDDDHNKKMSIPTTVSRVIKYIPELQKEV----  120

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKKG  659
                           + K   E  +     G    N    +SAT + +R+I++Q+     
Sbjct  121  -------------DGLEKKKEELRRASYEQGAMRQNTAPIVSATCLDDREIMVQVSQVST  167

Query  660  TQNLF--ADALSCLEQEGLVLLDSST--FQTSEDRVNFHTLHLQ  779
                   +  +  LE +GL L++SST  FQ       F++LHLQ
Sbjct  168  MAGALPMSKCIKVLENQGLRLINSSTSAFQNR----TFYSLHLQ  207



>ref|XP_010490919.1| PREDICTED: transcription factor bHLH101-like [Camelina sativa]
Length=263

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 111/177 (63%), Gaps = 8/177 (5%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            KKL+HNA+ER RR+K+N L++SLR LLP +DQK ++SIP TV+RVVKYIPE + EL+RL 
Sbjct  89   KKLNHNANERGRRRKLNALYTSLRDLLPPADQKRKLSIPMTVARVVKYIPEQKHELQRLS  148

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKKG  659
            ++K+EL  R++      K+  E  + +  M          +SA  + + +I +QI + K 
Sbjct  149  RRKEELLKRIS-----RKTNQERLRNKATMDSIDSCSSQQISANWLTDTEIAVQIATSKY  203

Query  660  TQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLL  830
            T    +D L  L++ GL ++  S+  +S  R+ F+TLHLQ+ G   + +++L   +L
Sbjct  204  TS--ISDMLLTLQENGLNVISISSSVSSTARI-FYTLHLQMIGDCKVRLEELINGML  257



>gb|KCW84375.1| hypothetical protein EUGRSUZ_B01226 [Eucalyptus grandis]
Length=206

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            MVKKL+HNASERDRRKKMNGL+S+LRSLLPA+D+  ++S+PTTVSR +KYIPE+Q+++E+
Sbjct  71   MVKKLNHNASERDRRKKMNGLYSTLRSLLPAADRMKKLSVPTTVSRALKYIPEMQQQVEK  130

Query  474  lqkkkqelTSRVNS  515
            L ++K++L SR+N+
Sbjct  131  LTQEKEKLLSRINA  144



>ref|XP_009124032.1| PREDICTED: transcription factor ORG2-like [Brassica rapa]
 emb|CDY06147.1| BnaA09g36330D [Brassica napus]
Length=251

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 66/184 (36%), Positives = 117/184 (64%), Gaps = 12/184 (7%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            ++KKL+HNA+ER+RRKK+N LF+SLRS LP  D+  ++SIP TVSR V+YI EL+K+  +
Sbjct  70   VMKKLNHNANERNRRKKINSLFTSLRSCLPDLDELKKLSIPKTVSRSVQYITELKKQANK  129

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L++KK +L  RV   ++    P     + +V+ G+     S + AT++ + ++++QI S 
Sbjct  130  LRQKKDDLLVRVLVQKERYVQP-----QPKVIAGY----VSTVFATKLRDNEVMVQISSS  180

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEV--DKLKEKL  827
            K       + L  LE++G +++D S   +  +R+ F+TLHLQ+   +  ++  ++L +++
Sbjct  181  KIHNFFIYNVLCGLEEDGFLIVDVSFLSSQGERI-FYTLHLQLDTFDNYKLICEELSQRI  239

Query  828  LSYF  839
            L  +
Sbjct  240  LYLY  243



>ref|XP_011040759.1| PREDICTED: transcription factor ORG2-like isoform X1 [Populus 
euphratica]
Length=249

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 131/191 (69%), Gaps = 13/191 (7%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            MVKKLSHNA+ERDRRKK+  L+SSLRSLLPA+DQ  ++S+P TVSR +KY+PELQ+++ER
Sbjct  70   MVKKLSHNANERDRRKKIKSLYSSLRSLLPAADQMKKLSVPATVSRALKYLPELQQQVER  129

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L ++K+EL S+            + N+R     G  ++  S +SA+Q+ ++++V+ I + 
Sbjct  130  LVQRKEELLSKQGGIIH------QENQR----NGTVYSSLSSVSASQLSDKEVVVHISTY  179

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQV-QGIEMMEVDKLKEKLL  830
            K  ++  ++ L  LE++ LVL +SS+F++S DRV F+ LHLQV +G   ++ + ++ KL+
Sbjct  180  KNHKSPLSEILLTLEEDRLVLKNSSSFESSGDRV-FYNLHLQVMEGTYTLDSEAMRAKLV  238

Query  831  S-YFNEEQTCL  860
            S Y   E + L
Sbjct  239  SLYVKRESSSL  249



>ref|XP_003565095.1| PREDICTED: transcription factor bHLH100-like [Brachypodium distachyon]
Length=242

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 90/163 (55%), Gaps = 19/163 (12%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            +K+SHNA ERDRRK++N L+SSLRSLLP +D   ++SIP TVSRV+KYIPELQ       
Sbjct  65   RKMSHNAYERDRRKQLNELYSSLRSLLPDADHTKKLSIPITVSRVLKYIPELQ-------  117

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKKG  659
                     V+  ++  +     N +  V+     N    +SAT + ++DI++Q+    G
Sbjct  118  -------KEVDGLERKKEELTRANCKPGVIAMKDQNVAPVVSATCLDDKDIMVQVSLLSG  170

Query  660  TQNLFADALSC---LEQEGLVLLDSSTFQTSEDRVNFHTLHLQ  779
                     +C   LE EGL L+ SST  ++     F+ LHLQ
Sbjct  171  MAAAALPMSTCIKILENEGLRLVSSST--SAFGNRTFYNLHLQ  211



>ref|XP_003572517.1| PREDICTED: transcription factor bHLH100-like [Brachypodium distachyon]
Length=234

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 91/166 (55%), Gaps = 21/166 (13%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            KKLSHNA ERDRRK++N L+ SLRSLLP +D   ++SIPTTV RV+KYIPELQ       
Sbjct  53   KKLSHNAYERDRRKQLNELYLSLRSLLPDADHTKKLSIPTTVCRVLKYIPELQ-------  105

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKKG  659
                    +V   +K  +     N +  V+          +SAT + +++I++Q+     
Sbjct  106  -------KKVEDLEKRKEELTSANCKPGVILSGGIALAPTVSATCLNDKEIMVQVSLLST  158

Query  660  TQNL------FADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQ  779
            T          +  +S LE EGL L+ SSTF T  D+  ++ LHLQ
Sbjct  159  TDAATTTTLPLSKCISVLENEGLRLISSSTFSTFGDK-TYYNLHLQ  203



>gb|KGN54724.1| hypothetical protein Csa_4G434480 [Cucumis sativus]
Length=237

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 92/253 (36%), Positives = 140/253 (55%), Gaps = 31/253 (12%)
 Frame = +3

Query  36   PFFSPMSFPNMGWSIDDYISHEQFGTDLYSNAAGDTSPDAPPPH--FVSLPSSPLPPAME  209
            P FSP       W  +D IS       L+S       P  P  H  ++  P  PL P+  
Sbjct  7    PLFSPHQ-----WQFEDPISLHHQHNSLFS-------PFEPSDHSFYLQFPPPPLDPSHG  54

Query  210  RCDSLKFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPAS  389
              D            +     G S  + M KKLSHNASERDRRKK+N L+SSLR+LLP+S
Sbjct  55   EHDHYP-------SSAAPSPEGVSNVSKMAKKLSHNASERDRRKKINSLYSSLRALLPSS  107

Query  390  DQKARMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVM  569
            DQ  ++S P T+SR++ YIPELQ+++E   +KK+EL + +   Q++       N   + M
Sbjct  108  DQMKKLSNPATISRILSYIPELQQQVEEQMRKKEELMAAM-VGQEVK------NDEEKKM  160

Query  570  GGHHHNRQSYLSATQVGERDIVIQICS--KKGTQNLFADALSCLEQEGLVLLDSSTFQTS  743
                 +  S +SA+++   ++ IQI +    G +N  ++ L CLE+EGL+LL++S+F++ 
Sbjct  161  KSAVSSSSSIISASRLSRHEMAIQISTDINGGQRNYLSEILICLEEEGLLLLNASSFESF  220

Query  744  EDRVNFHTLHLQV  782
            + ++ FH LHLQ+
Sbjct  221  DGKI-FHNLHLQI  232



>gb|EMT09813.1| Transcription factor ORG2 [Aegilops tauschii]
Length=261

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 94/165 (57%), Gaps = 20/165 (12%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            KKLSHNA ERDRRK++N L+ SLRSLLP +D   ++SIPTTV R +KYIPELQK      
Sbjct  75   KKLSHNAYERDRRKQLNELYLSLRSLLPDADHTKKLSIPTTVCRALKYIPELQK------  128

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKKG  659
                    +V + +K  +     N +  V+     +    +SAT + +++I++QI   +G
Sbjct  129  --------QVENLEKKKEKLASANCKPGVLSA-SGSIAPTVSATCLNDKEIMVQISLLRG  179

Query  660  TQNLFADALS----CLEQEGLVLLDSSTFQTSEDRVNFHTLHLQV  782
            T    A  LS     LE EGL L+ SST  T  ++  F+ LHLQ 
Sbjct  180  TDAATALPLSKCINVLENEGLQLISSSTSSTFGNKT-FYNLHLQT  223



>ref|XP_004971296.1| PREDICTED: transcription factor ORG3-like isoform X2 [Setaria 
italica]
Length=241

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 98/171 (57%), Gaps = 20/171 (12%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            +KLSHNA ERDRRK++N L+SSLRSLLP +D   ++SIPTTVSRV+KYIPELQ       
Sbjct  69   RKLSHNAYERDRRKQLNELYSSLRSLLPDADH-TKLSIPTTVSRVLKYIPELQ-------  120

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQI---CS  650
                    +V++ ++  K     N +  V+          +SAT + + +I++Q+    +
Sbjct  121  -------KQVDNLERRKKELTNANCKPGVLNASEI-ITPIVSATCLNDTEIMVQVSLQSN  172

Query  651  KKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMME  803
               T    +  +  LE EGL L+ SST+ T +++  F++LHLQ     M E
Sbjct  173  MAATTLPLSKCIKVLENEGLHLISSSTYSTLDNKT-FYSLHLQRSQRTMKE  222



