BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13141_g1_i2 len=1983 path=[2238:0-1141 3421:1142-1982]

Length=1983
                                                                      Score     E

ref|XP_009606034.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    372   0.0      
ref|XP_009606035.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    372   0.0      
ref|XP_009792347.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    375   0.0      
ref|XP_009792348.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    375   0.0      
ref|XP_006345714.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    364   0.0      
ref|XP_004247263.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    361   0.0      
emb|CDP11722.1|  unnamed protein product                                346   0.0      
ref|XP_011089613.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    325   3e-173   
ref|XP_011089615.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    323   2e-172   
ref|XP_010645230.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    329   8e-171   
ref|XP_002527264.1|  ribonuclease, putative                             324   2e-170   Ricinus communis
ref|XP_010095607.1|  Poly(A)-specific ribonuclease PARN-like protein    318   6e-168   
ref|XP_008235891.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    329   2e-167   
ref|XP_009358962.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    325   4e-166   
ref|XP_009334241.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    319   2e-165   
ref|XP_011089616.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    326   2e-165   
ref|XP_007049584.1|  Polynucleotidyl transferase, ribonuclease H-...    308   9e-165   
gb|KDO58560.1|  hypothetical protein CISIN_1g006991mg                   305   4e-163   
ref|XP_010245934.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    301   2e-162   
gb|KDO58559.1|  hypothetical protein CISIN_1g006991mg                   305   5e-162   
ref|XP_006492222.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    302   4e-161   
ref|XP_008348961.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    322   5e-161   
ref|XP_010678977.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    303   4e-160   
ref|XP_010678978.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    303   5e-160   
ref|XP_011009330.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    303   3e-159   
gb|KHG18699.1|  Poly(A)-specific ribonuclease PARN-like                 295   3e-158   
gb|KHG18700.1|  Poly(A)-specific ribonuclease PARN-like                 295   7e-158   
ref|XP_008382764.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    306   2e-157   
gb|EYU40665.1|  hypothetical protein MIMGU_mgv1a018070mg                295   1e-155   
ref|XP_004492234.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    301   3e-151   
ref|XP_004492235.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    301   9e-151   
ref|XP_009358963.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    326   1e-150   
ref|XP_010532929.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    281   2e-150   
ref|XP_010943605.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    278   3e-148   
ref|NP_189170.1|  poly(A)-specific ribonuclease PARN-like protein       290   2e-147   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB01314.1|  unnamed protein product                                290   3e-147   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008364676.1|  PREDICTED: LOW QUALITY PROTEIN: poly(A)-spec...    302   3e-147   
ref|XP_003532241.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    293   4e-147   
ref|XP_006299254.1|  hypothetical protein CARUB_v10015403mg             290   1e-146   
ref|XP_004148964.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    281   3e-146   
ref|XP_004161545.1|  PREDICTED: LOW QUALITY PROTEIN: poly(A)-spec...    280   4e-146   
ref|XP_006418630.1|  hypothetical protein EUTSA_v10002449mg             287   7e-146   
ref|XP_010466956.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    289   3e-145   
gb|KFK39842.1|  hypothetical protein AALP_AA3G294900                    274   2e-144   
ref|XP_007140707.1|  hypothetical protein PHAVU_008G135000g             291   3e-144   
gb|KFK39841.1|  hypothetical protein AALP_AA3G294900                    273   4e-144   
emb|CDY00839.1|  BnaCnng00390D                                          280   8e-144   
emb|CDY27893.1|  BnaA07g04830D                                          283   1e-143   
ref|XP_010488642.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    284   2e-143   
ref|XP_010514159.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    282   3e-143   
ref|XP_009102413.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    279   1e-142   
ref|XP_009415962.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    266   3e-141   
ref|XP_010069588.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    278   6e-141   
ref|XP_008451634.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    265   4e-139   
ref|XP_008799184.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    265   2e-138   
ref|XP_002883605.1|  predicted protein                                  288   1e-137   
ref|XP_002444414.1|  hypothetical protein SORBIDRAFT_07g021600          252   8e-125   Sorghum bicolor [broomcorn]
ref|XP_003572239.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    243   2e-124   
gb|EEE68767.1|  hypothetical protein OsJ_27469                          239   4e-123   Oryza sativa Japonica Group [Japonica rice]
gb|EEC83639.1|  hypothetical protein OsI_29373                          239   1e-122   Oryza sativa Indica Group [Indian rice]
ref|XP_004973547.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    234   7e-122   
ref|XP_002320703.1|  hypothetical protein POPTR_0014s01880g             277   7e-122   Populus trichocarpa [western balsam poplar]
ref|XP_006447983.1|  hypothetical protein CICLE_v10014999mg             303   4e-117   
dbj|BAK06461.1|  predicted protein                                      241   1e-116   
ref|XP_010466957.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    255   2e-109   
ref|XP_008235892.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    291   3e-109   
ref|XP_008799186.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    257   2e-107   
ref|XP_007201614.1|  hypothetical protein PRUPE_ppa019832mg             327   9e-102   
gb|KDP45240.1|  hypothetical protein JCGZ_15105                         321   8e-100   
gb|ABK95700.1|  unknown                                                 300   4e-98    Populus trichocarpa [western balsam poplar]
emb|CBI35579.3|  unnamed protein product                                329   5e-93    
ref|XP_007049585.1|  Poly(A)-specific ribonuclease PARN-like, put...    308   2e-91    
ref|XP_010069587.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    279   2e-91    
ref|XP_003622727.1|  Poly(A)-specific ribonuclease PARN-like protein    278   2e-89    
ref|XP_002321324.2|  hypothetical protein POPTR_0014s175702g            293   5e-89    Populus trichocarpa [western balsam poplar]
ref|XP_002321239.2|  hypothetical protein POPTR_0014s175701g            275   6e-84    Populus trichocarpa [western balsam poplar]
gb|EPS58289.1|  hypothetical protein M569_16526                         270   1e-81    
ref|XP_006847462.1|  hypothetical protein AMTR_s00163p00014030          271   5e-81    
ref|XP_008799185.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    265   5e-78    
ref|XP_007049586.1|  Poly(A)-specific ribonuclease PARN-like, put...    268   1e-77    
ref|XP_008678596.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    241   6e-71    
ref|NP_001061902.1|  Os08g0440200                                       240   1e-69    Oryza sativa Japonica Group [Japonica rice]
gb|EMT01997.1|  Poly(A)-specific ribonuclease PARN-like protein         201   1e-52    
ref|XP_003622728.1|  Poly(A)-specific ribonuclease PARN-like protein    189   6e-52    
ref|XP_008465472.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    185   5e-51    
ref|XP_008465473.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    183   2e-50    
ref|NP_001169910.1|  uncharacterized protein LOC100383807               181   3e-48    Zea mays [maize]
ref|XP_004292332.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    173   6e-46    
ref|XP_004148252.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    168   5e-41    
ref|XP_008449056.1|  PREDICTED: poly(A)-specific ribonuclease PARN      164   1e-39    
ref|XP_010273436.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    164   2e-39    
ref|XP_010273437.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    159   6e-39    
gb|KHF97874.1|  Poly (A)-specific ribonuclease PARN -like protein       161   1e-38    
ref|XP_009391781.1|  PREDICTED: poly(A)-specific ribonuclease PARN      160   3e-38    
ref|XP_010942842.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    157   3e-38    
ref|XP_006392591.1|  hypothetical protein EUTSA_v10011283mg             160   3e-38    
ref|XP_010273434.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    159   6e-38    
ref|XP_010480146.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    159   8e-38    
emb|CBI39748.3|  unnamed protein product                                159   9e-38    
ref|XP_009348053.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    157   9e-38    
ref|XP_009379459.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    159   1e-37    
ref|XP_009348051.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    159   1e-37    
ref|XP_010644585.1|  PREDICTED: poly(A)-specific ribonuclease PARN      158   2e-37    
emb|CAN76999.1|  hypothetical protein VITISV_007764                     158   2e-37    Vitis vinifera
ref|XP_010675952.1|  PREDICTED: poly(A)-specific ribonuclease PARN      158   2e-37    
ref|XP_010942841.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    157   4e-37    
ref|XP_004296331.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    157   5e-37    
ref|XP_008363350.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    156   7e-37    
ref|XP_007020484.1|  Poly(A)-specific ribonuclease PARN isoform 1       156   9e-37    
ref|XP_008384548.1|  PREDICTED: LOW QUALITY PROTEIN: poly(A)-spec...    156   1e-36    
ref|XP_008219726.1|  PREDICTED: poly(A)-specific ribonuclease PARN      155   2e-36    
ref|XP_008808745.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    155   2e-36    
ref|XP_008808744.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    155   2e-36    
ref|XP_007207137.1|  hypothetical protein PRUPE_ppa002362mg             154   2e-36    
gb|KDP25970.1|  hypothetical protein JCGZ_22700                         155   2e-36    
gb|EPS70287.1|  hypothetical protein M569_04472                         152   4e-36    
emb|CDP13712.1|  unnamed protein product                                153   9e-36    
ref|XP_010240011.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    152   2e-35    
ref|XP_003581331.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    152   2e-35    
ref|XP_009600219.1|  PREDICTED: poly(A)-specific ribonuclease PARN      152   2e-35    
ref|XP_002891857.1|  Poly(A)-specific ribonuclease                      151   3e-35    
ref|XP_010501213.1|  PREDICTED: poly(A)-specific ribonuclease PARN      151   3e-35    
ref|XP_010462450.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    151   4e-35    
ref|XP_006304676.1|  hypothetical protein CARUB_v10011913mg             151   4e-35    
ref|XP_010061446.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    151   4e-35    
ref|XP_006346129.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    151   5e-35    
ref|XP_011097756.1|  PREDICTED: poly(A)-specific ribonuclease PARN      150   6e-35    
ref|XP_004244040.1|  PREDICTED: poly(A)-specific ribonuclease PARN      149   1e-34    
ref|XP_002300380.2|  CAF1 family ribonuclease family protein            149   2e-34    Populus trichocarpa [western balsam poplar]
ref|XP_010552367.1|  PREDICTED: poly(A)-specific ribonuclease PARN      149   2e-34    
ref|XP_006857781.1|  hypothetical protein AMTR_s00061p00208140          148   4e-34    
ref|XP_011038803.1|  PREDICTED: poly(A)-specific ribonuclease PARN      147   6e-34    
ref|XP_002447992.1|  hypothetical protein SORBIDRAFT_06g019420          147   8e-34    Sorghum bicolor [broomcorn]
gb|EMT26628.1|  Poly(A)-specific ribonuclease PARN                      147   1e-33    
ref|XP_001765586.1|  predicted protein                                  144   1e-33    
ref|NP_175983.5|  poly(A)-specific ribonuclease PARN                    146   1e-33    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009147470.1|  PREDICTED: poly(A)-specific ribonuclease PARN      146   2e-33    
emb|CDY52905.1|  BnaA06g00130D                                          146   2e-33    
ref|XP_009784553.1|  PREDICTED: poly(A)-specific ribonuclease PARN      146   2e-33    
ref|XP_006847463.1|  hypothetical protein AMTR_s00163p00015730          137   6e-33    
ref|XP_010061447.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    144   1e-32    
ref|XP_010061445.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    144   1e-32    
ref|NP_001169499.1|  hypothetical protein                               143   2e-32    Zea mays [maize]
ref|XP_004516095.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    143   2e-32    
ref|XP_006602126.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    140   2e-32    
ref|XP_008465474.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    134   2e-32    
ref|XP_009358966.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    132   2e-32    
ref|XP_006602125.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    140   3e-32    
emb|CDY53757.1|  BnaCnng25490D                                          141   7e-32    
ref|XP_006602123.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    140   9e-32    
ref|XP_006602122.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    140   2e-31    
ref|XP_003552994.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    140   2e-31    
ref|XP_006586143.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    137   3e-31    
ref|XP_003530802.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    137   2e-30    
ref|XP_002985556.1|  hypothetical protein SELMODRAFT_424560             135   3e-30    
ref|XP_004975901.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    136   3e-30    
ref|XP_002987014.1|  hypothetical protein SELMODRAFT_446815             134   6e-30    
ref|XP_010088438.1|  Poly(A)-specific ribonuclease PARN                 135   1e-29    
ref|XP_006474884.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    133   4e-29    
ref|XP_006474883.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    133   4e-29    
ref|XP_006452602.1|  hypothetical protein CICLE_v10007611mg             132   6e-29    
ref|XP_002970869.1|  hypothetical protein SELMODRAFT_451150             131   1e-28    
ref|XP_002522771.1|  conserved hypothetical protein                     130   4e-28    Ricinus communis
ref|XP_002969601.1|  hypothetical protein SELMODRAFT_410403             128   1e-27    
ref|XP_007146650.1|  hypothetical protein PHAVU_006G058000g             128   1e-27    
gb|AFW58529.1|  hypothetical protein ZEAMMB73_225129                    122   9e-26    
gb|EYU33709.1|  hypothetical protein MIMGU_mgv1a003022mg                114   4e-23    
gb|AAF79314.1|AC002304_7  F14J16.11                                     112   1e-22    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001173974.1|  Os04g0467400                                       106   2e-22    
ref|XP_006653504.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    111   4e-22    
ref|XP_009358967.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  99.8    5e-21    
emb|CAH66773.1|  OSIGBa0115M15.11                                       104   7e-20    Oryza sativa [red rice]
emb|CAH67368.1|  OSIGBa0128P10.2                                      99.4    2e-18    Oryza sativa [red rice]
gb|AAH73682.1|  Unknown (protein for IMAGE:5572400)                   95.9    2e-17    Xenopus laevis [clawed frog]
ref|XP_010731915.1|  PREDICTED: poly(A)-specific ribonuclease PARN    95.9    4e-17    
sp|Q90ZA1.1|PARN_XENLA  RecName: Full=Poly(A)-specific ribonuclea...  95.5    4e-17    Xenopus laevis [clawed frog]
ref|NP_001081143.1|  poly(A)-specific ribonuclease PARN               95.5    4e-17    Xenopus laevis [clawed frog]
ref|XP_004348604.1|  ribonuclease, putative                           94.7    5e-17    
ref|XP_010792702.1|  PREDICTED: poly(A)-specific ribonuclease PARN    91.7    1e-16    
gb|KGL77093.1|  Poly(A)-specific ribonuclease PARN                    93.2    2e-16    
ref|XP_010212713.1|  PREDICTED: poly(A)-specific ribonuclease PARN    93.2    2e-16    
ref|XP_006257909.1|  PREDICTED: poly(A)-specific ribonuclease PARN    92.4    4e-16    
ref|XP_005150742.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  92.4    4e-16    
gb|EPZ32187.1|  Ribonuclease CAF1 domain-containing protein           91.3    5e-16    
ref|XP_009090176.1|  PREDICTED: poly(A)-specific ribonuclease PARN    92.0    5e-16    
dbj|BAG91080.1|  unnamed protein product                              91.3    5e-16    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008292118.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  92.0    5e-16    
ref|XP_003972409.1|  PREDICTED: LOW QUALITY PROTEIN: poly(A)-spec...  91.7    6e-16    
ref|XP_008292120.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  92.0    6e-16    
ref|XP_008436164.1|  PREDICTED: poly(A)-specific ribonuclease PARN    91.7    6e-16    
ref|XP_007549755.1|  PREDICTED: poly(A)-specific ribonuclease PARN    91.7    7e-16    
ref|XP_002197536.1|  PREDICTED: poly(A)-specific ribonuclease PARN    91.3    8e-16    Taeniopygia guttata
gb|AAI69159.1|  Unknown (protein for IMAGE:8898488)                   90.9    8e-16    Xenopus tropicalis [western clawed frog]
ref|XP_006134193.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  91.3    8e-16    
ref|XP_002606119.1|  hypothetical protein BRAFLDRAFT_125118           90.5    9e-16    Branchiostoma floridae
ref|XP_003228705.2|  PREDICTED: poly(A)-specific ribonuclease PARN    91.7    1e-15    
emb|CAL49352.1|  poly(A)-specific ribonuclease (deadenylation nuc...  90.5    1e-15    Xenopus tropicalis [western clawed frog]
ref|XP_009475558.1|  PREDICTED: poly(A)-specific ribonuclease PARN    90.9    1e-15    
ref|XP_005420477.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  90.9    1e-15    
ref|XP_009637874.1|  PREDICTED: poly(A)-specific ribonuclease PARN    90.9    1e-15    
gb|EEC77442.1|  hypothetical protein OsI_16244                        91.3    1e-15    Oryza sativa Indica Group [Indian rice]
gb|EEE61153.1|  hypothetical protein OsJ_15114                        91.3    1e-15    Oryza sativa Japonica Group [Japonica rice]
emb|CAF98128.1|  unnamed protein product                              90.5    1e-15    Tetraodon nigroviridis
ref|XP_005054114.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  90.5    1e-15    
ref|NP_001184102.1|  poly(A)-specific ribonuclease (deadenylation...  90.5    2e-15    
ref|XP_005813387.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  90.5    2e-15    
gb|EXX68717.1|  hypothetical protein RirG_102580                      87.4    2e-15    
ref|XP_005522951.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  90.1    2e-15    
ref|XP_008314795.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  90.1    2e-15    
ref|XP_008314796.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  90.1    2e-15    
ref|XP_009348052.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  89.4    4e-15    
dbj|BAE47488.1|  polyA specific ribonuclease                          83.2    5e-15    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002129059.1|  PREDICTED: poly(A)-specific ribonuclease PARN    89.0    5e-15    Ciona intestinalis [sea vase]
gb|EMP37329.1|  Poly(A)-specific ribonuclease PARN                    85.5    6e-15    
ref|XP_006637035.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  89.0    6e-15    
ref|XP_008919990.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  88.2    7e-15    
ref|XP_010901706.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  88.6    8e-15    
ref|XP_008063053.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  86.7    9e-15    
ref|XP_007663083.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  85.5    9e-15    
ref|XP_008063052.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  87.0    9e-15    
ref|XP_010959415.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  87.8    9e-15    
ref|XP_006602124.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  87.4    1e-14    
gb|KFV66105.1|  Poly(A)-specific ribonuclease PARN                    87.4    1e-14    
ref|XP_005744604.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  87.8    1e-14    
ref|XP_010981175.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  87.8    1e-14    
ref|XP_006179128.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  87.8    1e-14    
ref|XP_003457808.1|  PREDICTED: poly(A)-specific ribonuclease PARN    87.8    1e-14    
ref|XP_005947045.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  87.8    1e-14    
gb|KFQ35206.1|  Poly(A)-specific ribonuclease PARN                    87.4    1e-14    
ref|XP_009884889.1|  PREDICTED: poly(A)-specific ribonuclease PARN    87.4    1e-14    
ref|XP_006212136.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  87.4    1e-14    
ref|XP_006804394.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  87.4    1e-14    
ref|XP_006009665.1|  PREDICTED: poly(A)-specific ribonuclease PARN    87.4    1e-14    
ref|XP_007498687.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  87.4    1e-14    
ref|XP_001634577.1|  predicted protein                                87.4    2e-14    Nematostella vectensis
gb|KFQ87427.1|  Poly(A)-specific ribonuclease PARN                    85.1    2e-14    
ref|XP_009897136.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  87.0    2e-14    
ref|XP_004454677.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  87.0    2e-14    
ref|XP_001622538.1|  hypothetical protein NEMVEDRAFT_v1g1365          86.3    2e-14    Nematostella vectensis
ref|XP_003269351.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  87.0    2e-14    
gb|KFW94766.1|  Poly(A)-specific ribonuclease PARN                    85.5    2e-14    
gb|KFQ03489.1|  Poly(A)-specific ribonuclease PARN                    86.7    2e-14    
gb|ERZ96763.1|  hypothetical protein GLOINDRAFT_330565                86.7    2e-14    
ref|XP_003417760.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  86.7    3e-14    
ref|XP_010595596.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  86.7    3e-14    
ref|XP_004332390.1|  PREDICTED: LOW QUALITY PROTEIN: poly(A)-spec...  86.3    3e-14    
gb|KFV08311.1|  Poly(A)-specific ribonuclease PARN                    85.5    3e-14    
ref|XP_004270210.1|  PREDICTED: poly(A)-specific ribonuclease PARN    86.3    3e-14    
ref|XP_007467023.1|  PREDICTED: poly(A)-specific ribonuclease PARN    86.3    3e-14    
ref|XP_007188428.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  86.3    3e-14    
ref|XP_004750405.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  85.9    3e-14    
ref|XP_004441909.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  86.3    4e-14    
ref|XP_004373325.1|  PREDICTED: poly(A)-specific ribonuclease PARN    86.3    4e-14    
ref|XP_005697572.1|  PREDICTED: poly(A)-specific ribonuclease PARN    86.3    4e-14    
ref|NP_001153677.1|  poly(A)-specific ribonuclease                    85.9    4e-14    Bombyx mori [silk moth]
ref|XP_007188429.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  85.9    4e-14    
ref|XP_006728698.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  85.9    4e-14    
gb|ELK13541.1|  Poly(A)-specific ribonuclease PARN                    85.9    4e-14    
ref|XP_006105281.1|  PREDICTED: poly(A)-specific ribonuclease PARN    85.5    4e-14    
ref|XP_008695138.1|  PREDICTED: poly(A)-specific ribonuclease PARN    85.9    4e-14    
gb|KFO05713.1|  Poly(A)-specific ribonuclease PARN                    85.1    4e-14    
ref|XP_004408976.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  85.9    4e-14    
gb|KDR16211.1|  Poly(A)-specific ribonuclease PARN                    85.9    4e-14    
ref|XP_010838177.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  85.5    5e-14    
ref|XP_002918111.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  85.9    5e-14    
ref|XP_006759737.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  85.5    5e-14    
ref|XP_004750403.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  85.5    5e-14    
ref|XP_004692171.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  85.5    5e-14    
ref|XP_010817613.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  85.1    5e-14    
ref|XP_006910997.1|  PREDICTED: poly(A)-specific ribonuclease PARN    85.9    5e-14    
ref|XP_004652333.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  85.5    5e-14    
ref|XP_536966.2|  PREDICTED: poly(A)-specific ribonuclease PARN i...  85.5    5e-14    Canis lupus familiaris [dogs]
ref|XP_010817612.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  85.5    6e-14    
ref|XP_007904625.1|  PREDICTED: poly(A)-specific ribonuclease PARN    85.5    6e-14    
gb|KFZ62922.1|  Poly(A)-specific ribonuclease PARN                    85.1    6e-14    
ref|XP_007106207.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  85.1    7e-14    
ref|XP_007076924.1|  PREDICTED: poly(A)-specific ribonuclease PARN    85.1    7e-14    
ref|XP_001490195.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  85.1    7e-14    Equus caballus [domestic horse]
gb|KFO58896.1|  Poly(A)-specific ribonuclease PARN                    85.1    7e-14    
ref|XP_006759736.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  85.1    7e-14    
gb|KFP32610.1|  Poly(A)-specific ribonuclease PARN                    84.7    7e-14    
ref|XP_003998895.1|  PREDICTED: poly(A)-specific ribonuclease PARN    85.1    7e-14    
ref|XP_005598954.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  85.1    7e-14    
ref|XP_006146609.1|  PREDICTED: poly(A)-specific ribonuclease PARN    85.1    8e-14    
ref|XP_010817609.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  85.1    8e-14    
gb|KFO75744.1|  Poly(A)-specific ribonuclease PARN                    85.1    8e-14    
ref|NP_001094588.1|  poly(A)-specific ribonuclease PARN               85.1    8e-14    
ref|XP_004586831.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  85.1    8e-14    
ref|XP_006049827.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  85.1    8e-14    
ref|XP_008139791.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  85.1    8e-14    
ref|XP_004706318.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  85.1    8e-14    
pdb|2A1R|A  Chain A, Crystal Structure Of Parn Nuclease Domain        84.0    9e-14    
ref|XP_006894585.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  85.1    9e-14    
ref|XP_009837586.1|  hypothetical protein H257_12163                  84.7    9e-14    
ref|XP_010817608.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  85.1    9e-14    
gb|KFW05870.1|  Poly(A)-specific ribonuclease PARN                    84.3    1e-13    
gb|KFW04594.1|  Poly(A)-specific ribonuclease PARN                    84.3    1e-13    
gb|KFP16596.1|  Poly(A)-specific ribonuclease PARN                    84.7    1e-13    
ref|XP_006681993.1|  hypothetical protein BATDEDRAFT_36029            84.3    1e-13    
ref|XP_006867301.1|  PREDICTED: poly(A)-specific ribonuclease PARN    84.3    1e-13    
gb|KFP51026.1|  Poly(A)-specific ribonuclease PARN                    83.6    1e-13    
ref|XP_008546939.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  84.3    1e-13    
gb|AAQ97826.1|  poly(A)-specific ribonuclease                         84.3    1e-13    
ref|XP_005323743.1|  PREDICTED: poly(A)-specific ribonuclease PARN    84.3    1e-13    
ref|XP_004057290.1|  PREDICTED: poly(A)-specific ribonuclease PARN    84.0    2e-13    
ref|NP_957382.1|  poly(A)-specific ribonuclease PARN                  84.0    2e-13    
sp|Q7ZU92.2|PARN_DANRE  RecName: Full=Poly(A)-specific ribonuclea...  84.0    2e-13    
ref|XP_010337706.1|  PREDICTED: poly(A)-specific ribonuclease PARN    84.0    2e-13    
gb|KHN31672.1|  Poly(A)-specific ribonuclease PARN                    84.3    2e-13    
ref|XP_009194320.1|  PREDICTED: poly(A)-specific ribonuclease PARN    83.6    2e-13    
ref|XP_003477815.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  83.6    2e-13    
ref|XP_007529597.1|  PREDICTED: poly(A)-specific ribonuclease PARN    83.6    2e-13    
gb|KFU93814.1|  Poly(A)-specific ribonuclease PARN                    83.6    2e-13    
ref|XP_005591355.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  83.6    2e-13    
ref|NP_002573.1|  poly(A)-specific ribonuclease PARN isoform 1        83.6    2e-13    
ref|XP_007984527.1|  PREDICTED: poly(A)-specific ribonuclease PARN    83.6    2e-13    
ref|XP_510832.3|  PREDICTED: poly(A)-specific ribonuclease PARN       83.6    2e-13    
ref|XP_003496745.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  83.6    2e-13    
ref|XP_005591354.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  83.6    3e-13    
gb|KFW79166.1|  Poly(A)-specific ribonuclease PARN                    83.2    3e-13    
ref|XP_005350397.1|  PREDICTED: poly(A)-specific ribonuclease PARN    83.2    3e-13    
ref|XP_002755955.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  83.2    3e-13    
ref|XP_003832732.1|  PREDICTED: poly(A)-specific ribonuclease PARN    83.2    3e-13    
ref|XP_007650658.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  83.2    3e-13    
ref|XP_008828121.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  83.2    3e-13    
ref|XP_005391192.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  83.2    3e-13    
ref|XP_008828122.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  83.2    3e-13    
ref|XP_005391191.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  83.2    3e-13    
ref|XP_003761743.1|  PREDICTED: poly(A)-specific ribonuclease PARN    83.2    3e-13    
ref|XP_005391197.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  82.8    4e-13    
ref|XP_004644290.1|  PREDICTED: poly(A)-specific ribonuclease PARN    82.8    4e-13    
gb|KFO86027.1|  Poly(A)-specific ribonuclease PARN                    82.8    4e-13    
gb|KFQ69044.1|  Poly(A)-specific ribonuclease PARN                    82.0    4e-13    
ref|XP_005103432.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  82.8    4e-13    
gb|KFV03233.1|  Poly(A)-specific ribonuclease PARN                    82.4    4e-13    
ref|XP_002711808.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  82.8    5e-13    
gb|KFQ41688.1|  Poly(A)-specific ribonuclease PARN                    82.0    5e-13    
ref|XP_008201922.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  82.0    5e-13    
gb|KFQ59750.1|  Poly(A)-specific ribonuclease PARN                    82.0    5e-13    
gb|KFQ33753.1|  Poly(A)-specific ribonuclease PARN                    82.0    6e-13    
gb|KGL94587.1|  Poly(A)-specific ribonuclease PARN                    82.0    6e-13    
gb|EMC85602.1|  Poly(A)-specific ribonuclease PARN                    82.0    6e-13    
gb|KFW67601.1|  Poly(A)-specific ribonuclease PARN                    82.0    6e-13    
gb|KFM09138.1|  Poly(A)-specific ribonuclease PARN                    82.0    6e-13    
gb|KFV48490.1|  Poly(A)-specific ribonuclease PARN                    82.0    7e-13    
ref|XP_008201921.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  82.0    7e-13    
gb|KFB51637.1|  AGAP007399-PA-like protein                            82.0    7e-13    
gb|KFP40726.1|  Poly(A)-specific ribonuclease PARN                    81.6    8e-13    
ref|XP_008201919.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  82.0    9e-13    
ref|NP_001125357.1|  poly(A)-specific ribonuclease PARN               81.6    9e-13    
pdb|3D45|A  Chain A, Crystal Structure Of Mouse Parn In Complex W...  81.3    9e-13    
gb|KFP65999.1|  Poly(A)-specific ribonuclease PARN                    80.9    1e-12    
gb|EPY85169.1|  poly(A)-specific ribonuclease PARN                    80.5    2e-12    
ref|XP_004886596.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  80.9    2e-12    
ref|XP_002838529.1|  hypothetical protein                             79.7    2e-12    
gb|ETL82650.1|  hypothetical protein L917_17220                       80.5    2e-12    
ref|XP_006452603.1|  hypothetical protein CICLE_v10007611mg           80.1    2e-12    
ref|XP_008896484.1|  hypothetical protein PPTG_04345                  80.1    2e-12    
ref|XP_008873086.1|  hypothetical protein H310_08934                  80.1    2e-12    
dbj|BAE35913.1|  unnamed protein product                              80.1    2e-12    
gb|ELR48641.1|  Poly(A)-specific ribonuclease PARN                    80.1    2e-12    
ref|XP_010608324.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  80.1    3e-12    
gb|KDO59123.1|  hypothetical protein CISIN_1g007386mg                 80.1    3e-12    
ref|NP_083037.1|  poly(A)-specific ribonuclease PARN                  80.1    3e-12    
gb|EFB16183.1|  hypothetical protein PANDA_006508                     80.1    3e-12    
sp|Q8VDG3.1|PARN_MOUSE  RecName: Full=Poly(A)-specific ribonuclea...  80.1    3e-12    
ref|XP_006983981.1|  PREDICTED: poly(A)-specific ribonuclease PARN    80.1    3e-12    
gb|EHJ78364.1|  putative poly                                         80.1    3e-12    
ref|XP_010608325.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  80.1    3e-12    
gb|ETP33679.1|  hypothetical protein F442_17814                       79.7    3e-12    
gb|EDK97364.1|  poly(A)-specific ribonuclease (deadenylation nucl...  80.1    3e-12    
gb|ETI35752.1|  hypothetical protein F443_17972                       79.7    3e-12    
gb|EFX66955.1|  hypothetical protein DAPPUDRAFT_203845                79.7    3e-12    
gb|ETK75973.1|  hypothetical protein L915_17489                       79.7    3e-12    
gb|EPQ11307.1|  Poly(A)-specific ribonuclease PARN                    80.1    4e-12    
gb|ELK33278.1|  Poly(A)-specific ribonuclease PARN                    79.7    4e-12    
gb|KDO59122.1|  hypothetical protein CISIN_1g007386mg                 79.7    4e-12    
gb|KFO98221.1|  Poly(A)-specific ribonuclease PARN                    79.7    4e-12    
gb|ETE72116.1|  Poly(A)-specific ribonuclease PARN                    79.0    7e-12    
gb|ETN61263.1|  polyA-specific ribonuclease                           78.2    9e-12    
gb|EHH31444.1|  Poly(A)-specific ribonuclease PARN                    78.6    9e-12    
emb|CAE05998.4|  OSJNBa0016O02.8                                      78.2    1e-11    
gb|EHH60178.1|  Poly(A)-specific ribonuclease PARN                    78.2    1e-11    
gb|EDL96165.1|  rCG49798                                              77.8    1e-11    
ref|NP_001257344.1|  poly(A)-specific ribonuclease PARN               77.8    1e-11    
ref|XP_002905017.1|  Poly(A)-specific ribonuclease PARN-like protein  77.4    2e-11    
ref|XP_009023768.1|  hypothetical protein HELRODRAFT_193079           77.0    2e-11    
ref|XP_006522714.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  77.0    2e-11    
gb|KFM74655.1|  Poly(A)-specific ribonuclease PARN                    77.0    2e-11    
ref|XP_008365990.1|  PREDICTED: uncharacterized protein LOC103429631  73.6    3e-11    
gb|KDR21432.1|  Poly(A)-specific ribonuclease PARN-like domain-co...  75.9    5e-11    
ref|XP_003707832.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  76.3    5e-11    
ref|XP_007673685.1|  hypothetical protein BAUCODRAFT_59256            75.5    5e-11    
ref|XP_009521153.1|  hypothetical protein PHYSODRAFT_540459           75.9    6e-11    
emb|CBH09267.1|  putative poly(A)-specific ribonuclease (parn)        75.5    7e-11    
ref|XP_967921.2|  PREDICTED: poly(A)-specific ribonuclease PARN       75.5    7e-11    
gb|EPB82776.1|  hypothetical protein HMPREF1544_10479                 75.5    8e-11    
ref|XP_006522713.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  75.1    9e-11    
gb|ERE68849.1|  poly(A)-specific ribonuclease PARN isoform 2          71.2    1e-10    
ref|XP_006522712.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  75.1    1e-10    
ref|XP_001433738.1|  hypothetical protein                             74.7    1e-10    
gb|KDO24363.1|  hypothetical protein SPRG_10440                       74.7    1e-10    
ref|XP_001659202.1|  poly(a)-specific ribonuclease (deadenylation...  74.7    1e-10    
ref|XP_009248759.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  74.7    1e-10    
gb|AGC92706.1|  poly(A)-specific ribonuclease PARN-like protein       74.3    2e-10    
gb|KFH62568.1|  hypothetical protein MVEG_11961                       74.3    2e-10    
ref|XP_008606625.1|  hypothetical protein SDRG_02801                  73.9    2e-10    
gb|EMF13331.1|  CAF1-domain-containing protein                        73.9    2e-10    
gb|KFZ48696.1|  Poly(A)-specific ribonuclease PARN                    72.0    3e-10    
gb|EFZ22121.1|  hypothetical protein SINV_07959                       73.2    4e-10    
gb|EAW85111.1|  poly(A)-specific ribonuclease (deadenylation nucl...  73.2    5e-10    
emb|CDS09676.1|  hypothetical protein LRAMOSA02353                    72.8    5e-10    
ref|XP_007237945.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  72.4    7e-10    
emb|CEI85857.1|  hypothetical protein RMCBS344292_00306               72.4    7e-10    
dbj|BAE47489.1|  polyA specific ribonuclease                          72.4    7e-10    
emb|CEG64045.1|  hypothetical protein RMATCC62417_01090               72.4    7e-10    
emb|CEG81630.1|  hypothetical protein RMATCC62417_15806               72.0    8e-10    
ref|XP_005065819.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  71.6    8e-10    
ref|XP_002949475.1|  hypothetical protein VOLCADRAFT_120753           72.0    9e-10    
ref|NP_001077725.4|  poly(A)-specific ribonuclease PARN               71.6    1e-09    
ref|XP_003853756.1|  hypothetical protein MYCGRDRAFT_91566            72.0    1e-09    
ref|XP_001454910.1|  hypothetical protein                             71.6    1e-09    
ref|XP_006617599.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  71.6    1e-09    
ref|XP_006617598.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  71.6    1e-09    
gb|KFR12064.1|  Poly(A)-specific ribonuclease PARN                    71.2    1e-09    
ref|XP_392167.3|  PREDICTED: poly(A)-specific ribonuclease PARN-l...  72.0    1e-09    
gb|ELT97394.1|  hypothetical protein CAPTEDRAFT_177560                71.2    2e-09    
ref|XP_006557414.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  71.2    2e-09    
gb|KFV75551.1|  Poly(A)-specific ribonuclease PARN-like domain-co...  70.9    2e-09    
ref|XP_005305773.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  70.9    2e-09    
gb|EFN61018.1|  Poly(A)-specific ribonuclease PARN                    70.9    2e-09    
ref|XP_003690772.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  70.9    2e-09    
ref|XP_006557413.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  70.9    2e-09    
gb|EFW42758.2|  hypothetical protein CAOG_07890                       70.9    2e-09    
gb|KFP74237.1|  Poly(A)-specific ribonuclease PARN                    70.5    2e-09    
ref|XP_004342975.1|  conserved hypothetical protein                   70.9    3e-09    
ref|XP_308433.4|  AGAP007399-PA                                       70.5    3e-09    
ref|XP_006021972.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  70.1    3e-09    
ref|XP_008182199.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  70.5    3e-09    
ref|XP_011113705.1|  hypothetical protein H072_7980                   70.1    3e-09    
gb|EIE80249.1|  hypothetical protein RO3G_04954                       70.5    3e-09    
ref|XP_006021973.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  70.1    4e-09    
gb|KFP76265.1|  Poly(A)-specific ribonuclease PARN                    69.3    4e-09    
ref|XP_006263653.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  69.7    4e-09    
gb|KFQ93227.1|  Poly(A)-specific ribonuclease PARN                    69.7    4e-09    
gb|EME45478.1|  hypothetical protein DOTSEDRAFT_52745                 69.7    5e-09    
gb|KFV85722.1|  Poly(A)-specific ribonuclease PARN                    69.3    5e-09    
dbj|BAG64410.1|  unnamed protein product                              66.6    6e-09    
ref|XP_008384296.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  64.7    6e-09    
ref|XP_011057199.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  69.3    6e-09    
ref|XP_011057198.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  69.3    6e-09    
ref|WP_028831969.1|  hypothetical protein                             69.3    7e-09    
gb|EOA94947.1|  Poly(A)-specific ribonuclease PARN                    68.9    7e-09    
ref|XP_003769636.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  68.9    7e-09    
ref|XP_007484915.1|  PREDICTED: poly(A)-specific ribonuclease (PA...  68.9    7e-09    
ref|XP_009051572.1|  hypothetical protein LOTGIDRAFT_152814           68.6    9e-09    
ref|XP_005390766.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  68.6    9e-09    
ref|XP_008714897.1|  hypothetical protein HMPREF1541_02319            68.9    9e-09    
ref|XP_007484914.1|  PREDICTED: poly(A)-specific ribonuclease (PA...  68.6    1e-08    
gb|EFN75773.1|  Poly(A)-specific ribonuclease PARN                    68.2    1e-08    
ref|XP_005390765.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  67.8    2e-08    
ref|XP_005488187.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  67.8    2e-08    
emb|CBJ26041.1|  conserved unknown protein                            68.2    2e-08    
ref|XP_003494666.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  68.2    2e-08    
gb|KFP38394.1|  Poly(A)-specific ribonuclease PARN-like domain-co...  67.4    2e-08    
gb|EAR94228.2|  CAF1 family ribonuclease                              67.8    2e-08    
ref|XP_007925243.1|  hypothetical protein MYCFIDRAFT_152853           67.4    2e-08    
gb|KFH68813.1|  hypothetical protein MVEG_05617                       67.8    2e-08    
gb|KFQ36117.1|  Poly(A)-specific ribonuclease PARN-like domain-co...  67.4    2e-08    
ref|XP_003726420.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  67.4    2e-08    
ref|XP_003067337.1|  CAF1 family ribonuclease containing protein      67.4    2e-08    
gb|EGW05736.1|  Poly(A)-specific ribonuclease PARN-like domain-co...  67.0    2e-08    
ref|XP_009288341.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  67.4    2e-08    
ref|XP_005105112.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  67.4    2e-08    
gb|ERE86391.1|  poly(A)-specific ribonuclease PARN-like domain-co...  67.0    3e-08    
gb|ERE86392.1|  poly(A)-specific ribonuclease PARN-like domain-co...  67.4    3e-08    
ref|XP_007635018.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  67.4    3e-08    
ref|XP_010123842.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  67.0    3e-08    
ref|XP_003503113.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  67.0    3e-08    
gb|KFO21008.1|  Poly(A)-specific ribonuclease PARN                    67.4    3e-08    
ref|XP_010183248.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  66.6    3e-08    
ref|XP_005321523.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  66.6    4e-08    
gb|EHB04162.1|  Poly(A)-specific ribonuclease PARN                    66.2    5e-08    
ref|XP_001633395.1|  predicted protein                                65.5    7e-08    
ref|XP_007748970.1|  hypothetical protein A1O5_10202                  65.9    8e-08    
ref|XP_001762457.1|  predicted protein                                65.9    8e-08    
emb|CCX06373.1|  Similar to Poly(A)-specific ribonuclease PARN; a...  65.5    8e-08    
ref|XP_010705426.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  65.5    8e-08    
ref|XP_001437815.1|  hypothetical protein                             65.5    8e-08    
ref|XP_002160561.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  65.5    9e-08    
ref|XP_010705425.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  65.5    9e-08    
ref|XP_005840350.1|  hypothetical protein GUITHDRAFT_101074           65.1    1e-07    
ref|XP_005043673.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  65.1    1e-07    
ref|XP_007725710.1|  hypothetical protein A1O1_06642                  65.5    1e-07    
ref|XP_003271811.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  65.1    1e-07    
emb|CDS08630.1|  hypothetical protein LRAMOSA09991                    65.1    1e-07    
ref|XP_003271812.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  65.1    1e-07    
emb|CEG77716.1|  hypothetical protein RMATCC62417_12419               63.9    1e-07    
ref|XP_002109743.1|  hypothetical protein TRIADDRAFT_52927            65.1    1e-07    
ref|XP_004651329.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  65.1    1e-07    



>ref|XP_009606034.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X1 
[Nicotiana tomentosiformis]
Length=621

 Score =   372 bits (955),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 212/359 (59%), Positives = 269/359 (75%), Gaps = 13/359 (4%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             A GG T  VRVVLTSS+EDK LL+KELQ  E +HNK +RGFREV+DLIS SQKPVVAHNS
Sbjct  271   AKGGTTMSVRVVLTSSEEDKILLQKELQNEEKEHNKRIRGFREVIDLISASQKPVVAHNS  330

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             LNDFT +HSKFLAPLPSTLDEF+ SL  V P++LDV HLMKE+   K +NN+  + SYL 
Sbjct  331   LNDFTFVHSKFLAPLPSTLDEFKSSLCEVLPNVLDVNHLMKEISPLKKVNNLPASISYLK  390

Query  783   SRFFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQL  604
              RFFAP+D+E+ +QA   +A  VK+ GH+VLKISELFAK+ SIL++ PKAPEA E  G L
Sbjct  391   QRFFAPIDMEISNQA--AEATEVKTLGHDVLKISELFAKLYSILRIAPKAPEAAE--GHL  446

Query  603   PPALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKS  424
             P A+E Y N+F+PC  S     + +E V V   S +++S KN+VFLWGF+ G S GQ+KS
Sbjct  447   PDAIECYLNLFNPCFASSHG--LADEGVSVWTDSTRKISIKNLVFLWGFRGGTSAGQLKS  504

Query  423   LVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDSGS-----LEEMVSEGIRA  259
             L++G HEV  +EFD+RLVD+SCAV+VF +PG SEVLL+ +DSG      L+EM+++G+ A
Sbjct  505   LLHGSHEVLHNEFDVRLVDKSCAVVVFGNPGFSEVLLQLMDSGGICTSILKEMLADGLTA  564

Query  258   ASYDAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
             A Y+AY KVC+LGLW+A+LA S E ALEE          +++L  I WN+DEMI+LDDL
Sbjct  565   AGYEAYQKVCELGLWEADLASSFERALEENDSFSEAH--SQELPGICWNNDEMINLDDL  621


 Score =   364 bits (935),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 176/248 (71%), Positives = 204/248 (82%), Gaps = 1/248 (0%)
 Frame = -2

Query  1913  MLQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQ  1734
             MLQRRLFCT IS+T F+ N G  N  KW +KQV+KSNFS AL +I T I++SDFIAVSL+
Sbjct  1     MLQRRLFCTRISKTIFQSNPG-HNQSKWSVKQVSKSNFSAALEEISTFISDSDFIAVSLK  59

Query  1733  TTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFP  1554
              TGAYS+PWQR+LP DTA  AYLKAK AAER+Q+LQFAVCPFS+R SKLI  PYNFHLFP
Sbjct  60    NTGAYSAPWQRILPIDTAHTAYLKAKYAAERFQVLQFAVCPFSIRGSKLIVHPYNFHLFP  119

Query  1553  RDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAGS  1374
             RDELK GMPSYSFSCQSSYL S+AREGFDFNACI DGISYLSR+QE AA D I + S  +
Sbjct  120   RDELKIGMPSYSFSCQSSYLTSMAREGFDFNACIYDGISYLSRSQESAAIDRIGNASHIT  179