>gb|EMS54276.1| Transcription factor ORG2 [Triticum urartu]
Length=224

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 94/165 (57%), Gaps = 20/165 (12%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            KKLSHNA ERDRRK++N L+ SLRSLLP +D   ++SIPTTV R +KYIPELQ       
Sbjct  75   KKLSHNAYERDRRKQLNELYLSLRSLLPDTDHTKKLSIPTTVCRALKYIPELQ-------  127

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKKG  659
                    +V + +K  +     N +  V+     +    +SAT + +++I++QI   + 
Sbjct  128  -------KQVENLEKKKEKLASANCKPGVLSV-SGSIAPTVSATCLNDKEIMVQISVSRD  179

Query  660  TQNLFADALS----CLEQEGLVLLDSSTFQTSEDRVNFHTLHLQV  782
            T    A  LS     LE EGL L+ SST  T  +++ F+ LHLQV
Sbjct  180  TDAATALPLSRCINVLENEGLQLISSSTSSTFGNKM-FYNLHLQV  223



>ref|XP_009414172.1| PREDICTED: transcription factor bHLH101-like [Musa acuminata 
subsp. malaccensis]
Length=240

 Score = 90.9 bits (224),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 94/171 (55%), Gaps = 26/171 (15%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQ----KARMSIPTTVSRVVKYIPelqkel  467
            KKL HNA ERDRRKK+N L+SSLR LLP SDQ    K ++SIP  V RV+KY+P      
Sbjct  53   KKLCHNAYERDRRKKLNDLYSSLRDLLPESDQARKKKKKLSIPLIVCRVLKYVP------  106

Query  468  erlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSY----LSATQVGERDIV  635
                +++ E  SR      ++ S PE           H  R +     +SAT + +R+++
Sbjct  107  --ELQRQVERLSRRKEEILLALSRPEEQS--------HCVRSAVQYPMVSATCLSKREVM  156

Query  636  IQIC-SKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQ  785
            +Q+C   K     F+  L  LE+EGL L++SS + T + R    +LHLQ +
Sbjct  157  VQLCVVNKDATFSFSKILKVLEREGLHLMNSSNYTTCDGRC-VCSLHLQAR  206



>ref|XP_006854796.1| hypothetical protein AMTR_s00063p00154030 [Amborella trichopoda]
 gb|ERN16263.1| hypothetical protein AMTR_s00063p00154030 [Amborella trichopoda]
Length=241

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 116/180 (64%), Gaps = 11/180 (6%)
 Frame = +3

Query  297  VKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerl  476
            VKKL+HNA+ERDRRKK+N L+SSLRSLLP S+Q  RMSIPTTV+RV+KYIPELQKE++ L
Sbjct  62   VKKLTHNANERDRRKKLNSLYSSLRSLLPESEQGKRMSIPTTVTRVLKYIPELQKEVDSL  121

Query  477  qkkkqelTSR--VNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICS  650
             ++++E+ +R  V    +I    P  N+     G    N    ++  ++ E ++++QIC+
Sbjct  122  IQRREEILARAPVQDNHRI----PNANR-----GNVQGNSVPRITICRLDEGEMMVQICA  172

Query  651  KKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLL  830
             K  +  F+  L  LE+EGL+  D+S+F      V ++ L    +G   ++ + LK+K+L
Sbjct  173  SKMKRGQFSKILIGLEEEGLMATDASSFSIGGHGVVYNLLLQVKEGFPRLDCEVLKDKIL  232



>emb|CDX77490.1| BnaA07g06280D [Brassica napus]
Length=248

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 104/170 (61%), Gaps = 18/170 (11%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            ++KKL HNA+ER+RRKK N LFS+LRS LP SD+  R+S P T+SR ++YIPEL++++++
Sbjct  69   VIKKLIHNANERNRRKKTNSLFSALRSCLPGSDE--RLSNPQTISRSMQYIPELKEQVKK  126

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLS---ATQVGERDIVIQI  644
            L +       + N    IS+      +R R          SY+S   AT++ + ++++QI
Sbjct  127  LTQ------KKENLLLLISR------QRERYAMPQPKVVCSYVSTVFATELRDNEVMVQI  174

Query  645  CSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIE  794
             S K       + LS LE++G VL+D S+     +R+ F+TLHLQV  I+
Sbjct  175  SSSKNHNFSIYNVLSGLEEDGFVLVDVSSSNPRGERL-FYTLHLQVDKID  223



>dbj|BAJ93630.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=253

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 100/181 (55%), Gaps = 21/181 (12%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            KKLSHNA ERDRRK++N L+ SLRSLLP +D   ++SIPTTV R +KYIPELQ       
Sbjct  75   KKLSHNAYERDRRKQLNELYLSLRSLLPDADHTKKLSIPTTVCRALKYIPELQ-------  127

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKK-  656
                    +V + +K  +     N +  V+        + +SAT + +++I++QI   + 
Sbjct  128  -------KQVENLEKKKEKLASANCKPGVLSVSGSIAPT-VSATCLNDKEIMVQISMSRD  179

Query  657  ---GTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQ-VQGIEMMEVDKLKEK  824
                T    +  ++ LE EGL L+ SST  T  +++ F+ LHLQ  QG   ME     +K
Sbjct  180  KDAATTLPLSKCINVLENEGLQLISSSTSSTFGNKM-FYNLHLQRSQGALNMECPSFCDK  238

Query  825  L  827
            L
Sbjct  239  L  239



>ref|XP_007015050.1| Basic helix-loop-helix (bHLH) DNA-binding superfamily protein 
[Theobroma cacao]
 gb|EOY32669.1| Basic helix-loop-helix (bHLH) DNA-binding superfamily protein 
[Theobroma cacao]
Length=250

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 117/181 (65%), Gaps = 8/181 (4%)
 Frame = +3

Query  297  VKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerl  476
            VKKL+HNASERDRRKK+N L+SSLRSLLP +DQ  ++S P TVS+ +KYIPELQ+++E L
Sbjct  65   VKKLNHNASERDRRKKVNSLYSSLRSLLPVADQMKKLSFPATVSQALKYIPELQEQVEGL  124

Query  477  qkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKK  656
             +KK++L  R++    + +   E  +R+  +G    +  S +S  ++ + +I IQI  +K
Sbjct  125  VQKKEKLLLRISERGGLKR---EEQQRKSRLG---RSLSSAISINRLTDSEIAIQISMRK  178

Query  657  GTQ-NLFADALSCLEQEGLV-LLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLL  830
              Q N  +  L  LEQ+GL  LL +++F++      F+ +HLQ +    +E + L EKLL
Sbjct  179  VDQKNQLSKILQYLEQDGLFHLLSATSFESFGGMDVFYNIHLQAETTYKLESEALSEKLL  238

Query  831  S  833
            S
Sbjct  239  S  239



>ref|XP_002308882.2| hypothetical protein POPTR_0006s03560g [Populus trichocarpa]
 gb|EEE92405.2| hypothetical protein POPTR_0006s03560g [Populus trichocarpa]
Length=251

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 130/181 (72%), Gaps = 10/181 (6%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            MVKKLSHNA+ERDRRKK+  L+SSLRSLLPA+DQ  ++S+P TVSR +KY+PELQ+++ER
Sbjct  70   MVKKLSHNANERDRRKKIKSLYSSLRSLLPAADQ-MKLSVPATVSRALKYLPELQQQVER  128

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L ++K+EL S+++    I     + N+R   +    ++  S +SA+Q+ ++++V+ I + 
Sbjct  129  LVQRKEELLSKLSKQGGIIH---QENQRNDTV----YSSLSSVSASQLSDKEVVVHISTY  181

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQV-QGIEMMEVDKLKEKLL  830
            K  ++  ++ L  LE++GLVL +SS+F++  DRV F+ LHLQV +G   ++ + ++ KL+
Sbjct  182  KNHKSPLSEILLTLEEDGLVLKNSSSFESFGDRV-FYNLHLQVMEGTYTLDSEAMRAKLV  240

Query  831  S  833
            S
Sbjct  241  S  241



>ref|XP_009105533.1| PREDICTED: transcription factor ORG2-like [Brassica rapa]
Length=244

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 73/189 (39%), Positives = 117/189 (62%), Gaps = 16/189 (8%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            M+KKLSHNA+ER RRK+MN LFS+L S LPAS Q  ++SIP TV R VKYIP+LQ+++++
Sbjct  61   MIKKLSHNANERYRRKQMNSLFSTLCSCLPASYQLNKLSIPQTVLRTVKYIPDLQEQVKK  120

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLS---ATQVGERDIVIQI  644
            L +KK++L  R    + +     +          H     SY+S   AT+ G+ ++++QI
Sbjct  121  LTQKKEDLLVRALGQRDMESYVKQ----------HPQAVASYVSTVFATKNGDNEVMVQI  170

Query  645  CSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEV--DKLK  818
             S    +    + LS LE++G V++D S+  +  +R+ F+TLHLQV   +  ++  ++L 
Sbjct  171  SSSTIHKFSIYNVLSGLEEDGFVVVDVSSSSSRGERL-FYTLHLQVGKTDSNKIICEELS  229

Query  819  EKLLSYFNE  845
            +K+L  + E
Sbjct  230  QKILYLYEE  238



>ref|XP_004144366.1| PREDICTED: transcription factor ORG2-like [Cucumis sativus]
Length=174

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 102/167 (61%), Gaps = 13/167 (8%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            M KKL HNA+ERDRR+K+N L+ SLR LLP +D   RMS P+T+S+ +KYIPELQ+++E 
Sbjct  1    MAKKLKHNANERDRRRKINSLYCSLRCLLPPTDSMKRMSNPSTISKALKYIPELQQQVEG  60

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQIC--  647
            L+++K+ L +++N          E N ++           S+ +   + E + ++QI   
Sbjct  61   LRRRKEGLVTKLN----------EENLKQIRKNNKEPWMSSFCAVNWLSETEALLQIALE  110

Query  648  SKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQG  788
             +  TQ  F+  L  LE++GL+LL +S+F++   R+ F TL LQ + 
Sbjct  111  DQTHTQLPFSQILLSLEEDGLLLLTASSFRSFNGRL-FLTLLLQAKA  156



>ref|XP_008455703.1| PREDICTED: transcription factor bHLH100-like [Cucumis melo]
Length=249

 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 99/272 (36%), Positives = 147/272 (54%), Gaps = 34/272 (13%)
 Frame = +3

Query  36   PFFSPMSFPNMGWSIDDYISHEQFGTDLYSNAAGDTSPDAPPPH--FVSLPSSPLPPAME  209
            P FSP       W ++D IS       L+S       P  P  H  ++  P  PL P+ +
Sbjct  7    PLFSPHQ-----WQLEDPISLHHQHNSLFS-------PFEPSDHSFYLQFPPPPLDPSHD  54