Query  1373  CTVPSPASRSVADSIFINRIKSRVKHWRNACTDQSKKTEDVLISSLRKMISATEVHGSRP  1194
             CTV SP+  +VADS+F  RIKSR+K W +AC D +KK ED LISSLRK++S  EV+GSRP
Sbjct  180   CTVQSPSGHTVADSVFAERIKSRLKRWISACRDTNKKPEDALISSLRKIVSGDEVYGSRP  239

Query  1193  CLNIDICS  1170
             CL+ID+CS
Sbjct  240   CLSIDVCS  247



>ref|XP_009606035.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X2 
[Nicotiana tomentosiformis]
Length=620

 Score =   372 bits (954),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 212/359 (59%), Positives = 269/359 (75%), Gaps = 14/359 (4%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             A GG T  VRVVLTSS+EDK LL+KELQ  E +HNK +RGFREV+DLIS SQKPVVAHNS
Sbjct  271   AKGGTTMSVRVVLTSSEEDKILLQKELQNEEKEHNKRIRGFREVIDLISASQKPVVAHNS  330

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             LNDFT +HSKFLAPLPSTLDEF+ SL  V P++LDV HLMKE+   K +NN+  + SYL 
Sbjct  331   LNDFTFVHSKFLAPLPSTLDEFKSSLCEVLPNVLDVNHLMKEISPLKKVNNLPASISYLK  390

Query  783   SRFFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQL  604
              RFFAP+D+E+ +QA   +A  VK+ GH+VLKISELFAK+ SIL++ PKAPEA E  G L
Sbjct  391   QRFFAPIDMEISNQA---EATEVKTLGHDVLKISELFAKLYSILRIAPKAPEAAE--GHL  445

Query  603   PPALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKS  424
             P A+E Y N+F+PC  S     + +E V V   S +++S KN+VFLWGF+ G S GQ+KS
Sbjct  446   PDAIECYLNLFNPCFASSHG--LADEGVSVWTDSTRKISIKNLVFLWGFRGGTSAGQLKS  503

Query  423   LVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDSGS-----LEEMVSEGIRA  259
             L++G HEV  +EFD+RLVD+SCAV+VF +PG SEVLL+ +DSG      L+EM+++G+ A
Sbjct  504   LLHGSHEVLHNEFDVRLVDKSCAVVVFGNPGFSEVLLQLMDSGGICTSILKEMLADGLTA  563

Query  258   ASYDAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
             A Y+AY KVC+LGLW+A+LA S E ALEE          +++L  I WN+DEMI+LDDL
Sbjct  564   AGYEAYQKVCELGLWEADLASSFERALEENDSFSEAH--SQELPGICWNNDEMINLDDL  620


 Score =   364 bits (935),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 176/248 (71%), Positives = 204/248 (82%), Gaps = 1/248 (0%)
 Frame = -2

Query  1913  MLQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQ  1734
             MLQRRLFCT IS+T F+ N G  N  KW +KQV+KSNFS AL +I T I++SDFIAVSL+
Sbjct  1     MLQRRLFCTRISKTIFQSNPG-HNQSKWSVKQVSKSNFSAALEEISTFISDSDFIAVSLK  59

Query  1733  TTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFP  1554
              TGAYS+PWQR+LP DTA  AYLKAK AAER+Q+LQFAVCPFS+R SKLI  PYNFHLFP
Sbjct  60    NTGAYSAPWQRILPIDTAHTAYLKAKYAAERFQVLQFAVCPFSIRGSKLIVHPYNFHLFP  119

Query  1553  RDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAGS  1374
             RDELK GMPSYSFSCQSSYL S+AREGFDFNACI DGISYLSR+QE AA D I + S  +
Sbjct  120   RDELKIGMPSYSFSCQSSYLTSMAREGFDFNACIYDGISYLSRSQESAAIDRIGNASHIT  179

Query  1373  CTVPSPASRSVADSIFINRIKSRVKHWRNACTDQSKKTEDVLISSLRKMISATEVHGSRP  1194
             CTV SP+  +VADS+F  RIKSR+K W +AC D +KK ED LISSLRK++S  EV+GSRP
Sbjct  180   CTVQSPSGHTVADSVFAERIKSRLKRWISACRDTNKKPEDALISSLRKIVSGDEVYGSRP  239

Query  1193  CLNIDICS  1170
             CL+ID+CS
Sbjct  240   CLSIDVCS  247



>ref|XP_009792347.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X1 
[Nicotiana sylvestris]
Length=621

 Score =   375 bits (963),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 213/359 (59%), Positives = 270/359 (75%), Gaps = 13/359 (4%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             A GG T  +RVVLTSS+EDK LL+KELQ  E +HNK +RGFREV+DLIS SQKPVV HNS
Sbjct  271   AKGGMTMSIRVVLTSSEEDKILLQKELQNEEKEHNKRIRGFREVIDLISASQKPVVVHNS  330

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             LNDFT +HSKFLAPLP TLDEF+ SL  VFP++LDV HLMKE+   K +NN+  + SYL 
Sbjct  331   LNDFTFVHSKFLAPLPPTLDEFKSSLCEVFPNVLDVTHLMKEISPLKKVNNLPASISYLK  390

Query  783   SRFFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQL  604
              RFFAPVD+E+ +QA   +A  VK+ GH+VLKISELFAK+ SILK+ PKAPEA E  G L
Sbjct  391   QRFFAPVDMEISNQA--AEATEVKTLGHDVLKISELFAKLYSILKIAPKAPEAAE--GHL  446

Query  603   PPALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKS  424
             P A+E Y N+F+PC  S     + +E V V   + +++S KN+VFLWGF+ G S GQ+KS
Sbjct  447   PDAIECYINLFNPCFASSHG--LADEGVSVWTDNTRKISIKNLVFLWGFRGGTSAGQLKS  504

Query  423   LVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDSG-----SLEEMVSEGIRA  259
             L+YG HEVF +EFD+RLVD+SCAV+VF +PG SEVLL+ +DSG     +L+EM+++G+ A
Sbjct  505   LLYGSHEVFHNEFDVRLVDKSCAVVVFGNPGFSEVLLQLMDSGGICTSTLKEMLADGLTA  564

Query  258   ASYDAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
             A Y+AY KVC+LGLW+A+LA S E ALEE          +++L  I WN+DEMI+LDDL
Sbjct  565   AGYEAYQKVCELGLWEADLASSFERALEENDSFSEAH--SQELPGICWNNDEMINLDDL  621


 Score =   358 bits (919),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 172/248 (69%), Positives = 202/248 (81%), Gaps = 1/248 (0%)
 Frame = -2

Query  1913  MLQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQ  1734
             MLQRRLFCT IS+T  + N G  N+ KW +KQVTKSNFS  L +I T I++SDFIAVSL+
Sbjct  1     MLQRRLFCTRISKTILQSNPG-HNHSKWSVKQVTKSNFSATLEEISTFISDSDFIAVSLK  59

Query  1733  TTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFP  1554
              TGAYS+PWQR+LP DTA  AYLKAK AAER+Q+LQFAVCPFS+R SKLI  PYNFHLFP
Sbjct  60    NTGAYSAPWQRILPIDTAHTAYLKAKYAAERFQVLQFAVCPFSIRGSKLIVHPYNFHLFP  119

Query  1553  RDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAGS  1374
             RDELK GMPSYSFSCQSSYL S+AR+GFDFNACI DGISYLSR+QE AA D I + S  +
Sbjct  120   RDELKIGMPSYSFSCQSSYLTSMARQGFDFNACIYDGISYLSRSQESAAIDRIGNASHIT  179

Query  1373  CTVPSPASRSVADSIFINRIKSRVKHWRNACTDQSKKTEDVLISSLRKMISATEVHGSRP  1194
               V SP+  +VADS+F  RIKSRVKHW ++C D +KK ED LIS+LRK++S  EV+GSRP
Sbjct  180   RKVQSPSGHTVADSVFAERIKSRVKHWISSCRDTNKKPEDALISALRKIVSGDEVYGSRP  239

Query  1193  CLNIDICS  1170
             CL+ID+CS
Sbjct  240   CLSIDVCS  247



>ref|XP_009792348.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X2 
[Nicotiana sylvestris]
Length=620

 Score =   375 bits (962),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 213/359 (59%), Positives = 270/359 (75%), Gaps = 14/359 (4%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             A GG T  +RVVLTSS+EDK LL+KELQ  E +HNK +RGFREV+DLIS SQKPVV HNS
Sbjct  271   AKGGMTMSIRVVLTSSEEDKILLQKELQNEEKEHNKRIRGFREVIDLISASQKPVVVHNS  330

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             LNDFT +HSKFLAPLP TLDEF+ SL  VFP++LDV HLMKE+   K +NN+  + SYL 
Sbjct  331   LNDFTFVHSKFLAPLPPTLDEFKSSLCEVFPNVLDVTHLMKEISPLKKVNNLPASISYLK  390

Query  783   SRFFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQL  604
              RFFAPVD+E+ +QA   +A  VK+ GH+VLKISELFAK+ SILK+ PKAPEA E  G L
Sbjct  391   QRFFAPVDMEISNQA---EATEVKTLGHDVLKISELFAKLYSILKIAPKAPEAAE--GHL  445

Query  603   PPALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKS  424
             P A+E Y N+F+PC  S     + +E V V   + +++S KN+VFLWGF+ G S GQ+KS
Sbjct  446   PDAIECYINLFNPCFASSHG--LADEGVSVWTDNTRKISIKNLVFLWGFRGGTSAGQLKS  503

Query  423   LVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDSG-----SLEEMVSEGIRA  259
             L+YG HEVF +EFD+RLVD+SCAV+VF +PG SEVLL+ +DSG     +L+EM+++G+ A
Sbjct  504   LLYGSHEVFHNEFDVRLVDKSCAVVVFGNPGFSEVLLQLMDSGGICTSTLKEMLADGLTA  563

Query  258   ASYDAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
             A Y+AY KVC+LGLW+A+LA S E ALEE          +++L  I WN+DEMI+LDDL
Sbjct  564   AGYEAYQKVCELGLWEADLASSFERALEENDSFSEAH--SQELPGICWNNDEMINLDDL  620


 Score =   358 bits (918),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 172/248 (69%), Positives = 202/248 (81%), Gaps = 1/248 (0%)
 Frame = -2

Query  1913  MLQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQ  1734
             MLQRRLFCT IS+T  + N G  N+ KW +KQVTKSNFS  L +I T I++SDFIAVSL+
Sbjct  1     MLQRRLFCTRISKTILQSNPG-HNHSKWSVKQVTKSNFSATLEEISTFISDSDFIAVSLK  59

Query  1733  TTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFP  1554
              TGAYS+PWQR+LP DTA  AYLKAK AAER+Q+LQFAVCPFS+R SKLI  PYNFHLFP
Sbjct  60    NTGAYSAPWQRILPIDTAHTAYLKAKYAAERFQVLQFAVCPFSIRGSKLIVHPYNFHLFP  119

Query  1553  RDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAGS  1374
             RDELK GMPSYSFSCQSSYL S+AR+GFDFNACI DGISYLSR+QE AA D I + S  +
Sbjct  120   RDELKIGMPSYSFSCQSSYLTSMARQGFDFNACIYDGISYLSRSQESAAIDRIGNASHIT  179

Query  1373  CTVPSPASRSVADSIFINRIKSRVKHWRNACTDQSKKTEDVLISSLRKMISATEVHGSRP  1194
               V SP+  +VADS+F  RIKSRVKHW ++C D +KK ED LIS+LRK++S  EV+GSRP
Sbjct  180   RKVQSPSGHTVADSVFAERIKSRVKHWISSCRDTNKKPEDALISALRKIVSGDEVYGSRP  239

Query  1193  CLNIDICS  1170
             CL+ID+CS
Sbjct  240   CLSIDVCS  247



>ref|XP_006345714.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Solanum tuberosum]
Length=619

 Score =   364 bits (935),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/359 (56%), Positives = 267/359 (74%), Gaps = 15/359 (4%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             A GG  + VRVVLTSS+ED  LL+KELQ  E +HNK +RGFREV++LIS SQKPVVAHNS
Sbjct  271   AKGGAIRPVRVVLTSSEEDSILLQKELQNEEKEHNKRLRGFREVINLISASQKPVVAHNS  330

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             LNDFT +HSKFLAPLPSTL+EFR SL  VFP++LDV H+MKE+  Q  +NN+    SYL 
Sbjct  331   LNDFTFVHSKFLAPLPSTLEEFRSSLCLVFPNVLDVNHIMKEISPQTKVNNLPACISYLK  390

Query  783   SRFFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQL  604
              RFFAP+D+E+P+QA   + + VK+ GH+ +KIS+LFAK+CSILK+ P+ PEA E  G L
Sbjct  391   QRFFAPIDIEIPNQA---EVNEVKTLGHDAVKISQLFAKLCSILKIAPRTPEAAE--GHL  445

Query  603   PPALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKS  424
             P A+E Y N + PC TS   P   +EDV VR  + +++SSKN+VFLWGF+   S G++KS
Sbjct  446   PDAIECYTNSYSPCFTSSHGPA--DEDVSVRTDNTRKISSKNLVFLWGFRGVTSAGKLKS  503

Query  423   LVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDSG-----SLEEMVSEGIRA  259
             L+ G HEVF  EFD+R+VD+SCAV+ F +PG +EV+L+ + SG     +L+EM+++G+ A
Sbjct  504   LLCGSHEVF-HEFDVRMVDKSCAVVAFRNPGFAEVMLQLMYSGGICTNTLKEMLADGLTA  562

Query  258   ASYDAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
             A Y+ Y KVC+LGLW+++LA S+E A EE          +K+LS + WN+DEMI+LDDL
Sbjct  563   AGYETYQKVCELGLWESDLASSMEKASEEIESFSEAQ--SKELSGLCWNNDEMINLDDL  619


 Score =   353 bits (907),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 170/248 (69%), Positives = 201/248 (81%), Gaps = 1/248 (0%)
 Frame = -2

Query  1913  MLQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQ  1734
             MLQRRL C+ +S T  + N G S   KW +KQVTKSNFS AL +I T I++SDFIAVSL+
Sbjct  1     MLQRRLICSRVSNTVVQSNPGHSQ-SKWNVKQVTKSNFSAALEEISTCISDSDFIAVSLK  59

Query  1733  TTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFP  1554
              TGAYS+PWQR++P DTA IAYLKAK AAER+Q+LQF VCPFS++ SKLI  PYNFHLFP
Sbjct  60    NTGAYSAPWQRIMPIDTAHIAYLKAKYAAERFQVLQFTVCPFSIKGSKLIVHPYNFHLFP  119

Query  1553  RDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAGS  1374
             RDELK GMPSYSFSCQSSYL S+A+EGFDFNACI DGISYLS++QE AA D I + S  S
Sbjct  120   RDELKIGMPSYSFSCQSSYLTSMAQEGFDFNACIYDGISYLSKSQESAAVDRIGNASPIS  179

Query  1373  CTVPSPASRSVADSIFINRIKSRVKHWRNACTDQSKKTEDVLISSLRKMISATEVHGSRP  1194
             CTV +P+  +VADS+F  RIKSRVK+W  AC D +KK ED LISSLRK++S  EV+GSRP
Sbjct  180   CTVQTPSGYTVADSVFAERIKSRVKNWITACKDTNKKPEDALISSLRKIVSGDEVYGSRP  239

Query  1193  CLNIDICS  1170
             CL+ID+CS
Sbjct  240   CLSIDVCS  247



>ref|XP_004247263.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Solanum lycopersicum]
Length=619

 Score =   361 bits (926),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/359 (56%), Positives = 265/359 (74%), Gaps = 15/359 (4%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             A GG  + VRVVLTSS+ED+ LL+K+LQ  E +HNK +RGFREV+DLIS SQKPVVAHNS
Sbjct  271   AMGGTIRPVRVVLTSSEEDRILLQKQLQNEEEEHNKRLRGFREVIDLISASQKPVVAHNS  330

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             LNDFT IHSKFLAPLPSTL+EFR SL  VFP++LDV HLM E+  Q  +NN+    SYL 
Sbjct  331   LNDFTFIHSKFLAPLPSTLEEFRSSLCLVFPNVLDVNHLMNEINPQTKVNNLPACISYLK  390

Query  783   SRFFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQL  604
              RFFAP+D+E+P+QA   + + VK+ GH+ +KIS+LFAK+CSILK+ P+ PEA E  G  
Sbjct  391   QRFFAPIDIEIPNQA---EVNEVKTLGHDAVKISQLFAKLCSILKIAPRTPEAAE--GHF  445

Query  603   PPALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKS  424
             P A+E Y N ++PC TS       +EDV VR  + +++S KN+VFLWGF+   S G++KS
Sbjct  446   PDAIECYRNSYNPCFTSSHGSA--DEDVSVRTDNTRKISCKNLVFLWGFRGMTSAGKLKS  503

Query  423   LVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDSG-----SLEEMVSEGIRA  259
             L+ G H+VF  +FD+R+VD+SCAV+ F +PG +EVL + +DSG     +L+EM+++G+ A
Sbjct  504   LLCGSHDVF-HDFDVRMVDKSCAVVAFRNPGFAEVLFQLMDSGGICTKTLKEMLADGLTA  562

Query  258   ASYDAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
             A YD Y KVC+LGLW+A+LA S+E AL E          +K+LS + WN+DEMI+LDDL
Sbjct  563   AGYDTYQKVCELGLWEADLASSMEKALGEIESFSEAQ--SKELSGMCWNNDEMINLDDL  619


 Score =   351 bits (900),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 168/248 (68%), Positives = 201/248 (81%), Gaps = 1/248 (0%)
 Frame = -2

Query  1913  MLQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQ  1734
             M+QRRLFC+ IS T  + N G S   KW +KQVTKSNFS AL +I   I++SDFIA+SL+
Sbjct  1     MIQRRLFCSMISNTVVQSNPGHSQ-SKWNVKQVTKSNFSAALEEIRNCISDSDFIAISLK  59

Query  1733  TTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFP  1554
              TGAYS+PWQR++P DTA  AYLKAK AAER+Q+LQFAVCPFS++ SKLI  PYNFHLFP
Sbjct  60    NTGAYSAPWQRIMPIDTARTAYLKAKYAAERFQVLQFAVCPFSIKGSKLIVHPYNFHLFP  119

Query  1553  RDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAGS  1374
             RDELK GMPSYSFSCQSSYL S+++EGFDFNACI DGISYLS++QE AA D I + S  S
Sbjct  120   RDELKIGMPSYSFSCQSSYLTSMSQEGFDFNACIYDGISYLSKSQESAAVDRIGNASPIS  179

Query  1373  CTVPSPASRSVADSIFINRIKSRVKHWRNACTDQSKKTEDVLISSLRKMISATEVHGSRP  1194
             CTV +P+  +VADS+F  RIKSRVK+W  AC D +KK ED LISSLRK++S  EV+GSRP
Sbjct  180   CTVQTPSGYTVADSVFAQRIKSRVKNWITACKDTNKKPEDALISSLRKIVSGDEVYGSRP  239

Query  1193  CLNIDICS  1170
             CL+ID+CS
Sbjct  240   CLSIDVCS  247



>emb|CDP11722.1| unnamed protein product [Coffea canephora]
Length=628

 Score =   346 bits (888),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 169/253 (67%), Positives = 199/253 (79%), Gaps = 5/253 (2%)
 Frame = -2

Query  1913  MLQRRLFCTAISETAFRP---NSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAV  1743
             +LQRRL CT + + +  P    +   N  KW IKQVTKSNF+E L +I+T I  SDFIAV
Sbjct  2     LLQRRLLCTQVPKRSIHPTHHQNSNLNNKKWAIKQVTKSNFAETLEEIKTHIFNSDFIAV  61

Query  1742  SLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFH  1563
             SLQ TGA+SSPWQ++LPFDTAE+AYLKAK AAER+Q+LQFAVCPFS++ SK+IA PYNFH
Sbjct  62    SLQKTGAFSSPWQKVLPFDTAEVAYLKAKYAAERFQVLQFAVCPFSVKSSKIIAHPYNFH  121

Query  1562  LFPRDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPS  1383
             LFPRDELK GMPSYSF CQSSYL ++A+EGFDFNACI DGISYLSRAQELAAKD   +P 
Sbjct  122   LFPRDELKMGMPSYSFFCQSSYLTAMAQEGFDFNACIYDGISYLSRAQELAAKDRTGNPL  181

Query  1382  AGSCTVP--SPASRSVADSIFINRIKSRVKHWRNACTDQSKKTEDVLISSLRKMISATEV  1209
               S   P  SP   SVADS+F++RIKSR+K W+  C D  KKTED LIS+LRK++S  EV
Sbjct  182   PRSYMKPSQSPTVYSVADSMFVDRIKSRIKIWKRTCQDSEKKTEDDLISTLRKIVSGGEV  241

Query  1208  HGSRPCLNIDICS  1170
              GSRP L+IDICS
Sbjct  242   FGSRPSLSIDICS  254


 Score =   319 bits (817),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 177/359 (49%), Positives = 247/359 (69%), Gaps = 13/359 (4%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             A GGG+Q +RVVLTSS+ED+ + EKELQ ME +HN  VRGFREVVDLIS SQKPVVAHN+
Sbjct  278   AKGGGSQAIRVVLTSSKEDRNVFEKELQLMEEEHNMQVRGFREVVDLISTSQKPVVAHNA  337

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             +N+F  IHSKF+APLPST+DEFR SL  VF HI+DV HLM+E+G    +NN+  A  YL 
Sbjct  338   INEFAFIHSKFIAPLPSTVDEFRSSLCSVFSHIVDVNHLMREIGPLNKVNNLPAAILYLK  397

Query  783   SRFFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQL  604
              RF  P+ +E+P        D V+ HG +VL+ISELFAK+C IL++ P++PEA       
Sbjct  398   RRFTRPLHMEIPQH---IDGDEVRVHGRDVLRISELFAKLCLILRIVPESPEADYSTSS-  453

Query  603   PPALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKS  424
                LE YAN+F+PC  S  D  + ++DV +  +  +R+S  N+VFLWGF+  +S  ++KS
Sbjct  454   -STLECYANVFNPCFISSSD--LLDDDVNISTEKTRRISVANLVFLWGFRGMMSARKLKS  510

Query  423   LVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDSGS-----LEEMVSEGIRA  259
             L+ G HEVFS E D+RL D +CA++VF +PG +E  L+ ++SG      +++M+SEG+RA
Sbjct  511   LLKGSHEVFSGEIDVRLADRNCAIVVFWAPGFAERFLKVMNSGGTNCEPIKDMISEGLRA  570

Query  258   ASYDAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
             A Y  Y +VC+L +W+ +          EE+  L EA++ ++L  I W++DE+ +LDDL
Sbjct  571   ACYRTYKRVCELSIWEPS-LADALEKALEEASDLPEANSEEELPAICWDNDELTNLDDL  628



>ref|XP_011089613.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X1 
[Sesamum indicum]
 ref|XP_011089614.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X2 
[Sesamum indicum]
Length=615

 Score =   325 bits (834),  Expect(2) = 3e-173, Method: Compositional matrix adjust.
 Identities = 184/357 (52%), Positives = 248/357 (69%), Gaps = 12/357 (3%)
 Frame = -1

Query  1137  GGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLN  958
             G G Q VR VLTSSQEDK LLEKELQ ME +  + V GFREV+DLIS SQ+PVV HNSLN
Sbjct  266   GAGVQAVRAVLTSSQEDKNLLEKELQHMEQEQRERVLGFREVIDLISTSQRPVVVHNSLN  325

Query  957   DFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSR  778
             DF  IHSKFLAPLP T+DEFR SL  +FPHILDV HLMKE+G  + +NN+  A SYL  R
Sbjct  326   DFAFIHSKFLAPLPLTMDEFRSSLHLIFPHILDVNHLMKEIGPFEKMNNMPAAISYLERR  385

Query  777   FFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPP  598
             F   +D+++  QA     D V  HGHNVL++  LF K+CSILK+ P+ PE  +    L P
Sbjct  386   FSGSIDMDISSQA---DTDKVNIHGHNVLRVCHLFVKLCSILKISPEVPEDGQ--SHLSP  440

Query  597   ALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLV  418
             +L R++NIF+PCS++  +P   E+DVR+   + + +S  N+VFLWGF+SGIS   +K L+
Sbjct  441   SLPRHSNIFNPCSSNSTNPI--EDDVRIWTGNSRTISINNLVFLWGFESGISARSLKDLL  498

Query  417   YGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDSGS-----LEEMVSEGIRAAS  253
                H+VFS EFD+R++D +CAV+VF +PG +E  L  +DSG      L  ++S G++AA 
Sbjct  499   CDTHDVFSEEFDVRMLDRTCAVVVFWTPGFAECFLRIIDSGEIISTKLTGLISGGLKAAG  558

Query  252   YDAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
             Y+ Y +VC+ GL K++LAD L+ A++E         + ++  VI+WN+DEMI+L+DL
Sbjct  559   YETYKRVCESGLRKSDLADCLDQAMDETEILSGTVKSQQEQPVIYWNNDEMINLNDL  615


 Score =   313 bits (801),  Expect(2) = 3e-173, Method: Compositional matrix adjust.
 Identities = 152/222 (68%), Positives = 179/222 (81%), Gaps = 1/222 (0%)
 Frame = -2

Query  1835  KWGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAK  1656
             +W +KQVTKSNFSEAL +I+  I  SD++AVS + TG +S+PW ++LP DTAE AY KAK
Sbjct  20    QWPVKQVTKSNFSEALAEIKACILNSDYVAVSFKQTGGHSAPWHKILPIDTAETAYFKAK  79

Query  1655  RAAERYQILQFAVCPFSLRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIARE  1476
              AAER+QILQFAVCPFS++ SKLIA PYNFHLFPRDELK GMPSYSFSCQSSYL ++A+E
Sbjct  80    HAAERFQILQFAVCPFSVKASKLIAHPYNFHLFPRDELKVGMPSYSFSCQSSYLTAMAQE  139

Query  1475  GFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSVADSIFINRIKSRVKH  1296
             GFDFNACI +GISYLS+AQE A    I   S  SCTV S +  SVADS+F  RI+SRVK+
Sbjct  140   GFDFNACIYNGISYLSKAQESATNVQIGHLSPSSCTVHSSSVHSVADSLFTERIRSRVKN  199

Query  1295  WRNACTDQSKKTEDVLISSLRKMISATEVHGSRPCLNIDICS  1170
             W  AC D S KTED LISSLRK+IS +EV+GSRP LNID+CS
Sbjct  200   WIRACKD-SNKTEDALISSLRKLISGSEVYGSRPSLNIDVCS  240



>ref|XP_011089615.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X3 
[Sesamum indicum]
Length=614

 Score =   323 bits (828),  Expect(2) = 2e-172, Method: Compositional matrix adjust.
 Identities = 183/357 (51%), Positives = 247/357 (69%), Gaps = 13/357 (4%)
 Frame = -1

Query  1137  GGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLN  958
             G G Q VR VLTSSQEDK LLEKELQ ME +  + V GFREV+DLIS SQ+PVV HNSLN
Sbjct  266   GAGVQAVRAVLTSSQEDKNLLEKELQHMEQEQRERVLGFREVIDLISTSQRPVVVHNSLN  325

Query  957   DFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSR  778
             DF  IHSKFLAPLP T+DEFR SL  +FPHILDV HLMKE+G  + +NN+  A SYL  R
Sbjct  326   DFAFIHSKFLAPLPLTMDEFRSSLHLIFPHILDVNHLMKEIGPFEKMNNMPAAISYLERR  385

Query  777   FFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPP  598
             F   +D+++  Q      D V  HGHNVL++  LF K+CSILK+ P+ PE  +    L P
Sbjct  386   FSGSIDMDISSQ----DTDKVNIHGHNVLRVCHLFVKLCSILKISPEVPEDGQ--SHLSP  439

Query  597   ALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLV  418
             +L R++NIF+PCS++  +P   E+DVR+   + + +S  N+VFLWGF+SGIS   +K L+
Sbjct  440   SLPRHSNIFNPCSSNSTNPI--EDDVRIWTGNSRTISINNLVFLWGFESGISARSLKDLL  497

Query  417   YGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDSGS-----LEEMVSEGIRAAS  253
                H+VFS EFD+R++D +CAV+VF +PG +E  L  +DSG      L  ++S G++AA 
Sbjct  498   CDTHDVFSEEFDVRMLDRTCAVVVFWTPGFAECFLRIIDSGEIISTKLTGLISGGLKAAG  557

Query  252   YDAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
             Y+ Y +VC+ GL K++LAD L+ A++E         + ++  VI+WN+DEMI+L+DL
Sbjct  558   YETYKRVCESGLRKSDLADCLDQAMDETEILSGTVKSQQEQPVIYWNNDEMINLNDL  614


 Score =   313 bits (801),  Expect(2) = 2e-172, Method: Compositional matrix adjust.
 Identities = 152/222 (68%), Positives = 179/222 (81%), Gaps = 1/222 (0%)
 Frame = -2

Query  1835  KWGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAK  1656
             +W +KQVTKSNFSEAL +I+  I  SD++AVS + TG +S+PW ++LP DTAE AY KAK
Sbjct  20    QWPVKQVTKSNFSEALAEIKACILNSDYVAVSFKQTGGHSAPWHKILPIDTAETAYFKAK  79

Query  1655  RAAERYQILQFAVCPFSLRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIARE  1476
              AAER+QILQFAVCPFS++ SKLIA PYNFHLFPRDELK GMPSYSFSCQSSYL ++A+E
Sbjct  80    HAAERFQILQFAVCPFSVKASKLIAHPYNFHLFPRDELKVGMPSYSFSCQSSYLTAMAQE  139

Query  1475  GFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSVADSIFINRIKSRVKH  1296
             GFDFNACI +GISYLS+AQE A    I   S  SCTV S +  SVADS+F  RI+SRVK+
Sbjct  140   GFDFNACIYNGISYLSKAQESATNVQIGHLSPSSCTVHSSSVHSVADSLFTERIRSRVKN  199

Query  1295  WRNACTDQSKKTEDVLISSLRKMISATEVHGSRPCLNIDICS  1170
             W  AC D S KTED LISSLRK+IS +EV+GSRP LNID+CS
Sbjct  200   WIRACKD-SNKTEDALISSLRKLISGSEVYGSRPSLNIDVCS  240



>ref|XP_010645230.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Vitis vinifera]
Length=610

 Score =   329 bits (843),  Expect(2) = 8e-171, Method: Compositional matrix adjust.
 Identities = 194/360 (54%), Positives = 251/360 (70%), Gaps = 14/360 (4%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             A GGGTQ VRV+LTSS+EDK LL++ELQ++E + NK V GFREV+DLIS SQKPVV+HNS
Sbjct  259   AKGGGTQAVRVILTSSEEDKDLLKRELQDLEEEQNKRVCGFREVIDLISASQKPVVSHNS  318

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             LN+F  IHSKFL+PLP  +DEF  SL  VFPH+LDV HLMKE+G  K + N+  A S L 
Sbjct  319   LNEFAFIHSKFLSPLPPNMDEFMCSLRMVFPHVLDVNHLMKEIGPLKKVTNLSAAASCLK  378

Query  783   SRFFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQL  604
              RFF P+D+E+PHQA    ++  K HGHNVLKIS L A +CSILK+ P+  ++    G L
Sbjct  379   RRFFVPIDMEIPHQA----SNEDKIHGHNVLKISHLLANLCSILKITPEMIQS--DGGHL  432

Query  603   PPALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKS  424
               ALE YANIF P ST+ +DP   +  ++V     ++VSS+ +VF+WGF+  +S G +K 
Sbjct  433   ASALEGYANIFHPHSTNTEDPI--DGGIKVWTDDTRKVSSEGLVFIWGFRGRMSAGGLKR  490

Query  423   LVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALD----SGSLEEMVSEGIRAA  256
             L+ G H VFS EFD+R+VD SCA++VF   GLS+  LEA+     SG L EMVSEG+RAA
Sbjct  491   LLQGSHSVFSEEFDVRMVDGSCAIVVFWQSGLSQTFLEAISSNWISGLLREMVSEGLRAA  550

Query  255   SYDAYVKVCKLGLWKANladslelaleeeseclseAHTAKDL--SVIHWNSDEMISLDDL  82
              Y+ Y   C+LG W+A+LADSL+ ALEE          AK    S I+W+ D +I+LD+L
Sbjct  551   GYETYKNACRLGFWEADLADSLDKALEEPDHNSEADSEAKPTGPSQIYWSRDSIINLDEL  610


 Score =   301 bits (771),  Expect(2) = 8e-171, Method: Compositional matrix adjust.
 Identities = 138/228 (61%), Positives = 180/228 (79%), Gaps = 0/228 (0%)
 Frame = -2

Query  1853  GGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEI  1674
             G S   +W +KQVTKSNFS+ L  ++ +I++SDF+AVSLQ TG++S+PW R+LPFDT + 
Sbjct  7     GLSTKREWRVKQVTKSNFSQTLESLKPQISQSDFVAVSLQKTGSFSAPWHRVLPFDTPQT  66

Query  1673  AYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYL  1494
             AY KA+ AA+++Q+ QFAVCPFS+R SK++A PYNFHLFPRDELK GMPSYSFSCQ+SYL
Sbjct  67    AYSKARFAADKFQVFQFAVCPFSVRASKVVAHPYNFHLFPRDELKIGMPSYSFSCQTSYL  126

Query  1493  ISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSVADSIFINRI  1314
              S+AREGFDFN CI DGISYLSRAQE  A   I +P   +    S ++ SVAD++FI RI
Sbjct  127   ASMAREGFDFNVCIYDGISYLSRAQESVANARIGNPIPSNNVKTSSSTPSVADAVFIERI  186

Query  1313  KSRVKHWRNACTDQSKKTEDVLISSLRKMISATEVHGSRPCLNIDICS  1170
             KSRVKHW++AC D S + ++ L+ SLRK+I  +E + SRPC+N+D+CS
Sbjct  187   KSRVKHWKSACRDSSTRADEALVKSLRKLILGSEEYRSRPCVNLDVCS  234



>ref|XP_002527264.1| ribonuclease, putative [Ricinus communis]
 gb|EEF35108.1| ribonuclease, putative [Ricinus communis]
Length=624

 Score =   324 bits (830),  Expect(2) = 2e-170, Method: Compositional matrix adjust.
 Identities = 174/318 (55%), Positives = 228/318 (72%), Gaps = 12/318 (4%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             A GGGTQ VRVVLTSS+ED+ LL+ ELQ +E++ NK +RGFREV+DLIS S+KPVV+HNS
Sbjct  274   AKGGGTQAVRVVLTSSKEDRDLLQMELQNLEDEQNKKIRGFREVIDLISGSEKPVVSHNS  333

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             LND   IHSKFLAPLP +++EF  SL  VFP ++DV HLMKE+   K + NI +ATSYL 
Sbjct  334   LNDLAFIHSKFLAPLPPSMEEFTCSLRLVFPQVIDVNHLMKEISPLKKVTNIPMATSYLK  393

Query  783   SRFFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQL  604
             + FFAPVD+E+P  A+  +    K HGHNV++I +LFAK+C ILK+ P + ++ E    L
Sbjct  394   NWFFAPVDMEIPFPAMVNEG---KIHGHNVMRICQLFAKLCYILKLAPNSIQSNE--KNL  448

Query  603   PPALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKS  424
               A+E Y NIF P     Q+P   +EDVR+   + ++VS +++VFLWGF+  +S G +KS
Sbjct  449   ASAIEAYVNIFSPYFPGPQEP--TDEDVRIWTNNTRKVSCQDLVFLWGFRYRMSAGMLKS  506

Query  423   LVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDS-----GSLEEMVSEGIRA  259
             L+   H+VFS EFD+R VD+SCA++VF  PGLS  LL+ L       G L EMVSEG+RA
Sbjct  507   LLQQSHKVFSEEFDVRFVDKSCAIVVFWEPGLSNTLLDVLKGSSEIVGPLREMVSEGVRA  566

Query  258   ASYDAYVKVCKLGLWKAN  205
             ASYD Y +VC+LGLW  N
Sbjct  567   ASYDTYNRVCRLGLWHEN  584


 Score =   305 bits (781),  Expect(2) = 2e-170, Method: Compositional matrix adjust.
 Identities = 140/247 (57%), Positives = 188/247 (76%), Gaps = 7/247 (3%)
 Frame = -2

Query  1910  LQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQT  1731
             LQRRLFCT I       +     + +W +KQ+TKSNF+++L +I + I  SDFI++SL+T
Sbjct  10    LQRRLFCTKIH------HHRAHTHNQWNVKQITKSNFADSLPEINSHIMCSDFISISLKT  63

Query  1730  TGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFPR  1551
             TG++SSPW R+ PFDT ++AYLK+K AAE++QILQ AVCPF++  SK+ A PYNFHLFPR
Sbjct  64    TGSFSSPWHRVSPFDTPDVAYLKSKHAAEKFQILQLAVCPFTVSASKVTAYPYNFHLFPR  123

Query  1550  DELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAGSC  1371
             DEL +GMPSYSFSC +SYL  + +EGFDFNAC+NDGISYLSRAQE AA+  +++P     
Sbjct  124   DELNSGMPSYSFSCHTSYLTKMVQEGFDFNACVNDGISYLSRAQESAARVRMKNPFLAKD  183

Query  1370  TVPSPASRSVADSIFINRIKSRVKHWRNACTDQSKKTEDVLISSLRKMISATEVHGSRPC  1191
              V S ++  VADS+F+ R +SRVK+W+NACTD S  T++ L+ SLRK++   E + SRPC
Sbjct  184   IVESTSTPGVADSVFVQRTRSRVKNWKNACTDTS-STDEALVKSLRKLVLGLEEYNSRPC  242

Query  1190  LNIDICS  1170
             +NID+CS
Sbjct  243   INIDVCS  249



>ref|XP_010095607.1| Poly(A)-specific ribonuclease PARN-like protein [Morus notabilis]
 gb|EXB61180.1| Poly(A)-specific ribonuclease PARN-like protein [Morus notabilis]
Length=613

 Score =   318 bits (815),  Expect(2) = 6e-168, Method: Compositional matrix adjust.
 Identities = 187/359 (52%), Positives = 252/359 (70%), Gaps = 12/359 (3%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             A  GGTQ VRVVL SS+EDK+  E+EL+  E + NK  RGFREV+DLIS SQKPVV++NS
Sbjct  262   AKSGGTQAVRVVLASSKEDKEFFEEELRCREEEENKKFRGFREVIDLISASQKPVVSYNS  321

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             L DFT IHSKFLAPLP T+DEF  SL  VFPH+LDV HLMK +   + + NI VA SYLN
Sbjct  322   LTDFTFIHSKFLAPLPPTIDEFASSLRPVFPHVLDVSHLMKVVRPLRKVANIPVAISYLN  381

Query  783   SRFFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQL  604
             + FFAPVD+E+ HQA   +    ++HG NV++I  LFAK+CSILK+   +  +      L
Sbjct  382   NHFFAPVDIEISHQATENEG---RNHGLNVIRICHLFAKLCSILKIGSSSTMSGNDV-LL  437

Query  603   PPALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKS  424
              PALE   N+F+  STS ++    +ED+ V  +S ++VS +++VFLWGF SG + G++KS
Sbjct  438   APALEECTNVFNAFSTSSEESI--DEDISVWTESTRKVSCEHLVFLWGFGSGTTAGKLKS  495

Query  423   LVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALD-----SGSLEEMVSEGIRA  259
             L+   H V S EFDIRLVD+SCA+LVF  PGL+E  L+ ++     +GSL E+VSEG+RA
Sbjct  496   LLNKSHYVSSKEFDIRLVDKSCAILVFWQPGLAETFLDVMNNSEEITGSLRELVSEGLRA  555

Query  258   ASYDAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
             ASY+ Y +VCKL +W+A+          E+S+CL+EAH+      I+W++D+MI+LD+L
Sbjct  556   ASYETYKRVCKLPIWEAD-LGESLDRALEDSDCLTEAHSKATPKEIYWSNDDMINLDEL  613


 Score =   302 bits (774),  Expect(2) = 6e-168, Method: Compositional matrix adjust.
 Identities = 145/249 (58%), Positives = 187/249 (75%), Gaps = 13/249 (5%)
 Frame = -2

Query  1916  SMLQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSL  1737
             ++LQ+RLFC+A+ +             KW +KQVTK+NF E+L +I+  I+ SDF+AVSL
Sbjct  2     AVLQKRLFCSAVPK-------------KWPVKQVTKTNFPESLEEIKRHISSSDFVAVSL  48

Query  1736  QTTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLF  1557
             Q TG++S+PW RLLPFDTA+ AY KAK +AER+Q+ QFA+CPFSL  SKL+A PYN+ L+
Sbjct  49    QKTGSFSAPWHRLLPFDTADTAYSKAKSSAERFQLFQFALCPFSLENSKLVAHPYNYLLY  108

Query  1556  PRDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAG  1377
             PRDELK GMPSYSFSCQSS+L S+AREGFDFNACI  GISYLSR QE AAK  I +PS  
Sbjct  109   PRDELKLGMPSYSFSCQSSHLTSMAREGFDFNACIYHGISYLSREQETAAKIRIGNPSPS  168

Query  1376  SCTVPSPASRSVADSIFINRIKSRVKHWRNACTDQSKKTEDVLISSLRKMISATEVHGSR  1197
             +  V S  + SVADSIF+ R+KSRV  W++AC        +VL++SLRK+I  +E +GSR
Sbjct  169   TLVVDSSFAPSVADSIFMERLKSRVIRWKSACQKPKDSRNEVLMNSLRKLIMGSEYYGSR  228

Query  1196  PCLNIDICS  1170
             P +N+D+CS
Sbjct  229   PSINLDVCS  237



>ref|XP_008235891.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X1 
[Prunus mume]
Length=614

 Score =   329 bits (844),  Expect(2) = 2e-167, Method: Compositional matrix adjust.
 Identities = 190/359 (53%), Positives = 253/359 (70%), Gaps = 15/359 (4%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             A GGGTQ VRVVLTSS+EDK   E+ELQ +E + N+ VRGFREV+DLIS SQKPVV+HNS
Sbjct  266   AKGGGTQAVRVVLTSSKEDKDSFERELQNLEEEQNQRVRGFREVIDLISASQKPVVSHNS  325

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             LNDFT IHSKFL+PLP+ +DEF  SL  VFPH+LDV H+MK +G  + + NI+ A SYLN
Sbjct  326   LNDFTFIHSKFLSPLPTNVDEFMDSLHLVFPHLLDVNHMMKNIGPLRKVTNIHAAISYLN  385

Query  783   SRFFAPVDVE-LPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQ  607
             + +FAP+D+E LP +      +    H HNV+K+  LFAK+CSILK+   A     +   
Sbjct  386   NHYFAPIDMENLPQE-----NEEGTVHRHNVVKMCYLFAKLCSILKIPDNA--MTSNNAL  438

Query  606   LPPALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVK  427
             L PA E Y NI +P   S Q+  IN +D+R+  K+ K+VS  ++VFLWGF+SG++ G +K
Sbjct  439   LAPAPEEYTNISNPYPDSPQE-SIN-DDIRIWTKNMKKVSCNHLVFLWGFRSGMTAGMLK  496

Query  426   SLVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDS----GSLEEMVSEGIRA  259
             SL++  H+VFS EFD+RLVD+SCA++VF  PGLSE  L+ +      GSL EMVSEG+RA
Sbjct  497   SLLHKSHDVFSEEFDVRLVDKSCAIVVFWRPGLSETFLDFVSGEEICGSLREMVSEGLRA  556

Query  258   ASYDAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
             +SY+AY +VC+LGLW+AN          E+ +CL EA+ A +   I+W+SD  I+ D+L
Sbjct  557   SSYEAYKRVCRLGLWEAN-LAESLDRALEDPDCLVEANLAANCKEIYWSSDSTINFDNL  614


 Score =   290 bits (741),  Expect(2) = 2e-167, Method: Compositional matrix adjust.
 Identities = 135/222 (61%), Positives = 176/222 (79%), Gaps = 2/222 (1%)
 Frame = -2

Query  1835  KWGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAK  1656
             KW +K+VTK NF ++L + +  +  +DF+AVSLQ TG++S+ W R  PFDTA+ +Y KAK
Sbjct  22    KWAVKEVTKLNFKKSLEEFKDHLAGADFVAVSLQKTGSFSAAWHRPQPFDTADTSYCKAK  81

Query  1655  RAAERYQILQFAVCPFSLRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIARE  1476
              AAER+Q+LQFA CPF+LR SKL   PYNF LFPRDELK GMPSYSFS Q+S+L S+A+E
Sbjct  82    YAAERFQLLQFAACPFTLRASKLTPHPYNFVLFPRDELKLGMPSYSFSVQTSHLTSMAQE  141

Query  1475  GFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSVADSIFINRIKSRVKH  1296
             GFDFNACI +GISYLSRAQE AAK  I +PS  +  + S ++ +VAD++FI RIKSRVKH
Sbjct  142   GFDFNACIYNGISYLSRAQESAAKVRIGNPSPSTYIMNSSSTHTVADTVFIERIKSRVKH  201

Query  1295  WRNACTDQSKKTEDVLISSLRKMISATEVHGSRPCLNIDICS  1170
             W+NAC  +S K +D L+SSLRK++  +E++GSRPC+NID+CS
Sbjct  202   WKNAC--RSSKKDDALLSSLRKLVLGSELYGSRPCMNIDVCS  241



>ref|XP_009358962.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X1 
[Pyrus x bretschneideri]
Length=615

 Score =   325 bits (834),  Expect(2) = 4e-166, Method: Compositional matrix adjust.
 Identities = 185/359 (52%), Positives = 246/359 (69%), Gaps = 16/359 (4%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             + GGGTQ VRVVLTSS  DK L E+ELQ +E + NK VRGFREV+DLIS SQKPVV+HNS
Sbjct  268   SRGGGTQAVRVVLTSSTADKDLFERELQNLEEEQNKRVRGFREVIDLISASQKPVVSHNS  327

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             LNDFT IHS+FL+PLP+ +DEF  SL  VF HILDV HLMK +G  + + NI  A SYLN
Sbjct  328   LNDFTVIHSEFLSPLPTNVDEFMGSLHSVFTHILDVSHLMKNIGPLRKMTNISAAISYLN  387

Query  783   SRFFAPVDVE-LPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQ  607
             + +FAP+D+E LP ++          H HNV+K+  LFAK+CSILK+   A   + +   
Sbjct  388   NHYFAPIDMEILPQES------EGNIHRHNVVKMCYLFAKLCSILKISDNA--MVSNNAL  439

Query  606   LPPALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVK  427
             L PA+E Y NI +PCS S Q+     ED+RV  K+ ++VS   +VFLWGF+SG++ G +K
Sbjct  440   LAPAIEEYTNISNPCSDSPQES--TNEDIRVWTKNMRKVSCDQLVFLWGFRSGMTAGMIK  497

Query  426   SLVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDS----GSLEEMVSEGIRA  259
             SL+   H VFS EFD+RLVD+SCA++VF   GLSE  L+A+       SL E+ SEGIRA
Sbjct  498   SLLCKSHAVFSEEFDVRLVDKSCAIVVFWRRGLSETFLDAMSREEICDSLVEIASEGIRA  557

Query  258   ASYDAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
             +SY+ Y +VC+LGLW+A+          E+ + L+E ++A +   I+W+S+  I+ DDL
Sbjct  558   SSYETYKRVCRLGLWEAD-LAESLDKALEDLDYLAEVNSATNSKEIYWSSNSAINFDDL  615


 Score =   289 bits (740),  Expect(2) = 4e-166, Method: Compositional matrix adjust.
 Identities = 135/222 (61%), Positives = 179/222 (81%), Gaps = 2/222 (1%)
 Frame = -2

Query  1835  KWGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAK  1656
             KW +K+VTKSNFSE+L + +  ++ SDF+AVSLQ TG+Y +PWQR  PFDTAE +Y KAK
Sbjct  24    KWAVKEVTKSNFSESLVEFKDHLSSSDFVAVSLQKTGSYRAPWQRPQPFDTAETSYCKAK  83

Query  1655  RAAERYQILQFAVCPFSLRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIARE  1476
              AAER+Q+LQFA CPF+LR SKL   PYNF LFPRDELK GMP+YSFS Q+S+L S+A E
Sbjct  84    YAAERFQLLQFAACPFTLRASKLTPYPYNFVLFPRDELKMGMPTYSFSVQASHLTSMADE  143

Query  1475  GFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSVADSIFINRIKSRVKH  1296
             GFDFNACI +GISYLSRAQE AAK  I +P+  S  + S ++ +VAD++F+ RIKSRVKH
Sbjct  144   GFDFNACIYNGISYLSRAQESAAKARIGNPTTSSYVMSSSSTHTVADTVFVERIKSRVKH  203

Query  1295  WRNACTDQSKKTEDVLISSLRKMISATEVHGSRPCLNIDICS  1170
             W++AC  ++ K ++ L+SSLRK++  +E++G+RPC+N+D+CS
Sbjct  204   WKSAC--KNTKKDNALLSSLRKIVMGSEIYGTRPCMNLDVCS  243



>ref|XP_009334241.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Pyrus x bretschneideri]
Length=606

 Score =   319 bits (818),  Expect(2) = 2e-165, Method: Compositional matrix adjust.
 Identities = 184/358 (51%), Positives = 251/358 (70%), Gaps = 22/358 (6%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             A GGGTQ VRVVLTSS+EDK+L E+ELQ +E + NK VRGFREV+DLIS SQKPVV+HNS
Sbjct  267   AKGGGTQAVRVVLTSSKEDKELFERELQNLEEEQNKRVRGFREVIDLISASQKPVVSHNS  326

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             LNDFT IHS+FL+PLP  +DEF  SL  VFPHILD+ HLMK +G  + + NI+ A SYLN
Sbjct  327   LNDFTVIHSEFLSPLPINVDEFVGSLRSVFPHILDISHLMKNIGPLRTMTNIHAAISYLN  386

Query  783   SRFFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQL  604
             + +FAP+D+E     IS + +    H   V+K+   FAK+CSILK+   A   + +   L
Sbjct  387   NHYFAPIDME-----ISPQENEGNIHNLCVVKMCYFFAKLCSILKISENA--MVSNNALL  439

Query  603   PPALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKS  424
              PALE Y NI  P  ++        EDVRV  K+ ++VS  ++VFLWGF+SG++ G +KS
Sbjct  440   DPALEEYKNISGPQEST-------NEDVRVWTKNMRKVSCDDLVFLWGFRSGMTAGMLKS  492

Query  423   LVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDS----GSLEEMVSEGIRAA  256
             L++  H VFS EFD+RLVD+SCA++VF  P LS+  L+A+ S    GSL E++SEG+RA+
Sbjct  493   LLHKSHAVFSEEFDVRLVDKSCAIVVFWEPSLSQTFLDAVSSEEICGSLREIISEGLRAS  552

Query  255   SYDAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
             +Y+ Y +VC+LGLW+A+LA+S++ ALE+    +   ++      I+W+SD  I+ DDL
Sbjct  553   NYETYKRVCRLGLWEADLAESMDKALEDSDCLMEATYSND----IYWSSDFTINFDDL  606


 Score =   293 bits (749),  Expect(2) = 2e-165, Method: Compositional matrix adjust.
 Identities = 133/222 (60%), Positives = 176/222 (79%), Gaps = 2/222 (1%)
 Frame = -2

Query  1835  KWGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAK  1656
             KW +K+VTKSNFSE+L + +  ++ SDF+AVSLQ TG+Y +PW R  PFDT + +Y KAK
Sbjct  23    KWAVKKVTKSNFSESLEEFKNHLSSSDFVAVSLQKTGSYCAPWHRPQPFDTVDTSYFKAK  82

Query  1655  RAAERYQILQFAVCPFSLRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIARE  1476
              AAER+Q+LQFA CPF+LR SKL   PYNF LFPRDELK GMP+YSFS Q+S+L S+A E
Sbjct  83    YAAERFQLLQFAACPFTLRASKLTPHPYNFVLFPRDELKMGMPTYSFSVQTSHLTSMAEE  142

Query  1475  GFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSVADSIFINRIKSRVKH  1296
             GFDFNACI +GISYLSRAQE AAK  I +P+A SC   + ++ ++AD++F+ RIKSRVKH
Sbjct  143   GFDFNACIYNGISYLSRAQESAAKVRIGNPAAISCVTNTSSTHTIADTVFVERIKSRVKH  202

Query  1295  WRNACTDQSKKTEDVLISSLRKMISATEVHGSRPCLNIDICS  1170
             W+ A   +S K +D L+SSLRKM+  +E++G+RPC+++D+CS
Sbjct  203   WKTAF--KSTKKDDALLSSLRKMVMRSEMYGTRPCMDLDVCS  242



>ref|XP_011089616.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X4 
[Sesamum indicum]
Length=605

 Score =   326 bits (835),  Expect(2) = 2e-165, Method: Compositional matrix adjust.
 Identities = 184/357 (52%), Positives = 248/357 (69%), Gaps = 12/357 (3%)
 Frame = -1

Query  1137  GGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLN  958
             G G Q VR VLTSSQEDK LLEKELQ ME +  + V GFREV+DLIS SQ+PVV HNSLN
Sbjct  256   GAGVQAVRAVLTSSQEDKNLLEKELQHMEQEQRERVLGFREVIDLISTSQRPVVVHNSLN  315

Query  957   DFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSR  778
             DF  IHSKFLAPLP T+DEFR SL  +FPHILDV HLMKE+G  + +NN+  A SYL  R
Sbjct  316   DFAFIHSKFLAPLPLTMDEFRSSLHLIFPHILDVNHLMKEIGPFEKMNNMPAAISYLERR  375

Query  777   FFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPP  598
             F   +D+++  QA     D V  HGHNVL++  LF K+CSILK+ P+ PE  +    L P
Sbjct  376   FSGSIDMDISSQA---DTDKVNIHGHNVLRVCHLFVKLCSILKISPEVPEDGQ--SHLSP  430

Query  597   ALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLV  418
             +L R++NIF+PCS++  +P   E+DVR+   + + +S  N+VFLWGF+SGIS   +K L+
Sbjct  431   SLPRHSNIFNPCSSNSTNPI--EDDVRIWTGNSRTISINNLVFLWGFESGISARSLKDLL  488

Query  417   YGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDSGS-----LEEMVSEGIRAAS  253
                H+VFS EFD+R++D +CAV+VF +PG +E  L  +DSG      L  ++S G++AA 
Sbjct  489   CDTHDVFSEEFDVRMLDRTCAVVVFWTPGFAECFLRIIDSGEIISTKLTGLISGGLKAAG  548

Query  252   YDAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
             Y+ Y +VC+ GL K++LAD L+ A++E         + ++  VI+WN+DEMI+L+DL
Sbjct  549   YETYKRVCESGLRKSDLADCLDQAMDETEILSGTVKSQQEQPVIYWNNDEMINLNDL  605


 Score =   286 bits (732),  Expect(2) = 2e-165, Method: Compositional matrix adjust.
 Identities = 144/222 (65%), Positives = 170/222 (77%), Gaps = 11/222 (5%)
 Frame = -2

Query  1835  KWGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAK  1656
             +W +KQVTKSNFSEAL +I+  I  SD++AVS + TG +S+PW ++LP DTAE AY KAK
Sbjct  20    QWPVKQVTKSNFSEALAEIKACILNSDYVAVSFKQTGGHSAPWHKILPIDTAETAYFKAK  79

Query  1655  RAAERYQILQFAVCPFSLRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIARE  1476
              AAER+QILQFAVCPFS++ SKLIA PYNFHLFPRDELK GMPSYSFSCQSSYL ++A+E
Sbjct  80    HAAERFQILQFAVCPFSVKASKLIAHPYNFHLFPRDELKVGMPSYSFSCQSSYLTAMAQE  139

Query  1475  GFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSVADSIFINRIKSRVKH  1296
                       GISYLS+AQE A    I   S  SCTV S +  SVADS+F  RI+SRVK+
Sbjct  140   ----------GISYLSKAQESATNVQIGHLSPSSCTVHSSSVHSVADSLFTERIRSRVKN  189

Query  1295  WRNACTDQSKKTEDVLISSLRKMISATEVHGSRPCLNIDICS  1170
             W  AC D S KTED LISSLRK+IS +EV+GSRP LNID+CS
Sbjct  190   WIRACKD-SNKTEDALISSLRKLISGSEVYGSRPSLNIDVCS  230



>ref|XP_007049584.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein, putative isoform 1 [Theobroma cacao]
 gb|EOX93741.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein, putative isoform 1 [Theobroma cacao]
Length=623

 Score =   308 bits (788),  Expect(2) = 9e-165, Method: Compositional matrix adjust.
 Identities = 176/353 (50%), Positives = 240/353 (68%), Gaps = 12/353 (3%)
 Frame = -1

Query  1137  GGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLN  958
             GGGTQ VRVVLTSS+EDK L E+ELQ +E + NK +RGFREV+DLIS SQKPVV+HNSLN
Sbjct  274   GGGTQAVRVVLTSSKEDKSLFERELQNVEEEQNKKIRGFREVIDLISASQKPVVSHNSLN  333

Query  957   DFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSR  778
             DF+ IHSKF+ PLP  +DEF  SL  VFPH+ DV HLMKE+G  +N+ NI  A SYL +R
Sbjct  334   DFSVIHSKFIGPLPLNMDEFLCSLRLVFPHVFDVNHLMKEIGPLENVTNIPAAISYLKNR  393

Query  777   FFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPP  598
             FFAP+D+E+ H A+  +    K HG  VL+I  LFAK+CS+L++ P A ++ +    +  
Sbjct  394   FFAPIDMEISHGALLNEG---KIHGQTVLRICHLFAKLCSVLRITPGAIQSSD--DNITS  448

Query  597   ALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLV  418
              L  YA+ F  CS S Q+    +  +R+  KS ++V  K++VFLWGF+  +S G +KSL+
Sbjct  449   RLGGYAHSFKSCSVSSQESV--DGRIRIWTKSPRKVGCKHLVFLWGFRDSLSAGMLKSLL  506

Query  417   YGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALD----SGSLEEMVSEGIRAASY  250
              G H+VFS EFD+ LVD+SCA++VF  P LS+  L+ +     SGSL E+VSEG+RAA Y
Sbjct  507   QGSHDVFSEEFDVCLVDKSCAIVVFLQPNLSQAFLDIMSSEGISGSLRELVSEGLRAAGY  566

Query  249   DAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISL  91
             + Y + C LG W+A+LA +L+ A            +  + S ++W +D MI+L
Sbjct  567   ETYKRACGLGYWEADLASALDKASATPDCFSQSG-SETNPSEVYWCNDLMINL  618


 Score =   302 bits (773),  Expect(2) = 9e-165, Method: Compositional matrix adjust.
 Identities = 142/253 (56%), Positives = 190/253 (75%), Gaps = 8/253 (3%)
 Frame = -2

Query  1922  LCSMLQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAV  1743
             + +++ RRLFCT IS    +      +  +W +KQVTKSNF+++L+D  + ++ SDF+AV
Sbjct  1     MVALIPRRLFCTKISRNCHQ------HQLQWSVKQVTKSNFNDSLHDFHSHLSSSDFVAV  54

Query  1742  SLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFH  1563
             S Q TG++S+ W R+  FD  E AYLKA+RAA+R+Q+LQFAVCPF++  SK+ A PYNFH
Sbjct  55    SFQNTGSFSAAWHRVSSFDCPETAYLKARRAADRFQLLQFAVCPFTISGSKVTAHPYNFH  114

Query  1562  LFPRDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPS  1383
             LFPRDEL  GMPSYSFSCQ+SYL ++A++GFDFNACI DGISYLSRAQEL AK  + +P 
Sbjct  115   LFPRDELNIGMPSYSFSCQTSYLTAMAQQGFDFNACIYDGISYLSRAQELVAKVRMGNPI  174

Query  1382  AGSCTV-PSPASRSVADSIFINRIKSRVKHWRNACTD-QSKKTEDVLISSLRKMISATEV  1209
             A    V P+    SVAD+IF+ R+KSRVKHW+ AC D  S+KT++ L+ SLRK++   E 
Sbjct  175   AIHHVVKPTSTPPSVADTIFVERVKSRVKHWKKACADSSSRKTDEALVKSLRKLVLGGEQ  234

Query  1208  HGSRPCLNIDICS  1170
             +GSRPC+ ID+CS
Sbjct  235   YGSRPCMTIDVCS  247



>gb|KDO58560.1| hypothetical protein CISIN_1g006991mg [Citrus sinensis]
Length=622

 Score =   305 bits (782),  Expect(2) = 4e-163, Method: Compositional matrix adjust.
 Identities = 164/316 (52%), Positives = 220/316 (70%), Gaps = 11/316 (3%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             A GGGTQ VR VLTSS EDK LL++ELQ  E + NK VRGFREV+DLIS SQKP+VAHNS
Sbjct  274   AKGGGTQAVRAVLTSSDEDKDLLKRELQTFEFEQNKRVRGFREVIDLISASQKPLVAHNS  333

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             LNDFT IHSKFLAPLP  ++EF  SL   FP ++DV +L+K++G  K + NI    +YL 
Sbjct  334   LNDFTFIHSKFLAPLPPNMNEFICSLRLAFPQVIDVNYLLKDIGPVKKMTNISATIAYLK  393

Query  783   SRFFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQL  604
             +RFFAP+++E+P+QA   +    K HGHNV+KI +LF K+CSILK+ P A E+ +    L
Sbjct  394   NRFFAPIEMEIPNQANENEG---KIHGHNVVKICQLFGKLCSILKITPDAIESSDDF--L  448

Query  603   PPALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKS  424
               A+ RYANIF     S Q+P    E++R      ++VS ++VVFLWGF+  IS G +K+
Sbjct  449   ASAINRYANIFYSLPGSSQEP--TNEEIRGWTNDKRKVSCEDVVFLWGFRERISAGILKN  506

Query  423   LVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALD----SGSLEEMVSEGIRAA  256
             ++ G HEVF+  F++R+VD SCA++VF  PGLS      ++    SG L EMVS+G++AA
Sbjct  507   MLQGSHEVFAEAFNVRMVDRSCAIVVFGKPGLSNTFKNVMNSKAVSGPLREMVSDGLKAA  566

Query  255   SYDAYVKVCKLGLWKA  208
              Y+ Y +VC  GLW++
Sbjct  567   GYETYQRVCSSGLWES  582


 Score =   299 bits (765),  Expect(2) = 4e-163, Method: Compositional matrix adjust.
 Identities = 147/251 (59%), Positives = 183/251 (73%), Gaps = 11/251 (4%)
 Frame = -2

Query  1916  SMLQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSL  1737
             S L+ R FCT   +          N   W IKQ+TK+NF+E+L++I+  I+ SDFIAVSL
Sbjct  8     SPLRIRSFCTKTVQ---------QNPHHWPIKQITKTNFNESLSEIKNHISSSDFIAVSL  58

Query  1736  QTTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLF  1557
             Q TG++SSPW R+  FDT E AYLKAK AAER+QILQFA+CPF L+ SK+IA PYNFHLF
Sbjct  59    QNTGSFSSPWHRVSTFDTPETAYLKAKFAAERFQILQFAICPFKLQASKVIAYPYNFHLF  118

Query  1556  PRDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAG  1377
             PRDELK GMPSYSF+CQ+SYL ++A+EGFDFN CI DGISYLS AQE   K  + +P A 
Sbjct  119   PRDELKMGMPSYSFTCQTSYLTAMAKEGFDFNTCIYDGISYLSEAQESTVKVRMGNPMAV  178

Query  1376  SCTVPSPAS--RSVADSIFINRIKSRVKHWRNACTDQSKKTEDVLISSLRKMISATEVHG  1203
                  S +S   SVAD++FI R++SRVKHW+NACTD   KTE  L++SLRK++   E  G
Sbjct  179   DHATKSSSSPALSVADTVFIERVRSRVKHWKNACTDSDIKTEAALVTSLRKIVLGGEQFG  238

Query  1202  SRPCLNIDICS  1170
             SRP + ID+CS
Sbjct  239   SRPSMTIDVCS  249



>ref|XP_010245934.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Nelumbo nucifera]
Length=623

 Score =   301 bits (771),  Expect(2) = 2e-162, Method: Compositional matrix adjust.
 Identities = 137/222 (62%), Positives = 178/222 (80%), Gaps = 1/222 (0%)
 Frame = -2

Query  1835  KWGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAK  1656
             +W +KQVTKSNF E+L +I+  I +  FI VS Q TG +S+PW+R+LPFDT ++AYLKAK
Sbjct  24    QWSVKQVTKSNFLESLEEIQKHIHDCHFITVSSQKTGGFSAPWRRVLPFDTPDMAYLKAK  83

Query  1655  RAAERYQILQFAVCPFSLRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIARE  1476
              AAER+Q+ QFAVCPF++  SK++A PYNFHLFPRDEL  GMPSYSFSCQ+SYL+S+ARE
Sbjct  84    DAAERFQLFQFAVCPFTIESSKVVAYPYNFHLFPRDELNIGMPSYSFSCQTSYLMSMARE  143

Query  1475  GFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSVADSIFINRIKSRVKH  1296
              FDFNACI DGISYLSR QE  AKD I +P   S  V S ++ SVAD +F+ RIK+RV+H
Sbjct  144   DFDFNACIYDGISYLSRVQESTAKDRIGNP-ISSHLVKSSSTSSVADVVFVERIKARVRH  202

Query  1295  WRNACTDQSKKTEDVLISSLRKMISATEVHGSRPCLNIDICS  1170
             WRNAC + +K T+++L+ SLRK+I   E++GSRPC++ID+C+
Sbjct  203   WRNACKEPNKGTDELLVKSLRKLILGGELYGSRPCMSIDVCN  244


 Score =   301 bits (770),  Expect(2) = 2e-162, Method: Compositional matrix adjust.
 Identities = 172/356 (48%), Positives = 252/356 (71%), Gaps = 9/356 (3%)
 Frame = -1

Query  1134  GGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLND  955
             GG + VRVV TSS EDK LLEKEL+ +E + NK VRGFREV+D++S SQKP++A + LN+
Sbjct  272   GGPKAVRVVFTSSPEDKNLLEKELENIEEEWNKQVRGFREVIDVLSASQKPIIAFDCLNE  331

Query  954   FTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSRF  775
             FT +HSKF+APLPS L+EF  SL  VFP ILDV +L+KE+G      N+  A SYL  +F
Sbjct  332   FTFVHSKFIAPLPSNLNEFMCSLRLVFPCILDVNNLLKEIGPVSRAKNLPAAMSYLKRQF  391

Query  774   FAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPA  595
             F P+D+E+PHQ IS + +  K HGHNVL+I+ LFAK+ SILK+   + + +   G +   
Sbjct  392   FVPLDMEIPHQGISAEENERKKHGHNVLRITHLFAKLGSILKITHGSCKTMN--GDIDKV  449

Query  594   LERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLVY  415
             +E + NIF PC +S ++P   + D+ V     ++VS++++VFLWGF+ G++ G +K ++Y
Sbjct  450   MEDHGNIFYPCCSSLKEPI--DRDILVFTNKTRKVSTEDLVFLWGFRVGMTAGVLKKILY  507

Query  414   GKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDSG-----SLEEMVSEGIRAASY  250
               H+VFS +F+++LVD+SCAV+VF +PGL+EVLL+ + SG     +L +M+SEG++AA Y
Sbjct  508   ASHDVFSEDFEVKLVDKSCAVVVFWTPGLAEVLLKVISSGGVGSSALMDMISEGLKAAGY  567

Query  249   DAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
             +AY +VC++ LW+ +LADSL+ AL +E      A+   +   I WN++ +I LDDL
Sbjct  568   EAYKRVCRMRLWELHLADSLDKALSDEYPRDWVANARSEPLGICWNNEFIIKLDDL  623



>gb|KDO58559.1| hypothetical protein CISIN_1g006991mg [Citrus sinensis]
Length=621

 Score =   305 bits (782),  Expect(2) = 5e-162, Method: Compositional matrix adjust.
 Identities = 164/316 (52%), Positives = 220/316 (70%), Gaps = 11/316 (3%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             A GGGTQ VR VLTSS EDK LL++ELQ  E + NK VRGFREV+DLIS SQKP+VAHNS
Sbjct  273   AKGGGTQAVRAVLTSSDEDKDLLKRELQTFEFEQNKRVRGFREVIDLISASQKPLVAHNS  332

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             LNDFT IHSKFLAPLP  ++EF  SL   FP ++DV +L+K++G  K + NI    +YL 
Sbjct  333   LNDFTFIHSKFLAPLPPNMNEFICSLRLAFPQVIDVNYLLKDIGPVKKMTNISATIAYLK  392

Query  783   SRFFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQL  604
             +RFFAP+++E+P+QA   +    K HGHNV+KI +LF K+CSILK+ P A E+ +    L
Sbjct  393   NRFFAPIEMEIPNQANENEG---KIHGHNVVKICQLFGKLCSILKITPDAIESSDDF--L  447

Query  603   PPALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKS  424
               A+ RYANIF     S Q+P    E++R      ++VS ++VVFLWGF+  IS G +K+
Sbjct  448   ASAINRYANIFYSLPGSSQEP--TNEEIRGWTNDKRKVSCEDVVFLWGFRERISAGILKN  505

Query  423   LVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALD----SGSLEEMVSEGIRAA  256
             ++ G HEVF+  F++R+VD SCA++VF  PGLS      ++    SG L EMVS+G++AA
Sbjct  506   MLQGSHEVFAEAFNVRMVDRSCAIVVFGKPGLSNTFKNVMNSKAVSGPLREMVSDGLKAA  565

Query  255   SYDAYVKVCKLGLWKA  208
              Y+ Y +VC  GLW++
Sbjct  566   GYETYQRVCSSGLWES  581


 Score =   295 bits (756),  Expect(2) = 5e-162, Method: Compositional matrix adjust.
 Identities = 147/251 (59%), Positives = 183/251 (73%), Gaps = 12/251 (5%)
 Frame = -2

Query  1916  SMLQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSL  1737
             S L+ R FCT   +          N   W IKQ+TK+NF+E+L++I+  I+ SDFIAVSL
Sbjct  8     SPLRIRSFCTKTVQ---------QNPHHWPIKQITKTNFNESLSEIKNHISSSDFIAVSL  58

Query  1736  QTTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLF  1557
             Q TG++SSPW R+  FDT E AYLKAK AAER+QILQFA+CPF L+ SK+IA PYNFHLF
Sbjct  59    QNTGSFSSPWHRVSTFDTPETAYLKAKFAAERFQILQFAICPFKLQASKVIAYPYNFHLF  118

Query  1556  PRDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAG  1377
             PRDELK GMPSYSF+CQ+SYL ++A+EGFDFN CI DGISYLS AQE   K  + +P A 
Sbjct  119   PRDELKMGMPSYSFTCQTSYLTAMAKEGFDFNTCIYDGISYLSEAQESTVKVRMGNPMAV  178

Query  1376  SCTVPSPAS--RSVADSIFINRIKSRVKHWRNACTDQSKKTEDVLISSLRKMISATEVHG  1203
                  S +S   SVAD++FI R++SRVKHW+NACTD   KTE  L++SLRK++   E  G
Sbjct  179   DHATKSSSSPALSVADTVFIERVRSRVKHWKNACTDSDIKTE-ALVTSLRKIVLGGEQFG  237

Query  1202  SRPCLNIDICS  1170
             SRP + ID+CS
Sbjct  238   SRPSMTIDVCS  248



>ref|XP_006492222.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Citrus sinensis]
Length=622

 Score =   302 bits (773),  Expect(2) = 4e-161, Method: Compositional matrix adjust.
 Identities = 162/316 (51%), Positives = 219/316 (69%), Gaps = 11/316 (3%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             A GGGTQ VR VLTSS EDK LL++ELQ  E + NK VRGFREV+DLIS SQKP+VAHNS
Sbjct  274   AKGGGTQAVRAVLTSSDEDKDLLKRELQTFEFEQNKRVRGFREVIDLISASQKPLVAHNS  333

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             LNDFT IHSKFLAPLP  ++EF  SL   +P ++DV +L+K++G  K + NI    +YL 
Sbjct  334   LNDFTFIHSKFLAPLPPNMNEFICSLRLAYPQVIDVNYLLKDIGPVKKMTNISATIAYLK  393

Query  783   SRFFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQL  604
             +RFFAP+++E+P+QA   +    K HGHNV+KI +LF K+CSILK+ P A E+ +    L
Sbjct  394   NRFFAPIEMEIPNQANENEG---KIHGHNVVKICQLFGKLCSILKITPDAIESSDDF--L  448

Query  603   PPALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKS  424
               A+ RY NIF     S Q+P    E++R      ++VS ++VVFLWGF+  IS G +K+
Sbjct  449   ASAINRYTNIFYSLPGSSQEP--TNEEIRGWTNDKRKVSCEDVVFLWGFRERISAGILKN  506

Query  423   LVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALD----SGSLEEMVSEGIRAA  256
             ++ G HEVF+  F++R+VD SCA++VF  PGLS      ++    SG L EMVS+G++AA
Sbjct  507   MLQGSHEVFAEAFNVRMVDRSCAIVVFGKPGLSNTFKNVMNSKAVSGPLREMVSDGLKAA  566

Query  255   SYDAYVKVCKLGLWKA  208
              Y+ Y +VC  GLW++
Sbjct  567   GYETYQRVCSSGLWES  582


 Score =   296 bits (757),  Expect(2) = 4e-161, Method: Compositional matrix adjust.
 Identities = 146/251 (58%), Positives = 187/251 (75%), Gaps = 11/251 (4%)
 Frame = -2

Query  1916  SMLQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSL  1737
             S L+ R FCT   +         +++ +W IKQ+TK+NF+E+L++I+  I+ SDFIAVSL
Sbjct  8     SPLRIRFFCTKTVQQ--------NHHHRWPIKQITKTNFNESLSEIKNHISSSDFIAVSL  59

Query  1736  QTTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLF  1557
             Q TG++SSPW  +  FDT + AYLKAK AAER+QILQFA+CPF L+ SK+IA PYNFHLF
Sbjct  60    QNTGSFSSPWHCVSTFDTPDTAYLKAKFAAERFQILQFAICPFKLQASKVIAYPYNFHLF  119

Query  1556  PRDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAG  1377
             PRDELK GMPSYSF+CQ+SYL ++A+EGFDFN CI DGISYLS AQE AAK  + +P A 
Sbjct  120   PRDELKMGMPSYSFTCQTSYLTAMAKEGFDFNTCIYDGISYLSEAQESAAKVRMGNPMAV  179

Query  1376  SCTVPSPAS--RSVADSIFINRIKSRVKHWRNACTDQSKKTEDVLISSLRKMISATEVHG  1203
                  S +S   SVAD++FI R++SRVKHW+NACTD   KTE  L++SLRK++   E  G
Sbjct  180   DHATKSSSSPALSVADTVFIERVRSRVKHWKNACTDSDIKTE-ALVTSLRKIVLGGEQFG  238

Query  1202  SRPCLNIDICS  1170
             SRP + ID+CS
Sbjct  239   SRPSMTIDVCS  249



>ref|XP_008348961.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Malus domestica]
Length=614

 Score =   322 bits (824),  Expect(2) = 5e-161, Method: Compositional matrix adjust.
 Identities = 186/360 (52%), Positives = 255/360 (71%), Gaps = 18/360 (5%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             A GGGTQ VRVVLTSS+ED++L E+ELQ +E + NK VRGFREV+DLIS SQKPVV+HNS
Sbjct  267   AXGGGTQXVRVVLTSSKEDRELFERELQNLEEEQNKRVRGFREVIDLISASQKPVVSHNS  326

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             LNDFT IHS+FL+PLP+ +DEF  SL  VFPHILDV HLMK +G  + + NI  A SYLN
Sbjct  327   LNDFTVIHSEFLSPLPTNVDEFVGSLLSVFPHILDVSHLMKNIGPLRKMTNIPAAISYLN  386

Query  783   SRFFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQL  604
             + +FAP+D+E     IS + +    H   V+K+   FAK+C ILK+   A   + +   L
Sbjct  387   NHYFAPIDME-----ISPQENEGNIHNLCVVKMCYFFAKLCYILKISKNA--MVSNNALL  439

Query  603   PPALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKS  424
              PALE Y NI +PCS + Q+     ED+RV  K+ ++VS  ++VFLWGF++G++ G +KS
Sbjct  440   DPALEEYTNISNPCSDNPQES--TNEDIRVWTKNMRKVSCDHLVFLWGFRNGMTAGMLKS  497

Query  423   LVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDS----GSLEEMVSEGIRAA  256
             L++  H VFS EFD+RLVD+SCA++VF  P LS+  L+A+ S     SL E+VSEG+RA+
Sbjct  498   LLHKSHAVFSEEFDVRLVDKSCAIVVFWQPALSQTFLDAVSSEEICDSLREIVSEGLRAS  557

Query  255   SYDAYVKVCKLGLWKANladslelaleeeseclseAHT--AKDLSVIHWNSDEMISLDDL  82
             +Y+ Y +VC+LGLW+A+LA+S++ ALE+    +    +  +KD   I+W+SD  I+ DDL
Sbjct  558   NYETYNRVCRLGLWEADLAESMDKALEDSDCLMEANSSTYSKD---IYWSSDSTINFDDL  614


 Score =   276 bits (705),  Expect(2) = 5e-161, Method: Compositional matrix adjust.
 Identities = 128/222 (58%), Positives = 172/222 (77%), Gaps = 2/222 (1%)
 Frame = -2

Query  1835  KWGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAK  1656
             KW +K+VTKSN SE+L + +  ++ SDF+AVSLQ TG++ +PW R  PFDT + +Y KAK
Sbjct  23    KWAVKEVTKSNXSESLEEFKNHLSSSDFVAVSLQKTGSHRAPWXRPQPFDTVDTSYXKAK  82

Query  1655  RAAERYQILQFAVCPFSLRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIARE  1476
              AAER+Q+LQFA CPF+LR SKL   PYNF LFPRDELK GMP+YSFS Q+S+L S+A E
Sbjct  83    YAAERFQLLQFAACPFTLRASKLTLHPYNFVLFPRDELKMGMPTYSFSAQTSHLTSMAEE  142

Query  1475  GFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSVADSIFINRIKSRVKH  1296
             GFDFNACI +GISYLSRAQE AAK  I +P+A S    + ++ ++AD++F+ RIKSRV H
Sbjct  143   GFDFNACIYNGISYLSRAQESAAKVXIGNPAASSXVTNTSSTHTIADTVFVERIKSRVTH  202

Query  1295  WRNACTDQSKKTEDVLISSLRKMISATEVHGSRPCLNIDICS  1170
             W+ A   +S K +D L+SSLRK++  +E+ G+RPC+++D+CS
Sbjct  203   WKTAF--KSTKKDDALLSSLRKIVMRSEMXGTRPCMDLDVCS  242



>ref|XP_010678977.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=622

 Score =   303 bits (776),  Expect(2) = 4e-160, Method: Compositional matrix adjust.
 Identities = 149/250 (60%), Positives = 188/250 (75%), Gaps = 6/250 (2%)
 Frame = -2

Query  1910  LQRRLFCTAISETAFRPNSGGSNY-GKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQ  1734
             +++RL CT  S T        SN   KW IKQV KSNF++ L +I++ I+ SDFIA+SLQ
Sbjct  1     MRKRLLCTQTS-THIENTIKNSNLTKKWRIKQVKKSNFNQNLEEIKSHISNSDFIAISLQ  59

Query  1733  TTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFP  1554
              TG+YSSPWQ++LPFDT EIAYLK+KR+AE++Q+LQ AVCPF+LR SKL A PYNFHLFP
Sbjct  60    KTGSYSSPWQKVLPFDTPEIAYLKSKRSAEKFQLLQLAVCPFTLRASKLTAYPYNFHLFP  119

Query  1553  RDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAG-  1377
             RDELK GMPSYSF+CQ+SYL S+AR GFDFN+CI DGISY+SRAQE + K    + +   
Sbjct  120   RDELKIGMPSYSFACQTSYLTSMARLGFDFNSCIYDGISYISRAQESSMKHLTGTGNLAV  179

Query  1376  -SCTVPSPASRSVADSIFINRIKSRVKHWRNACTDQSKKTEDVLISSLRKMISATEVHGS  1200
              + +V S ++ SVADS+FI RIKSRVK WR AC D     ED L+ +LRK++     HGS
Sbjct  180   RARSVKSSSTISVADSVFIERIKSRVKTWRTACKDSKGSNEDALVRALRKVVLGE--HGS  237

Query  1199  RPCLNIDICS  1170
             RPCL++D+CS
Sbjct  238   RPCLDVDVCS  247


 Score =   291 bits (745),  Expect(2) = 4e-160, Method: Compositional matrix adjust.
 Identities = 169/356 (47%), Positives = 242/356 (68%), Gaps = 13/356 (4%)
 Frame = -1

Query  1134  GGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLND  955
             GGTQ VR V+TSS+EDK L EKELQ++E + +K VRGFREV+DLIS SQKPVVAHN+L+D
Sbjct  275   GGTQGVRAVMTSSKEDKILFEKELQDLEEEQSKNVRGFREVIDLISASQKPVVAHNTLDD  334

Query  954   FTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSRF  775
             FT +HSKFL+PLP ++DEF+ SL   FP+++D+ HLMK       +NNI  A+S+L SRF
Sbjct  335   FTFLHSKFLSPLPPSIDEFKCSLSSYFPYVIDMGHLMKHFNPSGKMNNIPAASSFLRSRF  394

Query  774   FAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPA  595
             FAPV++++P +    +    K HG NVL+IS++FAK+ SI+K        I     L  A
Sbjct  395   FAPVEIDIPLKGTPEEMSEGKIHGQNVLQISQIFAKLYSIMK---PGQHHINEGKNL--A  449

Query  594   LERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLVY  415
             L+ YANIFDPCS+   +   +++DVR+ + + +R+S  ++VFLWGF+SG+S G++KSL+ 
Sbjct  450   LDNYANIFDPCSSVSLEN--SDDDVRISSGNTRRLSCNDMVFLWGFKSGLSVGELKSLLS  507

Query  414   GKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDSG-----SLEEMVSEGIRAASY  250
               HE FSSEFD+R+VD+SC V+ F  P L+   ++A+ SG      L E+ S G+RAA+Y
Sbjct  508   KSHEAFSSEFDVRVVDKSCVVVAFQQPELAGDFVKAMGSGGTCHEGLTELTSLGLRAANY  567

Query  249   DAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
             + Y   C L  W ++LADSL+  +    +   ++H  K    I W+ D +++LDD 
Sbjct  568   ETYKCACNLSRWDSDLADSLDQVVTSADQFPVDSH-GKSPYEIWWDDDTVLNLDDF  622



>ref|XP_010678978.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=605

 Score =   303 bits (776),  Expect(2) = 5e-160, Method: Compositional matrix adjust.
 Identities = 149/250 (60%), Positives = 188/250 (75%), Gaps = 6/250 (2%)
 Frame = -2

Query  1910  LQRRLFCTAISETAFRPNSGGSNY-GKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQ  1734
             +++RL CT  S T        SN   KW IKQV KSNF++ L +I++ I+ SDFIA+SLQ
Sbjct  1     MRKRLLCTQTS-THIENTIKNSNLTKKWRIKQVKKSNFNQNLEEIKSHISNSDFIAISLQ  59

Query  1733  TTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFP  1554
              TG+YSSPWQ++LPFDT EIAYLK+KR+AE++Q+LQ AVCPF+LR SKL A PYNFHLFP
Sbjct  60    KTGSYSSPWQKVLPFDTPEIAYLKSKRSAEKFQLLQLAVCPFTLRASKLTAYPYNFHLFP  119

Query  1553  RDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAG-  1377
             RDELK GMPSYSF+CQ+SYL S+AR GFDFN+CI DGISY+SRAQE + K    + +   
Sbjct  120   RDELKIGMPSYSFACQTSYLTSMARLGFDFNSCIYDGISYISRAQESSMKHLTGTGNLAV  179

Query  1376  -SCTVPSPASRSVADSIFINRIKSRVKHWRNACTDQSKKTEDVLISSLRKMISATEVHGS  1200
              + +V S ++ SVADS+FI RIKSRVK WR AC D     ED L+ +LRK++     HGS
Sbjct  180   RARSVKSSSTISVADSVFIERIKSRVKTWRTACKDSKGSNEDALVRALRKVVLGE--HGS  237

Query  1199  RPCLNIDICS  1170
             RPCL++D+CS
Sbjct  238   RPCLDVDVCS  247


 Score =   291 bits (745),  Expect(2) = 5e-160, Method: Compositional matrix adjust.
 Identities = 169/356 (47%), Positives = 242/356 (68%), Gaps = 13/356 (4%)
 Frame = -1

Query  1134  GGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLND  955
             GGTQ VR V+TSS+EDK L EKELQ++E + +K VRGFREV+DLIS SQKPVVAHN+L+D
Sbjct  258   GGTQGVRAVMTSSKEDKILFEKELQDLEEEQSKNVRGFREVIDLISASQKPVVAHNTLDD  317

Query  954   FTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSRF  775
             FT +HSKFL+PLP ++DEF+ SL   FP+++D+ HLMK       +NNI  A+S+L SRF
Sbjct  318   FTFLHSKFLSPLPPSIDEFKCSLSSYFPYVIDMGHLMKHFNPSGKMNNIPAASSFLRSRF  377

Query  774   FAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPA  595
             FAPV++++P +    +    K HG NVL+IS++FAK+ SI+K        I     L  A
Sbjct  378   FAPVEIDIPLKGTPEEMSEGKIHGQNVLQISQIFAKLYSIMK---PGQHHINEGKNL--A  432

Query  594   LERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLVY  415
             L+ YANIFDPCS+   +   +++DVR+ + + +R+S  ++VFLWGF+SG+S G++KSL+ 
Sbjct  433   LDNYANIFDPCSSVSLEN--SDDDVRISSGNTRRLSCNDMVFLWGFKSGLSVGELKSLLS  490

Query  414   GKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDSG-----SLEEMVSEGIRAASY  250
               HE FSSEFD+R+VD+SC V+ F  P L+   ++A+ SG      L E+ S G+RAA+Y
Sbjct  491   KSHEAFSSEFDVRVVDKSCVVVAFQQPELAGDFVKAMGSGGTCHEGLTELTSLGLRAANY  550

Query  249   DAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
             + Y   C L  W ++LADSL+  +    +   ++H  K    I W+ D +++LDD 
Sbjct  551   ETYKCACNLSRWDSDLADSLDQVVTSADQFPVDSH-GKSPYEIWWDDDTVLNLDDF  605



>ref|XP_011009330.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Populus euphratica]
Length=626

 Score =   303 bits (775),  Expect(2) = 3e-159, Method: Compositional matrix adjust.
 Identities = 144/253 (57%), Positives = 187/253 (74%), Gaps = 11/253 (4%)
 Frame = -2

Query  1913  MLQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQ  1734
             +L+RRL  T+++ T  +P        +W IKQVTKSNF++ L DI++ ++ SDF+AVSLQ
Sbjct  7     LLRRRLLSTSVTRTHHKPQQ------QWSIKQVTKSNFADTLEDIKSHVSNSDFVAVSLQ  60

Query  1733  TTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFP  1554
              TG +S+PWQR+ PFDTA+ AYLKAK AAER+Q+L FAVCPF++R SK+ A PYNFHLFP
Sbjct  61    NTGFFSAPWQRVSPFDTADTAYLKAKYAAERFQVLHFAVCPFTVRASKVTAYPYNFHLFP  120

Query  1553  RDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAGS  1374
             R ELK  MPSYSF CQ+S LIS+AR+GFDFN+CINDGISYLSR QE AAK  + +P    
Sbjct  121   RPELKMEMPSYSFYCQTSSLISMARQGFDFNSCINDGISYLSREQESAAKIQMGNPILAK  180

Query  1373  CTVPSPASRSVADSIFINRIKSRVKHWRNACTDQSKKTE-----DVLISSLRKMISATEV  1209
                 S ++ SVADS+FI RIKS +K+W+ AC + S + E     D L+ SLRK++   E 
Sbjct  181   NVTESTSTLSVADSVFIERIKSHIKNWKKACKETSTRKEGNQIQDALVRSLRKLVLGNEE  240

Query  1208  HGSRPCLNIDICS  1170
             + SRPC+NID+CS
Sbjct  241   YDSRPCMNIDVCS  253


 Score =   289 bits (739),  Expect(2) = 3e-159, Method: Compositional matrix adjust.
 Identities = 159/318 (50%), Positives = 217/318 (68%), Gaps = 12/318 (4%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             A GG  Q VRVVLTSS+EDK LL+ +LQ  E +  K VRGFREV+DLIS SQKPVV+H S
Sbjct  278   AKGGAMQAVRVVLTSSKEDKDLLQGKLQNDEQELKKKVRGFREVIDLISASQKPVVSHGS  337

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             LND T IHSKF+APLP T+DEF  SL   FP ++DV HLMKE+   + + +I  A S L 
Sbjct  338   LNDLTLIHSKFIAPLPPTVDEFMCSLRLAFPLVIDVNHLMKEINPLRKVTSIPSAISQLK  397

Query  783   SRFFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQL  604
             +RFF P+D+E+P QA+  + D++   G NV+KI ELFA++CSILK+DP   ++ +   + 
Sbjct  398   NRFFTPIDMEIPCQAMENE-DTI--LGQNVVKICELFARLCSILKIDPADVKSDKE--KR  452

Query  603   PPALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKS  424
               ALE YANIF P  T+ ++P   E  +++   + + VS +++VFLWGF   ++ G +KS
Sbjct  453   ASALEAYANIFRPFCTASEEPIDGE--IKIWTNNTRTVSCEDLVFLWGFGDRVTAGVLKS  510