Query  210  RCDSLKFdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPAS  389
               S           +       S  + M KKLSHNASERDRRKK+N L+SSLR+LLP+S
Sbjct  55   HYPS----------SAAPSPEAVSNVSKMAKKLSHNASERDRRKKINSLYSSLRALLPSS  104

Query  390  DQKARMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVM  569
            DQ  ++S P T+SR++ YIPELQ+++E   +KK+EL + +   Q++       N   + M
Sbjct  105  DQMKKLSNPATISRILSYIPELQQQVEGQMRKKEELMAAM-VGQEVK------NDEEKKM  157

Query  570  GGHHHNRQSYLSATQVGERDIVIQICSK-KGTQ-NLFADALSCLEQEGLVLLDSSTFQTS  743
                 +  S +SA+++   ++ IQI +   G Q N  ++ L CLE+EGL+LL++S+F++ 
Sbjct  158  KSAASSSSSIISASRLSRHEMAIQISTDINGCQRNYLSEILCCLEEEGLLLLNASSFESF  217

Query  744  EDRVNFHTLHLQVQGIEMMEVDKLKEKLLSYF  839
            + +V FH LHLQ+     ME   L   LL  F
Sbjct  218  DGKV-FHNLHLQMGSNCKMEPKVLSNMLLEMF  248



>ref|XP_011040760.1| PREDICTED: transcription factor ORG2-like isoform X2 [Populus 
euphratica]
Length=248

 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 131/191 (69%), Gaps = 14/191 (7%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            MVKKLSHNA+ERDRRKK+  L+SSLRSLLPA+DQ  ++S+P TVSR +KY+PELQ+++ER
Sbjct  70   MVKKLSHNANERDRRKKIKSLYSSLRSLLPAADQ-MKLSVPATVSRALKYLPELQQQVER  128

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L ++K+EL S+            + N+R     G  ++  S +SA+Q+ ++++V+ I + 
Sbjct  129  LVQRKEELLSKQGGIIH------QENQR----NGTVYSSLSSVSASQLSDKEVVVHISTY  178

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQV-QGIEMMEVDKLKEKLL  830
            K  ++  ++ L  LE++ LVL +SS+F++S DRV F+ LHLQV +G   ++ + ++ KL+
Sbjct  179  KNHKSPLSEILLTLEEDRLVLKNSSSFESSGDRV-FYNLHLQVMEGTYTLDSEAMRAKLV  237

Query  831  S-YFNEEQTCL  860
            S Y   E + L
Sbjct  238  SLYVKRESSSL  248



>ref|XP_009102594.1| PREDICTED: transcription factor ORG3-like [Brassica rapa]
Length=248

 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 103/170 (61%), Gaps = 18/170 (11%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            ++KKL HNA+ER+RRKK N LFS+LRS LP SD+  R+S P T+SR ++YIPEL++++++
Sbjct  69   VIKKLIHNANERNRRKKTNSLFSALRSCLPGSDE--RLSNPQTISRSMQYIPELKEQVKK  126

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLS---ATQVGERDIVIQI  644
            L +       + N    IS+      +R R          SY+S   AT++ + ++++ I
Sbjct  127  LTQ------KKENLLLLISR------QRERYAMPQPKVVCSYVSTVFATELRDNEVMVHI  174

Query  645  CSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIE  794
             S K       + LS LE++G VL+D S+     +R+ F+TLHLQV  I+
Sbjct  175  SSSKNHNFSIYNVLSGLEEDGFVLVDVSSSNPRGERL-FYTLHLQVDKID  223



>ref|XP_006604330.1| PREDICTED: transcription factor ORG2-like, partial [Glycine max]
Length=121

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIP  449
            MVKKLSHNASERDRRKK+N L SSLR LLP  DQ  +MSIP TVSRV+KYIP
Sbjct  60   MVKKLSHNASERDRRKKVNNLVSSLRLLLPVEDQTKKMSIPATVSRVLKYIP  111



>emb|CBI25000.3| unnamed protein product [Vitis vinifera]
Length=178

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 116/163 (71%), Gaps = 8/163 (5%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            MVKKL+HN S RDRRKK+N L+SSLRSLLP++DQ  ++SIP+TVS V+KYIPELQ+++ER
Sbjct  1    MVKKLNHNVSVRDRRKKINSLYSSLRSLLPSADQVKKLSIPSTVSCVLKYIPELQRQVER  60

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L +KK+E  S+++    +       N+R   +G       S +SA ++ +R+IV+QI + 
Sbjct  61   LIQKKEEFLSKISREGDLIHLE---NQRNGTLGSS----LSAVSARRLSDREIVVQISTF  113

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQV  782
            K  ++  ++ L  LE++GL+++++S+F++   RV F+ LHLQV
Sbjct  114  KVHESPLSEVLLNLEEDGLLVINASSFESFGGRV-FYNLHLQV  155



>dbj|BAB64701.1| bHLH transcription factor-like [Oryza sativa Japonica Group]
 gb|EAY77256.1| hypothetical protein OsI_05230 [Oryza sativa Indica Group]
 gb|EAZ14859.1| hypothetical protein OsJ_04787 [Oryza sativa Japonica Group]
Length=248

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 102/165 (62%), Gaps = 17/165 (10%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            +KLSHNA ERDRRK++N L+SSLR+LLP +D   ++SIPTTVSRV+KYIPELQK++E L+
Sbjct  69   RKLSHNAYERDRRKQLNELYSSLRALLPDADHTKKLSIPTTVSRVLKYIPELQKQVENLE  128

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGH--HHNRQSYLSATQVGERDIVIQI---  644
            +KK+ELT+   +           N +  V+G           +SAT + + +I++Q+   
Sbjct  129  RKKKELTTTSTT-----------NCKPGVLGSQLMSEGMAPIVSATCINDMEIMVQVSLL  177

Query  645  CSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQ  779
             +  G+    +  +  LE EGL  + SST     +R  F+++HLQ
Sbjct  178  SNVAGSVLPLSKCIKVLENEGLHFISSSTSSGFGNRT-FYSIHLQ  221



>emb|CDY47395.1| BnaC04g24680D [Brassica napus]
Length=221

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 102/184 (55%), Gaps = 41/184 (22%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            KKL HNASERDRRKK+N LFSSL S LPASDQ  ++SIP TVSR +K+I ELQ+E+++L 
Sbjct  72   KKLKHNASERDRRKKINSLFSSLCSCLPASDQSKKLSIPQTVSRSLKHILELQEEVKKLI  131

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKKG  659
            +KK+EL  RV+  + I + P   N                                    
Sbjct  132  QKKEELLLRVSGQRAIEQQPKIHNFS----------------------------------  157

Query  660  TQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGI--EMMEVDKLKEKLLS  833
                 ++ LS LE++G+VL+D S  ++  +RV F+TLHLQV  I  + +   +L + +L 
Sbjct  158  ----ISNVLSGLEEDGIVLVDVSLSRSQGERV-FYTLHLQVDNIDNDKLNCTELSQMMLY  212

Query  834  YFNE  845
             + E
Sbjct  213  LYEE  216



>emb|CDX72086.1| BnaC08g27880D [Brassica napus]
Length=236

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 117/184 (64%), Gaps = 12/184 (7%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            M+KKL+HNA+ER+RRKK+N LFS L S LP S++  ++SIP TVSR V+YIPELQ+++++
Sbjct  55   MIKKLNHNANERNRRKKINYLFSILSSCLPGSNETKKLSIPRTVSRSVQYIPELQEQVKK  114

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L+ KK++L  RV   ++    P     + +V+        S + AT + + ++++QI S 
Sbjct  115  LKHKKEDLLVRVLGQRERHVKP-----QPKVVASD----VSTVFATMLRDNEVMVQISSS  165

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEV--DKLKEKL  827
            K         +S LE++  VL+D S+  +  +R+ F+TLHLQV  I+  ++  ++L +++
Sbjct  166  KIHNFSIYHVMSGLEEDEFVLVDVSSSSSRGERL-FYTLHLQVDKIDHYKLICEELSQRV  224

Query  828  LSYF  839
            L  +
Sbjct  225  LYLY  228



>emb|CDX76027.1| BnaA04g02910D [Brassica napus]
Length=230

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 110/172 (64%), Gaps = 12/172 (7%)
 Frame = +3

Query  339  KKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSW  518
            +K+N LFSSLRS LPASDQ  ++SIP TVSR +KYIPELQ+++++L +KK+EL  RV+  
Sbjct  62   RKINSLFSSLRSCLPASDQSKKLSIPQTVSRSLKYIPELQEQVKKLIQKKEELLVRVSGQ  121

Query  519  QKISK-SPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCL  695
            + I     P      R +        S +S T++G+ ++++QI S K      ++ LS L
Sbjct  122  RDIEHYVEPHPKAVARYV--------STISVTKLGDNEVMVQISSSKNHNFSISNVLSGL  173

Query  696  EQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIE--MMEVDKLKEKLLSYFNE  845
            E++G VL+D S+ ++  +R+ F+TLHLQ+   +   +  ++L++++L  + E
Sbjct  174  EEDGFVLVDVSSSRSHGERL-FYTLHLQMGNKDDYKLTCEELRQRMLYLYEE  224



>dbj|BAF30424.1| basic helix-loop-helix protein [Hordeum vulgare subsp. vulgare]
Length=252

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/164 (40%), Positives = 91/164 (55%), Gaps = 23/164 (14%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            +K+SHNA ERDRRK++N L+S LRSLLP SD   ++SIP TVSRV+KYIPELQ       
Sbjct  70   RKISHNAYERDRRKQLNELYSDLRSLLPDSDHTKKLSIPITVSRVLKYIPELQ-------  122

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQI--CSK  653
                    +V+  +K  +     + +  V+     N    +SAT + ER+I++Q+   S 
Sbjct  123  -------KQVDGLEKKKEELTRASCKPGVL-TMKENTVPIVSATCLDEREIMVQVSLVST  174

Query  654  KGTQNLFADALSCLEQEGLVLLDSST--FQTSEDRVNFHTLHLQ  779
                   +  +  LE EGL L+ SST  FQ       F++LHLQ
Sbjct  175  MAGALPMSKRIKVLENEGLRLISSSTSAFQNR----TFYSLHLQ  214



>ref|XP_009387039.1| PREDICTED: transcription factor ORG2-like [Musa acuminata subsp. 
malaccensis]
Length=247