Query  423   LVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDS-----GSLEEMVSEGIRA  259
             L+   HE FS EFD+RLVD SCA+++F   GLSE  L  ++      G L EMVSEG+RA
Sbjct  511   LLQESHEAFSKEFDVRLVDTSCAIVIFWQHGLSETFLNTMNKCSDMCGPLREMVSEGLRA  570

Query  258   ASYDAYVKVCKLGLWKAN  205
             A Y+ Y + C+LG W+++
Sbjct  571   AGYETYNRACRLGFWESS  588



>gb|KHG18699.1| Poly(A)-specific ribonuclease PARN-like [Gossypium arboreum]
Length=1127

 Score =   295 bits (756),  Expect(2) = 3e-158, Method: Compositional matrix adjust.
 Identities = 173/356 (49%), Positives = 246/356 (69%), Gaps = 15/356 (4%)
 Frame = -1

Query  1137  GGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLN  958
             GGGTQ VRVVLTSS+EDK LLE+ELQ  E + NK +RGFREV++L+S SQKPVV+HN+LN
Sbjct  274   GGGTQAVRVVLTSSKEDKSLLERELQNAEEEQNKKMRGFREVIELVSASQKPVVSHNTLN  333

Query  957   DFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSR  778
             DF+ IHSKF+APLP  ++EF +SL   FP I DV H+MK +G  +N+ +I  A S+L +R
Sbjct  334   DFSVIHSKFIAPLPLDVNEFLNSLQSNFPLIFDVNHMMKGIGPLENVTSIPAAVSHLKNR  393

Query  777   FFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPP  598
             FFAP+++EL H A+    D  K HG  V++I  LFAK+CS+LK+ P + ++ +  G++  
Sbjct  394   FFAPIEMELSHGAL---LDESKIHGQTVVRICYLFAKLCSVLKITPGSIQSSD--GKV--  446

Query  597   ALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLV  418
              L+ YAN+F  CS + ++    +  +R+   S ++V  K++VFLWGF++  S G +KSL+
Sbjct  447   -LDGYANVFRSCSGNSEESL--DGGIRIWTNSPRKVDCKDLVFLWGFRNRPSAGMLKSLL  503

Query  417   YGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALD----SGSLEEMVSEGIRAASY  250
              G H+VFS EFD+ LVD+SCA++VF  P LS+  L+ ++    SGSL+E+VSEG+RAA Y
Sbjct  504   QGSHDVFSEEFDVCLVDKSCAIVVFFHPNLSQAFLDVMNSEEISGSLKELVSEGLRAADY  563

Query  249   DAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
             D Y + C LGLW+ +LA SL+ A              K  + I+W +D +I+LDDL
Sbjct  564   DTYKRACSLGLWETDLASSLDKASATPDHLSQRDPETKP-AEIYWCNDLIINLDDL  618


 Score =   293 bits (749),  Expect(2) = 3e-158, Method: Compositional matrix adjust.
 Identities = 138/253 (55%), Positives = 190/253 (75%), Gaps = 8/253 (3%)
 Frame = -2

Query  1922  LCSMLQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAV  1743
             + ++++RR F T IS     PNS      +W +KQVTKSNFS++L + ++ ++ SDF+AV
Sbjct  1     MVALIRRRFFGTKIS-----PNSHRHKL-QWSVKQVTKSNFSDSLQEFKSHLSASDFVAV  54

Query  1742  SLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFH  1563
             SLQ TG++S+PW R+  FD+ E AYLK +RAAER+Q+LQFA+CPF++  SK+ A PYNFH
Sbjct  55    SLQNTGSFSAPWNRVSSFDSPETAYLKVRRAAERFQLLQFAICPFTISGSKVTAHPYNFH  114

Query  1562  LFPRDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPS  1383
             LFPRDEL  GMPSYSFSCQ+SYL ++AR+GFDFNACI DGISYLSRAQELAA   + +P 
Sbjct  115   LFPRDELNIGMPSYSFSCQTSYLTAMARQGFDFNACIYDGISYLSRAQELAAIVRMANPI  174

Query  1382  AGSCTVPSPAS-RSVADSIFINRIKSRVKHWRNACTDQ-SKKTEDVLISSLRKMISATEV  1209
               +  V + +S  +VAD++F+ R+K R+KHW+ +C D  SKK +D L+ SL+K++   E 
Sbjct  175   NLNYVVEASSSPPTVADTVFVERVKCRIKHWKKSCIDSTSKKIDDALVKSLQKLVLGGEQ  234

Query  1208  HGSRPCLNIDICS  1170
             +GSRPC+ I +CS
Sbjct  235   YGSRPCMTIAVCS  247



>gb|KHG18700.1| Poly(A)-specific ribonuclease PARN-like [Gossypium arboreum]
Length=618

 Score =   295 bits (756),  Expect(2) = 7e-158, Method: Compositional matrix adjust.
 Identities = 173/356 (49%), Positives = 246/356 (69%), Gaps = 15/356 (4%)
 Frame = -1

Query  1137  GGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLN  958
             GGGTQ VRVVLTSS+EDK LLE+ELQ  E + NK +RGFREV++L+S SQKPVV+HN+LN
Sbjct  274   GGGTQAVRVVLTSSKEDKSLLERELQNAEEEQNKKMRGFREVIELVSASQKPVVSHNTLN  333

Query  957   DFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSR  778
             DF+ IHSKF+APLP  ++EF +SL   FP I DV H+MK +G  +N+ +I  A S+L +R
Sbjct  334   DFSVIHSKFIAPLPLDVNEFLNSLQSNFPLIFDVNHMMKGIGPLENVTSIPAAVSHLKNR  393

Query  777   FFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPP  598
             FFAP+++EL H A+    D  K HG  V++I  LFAK+CS+LK+ P + ++ +  G++  
Sbjct  394   FFAPIEMELSHGAL---LDESKIHGQTVVRICYLFAKLCSVLKITPGSIQSSD--GKV--  446

Query  597   ALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLV  418
              L+ YAN+F  CS + ++    +  +R+   S ++V  K++VFLWGF++  S G +KSL+
Sbjct  447   -LDGYANVFRSCSGNSEESL--DGGIRIWTNSPRKVDCKDLVFLWGFRNRPSAGMLKSLL  503

Query  417   YGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALD----SGSLEEMVSEGIRAASY  250
              G H+VFS EFD+ LVD+SCA++VF  P LS+  L+ ++    SGSL+E+VSEG+RAA Y
Sbjct  504   QGSHDVFSEEFDVCLVDKSCAIVVFFHPNLSQAFLDVMNSEEISGSLKELVSEGLRAADY  563

Query  249   DAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
             D Y + C LGLW+ +LA SL+ A              K  + I+W +D +I+LDDL
Sbjct  564   DTYKRACSLGLWETDLASSLDKASATPDHLSQRDPETKP-AEIYWCNDLIINLDDL  618


 Score =   292 bits (747),  Expect(2) = 7e-158, Method: Compositional matrix adjust.
 Identities = 138/253 (55%), Positives = 190/253 (75%), Gaps = 8/253 (3%)
 Frame = -2

Query  1922  LCSMLQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAV  1743
             + ++++RR F T IS     PNS      +W +KQVTKSNFS++L + ++ ++ SDF+AV
Sbjct  1     MVALIRRRFFGTKIS-----PNSHRHKL-QWSVKQVTKSNFSDSLQEFKSHLSASDFVAV  54

Query  1742  SLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFH  1563
             SLQ TG++S+PW R+  FD+ E AYLK +RAAER+Q+LQFA+CPF++  SK+ A PYNFH
Sbjct  55    SLQNTGSFSAPWNRVSSFDSPETAYLKVRRAAERFQLLQFAICPFTISGSKVTAHPYNFH  114

Query  1562  LFPRDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPS  1383
             LFPRDEL  GMPSYSFSCQ+SYL ++AR+GFDFNACI DGISYLSRAQELAA   + +P 
Sbjct  115   LFPRDELNIGMPSYSFSCQTSYLTAMARQGFDFNACIYDGISYLSRAQELAAIVRMANPI  174

Query  1382  AGSCTVPSPAS-RSVADSIFINRIKSRVKHWRNACTDQ-SKKTEDVLISSLRKMISATEV  1209
               +  V + +S  +VAD++F+ R+K R+KHW+ +C D  SKK +D L+ SL+K++   E 
Sbjct  175   NLNYVVEASSSPPTVADTVFVERVKCRIKHWKKSCIDSTSKKIDDALVKSLQKLVLGGEQ  234

Query  1208  HGSRPCLNIDICS  1170
             +GSRPC+ I +CS
Sbjct  235   YGSRPCMTIAVCS  247



>ref|XP_008382764.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Malus domestica]
Length=628

 Score =   306 bits (785),  Expect(2) = 2e-157, Method: Compositional matrix adjust.
 Identities = 183/360 (51%), Positives = 249/360 (69%), Gaps = 27/360 (8%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             A GGGTQ VRVVLTSS+ED++L E+ELQ +E + NK VRGFREV+DLIS SQKPVV+HNS
Sbjct  290   AXGGGTQXVRVVLTSSKEDRELFERELQNLEEEQNKRVRGFREVIDLISASQKPVVSHNS  349

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             LNDFT IHS+FL+PLP+ +DEF  SL  VFPHILDV HLMK         NI  A SYLN
Sbjct  350   LNDFTVIHSEFLSPLPTNVDEFVGSLXSVFPHILDVSHLMK---------NIPAAISYLN  400

Query  783   SRFFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQL  604
             + +F P+D+E     IS + +    H   V+K+   FAK+C ILK+   A   + +   L
Sbjct  401   NHYFXPIDME-----ISPQENEGNIHNLCVVKMCYFFAKLCXILKISXNA--MVSNNALL  453

Query  603   PPALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKS  424
              PALE Y NI +PCS + Q+      D+RV  K+ ++VS  ++VFLWGF++G++ G +KS
Sbjct  454   DPALEEYTNISNPCSDNPQES--TNXDIRVWTKNMRKVSCDHLVFLWGFRNGMTAGMLKS  511

Query  423   LVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDS----GSLEEMVSEGIRAA  256
             L++  H VFS EFD+RLVD+SCA++VF  P LS+  L+A+ S     SL E+VSEG+RA+
Sbjct  512   LLHKSHAVFSEEFDVRLVDKSCAIVVFWQPALSQTFLDAVSSEEICDSLREIVSEGLRAS  571

Query  255   SYDAYVKVCKLGLWKANladslelaleeeseclseAHT--AKDLSVIHWNSDEMISLDDL  82
             +Y+ Y +VC+LGLW+A+LA+S++ ALE+    +    +  +KD   I+W+SD  I+ DDL
Sbjct  572   NYETYNRVCRLGLWEADLAESMDKALEDSDCLMEANSSTYSKD---IYWSSDSTINFDDL  628


 Score =   278 bits (712),  Expect(2) = 2e-157, Method: Compositional matrix adjust.
 Identities = 129/222 (58%), Positives = 173/222 (78%), Gaps = 2/222 (1%)
 Frame = -2

Query  1835  KWGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAK  1656
             KW +K+VTKSNFSE+L + +  ++ SDF+AVSLQ TG++ +PW R  PFDT + +Y KAK
Sbjct  46    KWAVKEVTKSNFSESLEEFKNHLSSSDFVAVSLQKTGSHRAPWXRPQPFDTVDTSYXKAK  105

Query  1655  RAAERYQILQFAVCPFSLRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIARE  1476
              AAER+Q+LQFA CPF+LR SKL   PYNF LFPRDELK GMP+YSFS Q+S+L S+A E
Sbjct  106   YAAERFQLLQFAACPFTLRASKLTLHPYNFVLFPRDELKMGMPTYSFSAQTSHLTSMAEE  165

Query  1475  GFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSVADSIFINRIKSRVKH  1296
             GFDFNACI +GISYLSRAQE AAK  I +P+A S    + ++ ++AD++F+ RIKSRV H
Sbjct  166   GFDFNACIYNGISYLSRAQESAAKVXIGNPAASSXVTNTSSTHTIADTVFVERIKSRVTH  225

Query  1295  WRNACTDQSKKTEDVLISSLRKMISATEVHGSRPCLNIDICS  1170
             W+ A   +S K +D L+SSLRK++  +E+ G+RPC+++D+CS
Sbjct  226   WKTAF--KSTKKDDALLSSLRKIVMRSEMXGTRPCMDLDVCS  265



>gb|EYU40665.1| hypothetical protein MIMGU_mgv1a018070mg [Erythranthe guttata]
Length=623

 Score =   295 bits (755),  Expect(2) = 1e-155, Method: Compositional matrix adjust.
 Identities = 150/250 (60%), Positives = 185/250 (74%), Gaps = 7/250 (3%)
 Frame = -2

Query  1913  MLQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQ  1734
             M  +R  C+  +    R + G     +W +KQVT SNFSEAL +I+  I  SDF+AVSLQ
Sbjct  1     MFFKRFLCSHTAAARRRHHHGK----QWSVKQVTNSNFSEALPEIKACIFNSDFVAVSLQ  56

Query  1733  TTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFP  1554
              TG +S+ WQR+LP DTAE AY+K K AA R+QILQF+VCPFS++ SK+IA P+NFH+FP
Sbjct  57    KTGGHSATWQRILPIDTAETAYMKVKDAATRFQILQFSVCPFSVKGSKVIAHPFNFHVFP  116

Query  1553  RDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAGS  1374
             RDELK GMPSYSFSCQSSYL S+AREGFDFNACI +GISYLS+AQE AAK    + S  +
Sbjct  117   RDELKVGMPSYSFSCQSSYLTSMAREGFDFNACIYNGISYLSKAQESAAKIQTGNLSPVN  176

Query  1373  CTVPSPASRSVADSIFINRIKSRVKHWRNACTDQSKKTE--DVLISSLRKMISATEVHGS  1200
               V   +  SVAD+IF+ RI+SRVK+W  AC D S KTE  D LISSLRK+++ +EV GS
Sbjct  177   GAVEPSSVYSVADTIFMERIESRVKNWIRACKD-SNKTEVADALISSLRKLVAGSEVFGS  235

Query  1199  RPCLNIDICS  1170
             RP L ID+CS
Sbjct  236   RPSLTIDVCS  245


 Score =   285 bits (729),  Expect(2) = 1e-155, Method: Compositional matrix adjust.
 Identities = 168/367 (46%), Positives = 240/367 (65%), Gaps = 25/367 (7%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             A G G Q VR VLTSS+EDK LLEKE+Q+ E++  K VRGFREV+DLIS SQ+PVV HNS
Sbjct  269   AKGVGVQAVRAVLTSSKEDKTLLEKEIQDTEHEQRKLVRGFREVIDLISTSQRPVVVHNS  328

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             L D   IHSKF APLPST+DEF++SL  +FPH LDV HLMKE+G    +NN+  A SYL 
Sbjct  329   LYDLALIHSKFQAPLPSTMDEFKNSLLSLFPHTLDVNHLMKEIGPFDKMNNVQAALSYLE  388

Query  783   SRFFAPVDVELPHQ-------------AISTKADSVKSHGHNVLKISELFAKVCSILKVD  643
              RF AP+D+++ +Q             A + + ++  +HGHNVL++ +LF K+CSILK+ 
Sbjct  389   RRFSAPIDMDISNQGKKPTYLKHEALVASTEEPENTNTHGHNVLRVCQLFVKLCSILKIP  448

Query  642   PKAPEAIEHCGQLPPALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLW  463
              + PE  E   QL P+L+R +N F     S +    +++ V +R+ + ++VS+ N+VFLW
Sbjct  449   LEFPEG-ERITQLAPSLQRTSNTF-----SSKVHTADDDGVGIRSGNSEKVSTDNLVFLW  502

Query  462   GFQSGISTGQVKSLVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDSGSLEE  283
             G ++  S+  +K+L+   + V S EFD+R++D +CAV+VF + G+ +  L     G +E 
Sbjct  503   GLKNRKSSRNLKNLICDSYNVLSEEFDVRMLDRTCAVVVFWNAGVLDRFL-----GMVEG  557

Query  282   MVSEGIRAASYDAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDE  103
                EG+R A Y+ Y +VC+ GLWKA+LA+  +  L+E           ++ SVI+WN DE
Sbjct  558   SGGEGLRCARYNTYRRVCESGLWKADLAECFDETLDESETLSRTEAKLEE-SVIYWNDDE  616

Query  102   MISLDDL  82
             MI+LDDL
Sbjct  617   MINLDDL  623



>ref|XP_004492234.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X1 
[Cicer arietinum]
Length=623

 Score =   301 bits (770),  Expect(2) = 3e-151, Method: Compositional matrix adjust.
 Identities = 165/358 (46%), Positives = 245/358 (68%), Gaps = 11/358 (3%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             + GG TQ VR+VL +S+EDK+ +E+E+  +E K +K +RGFREV+DLIS SQKPV++HN 
Sbjct  273   SKGGTTQAVRIVLANSKEDKEFMEREVHSLEEKESKKIRGFREVIDLISASQKPVISHNC  332

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             LND T IHSKF+ PLPS +DEF  S+  +FP +LD+ +LMK+ G+ + + NI  A ++LN
Sbjct  333   LNDCTFIHSKFIVPLPSEVDEFESSMHMIFPKVLDMIYLMKKSGTMRKVTNIRNALTFLN  392

Query  783   SRFFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQL  604
             + FFAPVD+E+P Q    K    K  G + L++S LF K+CSILK+ P    +     +L
Sbjct  393   THFFAPVDMEIPDQDTVNKG---KIDGLDALRLSYLFMKLCSILKISPIVTRSGNR--RL  447

Query  603   PPALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKS  424
              P LE + N+F PCST+ Q+     EDV +   + ++++S+++VFLWGF+ G++ G +KS
Sbjct  448   APELEDFTNVFHPCSTNIQESC--SEDVGLWNNNTRKINSEHLVFLWGFKFGMTAGMLKS  505

Query  423   LVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDS----GSLEEMVSEGIRAA  256
             ++   H++FS EFD+R VD+SCA++VF  PGLS+  L+ ++S    G L+E+VS+G+R  
Sbjct  506   VLRASHDIFSGEFDVRFVDKSCAIVVFWQPGLSKDFLDVMNSEEIGGGLKELVSDGLRVT  565

Query  255   SYDAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
              Y+ Y  +C+LGLW+ +LA+SLE ALE         +  K  S IHW +D +I+LDDL
Sbjct  566   CYETYRTMCRLGLWEMDLAESLERALESFVSDTEINNERKSSSEIHWCNDNVINLDDL  623


 Score =   264 bits (675),  Expect(2) = 3e-151, Method: Compositional matrix adjust.
 Identities = 137/251 (55%), Positives = 178/251 (71%), Gaps = 19/251 (8%)
 Frame = -2

Query  1907  QRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQTT  1728
             QRR  CT +      P S      KW +KQVT SNF+E+L +I+  I+ SDFIA+S++ T
Sbjct  12    QRRSLCTKV------PTS------KWKVKQVTTSNFNESLEEIKIHISSSDFIAISMEKT  59

Query  1727  GA-YSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESK-LIASPYNFHLFP  1554
             G+   +PW R+ PFDTAE AYLKA  +A+R+Q+LQFAVCPFS+ +S  L+A PYNF LFP
Sbjct  60    GSSLVTPWHRVQPFDTAETAYLKASHSAQRFQLLQFAVCPFSVTDSNNLVAHPYNFLLFP  119

Query  1553  RDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCI--RSPSA  1380
             RDELK GMP+YSF CQ+S+L S+A +GFDFNA I +GISYLSRAQE AAK  +   SPS 
Sbjct  120   RDELKLGMPAYSFFCQTSHLTSMACQGFDFNASIYEGISYLSRAQESAAKVRLGTNSPSL  179

Query  1379  GSCTVPSPASRSVADSIFINRIKSRVKHWRNACTDQSKKT-EDVLISSLRKMISATEVHG  1203
             G     SP   ++ADS+F+ RI+ R+KHWRN+C     KT +D +I SLR ++  +E+  
Sbjct  180   GVMKSSSPP--TIADSVFVERIRLRIKHWRNSCKKSGTKTSKDEIIISLRNIVLGSELFK  237

Query  1202  SRPCLNIDICS  1170
             SRPCL ID+CS
Sbjct  238   SRPCLTIDVCS  248



>ref|XP_004492235.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X2 
[Cicer arietinum]
Length=622

 Score =   301 bits (770),  Expect(2) = 9e-151, Method: Compositional matrix adjust.
 Identities = 165/358 (46%), Positives = 245/358 (68%), Gaps = 13/358 (4%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             + GG TQ VR+VL +S+EDK+ +E+E+  +E K +K +RGFREV+DLIS SQKPV++HN 
Sbjct  274   SKGGTTQAVRIVLANSKEDKEFMEREVHSLEEKESKKIRGFREVIDLISASQKPVISHNC  333

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             LND T IHSKF+ PLPS +DEF  S+  +FP +LD+ +LMK+ G+ + + NI  A ++LN
Sbjct  334   LNDCTFIHSKFIVPLPSEVDEFESSMHMIFPKVLDMIYLMKKSGTMRKVTNIRNALTFLN  393

Query  783   SRFFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQL  604
             + FFAPVD+E+P Q    K D     G + L++S LF K+CSILK+ P    +     +L
Sbjct  394   THFFAPVDMEIPDQVNKGKID-----GLDALRLSYLFMKLCSILKISPIVTRSGNR--RL  446

Query  603   PPALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKS  424
              P LE + N+F PCST+ Q+     EDV +   + ++++S+++VFLWGF+ G++ G +KS
Sbjct  447   APELEDFTNVFHPCSTNIQESC--SEDVGLWNNNTRKINSEHLVFLWGFKFGMTAGMLKS  504

Query  423   LVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDS----GSLEEMVSEGIRAA  256
             ++   H++FS EFD+R VD+SCA++VF  PGLS+  L+ ++S    G L+E+VS+G+R  
Sbjct  505   VLRASHDIFSGEFDVRFVDKSCAIVVFWQPGLSKDFLDVMNSEEIGGGLKELVSDGLRVT  564

Query  255   SYDAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
              Y+ Y  +C+LGLW+ +LA+SLE ALE         +  K  S IHW +D +I+LDDL
Sbjct  565   CYETYRTMCRLGLWEMDLAESLERALESFVSDTEINNERKSSSEIHWCNDNVINLDDL  622


 Score =   262 bits (670),  Expect(2) = 9e-151, Method: Compositional matrix adjust.
 Identities = 136/252 (54%), Positives = 178/252 (71%), Gaps = 20/252 (8%)
 Frame = -2

Query  1907  QRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQTT  1728
             QRR  CT +      P S      KW +KQVT SNF+E+L +I+  I+ SDFIA+S++ T
Sbjct  12    QRRSLCTKV------PTS------KWKVKQVTTSNFNESLEEIKIHISSSDFIAISMEKT  59

Query  1727  GA-YSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESK-LIASPYNFHLFP  1554
             G+   +PW R+ PFDTAE AYLKA  +A+R+Q+LQFAVCPFS+ +S  L+A PYNF LFP
Sbjct  60    GSSLVTPWHRVQPFDTAETAYLKASHSAQRFQLLQFAVCPFSVTDSNNLVAHPYNFLLFP  119

Query  1553  RDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCI--RSPSA  1380
             RDELK GMP+YSF CQ+S+L S+A +GFDFNA I +GISYLSRAQE AAK  +   SPS 
Sbjct  120   RDELKLGMPAYSFFCQTSHLTSMACQGFDFNASIYEGISYLSRAQESAAKVRLGTNSPSL  179

Query  1379  GSCTVPSPASRSVADSIFINRIKSRVKHWRNACTDQSKKT--EDVLISSLRKMISATEVH  1206
             G     SP   ++ADS+F+ RI+ R+KHWRN+C     KT  ++ +I SLR ++  +E+ 
Sbjct  180   GVMKSSSPP--TIADSVFVERIRLRIKHWRNSCKKSGTKTSKDEEIIISLRNIVLGSELF  237

Query  1205  GSRPCLNIDICS  1170
              SRPCL ID+CS
Sbjct  238   KSRPCLTIDVCS  249



>ref|XP_009358963.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X2 
[Pyrus x bretschneideri]
Length=588

 Score =   326 bits (835),  Expect(2) = 1e-150, Method: Compositional matrix adjust.
 Identities = 185/359 (52%), Positives = 246/359 (69%), Gaps = 16/359 (4%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             + GGGTQ VRVVLTSS  DK L E+ELQ +E + NK VRGFREV+DLIS SQKPVV+HNS
Sbjct  241   SRGGGTQAVRVVLTSSTADKDLFERELQNLEEEQNKRVRGFREVIDLISASQKPVVSHNS  300

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             LNDFT IHS+FL+PLP+ +DEF  SL  VF HILDV HLMK +G  + + NI  A SYLN
Sbjct  301   LNDFTVIHSEFLSPLPTNVDEFMGSLHSVFTHILDVSHLMKNIGPLRKMTNISAAISYLN  360

Query  783   SRFFAPVDVE-LPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQ  607
             + +FAP+D+E LP ++          H HNV+K+  LFAK+CSILK+   A   + +   
Sbjct  361   NHYFAPIDMEILPQES------EGNIHRHNVVKMCYLFAKLCSILKISDNA--MVSNNAL  412

Query  606   LPPALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVK  427
             L PA+E Y NI +PCS S Q+     ED+RV  K+ ++VS   +VFLWGF+SG++ G +K
Sbjct  413   LAPAIEEYTNISNPCSDSPQES--TNEDIRVWTKNMRKVSCDQLVFLWGFRSGMTAGMIK  470

Query  426   SLVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDS----GSLEEMVSEGIRA  259
             SL+   H VFS EFD+RLVD+SCA++VF   GLSE  L+A+       SL E+ SEGIRA
Sbjct  471   SLLCKSHAVFSEEFDVRLVDKSCAIVVFWRRGLSETFLDAMSREEICDSLVEIASEGIRA  530

Query  258   ASYDAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
             +SY+ Y +VC+LGLW+A+          E+ + L+E ++A +   I+W+S+  I+ DDL
Sbjct  531   SSYETYKRVCRLGLWEAD-LAESLDKALEDLDYLAEVNSATNSKEIYWSSNSAINFDDL  588


 Score =   237 bits (605),  Expect(2) = 1e-150, Method: Compositional matrix adjust.
 Identities = 117/222 (53%), Positives = 158/222 (71%), Gaps = 29/222 (13%)
 Frame = -2

Query  1835  KWGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAK  1656
             KW +K+VTKSNFSE+L + +  ++ SDF+AVSLQ TG+Y +PWQR  PFDTAE +Y KAK
Sbjct  24    KWAVKEVTKSNFSESLVEFKDHLSSSDFVAVSLQKTGSYRAPWQRPQPFDTAETSYCKAK  83

Query  1655  RAAERYQILQFAVCPFSLRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIARE  1476
                                        YNF LFPRDELK GMP+YSFS Q+S+L S+A E
Sbjct  84    ---------------------------YNFVLFPRDELKMGMPTYSFSVQASHLTSMADE  116

Query  1475  GFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSVADSIFINRIKSRVKH  1296
             GFDFNACI +GISYLSRAQE AAK  I +P+  S  + S ++ +VAD++F+ RIKSRVKH
Sbjct  117   GFDFNACIYNGISYLSRAQESAAKARIGNPTTSSYVMSSSSTHTVADTVFVERIKSRVKH  176

Query  1295  WRNACTDQSKKTEDVLISSLRKMISATEVHGSRPCLNIDICS  1170
             W++AC  ++ K ++ L+SSLRK++  +E++G+RPC+N+D+CS
Sbjct  177   WKSAC--KNTKKDNALLSSLRKIVMGSEIYGTRPCMNLDVCS  216



>ref|XP_010532929.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Tarenaya 
hassleriana]
Length=617

 Score =   281 bits (720),  Expect(2) = 2e-150, Method: Compositional matrix adjust.
 Identities = 151/317 (48%), Positives = 220/317 (69%), Gaps = 14/317 (4%)
 Frame = -1

Query  1137  GGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLN  958
             G GTQ VR VLTSS+EDK+L +KEL+++E++ N+ VRGFREVV+LIS S+KPVV+ NSLN
Sbjct  271   GRGTQAVRAVLTSSEEDKELFKKELRDLESEQNRRVRGFREVVELISTSRKPVVSQNSLN  330

Query  957   DFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSR  778
             DFT IH+KFLAPLPS +DEF  SL   FP+I+D+  LMKE+   +N+ N+  A S +N R
Sbjct  331   DFTFIHAKFLAPLPSNVDEFNSSLSSAFPNIVDLSQLMKEISPLRNITNVSAAMSCMN-R  389

Query  777   FFAPVDVELPHQAISTK-ADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLP  601
             F+APVDVE+ +Q    K A+  + HG N L IS LFAK+C +LK +P   ++ ++     
Sbjct  390   FYAPVDVEVANQGSPVKLAEDHQIHGQNSLMISLLFAKLCMVLKAEPATIQSSDNFQAF-  448

Query  600   PALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSL  421
                + YAN  DPCS +  D     E+VR+ +++ +RV S+N+VFLWG    +S   +K++
Sbjct  449   -GSDEYANTIDPCSGNPSD-----ENVRIWSRNSRRVKSENLVFLWGLGKKMSAAVLKNV  502

Query  420   VYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDSG-----SLEEMVSEGIRAA  256
             +   H VF+ EFD++ +D+SCA++VF +PG SE  L A+ +G     +L+EMV+EG+RA 
Sbjct  503   LQKLHPVFAEEFDVKFIDKSCAIVVFWNPGFSETFLNAVTNGEQLSDTLKEMVAEGLRAT  562

Query  255   SYDAYVKVCKLGLWKAN  205
              YD + + C+LG W+++
Sbjct  563   GYDTFKRACRLGFWESD  579


 Score =   280 bits (717),  Expect(2) = 2e-150, Method: Compositional matrix adjust.
 Identities = 132/250 (53%), Positives = 174/250 (70%), Gaps = 9/250 (4%)
 Frame = -2

Query  1910  LQRRLFCTAISETAFRPNSGGS---NYGKWGIKQVTKSNFSEALNDIETRITESDFIAVS  1740
             +QRR        ++F   +GG    N+ +W  KQV KSNF + ++++ T I  SDF+AVS
Sbjct  1     MQRRFL------SSFPAGAGGGKTLNHRRWCAKQVKKSNFQDTIDEVRTCIDSSDFVAVS  54

Query  1739  LQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHL  1560
             LQ TG+Y++ W R+   DT E AY+KAK AAERYQI QFA+CPF++R S+L   PYNFHL
Sbjct  55    LQNTGSYAAAWHRVSALDTPETAYMKAKYAAERYQIFQFALCPFTIRGSRLTVQPYNFHL  114

Query  1559  FPRDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSA  1380
             FPRDELK GMPSYSFSCQ+S L ++AREGFDFN CI +GISYLSRAQE A+K    +P  
Sbjct  115   FPRDELKLGMPSYSFSCQASRLTAMAREGFDFNTCIYEGISYLSRAQESASKFISGNPVL  174

Query  1379  GSCTVPSPASRSVADSIFINRIKSRVKHWRNACTDQSKKTEDVLISSLRKMISATEVHGS  1200
                     +  +VAD++F+ R++SRV  W+  CTD S K ++ L+ SLR+++   E HGS
Sbjct  175   ADPVTEPFSPSTVADTVFVGRVRSRVTSWKQTCTDSSSKIDEPLVKSLRRLVLGGEEHGS  234

Query  1199  RPCLNIDICS  1170
             RPCL ID+CS
Sbjct  235   RPCLTIDVCS  244



>ref|XP_010943605.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Elaeis guineensis]
Length=610

 Score =   278 bits (711),  Expect(2) = 3e-148, Method: Compositional matrix adjust.
 Identities = 163/355 (46%), Positives = 238/355 (67%), Gaps = 14/355 (4%)
 Frame = -1

Query  1131  GTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLNDF  952
             G + VRVVLTSS+EDK LL  E+Q +E + N  VRGFREV+DLIS S KP++A+N L+DF
Sbjct  265   GPKSVRVVLTSSEEDKHLLMSEIQNLEEEQNLKVRGFREVIDLISSSHKPIIAYNCLHDF  324

Query  951   TSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSRFF  772
             T IHSKF++PLP +L+EF  SL  VF +I+DV HL+KE+G  +   N+  A SYL  +FF
Sbjct  325   TFIHSKFISPLPPSLNEFMCSLRLVFSNIVDVNHLLKEIGPLRKAKNLPAALSYLKRQFF  384

Query  771   APVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPAL  592
              P+D+E+P  A     +S K+HGHNVL+I+ +FAK+  +LK+ P    ++   G+   A+
Sbjct  385   VPIDMEIPQPA---DGNSNKNHGHNVLRITRVFAKLSILLKIVPDCQTSL---GRHTMAI  438

Query  591   ERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLVYG  412
             E YANIF P S S Q+     +DV     + +++S+  ++F+WGF+ G S  ++KS +  
Sbjct  439   EEYANIFYPTSNSVQE--TEADDVDFHMDNVRKISTDELIFMWGFRGGTSAAELKSHLRQ  496

Query  411   KHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDSGSLE-----EMVSEGIRAASYD  247
              H VF+ +F++RLVD +CAV+VF   G +E LL+ + SG        +M+SEG++AA Y+
Sbjct  497   THFVFTEDFELRLVDNTCAVVVFQKSGSAEALLKEIGSGKTNSTAPSKMLSEGLKAAGYE  556

Query  246   AYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
              Y KVC+LGLW+A LADSLE    + S  +  + + +D S I+W+S+ MI L+DL
Sbjct  557   TYKKVCRLGLWEAELADSLESVTSDSSGDVVIS-SGEDASDIYWSSESMIDLNDL  610


 Score =   277 bits (708),  Expect(2) = 3e-148, Method: Compositional matrix adjust.
 Identities = 143/235 (61%), Positives = 170/235 (72%), Gaps = 8/235 (3%)
 Frame = -2

Query  1856  SGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSS------PWQRLL  1695
             SGG +     +KQ+TKSNFS AL  I+  I ++DFIAVS Q TG  S+      PW+R+L
Sbjct  4     SGGKHCWCRAVKQITKSNFSAALQQIKAHIKDADFIAVSSQKTGDLSASSSHRYPWRRVL  63

Query  1694  PFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFPRDELKTGMPSYSF  1515
             P D  E AYLKAK AAE +++LQFAVCPF  + SKL+A PYNFHLFPRDEL  GMPSYSF
Sbjct  64    PIDVPETAYLKAKLAAETFELLQFAVCPFRFQGSKLVAFPYNFHLFPRDELNLGMPSYSF  123

Query  1514  SCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSVAD  1335
             SCQSS+L S+AREGFDFN  I DGISYLSRAQE  AK+  R+P+    +  S  + SVAD
Sbjct  124   SCQSSFLTSMAREGFDFNVSIYDGISYLSRAQESIAKE--RTPTPLVYSSSSSPTPSVAD  181

Query  1334  SIFINRIKSRVKHWRNACTDQSKKTEDVLISSLRKMISATEVHGSRPCLNIDICS  1170
             SIFI RIKSRV+HWRNAC D    T+  L  SLRK+I   EV+GSRP L+ID+CS
Sbjct  182   SIFIGRIKSRVEHWRNACKDSRNMTDGSLAKSLRKLILGGEVYGSRPSLSIDVCS  236



>ref|NP_189170.1| poly(A)-specific ribonuclease PARN-like protein [Arabidopsis 
thaliana]
 sp|Q8W4C3.1|PARNL_ARATH RecName: Full=Poly(A)-specific ribonuclease PARN-like; AltName: 
Full=Polyadenylate-specific ribonuclease-like protein [Arabidopsis 
thaliana]
 gb|AAL32742.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP37744.1| At3g25430 [Arabidopsis thaliana]
 gb|AEE77010.1| poly(A)-specific ribonuclease PARN-like protein [Arabidopsis 
thaliana]
Length=618

 Score =   290 bits (742),  Expect(2) = 2e-147, Method: Compositional matrix adjust.
 Identities = 143/248 (58%), Positives = 182/248 (73%), Gaps = 4/248 (2%)
 Frame = -2

Query  1910  LQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQT  1731
             +QRR F ++IS TA   N+   N G+W +KQV KSNF   L++I T I  SDFIA+SLQ 
Sbjct  1     MQRR-FLSSISATA--GNTKTLNQGRWSVKQVKKSNFHVTLDEIRTSIDSSDFIALSLQN  57

Query  1730  TGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFPR  1551
             TG+Y++ W R+   DT + +YLKAK AAERYQILQFA+CPFSL+ SKL   PYNFHLFPR
Sbjct  58    TGSYAAAWHRVSAIDTPQTSYLKAKYAAERYQILQFALCPFSLQGSKLTVHPYNFHLFPR  117

Query  1550  DELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAGSC  1371
             DELK GMPSYSFSCQ+S L ++AREGFDFN CI +GISYLSRAQE A+K    +P     
Sbjct  118   DELKCGMPSYSFSCQASRLTAMAREGFDFNICIYEGISYLSRAQESASKFLSENPILADS  177

Query  1370  TVPSPASRSVADSIFINRIKSRVKHWRNACTDQSKKT-EDVLISSLRKMISATEVHGSRP  1194
                S +  +VAD++F+ RI+SRVK+WR +C D   KT +D L+SSLR+++  +E +GSR 
Sbjct  178   VTVSSSPATVADTVFVGRIRSRVKNWRQSCIDSGSKTGDDDLVSSLRRLVLGSEQYGSRL  237

Query  1193  CLNIDICS  1170
             CL ID+CS
Sbjct  238   CLTIDVCS  245


 Score =   262 bits (670),  Expect(2) = 2e-147, Method: Compositional matrix adjust.
 Identities = 146/315 (46%), Positives = 209/315 (66%), Gaps = 14/315 (4%)
 Frame = -1

Query  1131  GTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLNDF  952
             GTQ VR V  SS+EDK L ++EL+++E + N+ VRGFREVVD IS SQKPVV+ N L+DF
Sbjct  274   GTQAVRTVFMSSKEDKDLFKRELKDLEKEENRRVRGFREVVDFISSSQKPVVSQNYLSDF  333

Query  951   TSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSRFF  772
             TSIH+KFL PLPS +D+F  SL   FP+++D+   MKE+    N++N+  A S LN RFF
Sbjct  334   TSIHAKFLGPLPSNVDDFSSSLSSAFPNVVDLSQFMKEISPLSNISNLPAAMSSLN-RFF  392

Query  771   APVDVELPHQAISTKADSV-KSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPA  595
             APVDVE+ +Q    K D   +SHG N + IS+LFAK+C+I K D    ++ E    L  A
Sbjct  393   APVDVEVANQGCPVKLDEGHQSHGQNAVMISQLFAKLCTIQKSDLSTIQSNEDFQAL--A  450

Query  594   LERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLVY  415
              + +AN    CS +  D     E+V+V +K+ +RVSS+N+VF+WG    ++  ++K+++ 
Sbjct  451   SDEHANSVTSCSKNAGD-----ENVKVWSKNSRRVSSENLVFIWGLGKKMTAAKLKNVLQ  505

Query  414   GKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDS-----GSLEEMVSEGIRAASY  250
               H VF+ EFD++ +D S A+LVF   G SE  L A+++     GSL EMV+EG+R A Y
Sbjct  506   KSHPVFAREFDVKYIDRSSAILVFWESGPSETFLSAVNNEEQLDGSLREMVAEGLRGAGY  565

Query  249   DAYVKVCKLGLWKAN  205
             + Y + C+LG W+A+
Sbjct  566   ETYKRACRLGFWEAD  580



>dbj|BAB01314.1| unnamed protein product [Arabidopsis thaliana]
Length=1115

 Score =   290 bits (741),  Expect(2) = 3e-147, Method: Compositional matrix adjust.
 Identities = 143/248 (58%), Positives = 182/248 (73%), Gaps = 4/248 (2%)
 Frame = -2

Query  1910  LQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQT  1731
             +QRR F ++IS TA   N+   N G+W +KQV KSNF   L++I T I  SDFIA+SLQ 
Sbjct  1     MQRR-FLSSISATA--GNTKTLNQGRWSVKQVKKSNFHVTLDEIRTSIDSSDFIALSLQN  57

Query  1730  TGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFPR  1551
             TG+Y++ W R+   DT + +YLKAK AAERYQILQFA+CPFSL+ SKL   PYNFHLFPR
Sbjct  58    TGSYAAAWHRVSAIDTPQTSYLKAKYAAERYQILQFALCPFSLQGSKLTVHPYNFHLFPR  117

Query  1550  DELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAGSC  1371
             DELK GMPSYSFSCQ+S L ++AREGFDFN CI +GISYLSRAQE A+K    +P     
Sbjct  118   DELKCGMPSYSFSCQASRLTAMAREGFDFNICIYEGISYLSRAQESASKFLSENPILADS  177

Query  1370  TVPSPASRSVADSIFINRIKSRVKHWRNACTDQSKKT-EDVLISSLRKMISATEVHGSRP  1194
                S +  +VAD++F+ RI+SRVK+WR +C D   KT +D L+SSLR+++  +E +GSR 
Sbjct  178   VTVSSSPATVADTVFVGRIRSRVKNWRQSCIDSGSKTGDDDLVSSLRRLVLGSEQYGSRL  237

Query  1193  CLNIDICS  1170
             CL ID+CS
Sbjct  238   CLTIDVCS  245


 Score =   262 bits (670),  Expect(2) = 3e-147, Method: Compositional matrix adjust.
 Identities = 146/315 (46%), Positives = 209/315 (66%), Gaps = 14/315 (4%)
 Frame = -1

Query  1131  GTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLNDF  952
             GTQ VR V  SS+EDK L ++EL+++E + N+ VRGFREVVD IS SQKPVV+ N L+DF
Sbjct  274   GTQAVRTVFMSSKEDKDLFKRELKDLEKEENRRVRGFREVVDFISSSQKPVVSQNYLSDF  333

Query  951   TSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSRFF  772
             TSIH+KFL PLPS +D+F  SL   FP+++D+   MKE+    N++N+  A S LN RFF
Sbjct  334   TSIHAKFLGPLPSNVDDFSSSLSSAFPNVVDLSQFMKEISPLSNISNLPAAMSSLN-RFF  392

Query  771   APVDVELPHQAISTKADSV-KSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPA  595
             APVDVE+ +Q    K D   +SHG N + IS+LFAK+C+I K D    ++ E    L  A
Sbjct  393   APVDVEVANQGCPVKLDEGHQSHGQNAVMISQLFAKLCTIQKSDLSTIQSNEDFQAL--A  450

Query  594   LERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLVY  415
              + +AN    CS +  D     E+V+V +K+ +RVSS+N+VF+WG    ++  ++K+++ 
Sbjct  451   SDEHANSVTSCSKNAGD-----ENVKVWSKNSRRVSSENLVFIWGLGKKMTAAKLKNVLQ  505

Query  414   GKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDS-----GSLEEMVSEGIRAASY  250
               H VF+ EFD++ +D S A+LVF   G SE  L A+++     GSL EMV+EG+R A Y
Sbjct  506   KSHPVFAREFDVKYIDRSSAILVFWESGPSETFLSAVNNEEQLDGSLREMVAEGLRGAGY  565

Query  249   DAYVKVCKLGLWKAN  205
             + Y + C+LG W+A+
Sbjct  566   ETYKRACRLGFWEAD  580



>ref|XP_008364676.1| PREDICTED: LOW QUALITY PROTEIN: poly(A)-specific ribonuclease 
PARN-like [Malus domestica]
Length=628

 Score =   302 bits (773),  Expect(2) = 3e-147, Method: Compositional matrix adjust.
 Identities = 166/318 (52%), Positives = 217/318 (68%), Gaps = 15/318 (5%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             A GGGTQ VR VLTSS  DK   E+ELQ +E + NK VRGF+EV+DLIS SQKPVV+HNS
Sbjct  289   AKGGGTQAVRXVLTSSTADKDXFERELQNLEEEQNKRVRGFQEVIDLISASQKPVVSHNS  348

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             LN  + IHS+FL+PLP+ +DEF  SL  VFPHILDV HLMK +G  + + NI  A SYLN
Sbjct  349   LNGISVIHSEFLSPLPTNVDEFMGSLHSVFPHILDVNHLMKNIGPLRRMTNIPAAISYLN  408

Query  783   SRFFAPVDVE-LPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQ  607
             + +FA +D+E LP ++          H HNV+K+  LFAK+CSILK+   A   + +   
Sbjct  409   NHYFAAIDMEILPQES------EGNIHRHNVVKMCYLFAKLCSILKISDNA--MVSNNAX  460

Query  606   LPPALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVK  427
             L PA+    NI +PCS S Q+     ED+RV  K+ ++VS   +VFLWGF+SG++ G +K
Sbjct  461   LAPAIXEXTNISNPCSDSPQES--TNEDIRVWTKNMRKVSCDQLVFLWGFRSGMTAGMIK  518

Query  426   SLVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDS----GSLEEMVSEGIRA  259
             SL+   H VFS EFD+R  D+SCA++VF   GLSE  L+A+ S     SL E+ SEGIRA
Sbjct  519   SLLCKXHAVFSEEFDVRXXDKSCAIVVFWRRGLSETFLDAMSSEEICDSLMEIASEGIRA  578

Query  258   ASYDAYVKVCKLGLWKAN  205
             +SY+ Y  VC+LGLW+A+
Sbjct  579   SSYETYKXVCRLGLWEAD  596


 Score =   249 bits (637),  Expect(2) = 3e-147, Method: Compositional matrix adjust.
 Identities = 122/230 (53%), Positives = 167/230 (73%), Gaps = 13/230 (6%)
 Frame = -2

Query  1835  KWGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAK  1656
             KW +K+VTKSNFSE+L + +  ++ SDF+A SLQ TG+Y +PW+   PFDTA+ +Y KAK
Sbjct  40    KWAVKEVTKSNFSESLXEFKDHLSSSDFVAFSLQKTGSYRAPWRHPQPFDTADTSYFKAK  99

Query  1655  RAAERYQILQFAVCPFSLRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIARE  1476
              AAER+Q+LQFA CP++LR SKL   PYNF LFPRDEL  G+     S Q+S+L S+A E
Sbjct  100   YAAERFQLLQFAACPYTLRASKLTPYPYNFVLFPRDELMMGLLX---SVQTSHLTSMAEE  156

Query  1475  GFDFNACI-ND-------GISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSVADSIFIN  1320
             GFDFNACI ND       GISYLS AQE AAK  I +P+  S  + S ++ +VAD++F+ 
Sbjct  157   GFDFNACIYNDFVFCNETGISYLSGAQESAAKARIGNPTTSSYVMNSSSTHTVADTVFVE  216

Query  1319  RIKSRVKHWRNACTDQSKKTEDVLISSLRKMISATEVHGSRPCLNIDICS  1170
             RIK RV HW++AC  ++ K +D L+SSLRK++  +E++G+RP +N+D+ S
Sbjct  217   RIKLRVXHWKSAC--KNTKKDDALLSSLRKIVMGSEIYGTRPXMNLDVXS  264



>ref|XP_003532241.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Glycine max]
 gb|KHN10920.1| Poly(A)-specific ribonuclease PARN-like [Glycine soja]
Length=619

 Score =   293 bits (749),  Expect(2) = 4e-147, Method: Compositional matrix adjust.
 Identities = 174/356 (49%), Positives = 241/356 (68%), Gaps = 11/356 (3%)
 Frame = -1

Query  1137  GGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLN  958
              G    VR+VL +S+EDK LLE+EL+ +E + +K +RGFREV+DLIS SQKPV++HN LN
Sbjct  271   SGTIHAVRIVLANSKEDKDLLERELRNLEEEESKKIRGFREVIDLISASQKPVISHNCLN  330

Query  957   DFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSR  778
             D T IHSKF+APLP  +DEF  SL  VFP +LD+ +LMK+ G+ + + NI  A SYLN+ 
Sbjct  331   DCTLIHSKFIAPLPPEIDEFVSSLCSVFPEVLDINYLMKKHGTMRKVTNIPSAISYLNNH  390

Query  777   FFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPP  598
             FFAPVD+E+P QA   +    K HG   L++S LF K+CSILK+ P   E+      L P
Sbjct  391   FFAPVDLEIPDQATVKEG---KIHGLTALRLSYLFMKLCSILKISPNVTESGNK--HLAP  445

Query  597   ALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLV  418
              LE + N+F P ST  QD   N  DV +   + K+VS +++VFLWGF+ GI+ G +KSL+
Sbjct  446   ELEDFTNVFHPFSTPIQD-SFNGGDVGMWTNNTKKVSCEHLVFLWGFKIGITAGMLKSLL  504

Query  417   YGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDS----GSLEEMVSEGIRAASY  250
                H++FS EFD++LVD+SCA++VF   G+S+  L+ L+S    G L+E+VS+G+R  SY
Sbjct  505   RSSHDIFSREFDVKLVDKSCAIVVFWQSGVSKRFLDILNSEEIRGDLKELVSDGMRVTSY  564

Query  249   DAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
             + Y  +C+LGLW+ +LA+SLE ALE     +      K  S IHW +D +I+LDDL
Sbjct  565   ETYNTICRLGLWEMDLAESLERALESSCCDIESNCERKS-SEIHWYNDNVINLDDL  619


 Score =   258 bits (660),  Expect(2) = 4e-147, Method: Compositional matrix adjust.
 Identities = 123/226 (54%), Positives = 171/226 (76%), Gaps = 4/226 (2%)
 Frame = -2

Query  1835  KWGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSP-WQRLLPFDTAEIAYLKA  1659
             KW +KQVT SNF E+L +I+T I+ SDF+A+S+  TG+ S+P W R LPFDTA+ AY KA
Sbjct  19    KWRVKQVTTSNFQESLQEIKTHISNSDFVAISMGKTGSPSAPSWLRPLPFDTAQTAYSKA  78

Query  1658  KRAAERYQILQFAVCPFSL-RESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIA  1482
             +RAA+R+Q+L FAVCPFS+ R  KL+A PYNF LFPRDE+K GMP+YSFSCQ+S L S+A
Sbjct  79    RRAAQRFQLLHFAVCPFSVSRSDKLLAHPYNFMLFPRDEMKMGMPTYSFSCQTSLLASMA  138

Query  1481  REGFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSVADSIFINRIKSRV  1302
             R+GFDFNAC+ +GISYLSRAQE AA+  + +       + S +  +VAD++F+ RI+S+V
Sbjct  139   RQGFDFNACVYNGISYLSRAQESAARIRLGTALPSLRVMKSSSPSTVADTVFVERIRSKV  198

Query  1301  KHWRNAC--TDQSKKTEDVLISSLRKMISATEVHGSRPCLNIDICS  1170
             K+WR +C  +D +K  ++ L++SLR ++   E   SRPC+ +D+CS
Sbjct  199   KYWRESCKSSDTNKSRDEELVNSLRNIVLGNEQFRSRPCMTVDVCS  244



>ref|XP_006299254.1| hypothetical protein CARUB_v10015403mg [Capsella rubella]
 gb|EOA32152.1| hypothetical protein CARUB_v10015403mg [Capsella rubella]
Length=616

 Score =   290 bits (743),  Expect(2) = 1e-146, Method: Compositional matrix adjust.
 Identities = 145/248 (58%), Positives = 182/248 (73%), Gaps = 4/248 (2%)
 Frame = -2

Query  1910  LQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQT  1731
             +QRR F ++IS TA   NS   N G+W +KQV KSNF   L++I T I  SDFIA+SLQ 
Sbjct  1     MQRR-FLSSISGTA--GNSKTLNQGRWSVKQVKKSNFHVTLDEIRTSIESSDFIALSLQN  57

Query  1730  TGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFPR  1551
             TG+Y++ W R+   DT + +YLKAK AAERYQI QFA+CPFSL+ SKL   PYNFHLFPR
Sbjct  58    TGSYAAAWHRVSAIDTPQTSYLKAKYAAERYQIFQFALCPFSLQGSKLTVHPYNFHLFPR  117

Query  1550  DELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAGSC  1371
             DELK GMPSYSFSCQ+S L S+AREGFDFN CI +GISYLSRAQE A+K    +P   + 
Sbjct  118   DELKCGMPSYSFSCQASRLTSMAREGFDFNTCIYEGISYLSRAQESASKYLSGNPILANP  177

Query  1370  TVPSPASRSVADSIFINRIKSRVKHWRNACTDQSKKT-EDVLISSLRKMISATEVHGSRP  1194
                S +  SVAD++F+ RI+SRVK+WR +C D   KT +D L+SSLR+++  +E +GSR 
Sbjct  178   ITVSSSPASVADTVFVGRIRSRVKNWRQSCIDSGSKTGDDDLVSSLRRLVLGSEQYGSRL  237

Query  1193  CLNIDICS  1170
             CL ID+CS
Sbjct  238   CLTIDVCS  245


 Score =   259 bits (663),  Expect(2) = 1e-146, Method: Compositional matrix adjust.
 Identities = 150/356 (42%), Positives = 224/356 (63%), Gaps = 19/356 (5%)
 Frame = -1

Query  1131  GTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLNDF  952
             GTQ VR V  SS+EDK L ++E+Q++ENK N+ VRGFREV+DLIS SQKPV++ N L+D 
Sbjct  274   GTQAVRTVFMSSKEDKDLFKREIQDLENKENRRVRGFREVIDLISSSQKPVISQNYLSDL  333

Query  951   TSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSRFF  772
             TSIH+KFL PLP+ +D+F  SL   FP+++D+   MKE+    N++N+  A S LN RFF
Sbjct  334   TSIHAKFLGPLPANVDDFSSSLSSAFPNVVDLSQFMKEISPLSNISNLPAAMSSLN-RFF  392

Query  771   APVDVELPHQAISTK-ADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPA  595
             APVDVE+ +Q    K +++ +SHG N + IS+LFAK+ +I K D    ++ E    L   
Sbjct  393   APVDVEVANQGCPVKLSENYQSHGQNAVMISQLFAKLSAIQKSDLSTVQSNEDSQDLAS-  451

Query  594   LERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLVY  415
                     D  ++         E+V+V +K+ +RVSS+N+VF+WGF   ++  ++K+ + 
Sbjct  452   --------DEHTSFVISKNTGNENVKVWSKNSRRVSSENLVFIWGFAKKLTAAKLKNFLQ  503

Query  414   GKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALD-----SGSLEEMVSEGIRAASY  250
               H VF+ EFD++ +D SCA++VF   G SE  L A++     SGSL EMV+EG+RAA Y
Sbjct  504   KSHPVFTQEFDVKYLDRSCAIVVFWESGPSETFLSAVNNEEQLSGSLREMVAEGLRAAGY  563

Query  249   DAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
             + Y + C+LG W+A+     E   +      +E  +    S I+W++D  I+ D+L
Sbjct  564   ETYKRACRLGFWEAD---LAESLDKTLDSSDTEHDSDTKPSEINWSNDLAINFDEL  616



>ref|XP_004148964.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Cucumis sativus]
Length=610

 Score =   281 bits (718),  Expect(2) = 3e-146, Method: Compositional matrix adjust.
 Identities = 154/321 (48%), Positives = 220/321 (69%), Gaps = 19/321 (6%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             A GGGTQ VR +LTSS+EDK LLEKELQ +E+K NK  RGFREV+D+IS SQKP+V++NS
Sbjct  267   AKGGGTQAVRAILTSSKEDKILLEKELQYLEDKENKKFRGFREVIDVISASQKPIVSYNS  326

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             L+DFT IHSKFLAPLP+++DE+  SL  VFP + DVKHLM ++G      +I  A SYL 
Sbjct  327   LHDFTFIHSKFLAPLPTSIDEYASSLHSVFPRVHDVKHLMSKIGGLSKPMSIAAAYSYLK  386

Query  783   SRFFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQL  604
              +++AP  +++P +A     +  K HGHN +++  LFA+VCS+LK+D    ++ ++    
Sbjct  387   KQYYAPSYLDIPVEA---PGNDHKPHGHNAIRLCHLFAQVCSVLKIDLSGVQSNDN----  439

Query  603   PPALERYANIFDPCSTSYQDPPIN----EEDVRVRAKSCKRVSSKNVVFLWGFQSGISTG  436
                 E  A++ D CS      P +    +EDV++ A+  ++VS +++VFLWG + G++  
Sbjct  440   ----ECLASMLDECSNVSSFSPYHCKPKDEDVKIWAQGVRKVSCRHLVFLWGLREGLTAR  495

Query  435   QVKSLVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDS----GSLEEMVSEG  268
              +K+ + G HEVF  EFD+R VD+ CA++VFS P LSE  L+A++S    GSL EMVSEG
Sbjct  496   LLKASLEGTHEVFCEEFDVRFVDKKCAIVVFSQPDLSETFLDAINSDNIVGSLREMVSEG  555

Query  267   IRAASYDAYVKVCKLGLWKAN  205
             +RAA Y+ Y K+C   LW+A+
Sbjct  556   LRAAGYETYKKICSFDLWEAD  576


 Score =   268 bits (684),  Expect(2) = 3e-146, Method: Compositional matrix adjust.
 Identities = 139/254 (55%), Positives = 177/254 (70%), Gaps = 28/254 (11%)
 Frame = -2

Query  1910  LQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQT  1731
             L RRL+ T                 +W ++QV  SNF  +L D++  I++SDFIA+SLQ 
Sbjct  10    LHRRLYTTT---------------SQWSVRQVRNSNFLGSLEDLKNDISDSDFIALSLQR  54

Query  1730  TGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFPR  1551
             TG+ S PW RL PFDT + AY KAK AAE++QI+QF++CPFS+R+SKLIA PYNFHLFPR
Sbjct  55    TGSSSFPWHRLQPFDTHDTAYCKAKYAAEKFQIIQFSLCPFSVRDSKLIAHPYNFHLFPR  114

Query  1550  DELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAGSC  1371
             DEL  GMPSYSFSCQ S+L S+AREGFDF A + DGISYLSRAQE  AK        GS 
Sbjct  115   DELNIGMPSYSFSCQVSHLTSMAREGFDFGAWVYDGISYLSRAQESIAK-----TQMGSQ  169

Query  1370  TVP------SPASR-SVADSIFINRIKSRVKHWRNACTDQSKKTEDVLISSLRKMISATE  1212
             T+P       P+S  SVAD+IF+ R+KSRVK+W++A  D S KT D L+S+L+K+I  +E
Sbjct  170   TLPPNINAVKPSSELSVADTIFVQRVKSRVKNWKDA-YDSSSKTSDALLSTLKKLIVGSE  228

Query  1211  VHGSRPCLNIDICS  1170
              +GSRP + ID+ S
Sbjct  229   QYGSRPSIVIDVYS  242



>ref|XP_004161545.1| PREDICTED: LOW QUALITY PROTEIN: poly(A)-specific ribonuclease 
PARN-like [Cucumis sativus]
Length=610

 Score =   280 bits (716),  Expect(2) = 4e-146, Method: Compositional matrix adjust.
 Identities = 154/321 (48%), Positives = 220/321 (69%), Gaps = 19/321 (6%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             A GGGTQ VR +LTSS+EDK LLEKELQ +E+K NK  RGFREV+D+IS SQKP+V++NS
Sbjct  267   AKGGGTQAVRAILTSSKEDKILLEKELQYLEDKENKKFRGFREVIDVISASQKPIVSYNS  326

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             L+DFT IHSKFLAPLP+++DE+  SL  VFP + DVKHLM ++G      +I  A SYL 
Sbjct  327   LHDFTFIHSKFLAPLPTSIDEYASSLHSVFPRVHDVKHLMSKIGGLSKPMSIAAAYSYLK  386

Query  783   SRFFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQL  604
             + ++AP  +++P +A     +  K HGHN +++  LFA+VCS+LK+D    ++ ++    
Sbjct  387   NXYYAPSYLDIPVEA---PGNDHKPHGHNAIRLCHLFAQVCSVLKIDLSGVQSNDN----  439

Query  603   PPALERYANIFDPCSTSYQDPPIN----EEDVRVRAKSCKRVSSKNVVFLWGFQSGISTG  436
                 E  A++ D CS      P +    +EDV++ A+  ++VS +++VFLWG + G++  
Sbjct  440   ----ECLASMLDECSNVSSFSPYHCKPKDEDVKIWAQGVRKVSCRHLVFLWGLREGLTAR  495

Query  435   QVKSLVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDS----GSLEEMVSEG  268
              +K+ + G HEVF  EFD+R VD+ CA++VFS P LSE  L+A++S    GSL EMVSEG
Sbjct  496   LLKASLEGTHEVFCEEFDVRFVDKKCAIVVFSQPDLSETFLDAINSDNIVGSLREMVSEG  555

Query  267   IRAASYDAYVKVCKLGLWKAN  205
             +RAA Y+ Y K+C   LW+A+
Sbjct  556   LRAAGYETYKKICSFDLWEAD  576


 Score =   268 bits (685),  Expect(2) = 4e-146, Method: Compositional matrix adjust.
 Identities = 139/254 (55%), Positives = 177/254 (70%), Gaps = 28/254 (11%)
 Frame = -2

Query  1910  LQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQT  1731
             L RRL+ T                 +W ++QV  SNF  +L D++  I++SDFIA+SLQ 
Sbjct  10    LHRRLYTTT---------------SQWSVRQVRNSNFLGSLEDLKNDISDSDFIALSLQR  54

Query  1730  TGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFPR  1551
             TG+ S PW RL PFDT + AY KAK AAE++QI+QF++CPFS+R+SKLIA PYNFHLFPR
Sbjct  55    TGSSSFPWHRLQPFDTHDTAYCKAKYAAEKFQIIQFSLCPFSVRDSKLIAHPYNFHLFPR  114

Query  1550  DELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAGSC  1371
             DEL  GMPSYSFSCQ S+L S+AREGFDF A + DGISYLSRAQE  AK        GS 
Sbjct  115   DELNIGMPSYSFSCQVSHLTSMAREGFDFGAWVYDGISYLSRAQESIAK-----TQMGSQ  169

Query  1370  TVP------SPASR-SVADSIFINRIKSRVKHWRNACTDQSKKTEDVLISSLRKMISATE  1212
             T+P       P+S  SVAD+IF+ R+KSRVK+W++A  D S KT D L+S+L+K+I  +E
Sbjct  170   TLPPNINAVKPSSELSVADTIFVQRVKSRVKNWKDA-YDSSSKTSDALLSTLKKLIVGSE  228

Query  1211  VHGSRPCLNIDICS  1170
              +GSRP + ID+ S
Sbjct  229   QYGSRPSIVIDVYS  242



>ref|XP_006418630.1| hypothetical protein EUTSA_v10002449mg [Eutrema salsugineum]
 gb|ESQ37066.1| hypothetical protein EUTSA_v10002449mg [Eutrema salsugineum]
Length=610

 Score =   287 bits (734),  Expect(2) = 7e-146, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 170/226 (75%), Gaps = 1/226 (0%)
 Frame = -2

Query  1844  NYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYL  1665
             N G+W +KQV KSNF   L++I T I  SDF+A+SLQ TG+Y++ W R+   DT +++YL
Sbjct  20    NNGRWSVKQVKKSNFKSTLDEIRTSIDSSDFVALSLQNTGSYAAAWHRISAIDTPQMSYL  79

Query  1664  KAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISI  1485
             KAK AAERYQILQFA+CPFSLR SKL   PYNFHLFPRDELK GMPSYSFSCQ+S L ++
Sbjct  80    KAKYAAERYQILQFALCPFSLRGSKLTVHPYNFHLFPRDELKLGMPSYSFSCQASRLTAM  139

Query  1484  AREGFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSVADSIFINRIKSR  1305
             AREGFDFNACI +GISYLSR QE A+K    +P          +  +VAD++F+ RI+SR
Sbjct  140   AREGFDFNACIYEGISYLSREQESASKFLSGNPILAEPVAAPSSPSTVADTVFVGRIRSR  199

Query  1304  VKHWRNACTDQSKKT-EDVLISSLRKMISATEVHGSRPCLNIDICS  1170
             VK+WR +C D S KT +D L+SSLRK++  +E +GSR CL ID+CS
Sbjct  200   VKNWRQSCLDSSSKTGDDDLVSSLRKLVLGSEQYGSRLCLTIDVCS  245


 Score =   260 bits (664),  Expect(2) = 7e-146, Method: Compositional matrix adjust.
 Identities = 145/323 (45%), Positives = 206/323 (64%), Gaps = 30/323 (9%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             +  GGTQ VR V  SS+ED    ++ELQ++EN+ N+ +RGFREVVDLIS SQKPVV+ N 
Sbjct  270   SKSGGTQAVRAVFMSSKEDMDRFKRELQDLENEENRRLRGFREVVDLISSSQKPVVSQNY  329

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             L+DFTSIH+KFL PLPS +D+F  SL   FP+++D+   MKE+    N++N+  A S LN
Sbjct  330   LSDFTSIHAKFLGPLPSNVDDFSSSLSSAFPNVVDLSQFMKEISPLSNISNLPAAMSSLN  389

Query  783   SRFFAPVDVELPHQAISTKAD-SVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQ  607
              RFFAPVDVE+ +Q    K D S + HG N + IS+LFAK+ +I K D            
Sbjct  390   -RFFAPVDVEVANQGCPIKLDESHQMHGQNAVMISQLFAKLSTIQKSD------------  436

Query  606   LPPALERYANIFDPCSTSY---QDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTG  436
                    Y +   P   SY    D   ++E+V+V +K+ +RVSS+N+VF+WG    ++  
Sbjct  437   -------YQSSVQPSEDSYALASDQHASDENVQVWSKNSRRVSSENLVFIWGLAKKMTAS  489

Query  435   QVKSLVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDS------GSLEEMVS  274
              +K+++   H VF+ EFD++L+D SCAV+VF  P  SE  L A+++      GSL  MV+
Sbjct  490   TLKNVLQKSHNVFAQEFDVKLLDRSCAVVVFWQPSSSETFLSAVNNEDQLLGGSLRVMVA  549

Query  273   EGIRAASYDAYVKVCKLGLWKAN  205
             EG+RAA Y+ Y + C+LG W+A+
Sbjct  550   EGLRAAGYETYKRACRLGFWEAD  572



>ref|XP_010466956.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X1 
[Camelina sativa]
Length=619

 Score =   289 bits (739),  Expect(2) = 3e-145, Method: Compositional matrix adjust.
 Identities = 147/249 (59%), Positives = 183/249 (73%), Gaps = 5/249 (2%)
 Frame = -2

Query  1910  LQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQT  1731
             +QRR F ++IS TA   NS   N G+W +KQV KSNF   L+ I   I  SDFIA+SLQ 
Sbjct  1     MQRR-FLSSISATA--GNSKTLNQGRWSVKQVKKSNFHVTLDKIRASIDSSDFIALSLQN  57

Query  1730  TGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFPR  1551
             TG+Y++ W R+   DT + +YLKAK AAERYQILQFA+CPFSL+ SKL   PYNFHLFPR
Sbjct  58    TGSYAAAWHRVSAIDTPQTSYLKAKYAAERYQILQFALCPFSLQGSKLTVHPYNFHLFPR  117

Query  1550  DELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSP-SAGS  1374
             DELK GMPSYSFSCQ+S L S+AREGFDFN CI +GISYLSRAQE A+K    +P  A  
Sbjct  118   DELKCGMPSYSFSCQASRLTSMAREGFDFNTCIYEGISYLSRAQESASKFLSGNPILADP  177

Query  1373  CTVPSPASRSVADSIFINRIKSRVKHWRNACTDQSKKT-EDVLISSLRKMISATEVHGSR  1197
               V S +  +VAD++F+ RI+SRVK+WR +C D S KT +D L+SSLR+++  +E +GSR
Sbjct  178   IAVSSSSPATVADTVFVGRIRSRVKNWRKSCVDSSIKTGDDDLVSSLRRLVLGSEQYGSR  237

Query  1196  PCLNIDICS  1170
              CL ID+CS
Sbjct  238   LCLTIDVCS  246


 Score =   256 bits (655),  Expect(2) = 3e-145, Method: Compositional matrix adjust.
 Identities = 153/356 (43%), Positives = 228/356 (64%), Gaps = 17/356 (5%)
 Frame = -1

Query  1131  GTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLNDF  952
             GTQ VR V  SS+EDK L  +ELQ++ENK N+ VRGFREV+DLIS SQKPV++ N L+D 
Sbjct  275   GTQAVRTVFMSSKEDKDLFMRELQDLENKENRRVRGFREVIDLISSSQKPVISQNYLSDL  334

Query  951   TSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSRFF  772
             TSIH+KFL PLP+ +D+F  SL   FP ++D+   MKE+    N++N+  A S LN RFF
Sbjct  335   TSIHAKFLGPLPANVDDFSSSLSSAFPSVVDLSQFMKEISPLSNISNLPAAMSSLN-RFF  393

Query  771   APVDVELPHQAISTK-ADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPA  595
             APVDVE+ +Q    K ++S +SHG N + IS+LFAK+ +I K D    E  E    L  A
Sbjct  394   APVDVEVANQGSQVKLSESYQSHGQNAVMISQLFAKLRTIQKSDLSTVEPNEDFQAL--A  451

Query  594   LERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLVY  415
              + + +    CS +  D     E+V+V +K+ +RVSS+N+VF+WG    ++  ++K+++ 
Sbjct  452   SDEHESSVTSCSQNAGD-----ENVKVWSKNSRRVSSENLVFIWGLTKKMTAAKLKNVLQ  506

Query  414   GKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDS-----GSLEEMVSEGIRAASY  250
               H VF+ EFD++ +D+SCA++VF   G SE  + A+++     GSL+EMV+EG+RAA Y
Sbjct  507   KSHPVFTQEFDVKYLDKSCAIVVFWESGPSETFVTAVNNEEQLGGSLKEMVAEGLRAAGY  566

Query  249   DAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
             + Y K C+LG W+A+     E   +      ++  +  + S I W++D  I+ D+L
Sbjct  567   ETYKKACRLGFWEAD---LAESLDKTLESSDTDPDSDSNPSEIDWSNDLAINFDEL  619



>gb|KFK39842.1| hypothetical protein AALP_AA3G294900 [Arabis alpina]
Length=791

 Score =   274 bits (701),  Expect(2) = 2e-144, Method: Compositional matrix adjust.
 Identities = 136/231 (59%), Positives = 170/231 (74%), Gaps = 3/231 (1%)
 Frame = -2

Query  1856  SGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAE  1677
             S  SN+  W +KQV KSNFS AL+ I T I  SDF+A+SLQ TG+Y++ W R+   DT E
Sbjct  189   SSTSNHRGWSVKQVKKSNFSSALDQIRTSIDSSDFVALSLQNTGSYAAAWHRVSAIDTPE  248

Query  1676  IAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSY  1497
              +Y KAK AAERYQI QFA+CPFSL  S L   PYNFHLFPRD+ K GMPSYSFSCQ+S 
Sbjct  249   TSYFKAKYAAERYQIFQFALCPFSLGGSTLTVHPYNFHLFPRDDFKLGMPSYSFSCQASR  308

Query  1496  LISIAREGFDFNACINDGISYLSRAQELAAKDCIRSP-SAGSCTVPSPASRSVADSIFIN  1320
             L ++AR+GFDFN CI  GISYLSRAQE A+K    +P    + TVPS +  +VAD++F+ 
Sbjct  309   LTAMARQGFDFNTCIYQGISYLSRAQESASKFLSGNPILPDAITVPS-SPPTVADTVFVA  367

Query  1319  RIKSRVKHWRNACTDQSKKTE-DVLISSLRKMISATEVHGSRPCLNIDICS  1170
             RI+SRVK+WR +C D S +TE D L+SSLRK++  +E +GSR CL ID+CS
Sbjct  368   RIRSRVKNWRQSCLDTSSRTEDDDLVSSLRKLVLGSEQYGSRLCLTIDVCS  418


 Score =   268 bits (685),  Expect(2) = 2e-144, Method: Compositional matrix adjust.
 Identities = 146/315 (46%), Positives = 208/315 (66%), Gaps = 14/315 (4%)
 Frame = -1

Query  1131  GTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLNDF  952
             GTQ VR V  SS+ED  L ++ELQ +EN+ N+ VRGFREV+DLIS SQKPVV+ N L+DF
Sbjct  447   GTQAVRAVFMSSKEDMDLFKRELQGLENEENRRVRGFREVIDLISASQKPVVSQNYLSDF  506

Query  951   TSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSRFF  772
             TSIH+KFL PLPS +D+F  SL   FP ++D+   MKE+    N++N+  A S LN RFF
Sbjct  507   TSIHAKFLGPLPSNVDDFNSSLSSAFPDVVDLSQFMKEISPLSNISNLPAAMSSLN-RFF  565

Query  771   APVDVELPHQAISTKADSV-KSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPA  595
             APVDVE+ +Q    K +   +SHG N + IS+LFAK+C+I K DP + ++ E    L  +
Sbjct  566   APVDVEVANQGCPIKLNEDHQSHGQNAVMISQLFAKLCTIQKSDPSSAQSNEDFQAL--S  623

Query  594   LERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLVY  415
              + +A+    C+ +  D      +VRV +K+ +RVSS N+V +WG    ++   +K+++ 
Sbjct  624   SDEHADFVTSCARNAGD-----ANVRVWSKNSRRVSSDNLVLIWGLAKKMTAAMLKNVLQ  678

Query  414   GKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDS-----GSLEEMVSEGIRAASY  250
               H VF+ EFD++ +D SCA+LVF   G SE  L A+++     GSL EMV+EG+RAA Y
Sbjct  679   QAHPVFAQEFDVKFLDRSCAILVFWESGSSETFLTAINNEEQLGGSLREMVAEGLRAAGY  738

Query  249   DAYVKVCKLGLWKAN  205
             D Y + C+LG W+A+
Sbjct  739   DTYKRACRLGFWEAD  753



>ref|XP_007140707.1| hypothetical protein PHAVU_008G135000g [Phaseolus vulgaris]
 gb|ESW12701.1| hypothetical protein PHAVU_008G135000g [Phaseolus vulgaris]
Length=617

 Score =   291 bits (746),  Expect(2) = 3e-144, Method: Compositional matrix adjust.
 Identities = 169/355 (48%), Positives = 238/355 (67%), Gaps = 11/355 (3%)
 Frame = -1

Query  1134  GGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLND  955
             G T  +R+VL +S+EDK+LLE+ELQ  E + +K +RGFREV+D IS SQKPV+ +N LND
Sbjct  270   GTTHALRIVLANSKEDKELLERELQNFEEEESKKIRGFREVIDSISASQKPVICYNCLND  329

Query  954   FTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSRF  775
              T IHSKF+APLP  +DEF  SL  +FP++LD+ +LMK+ G+ + + NI  A SYLN+ F
Sbjct  330   CTLIHSKFIAPLPLEVDEFVSSLHSIFPNVLDINYLMKKHGTMRKVTNIPSAISYLNNNF  389

Query  774   FAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPA  595
             FAPVD+E+P QA   +    K HG N L++  LF K+CSILK+ P   ++      L P 
Sbjct  390   FAPVDLEIPDQATVKEG---KIHGLNALRLGYLFMKLCSILKISPNVTDSGNK--HLAPE  444

Query  594   LERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLVY  415
             LE + N+F PCS   QD   N  DV V   + +++S +++VFLWGF  GI+ G +KSL+ 
Sbjct  445   LEDFTNVFHPCSPPIQDSS-NAGDVGVWTNNTRKISCEHLVFLWGFNLGITAGMLKSLLR  503

Query  414   GKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALD----SGSLEEMVSEGIRAASYD  247
               H +FS EFD++LVD+SCA++VF  PG+S+  L+ ++    SG L+E+VS G+R  SY+
Sbjct  504   SSHNIFSREFDVKLVDKSCAIVVFWQPGVSKQFLDIMNSEEMSGDLKELVSNGLRVTSYE  563

Query  246   AYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
              Y ++C+LGLW+ +L +SLE ALE            K  S IHW +D +I+LDDL
Sbjct  564   TYDRICRLGLWEMDLRESLERALENSWCDEKSNCGTKS-SEIHWYNDNVINLDDL  617


 Score =   250 bits (638),  Expect(2) = 3e-144, Method: Compositional matrix adjust.
 Identities = 130/251 (52%), Positives = 170/251 (68%), Gaps = 19/251 (8%)
 Frame = -2

Query  1910  LQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQT  1731
             L+RR  CT+                KW +KQVT SNF E+L +I+T I+ SD++AVS+  
Sbjct  7     LRRRFLCTS---------------SKWKVKQVTTSNFEESLQEIKTHISSSDYVAVSMAR  51

Query  1730  TGAYSSP-WQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRES-KLIASPYNFHLF  1557
             TG+ S P W R LPFDTA+ AY KA+RAA R+Q+L FAVCPFS+  S KL+A PYNF LF
Sbjct  52    TGSPSPPSWLRPLPFDTAQTAYSKARRAAHRFQVLHFAVCPFSVSHSDKLLAHPYNFVLF  111

Query  1556  PRDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAG  1377
             PRDELK GMP+YSFS Q+S L S+AR GFDFNAC+ +GISYLSRAQE AAK  + +    
Sbjct  112   PRDELKMGMPAYSFSSQTSLLASMARRGFDFNACVYNGISYLSRAQESAAKVRLGAALPS  171

Query  1376  SCTVPSPASRSVADSIFINRIKSRVKHWRNACTDQSKKT--EDVLISSLRKMISATEVHG  1203
                V S +S +VAD++F+ R +SR+KHWR         T  ++ LI+SL+ ++  +E   
Sbjct  172   LREVKSSSSPTVADTVFVERTRSRIKHWRKTFERSGTSTSRDEELINSLKNIVLGSEQFR  231

Query  1202  SRPCLNIDICS  1170
             SRPC+ ID+CS
Sbjct  232   SRPCMTIDVCS  242



>gb|KFK39841.1| hypothetical protein AALP_AA3G294900 [Arabis alpina]
Length=795

 Score =   273 bits (697),  Expect(2) = 4e-144, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 170/235 (72%), Gaps = 7/235 (3%)
 Frame = -2

Query  1856  SGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAE  1677
             S  SN+  W +KQV KSNFS AL+ I T I  SDF+A+SLQ TG+Y++ W R+   DT E
Sbjct  189   SSTSNHRGWSVKQVKKSNFSSALDQIRTSIDSSDFVALSLQNTGSYAAAWHRVSAIDTPE  248

Query  1676  IAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSY  1497
              +Y KAK AAERYQI QFA+CPFSL  S L   PYNFHLFPRD+ K GMPSYSFSCQ+S 
Sbjct  249   TSYFKAKYAAERYQIFQFALCPFSLGGSTLTVHPYNFHLFPRDDFKLGMPSYSFSCQASR  308

Query  1496  LISIAREGFDFNACINDGISYLSRAQELAAKDCIRSP-SAGSCTVPSPASRSVADSIFIN  1320
             L ++AR+GFDFN CI  GISYLSRAQE A+K    +P    + TVPS +  +VAD++F+ 
Sbjct  309   LTAMARQGFDFNTCIYQGISYLSRAQESASKFLSGNPILPDAITVPS-SPPTVADTVFVA  367

Query  1319  RIKSRVKHWRNACTDQSKKTEDV-----LISSLRKMISATEVHGSRPCLNIDICS  1170
             RI+SRVK+WR +C D S +TED      L+SSLRK++  +E +GSR CL ID+CS
Sbjct  368   RIRSRVKNWRQSCLDTSSRTEDGALANDLVSSLRKLVLGSEQYGSRLCLTIDVCS  422


 Score =   268 bits (686),  Expect(2) = 4e-144, Method: Compositional matrix adjust.
 Identities = 146/315 (46%), Positives = 208/315 (66%), Gaps = 14/315 (4%)
 Frame = -1

Query  1131  GTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLNDF  952
             GTQ VR V  SS+ED  L ++ELQ +EN+ N+ VRGFREV+DLIS SQKPVV+ N L+DF
Sbjct  451   GTQAVRAVFMSSKEDMDLFKRELQGLENEENRRVRGFREVIDLISASQKPVVSQNYLSDF  510

Query  951   TSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSRFF  772
             TSIH+KFL PLPS +D+F  SL   FP ++D+   MKE+    N++N+  A S LN RFF
Sbjct  511   TSIHAKFLGPLPSNVDDFNSSLSSAFPDVVDLSQFMKEISPLSNISNLPAAMSSLN-RFF  569

Query  771   APVDVELPHQAISTKADSV-KSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPA  595
             APVDVE+ +Q    K +   +SHG N + IS+LFAK+C+I K DP + ++ E    L  +
Sbjct  570   APVDVEVANQGCPIKLNEDHQSHGQNAVMISQLFAKLCTIQKSDPSSAQSNEDFQAL--S  627

Query  594   LERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLVY  415
              + +A+    C+ +  D      +VRV +K+ +RVSS N+V +WG    ++   +K+++ 
Sbjct  628   SDEHADFVTSCARNAGD-----ANVRVWSKNSRRVSSDNLVLIWGLAKKMTAAMLKNVLQ  682

Query  414   GKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDS-----GSLEEMVSEGIRAASY  250
               H VF+ EFD++ +D SCA+LVF   G SE  L A+++     GSL EMV+EG+RAA Y
Sbjct  683   QAHPVFAQEFDVKFLDRSCAILVFWESGSSETFLTAINNEEQLGGSLREMVAEGLRAAGY  742

Query  249   DAYVKVCKLGLWKAN  205
             D Y + C+LG W+A+
Sbjct  743   DTYKRACRLGFWEAD  757



>emb|CDY00839.1| BnaCnng00390D [Brassica napus]
Length=616

 Score =   280 bits (716),  Expect(2) = 8e-144, Method: Compositional matrix adjust.
 Identities = 142/249 (57%), Positives = 178/249 (71%), Gaps = 9/249 (4%)
 Frame = -2

Query  1910  LQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQT  1731
             +QRR        +A   NS   N  +W +KQVTKSNF  +L++  T I  SDF+A+SLQ 
Sbjct  7     MQRRFL------SASAGNSKTLNNRRWSVKQVTKSNFKSSLDEFRTSIESSDFVALSLQN  60

Query  1730  TGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFPR  1551
             TG+Y++ W R+   DT + +YLKAK AAERYQI QFA+CPFSLR SKL   PYNF+LFPR
Sbjct  61    TGSYAAAWHRVSAIDTPQTSYLKAKYAAERYQIFQFALCPFSLRGSKLTVHPYNFYLFPR  120

Query  1550  DELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSP-SAGS  1374
             DELK GMPSYSFSCQ+S L ++AREGFDFN CI +GISYLSR QE A+K    +P     
Sbjct  121   DELKLGMPSYSFSCQASRLTAMAREGFDFNTCIYEGISYLSREQESASKFLSGNPILPDP  180

Query  1373  CTVPSPASRSVADSIFINRIKSRVKHWRNACTDQSKKT-EDVLISSLRKMISATEVHGSR  1197
              TVPS  S +VAD++F+ RI+SRVK WR +C D S KT +D L+SSLRK++  +E +GSR
Sbjct  181   ITVPSSPS-TVADTVFVGRIRSRVKSWRQSCIDSSSKTGDDDLVSSLRKLVLGSEQYGSR  239

Query  1196  PCLNIDICS  1170
              CL ID+CS
Sbjct  240   LCLTIDVCS  248


 Score =   260 bits (665),  Expect(2) = 8e-144, Method: Compositional matrix adjust.
 Identities = 158/360 (44%), Positives = 224/360 (62%), Gaps = 30/360 (8%)
 Frame = -1

Query  1131  GTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLNDF  952
             GTQ VR V  SS+EDK L ++ELQ++EN+ N+ VRGFREVVDLIS SQKPVV+ N L+DF
Sbjct  277   GTQAVRTVFMSSKEDKDLFKRELQDLENEENQRVRGFREVVDLISSSQKPVVSQNYLSDF  336

Query  951   TSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSRFF  772
             TSIH+KFL PLPS +D+F  SL   FP+ +D+  LMKE+    N++N+  A S LN RFF
Sbjct  337   TSIHAKFLGPLPSNVDDFSSSLSSAFPNFVDLSQLMKEISPLSNISNLPAAMSSLN-RFF  395

Query  771   APVDVELPHQAISTKAD-SVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPA  595
             APVDVE+ +Q  +   D   + HG NV+ IS+LFAK+ +I K D     + E    L  A
Sbjct  396   APVDVEVANQGCAANPDEGNQMHGQNVVMISQLFAKLSTIQKSDKSPARSNEDLQALDSA  455

Query  594   LERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLVY  415
                +AN              N+E+V+V +K+ +RVSS+N+VF+WG    ++   +K+++ 
Sbjct  456   --EHANSITS----------NDENVKVWSKNSRRVSSENLVFIWGLSKKMTAAMLKNVLQ  503

Query  414   GKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDS-----GSLEEMVSEGIRAASY  250
               H VF+ EFD++ +D SCAV+VF   G SE  L  +++     GSL EMV+EG+R A Y
Sbjct  504   KSHAVFAQEFDVKYLDRSCAVVVFWESGSSETFLREVNNEEQLVGSLREMVAEGLRVAGY  563

Query  249   DAYVKVCKLGLWKANladslelaleeeseclseAHTAKDL----SVIHWNSDEMISLDDL  82
             + Y + C+LG W+A+         E   + L  + T +DL    S I W+S+  I+ D+L
Sbjct  564   ETYRRACRLGFWEAD-------LAEALDKTLESSDTDRDLDTKPSDISWSSELTINFDEL  616



>emb|CDY27893.1| BnaA07g04830D [Brassica napus]
Length=616

 Score =   283 bits (723),  Expect(2) = 1e-143, Method: Compositional matrix adjust.
 Identities = 143/256 (56%), Positives = 185/256 (72%), Gaps = 10/256 (4%)
 Frame = -2

Query  1931  VSILCSMLQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDF  1752
             +S+L  M +R L  +A        NS   N+ +W +KQVTKSNF  +L+++ T I  SDF
Sbjct  1     MSMLLKMQRRFLSASA-------GNSKTLNHRRWSVKQVTKSNFKSSLDELRTSIESSDF  53

Query  1751  IAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPY  1572
             +A+SLQ TG++++ W R+   DT + +YLKAK AAERYQI QFA+CPFSLR SKL   PY
Sbjct  54    VALSLQNTGSHAAAWHRVSAIDTPQTSYLKAKYAAERYQIFQFALCPFSLRGSKLTVHPY  113

Query  1571  NFHLFPRDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIR  1392
             NF+LFPRDELK GMPSYSFSCQ+S L ++AREGFDFN CI +GISYLSR QE A+K    
Sbjct  114   NFYLFPRDELKLGMPSYSFSCQASRLTAMAREGFDFNTCIYEGISYLSREQESASKFLSG  173

Query  1391  SP-SAGSCTVPSPASRSVADSIFINRIKSRVKHWRNACTDQSKKT-EDVLISSLRKMISA  1218
             +P      TVPS  S +VAD++F+ RI+SRVK+WR +C D S KT +D L+SSLRK++  
Sbjct  174   NPILPDPITVPSSPS-TVADTVFVGRIRSRVKNWRQSCIDSSSKTGDDDLVSSLRKLVLG  232

Query  1217  TEVHGSRPCLNIDICS  1170
             +E +GSR CL ID+CS
Sbjct  233   SEQYGSRLCLTIDVCS  248


 Score =   257 bits (657),  Expect(2) = 1e-143, Method: Compositional matrix adjust.
 Identities = 157/356 (44%), Positives = 225/356 (63%), Gaps = 22/356 (6%)
 Frame = -1

Query  1131  GTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLNDF  952
             GTQ VR V  SS+EDK L ++EL+++E + N+ VRGFREVVDLIS SQKPVV+ N L+DF
Sbjct  277   GTQAVRTVFMSSKEDKDLFKRELKDLETEENRRVRGFREVVDLISSSQKPVVSQNYLSDF  336

Query  951   TSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSRFF  772
             TSIH+KFL PLPS +D+F  SL   FP+++D+  LMKE+    N++N+  A S LN RFF
Sbjct  337   TSIHAKFLGPLPSNVDDFSSSLSSAFPNVVDLSQLMKEISPLSNISNLPAAMSSLN-RFF  395

Query  771   APVDVELPHQAISTKADSV-KSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPA  595
             APVDVE+ +Q    K D   + HG NV+ IS+LFAK+ +I K D    ++ E    L  A
Sbjct  396   APVDVEVANQGCVVKPDEGHQMHGQNVVMISQLFAKLSTIQKSDKSPAQSNEDLQALDSA  455

Query  594   LERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLVY  415
                +AN              N+E+V+V +K+ +RVSS+N+VF+WG    ++   +K+++ 
Sbjct  456   --EHANSITS----------NDENVKVWSKNSRRVSSENLVFIWGVSKKMTAAMLKNVLQ  503

Query  414   GKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDS-----GSLEEMVSEGIRAASY  250
               H VF+ EFD++ +D SCAV+VF   G SE  L  +++     GSL EM +EG+R A Y
Sbjct  504   KSHAVFAREFDVKYLDRSCAVVVFWESGSSETFLREVNNEEQLVGSLREMAAEGLRVAGY  563

Query  249   DAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
             + Y + C+LG W+A LA++L+  LE     L       D+S   W+S+  I+ D+L
Sbjct  564   ETYRRACRLGFWEAELAEALDKTLESSDTDLDSDTKPSDIS---WSSELTINFDEL  616



>ref|XP_010488642.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Camelina 
sativa]
Length=615

 Score =   284 bits (726),  Expect(2) = 2e-143, Method: Compositional matrix adjust.
 Identities = 145/249 (58%), Positives = 182/249 (73%), Gaps = 5/249 (2%)
 Frame = -2