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 111/184 (60%), Gaps = 14/184 (8%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            KKL HNA ER RRKK+N L++SLR+LLP SDQ   +SIP T+SRV+KYIPELQ+++ERLQ
Sbjct  66   KKLCHNAYERGRRKKINDLYASLRALLPESDQSKNLSIPLTISRVLKYIPELQRQVERLQ  125

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKKG  659
            ++K+E+         ++ S PE     +   G     +  +SA  +  R++++Q+C    
Sbjct  126  QRKEEIL--------LALSRPE----EQSHCGDIVVYRPMVSAACLSNREVMVQVCLLSS  173

Query  660  TQNL-FADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLLSY  836
              ++ F+  L  L++EGL L+++ST+ T + R  F +LH++ +     E     + LL  
Sbjct  174  HFSISFSKILRLLKREGLHLVNASTYTTHDGRC-FCSLHIEARETFDTECRIFCDTLLKE  232

Query  837  FNEE  848
              E+
Sbjct  233  IKEQ  236



>emb|CDY71388.1| BnaUnng04340D [Brassica napus]
Length=251

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 106/167 (63%), Gaps = 10/167 (6%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            ++KKL+HNA+ER+RR+K N LFSSLRS LP+S Q  ++S P TVSR V YIPELQ+E+++
Sbjct  70   VIKKLNHNANERNRRQKANALFSSLRSCLPSSYQSKKLSNPETVSRSVLYIPELQEEVKK  129

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L +KK++L  RV S Q+     PE     +V   +     S + AT + +  + +QI S 
Sbjct  130  LIQKKEDLLVRV-SDQREHYVKPE----PKVAASYF----STVFATNLVDNKVTVQISSS  180

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIE  794
            K       + L+ LE++G V++D S+  +  + + F+TLHLQV  I+
Sbjct  181  KIHNFSIYNVLNGLEEDGFVIVDVSSSSSQGEWL-FYTLHLQVDKID  226



>gb|EMS47280.1| Transcription factor ORG2 [Triticum urartu]
Length=269

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 91/165 (55%), Gaps = 20/165 (12%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            KKLSHNA ERDRRK++N L+ SLRSLLP +D   ++SIPTT  R +KYIPELQ       
Sbjct  74   KKLSHNAYERDRRKQLNELYLSLRSLLPDADHTKKLSIPTTACRALKYIPELQ-------  126

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKKG  659
                    +V + +K  +     N +  V+        + +SAT +  ++I++QI   + 
Sbjct  127  -------KQVENLEKKKEKLASANCKPGVLSVTGSIAPT-VSATCLNHKEIMVQISLLRD  178

Query  660  TQNLFADALS----CLEQEGLVLLDSSTFQTSEDRVNFHTLHLQV  782
            T    A  LS     LE EGL L+ SST  T  ++  F+ LHLQV
Sbjct  179  TDASTALPLSKCINVLENEGLQLISSSTSSTFGNKT-FYNLHLQV  222



>ref|XP_010243481.1| PREDICTED: transcription factor bHLH101-like [Nelumbo nucifera]
Length=282

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 99/166 (60%), Gaps = 14/166 (8%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQ-KARMSIPTTVSRVVKYIPelqkele  470
            +VKKL HNA ER RR K+N  + +LRSLLP S + K + S P  V +V++YIPEL+ E+E
Sbjct  99   VVKKLDHNAKERVRRMKLNSSYLALRSLLPDSRRSKKKWSAPVIVGKVLEYIPELESEIE  158

Query  471  rlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICS  650
             L ++K+++ S V   Q  ++  P  +K   V            S ++V + ++++QIC 
Sbjct  159  NLTQRKEQMLSIVEKRQIPTQGSPSESKTPTV------------SVSEVRKGEVIVQICI  206

Query  651  KKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQG  788
            ++   ++F+  L+  E EG+ ++ SS    S+DRV +H LHL V G
Sbjct  207  QRENSSVFSTLLANAEGEGMQIVSSSALSVSDDRVCYH-LHLHVSG  251



>gb|ABD37969.1| basic helix-loop-helix family protein [Noccaea caerulescens]
Length=179

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 87/119 (73%), Gaps = 4/119 (3%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            +++KL+HNASERDRRKK+N +FSSLRS LPASDQ  ++S+  TVS+ +KYIPELQ+++++
Sbjct  54   VMRKLNHNASERDRRKKINAMFSSLRSCLPASDQSKKLSVSATVSQALKYIPELQEKVKK  113

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICS  650
            L KKK EL+ +++  + +  +       ++ + G+     S +SAT++GE ++++QI S
Sbjct  114  LIKKKDELSFQISGQRDLVYTNQNGKPEKKGVTGY----ASTVSATRLGETEVMVQISS  168



>ref|NP_001045424.1| Os01g0952800 [Oryza sativa Japonica Group]
 dbj|BAF07338.1| Os01g0952800 [Oryza sativa Japonica Group]
Length=247

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 102/165 (62%), Gaps = 18/165 (11%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            +KLSHNA ERDRRK++N L+SSLR+LLP +D   ++SIPTTVSRV+KYIPELQK++E L+
Sbjct  69   RKLSHNAYERDRRKQLNELYSSLRALLPDADH-TKLSIPTTVSRVLKYIPELQKQVENLE  127

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGH--HHNRQSYLSATQVGERDIVIQI---  644
            +KK+ELT+   +           N +  V+G           +SAT + + +I++Q+   
Sbjct  128  RKKKELTTTSTT-----------NCKPGVLGSQLMSEGMAPIVSATCINDMEIMVQVSLL  176

Query  645  CSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQ  779
             +  G+    +  +  LE EGL  + SST     +R  F+++HLQ
Sbjct  177  SNVAGSVLPLSKCIKVLENEGLHFISSSTSSGFGNRT-FYSIHLQ  220



>gb|EMS61479.1| Transcription factor ORG2 [Triticum urartu]
Length=227

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 87/163 (53%), Gaps = 18/163 (11%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            KKLSHNA ERDRR ++N L+S+LRSL+P +D   ++SIPTTV +V+ YIPELQ       
Sbjct  72   KKLSHNAYERDRRTQLNQLYSTLRSLIPNADHTKKLSIPTTVCQVLDYIPELQ-------  124

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQI--CSK  653
                    +V   +K  +       R R+      N    +SAT +   +I++Q+   S 
Sbjct  125  -------KQVEDLEKKKQELTRAKCRERLQRV-KDNTGRIVSATPLDGNEIMVQVSLLSN  176

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQV  782
                   +  ++  E EGL L+ SSTF T  +R  F++ H ++
Sbjct  177  MAASLPLSKCINVFENEGLHLISSSTFSTEVNRT-FYSFHFEM  218



>tpd|FAA00382.1| TPA: bHLH transcription factor [Oryza sativa Japonica Group]
Length=247

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 102/165 (62%), Gaps = 18/165 (11%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            +KLSHNA ERDRRK++N L+SSLR+L+P +D   ++SIPTTVSRV+KYIPELQK++E L+
Sbjct  69   RKLSHNAYERDRRKQLNKLYSSLRALIPDADH-TKLSIPTTVSRVLKYIPELQKQVENLE  127

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGH--HHNRQSYLSATQVGERDIVIQI---  644
            +KK+ELT+   +           N +  V+G           +SAT + + +I++Q+   
Sbjct  128  RKKKELTTTSTT-----------NCKPGVLGSQLMSEGMAPIVSATCINDMEIMVQVSLL  176

Query  645  CSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQ  779
             +  G+    +  +  LE EGL  + SST     +R  F+++HLQ
Sbjct  177  SNVAGSVLPLSKCIKVLENEGLHFISSSTSSGFGNRT-FYSIHLQ  220



>ref|XP_006645381.1| PREDICTED: transcription factor bHLH100-like [Oryza brachyantha]
Length=251

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 64/169 (38%), Positives = 96/169 (57%), Gaps = 25/169 (15%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            +KLSHNA ERDRRK++N L+SSLR+LLP +D   ++SIPTTVSRV+KYIPELQ       
Sbjct  66   RKLSHNAYERDRRKQLNELYSSLRALLPDADH-TKLSIPTTVSRVLKYIPELQ-------  117

Query  480  kkkqelTSRVNSWQKISKSPPEFNK--RRRVMGGHHH----NRQSYLSATQVGERDIVIQ  641
                    +V + ++  K     N   ++ ++G        +    +SAT + + +I++Q
Sbjct  118  -------KQVENLERKKKELTMNNPSCKQGLLGSQMSESALSTAPIVSATCIDDMEIMVQ  170

Query  642  I---CSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQ  779
            I    +  G+    +  +  LE EGL L+ SST     +R  F++LHLQ
Sbjct  171  ISFLSNVAGSILPLSKCIKVLENEGLHLISSSTSSAFGNRT-FYSLHLQ  218



>ref|XP_009116400.1| PREDICTED: transcription factor ORG3-like [Brassica rapa]
 emb|CDY06149.1| BnaA09g36310D [Brassica napus]
Length=249

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 104/167 (62%), Gaps = 10/167 (6%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            ++KKL+HNA+ER+RR+K N LFSSLR  LP S Q  ++S P TVSR V YIPELQ+E+++
Sbjct  68   VIKKLNHNANERNRRQKANALFSSLRLCLPRSYQSKKLSNPETVSRSVLYIPELQEEVKK  127

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L +KK++L  RV S Q+     PE     +V   +     S + AT + +  + +QI S 
Sbjct  128  LIQKKEDLLVRV-SDQREHYVKPE----PKVAASYF----STVFATNLVDNKVTVQISSS  178

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIE  794
            K       + L+ LE++G V++D S+  +  + + F+TLHLQV  I+
Sbjct  179  KIHNFSIYNVLNGLEEDGFVIVDVSSSSSQGEWL-FYTLHLQVDKID  224



>ref|XP_009139052.1| PREDICTED: transcription factor ORG2-like [Brassica rapa]
Length=195

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIP  449
            + KKL HNASERDRRKK+N LFSSLRS LPASDQ  ++SIP TVSR +KYIP
Sbjct  68   VTKKLKHNASERDRRKKINSLFSSLRSCLPASDQSKKLSIPQTVSRSLKYIP  119



>gb|EMT13532.1| Transcription factor ORG2 [Aegilops tauschii]
Length=244

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 94/182 (52%), Gaps = 23/182 (13%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            KKL+HNA ERDRR ++N L+S+LRSL+P +D   ++SIPTTV +V+ YIP+LQ       
Sbjct  79   KKLNHNAYERDRRTQLNQLYSTLRSLIPNADHTKKLSIPTTVCQVLDYIPKLQ-------  131

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQI--CSK  653
                    +V   +K  +       R R+      N    +SAT +   +I++Q+   S 
Sbjct  132  -------KQVEDLEKKKQELTRAKCRERLQRV-KDNTCRIVSATPLDGNEIMVQVRLLSN  183

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLLS  833
                   +  ++  E EGL L+ SSTF T  +R  F++ H      EMM   + +E +  
Sbjct  184  MAASLPLSKCINVFENEGLHLISSSTFSTEVNRT-FYSFHF-----EMMFAKRQQENVKH  237

Query  834  YF  839
            ++
Sbjct  238  FY  239



>ref|XP_008455701.1| PREDICTED: transcription factor bHLH101-like [Cucumis melo]
Length=210

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 99/167 (59%), Gaps = 13/167 (8%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            M KKL HNA+ERDRR+K+N L+ SLR LLP +D   RMS P+T+S+ +KYIPELQ+++E 
Sbjct  37   MDKKLKHNANERDRRRKINSLYYSLRCLLPPTDSMKRMSNPSTISKALKYIPELQQQVEG  96

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQIC--  647
            L+++K+ L +++N          E N ++           S  +   + E + ++QI   
Sbjct  97   LRRRKEGLVTKLN----------EENLKQIRKNNKEPWMSSLCAVNWLSETEALLQIALE  146

Query  648  SKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQG  788
             +  TQ  F+  L  LE +GL+L  +S+F++S   + F TL LQ + 
Sbjct  147  EQTHTQLPFSQILLSLEDDGLLLSTASSFRSSNGSL-FFTLLLQAKA  192



>gb|KHN14918.1| Transcription factor ORG2 [Glycine soja]
Length=303

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIP  449
            MVKKLSHN SERDRRKK+N L SSLR LLP  DQ  +MSIP TVSRV+KYIP
Sbjct  60   MVKKLSHNDSERDRRKKVNNLVSSLRLLLPVEDQTKKMSIPATVSRVLKYIP  111



>ref|XP_009796478.1| PREDICTED: transcription factor bHLH101-like [Nicotiana sylvestris]
Length=178

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 73/101 (72%), Gaps = 6/101 (6%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            +VKKL+HNASERDRRK  N L+SSLR LLPA+DQ  ++S+P TV RV+KYIPEL+KE+ER
Sbjct  65   IVKKLNHNASERDRRKNTNSLYSSLRFLLPATDQTKKVSLPATVGRVLKYIPELKKEVER  124

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNK---RRRVMGGHHHN  587
            L +KK+ LT R    ++ S    +FNK   RRR+     H+
Sbjct  125  LTQKKENLTLRSIPKKEYSA---DFNKQTLRRRIQNSLCHD  162



>ref|XP_010543098.1| PREDICTED: transcription factor ORG3-like isoform X1 [Tarenaya 
hassleriana]
Length=256

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 78/196 (40%), Positives = 120/196 (61%), Gaps = 20/196 (10%)
 Frame = +3

Query  297  VKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerl  476
             KKL HNASERDRRKK+N LFSSLRSLLP+SD   ++S+P TVS  + YI ELQ+++++L
Sbjct  63   AKKLGHNASERDRRKKINALFSSLRSLLPSSDHSKKLSLPATVSHALNYIGELQEQIKKL  122

Query  477  qkkkqelTSRVNSWQKISKSPPEFNKRRRV-------------MGGHHHNRQSYLSATQV  617
             +KK+EL   ++    I  S    +K R               +   +    S +SAT++
Sbjct  123  IQKKEELLLGLSRQTDIITS----HKGRDDDDDDDHGHDHDTPVKAMNVGFASIVSATRL  178

Query  618  GERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIE-  794
            GE ++++QI S K  +  F++ L+ LE++G VL+D+S+  +  DR+ F+TLH Q +  + 
Sbjct  179  GETELMVQISSPKTVKCSFSNVLTGLEEDGFVLIDASSSLSRGDRL-FYTLHFQAEVGDN  237

Query  795  -MMEVDKLKEKLLSYF  839
              + V  L +KLLS +
Sbjct  238  YKLNVQDLSDKLLSLY  253



>gb|EEC72172.1| hypothetical protein OsI_05220 [Oryza sativa Indica Group]
Length=181

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIP  449
            +KLSHNA ERDRRK++N L+SSLR+LLP +D   ++SIPTTVSRV+KYIP
Sbjct  70   RKLSHNAYERDRRKQLNELYSSLRALLPDADHTKKLSIPTTVSRVLKYIP  119



>ref|XP_008803360.1| PREDICTED: transcription factor bHLH101-like [Phoenix dactylifera]
Length=290

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 111/187 (59%), Gaps = 22/187 (12%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            K+LSHNA ERDRRKK+N L+SSLRSLLP +DQ  ++SIP+TVSRV+KYIPELQ+++E L 
Sbjct  112  KQLSHNAYERDRRKKLNSLYSSLRSLLPETDQSKKLSIPSTVSRVLKYIPELQRQVENLT  171

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNR---QSYLSATQVGERDIVIQIC-  647
            ++K+E    V+  ++                 H +N       +SAT +  +++++QIC 
Sbjct  172  RRKEENLLMVSRQEE-----------------HAYNSGIIYPIVSATCLNNKEVMLQICF  214

Query  648  SKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKL  827
              K  +  F+  L  LE EGL L+++ST  T  D+  F++LHLQ      +E     E L
Sbjct  215  LHKDVRLPFSKVLRVLEGEGLQLMNASTLTTHADK-TFYSLHLQASESGSIECQIFCEHL  273

Query  828  LSYFNEE  848
            +    E+
Sbjct  274  IKTIREQ  280



>ref|XP_004985006.1| PREDICTED: transcription factor bHLH100-like [Setaria italica]
Length=247

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 88/163 (54%), Gaps = 19/163 (12%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            +K +HNA ERDRRK +N L+SSL SLLP +D   + SI  TV+RV+KYIPELQ       
Sbjct  58   RKRNHNAYERDRRKHLNELYSSLHSLLPDADHAKKPSIAITVARVLKYIPELQ-------  110

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQI--CSK  653
                    +V + +   K     N ++  +     +    +S   + E +I++QI   S 
Sbjct  111  -------KQVENLEVRKKKLMNANCKQGALNP-SGSIAPIVSVNCLNEMEIMVQISFLSN  162

Query  654  KGTQNL-FADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQ  779
                 L F+  +  LE EGL L+ SSTF  +E+R  F++LHLQ
Sbjct  163  SAEATLPFSVFIEVLENEGLRLISSSTFSPTENRT-FYSLHLQ  204



>ref|XP_006838370.1| hypothetical protein AMTR_s00002p00041060 [Amborella trichopoda]
 gb|ERN00939.1| hypothetical protein AMTR_s00002p00041060 [Amborella trichopoda]
Length=252

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 60/172 (35%), Positives = 85/172 (49%), Gaps = 36/172 (21%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLP-ASDQKARMSIPTTVSRVVKYIPelqkelerl  476
            KK SHNA+ER+RRK++N  FS+LR LLP +S  K + SIPTTVS+ V YIP         
Sbjct  48   KKQSHNANERERRKRLNTAFSNLRFLLPDSSISKRKWSIPTTVSKAVDYIP---------  98

Query  477  qkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGH---HHNRQSYLSAT-------QVGER  626
                           ++ +   +  KRR  +      HH R   L++        +V + 
Sbjct  99   ---------------ELQREVDDLLKRREKLHASVSTHHERTHPLTSCLPTVTVIRVDQL  143

Query  627  DIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQV  782
            +I  QIC  K     F+  ++ LE EGL +   ST     +RV ++ LHLQV
Sbjct  144  EITTQICLSKAYSLPFSTLVARLEGEGLHVTSGSTSAICGNRVCYN-LHLQV  194



>emb|CBI23781.3| unnamed protein product [Vitis vinifera]
Length=320

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 95/163 (58%), Gaps = 14/163 (9%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            +++K +HNA ER RR ++N  + +LRSLLP + +  R S P  + RV++YIPEL+ E+E 
Sbjct  165  VLRKENHNAKERVRRMQLNASYLALRSLLPDARRSKRWSSPRIIDRVLEYIPELENEIEN  224

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L  KK+ + S + + Q     P +              +   +S T+V + ++++QIC +
Sbjct  225  LTLKKENMLSSLANEQTHQNQPSDL-------------QVPTVSVTEVRKGEVIVQICMQ  271

Query  654  KGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQV  782
            +   N+ ++ +  +E EG+ ++ +S+    ++RV +H LH+QV
Sbjct  272  REPGNVLSNLMQNVEGEGMRIMSASSLHVCDERVCYH-LHIQV  313



>ref|XP_010543164.1| PREDICTED: transcription factor ORG3-like isoform X2 [Tarenaya 
hassleriana]
Length=255

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 78/196 (40%), Positives = 121/196 (62%), Gaps = 21/196 (11%)
 Frame = +3

Query  297  VKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerl  476
             KKL HNASERDRRKK+N LFSSLRSLLP+SD  +++S+P TVS  + YI ELQ+++++L
Sbjct  63   AKKLGHNASERDRRKKINALFSSLRSLLPSSDH-SKLSLPATVSHALNYIGELQEQIKKL  121

Query  477  qkkkqelTSRVNSWQKISKSPPEFNKRRRV-------------MGGHHHNRQSYLSATQV  617
             +KK+EL   ++    I  S    +K R               +   +    S +SAT++
Sbjct  122  IQKKEELLLGLSRQTDIITS----HKGRDDDDDDDHGHDHDTPVKAMNVGFASIVSATRL  177

Query  618  GERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIE-  794
            GE ++++QI S K  +  F++ L+ LE++G VL+D+S+  +  DR+ F+TLH Q +  + 
Sbjct  178  GETELMVQISSPKTVKCSFSNVLTGLEEDGFVLIDASSSLSRGDRL-FYTLHFQAEVGDN  236

Query  795  -MMEVDKLKEKLLSYF  839
              + V  L +KLLS +
Sbjct  237  YKLNVQDLSDKLLSLY  252



>ref|XP_010030117.1| PREDICTED: uncharacterized protein LOC104419969 [Eucalyptus grandis]
Length=399

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 93/169 (55%), Gaps = 18/169 (11%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlq  479
            KK  HNA ER RR  +N  + +L ++LP    K R   P  +  V++YIPE++KE+E L 
Sbjct  220  KKEDHNAKERVRRMNLNACYMALANMLPPPSSKKRQGAPAIIDEVLEYIPEIKKEIEELT  279