Query  1910  LQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQT  1731
             +QRR F ++I  TA   NS   N G+W +KQV KSNF   L+ I   I  SDFIA+SLQ 
Sbjct  1     MQRR-FLSSICATA--GNSKTLNQGRWSVKQVKKSNFHVTLDKIRASIDSSDFIALSLQN  57

Query  1730  TGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFPR  1551
             TG+Y++ W R+   DT + +YLKAK AAERYQILQFA+CPFSL+ SKL   PYNFHLFPR
Sbjct  58    TGSYAAAWHRVSAIDTPQTSYLKAKYAAERYQILQFALCPFSLQGSKLTVHPYNFHLFPR  117

Query  1550  DELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSP-SAGS  1374
             DELK GMPSYSFSCQ+S L S+AREGFDFN CI +GISYLSRAQE A+K    +P  A  
Sbjct  118   DELKCGMPSYSFSCQASRLTSMAREGFDFNTCIYEGISYLSRAQESASKFLSGNPILADP  177

Query  1373  CTVPSPASRSVADSIFINRIKSRVKHWRNACTDQSKKT-EDVLISSLRKMISATEVHGSR  1197
               V S +  +VAD++F+ RI+SRVK+WR +C + S KT +D L+SSLR+++  +E +GSR
Sbjct  178   IAVSSSSPATVADTVFVGRIRSRVKNWRKSCVESSIKTGDDDLVSSLRRLVLGSEQYGSR  237

Query  1196  PCLNIDICS  1170
              CL ID+CS
Sbjct  238   LCLTIDVCS  246


 Score =   255 bits (651),  Expect(2) = 2e-143, Method: Compositional matrix adjust.
 Identities = 144/315 (46%), Positives = 210/315 (67%), Gaps = 18/315 (6%)
 Frame = -1

Query  1131  GTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLNDF  952
             GTQ VR V  SS+EDK L ++ELQ++ENK N+ VRGFREV+DLIS SQKP+++ N L+D 
Sbjct  275   GTQAVRTVFMSSKEDKDLFKRELQDLENKENRRVRGFREVIDLISSSQKPIISQNYLSDL  334

Query  951   TSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSRFF  772
             TSIH+KFL PLP+ +D+F  SL   FP+++D+   MKE+    N++N+  A S LN RFF
Sbjct  335   TSIHAKFLGPLPANVDDFSSSLSSAFPNVVDLSQFMKEISPLSNISNLPAAMSSLN-RFF  393

Query  771   APVDVELPHQAISTK-ADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPA  595
             APVDVE+ +Q    K ++S +SHG N + IS+LFAK+ +I K D     + E    L  A
Sbjct  394   APVDVEVANQGSPVKLSESYQSHGQNAVMISQLFAKLRTIQKSDL----STEDFQAL--A  447

Query  594   LERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLVY  415
              + + +    CS +  D     E+V+V +K+ +RVSS+N+VF+WG    ++   +K+ + 
Sbjct  448   SDEHESSITSCSKNAGD-----ENVKVWSKNSRRVSSENLVFIWGLAKKMTAANLKNALQ  502

Query  414   GKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDS-----GSLEEMVSEGIRAASY  250
               H VF+ EFD++ +D+SCA++VF   G SE  L A+++     GSL EMV+EG+RAA Y
Sbjct  503   KSHPVFAQEFDVKYLDKSCAIVVFWESGPSETFLSAVNNEEQLCGSLREMVAEGLRAAGY  562

Query  249   DAYVKVCKLGLWKAN  205
             + Y K C+LG W+A+
Sbjct  563   ETYKKACRLGFWEAD  577



>ref|XP_010514159.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Camelina 
sativa]
Length=619

 Score =   282 bits (721),  Expect(2) = 3e-143, Method: Compositional matrix adjust.
 Identities = 143/249 (57%), Positives = 181/249 (73%), Gaps = 5/249 (2%)
 Frame = -2

Query  1910  LQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQT  1731
             +QRR F ++IS TA   NS   N G+W +KQV KSNF   L+ I   I  SDFIA+SLQ 
Sbjct  1     MQRR-FLSSISATA--GNSKTLNQGRWSVKQVKKSNFHVTLDKIRASIDSSDFIALSLQN  57

Query  1730  TGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFPR  1551
             TG+Y++ W R+   DT + +YLKAK  AERYQILQFA+CPFSL  +KL   PYNFHLFPR
Sbjct  58    TGSYTAAWHRVSAIDTPQTSYLKAKYTAERYQILQFALCPFSLHGTKLTVHPYNFHLFPR  117

Query  1550  DELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSP-SAGS  1374
             DELK GMPSY FSCQ+S L ++AREGFDFN CI +GISYLSRAQE A+K    +P  A  
Sbjct  118   DELKCGMPSYRFSCQASRLTAMAREGFDFNTCIYEGISYLSRAQESASKFLSGNPILADP  177

Query  1373  CTVPSPASRSVADSIFINRIKSRVKHWRNACTDQSKKT-EDVLISSLRKMISATEVHGSR  1197
              TV S +  +VAD++F+ RI+SRVK+WR +C + S KT +D L+SSLR+++  +E +GSR
Sbjct  178   ITVSSSSPATVADTVFVGRIRSRVKNWRKSCVESSIKTGDDDLVSSLRRLVLGSEQYGSR  237

Query  1196  PCLNIDICS  1170
              CL ID+CS
Sbjct  238   LCLTIDVCS  246


 Score =   256 bits (654),  Expect(2) = 3e-143, Method: Compositional matrix adjust.
 Identities = 157/356 (44%), Positives = 230/356 (65%), Gaps = 17/356 (5%)
 Frame = -1

Query  1131  GTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLNDF  952
             GTQ VR V  SS+EDK L ++ELQ++ENK N+ VRGFREVVDLIS SQKPV++ N L+D 
Sbjct  275   GTQAVRTVFMSSKEDKDLFKRELQDLENKENRRVRGFREVVDLISSSQKPVISKNYLSDL  334

Query  951   TSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSRFF  772
             TSIH+KFL PLP+ +D+F  SL   FP+++D+   MKE+    N++N+  A S LN RFF
Sbjct  335   TSIHAKFLGPLPANVDDFSSSLSSAFPNVVDLSQFMKEISPLSNISNLPAAMSSLN-RFF  393

Query  771   APVDVELPHQAISTK-ADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPA  595
             APVDVE+ ++    K +++ +SHG N + IS+LFAK+ +I K D    +  E    L  A
Sbjct  394   APVDVEVANEGCPVKLSENYQSHGQNAVMISQLFAKLRTIRKSDLPTVQPNEDFQDL--A  451

Query  594   LERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLVY  415
              + + +    CS +  D     E+V+V +K+ +RVSS+N+VF+WG    ++   +K+ + 
Sbjct  452   SDEHESSVASCSKNADD-----ENVKVWSKNSRRVSSENLVFIWGLAKKMTAANLKNALQ  506

Query  414   GKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDS-----GSLEEMVSEGIRAASY  250
               H VF+ EFD++ +D+SCA++VF   G SE  L+A+++     GSL+EMV+EG+RAA Y
Sbjct  507   KSHPVFAQEFDVKYLDKSCAIVVFWESGPSETFLKAVNNEEQLCGSLKEMVAEGLRAAGY  566

Query  249   DAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
               Y K C+LG W+A+LA+SL+  LE               S I W++D  I+ D+L
Sbjct  567   KTYKKACRLGFWEADLAESLDKTLESSDTDPDSDTKP---SEIDWSNDLAINFDEL  619



>ref|XP_009102413.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Brassica 
rapa]
Length=616

 Score =   279 bits (714),  Expect(2) = 1e-142, Method: Compositional matrix adjust.
 Identities = 142/256 (55%), Positives = 184/256 (72%), Gaps = 10/256 (4%)
 Frame = -2

Query  1931  VSILCSMLQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDF  1752
             +S+L  M +R L  +A        NS   N+ +W +KQVTKSNF  +L++  + I  SDF
Sbjct  1     MSMLLKMQRRFLSASA-------GNSKTLNHRRWSVKQVTKSNFKSSLDEFRSSIESSDF  53

Query  1751  IAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPY  1572
             +A+SLQ TG++++ W R+   DT + +YLKAK AAERYQI QFA+CPFSLR SKL   PY
Sbjct  54    VALSLQNTGSHAAAWHRVSAIDTPQTSYLKAKYAAERYQIFQFALCPFSLRGSKLTLHPY  113

Query  1571  NFHLFPRDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIR  1392
             NF+LFPRDELK GMPSYSFSCQ+S L ++AREGFDFN CI +GISYLSR QE A+K    
Sbjct  114   NFYLFPRDELKLGMPSYSFSCQASRLTAMAREGFDFNTCIYEGISYLSREQESASKFLSG  173

Query  1391  SP-SAGSCTVPSPASRSVADSIFINRIKSRVKHWRNACTDQSKKT-EDVLISSLRKMISA  1218
             +P      TVPS  S +VAD++F+ RI+SRVK+WR +C D S KT +D L+SSLRK++  
Sbjct  174   NPILPDPITVPSSPS-TVADTVFVGRIRSRVKNWRQSCIDSSSKTGDDDLVSSLRKLVLG  232

Query  1217  TEVHGSRPCLNIDICS  1170
             +E +GSR CL ID+CS
Sbjct  233   SEQYGSRLCLTIDVCS  248


 Score =   257 bits (656),  Expect(2) = 1e-142, Method: Compositional matrix adjust.
 Identities = 160/356 (45%), Positives = 224/356 (63%), Gaps = 22/356 (6%)
 Frame = -1

Query  1131  GTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLNDF  952
             GTQ VR V  SS+EDK L +KELQ++EN+ N+ VRGFREVVDLIS SQKPVV+ N L+DF
Sbjct  277   GTQAVRTVFMSSKEDKDLFKKELQDLENEENRRVRGFREVVDLISSSQKPVVSQNYLSDF  336

Query  951   TSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSRFF  772
             TSIH+KFL PLPS +D+F  SL   FP ++D+  LMKE+    N++N+  A S LN RFF
Sbjct  337   TSIHAKFLGPLPSNVDDFSSSLSPAFPKVVDLSQLMKEISPLSNISNLPAAMSSLN-RFF  395

Query  771   APVDVELPHQAISTKADSV-KSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPA  595
             APVDVE+ +Q    K D   + HG NV+ IS+LFAK+ +I K D    ++ E    L  A
Sbjct  396   APVDVEVANQGCVVKPDEGHQMHGQNVVMISQLFAKLSTIQKSDKSPAQSNEDLQALDSA  455

Query  594   LERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLVY  415
                +AN              N+E+V+V +K+  RVSS+N+VF+WG    ++   +K+++ 
Sbjct  456   --EHANSITS----------NDENVKVWSKNSGRVSSENLVFIWGVSKKMTAAMLKNVLQ  503

Query  414   GKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDS-----GSLEEMVSEGIRAASY  250
               H VF+ EFD++ +D SCAV+VF   G SE  L  +++     GSL EM +EG+R A Y
Sbjct  504   KSHAVFAREFDVKYLDRSCAVVVFWESGSSETFLREVNNEEQLVGSLREMAAEGLRVAGY  563

Query  249   DAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
             + Y + C+LG W+A LA++L+  LE     L       D+S   W+S+  I+ D+L
Sbjct  564   ETYRRACRLGFWEAELAEALDKTLESSDTDLDSDTKPSDIS---WSSELTINFDEL  616



>ref|XP_009415962.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Musa acuminata 
subsp. malaccensis]
Length=609

 Score =   266 bits (680),  Expect(2) = 3e-141, Method: Compositional matrix adjust.
 Identities = 133/236 (56%), Positives = 169/236 (72%), Gaps = 9/236 (4%)
 Frame = -2

Query  1856  SGGSNYGKWG--IKQVTKSNFSEALNDIETRITESDFIAVSLQTTG-----AYSSPWQRL  1698
             + GS   +W   +KQVTKSNF+ AL  + T +  +DF+A+S + TG     +   PW R+
Sbjct  2     AAGSGKQRWAGAVKQVTKSNFAAALQQLRTDVDSADFVAISCRKTGDSVASSRRHPWHRV  61

Query  1697  LPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFPRDELKTGMPSYS  1518
             LP DT E+AYLKA+ AAE Y+ILQFAVCPF LR  K++A PYNFHLFPRDE+    PSYS
Sbjct  62    LPIDTPEVAYLKARLAAESYEILQFAVCPFRLRGYKVLAYPYNFHLFPRDEINLVAPSYS  121

Query  1517  FSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSVA  1338
             FSCQ+S+L S+A+EGFDFNACI DGISYLSR QE   K+  R+P      V S +S SVA
Sbjct  122   FSCQTSFLTSMAQEGFDFNACIYDGISYLSRVQESIVKE--RNPIPQIQPVSSFSSLSVA  179

Query  1337  DSIFINRIKSRVKHWRNACTDQSKKTEDVLISSLRKMISATEVHGSRPCLNIDICS  1170
             DSIF++RIKSRV HW N C + S   ++ LI SLRK+IS TE++GSRP ++I +CS
Sbjct  180   DSIFMSRIKSRVVHWWNVCKESSNTIDEDLIKSLRKLISGTELYGSRPSMSISVCS  235


 Score =   266 bits (679),  Expect(2) = 3e-141, Method: Compositional matrix adjust.
 Identities = 159/360 (44%), Positives = 224/360 (62%), Gaps = 22/360 (6%)
 Frame = -1

Query  1134  GGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLND  955
             GG + VR+VLTSS+EDK LL  E+Q +EN+ N  VRGFREV+D+IS S KPV+ +N L+D
Sbjct  263   GGPKAVRIVLTSSEEDKNLLMTEIQNLENEQNLRVRGFREVIDVISSSNKPVIGYNCLHD  322

Query  954   FTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSRF  775
             FT IHSKF+APLP TL EF  SL  VF +I+D+ HL KE+G  +   N+    SYL  +F
Sbjct  323   FTFIHSKFIAPLPPTLFEFMCSLRLVFTNIIDINHLSKEIGPLRKAKNLPATLSYLKRQF  382

Query  774   FAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPA  595
             F P+D+ELP +A   K++    HG+NVL+I+ LFA + ++LK++P         GQLP  
Sbjct  383   FMPIDIELPPKAAEEKSNKAI-HGNNVLQITYLFAALSALLKLNPD--------GQLPQG  433

Query  594   -----LERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQV  430
                  +E Y+NIF P  TS Q+P   ++++    +  K+ S+ N+VFLWGF   IS+ ++
Sbjct  434   QNIMPIEDYSNIFYPICTSLQEP---DDELNYLMEHAKKSSTGNLVFLWGFSHLISSKEL  490

Query  429   KSLVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDSGSL----EEMVSEGIR  262
             K  +   HEVF+ +F+++L+DE+CA +VFS  GL+E LL  + SG          + G+R
Sbjct  491   KRELQQIHEVFTEDFELQLMDETCAAVVFSRSGLAEALLMEMGSGKFCSDALSTKTSGLR  550

Query  261   AASYDAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
             AA YDAY KVC  GLW+A         +   S     A + KD S ++W S+  I L DL
Sbjct  551   AAGYDAYRKVCMSGLWEA-YLADSLENILSGSTNSLSASSEKDSSEVYWRSESTIDLSDL  609



>ref|XP_010069588.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X2 
[Eucalyptus grandis]
 gb|KCW57979.1| hypothetical protein EUGRSUZ_H00715 [Eucalyptus grandis]
Length=615

 Score =   278 bits (712),  Expect(2) = 6e-141, Method: Compositional matrix adjust.
 Identities = 170/359 (47%), Positives = 232/359 (65%), Gaps = 17/359 (5%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             A G G   VRV+LTSS+EDK LLE+EL+ +E++  K  +GFREV++LIS +QKP+V+HNS
Sbjct  269   AKGAGAWAVRVILTSSKEDKILLEQELRNLEHEQTKAFQGFREVIELISAAQKPIVSHNS  328

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             LNDF SI+  FLAPLPST+DEF  SL  VFP + DV HLMKE+       +I  A S+LN
Sbjct  329   LNDFASIYPMFLAPLPSTVDEFLQSLCLVFPQVFDVNHLMKEIAPLGKTTDIPTALSFLN  388

Query  783   SRFFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCG-Q  607
             +RF AP+DVE+            K HG NV++I  LFAK+CSIL+    A E+ +  G  
Sbjct  389   NRFVAPIDVEVS----PVTGCEGKIHGLNVVRICHLFAKLCSILR---SASESSKSDGNH  441

Query  606   LPPALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVK  427
                 LER+ANI+ P  ++  DPP  EE + +     +RV+ K+VVFLWGF+ G+S   +K
Sbjct  442   QAGTLERFANIYRPWPSA--DPP--EESISIWRNDTRRVNCKDVVFLWGFRKGLSAKLLK  497

Query  426   SLVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALD----SGSLEEMVSEGIRA  259
             S + G HEVFS  FD+RLVD+SCA+++F  PGLSE LL  ++    SG L ++VSEG++A
Sbjct  498   SQLQGSHEVFSENFDVRLVDKSCAIVIFWQPGLSETLLSIMNSSDISGPLWDLVSEGLKA  557

Query  258   ASYDAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
             A Y  YVK+C LGL++A+             +  SE H+ +    I  +S+ MI L+DL
Sbjct  558   AGYGMYVKLCGLGLFEAD-LADAFDCNFANHDDYSEDHSMRKNYEIQSSSESMIYLEDL  615


 Score =   252 bits (644),  Expect(2) = 6e-141, Method: Compositional matrix adjust.
 Identities = 122/244 (50%), Positives = 164/244 (67%), Gaps = 7/244 (3%)
 Frame = -2

Query  1901  RLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGA  1722
             R FCT  S          ++  KW + QV KSNF+++L  +   ++ +DF+AVSL+ TG 
Sbjct  8     RRFCTNTS-------GASASARKWSVAQVFKSNFADSLERLRAHVSGADFVAVSLRRTGW  60

Query  1721  YSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFPRDEL  1542
              S+PW R+   DT E AY KA+ AAE++Q+LQFAVCPF +  +K++A PYNFHLFPRDEL
Sbjct  61    PSAPWHRVSRLDTLETAYAKARHAAEKFQVLQFAVCPFEVGPTKVVAHPYNFHLFPRDEL  120

Query  1541  KTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVP  1362
                 PSYSF CQSS+L S+  EGFDFNACI DGISYLSR QE  AK     P  G     
Sbjct  121   DIKRPSYSFVCQSSHLASMVDEGFDFNACIYDGISYLSREQECLAKVWKGIPVHGQYLEK  180

Query  1361  SPASRSVADSIFINRIKSRVKHWRNACTDQSKKTEDVLISSLRKMISATEVHGSRPCLNI  1182
             S +S SVAD++F+ RI+SR+K W+NA  D S + ++  + S+RK+I  +E +GSRP + +
Sbjct  181   SSSSPSVADAVFLERIRSRIKQWKNAFEDSSTRNDEPFVRSMRKLILGSEEYGSRPSMTL  240

Query  1181  DICS  1170
             D+CS
Sbjct  241   DVCS  244



>ref|XP_008451634.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Cucumis melo]
Length=595

 Score =   265 bits (677),  Expect(2) = 4e-139, Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 173/249 (69%), Gaps = 17/249 (7%)
 Frame = -2

Query  1910  LQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQT  1731
             L RRL+ T   +              W IKQV  SNF   L D++  I++SDFIA+SLQ 
Sbjct  10    LHRRLYTTTTDQ--------------WSIKQVRNSNFHSCLGDLKNHISDSDFIALSLQR  55

Query  1730  TGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFPR  1551
             TG+ S PW R  PFDT + AY KAK AAE++QILQF++CPFS+R+SKLIA PYNFHLFPR
Sbjct  56    TGSSSFPWHRPQPFDTLDTAYCKAKYAAEKFQILQFSLCPFSVRDSKLIAHPYNFHLFPR  115

Query  1550  DELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCI--RSPSAG  1377
             DEL  GMPSYSFSCQ S+L SIAREGFDF A + DGISYLSRAQE  AK  +  ++ +  
Sbjct  116   DELNIGMPSYSFSCQVSHLTSIAREGFDFGAWVYDGISYLSRAQESIAKAQMGCQTLTPN  175

Query  1376  SCTVPSPASRSVADSIFINRIKSRVKHWRNACTDQSKKTEDVLISSLRKMISATEVHGSR  1197
             +  V S +  SV D+IF+ R+KSRVK+W++A  D S KT D L+S+L+K+I   E +GSR
Sbjct  176   TDAVKSSSEPSVFDTIFVQRVKSRVKNWKDA-YDSSSKTNDALLSTLKKLIVGIEQYGSR  234

Query  1196  PCLNIDICS  1170
             P + ID+ S
Sbjct  235   PSIVIDVYS  243


 Score =   259 bits (663),  Expect(2) = 4e-139, Method: Compositional matrix adjust.
 Identities = 143/328 (44%), Positives = 218/328 (66%), Gaps = 19/328 (6%)
 Frame = -1

Query  1050  NKHNKCVRGFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFP  871
             ++ NK  RGFREV+++IS SQKP+V+++SL+DFT IHSKFLAPLP+++DEF  SL  VFP
Sbjct  282   DEENKKFRGFREVIEMISASQKPIVSYSSLHDFTFIHSKFLAPLPTSIDEFASSLHLVFP  341

Query  870   HILDVKHLMKELGSQKNLNNIYVATSYLNSRFFAPVDVELPHQAISTKADSVKSHGHNVL  691
              +L+VKHLM ++G      +I  A SYL   ++AP  +++P   I    +  K  GHN +
Sbjct  342   RVLEVKHLMSKIGGLSKPMSIAAALSYLKKHYYAPTYLDIP---IEAPGNDHKPQGHNAI  398

Query  690   KISELFAKVCSILKVDPKAPEAIEH-CGQLPPALERYANIFDPCSTSYQDPPINEEDVRV  514
             ++  LFAKVCS+LK+D    ++  + C  L   LE+ +N+    S  + +P   +EDV++
Sbjct  399   RLCHLFAKVCSLLKIDLSGVQSNNNEC--LASMLEKCSNVSSSFSPYHHEP--KDEDVKI  454

Query  513   RAKSCKRVSSKNVVFLWGFQSGISTGQVKSLVYGKHEVFSSEFDIRLVDESCAVLVFSSP  334
              A+  ++ S +++VFLWGF+ G++   +K+ + G HEVF  EF +R VD+ CA++VFS P
Sbjct  455   WARDVRKASCRHLVFLWGFREGMTAPLLKASLEGSHEVFCEEFYVRFVDKKCAIIVFSQP  514

Query  333   GLSEVLLEALDS----GSLEEMVSEGIRAASYDAYVKVCKLGLWKANladslelaleees  166
             GLSE  L+A++S    GSL EMVSEG+RA  Y+ Y ++C+  LW+A+LA+SLE A+ E  
Sbjct  515   GLSETFLDAINSDCIVGSLREMVSEGLRATGYETYKRMCRFDLWEADLAESLERAIFEAD  574

Query  165   eclseAHTAKDLSVIHWNSDEMISLDDL  82
                ++         I++++D +ISLDDL
Sbjct  575   PETAQLD-------INYSNDTVISLDDL  595



>ref|XP_008799184.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X1 
[Phoenix dactylifera]
Length=609

 Score =   265 bits (677),  Expect(2) = 2e-138, Method: Compositional matrix adjust.
 Identities = 138/234 (59%), Positives = 167/234 (71%), Gaps = 11/234 (5%)
 Frame = -2

Query  1847  SNYGKWG--IKQVTKSNFSEALNDIETRITESDFIAVSLQTTG------AYSSPWQRLLP  1692
             S   +WG  +KQ+TKSNFS AL  I+  I ++DFIAVS Q TG      ++  PW+R+LP
Sbjct  5     SGKHRWGGAVKQITKSNFSAALQQIKVHIQDADFIAVSSQKTGDLAASSSHRYPWRRILP  64

Query  1691  FDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFPRDELKTGMPSYSFS  1512
              D AE AYLKAK AAE +++LQFAVCPF  + SK++A PYNFHLFPRDEL  GMPSYSFS
Sbjct  65    IDIAETAYLKAKLAAETFELLQFAVCPFRFQGSKVVAFPYNFHLFPRDELNLGMPSYSFS  124

Query  1511  CQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSVADS  1332
             CQ+S+L S+AREGFDFN  I DGISYLSRAQE  AK+     +    +  S  S SVADS
Sbjct  125   CQTSFLASMAREGFDFNVSIYDGISYLSRAQESIAKE---RTTPRVYSSSSSPSPSVADS  181

Query  1331  IFINRIKSRVKHWRNACTDQSKKTEDVLISSLRKMISATEVHGSRPCLNIDICS  1170
             IFI RIKSRV++WRNAC D     +  L  SLRK+I   EV+GSRP L+ID+CS
Sbjct  182   IFIGRIKSRVENWRNACKDPCNMADGSLAKSLRKLILGGEVYGSRPSLSIDVCS  235


 Score =   257 bits (657),  Expect(2) = 2e-138, Method: Compositional matrix adjust.
 Identities = 164/356 (46%), Positives = 243/356 (68%), Gaps = 14/356 (4%)
 Frame = -1

Query  1134  GGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLND  955
             GG + VRVVLTSS+EDK LL  E+Q +E + N  VRGFREV+DLIS S+KP++A+N L+D
Sbjct  263   GGAKSVRVVLTSSEEDKNLLMSEIQNLEEEQNLKVRGFREVIDLISSSKKPIIAYNCLHD  322

Query  954   FTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSRF  775
             FT IHSKF++PL  +L+EF  SL  VF +I+DV HL+KE+G  +   N+  A SYL  +F
Sbjct  323   FTFIHSKFISPLQPSLNEFMCSLRLVFSNIVDVSHLLKEIGPLRKARNLPAALSYLKRQF  382

Query  774   FAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPA  595
             F P+DVE+P  A     +S  +HGHNVLK++ +FAK+  +LK+ P    ++   GQ    
Sbjct  383   FVPIDVEIPQLA---DGNSNNNHGHNVLKLTRVFAKLGILLKIVPDCQTSL---GQHTVP  436

Query  594   LERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLVY  415
             +E YANIF P S S Q+     +DV     + +++S+ ++VF+WGF+ G S  ++K+ + 
Sbjct  437   IEEYANIFYPISNSLQES--EADDVDFHMDNVRKISTDDLVFIWGFREGTSAAELKNHLR  494

Query  414   GKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDSG-----SLEEMVSEGIRAASY  250
               H VFS + +++LVD++CAV+VF   G +E LL+ + SG     +  +++SEG++AA Y
Sbjct  495   QTHSVFSEDIELQLVDKTCAVVVFQKSGSAEALLKEIGSGMTNSTAPSKIISEGLKAAGY  554

Query  249   DAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
             +AY KVC+LG+W+A LADSL+ AL E S  L+ + + +D S I+W+S+ MI L+DL
Sbjct  555   EAYKKVCRLGMWEAELADSLDCALSEPSGDLTIS-SGEDASEIYWSSESMIDLNDL  609



>ref|XP_002883605.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59864.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1055

 Score =   288 bits (737),  Expect(2) = 1e-137, Method: Compositional matrix adjust.
 Identities = 143/248 (58%), Positives = 181/248 (73%), Gaps = 4/248 (2%)
 Frame = -2

Query  1910  LQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQT  1731
             +QRR F ++IS TA   N+   N G+W +KQV KSNF   L++I T I  SDFIA+SLQ 
Sbjct  1     MQRR-FLSSISATA--GNTKTLNQGRWSVKQVKKSNFHVTLDEIRTSIDSSDFIALSLQN  57

Query  1730  TGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFPR  1551
             TG+Y++ W R+   DT + +YLKAK AAERYQILQFA+CPFSL  SKL   PYNFHLFPR
Sbjct  58    TGSYAAAWHRVSAIDTPQTSYLKAKYAAERYQILQFALCPFSLHGSKLTVHPYNFHLFPR  117

Query  1550  DELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAGSC  1371
             DELK GMPSYSFSCQ+S L ++AREGFDFN CI +GISYLSRAQE A+K    +P     
Sbjct  118   DELKCGMPSYSFSCQASRLTAMAREGFDFNTCIYEGISYLSRAQESASKFLSGNPILADH  177

Query  1370  TVPSPASRSVADSIFINRIKSRVKHWRNACTDQSKKT-EDVLISSLRKMISATEVHGSRP  1194
                S +  +VAD++F+ RI+SRVK+WR +C D   KT +D L+SSLR+++  +E +GSR 
Sbjct  178   ITVSSSPATVADTVFVGRIRSRVKNWRQSCIDSGSKTGDDDLVSSLRRLVLGSEQYGSRL  237

Query  1193  CLNIDICS  1170
             CL ID+CS
Sbjct  238   CLTIDVCS  245


 Score =   231 bits (590),  Expect(2) = 1e-137, Method: Compositional matrix adjust.
 Identities = 139/316 (44%), Positives = 198/316 (63%), Gaps = 26/316 (8%)
 Frame = -1

Query  1131  GTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLNDF  952
             GTQ VR V  SS+EDK L ++ELQ++E + N+ VRGFREVVDLIS SQKPVV+ N L+DF
Sbjct  274   GTQAVRTVFMSSKEDKDLFKRELQDLEKEENRRVRGFREVVDLISSSQKPVVSQNYLSDF  333

Query  951   TSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSRFF  772
             TSIH+KFL PLPS LD+F  SL   FP+++D+   MKE+    N++N+  A S LN RFF
Sbjct  334   TSIHAKFLGPLPSNLDDFSSSLSSAFPNVVDLSQFMKEISPLSNISNLPAAMSSLN-RFF  392

Query  771   APVDVELPHQAISTKADSV-KSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPA  595
              PVDVE+ +Q    K +   +SHG N + IS+LFAK+C+I K D    ++ E    L  A
Sbjct  393   VPVDVEVANQGCPVKLNEGHQSHGQNAVMISQLFAKLCTIQKSDQSTVQSNEDFQAL--A  450

Query  594   LERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLVY  415
              + +AN    CS +  D     E+ ++R           +  +WG    ++  ++K+++ 
Sbjct  451   SDEHANSVTSCSKNAGD-----ENSKLR----------ELGVIWGLAKKMTAAKLKNVLQ  495

Query  414   GKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLL------EALDSGSLEEMVSEGIRAAS  253
               H VF+ EFD++ +D SCA++VF   G SE  L      E LD GSL EMV++G+RA+ 
Sbjct  496   KSHPVFAQEFDVKYLDRSCAIVVFWESGPSETFLSVVNNEEQLD-GSLREMVAQGLRASG  554

Query  252   YDAYVKVCKLGLWKAN  205
             Y+ Y + C+LG W+A+
Sbjct  555   YETYKRACRLGFWEAD  570



>ref|XP_002444414.1| hypothetical protein SORBIDRAFT_07g021600 [Sorghum bicolor]
 gb|EES13909.1| hypothetical protein SORBIDRAFT_07g021600 [Sorghum bicolor]
Length=599

 Score =   252 bits (643),  Expect(2) = 8e-125, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 161/221 (73%), Gaps = 6/221 (3%)
 Frame = -2

Query  1823  KQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAE  1644
             KQVT+ NF+EA+ ++   +   D++AV+ Q TGA  + W+R LP DTAE AYLKAK AAE
Sbjct  12    KQVTRQNFAEAVRELRAHLEACDYVAVAAQKTGA-PTGWRRALPVDTAETAYLKAKLAAE  70

Query  1643  RYQILQFAVCPFSLRESK---LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
              +Q LQFAVCPF LR S    L+A PYNFHLFPRDEL+ GMPSYSFSCQSSYL ++A +G
Sbjct  71    SFQPLQFAVCPFRLRSSSPSTLVAYPYNFHLFPRDELQLGMPSYSFSCQSSYLSTMANDG  130

Query  1472  FDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSVADSIFINRIKSRVKHW  1293
             FDFN CI DGISYLSR QE  A+  I + S     +PSP S SV+DS+F+NRIKS++ HW
Sbjct  131   FDFNMCIYDGISYLSRVQESLARQKIFT-SRPQQLLPSP-STSVSDSVFVNRIKSKILHW  188

Query  1292  RNACTDQSKKTEDVLISSLRKMISATEVHGSRPCLNIDICS  1170
             R    D SKK +  L+SSL ++I   E +GSRP ++ID+CS
Sbjct  189   RKGYADPSKKDDGSLVSSLSRLILGGETYGSRPSMSIDVCS  229


 Score =   225 bits (573),  Expect(2) = 8e-125, Method: Compositional matrix adjust.
 Identities = 122/315 (39%), Positives = 204/315 (65%), Gaps = 16/315 (5%)
 Frame = -1

Query  1137  GGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLN  958
              G  + VRV+ T+S+EDK LL  ++Q++E++ N   RGFREV+DL+S SQKP++++N LN
Sbjct  256   AGAARFVRVIFTNSKEDKNLLLMDIQKLEDEQNFKFRGFREVIDLLSSSQKPIISYNCLN  315

Query  957   DFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSR  778
             D T +HSKF+APLP  + EF  SL  VF +++D+ HL +++G  +   NI  A SYL  +
Sbjct  316   DMTMLHSKFIAPLPPNMHEFLCSLKMVFSNVVDISHLWRQIGPLRKAKNIQAALSYLQRQ  375

Query  777   FFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAP-EAIEHCGQLP  601
             +  P+++E+P Q  ++   SV  +  NVL+I++LFAK+ ++LK+ P+   ++ E C    
Sbjct  376   YCVPIEIEIPQQDGTS---SVTKNEKNVLRITKLFAKLSNLLKISPECQLQSHEQCT---  429

Query  600   PALERYANIFDP-CSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKS  424
              A+E Y NIF P C     D    + +  + + + + VS+ N++FLWGF+   S  ++K 
Sbjct  430   -AVEEYCNIFYPSCVVEGSD----DANFAIESDTTEIVSTDNIIFLWGFREK-SVKELKP  483

Query  423   LVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDSG--SLEEMVSEGIRAASY  250
              + G H+ FS +F+++L+D++C+ L+F     +  LL+ ++S   SL   +SEG++AA +
Sbjct  484   YLIGLHQAFSEDFEVKLLDKTCSALIFRDSNTATQLLKEINSEGPSLNRFLSEGLKAAGF  543

Query  249   DAYVKVCKLGLWKAN  205
             + Y KVC+LGLW ++
Sbjct  544   EVYRKVCRLGLWDSD  558



>ref|XP_003572239.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Brachypodium 
distachyon]
 ref|XP_010235167.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Brachypodium 
distachyon]
Length=596

 Score =   243 bits (619),  Expect(2) = 2e-124, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 155/222 (70%), Gaps = 8/222 (4%)
 Frame = -2

Query  1823  KQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAE  1644
             KQVTK NF EAL ++   + E D++AV+   TGA  + W+R LP DTAE AYLKAK AAE
Sbjct  9     KQVTKRNFPEALQELAAHLKECDYVAVAALKTGA-PTGWRRALPVDTAETAYLKAKLAAE  67

Query  1643  RYQILQFAVCPF---SLRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
              +Q L  AVCPF   +   S ++A PYNFHLFPRDEL+ GMPSYSFSCQ+SY  S+AR+G
Sbjct  68    SFQPLHIAVCPFRFDATSHSTVVAYPYNFHLFPRDELQLGMPSYSFSCQTSYFSSMARDG  127

Query  1472  FDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPA-SRSVADSIFINRIKSRVKH  1296
             FDFN CI DGISYLSR QE  A+  I  P       PSP+ S +VADS+F  RIKSR++H
Sbjct  128   FDFNMCIYDGISYLSRVQESLARQKIFIPHLRQ---PSPSPSTTVADSVFTTRIKSRIQH  184

Query  1295  WRNACTDQSKKTEDVLISSLRKMISATEVHGSRPCLNIDICS  1170
             WR    + SK  +  L++SLRK+I   E +GSRP ++ID+CS
Sbjct  185   WRKGYAEPSKTADGSLVNSLRKLILGGESYGSRPSMSIDVCS  226


 Score =   233 bits (594),  Expect(2) = 2e-124, Method: Compositional matrix adjust.
 Identities = 142/354 (40%), Positives = 218/354 (62%), Gaps = 17/354 (5%)
 Frame = -1

Query  1137  GGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLN  958
              G ++ VRV+ TSS+EDK LL  ++Q++E++H+   RGFREV+DL+S SQKP++++N LN
Sbjct  253   AGMSRAVRVIFTSSEEDKNLLLMDIQKLEDEHSVKFRGFREVIDLLSSSQKPIISYNCLN  312

Query  957   DFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSR  778
             D T IH+KF+ PLP  + EF  SL  VF  ++DV HL +E+G  +N  NI  A SYL  +
Sbjct  313   DLTMIHTKFIGPLPPNMHEFTCSLRMVFSSVVDVGHLWREIGPLRNAKNIQAALSYLQRQ  372

Query  777   FFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPP  598
             +F P+++E+P Q      +SV   G NVL+I++LFAK+  +LK+ PK        G+   
Sbjct  373   YFVPMEIEIPQQ---DGTNSVTKGGENVLRITKLFAKLSMLLKISPKHQ---SQSGEQHH  426

Query  597   ALERYANIFDP-CSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSL  421
              +E + NIF P C     D    + D        + VS+ +V+FLWGF+   S  +++ L
Sbjct  427   TVEDFCNIFYPGCMAGESD----DVDCTKEPDITRTVSTDSVIFLWGFRK-TSAKELRYL  481

Query  420   VYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEAL--DSGSLEEMVSEGIRAASYD  247
             +   H VFS++F++RL+D++C+VL+F S      LL  +  +S SL    SEG++AA +D
Sbjct  482   LTRLHHVFSNDFELRLLDKTCSVLIFRSSDTPMELLREISSESPSLNNFFSEGLKAAGFD  541

Query  246   AYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDD  85
              Y KVC+LGLW ++LA++LE    E++      H     S I+WNS  M+ + +
Sbjct  542   VYWKVCRLGLWDSDLAEALEAVSSEQATSALSGHGT---SEIYWNSSLMLDIKE  592



>gb|EEE68767.1| hypothetical protein OsJ_27469 [Oryza sativa Japonica Group]
Length=601

 Score =   239 bits (610),  Expect(2) = 4e-123, Method: Compositional matrix adjust.
 Identities = 119/220 (54%), Positives = 154/220 (70%), Gaps = 6/220 (3%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAER  1641
             QVTK NF+EA+ D+   +   D++A++ Q TGA  + W+R LP DT E AYLKAK AAE 
Sbjct  15    QVTKRNFAEAVQDLAAHVEACDYVAIAAQRTGA-PTGWRRALPVDTPETAYLKAKLAAES  73

Query  1640  YQILQFAVCPFSLRE---SKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGF  1470
             +Q L FA+CPF +     S L+A PYNFHLFPRDEL+ GMP+YSFSCQSSYL S+A  GF
Sbjct  74    FQPLHFAICPFRVDATSPSTLVAYPYNFHLFPRDELQLGMPAYSFSCQSSYLSSMAHSGF  133

Query  1469  DFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSVADSIFINRIKSRVKHWR  1290
             DFN CI DGISYLSRAQE  A++ I  P     +  S  S S+ADS+F+ RIKSR++HWR
Sbjct  134   DFNMCIYDGISYLSRAQESLARERIFIPHVRQLS--SSPSTSIADSVFLTRIKSRIEHWR  191

Query  1289  NACTDQSKKTEDVLISSLRKMISATEVHGSRPCLNIDICS  1170
                T   K  +  L+++LR++I  +E +GSRP  +ID+CS
Sbjct  192   KGYTKPCKTADGSLVNTLRQLILGSESYGSRPSFSIDVCS  231


 Score =   232 bits (591),  Expect(2) = 4e-123, Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 216/356 (61%), Gaps = 21/356 (6%)
 Frame = -1

Query  1137  GGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLN  958
              G  + VRV+ TSS EDK LL  ++++ME++HN   RGFREV+DL+S SQKP++++N LN
Sbjct  258   AGTARAVRVIFTSSPEDKNLLLMDIKKMEDEHNLKFRGFREVIDLLSSSQKPIISYNFLN  317

Query  957   DFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSR  778
             DFT IHSKF+APLP  L EF  SL  VF +++D+ H+ +E+G  +   NI  A SYL  +
Sbjct  318   DFTMIHSKFVAPLPPNLHEFMCSLRMVFSNVIDISHMWREIGPLRKAKNIQGALSYLQRQ  377

Query  777   FFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPP  598
             +F P+DVE+P Q      +SV   G NVL+I++LFAK+ ++LK+   +P    H G    
Sbjct  378   YFVPMDVEIPQQ---DGNNSVTKSGENVLRITKLFAKLSNLLKI---SPNGQTHSGDKCH  431

Query  597   ALERYANIFDPCST---SYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVK  427
              +E Y+ I  P  T   S  D   NE      + + + V + NVVFLWGF+   S  +++
Sbjct  432   TVEEYSYILYPSCTAEESEDDKSSNE------SNTTRSVRTDNVVFLWGFRE-TSVKELR  484

Query  426   SLVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEAL--DSGSLEEMVSEGIRAAS  253
             S +   H  FS +F++RL+D SC+ L+F S   +  LL  +  +S SL    SEG++AA 
Sbjct  485   SRLASLHHAFSKDFELRLLDNSCSALIFHSSDTAIDLLREINSESPSLNNFFSEGLKAAG  544

Query  252   YDAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDD  85
             +DAY KVC+ GLW ++LA++L+    E S       + +  S I WN+  M+ L +
Sbjct  545   FDAYRKVCRSGLWDSDLAEALDGVSSEPSTSTL---SGRGTSEICWNTSLMLDLKE  597



>gb|EEC83639.1| hypothetical protein OsI_29373 [Oryza sativa Indica Group]
Length=602

 Score =   239 bits (609),  Expect(2) = 1e-122, Method: Compositional matrix adjust.
 Identities = 118/220 (54%), Positives = 154/220 (70%), Gaps = 6/220 (3%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAER  1641
             QVTK NF+EA+ D+   +   D++A++ Q TGA  + W+R LP DT E AYLKAK AAE 
Sbjct  16    QVTKRNFAEAVQDLAAHVEACDYVAIAAQRTGA-PTGWRRALPVDTPETAYLKAKLAAES  74

Query  1640  YQILQFAVCPFSLRE---SKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGF  1470
             +Q L FA+CPF +     S L+A PYNFHLFPRDEL+ GMP+YSFSCQSSYL S+A  GF
Sbjct  75    FQPLHFAICPFRVDATSPSTLVAYPYNFHLFPRDELQLGMPAYSFSCQSSYLSSMAHSGF  134

Query  1469  DFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSVADSIFINRIKSRVKHWR  1290
             DFN CI DGISYLSRAQE  A++ I  P     +  S  S S+ADS+F+ RIKSR++HWR
Sbjct  135   DFNMCIYDGISYLSRAQESLARERIFIPHVRQLS--SSPSTSIADSVFLTRIKSRIEHWR  192

Query  1289  NACTDQSKKTEDVLISSLRKMISATEVHGSRPCLNIDICS  1170
                T   K  +  L+++LR+++  +E +GSRP  +ID+CS
Sbjct  193   KGYTKPCKTADGSLVNTLRQLVLGSESYGSRPSFSIDVCS  232


 Score =   231 bits (588),  Expect(2) = 1e-122, Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 216/356 (61%), Gaps = 21/356 (6%)
 Frame = -1

Query  1137  GGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLN  958
              G  + VRV+ TSS EDK LL  ++++ME++HN   RGFREV+DL+S SQKP++++N LN
Sbjct  259   AGTARAVRVIFTSSPEDKNLLLMDIKKMEDEHNLKFRGFREVIDLLSSSQKPIISYNFLN  318

Query  957   DFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSR  778
             DFT IHSKF+APLP  L EF  SL  VF +++D+ H+ +E+G  +   NI  A SYL  +
Sbjct  319   DFTMIHSKFVAPLPPNLHEFMCSLRMVFSNVIDISHMWREIGPLRKAKNIQGALSYLQRQ  378

Query  777   FFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPP  598
             +F P+DVE+P Q      +SV   G NVL+I++LFAK+ ++LK+   +P    H G    
Sbjct  379   YFVPMDVEIPQQ---DGNNSVTKSGENVLRITKLFAKLSNLLKI---SPNGQTHPGDKCH  432

Query  597   ALERYANIFDPCST---SYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVK  427
              +E Y+ I  P  T   S  D   NE      + + + V + NVVFLWGF+   S  +++
Sbjct  433   TVEEYSYILYPSCTAEESEDDKSSNE------SNTTRSVRTDNVVFLWGFRE-TSVKELR  485

Query  426   SLVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEAL--DSGSLEEMVSEGIRAAS  253
             S +   H  FS +F++RL+D SC+ L+F S   +  LL  +  +S SL    SEG++AA 
Sbjct  486   SRLASLHHAFSKDFELRLLDNSCSALIFHSSDAAIDLLREINSESPSLNNFFSEGLKAAG  545