Query  480  kkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQS-----YLSATQVGERDIVIQI  644
             +K+ + S ++            NK+  +    H + +S      LS  ++ + ++V+QI
Sbjct  280  LQKESMLSAIDP-----------NKQSVLNNSSHTSSESNEGRPTLSVHEIAKGELVLQI  328

Query  645  CSKKGTQN-LFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQG  788
            C+K+  +N   ++ L  LE EG+ +L++ST +   DRV FH +H+Q+  
Sbjct  329  CTKRDQRNHELSNLLWHLEAEGISILNASTVEVPHDRVCFH-IHVQMNA  376



>ref|XP_002269173.3| PREDICTED: uncharacterized protein LOC100258265 [Vitis vinifera]
Length=305

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/163 (32%), Positives = 94/163 (58%), Gaps = 15/163 (9%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLP-ASDQKARMSIPTTVSRVVKYIPelqkele  470
            +++K +HNA ER RR ++N  + +LRSLLP A   K R S P  + RV++YIPEL+ E+E
Sbjct  132  VLRKENHNAKERVRRMQLNASYLALRSLLPDARRSKKRWSSPRIIDRVLEYIPELENEIE  191

Query  471  rlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICS  650
             L  KK+ + S + + Q     P +              +   +S T+V + ++++QIC 
Sbjct  192  NLTLKKENMLSSLANEQTHQNQPSDL-------------QVPTVSVTEVRKGEVIVQICM  238

Query  651  KKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQ  779
            ++   N+ ++ +  +E EG+ ++ +S+    ++RV +H LH+Q
Sbjct  239  QREPGNVLSNLMQNVEGEGMRIMSASSLHVCDERVCYH-LHIQ  280



>emb|CDY23861.1| BnaC04g01760D [Brassica napus]
Length=140

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 92/138 (67%), Gaps = 6/138 (4%)
 Frame = +3

Query  354  LFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISK  533
            +FSSLRS LPASDQ  ++S+  TVS  + YIPELQ+++++L KKK +L+ +++  + +  
Sbjct  1    MFSSLRSCLPASDQSKKLSVSATVSHALNYIPELQEQVKQLIKKKDDLSFQISGQKDLVY  60

Query  534  SPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLV  713
            +    N  +   GG  +   S +SAT++GE ++++QI S +  +  F + L  +E++GLV
Sbjct  61   ADQNGNPEK---GGTRY--ASTVSATRLGETEVMVQISSLQTVKCSFGNLLGGIEEDGLV  115

Query  714  LLDSSTFQTSEDRVNFHT  767
            L+D+S+ ++  +R+ F+T
Sbjct  116  LMDASSSRSQGERL-FYT  132



>ref|XP_011087740.1| PREDICTED: transcription factor bHLH100 [Sesamum indicum]
Length=311

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 97/194 (50%), Gaps = 27/194 (14%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQ-KARMSIPTTVSRVVKYIPelqkele  470
            + KKL HNA ER RR K+N  + +LRSLLP S + K R S P  V RVVKYIP      E
Sbjct  132  VAKKLDHNAKERIRRMKLNASYLALRSLLPDSRRSKKRWSAPAIVERVVKYIP------E  185

Query  471  rlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQIC-  647
               + +   + + N  Q+ S S      ++++    H N    +   ++ + + V+Q+C 
Sbjct  186  LENEVEALRSKKDNIVQQSSTS------KKKIASAEHQNL--TVCVNKINQEEAVVQVCM  237

Query  648  -----SKKGTQNLFADALSCLE-QEGLVLLDS-STFQTSEDRVNFHTLHLQV-QGIEMME  803
                  + G    F + L  +E  EG+  + S ST    E R+  H LH+QV Q     E
Sbjct  238  GSREDDEDGEVVGFTNLLQAVEDDEGICNIKSASTVDVCESRICCH-LHIQVNQSSSEAE  296

Query  804  --VDKLKEKLLSYF  839
              +++LK+K++S  
Sbjct  297  GYIEELKDKIISRL  310



>ref|XP_010268963.1| PREDICTED: transcription factor ORG2-like [Nelumbo nucifera]
Length=175

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 58/173 (34%), Positives = 96/173 (55%), Gaps = 19/173 (11%)
 Frame = +3

Query  342  KMNGLFSSLRSLLPASDQ-KARMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSW  518
            K+N  + +LRSLLP S + K + S P  V +V++YIPEL+ E+E L +KK+++ S +   
Sbjct  2    KLNASYLALRSLLPDSHRSKKKWSAPVVVGKVLEYIPELETEIEDLTQKKEQMISMIEKR  61

Query  519  Q--KISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKKGTQNLFADALSC  692
            Q   I  SP EF                 +S T+V + +++IQIC K+   ++ +  ++ 
Sbjct  62   QITPIQASPSEFET-------------PTVSVTEVRKGEVIIQICMKRENSSVLSTLIAN  108

Query  693  LEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMME--VDKLKEKLLSYFNE  845
             E EG+ ++ +S    S+DRV +H LHL V G       ++ L+ K+LS+  E
Sbjct  109  AEGEGMQIVSASALPVSDDRVCYH-LHLHVNGSSERSDYIEVLRTKILSWSCE  160



>ref|XP_006421111.1| hypothetical protein CICLE_v10006413mg, partial [Citrus clementina]
 gb|ESR34351.1| hypothetical protein CICLE_v10006413mg, partial [Citrus clementina]
Length=140

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIP  449
            MVKKL HNASERDRRKK+N L+SSLRSLLP +DQ  ++SIP TVSRV+KYIP
Sbjct  63   MVKKLYHNASERDRRKKINSLYSSLRSLLPVADQTKKLSIPATVSRVLKYIP  114



>gb|KCW84374.1| hypothetical protein EUGRSUZ_B01225 [Eucalyptus grandis]
Length=129

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 67/131 (51%), Gaps = 16/131 (12%)
 Frame = +3

Query  51   MSFPNMGWSIDDYISHEQFGTDLYSNAAGDTSPDAPPPHFVSL-PSSPLPPAMERCDSLK  227
            +SF   GW ++   S EQ   + Y +    T    P  HF  L P +P P A +  D L 
Sbjct  2    LSFSPSGWPLEGSTSQEQ---ESYMHRDAYTCYSPPLVHFPFLSPPTPSPLAEQAFDPLG  58

Query  228  FdggstdigsggggggdsatagMVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARM  407
               G                  MVKKL+HNASERDRRKKMN L+S+LRSLLPA+DQ   +
Sbjct  59   IPFGVVKDEEAT----------MVKKLNHNASERDRRKKMNSLYSTLRSLLPAADQ--MV  106

Query  408  SIPTTVSRVVK  440
             IP  +S + +
Sbjct  107  IIPMLLSYIFE  117



>ref|XP_010679419.1| PREDICTED: transcription factor bHLH101 [Beta vulgaris subsp. 
vulgaris]
Length=227

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 98/184 (53%), Gaps = 10/184 (5%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQ-KARMSIPTTVSRVVKYIPelqkelerl  476
            KKL HNA E+ RR K+N  + + RSLLP S + K R S P  + R + YIP+LQ E+E+L
Sbjct  51   KKLDHNAKEKVRRMKLNETYLAFRSLLPDSKRAKKRWSAPYIIDRALDYIPQLQAEIEKL  110

Query  477  qkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKK  656
              +K+ + + +   Q++ +   + N            +   +S  +V   ++++QIC + 
Sbjct  111  TLEKKNMLTMLEKKQQLVERSKDHN------NATEDKKTLTVSMNEVKIGEVIVQICEQN  164

Query  657  GTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQV--QGIEMMEVDKLKEKLL  830
                +    +  LE E + ++ +S+ +  EDR  FH +H+Q+    +E   V  L +K++
Sbjct  165  NKIGMLPTLIEKLEGESMQIVGASSQRACEDRSCFH-IHVQMGENPVEADYVAILHKKII  223

Query  831  SYFN  842
            S+ +
Sbjct  224  SWLS  227



>gb|EPS74183.1| hypothetical protein M569_00579 [Genlisea aurea]
Length=171

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 88/167 (53%), Gaps = 26/167 (16%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPA---SDQKARMSIPTTVSRVVKYIPelqkele  470
            KK   + +ERDRRKKM  L+S+L SLLP    S    R+SIP T+SR V+YIPEL+    
Sbjct  7    KKKIRSDAERDRRKKMKHLYSTLSSLLPPPQDSSVTKRVSIPATISRAVEYIPELE----  62

Query  471  rlqkkkqelTSRVNSW--QKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQI  644
                       RV     ++ S    + ++RRR    HH      L+ T + +   V+QI
Sbjct  63   ----------KRVEGMISERQSLLLKKLSRRRRNCLAHH------LTVTPINDELTVVQI  106

Query  645  CSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQ  785
             ++    + F++A+  LE +G V+L +S+F +S       TLHL+ Q
Sbjct  107  SAEARCDSSFSEAVMVLEMDGFVVLSASSFASSSG-PTLLTLHLKSQ  152



>emb|CDX76032.1| BnaA04g02960D [Brassica napus]
Length=224

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 84/160 (53%), Gaps = 13/160 (8%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            + KKL+HNASERDR KK+  LFSSLRS LPASD        +     ++YIP   +E  +
Sbjct  68   VTKKLNHNASERDRHKKIKSLFSSLRSCLPASDPVKEAKYSSDGFSELEYIP-ELQEEVK  126

Query  474  lqkkkqelTSRVNSWQKIS---KSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQI  644
               KK+EL  RV+  + I    +  P+ +  R V         S +SAT++G+ ++++QI
Sbjct  127  KLIKKKELLVRVSGQRAIEHYVEPQPKTDVARYV---------STISATKLGDNEVMVQI  177

Query  645  CSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFH  764
             S K      ++ LS LE++G        F+ S  +   H
Sbjct  178  SSSKIHNFSISNVLSGLEEDGFCSYGYFIFKVSRRKTLLH  217



>emb|CDM84249.1| unnamed protein product [Triticum aestivum]
Length=215

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 93/170 (55%), Gaps = 37/170 (22%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKAR-MSIPTTVSRVVKYIPelqkelerl  476
            +K+SH+A ERD RK++N  +S+LRSLLP  D   R +  PT VSRV+KYIPELQKE++ L
Sbjct  63   RKMSHSAYERDSRKQLNEHYSNLRSLLPDDDHHTRKLGNPTIVSRVIKYIPELQKEVDGL  122