Query  252   YDAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDD  85
             +DAY KVC+ GLW ++LA++L+    E S       + +  S I WN+  M+ L +
Sbjct  546   FDAYRKVCRSGLWDSDLAEALDGVSSEPSTSTL---SGRGTSEICWNTSLMLDLKE  598



>ref|XP_004973547.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Setaria italica]
Length=599

 Score =   234 bits (597),  Expect(2) = 7e-122, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 155/221 (70%), Gaps = 6/221 (3%)
 Frame = -2

Query  1823  KQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAE  1644
             KQVT+ NF+E++ ++   +   D++ V+ Q TGA  + W+R LP DTAE  YLKAK AAE
Sbjct  12    KQVTRRNFAESVRELGAHLESCDYVTVAAQKTGA-PTGWRRALPVDTAETVYLKAKLAAE  70

Query  1643  RYQILQFAVCPFSLRESK---LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
              +Q LQ AVCPF LR+S    L+A PYNFHLFPRDEL+ GMPSYSFSCQSSYL ++A +G
Sbjct  71    SFQPLQIAVCPFRLRDSSPSTLVAYPYNFHLFPRDELQLGMPSYSFSCQSSYLSTMANDG  130

Query  1472  FDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSVADSIFINRIKSRVKHW  1293
             FDFN CI DGISYLSR QE  A+  I +       +PS  + SVADS+F +RI SR+ HW
Sbjct  131   FDFNMCIYDGISYLSRVQESFARQKIFTTRLRPL-LPS-QNTSVADSVFKSRIMSRITHW  188

Query  1292  RNACTDQSKKTEDVLISSLRKMISATEVHGSRPCLNIDICS  1170
             R    + SKK +D L+ SL ++I   E +GSRP ++ID+CS
Sbjct  189   RKGYAEPSKKDDDSLVGSLSRLILGGESYGSRPSMSIDVCS  229


 Score =   233 bits (594),  Expect(2) = 7e-122, Method: Compositional matrix adjust.
 Identities = 138/353 (39%), Positives = 221/353 (63%), Gaps = 15/353 (4%)
 Frame = -1

Query  1137  GGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLN  958
              G  + V V+ TSS+EDK LL  ++ + E + N   RGFREV+DL+S SQKP++++N LN
Sbjct  256   AGAARAVCVIFTSSKEDKNLLLMDIHKSEEEQNLKFRGFREVIDLLSSSQKPIISYNCLN  315

Query  957   DFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSR  778
             D T +HSKF+APLP  + EF  SL  VF +++D+ HL +++G  +   NI  A SYL  +
Sbjct  316   DLTMMHSKFVAPLPPNMHEFMCSLKMVFSNVVDISHLWRQIGPLRKAKNIQAALSYLQRQ  375

Query  777   FFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPP  598
             +F P+++++P Q +++   SV  +  NVL+I++LFAK+ ++LK+   +PE     G+   
Sbjct  376   YFVPMEIKIPQQDVTS---SVTKNEQNVLRITKLFAKLSNLLKI---SPECQLQSGEQCA  429

Query  597   ALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLV  418
             A+E Y NIF P S   +D   ++ D      + K VS+ N++FLWGF+   S  ++KS +
Sbjct  430   AVEEYCNIFYP-SCMVEDS--DDVDFANEPDTAKTVSTDNIIFLWGFREK-SAKELKSYL  485

Query  417   YGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLE--ALDSGSLEEMVSEGIRAASYDA  244
              G H+VFS +F+++L+D +C+ L+F +   +  LLE  +L+S SL    SEG++AA ++ 
Sbjct  486   PGLHQVFSEDFEVKLLDRTCSALIFRNSDTAMQLLEEISLESSSLNSFFSEGLKAAGFEV  545

Query  243   YVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDD  85
             Y K C+LGLW ++LA++LE    E +        +   S I+WNS  M+ L +
Sbjct  546   YRKACRLGLWDSDLAEALEGVSSEIAASTLSECNS---SPIYWNSSLMLDLKE  595



>ref|XP_002320703.1| hypothetical protein POPTR_0014s01880g [Populus trichocarpa]
 gb|EEE99018.1| hypothetical protein POPTR_0014s01880g [Populus trichocarpa]
Length=544

 Score =   277 bits (708),  Expect(2) = 7e-122, Method: Compositional matrix adjust.
 Identities = 157/320 (49%), Positives = 212/320 (66%), Gaps = 22/320 (7%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             A GG  Q VRVVLTSS+EDK LL+ +LQ  E +  K VRGFREV+DLIS SQKPVV+H S
Sbjct  228   AKGGAMQAVRVVLTSSKEDKDLLQGKLQNDEQELKKKVRGFREVIDLISASQKPVVSHGS  287

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             LN          APLP T+DEF  SL   FP ++DV HLMKE+ + + + +I VA S L 
Sbjct  288   LN----------APLPPTVDEFMCSLRLAFPLVIDVNHLMKEISALRKVTSIPVAISQLK  337

Query  783   SRFFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQL  604
             +RFF P+D+E+P QA+  + D++  HG NV+KI ELFA++CSILK+DP A ++ E  G  
Sbjct  338   NRFFTPIDMEIPCQAMENE-DTI--HGQNVVKICELFARLCSILKIDPAAVKSDEEKG--  392

Query  603   PPALERYANIFDPCSTSYQDPPINEEDVRVR--AKSCKRVSSKNVVFLWGFQSGISTGQV  430
               ALE YANIF P  T+ ++P   E  +       + + VS +++VFLWGF   ++ G +
Sbjct  393   ASALEAYANIFSPFCTASEEPIDGEIKIWTNKWTNNTRTVSCEDLVFLWGFGDRVTAGVL  452

Query  429   KSLVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDS-----GSLEEMVSEGI  265
             KSL+   HE FS EFD+RLVD SCA+++F   GL+E  L  ++      G L EMVSEG+
Sbjct  453   KSLLQESHEAFSKEFDVRLVDNSCAIVIFWQHGLTETFLNTMNKCSDMRGPLREMVSEGL  512

Query  264   RAASYDAYVKVCKLGLWKAN  205
             RAA Y+ Y + C+LGLW+++
Sbjct  513   RAAGYETYNRACRLGLWESS  532


 Score =   190 bits (483),  Expect(2) = 7e-122, Method: Compositional matrix adjust.
 Identities = 101/253 (40%), Positives = 143/253 (57%), Gaps = 61/253 (24%)
 Frame = -2

Query  1913  MLQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQ  1734
             +LQRRL  T++++T  +P      + +W IKQVTKSNF++ L DI++ ++ SDF+AVSLQ
Sbjct  7     LLQRRLLSTSVTKTHHKP------HQQWSIKQVTKSNFADTLKDIKSHVSNSDFVAVSLQ  60

Query  1733  TTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFP  1554
              TG++S+PWQR+ PFDTA+ AYLKAK AAER+Q+L FAVCP ++R SK+ A P       
Sbjct  61    NTGSFSAPWQRVSPFDTADTAYLKAKYAAERFQVLHFAVCPITVRASKVTAYP-------  113

Query  1553  RDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAGS  1374
                                                         QE  AK  + +P    
Sbjct  114   -------------------------------------------EQESTAKIQMGNPILAK  130

Query  1373  CTVPSPASRSVADSIFINRIKSRVKHWRNACTDQSKKTE-----DVLISSLRKMISATEV  1209
                 S ++ SVADS+F+ RIKS +K+W+ AC + S + E     D L+ SLRK++   E 
Sbjct  131   NVTESTSTLSVADSVFVERIKSHIKNWKKACKETSTRKEGNQIQDALVRSLRKLVLGNEE  190

Query  1208  HGSRPCLNIDICS  1170
             + SRPC+NID+CS
Sbjct  191   YDSRPCMNIDVCS  203



>ref|XP_006447983.1| hypothetical protein CICLE_v10014999mg [Citrus clementina]
 gb|ESR61223.1| hypothetical protein CICLE_v10014999mg [Citrus clementina]
Length=497

 Score =   303 bits (776),  Expect(2) = 4e-117, Method: Compositional matrix adjust.
 Identities = 161/316 (51%), Positives = 218/316 (69%), Gaps = 11/316 (3%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             A GGGTQ VR VLTSS EDK LL++ELQ    + NK VRGFREV+DLIS SQKP+VAHNS
Sbjct  149   AKGGGTQAVRAVLTSSDEDKDLLKRELQTFGFEQNKRVRGFREVIDLISASQKPLVAHNS  208

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             LNDFT IHSKFLAPLP  ++EF  SL   +P ++DV +L+K++G  K + NI    +YL 
Sbjct  209   LNDFTFIHSKFLAPLPPNMNEFICSLRLAYPQVIDVNYLLKDIGPVKKMTNISATIAYLK  268

Query  783   SRFFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQL  604
             +RFFAP+++E+P+QA   +    K HGHNV+KI +LF K+CSILK+ P A E+ +    L
Sbjct  269   NRFFAPIEMEIPNQANENEG---KIHGHNVVKICQLFGKLCSILKITPDAIESSDDF--L  323

Query  603   PPALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKS  424
               A+ RY NIF     S Q+P    E++R      ++VS ++VVFLWGF+  IS G +K+
Sbjct  324   ASAINRYTNIFYSLPGSSQEP--TNEEIRGWTNDKRKVSCEDVVFLWGFRERISAGILKN  381

Query  423   LVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALD----SGSLEEMVSEGIRAA  256
             ++ G HEVF+  F++R+VD SCA++VF  PGLS      ++    SG L EMVS+G++AA
Sbjct  382   MLQGSHEVFAEAFNVRMVDRSCAIVVFGKPGLSNTFKNVMNSKAVSGPLREMVSDGLKAA  441

Query  255   SYDAYVKVCKLGLWKA  208
              Y+ Y +VC  GLW++
Sbjct  442   GYETYQRVCSSGLWES  457


 Score =   148 bits (373),  Expect(2) = 4e-117, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 92/124 (74%), Gaps = 3/124 (2%)
 Frame = -2

Query  1535  GMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSP  1356
             GMPSYSF+CQ+SYL ++A+EGFDFN CI DGISYLS AQE AAK  + +P A      S 
Sbjct  2     GMPSYSFTCQTSYLTAMAKEGFDFNTCIYDGISYLSEAQESAAKVRMGNPMAVDHATKSS  61

Query  1355  AS--RSVADSIFINRIKSRVKHWRNACTDQSKKTEDVLISSLRKMISATEVHGSRPCLNI  1182
             +S   SVAD++FI R++SRVKHW+NACTD   KTE  L++SLRK++   E  GSRP + I
Sbjct  62    SSPALSVADTVFIERVRSRVKHWKNACTDSDIKTE-ALVTSLRKIVLGGEQFGSRPSMTI  120

Query  1181  DICS  1170
             D+CS
Sbjct  121   DVCS  124



>dbj|BAK06461.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=595

 Score =   241 bits (616),  Expect(2) = 1e-116, Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 156/222 (70%), Gaps = 8/222 (4%)
 Frame = -2

Query  1823  KQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAE  1644
             KQVT+ NF EA+ ++   + E D++A++   TGA  + W+R LP DTAE AYLKAK A+E
Sbjct  8     KQVTRRNFPEAVRELAAHVKECDYVAIAALKTGA-PTVWRRALPVDTAETAYLKAKFASE  66

Query  1643  RYQILQFAVCPFSLRE---SKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
              +Q L  AVCPF L     S ++A P+NFHLFPRDEL+ GMPSYSFSCQSSY  S+AR+G
Sbjct  67    SFQPLHIAVCPFRLGSASGSDVVAYPHNFHLFPRDELQLGMPSYSFSCQSSYFSSMARDG  126

Query  1472  FDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSP-ASRSVADSIFINRIKSRVKH  1296
             FDFN CI DGISYLSR QE  A+    +P       PSP AS SVADS+F NRIKSR+++
Sbjct  127   FDFNMCIYDGISYLSRVQESLARQKTFTPHLQQ---PSPSASTSVADSVFTNRIKSRIQN  183

Query  1295  WRNACTDQSKKTEDVLISSLRKMISATEVHGSRPCLNIDICS  1170
             WR  C + SK  +  L+SSLRK+I  +E +GSRP + I +CS
Sbjct  184   WRKGCAEPSKTADGSLVSSLRKLIMGSESYGSRPSMTILVCS  225


 Score =   208 bits (529),  Expect(2) = 1e-116, Method: Compositional matrix adjust.
 Identities = 135/353 (38%), Positives = 210/353 (59%), Gaps = 15/353 (4%)
 Frame = -1

Query  1137  GGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLN  958
              G  + VRV+ TSS EDK LL  +++++E++ +   RGFREV+DL+S S+KP++++N LN
Sbjct  252   AGVPRAVRVIFTSSAEDKNLLLMDIRKLEDEQSSKFRGFREVIDLVSSSEKPIISYNCLN  311

Query  957   DFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSR  778
             D T IH++F+APLP  L EF  S   VF  ++D+ HL +E+   +   NI  A SYL  +
Sbjct  312   DLTMIHAQFIAPLPPNLHEFMCSSRLVFSSVVDIGHLWREISPLRKAKNIQAALSYLQRQ  371

Query  777   FFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPP  598
              F P+++E+P Q        V   G NVL+I++LFAK+  +LK+ PK        G+   
Sbjct  372   HFVPMEIEIPLQ---DGTRGVTKSGENVLRITKLFAKLSKLLKITPKCQ---SQSGEQHH  425

Query  597   ALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLV  418
              +E + NI  P     +   +   D      + + VS+++VVFLWGF+   S   ++S +
Sbjct  426   TVEDHRNILCPSCMVEESDGV---DCTNEPGTTRTVSTQSVVFLWGFRE-TSAEDLRSRL  481

Query  417   YGKHEVFSSEFDIRLVDESCAVLVF-SSPGLSEVLLE-ALDSGSLEEMVSEGIRAASYDA  244
                H VFS +FD+RL+D++C+ L+F SS   SE+L + +L+S SL    SEG++AA +D 
Sbjct  482   TRLHHVFSKDFDLRLLDKTCSALIFRSSDTASELLGDISLESPSLNNFFSEGLKAAGFDV  541

Query  243   YVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDD  85
             Y K C LGLW ++LA++LE A  E +      H + +   I+WNS   + L +
Sbjct  542   YRKACSLGLWDSDLAEALEGASLEPATSTVSDHGSSE---IYWNSSLKLDLKE  591



>ref|XP_010466957.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X2 
[Camelina sativa]
Length=543

 Score =   255 bits (652),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 153/356 (43%), Positives = 228/356 (64%), Gaps = 17/356 (5%)
 Frame = -1

Query  1131  GTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLNDF  952
             GTQ VR V  SS+EDK L  +ELQ++ENK N+ VRGFREV+DLIS SQKPV++ N L+D 
Sbjct  199   GTQAVRTVFMSSKEDKDLFMRELQDLENKENRRVRGFREVIDLISSSQKPVISQNYLSDL  258

Query  951   TSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSRFF  772
             TSIH+KFL PLP+ +D+F  SL   FP ++D+   MKE+    N++N+  A S LN RFF
Sbjct  259   TSIHAKFLGPLPANVDDFSSSLSSAFPSVVDLSQFMKEISPLSNISNLPAAMSSLN-RFF  317

Query  771   APVDVELPHQAISTK-ADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPA  595
             APVDVE+ +Q    K ++S +SHG N + IS+LFAK+ +I K D    E  E    L  A
Sbjct  318   APVDVEVANQGSQVKLSESYQSHGQNAVMISQLFAKLRTIQKSDLSTVEPNEDFQAL--A  375

Query  594   LERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLVY  415
              + + +    CS +  D     E+V+V +K+ +RVSS+N+VF+WG    ++  ++K+++ 
Sbjct  376   SDEHESSVTSCSQNAGD-----ENVKVWSKNSRRVSSENLVFIWGLTKKMTAAKLKNVLQ  430

Query  414   GKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDS-----GSLEEMVSEGIRAASY  250
               H VF+ EFD++ +D+SCA++VF   G SE  + A+++     GSL+EMV+EG+RAA Y
Sbjct  431   KSHPVFTQEFDVKYLDKSCAIVVFWESGPSETFVTAVNNEEQLGGSLKEMVAEGLRAAGY  490

Query  249   DAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
             + Y K C+LG W+A+     E   +      ++  +  + S I W++D  I+ D+L
Sbjct  491   ETYKKACRLGFWEAD---LAESLDKTLESSDTDPDSDSNPSEIDWSNDLAINFDEL  543


 Score =   170 bits (431),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 105/137 (77%), Gaps = 2/137 (1%)
 Frame = -2

Query  1574  YNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCI  1395
             YNFHLFPRDELK GMPSYSFSCQ+S L S+AREGFDFN CI +GISYLSRAQE A+K   
Sbjct  34    YNFHLFPRDELKCGMPSYSFSCQASRLTSMAREGFDFNTCIYEGISYLSRAQESASKFLS  93

Query  1394  RSP-SAGSCTVPSPASRSVADSIFINRIKSRVKHWRNACTDQSKKT-EDVLISSLRKMIS  1221
              +P  A    V S +  +VAD++F+ RI+SRVK+WR +C D S KT +D L+SSLR+++ 
Sbjct  94    GNPILADPIAVSSSSPATVADTVFVGRIRSRVKNWRKSCVDSSIKTGDDDLVSSLRRLVL  153

Query  1220  ATEVHGSRPCLNIDICS  1170
              +E +GSR CL ID+CS
Sbjct  154   GSEQYGSRLCLTIDVCS  170



>ref|XP_008235892.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X2 
[Prunus mume]
Length=385

 Score =   291 bits (744),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 135/222 (61%), Positives = 176/222 (79%), Gaps = 2/222 (1%)
 Frame = -2

Query  1835  KWGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAK  1656
             KW +K+VTK NF ++L + +  +  +DF+AVSLQ TG++S+ W R  PFDTA+ +Y KAK
Sbjct  22    KWAVKEVTKLNFKKSLEEFKDHLAGADFVAVSLQKTGSFSAAWHRPQPFDTADTSYCKAK  81

Query  1655  RAAERYQILQFAVCPFSLRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIARE  1476
              AAER+Q+LQFA CPF+LR SKL   PYNF LFPRDELK GMPSYSFS Q+S+L S+A+E
Sbjct  82    YAAERFQLLQFAACPFTLRASKLTPHPYNFVLFPRDELKLGMPSYSFSVQTSHLTSMAQE  141

Query  1475  GFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSVADSIFINRIKSRVKH  1296
             GFDFNACI +GISYLSRAQE AAK  I +PS  +  + S ++ +VAD++FI RIKSRVKH
Sbjct  142   GFDFNACIYNGISYLSRAQESAAKVRIGNPSPSTYIMNSSSTHTVADTVFIERIKSRVKH  201

Query  1295  WRNACTDQSKKTEDVLISSLRKMISATEVHGSRPCLNIDICS  1170
             W+NAC  +S K +D L+SSLRK++  +E++GSRPC+NID+CS
Sbjct  202   WKNAC--RSSKKDDALLSSLRKLVLGSELYGSRPCMNIDVCS  241


 Score =   134 bits (337),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             A GGGTQ VRVVLTSS+EDK   E+ELQ +E + N+ VRGFREV+DLIS SQKPVV+HNS
Sbjct  266   AKGGGTQAVRVVLTSSKEDKDSFERELQNLEEEQNQRVRGFREVIDLISASQKPVVSHNS  325

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELG  832
             LNDFT IHSKFL+PLP+ +DEF  SL  VFPH+LDV H+MK +G
Sbjct  326   LNDFTFIHSKFLSPLPTNVDEFMDSLHLVFPHLLDVNHMMKNIG  369



>ref|XP_008799186.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X3 
[Phoenix dactylifera]
Length=509

 Score =   257 bits (656),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 164/356 (46%), Positives = 243/356 (68%), Gaps = 14/356 (4%)
 Frame = -1

Query  1134  GGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLND  955
             GG + VRVVLTSS+EDK LL  E+Q +E + N  VRGFREV+DLIS S+KP++A+N L+D
Sbjct  163   GGAKSVRVVLTSSEEDKNLLMSEIQNLEEEQNLKVRGFREVIDLISSSKKPIIAYNCLHD  222

Query  954   FTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSRF  775
             FT IHSKF++PL  +L+EF  SL  VF +I+DV HL+KE+G  +   N+  A SYL  +F
Sbjct  223   FTFIHSKFISPLQPSLNEFMCSLRLVFSNIVDVSHLLKEIGPLRKARNLPAALSYLKRQF  282

Query  774   FAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPA  595
             F P+DVE+P  A     +S  +HGHNVLK++ +FAK+  +LK+ P    ++   GQ    
Sbjct  283   FVPIDVEIPQLA---DGNSNNNHGHNVLKLTRVFAKLGILLKIVPDCQTSL---GQHTVP  336

Query  594   LERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLVY  415
             +E YANIF P S S Q+     +DV     + +++S+ ++VF+WGF+ G S  ++K+ + 
Sbjct  337   IEEYANIFYPISNSLQES--EADDVDFHMDNVRKISTDDLVFIWGFREGTSAAELKNHLR  394

Query  414   GKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDSG-----SLEEMVSEGIRAASY  250
               H VFS + +++LVD++CAV+VF   G +E LL+ + SG     +  +++SEG++AA Y
Sbjct  395   QTHSVFSEDIELQLVDKTCAVVVFQKSGSAEALLKEIGSGMTNSTAPSKIISEGLKAAGY  454

Query  249   DAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
             +AY KVC+LG+W+A LADSL+ AL E S  L+ + + +D S I+W+S+ MI L+DL
Sbjct  455   EAYKKVCRLGMWEAELADSLDCALSEPSGDLTIS-SGEDASEIYWSSESMIDLNDL  509


 Score =   162 bits (410),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 98/135 (73%), Gaps = 3/135 (2%)
 Frame = -2

Query  1574  YNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCI  1395
             YNFHLFPRDEL  GMPSYSFSCQ+S+L S+AREGFDFN  I DGISYLSRAQE  AK+  
Sbjct  4     YNFHLFPRDELNLGMPSYSFSCQTSFLASMAREGFDFNVSIYDGISYLSRAQESIAKE--  61

Query  1394  RSPSAGSCTVPSPASRSVADSIFINRIKSRVKHWRNACTDQSKKTEDVLISSLRKMISAT  1215
                +    +  S  S SVADSIFI RIKSRV++WRNAC D     +  L  SLRK+I   
Sbjct  62    -RTTPRVYSSSSSPSPSVADSIFIGRIKSRVENWRNACKDPCNMADGSLAKSLRKLILGG  120

Query  1214  EVHGSRPCLNIDICS  1170
             EV+GSRP L+ID+CS
Sbjct  121   EVYGSRPSLSIDVCS  135



>ref|XP_007201614.1| hypothetical protein PRUPE_ppa019832mg [Prunus persica]
 gb|EMJ02813.1| hypothetical protein PRUPE_ppa019832mg [Prunus persica]
Length=380

 Score =   327 bits (839),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 189/359 (53%), Positives = 254/359 (71%), Gaps = 15/359 (4%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             A GGGTQ VRVVLTSS+EDK   E+ELQ +E + N+ VRGFREV+DLIS SQKPVV+HN+
Sbjct  32    AKGGGTQAVRVVLTSSKEDKDSFERELQNLEEEQNQRVRGFREVIDLISASQKPVVSHNA  91

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             LNDFT IHSKFL+PLP+ +DEF  SL  VFPH+LDV H+MK +G  + + NI+ A SYLN
Sbjct  92    LNDFTFIHSKFLSPLPTNVDEFMDSLHLVFPHLLDVNHMMKNIGPLRKVTNIHAAISYLN  151

Query  783   SRFFAPVDVE-LPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQ  607
             + +FAP+D+E LP +      +    H HNV+K+  LFAK+CSILK+   A     +   
Sbjct  152   NHYFAPIDMENLPQE-----NEEGTVHRHNVVKMCYLFAKLCSILKIPDNA--MTSNNAL  204

Query  606   LPPALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVK  427
             L PA E Y NI +P   S Q+  IN +D+R+  K+ K+VS  ++VFLWGF+SG++ G +K
Sbjct  205   LAPAPEEYTNISNPYPDSPQE-SIN-DDIRIWTKNMKKVSCNHLVFLWGFRSGMTAGMLK  262

Query  426   SLVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDS----GSLEEMVSEGIRA  259
             SL++  H+VFS EFD+RLVD+SCA++VF  PGLSE  L+ + S    GSL E+VSEG+RA
Sbjct  263   SLLHKSHDVFSEEFDVRLVDKSCAIVVFWRPGLSETFLDFVSSEEICGSLREIVSEGLRA  322

Query  258   ASYDAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
             +SY+AY +VC+LGLW+AN          E+ +CL EA+ A +   I+W+SD  I+ D+L
Sbjct  323   SSYEAYKRVCRLGLWEAN-LAESLDRALEDPDCLVEANLAANCKEIYWSSDSTINFDNL  380



>gb|KDP45240.1| hypothetical protein JCGZ_15105 [Jatropha curcas]
Length=345

 Score =   321 bits (822),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 151/247 (61%), Positives = 188/247 (76%), Gaps = 7/247 (3%)
 Frame = -2

Query  1910  LQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQT  1731
             LQRRLF T +      P +  +N  +W +KQVTKSNF+ +L ++++ I+ SDFIAVSLQ 
Sbjct  8     LQRRLFSTHL------PKNHQTN-SQWNVKQVTKSNFTNSLEEVKSHISTSDFIAVSLQK  60

Query  1730  TGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFPR  1551
             TG++SSPW R+ PFDTA+ AYLKAK  AER+Q+LQFAVCPF++R SK+ A PYNFHLFPR
Sbjct  61    TGSFSSPWHRVSPFDTADTAYLKAKHVAERFQVLQFAVCPFTVRASKITAYPYNFHLFPR  120

Query  1550  DELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAGSC  1371
             DEL  GMPSYSFSCQ+SYL S+AREGFDFNACI DGISYLS+AQE AA+  + +P   + 
Sbjct  121   DELNIGMPSYSFSCQTSYLTSMAREGFDFNACIYDGISYLSKAQESAAEVQMGNPILANR  180

Query  1370  TVPSPASRSVADSIFINRIKSRVKHWRNACTDQSKKTEDVLISSLRKMISATEVHGSRPC  1191
              + S +  S AD  FI R KSRVKHWRNACTD   K ++ L+ SLRK++  TE H SRPC
Sbjct  181   ILESTSISSAADEFFIQRTKSRVKHWRNACTDSGTKADEGLLKSLRKLVLGTEEHNSRPC  240

Query  1190  LNIDICS  1170
             +NID+CS
Sbjct  241   MNIDVCS  247


 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             A GGGTQ +RVVL  S+ED+ LL+ ELQ ++ +HNK VRGFREV+DLIS SQKPVV+HNS
Sbjct  272   AKGGGTQAIRVVLARSKEDRDLLQNELQNLKEEHNKKVRGFREVIDLISSSQKPVVSHNS  331

Query  963   LN  958
             LN
Sbjct  332   LN  333



>gb|ABK95700.1| unknown [Populus trichocarpa]
Length=454

 Score =   300 bits (768),  Expect(2) = 4e-98, Method: Compositional matrix adjust.
 Identities = 164/320 (51%), Positives = 220/320 (69%), Gaps = 12/320 (4%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             A GG  Q VRVVLTSS+EDK LL+ +LQ  E +  K VRGFREV+DLIS SQKPVV+H S
Sbjct  128   AKGGAMQAVRVVLTSSKEDKDLLQGKLQNDEQELKKKVRGFREVIDLISASQKPVVSHGS  187

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             LND T IHSKF+APLP T+DEF  SL   FP ++DV HLMKE+ + + + +I VA S L 
Sbjct  188   LNDLTVIHSKFIAPLPPTVDEFMCSLRLAFPLVIDVNHLMKEISALRKVTSIPVAISQLK  247

Query  783   SRFFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQL  604
             +RFF P+D+E+P QA+  + D++  HG NV+KI ELFA++CSILK+DP A ++ E  G  
Sbjct  248   NRFFTPIDMEIPCQAMENE-DTI--HGQNVVKICELFARLCSILKIDPAAVKSDEEKG--  302

Query  603   PPALERYANIFDPCSTSYQDPPINEEDVRVR--AKSCKRVSSKNVVFLWGFQSGISTGQV  430
               ALE YANIF P  T+ ++P   E  +       + + VS +++VFLWGF   ++ G +
Sbjct  303   ASALEAYANIFSPFCTASEEPIDGEIKIWTNKWTNNTRTVSCEDLVFLWGFGDRVTAGVL  362

Query  429   KSLVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDS-----GSLEEMVSEGI  265
             KSL+   HE FS EFD+RLVD SCA+++F   GL+E  L  ++      G L EMVSEG+
Sbjct  363   KSLLQESHEAFSKEFDVRLVDNSCAIVIFWQHGLTETFLNTMNKCSDMRGPLREMVSEGL  422

Query  264   RAASYDAYVKVCKLGLWKAN  205
             RAA Y+ Y + C+LGLW+++
Sbjct  423   RAAGYETYNRACRLGLWESS  442


 Score = 88.6 bits (218),  Expect(2) = 4e-98, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 61/96 (64%), Gaps = 5/96 (5%)
 Frame = -2

Query  1442  ISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSVADSIFINRIKSRVKHWRNACTDQSKK  1263
             ISYLSR QE  AK  + +P        S ++ SVADS+F+ RIKS +K+W+ AC + S +
Sbjct  8     ISYLSREQESTAKIQMGNPILAKNVTESTSTLSVADSVFVERIKSHIKNWKKACKETSTR  67

Query  1262  TE-----DVLISSLRKMISATEVHGSRPCLNIDICS  1170
              E     D L+ SLRK++   E + SRPC+NID+CS
Sbjct  68    KEGNQIQDALVRSLRKLVLGNEEYDSRPCMNIDVCS  103



>emb|CBI35579.3| unnamed protein product [Vitis vinifera]
Length=6458

 Score =   329 bits (844),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 194/360 (54%), Positives = 251/360 (70%), Gaps = 14/360 (4%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             A GGGTQ VRV+LTSS+EDK LL++ELQ++E + NK V GFREV+DLIS SQKPVV+HNS
Sbjct  6107  AKGGGTQAVRVILTSSEEDKDLLKRELQDLEEEQNKRVCGFREVIDLISASQKPVVSHNS  6166

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             LN+F  IHSKFL+PLP  +DEF  SL  VFPH+LDV HLMKE+G  K + N+  A S L 
Sbjct  6167  LNEFAFIHSKFLSPLPPNMDEFMCSLRMVFPHVLDVNHLMKEIGPLKKVTNLSAAASCLK  6226

Query  783   SRFFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQL  604
              RFF P+D+E+PHQA    ++  K HGHNVLKIS L A +CSILK+ P+  ++    G L
Sbjct  6227  RRFFVPIDMEIPHQA----SNEDKIHGHNVLKISHLLANLCSILKITPEMIQS--DGGHL  6280

Query  603   PPALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKS  424
               ALE YANIF P ST+ +DP   +  ++V     ++VSS+ +VF+WGF+  +S G +K 
Sbjct  6281  ASALEGYANIFHPHSTNTEDPI--DGGIKVWTDDTRKVSSEGLVFIWGFRGRMSAGGLKR  6338

Query  423   LVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALD----SGSLEEMVSEGIRAA  256
             L+ G H VFS EFD+R+VD SCA++VF   GLS+  LEA+     SG L EMVSEG+RAA
Sbjct  6339  LLQGSHSVFSEEFDVRMVDGSCAIVVFWQSGLSQTFLEAISSNWISGLLREMVSEGLRAA  6398

Query  255   SYDAYVKVCKLGLWKANladslelaleeeseclseAHTAKDL--SVIHWNSDEMISLDDL  82
              Y+ Y   C+LG W+A+LADSL+ ALEE          AK    S I+W+ D +I+LD+L
Sbjct  6399  GYETYKNACRLGFWEADLADSLDKALEEPDHNSEADSEAKPTGPSQIYWSRDSIINLDEL  6458


 Score =   122 bits (305),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -2

Query  1853  GGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEI  1674
             G S   +W +KQVTKSNFS+ L  ++ +I++SDF+AVSLQ TG++S+PW R+LPFDT + 
Sbjct  7     GLSTKREWRVKQVTKSNFSQTLESLKPQISQSDFVAVSLQKTGSFSAPWHRVLPFDTPQT  66

Query  1673  AYLKAKRAAERYQILQFAVCPFSLRESKLIASP  1575
             AY KA+ AA+++Q+ QFAVCPFS+R SK++A P
Sbjct  67    AYSKARFAADKFQVFQFAVCPFSVRASKVVAHP  99



>ref|XP_007049585.1| Poly(A)-specific ribonuclease PARN-like, putative isoform 2 [Theobroma 
cacao]
 gb|EOX93742.1| Poly(A)-specific ribonuclease PARN-like, putative isoform 2 [Theobroma 
cacao]
Length=623

 Score =   308 bits (788),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 176/353 (50%), Positives = 240/353 (68%), Gaps = 12/353 (3%)
 Frame = -1

Query  1137  GGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLN  958
             GGGTQ VRVVLTSS+EDK L E+ELQ +E + NK +RGFREV+DLIS SQKPVV+HNSLN
Sbjct  274   GGGTQAVRVVLTSSKEDKSLFERELQNVEEEQNKKIRGFREVIDLISASQKPVVSHNSLN  333

Query  957   DFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSR  778
             DF+ IHSKF+ PLP  +DEF  SL  VFPH+ DV HLMKE+G  +N+ NI  A SYL +R
Sbjct  334   DFSVIHSKFIGPLPLNMDEFLCSLRLVFPHVFDVNHLMKEIGPLENVTNIPAAISYLKNR  393

Query  777   FFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPP  598
             FFAP+D+E+ H A+  +    K HG  VL+I  LFAK+CS+L++ P A ++ +    +  
Sbjct  394   FFAPIDMEISHGALLNEG---KIHGQTVLRICHLFAKLCSVLRITPGAIQSSD--DNITS  448

Query  597   ALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLV  418
              L  YA+ F  CS S Q+    +  +R+  KS ++V  K++VFLWGF+  +S G +KSL+
Sbjct  449   RLGGYAHSFKSCSVSSQESV--DGRIRIWTKSPRKVGCKHLVFLWGFRDSLSAGMLKSLL  506

Query  417   YGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALD----SGSLEEMVSEGIRAASY  250
              G H+VFS EFD+ LVD+SCA++VF  P LS+  L+ +     SGSL E+VSEG+RAA Y
Sbjct  507   QGSHDVFSEEFDVCLVDKSCAIVVFLQPNLSQAFLDIMSSEGISGSLRELVSEGLRAAGY  566

Query  249   DAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISL  91
             + Y + C LG W+A+LA +L+ A            +  + S ++W +D MI+L
Sbjct  567   ETYKRACGLGYWEADLASALDKASATPDCFSQSG-SETNPSEVYWCNDLMINL  618


 Score =   268 bits (684),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 166/224 (74%), Gaps = 7/224 (3%)
 Frame = -2

Query  1922  LCSMLQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAV  1743
             + +++ RRLFCT IS    +      +  +W +KQVTKSNF+++L+D  + ++ SDF+AV
Sbjct  1     MVALIPRRLFCTKISRNCHQ------HQLQWSVKQVTKSNFNDSLHDFHSHLSSSDFVAV  54

Query  1742  SLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFH  1563
             S Q TG++S+ W R+  FD  E AYLKA+RAA+R+Q+LQFAVCPF++  SK+ A PYNFH
Sbjct  55    SFQNTGSFSAAWHRVSSFDCPETAYLKARRAADRFQLLQFAVCPFTISGSKVTAHPYNFH  114

Query  1562  LFPRDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPS  1383
             LFPRDEL  GMPSYSFSCQ+SYL ++A++GFDFNACI DGISYLSRAQEL AK  + +P 
Sbjct  115   LFPRDELNIGMPSYSFSCQTSYLTAMAQQGFDFNACIYDGISYLSRAQELVAKVRMGNPI  174

Query  1382  AGSCTV-PSPASRSVADSIFINRIKSRVKHWRNACTDQSKKTED  1254
             A    V P+    SVAD+IF+ R+KSRVKHW+ AC D S +  D
Sbjct  175   AIHHVVKPTSTPPSVADTIFVERVKSRVKHWKKACADSSSRKTD  218



>ref|XP_010069587.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X1 
[Eucalyptus grandis]
Length=650

 Score =   279 bits (713),  Expect(2) = 2e-91, Method: Compositional matrix adjust.
 Identities = 160/318 (50%), Positives = 216/318 (68%), Gaps = 16/318 (5%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             A G G   VRV+LTSS+EDK LLE+EL+ +E++  K  +GFREV++LIS +QKP+V+HNS
Sbjct  304   AKGAGAWAVRVILTSSKEDKILLEQELRNLEHEQTKAFQGFREVIELISAAQKPIVSHNS  363

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             LNDF SI+  FLAPLPST+DEF  SL  VFP + DV HLMKE+       +I  A S+LN
Sbjct  364   LNDFASIYPMFLAPLPSTVDEFLQSLCLVFPQVFDVNHLMKEIAPLGKTTDIPTALSFLN  423

Query  783   SRFFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCG-Q  607
             +RF AP+DVE+            K HG NV++I  LFAK+CSIL+    A E+ +  G  
Sbjct  424   NRFVAPIDVEVS----PVTGCEGKIHGLNVVRICHLFAKLCSILR---SASESSKSDGNH  476

Query  606   LPPALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVK  427
                 LER+ANI+ P  ++  DPP  EE + +     +RV+ K+VVFLWGF+ G+S   +K
Sbjct  477   QAGTLERFANIYRPWPSA--DPP--EESISIWRNDTRRVNCKDVVFLWGFRKGLSAKLLK  532

Query  426   SLVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALD----SGSLEEMVSEGIRA  259
             S + G HEVFS  FD+RLVD+SCA+++F  PGLSE LL  ++    SG L ++VSEG++A
Sbjct  533   SQLQGSHEVFSENFDVRLVDKSCAIVIFWQPGLSETLLSIMNSSDISGPLWDLVSEGLKA  592

Query  258   ASYDAYVKVCKLGLWKAN  205
             A Y  YVK+C LGL++A+
Sbjct  593   AGYGMYVKLCGLGLFEAD  610


 Score = 87.0 bits (214),  Expect(2) = 2e-91, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 60/92 (65%), Gaps = 0/92 (0%)
 Frame = -2

Query  1445  GISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSVADSIFINRIKSRVKHWRNACTDQSK  1266
             GISYLSR QE  AK     P  G     S +S SVAD++F+ RI+SR+K W+NA  D S 
Sbjct  188   GISYLSREQECLAKVWKGIPVHGQYLEKSSSSPSVADAVFLERIRSRIKQWKNAFEDSST  247

Query  1265  KTEDVLISSLRKMISATEVHGSRPCLNIDICS  1170
             + ++  + S+RK+I  +E +GSRP + +D+CS
Sbjct  248   RNDEPFVRSMRKLILGSEEYGSRPSMTLDVCS  279



>ref|XP_003622727.1| Poly(A)-specific ribonuclease PARN-like protein [Medicago truncatula]
Length=513

 Score =   278 bits (712),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 163/358 (46%), Positives = 239/358 (67%), Gaps = 12/358 (3%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             + GG TQ VRVVLT S+EDK++LE+EL+ +E + +K +RGFREV+DLIS SQKPV++HN 
Sbjct  164   SKGGTTQAVRVVLTKSREDKEVLERELRSLEEEESKKIRGFREVIDLISASQKPVISHNC  223

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLN  784
             LND T IHSKF+APLPS +DEF  SL ++FP ++DV +L+K+ G+ K + NI  A SY+N
Sbjct  224   LNDCTLIHSKFIAPLPSEVDEFVSSLCKIFPKVIDVNYLLKKSGTMKKVTNIRNALSYMN  283

Query  783   SRFFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQL  604
             + F A V++E+P Q    K    K  G + L++S LF K+CS+LK+ P   E+     QL
Sbjct  284   THFLALVEMEIPDQDTINKG---KIDGLDALRLSYLFMKLCSVLKISPVVTESGNR--QL  338

Query  603   PPALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKS  424
              P LE + N+F  CS + Q+   N EDV V   + ++ + +++VFLWGF+ G++ G +KS
Sbjct  339   APQLEDFTNVFHSCSANIQESSCN-EDVSVWTNNTRKANCEHLVFLWGFKFGMTAGMLKS  397

Query  423   LVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALD----SGSLEEMVSEGIRAA  256
             ++   H++F  EFD++ VD+SCA +VF  PGLS+  L  ++    SG L+E+VS+G+R  
Sbjct  398   VLRESHDIFLEEFDVKFVDKSCAFVVFWEPGLSKDFLNVMNDEQISGGLKELVSDGLRVT  457

Query  255   SYDAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
              Y+ Y  +C+LGLW+ +LA+SLE +LE            K    I W +D +I+LDDL
Sbjct  458   GYETYRTMCRLGLWEIDLAESLEKSLECSLNDTDIHSERK--PEIPWCNDNVINLDDL  513


 Score = 80.9 bits (198),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 64/124 (52%), Gaps = 37/124 (30%)
 Frame = -2

Query  1442  ISYLSRAQELAAKDCIR----SPSAGSCTVPSPASRSVADSIFINRIKSRVKHWRNACTD  1275
             ISYLSRAQE  AK  IR    SPS G     SP +  VAD++FI RI+SR+KHWRN C +
Sbjct  20    ISYLSRAQESVAK--IRLGTSSPSLGVMKSSSPPT--VADTVFIERIRSRIKHWRNTCKN  75

Query  1274  QSKKTE-----------------------------DVLISSLRKMISATEVHGSRPCLNI  1182
                KT                              D LI+S+R +IS +E    RPCLN+
Sbjct  76    SGTKTSKDGKKIFSKFCTMRFFLGSPFILYHSFCADELINSIRNIISGSEQFKLRPCLNV  135

Query  1181  DICS  1170
             D+CS
Sbjct  136   DVCS  139



>ref|XP_002321324.2| hypothetical protein POPTR_0014s175702g, partial [Populus trichocarpa]
 gb|EEE99639.2| hypothetical protein POPTR_0014s175702g, partial [Populus trichocarpa]
Length=345

 Score =   293 bits (750),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 160/310 (52%), Positives = 217/310 (70%), Gaps = 12/310 (4%)
 Frame = -1

Query  1119  VRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLNDFTSIH  940
             VRVVLTSS+EDK LL+ +LQ  E +  K VRGFREV+DLIS SQKPVV+H SLND T IH
Sbjct  5     VRVVLTSSKEDKDLLQGKLQNDEQELKKKVRGFREVIDLISASQKPVVSHGSLNDLTVIH  64

Query  939   SKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSRFFAPVD  760
             SKF+APLP T+DEF  SL   FP ++DV HLMKE+   + + +I VA S L +RFF P+D
Sbjct  65    SKFIAPLPPTVDEFMCSLRLAFPLVIDVNHLMKEISPLRKVTSIPVAISQLKNRFFTPID  124

Query  759   VELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYA  580
             +E+P QA+  + D++  HG NV+KI ELFA++CSILK+DP A ++ E  G    ALE YA
Sbjct  125   MEIPCQAMENE-DTI--HGQNVVKICELFARLCSILKIDPAAVKSDEEKG--ASALEAYA  179

Query  579   NIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLVYGKHEV  400
             NIF P  T+ ++P   E  +++   + + VS +++VFLWGF   ++ G +KSL+   HE 
Sbjct  180   NIFSPFCTASEEPIDGE--IKIWTNNTRTVSCEDMVFLWGFGDRVTAGILKSLLQESHEA  237

Query  399   FSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDS-----GSLEEMVSEGIRAASYDAYVK  235
             FS EFD+RLVD SCA+++F   GL+E  L  ++      G L EMVSEG+RAA Y+ Y +
Sbjct  238   FSKEFDVRLVDNSCAIVIFWQHGLTETFLNTMNKCSDMRGPLREMVSEGLRAAGYETYNR  297

Query  234   VCKLGLWKAN  205
              C+LGLW+++
Sbjct  298   ACRLGLWESS  307



>ref|XP_002321239.2| hypothetical protein POPTR_0014s175701g, partial [Populus trichocarpa]
 gb|EEE99554.2| hypothetical protein POPTR_0014s175701g, partial [Populus trichocarpa]
Length=224

 Score =   275 bits (703),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 165/219 (75%), Gaps = 6/219 (3%)
 Frame = -2

Query  1913  MLQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQ  1734
             +LQRRL  T+++ T  +P        +W +KQVTKSNF++ L DI++ ++ SDF+AVSLQ
Sbjct  7     LLQRRLLSTSVTRTHHKPQQ------QWSVKQVTKSNFADTLEDIKSHVSNSDFVAVSLQ  60