Query  477  qkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKK  656
            +KKK++LT R +       +P                    +SAT + +R+I++Q+    
Sbjct  123  EKKKEQLT-RASCRPGDGTAP-------------------IVSATCLDDREIMVQV----  158

Query  657  GTQNLFADAL------SCLEQEGLVLLDS--STFQTSEDRVNFHTLHLQV  782
               N  A AL        LE +GL L+ S  S FQ       F++LHLQ 
Sbjct  159  SLLNTMAGALPMSKCIKVLENQGLCLISSSASAFQNR----TFYSLHLQA  204



>ref|XP_010543536.1| PREDICTED: transcription factor bHLH101 isoform X2 [Tarenaya 
hassleriana]
Length=230

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 112/179 (63%), Gaps = 6/179 (3%)
 Frame = +3

Query  297  VKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerl  476
            +KKLSHNASERDRRKK+N L+SSLRSLLP SD   ++SIP TVS V+KYIPEL++E+ER+
Sbjct  48   MKKLSHNASERDRRKKLNSLYSSLRSLLPRSDHTKKLSIPGTVSYVLKYIPELRQEVERM  107

Query  477  qkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKK  656
             +KK++L  R++    +S +       +R       +    +  +++ + +  +QI +  
Sbjct  108  CRKKEQLLKRISRQGPVSSAHEHEQHMQRPTNK---DLSPMILTSRLTDTEFAVQIANLN  164

Query  657  GTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLLS  833
             +Q   +D L  LE+  + ++  S+   S  RV  HTLHLQ+ G  +++ ++L + +L+
Sbjct  165  KSQ--ISDTLLGLEESSMEVISVSSSVYSNTRV-MHTLHLQMDGDCVVKAEELSDVILA  220



>ref|XP_006471125.1| PREDICTED: uncharacterized protein LOC102625584 [Citrus sinensis]
Length=398

 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 93/179 (52%), Gaps = 16/179 (9%)
 Frame = +3

Query  312  HNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlqkkkq  491
            HNA ER RR K+   + SL +LLP S+ K + S P  + R ++YIPEL+ E+E+L  KK 
Sbjct  232  HNAKERVRRMKLYATYLSLGALLPDSESKKKRSAPAIIDRALEYIPELENEIEKLTLKKD  291

Query  492  elTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQ-ICSKKGTQN  668
             + S++             NK+R        +    +   +V + D++IQ ICS    + 
Sbjct  292  NMLSKIE------------NKQRHNQNLQLEHEAPSVLVHEVEKGDVIIQIICSPNDEKT  339

Query  669  LFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMME--VDKLKEKLLSYF  839
            +F+  L  LE +   ++  ST    E RV +H LH+Q+Q   +    V+ L++ ++S+ 
Sbjct  340  VFSKLLQNLEAKEKGIISVSTLCVCEKRVCYH-LHIQMQKDSLATDYVEVLRQDVISWL  397



>gb|KDO53475.1| hypothetical protein CISIN_1g036457mg [Citrus sinensis]
Length=398

 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 93/179 (52%), Gaps = 16/179 (9%)
 Frame = +3

Query  312  HNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlqkkkq  491
            HNA ER RR K+   + SL +LLP S+ K + S P  + R ++YIPEL+ E+E+L  KK 
Sbjct  232  HNAKERVRRMKLYATYLSLGALLPDSESKKKRSAPAIIDRALEYIPELENEIEKLTLKKD  291

Query  492  elTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQ-ICSKKGTQN  668
             + S++             NK+R        +    +   +V + D++IQ ICS    + 
Sbjct  292  NMLSKIE------------NKQRHNQNLQLEHEAPSVLVHEVEKGDVIIQIICSPNDEKT  339

Query  669  LFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMME--VDKLKEKLLSYF  839
            +F+  L  LE +   ++  ST    E RV +H LH+Q+Q   +    V+ L++ ++S+ 
Sbjct  340  VFSKLLQNLEAKEKGIISVSTLCVCEKRVCYH-LHIQMQKDSLATDYVEVLRQDVISWL  397



>ref|XP_010507674.1| PREDICTED: transcription factor bHLH100-like [Camelina sativa]
Length=175

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 50/157 (32%), Positives = 100/157 (64%), Gaps = 7/157 (4%)
 Frame = +3

Query  369  RSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEF  548
            RS LP ++Q  ++S+  TVS+ +KYIPELQ+++++L KKK+EL+ +++  + +  +    
Sbjct  18   RSCLPPNNQSKQLSVSATVSQALKYIPELQEQVKKLMKKKEELSFQISGPRDLVYTEQNG  77

Query  549  NKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSS  728
               + V      +  S +SAT++GE ++++QI S       F + L+ +E++GLVL+D+S
Sbjct  78   KPEKGVT-----SYASTVSATRLGETEVMVQISSLHTCNCSFGNVLNGVEEDGLVLVDAS  132

Query  729  TFQTSEDRVNFHTLHLQVQGIEMMEVDKLKEKLLSYF  839
            + ++  +R+ F+TLHL +   + +  ++L ++LL  +
Sbjct  133  SSRSQGERL-FYTLHLWMDNCK-LNSEELSDRLLYLY  167



>gb|EYU26529.1| hypothetical protein MIMGU_mgv1a019680mg [Erythranthe guttata]
Length=270

 Score = 62.8 bits (151),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 86/166 (52%), Gaps = 13/166 (8%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkeler  473
            + KKL HNA ER RR K+N  + +LRSL+P S +  R S P+ + RV+ YIPELQ E++ 
Sbjct  113  IAKKLHHNAKERIRRMKVNASYLALRSLMPDSRRSKRWSAPSIIDRVLNYIPELQSEVKA  172

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSK  653
            L+ KK+       + + I  +    N         + +   +L+  ++   + +IQIC  
Sbjct  173  LKSKKETAKLAAKAKKIIIANNIPTN-------SQYESPAVFLN--RIKRDEAIIQICIA  223

Query  654  KGTQNL---FADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQV  782
            +  +N    F + L  LE EG+ +  SS     E R+    LH+QV
Sbjct  224  RSEENRGSSFTNLLQSLEDEGICIKSSSVLVVCERRI-CCNLHVQV  268



>ref|XP_010543534.1| PREDICTED: transcription factor bHLH101 isoform X1 [Tarenaya 
hassleriana]
Length=231

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 113/190 (59%), Gaps = 27/190 (14%)
 Frame = +3

Query  297  VKKLSHNASERDRRKKMNGLFSSLRSLLPASDQ-KARMSIPTTVSRVVKYIPelqkeler  473
            +KKLSHNASERDRRKK+N L+SSLRSLLP SD  + ++SIP TVS V+KYIPEL++E+ER
Sbjct  48   MKKLSHNASERDRRKKLNSLYSSLRSLLPRSDHTQKKLSIPGTVSYVLKYIPELRQEVER  107

Query  474  lqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQS----------YLSATQVGE  623
            + +KK++L  R      IS+  P       V   H H +             +  +++ +
Sbjct  108  MCRKKEQLLKR------ISRQGP-------VSSAHEHEQHMQRPTNKDLSPMILTSRLTD  154

Query  624  RDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMME  803
             +  +QI +   +Q   +D L  LE+  + ++  S+   S  RV  HTLHLQ+ G  +++
Sbjct  155  TEFAVQIANLNKSQ--ISDTLLGLEESSMEVISVSSSVYSNTRV-MHTLHLQMDGDCVVK  211

Query  804  VDKLKEKLLS  833
             ++L + +L+
Sbjct  212  AEELSDVILA  221



>gb|EMS55484.1| Transcription factor ORG2 [Triticum urartu]
Length=184

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKAR-MSIPTTVSRVVKYIP  449
            +K+SH+A ERD RK++N  +S+LRSLLP  D   R ++ PT VSRV+KYIP
Sbjct  61   RKMSHSAYERDSRKQLNEHYSNLRSLLPDDDHHTRKLNNPTIVSRVIKYIP  111



>gb|EMT11154.1| hypothetical protein F775_52460 [Aegilops tauschii]
Length=231

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 92/163 (56%), Gaps = 28/163 (17%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQKAR-MSIPTTVSRVVKYIPelqkelerl  476
            +K+SH+A ERD RK++N  +S+LRSLLP  D   R +  PT VSRV+KYIPELQKE++ L
Sbjct  63   RKMSHSAYERDSRKQLNEHYSNLRSLLPDDDHHTRKLGNPTIVSRVIKYIPELQKEVDGL  122

Query  477  qkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQICSKK  656
            +KKK++LT R +       +P         +G          S   + +R+I++ + +  
Sbjct  123  EKKKEQLT-RASCRPGDDTAP---------IG----------SRPCLDDREIMVLLNTMA  162

Query  657  GTQNLFADALSCLEQEGLVLLDS--STFQTSEDRVNFHTLHLQ  779
            G   + +  +  LE +GL L+ S  S FQ       F++LHLQ
Sbjct  163  GALPM-SKCIKVLENQGLCLISSSASAFQNR----TFYSLHLQ  200



>ref|XP_010042285.1| PREDICTED: transcription factor ORG2-like, partial [Eucalyptus 
grandis]
Length=166

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 92/153 (60%), Gaps = 10/153 (7%)
 Frame = +3

Query  402  RMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHH  581
            ++S+PTTVSR +K+IPELQ+++E+L ++K++L SR+N+    S+    +   + +  G  
Sbjct  2    KLSVPTTVSRALKHIPELQQQVEKLTQEKEKLLSRINA----SRDGDYYTSHQEISTGKG  57

Query  582  HNRQSY--LSATQVGERDIVIQICSKKGTQNL---FADALSCLEQEGLVLLDSSTFQTSE  746
              +     +SAT++ E ++ IQI ++K   +    F++ L  L+  G  ++ SSTF++  
Sbjct  58   ALQILVPSISATRLSESEVAIQISTRKVMTHKTVDFSEVLLALDYLGFPVISSSTFESCG  117

Query  747  D-RVNFHTLHLQVQGIEMMEVDKLKEKLLSYFN  842
              +  F+ LH+QV+    +E   LKEKL + F+
Sbjct  118  GMKTTFYNLHVQVERSRGVECGDLKEKLSALFD  150



>ref|XP_006431857.1| hypothetical protein CICLE_v10001998mg [Citrus clementina]
 gb|ESR45097.1| hypothetical protein CICLE_v10001998mg [Citrus clementina]
Length=299

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 96/179 (54%), Gaps = 16/179 (9%)
 Frame = +3

Query  312  HNASERDRRKKMNGLFSSLRSLLPASDQKARMSIPTTVSRVVKYIPelqkelerlqkkkq  491
            HNA ER RR K+   + SL +LLP S+ K + S P  + R ++YIPEL+ E+E+L  KK 
Sbjct  133  HNAKERVRRMKLYATYGSLGALLPDSESKKKRSAPAIIDRALEYIPELENEIEKLTLKKN  192

Query  492  elTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQ-ICSKKGTQN  668
             + S++ + Q         N+  ++     H   S L   +V + +++IQ ICS    + 
Sbjct  193  NMLSKIENKQ-------HDNQNLQL----EHEAPSVL-VHEVEKGEVIIQIICSPNDEKT  240

Query  669  LFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIEMME--VDKLKEKLLSYF  839
            LF+  L  LE +   ++  ST    E RV +H LH++++   +    V+ L++ ++S+ 
Sbjct  241  LFSKLLQNLEAKEKGIISVSTLCVWEKRVCYH-LHIRMKKDSLATDYVEVLRQDVISWL  298



>ref|XP_002529548.1| hypothetical protein RCOM_0407930 [Ricinus communis]
 gb|EEF32851.1| hypothetical protein RCOM_0407930 [Ricinus communis]
Length=260

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 83/166 (50%), Gaps = 24/166 (14%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQ-KARMSIPTTVSRVVKYIPelqkelerl  476
            KK  HNA E+ RR K+N  + +L SLL  S + K R + P  V +V++YIPELQ E+E L
Sbjct  105  KKQQHNAKEKVRRMKLNASYLALGSLLSNSRRSKKRWTAPVIVDKVLEYIPELQSEIEEL  164

Query  477  qkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSA-----TQVGERDIVIQ  641
              KK  + S++ + Q I                  HN    L A      +V   +++IQ
Sbjct  165  ILKKNSMVSKIKNEQAI-----------------QHNASVELQAPTVSVHEVKHGELIIQ  207

Query  642  ICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQ  779
            IC +       +  +  LE E +V+  +S+    +DR+ +H +H+Q
Sbjct  208  ICMQTDQDKGLSILMQNLEAESMVISSASSIGVCDDRICYH-VHIQ  252



>ref|XP_008449406.1| PREDICTED: transcription factor bHLH100 [Cucumis melo]
Length=301

 Score = 57.0 bits (136),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 89/169 (53%), Gaps = 6/169 (4%)
 Frame = +3

Query  297  VKKLSHNASERDRRKKMNGLFSSLRSLLP-ASDQKARMSIPTTVSRVVKYIPelqkeler  473
             KK  HNA ER RR +++  + SLRSLLP A   K R S  T + +VV YIP LQKE+E+
Sbjct  107  AKKEEHNARERQRRLELSHSYFSLRSLLPNARRSKKRWSSGTIIDKVVDYIPTLQKEIEK  166

Query  474  lqkkkq---elTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDIVIQI  644
            + +KKQ   +   R+ S     +     ++   +   +++N    +S  Q+ E +++IQI
Sbjct  167  MNQKKQNLIKAKERIMSNNNAERVLVSVDENEGLDNQYYNNINPTVSIHQLCEGEVIIQI  226

Query  645  C--SKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQ  785
            C   +    N  ++ +   E+EGL ++ +ST   S       T HL VQ
Sbjct  227  CINPRNSNNNKLSNLIQKAEEEGLRIIGASTVSVSHHDHQILTSHLHVQ  275



>ref|XP_007203481.1| hypothetical protein PRUPE_ppa022341mg, partial [Prunus persica]
 gb|EMJ04680.1| hypothetical protein PRUPE_ppa022341mg, partial [Prunus persica]
Length=163

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  294  MVKKLSHNASERDRRKKMNGLFSSLRSLLPASDQ  395
            +VKKL+HNASER+RRKK+N L+S+LRSL PA DQ
Sbjct  42   VVKKLNHNASERERRKKINTLYSTLRSLFPAPDQ  75



>gb|EMS49002.1| Transcription factor ORG2 [Triticum urartu]
Length=216

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 71/148 (48%), Gaps = 25/148 (17%)
 Frame = +3

Query  396  KARMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGG  575
            K +MSIPTTVSRV+KYIPELQKE+                   + K   E  +     G 
Sbjct  42   KKKMSIPTTVSRVIKYIPELQKEV-----------------DGLEKKKEELRRASCEQGA  84

Query  576  HHHNRQSYLSATQVGERDIVIQI--CSKKGTQNLFADALSCLEQEGLVLLDSST--FQTS  743
               N    +SAT + +R+I++Q+   S        +  +  LE +GL L++SST  FQ  
Sbjct  85   MRQNTAPIVSATCLDDREIMVQVSLVSTMAGALPMSKCIKVLENQGLRLINSSTSAFQNR  144

Query  744  EDRVNFHTLHLQVQGIEMMEVDKLKEKL  827
                 F++LHLQV         +LK KL
Sbjct  145  ----TFYSLHLQVWKFSEGNSCRLKFKL  168



>ref|XP_007042240.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
[Theobroma cacao]
 gb|EOX98071.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
[Theobroma cacao]
Length=160

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/173 (28%), Positives = 96/173 (55%), Gaps = 22/173 (13%)
 Frame = +3

Query  342  KMNGLFSSLRSLLP-ASDQKARMSIPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSW  518
            K++  + +L +L+P +S  K R S P  + R V+YIPEL++E+E+L  +K ++ S +   
Sbjct  2    KLHASYLALGALIPDSSRSKKRKSAPLIIDRSVEYIPELEEEIEKLTLRKNDMLSTIKHK  61

Query  519  QKISKSPPEFNKRRRVMGGHHH---NRQSYLSATQVGERDIVIQICSKKGTQNLFADALS  689
            Q ++++P              H   ++   +S  ++ + +++ QI S+    + F++ L 
Sbjct  62   QPLNQNP--------------HLKPDQDPSVSVHEIRQGEVITQIYSQIHPDDAFSNLLQ  107

Query  690  CLEQEGLVLLDSSTFQTSEDRVNFHTLHLQVQGIE---MMEVDKLKEKLLSYF  839
             +E+EG+ ++ +ST Q S+D V +H LH+Q  G        +  L+EK++S+ 
Sbjct  108  KVEEEGMCIMSASTLQVSDDGVCYH-LHIQQGGASSGGANHLASLREKVISWL  159



>ref|XP_002529549.1| hypothetical protein RCOM_0408240 [Ricinus communis]
 gb|EEF32852.1| hypothetical protein RCOM_0408240 [Ricinus communis]
Length=395

 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 48/151 (32%), Positives = 74/151 (49%), Gaps = 23/151 (15%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLPASDQ-KARMSIPTTVSRVVKYIPelqkelerl  476
            KK  HNA E+ RR K+N  + +L SLLP S + K R + P  + +V++YIPE+Q E+E L
Sbjct  241  KKQEHNAKEKVRRMKLNASYLALGSLLPNSRRSKKRWTAPVIIDKVLEYIPEVQSEIEEL  300

Query  477  qkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGERDI-----VIQ  641
              KK  + S++ + Q I                  HN    L A  V   +I     +IQ
Sbjct  301  ILKKNSIVSKIKNGQAI-----------------QHNASVELQAPTVSVHEIKHGELIIQ  343

Query  642  ICSKKGTQNLFADALSCLEQEGLVLLDSSTF  734
            +C +       +  +  LE EG+V+  +S+ 
Sbjct  344  VCMQTNQDKGLSILMQNLEAEGMVISSASSI  374



>emb|CDX72783.1| BnaC06g32310D [Brassica napus]
Length=238

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 89/168 (53%), Gaps = 22/168 (13%)
 Frame = +3

Query  300  KKLSHNASERDRRKKMNGLFSSLRSLLP--ASDQKARMSIPTTVSRVVKYIPelqkeler  473
            KK   NA+ER RR +++  + +L +LLP  +S  K +   P+ + RVV YIP+L  E+E 
Sbjct  63   KKQERNANERLRRMRLHASYLTLGTLLPDQSSSSKKKWCAPSIMDRVVTYIPKLLNEVEE  122

Query  474  lqkkkqelTSRVNSW--QKISKSPPEFNKRRRVMGGHHHNRQSYLSATQVGER--DIVIQ  641
            L  +K++L   + S   Q++ +  P+                  +S  ++GE   ++V+Q
Sbjct  123  LTIRKKKLAEAIESEKSQRLERQDPQTR---------------AISVLELGESGDEVVVQ  167

Query  642  ICSKKGTQNLFADALSCLEQEGLVLLDSST-FQTSEDRVNFHTLHLQV  782
            I  KK  ++ F++ L+ +E +G  +L +ST       RV  + LH+++
Sbjct  168  ISMKKEKEDEFSNLLNVMEMQGSSILSASTSLVCRHQRVVCYNLHVKM  215



>ref|XP_009627446.1| PREDICTED: transcription factor ORG3-like [Nicotiana tomentosiformis]
Length=150

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 80/122 (66%), Gaps = 7/122 (6%)
 Frame = +3

Query  411  IPTTVSRVVKYIPelqkelerlqkkkqelTSRVNSWQKISKSPPEFNKRRRVMGGHHHNR  590
            +P TV+R +KYIPEL+KE+ERL +KK++LT R    ++ S    +FNK+   + G   N 
Sbjct  33   LPATVARTLKYIPELKKEVERLTQKKEDLTLRSIPKKEYS---ADFNKQ--TLRGRIQNS  87

Query  591  QSYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTL  770
             S +SA QVG+R+I IQI   K  ++ FA+A+S LE+E L LL +S FQT   ++ F T+
Sbjct  88   LSIVSANQVGDREITIQISILKTNKSSFAEAISELEEEELHLLIASCFQTC--KIEFSTI  145

Query  771  HL  776
             +
Sbjct  146  CI  147



>ref|XP_010507673.1| PREDICTED: transcription factor bHLH100-like [Camelina sativa]
Length=122

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 55/82 (67%), Gaps = 2/82 (2%)
 Frame = +3

Query  594  SYLSATQVGERDIVIQICSKKGTQNLFADALSCLEQEGLVLLDSSTFQTSEDRVNFHTLH  773
            S +SAT++GE ++++QI S       F + L+ +E++GLVL+D+S+ ++  +R+ F+TLH
Sbjct  35   STVSATRLGETEVMVQISSLHTCNCSFGNVLNGVEEDGLVLVDASSSRSQGERL-FYTLH  93

Query  774  LQVQGIEMMEVDKLKEKLLSYF  839
            L +   + +  ++L ++LL  +
Sbjct  94   LWMDNCK-LNSEELSDRLLYLY  114



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2691533780576