Query  1733  TTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFP  1554
              TG +S+PWQR+ PFDTA+ AYLKAK AAER+Q+L FAVCPF++R SK+ A PYNFHLFP
Sbjct  61    NTGFFSAPWQRVSPFDTADTAYLKAKYAAERFQVLHFAVCPFTVRASKVTAYPYNFHLFP  120

Query  1553  RDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAGS  1374
             R ELK  MPSYSF CQ+S LIS+AR+GFDFN+CINDGISYLSR QE AAK  + +P    
Sbjct  121   RAELKMEMPSYSFYCQTSSLISMARQGFDFNSCINDGISYLSREQESAAKIQMGNPILAK  180

Query  1373  CTVPSPASRSVADSIFINRIKSRVKHWRNACTDQSKKTE  1257
                 S ++ SVADS+F+ RIKS +K+W+ AC + S + E
Sbjct  181   NVTESTSTLSVADSVFVERIKSHIKNWKKACKETSTRKE  219



>gb|EPS58289.1| hypothetical protein M569_16526, partial [Genlisea aurea]
Length=252

 Score =   270 bits (690),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 145/256 (57%), Positives = 177/256 (69%), Gaps = 21/256 (8%)
 Frame = -2

Query  1913  MLQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQ  1734
             ML +RL CT        P +  +    W +KQVTK+NFSEA+ +I   I  SDF+AVSL+
Sbjct  1     MLFKRLLCT--------PAAAYNRRHVWPVKQVTKNNFSEAVAEICDLIHSSDFVAVSLE  52

Query  1733  TTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFP  1554
              TG +++ WQ++L  DT   AYLKAK AAERYQ LQF+VCPFS+  SKL+A PYNFHLFP
Sbjct  53    RTGNHAANWQKILSIDTPGTAYLKAKHAAERYQTLQFSVCPFSVDGSKLLAHPYNFHLFP  112

Query  1553  RDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKD-----CIRS  1389
             RDELK GMP YSFSCQSSYL S+AREGFDFNACI +GISYLSRAQE   K      C+ +
Sbjct  113   RDELKVGMPCYSFSCQSSYLTSMAREGFDFNACIYNGISYLSRAQESVPKIQSGYLCLST  172

Query  1388  PSAGSCTVPSPASRSVADSIFINRIKSRVKHWRNACTDQSKKTE---DVLISSLRKMISA  1218
              S   C+    +S S ADS+F  RIKSRV +W  AC D S KTE   D LIS LRK++S 
Sbjct  173   TSMVQCS----SSNSPADSLFKQRIKSRVANWIKACKD-SNKTEAVADALISYLRKIVSG  227

Query  1217  TEVHGSRPCLNIDICS  1170
             +E  GSRP + I++C+
Sbjct  228   SEFFGSRPSVRINVCT  243



>ref|XP_006847462.1| hypothetical protein AMTR_s00163p00014030 [Amborella trichopoda]
 gb|ERN09043.1| hypothetical protein AMTR_s00163p00014030 [Amborella trichopoda]
Length=340

 Score =   271 bits (694),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 168/226 (74%), Gaps = 9/226 (4%)
 Frame = -2

Query  1835  KWGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAK  1656
             +W IKQ+TKSNFS  L  ++ RI  +DFI VS Q TG +S+PW+R+LP DT E AY K++
Sbjct  16    QWRIKQITKSNFSRILPQVKERIHGADFICVSSQKTGTFSAPWRRILPIDTPETAYCKSR  75

Query  1655  RAAERYQILQFAVCPFSLRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIARE  1476
              AAER+++L F VCP + + +K+IA PYNFHLFPRDEL  GMPSYSFSCQ+SYL S+A+E
Sbjct  76    DAAERFELLHFTVCPITFQGTKVIAYPYNFHLFPRDELNIGMPSYSFSCQTSYLTSMAQE  135

Query  1475  GFDFNACINDGISYLSRAQELAAKDCIRSPSAGSC---TVPSPASR-SVADSIFINRIKS  1308
             GFDFN CI +GISYLSR QE A+K        G+C   T+P  +S+ S AD+IF+   KS
Sbjct  136   GFDFNTCIYNGISYLSRVQESASKH-----QNGNCIPTTIPLTSSKPSFADAIFLEGTKS  190

Query  1307  RVKHWRNACTDQSKKTEDVLISSLRKMISATEVHGSRPCLNIDICS  1170
             RVKHWR+AC D S  ++  L+ SLRK I  +EV+G+RPC+NID+C+
Sbjct  191   RVKHWRDACKDSSGSSDGALMKSLRKHILGSEVYGTRPCINIDVCT  236



>ref|XP_008799185.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X2 
[Phoenix dactylifera]
Length=537

 Score =   265 bits (677),  Expect(2) = 5e-78, Method: Compositional matrix adjust.
 Identities = 138/234 (59%), Positives = 167/234 (71%), Gaps = 11/234 (5%)
 Frame = -2

Query  1847  SNYGKWG--IKQVTKSNFSEALNDIETRITESDFIAVSLQTTG------AYSSPWQRLLP  1692
             S   +WG  +KQ+TKSNFS AL  I+  I ++DFIAVS Q TG      ++  PW+R+LP
Sbjct  5     SGKHRWGGAVKQITKSNFSAALQQIKVHIQDADFIAVSSQKTGDLAASSSHRYPWRRILP  64

Query  1691  FDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFPRDELKTGMPSYSFS  1512
              D AE AYLKAK AAE +++LQFAVCPF  + SK++A PYNFHLFPRDEL  GMPSYSFS
Sbjct  65    IDIAETAYLKAKLAAETFELLQFAVCPFRFQGSKVVAFPYNFHLFPRDELNLGMPSYSFS  124

Query  1511  CQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSVADS  1332
             CQ+S+L S+AREGFDFN  I DGISYLSRAQE  AK+     +    +  S  S SVADS
Sbjct  125   CQTSFLASMAREGFDFNVSIYDGISYLSRAQESIAKE---RTTPRVYSSSSSPSPSVADS  181

Query  1331  IFINRIKSRVKHWRNACTDQSKKTEDVLISSLRKMISATEVHGSRPCLNIDICS  1170
             IFI RIKSRV++WRNAC D     +  L  SLRK+I   EV+GSRP L+ID+CS
Sbjct  182   IFIGRIKSRVENWRNACKDPCNMADGSLAKSLRKLILGGEVYGSRPSLSIDVCS  235


 Score = 56.2 bits (134),  Expect(2) = 5e-78, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -1

Query  1134  GGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNSLN  958
             GG + VRVVLTSS+EDK LL  E+Q +E + N  VRGFREV+DLIS S+KP++A+N L+
Sbjct  263   GGAKSVRVVLTSSEEDKNLLMSEIQNLEEEQNLKVRGFREVIDLISSSKKPIIAYNCLH  321


 Score =   137 bits (346),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 85/210 (40%), Positives = 138/210 (66%), Gaps = 11/210 (5%)
 Frame = -1

Query  696  VLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDPCSTSYQDPPINEEDVR  517
            VLK++ +FAK+  +LK+ P    ++   GQ    +E YANIF P S S Q+     +DV 
Sbjct  334  VLKLTRVFAKLGILLKIVPDCQTSL---GQHTVPIEEYANIFYPISNSLQES--EADDVD  388

Query  516  VRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLVYGKHEVFSSEFDIRLVDESCAVLVFSS  337
                + +++S+ ++VF+WGF+ G S  ++K+ +   H VFS + +++LVD++CAV+VF  
Sbjct  389  FHMDNVRKISTDDLVFIWGFREGTSAAELKNHLRQTHSVFSEDIELQLVDKTCAVVVFQK  448

Query  336  PGLSEVLLEALDSG-----SLEEMVSEGIRAASYDAYVKVCKLGLWKANladslelalee  172
             G +E LL+ + SG     +  +++SEG++AA Y+AY KVC+LG+W+A LADSL+ AL E
Sbjct  449  SGSAEALLKEIGSGMTNSTAPSKIISEGLKAAGYEAYKKVCRLGMWEAELADSLDCALSE  508

Query  171  eseclseAHTAKDLSVIHWNSDEMISLDDL  82
             S  L+ + + +D S I+W+S+ MI L+DL
Sbjct  509  PSGDLTIS-SGEDASEIYWSSESMIDLNDL  537



>ref|XP_007049586.1| Poly(A)-specific ribonuclease PARN-like, putative isoform 3 [Theobroma 
cacao]
 gb|EOX93743.1| Poly(A)-specific ribonuclease PARN-like, putative isoform 3 [Theobroma 
cacao]
Length=508

 Score =   268 bits (685),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/225 (57%), Positives = 169/225 (75%), Gaps = 8/225 (4%)
 Frame = -2

Query  1922  LCSMLQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAV  1743
             + +++ RRLFCT IS    +      +  +W +KQVTKSNF+++L+D  + ++ SDF+AV
Sbjct  1     MVALIPRRLFCTKISRNCHQ------HQLQWSVKQVTKSNFNDSLHDFHSHLSSSDFVAV  54

Query  1742  SLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFH  1563
             S Q TG++S+ W R+  FD  E AYLKA+RAA+R+Q+LQFAVCPF++  SK+ A PYNFH
Sbjct  55    SFQNTGSFSAAWHRVSSFDCPETAYLKARRAADRFQLLQFAVCPFTISGSKVTAHPYNFH  114

Query  1562  LFPRDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPS  1383
             LFPRDEL  GMPSYSFSCQ+SYL ++A++GFDFNACI DGISYLSRAQEL AK  + +P 
Sbjct  115   LFPRDELNIGMPSYSFSCQTSYLTAMAQQGFDFNACIYDGISYLSRAQELVAKVRMGNPI  174

Query  1382  AGSCTV-PSPASRSVADSIFINRIKSRVKHWRNACTD-QSKKTED  1254
             A    V P+    SVAD+IF+ R+KSRVKHW+ AC D  S+KT+D
Sbjct  175   AIHHVVKPTSTPPSVADTIFVERVKSRVKHWKKACADSSSRKTDD  219


 Score =   242 bits (617),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 131/294 (45%), Positives = 189/294 (64%), Gaps = 12/294 (4%)
 Frame = -1

Query  960  NDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNS  781
            +DF+ IHSKF+ PLP  +DEF  SL  VFPH+ DV HLMKE+G  +N+ NI  A SYL +
Sbjct  218  DDFSVIHSKFIGPLPLNMDEFLCSLRLVFPHVFDVNHLMKEIGPLENVTNIPAAISYLKN  277

Query  780  RFFAPVDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLP  601
            RFFAP+D+E+ H A+  +    K HG  VL+I  LFAK+CS+L++ P A ++ +    + 
Sbjct  278  RFFAPIDMEISHGALLNEG---KIHGQTVLRICHLFAKLCSVLRITPGAIQSSD--DNIT  332

Query  600  PALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSL  421
              L  YA+ F  CS S Q+    +  +R+  KS ++V  K++VFLWGF+  +S G +KSL
Sbjct  333  SRLGGYAHSFKSCSVSSQESV--DGRIRIWTKSPRKVGCKHLVFLWGFRDSLSAGMLKSL  390

Query  420  VYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALD----SGSLEEMVSEGIRAAS  253
            + G H+VFS EFD+ LVD+SCA++VF  P LS+  L+ +     SGSL E+VSEG+RAA 
Sbjct  391  LQGSHDVFSEEFDVCLVDKSCAIVVFLQPNLSQAFLDIMSSEGISGSLRELVSEGLRAAG  450

Query  252  YDAYVKVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISL  91
            Y+ Y + C LG W+A+LA +L+ A            +  + S ++W +D MI+L
Sbjct  451  YETYKRACGLGYWEADLASALDKASATPDCFSQSG-SETNPSEVYWCNDLMINL  503



>ref|XP_008678596.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Zea mays]
 gb|AFW62306.1| hypothetical protein ZEAMMB73_533831 [Zea mays]
 gb|AFW62307.1| hypothetical protein ZEAMMB73_533831 [Zea mays]
Length=244

 Score =   241 bits (616),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 155/221 (70%), Gaps = 6/221 (3%)
 Frame = -2

Query  1823  KQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAE  1644
             KQVT+ NF+EA+ ++   +   D++AV+ Q TGA +  W+R LP DTAE AYLKAK AAE
Sbjct  12    KQVTRQNFAEAVLELRAHLEACDYVAVAAQKTGAPTG-WRRALPVDTAETAYLKAKLAAE  70

Query  1643  RYQILQFAVCPFSLRES---KLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
              +Q LQ AVCPF  R S    L+A PYNFHLFPRDEL+ GMPSYSFSCQ  YL +IA +G
Sbjct  71    SFQPLQIAVCPFRQRNSYPSTLVAYPYNFHLFPRDELQLGMPSYSFSCQPCYLSTIANDG  130

Query  1472  FDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSVADSIFINRIKSRVKHW  1293
             FDFN CI DGISYLSR QE  A++ I +P        S  + SVADS+F+NRIKSR+ +W
Sbjct  131   FDFNMCIYDGISYLSRVQESLAREKIFTPRPHQLL--SSPNTSVADSVFMNRIKSRIVNW  188

Query  1292  RNACTDQSKKTEDVLISSLRKMISATEVHGSRPCLNIDICS  1170
             R    D SKK +  L+SSL ++I   E +GSRP ++ID+CS
Sbjct  189   RKRYADPSKKHDGSLVSSLSRLILGAETYGSRPSMSIDVCS  229



>ref|NP_001061902.1| Os08g0440200 [Oryza sativa Japonica Group]
 dbj|BAF23816.1| Os08g0440200 [Oryza sativa Japonica Group]
Length=291

 Score =   240 bits (612),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/220 (54%), Positives = 154/220 (70%), Gaps = 6/220 (3%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAER  1641
             QVTK NF+EA+ D+   +   D++A++ Q TGA +  W+R LP DT E AYLKAK AAE 
Sbjct  15    QVTKRNFAEAVQDLAAHVEACDYVAIAAQRTGAPTG-WRRALPVDTPETAYLKAKLAAES  73

Query  1640  YQILQFAVCPFSLRE---SKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGF  1470
             +Q L FA+CPF +     S L+A PYNFHLFPRDEL+ GMP+YSFSCQSSYL S+A  GF
Sbjct  74    FQPLHFAICPFRVDATSPSTLVAYPYNFHLFPRDELQLGMPAYSFSCQSSYLSSMAHSGF  133

Query  1469  DFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSVADSIFINRIKSRVKHWR  1290
             DFN CI DGISYLSRAQE  A++ I  P     +  S  S S+ADS+F+ RIKSR++HWR
Sbjct  134   DFNMCIYDGISYLSRAQESLARERIFIPHVRQLS--SSPSTSIADSVFLTRIKSRIEHWR  191

Query  1289  NACTDQSKKTEDVLISSLRKMISATEVHGSRPCLNIDICS  1170
                T   K  +  L+++LR++I  +E +GSRP  +ID+CS
Sbjct  192   KGYTKPCKTADGSLVNTLRQLILGSESYGSRPSFSIDVCS  231



>gb|EMT01997.1| Poly(A)-specific ribonuclease PARN-like protein [Aegilops tauschii]
Length=586

 Score =   201 bits (512),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 124/325 (38%), Positives = 194/325 (60%), Gaps = 15/325 (5%)
 Frame = -1

Query  1050  NKHNKCVRGFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFP  871
             ++ N   RGFREV+DL++ S+KP++++N LND T +H++F+APLP  L EF  S   VF 
Sbjct  270   DEQNLKFRGFREVIDLVASSEKPIISYNCLNDLTMMHTQFIAPLPPNLHEFMCSSRLVFS  329

Query  870   HILDVKHLMKELGSQKNLNNIYVATSYLNSRFFAPVDVELPHQAISTKADSVKSHGHNVL  691
              ++D+ HL +E+   +   NI  A SYL  ++F P+++E+P Q   TK   V   G NVL
Sbjct  330   SVVDIGHLWREISPLRKAKNIQAALSYLQRQYFVPMEIEIPLQD-GTKG--VTKSGENVL  386

Query  690   KISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDP-CSTSYQDPPINEEDVRV  514
             +I++LFAK+  +LK+ PK        G+    +E + NI  P C     D      D   
Sbjct  387   RITKLFAKLSKLLKITPKCQ---SQSGEQHYTVEDHRNILYPGCMVEESDGVDCTND--N  441

Query  513   RAKSCKRVSSKNVVFLWGFQSGISTGQVKSLVYGKHEVFSSEFDIRLVDESCAVLVF-SS  337
              + + + VS+++VVFLWGF+   S  +++S +   H VFS +FD+RL+D++C+ L+F SS
Sbjct  442   ESDTTRTVSTQSVVFLWGFRE-TSAEELRSRLARLHHVFSKDFDLRLLDKTCSALIFRSS  500

Query  336   PGLSEVLLE-ALDSGSLEEMVSEGIRAASYDAYVKVCKLGLWKANladslelaleeesec  160
                SE+L + +L+S SL    SEG++AA +D Y K C  GLW ++LA++LE A  E +  
Sbjct  501   DAASELLRDISLESPSLNNFFSEGLKAAGFDVYRKACSSGLWDSDLAEALESASLEPATS  560

Query  159   lseAHTAKDLSVIHWNSDEMISLDD  85
                 H + +   I+WNS   + L +
Sbjct  561   TISEHGSSE---IYWNSSLKLDLKE  582


 Score = 75.1 bits (183),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 68/124 (55%), Gaps = 10/124 (8%)
 Frame = -2

Query  1823  KQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAE  1644
             KQVT+ NF EAL ++   + E   +A++    GA +  W+R LP DT E AYLKAK A+E
Sbjct  8     KQVTRRNFPEALRELAAHVKECVCVAIAAVKAGAPTG-WRRALPVDTVETAYLKAKFASE  66

Query  1643  RYQILQFAVCPFSLRE---SKLIASPYNF-----HLFPRDELKTGMPSYSFSCQSSYLIS  1488
              +Q L  AVCPF L     S ++A P  F     + FP D L+  +P  +  C S    +
Sbjct  67    SFQPLHIAVCPFRLGSASGSDVVAYPVWFRQPGSNTFP-DCLRLDVPMMARGCLSILDGA  125

Query  1487  IARE  1476
             +A E
Sbjct  126   VAEE  129



>ref|XP_003622728.1| Poly(A)-specific ribonuclease PARN-like protein [Medicago truncatula]
Length=206

 Score =   189 bits (479),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 120/157 (76%), Gaps = 14/157 (9%)
 Frame = -2

Query  1907  QRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQTT  1728
             Q+R  CT IS +            KW +KQVT SNF+++L +I+T I+ SDFIA+S++ T
Sbjct  14    QKRSLCTKISSS------------KWKVKQVTISNFNDSLEEIKTNISNSDFIAISMEKT  61

Query  1727  GAYSS-PWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESK-LIASPYNFHLFP  1554
             G+ S+ PW R+ PFDTAE AYLKA ++A+R+Q+LQFAVCPFS+ +S  L+A PYNF LFP
Sbjct  62    GSSSTTPWHRVQPFDTAETAYLKASQSAQRFQLLQFAVCPFSVTDSNNLVAHPYNFLLFP  121

Query  1553  RDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDG  1443
             RDELK GMP+YSF CQ+S+L ++AR+GFDFNACI +G
Sbjct  122   RDELKLGMPAYSFLCQTSHLATMARQGFDFNACIYEG  158



>ref|XP_008465472.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X1 
[Cucumis melo]
Length=170

 Score =   185 bits (470),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 107/156 (69%), Gaps = 14/156 (9%)
 Frame = -2

Query  1910  LQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQT  1731
             L RRL+ T   +              W IKQV  SNF   L D++  I++SDFIA  LQ 
Sbjct  10    LHRRLYTTTTDQ--------------WSIKQVRNSNFHGCLGDLKNHISDSDFIAFFLQR  55

Query  1730  TGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFPR  1551
             TG+ S PW R  PFDT + AY KAK AAE++QILQF++CPFS+R+SKLIA PYNFHLFPR
Sbjct  56    TGSSSFPWHRPQPFDTLDTAYCKAKYAAEKFQILQFSLCPFSVRDSKLIAHPYNFHLFPR  115

Query  1550  DELKTGMPSYSFSCQSSYLISIAREGFDFNACINDG  1443
             DEL  GMPSYSFSCQ S+L SIARE FDF A + DG
Sbjct  116   DELNIGMPSYSFSCQVSHLTSIAREDFDFGAWVYDG  151



>ref|XP_008465473.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X2 
[Cucumis melo]
Length=160

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 106/155 (68%), Gaps = 14/155 (9%)
 Frame = -2

Query  1910  LQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQT  1731
             L RRL+ T   +              W IKQV  SNF   L D++  I++SDFIA  LQ 
Sbjct  10    LHRRLYTTTTDQ--------------WSIKQVRNSNFHGCLGDLKNHISDSDFIAFFLQR  55

Query  1730  TGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESKLIASPYNFHLFPR  1551
             TG+ S PW R  PFDT + AY KAK AAE++QILQF++CPFS+R+SKLIA PYNFHLFPR
Sbjct  56    TGSSSFPWHRPQPFDTLDTAYCKAKYAAEKFQILQFSLCPFSVRDSKLIAHPYNFHLFPR  115

Query  1550  DELKTGMPSYSFSCQSSYLISIAREGFDFNACIND  1446
             DEL  GMPSYSFSCQ S+L SIARE FDF A + D
Sbjct  116   DELNIGMPSYSFSCQVSHLTSIAREDFDFGAWVYD  150



>ref|NP_001169910.1| uncharacterized protein LOC100383807 [Zea mays]
 gb|ACN35230.1| unknown [Zea mays]
Length=280

 Score =   181 bits (460),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 103/291 (35%), Positives = 172/291 (59%), Gaps = 19/291 (7%)
 Frame = -1

Query  945  IHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELGSQKNLNNIYVATSYLNSRFFAP  766
            +H+KF+APLP  + EF  SL  VFP+++D+ HL +++G  +   NI  A SYL  ++F P
Sbjct  2    LHTKFIAPLPPNMHEFMCSLKMVFPNVVDISHLWRQIGPLRKAKNIQAALSYLQRQYFVP  61

Query  765  VDVELPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAP-EAIEHCGQLPPALE  589
            +++E+P Q       S+  +  NVL+I++LFAK+ ++LK+ P+   ++ E C     A+E
Sbjct  62   IEIEIPQQ---DGTSSITKNEQNVLRITKLFAKLSNLLKISPECQLQSREQCT----AVE  114

Query  588  RYANIFDP-CSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLVYG  412
             Y NIF P C     D    + +    + + + VS+ N++FLWGF+   S  ++KS + G
Sbjct  115  EYCNIFYPSCVVGGSD----DANFAFESDTTETVSTDNIIFLWGFREK-SVKELKSYLIG  169

Query  411  KHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDSG--SLEEMVSEGIRAASYDAYV  238
             H+ FS +F+++L+D++C+ L+F     +  LL+ + S   SL    SEG++AA ++ Y 
Sbjct  170  LHQAFSEDFEVKLLDKTCSALIFRDSNTAMQLLKEIGSEGPSLNRFFSEGLKAAGFEVYK  229

Query  237  KVCKLGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDD  85
            KVC+LGLW ++LA+ LE    E         +    S I+WNS+ M+ L +
Sbjct  230  KVCRLGLWDSDLAEVLEDVSSELGVPTLPECST---SQIYWNSELMLDLKE  277



>ref|XP_004292332.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Fragaria 
vesca subsp. vesca]
Length=221

 Score =   173 bits (438),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 102/228 (45%), Positives = 149/228 (65%), Gaps = 11/228 (5%)
 Frame = -1

Query  753  LPHQAISTKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANI  574
            +PH   S   +  KSH HNV+KI  LFAK+C+ILK+ P+  + I++   L PA E Y NI
Sbjct  1    MPHDCYS--ENEGKSHRHNVVKICYLFAKLCTILKI-PENAKPIDY-HLLAPATEEYTNI  56

Query  573  FDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLVYGKHEVFS  394
             +P S   Q+  INE D+R+   + +++S  ++ F+WGF+SG + G +KS++    ++FS
Sbjct  57   SNPLSNIPQES-INE-DIRIWRSNMRKISCNHLAFVWGFRSGYTAGMLKSMLQTSRDIFS  114

Query  393  SEFDIRLVDESCAVLVFSSPGLSEVLLEALDS----GSLEEMVSEGIRAASYDAYVKVCK  226
             +FD+RLVD+SCA++VF  PGLSE  L+ + +    GSL EMVSEG+RA SY  Y +VC 
Sbjct  115  EDFDVRLVDKSCAIVVFRQPGLSETFLDVVSNEDICGSLREMVSEGLRATSYQTYKRVCN  174

Query  225  LGLWKANladslelaleeeseclseAHTAKDLSVIHWNSDEMISLDDL  82
            LGLW+A+LADSL+ ALE     +    T     ++ W++D MI+ DDL
Sbjct  175  LGLWEADLADSLDKALEHPDYNMEADSTTNRREIL-WSTDSMINFDDL  221



>ref|XP_004148252.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Cucumis sativus]
 ref|XP_004169292.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Cucumis sativus]
 gb|KGN56034.1| hypothetical protein Csa_3G048430 [Cucumis sativus]
Length=700

 Score =   168 bits (426),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 89/222 (40%), Positives = 130/222 (59%), Gaps = 15/222 (7%)
 Frame = -2

Query  1910  LQRRLFC----TAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAV  1743
             LQRRLFC    T  S  A    S  SN   + +K VTKSNF  AL+++ + +  +DF+A+
Sbjct  10    LQRRLFCFIRTTNYSSAAVTAPSTASN-SSFPLKNVTKSNFEAALSELRSHVRAADFVAI  68

Query  1742  SLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESK--LIASPYN  1569
              L+ TG  S+PW+ LL FD  ++ YL  K +AE++ +LQF +CPF    +K   +A P+N
Sbjct  69    DLEMTGITSAPWRDLLEFDRFDVRYLNVKDSAEKFAVLQFGICPFRWDSAKNSFVAHPHN  128

Query  1568  FHLFPRDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAK-----  1404
             F +FPR E++   PS  F CQ++ +  +A+  FDFNACI +GISYLSRA E AA+     
Sbjct  129   FFIFPRHEIEVDGPSSEFLCQTTSMEFLAKYQFDFNACIYEGISYLSRAHEDAARKRLNF  188

Query  1403  ---DCIRSPSAGSCTVPSPASRSVADSIFINRIKSRVKHWRN  1287
                D +   S+    V       + D +F  R+K+R+  WR+
Sbjct  189   AYGDEMLDASSNVTNVMDKKRVGIPDVLFKERMKNRLHEWRD  230


 Score = 91.3 bits (225),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 92/316 (29%), Positives = 141/316 (45%), Gaps = 68/316 (22%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL+S  +K +V HN   D   IH KF+  LPST +EF  SLG+ FP+I+D K L
Sbjct  337   GFRHVIDLLSSEKKLIVGHNCFLDMLHIHRKFIGSLPSTTEEFVSSLGKHFPYIMDTKIL  396

Query  846   MKELGSQKNLNNIYVA-TSYLNSRFFAPVDVELPHQAIST--------------------  730
             +       N NNI +   +  N+   +   +  PH A S+                    
Sbjct  397   L-------NGNNILIRRMNKSNTSLSSAFGLLCPHIAFSSQRVSAWNSGVQVEVQVDDLR  449

Query  729   --KADSVKSH--GHNVLKISELFAKVCSILK---VDPKAPEAI-------EHCGQLPPAL  592
               K +S  +H  G++      +FA+ C ++    VD    E +       +H  +L  + 
Sbjct  450   SSKWNSGDTHEAGYDAFMTGCVFAQACDLMGIDFVDRSTSENLLGNEILQKHINRLYLSW  509

Query  591   ERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLV--  418
              R  +I D  ST  Q      E    R    K VS +N+V +WGF + ++  ++K+ +  
Sbjct  510   AR-GDIID-LSTGNQVT----ESFTTRKHRAK-VSFQNIVLIWGFPTNLTARKIKACISK  562

Query  417   -YGKHEVFSSEFDIRLVDESCAVLVFSSPGL-SEVL-----LEALDS-----GSLEEMVS  274
              +G+  V S    +  +DES   + F+ P + SE L     LE  D        L E+  
Sbjct  563   AFGQTNVSS----VNHLDESAVFVQFTKPEMVSEFLDLKEKLEKRDDPLSVLHPLTELFD  618

Query  273   -EGIRAASYDAYVKVC  229
                  AA Y+AY K+C
Sbjct  619   VRTTHAAGYEAYKKIC  634



>ref|XP_008449056.1| PREDICTED: poly(A)-specific ribonuclease PARN [Cucumis melo]
Length=702

 Score =   164 bits (415),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/220 (40%), Positives = 129/220 (59%), Gaps = 15/220 (7%)
 Frame = -2

Query  1904  RRLFC----TAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSL  1737
             RRLFC    T  S  A    +  SN   + +K VTKSNF  AL+++ + +  +DF+AV L
Sbjct  10    RRLFCFIRTTNYSSAAVTAPATASN-SSFPLKNVTKSNFEAALSELRSHVRAADFVAVDL  68

Query  1736  QTTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESK--LIASPYNFH  1563
             + TG  S+PW+ LL FD  ++ YL  K +AE++ ++QF VCPF    +K   +A P+NF 
Sbjct  69    EMTGITSAPWRDLLEFDRFDVRYLNVKDSAEKFAVVQFGVCPFRWDSAKKSFVAHPHNFF  128

Query  1562  LFPRDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAK-------  1404
             +FPR E++   PS  F C+++ L  +A+  FDFNACI +GISYLSRA E AA+       
Sbjct  129   IFPRHEIEVDGPSSEFLCRTTSLEFLAKYQFDFNACIYEGISYLSRAHEDAARKRLNFAY  188

Query  1403  -DCIRSPSAGSCTVPSPASRSVADSIFINRIKSRVKHWRN  1287
              D +   S+    V       +AD +F  R+K+R+  WR+
Sbjct  189   GDEMLDASSNVTNVRDKKRVGIADVLFRERMKNRLHEWRD  228


 Score = 89.4 bits (220),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 88/311 (28%), Positives = 141/311 (45%), Gaps = 58/311 (19%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL+S  +K +V HN   D   IH KF+  LPST +EF  S G+ FP+++D K L
Sbjct  335   GFRHVIDLLSSEKKLIVGHNCFLDMLHIHRKFIGSLPSTAEEFVSSFGKHFPYVMDTKIL  394

Query  846   MKE---LGSQKNLNNIYVATSY----------------LNSRFFAPVDVELPHQAISTKA  724
             + +   L  + N +N  +++++                LN      V V+      S+K 
Sbjct  395   LNDNYILRRRMNKSNTSLSSAFGSLCPHIAFSSLRVNALNDCVQVEVQVD---DLRSSKW  451

Query  723   DSVKSH--GHNVLKISELFAKVCSILK---VDPKAPEAIEHCGQLPPALER-YAN-----  577
             +S   H  G++      +FA+ C+++    VD    + +     L   + R Y N     
Sbjct  452   NSGDKHEAGYDAFMTGCVFAQACNLMGIDFVDCSTSKNLVDNEILQKHINRLYLNWASGD  511

Query  576   IFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVK---SLVYGKH  406
             I D  + +           RV      RVS +N+V +WGF + ++  ++K   S V+G+ 
Sbjct  512   IIDLSTGNQVTESFKTRKHRV------RVSFENIVLIWGFSTNLTARKIKACISKVFGQA  565

Query  405   EVFSSEFDIRLVDESCAVLVFSSPGL-SEVL-----LEALDS-----GSLEEMV-SEGIR  262
              V S    +  +DES   + F+ P + SE L     LE  D        L E+  +    
Sbjct  566   NVSS----VNHLDESAVFVQFTKPEMVSEFLNLKEKLEKRDDPISVLHPLTELFDARATH  621

Query  261   AASYDAYVKVC  229
             AA Y+AY K+C
Sbjct  622   AAGYEAYKKIC  632



>ref|XP_010273436.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X2 [Nelumbo 
nucifera]
Length=723

 Score =   164 bits (415),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 117/194 (60%), Gaps = 12/194 (6%)
 Frame = -2

Query  1832  WGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKR  1653
             + +K+VTK+NF  AL D+   + ++DF++  L+ TG  S+PW+    FD  ++ YLK K 
Sbjct  35    FSVKKVTKTNFESALEDLRRHVRDADFVSFDLEMTGVTSAPWRDSFEFDRFDVRYLKVKD  94

Query  1652  AAERYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAR  1479
             +AE++ ++QF VCPF    SK   +A P+NF++FPR EL    P+Y F CQ+S +  +A+
Sbjct  95    SAEKFAVVQFGVCPFRWDASKESFVAHPHNFYIFPRKELTVDGPAYEFLCQTSSIDFLAK  154

Query  1478  EGFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPS---------PASRSVADSIF  1326
               FDFNACI++GISYLSRAQE  +  C+     G  +            P  R+ AD +F
Sbjct  155   HQFDFNACIHEGISYLSRAQEAESLRCLNLAHGGEISNSGSHLEDFKDIPLVRT-ADILF  213

Query  1325  INRIKSRVKHWRNA  1284
               R+K+R   WR+ 
Sbjct  214   TERMKNRFSEWRDG  227


 Score = 79.3 bits (194),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 80/315 (25%), Positives = 144/315 (46%), Gaps = 52/315 (17%)
 Frame = -1

Query  1038  KCVRGFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILD  859
             K   GFR+V+DL+S  +K +V HN   D   I++KF  PLP+T++EF  S+   FP+I+D
Sbjct  329   KNALGFRQVIDLLSSEKKLLVGHNCFLDIAHIYNKFFGPLPATVEEFVSSVHENFPYIID  388

Query  858   VKHLM------KELGSQKNLN----------NIYVA--TSYLNSRFFAPVDVELPHQAIS  733
              KHL+      + L  +K+ +           I  A  +S L S  F  V+V++     S
Sbjct  389   TKHLLNVESVIQHLMKKKSTSLSSAFSLLCPQIAFASRSSALASHPFVKVEVQVDEMRSS  448

Query  732   TKADSVKSH-GHNVLKISELFAKVCSILKVDPKA---PEAIEHCGQLPPALERYANIF--  571
                   K   G++      +FA+VC  L ++ +    P  + +  +    L+++ N+   
Sbjct  449   NWNSGAKHEAGYDAFMTGCVFAQVCRHLDINFQVLSLPTELVNSEK----LQKHINLLYL  504

Query  570   -----DPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVK---SLVY  415
                  D  + S +D            +   ++   N+V +WGF S +  G+++   + V+
Sbjct  505   SWNNGDVINLSSRDISSQSFVSHNHIRRYPKIVFSNIVLIWGFPSKLKPGELRECVTKVF  564

Query  414   GKHEVFSSEFDIRLVDESCAVLVFSSPGLS---EVLLEALDSGS--------LEEMVSEG  268
             G   V S    I  +D++ A + F+         VL E L+  +        L +++  G
Sbjct  565   GPGSVTS----IYYLDKTAAFIQFNKEEFVFDFLVLKETLERNNDPISILHPLSKLLEGG  620

Query  267   -IRAASYDAYVKVCK  226
                AA+Y+ Y ++C+
Sbjct  621   KTGAATYEVYKEICR  635



>ref|XP_010273437.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X3 [Nelumbo 
nucifera]
Length=470

 Score =   159 bits (403),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 117/195 (60%), Gaps = 13/195 (7%)
 Frame = -2

Query  1832  WGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKR  1653
             + +K+VTK+NF  AL D+   + ++DF++  L+ TG  S+PW+    FD  ++ YLK K 
Sbjct  35    FSVKKVTKTNFESALEDLRRHVRDADFVSFDLEMTGVTSAPWRDSFEFDRFDVRYLKVKD  94

Query  1652  AAERYQILQFAVCPFSLRESK--LIASP-YNFHLFPRDELKTGMPSYSFSCQSSYLISIA  1482
             +AE++ ++QF VCPF    SK   +A P +NF++FPR EL    P+Y F CQ+S +  +A
Sbjct  95    SAEKFAVVQFGVCPFRWDASKESFVAHPRHNFYIFPRKELTVDGPAYEFLCQTSSIDFLA  154

Query  1481  REGFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPS---------PASRSVADSI  1329
             +  FDFNACI++GISYLSRAQE  +  C+     G  +            P  R+ AD +
Sbjct  155   KHQFDFNACIHEGISYLSRAQEAESLRCLNLAHGGEISNSGSHLEDFKDIPLVRT-ADIL  213

Query  1328  FINRIKSRVKHWRNA  1284
             F  R+K+R   WR+ 
Sbjct  214   FTERMKNRFSEWRDG  228


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR+V+DL+S  +K +V HN   D   I++KF  PLP+T++EF  S+   FP+I+D KHL
Sbjct  334   GFRQVIDLLSSEKKLLVGHNCFLDIAHIYNKFFGPLPATVEEFVSSVHENFPYIIDTKHL  393

Query  846   M  844
             +
Sbjct  394   L  394



>gb|KHF97874.1| Poly (A)-specific ribonuclease PARN -like protein [Gossypium 
arboreum]
Length=718

 Score =   161 bits (408),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 117/191 (61%), Gaps = 12/191 (6%)
 Frame = -2

Query  1826  IKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAA  1647
             +K VT+SNF  AL ++ + +  +DF+A+ ++ TG  S+PW+    FD  +I YLK K +A
Sbjct  32    LKHVTRSNFESALVELRSHVRAADFVAIDMEMTGVTSAPWRESFEFDRFDIRYLKVKDSA  91

Query  1646  ERYQILQFAVCPF---SLRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIARE  1476
             E++ +LQF VCPF   SL++S  IA P+NF +F R E+     SY F CQ++ +  +A+ 
Sbjct  92    EKFAVLQFGVCPFRWDSLKQS-FIAHPHNFFVFARQEIPLDRTSYEFLCQTTSMDFLAKY  150

Query  1475  GFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRS--------VADSIFIN  1320
              FDFNACI++GISYLSR QE  A+  + SP     T PS   R         VAD +F  
Sbjct  151   QFDFNACIHEGISYLSRGQEDEARKRLISPKGDQLTHPSHNLRETTDLPLVRVADVLFTE  210

Query  1319  RIKSRVKHWRN  1287
             R+K R+  WR+
Sbjct  211   RMKKRLGEWRD  221


 Score = 77.8 bits (190),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 84/310 (27%), Positives = 139/310 (45%), Gaps = 52/310 (17%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL+S   K +V HN + D   +HSKFLAPLPST +EF   + + FP I+D K L
Sbjct  327   GFRHVIDLLSSENKLIVGHNCILDIAHVHSKFLAPLPSTAEEFVSCVNKYFPSIIDTKIL  386

Query  846   MK-ELGSQKNLNNIY-------------VATSYL-NSRFFAP-VDVELP-HQAISTKADS  718
             +  +   Q+ +                 +A  +  N   + P V VE+   +  S+  +S
Sbjct  387   LNADYTLQRKMKRSSTSLSSAFSLLCPEIAHGFTRNVLSYEPCVKVEVHVDEMRSSNWNS  446

Query  717   VKSH--GHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDPCSTSYQD  544
                H  G++      +FA+ CS L +D +     E+  Q    L+++ N+      S+  
Sbjct  447   GAKHEAGYDAFMTGCVFAQACSHLGIDFQLHSPSENLTQ-NEKLQKHMNLL---YLSW--  500

Query  543   PPINEEDVRVRA--------------KSCKRVSSKNVVFLWGFQSGISTGQVKSLV---Y  415
               IN + + +R               K  +++  KN++ LWGF S +    ++  +    
Sbjct  501   --INGDIIDLRTGNRSAELSGSNMIRKPYRKILFKNILLLWGFPSKLKPSMIRDCICKTL  558

Query  414   GKHEV---FSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDSGS----LEEMVSEG-IRA  259
             G   V   +  +     V  S A LV     L E L ++ D+ S    L +++  G   A
Sbjct  559   GPTSVICTYGIDQTAVFVQFSKAELVSDFLNLKETLEQSNDAISHLHPLSQLLEGGNTHA  618

Query  258   ASYDAYVKVC  229
             ASY+ Y ++C
Sbjct  619   ASYETYKEIC  628



>ref|XP_009391781.1| PREDICTED: poly(A)-specific ribonuclease PARN [Musa acuminata 
subsp. malaccensis]
Length=714

 Score =   160 bits (406),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 83/200 (42%), Positives = 118/200 (59%), Gaps = 12/200 (6%)
 Frame = -2

Query  1829  GIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRA  1650
              +K+VT+SNF  AL D+   + E+DF+AV L+ TG  S+PW+    FD +++ YLK K +
Sbjct  41    AVKKVTRSNFEPALEDLRALVREADFVAVDLEMTGVTSAPWRDSFEFDRSDVRYLKLKDS  100

Query  1649  AERYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIARE  1476
             AE++ ++QF VCPF    S+   +A P+NF++FPR EL    PSY F CQ++ +  +A+ 
Sbjct  101   AEKFAVVQFGVCPFRWEPSRGSFVAYPHNFYVFPRKELPVHGPSYEFLCQTTSIDFLAKY  160

Query  1475  GFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCT---------VPSPASRSVADSIFI  1323
              FDFNACI +GISYLSRAQE  A   + S                V  P  R+ AD  F 
Sbjct  161   QFDFNACIREGISYLSRAQEAEALKYLSSKYLDGLANSFCNLEEHVDIPLVRT-ADLFFS  219

Query  1322  NRIKSRVKHWRNACTDQSKK  1263
              R+K + + WR+A    S K
Sbjct  220   ERMKIKFQEWRDAILKGSDK  239


 Score = 73.9 bits (180),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 76/301 (25%), Positives = 119/301 (40%), Gaps = 40/301 (13%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR VVDL++   K +V HN L D   I+SKF  PLPS++ EF  ++   FP+I+D KHL
Sbjct  337   GFRHVVDLLASDGKLIVGHNCLLDLAHIYSKFFGPLPSSMMEFILAVHEKFPYIIDTKHL  396

Query  846   MKELGSQKNLNNIYVATSYLNSRFFAP------------VDVELPHQAISTKADSVKS--  709
             +      + L      +         P              V    QA  T +    S  
Sbjct  397   LNSSQVIQFLMKRSSKSLSSAFSLLCPKVSSVSQNSTSSTYVRFEIQADETGSSCFNSGA  456

Query  708   ---HGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDPCSTSYQDPP  538
                 G++      +FA+ CS L +  +    +    +    ++ Y N+  P   S     
Sbjct  457   KHEAGYDAFMTGCVFAQACSHLGIKFEVHTPLYDLAR-NGKIKNYINVLYPSWNSGTVLH  515

Query  537   IN---EEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSL---VYGKHEVFSSEFDIR  376
             +N   E       +    V   N+V +WGF S      +K     V+G   + S    I 
Sbjct  516   LNTGTESPESGYKRKYPAVVFANIVLIWGFPSKFKPKDLKDCVCRVFGPDSITS----IF  571

Query  375   LVDESCAVLVFSSPGLSEVLLEALDS-----------GSLEEMVSEG-IRAASYDAYVKV  232
              +D + A++ FS       +L   D+             L +++  G  RAA+YD Y  +
Sbjct  572   FIDRTAALIQFSKEEFVNEILVLKDTLERVNDPISMLHPLSKLLEGGNTRAANYDTYRDI  631

Query  231   C  229
             C
Sbjct  632   C  632



>ref|XP_010942842.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X2 [Elaeis 
guineensis]
Length=460

 Score =   157 bits (397),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 112/190 (59%), Gaps = 12/190 (6%)
 Frame = -2

Query  1829  GIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRA  1650
              +K+VT SNF  AL ++  R+ E+DF+A+ L+ TG  S+PW+    FD +++ YLK K +
Sbjct  34    AVKKVTNSNFEPALEELRVRVREADFVAIDLEMTGIMSAPWRDAFEFDRSDVRYLKVKDS  93

Query  1649  AERYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIARE  1476
              E++ ++Q  VCPF    +K   IA P+NF++FPR EL    PSY F CQ++ +  +AR 
Sbjct  94    VEKFAVVQVGVCPFRWDGAKGSFIAHPHNFYVFPRKELPVDGPSYEFLCQTTSMDFLARY  153

Query  1475  GFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCT---------VPSPASRSVADSIFI  1323
              FDFNACI++GISYLSRAQE  A   + S                V  P   S AD +F 
Sbjct  154   QFDFNACIHEGISYLSRAQEAEALQTLSSAYKDEFNDSLHNLEEHVEIPL-LSTADLLFT  212

Query  1322  NRIKSRVKHW  1293
              R+K+R   W
Sbjct  213   ERMKNRFHQW  222


 Score = 61.2 bits (147),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL++  +K +V HN   D   I+ KF  PLPS++ EF  ++ +  P I+D KHL
Sbjct  331   GFRHVIDLLTSEEKLIVGHNCFLDIAHIYCKFFGPLPSSMVEFALAVHKNLPRIIDTKHL  390

Query  846   M  844
             +
Sbjct  391   L  391



>ref|XP_006392591.1| hypothetical protein EUTSA_v10011283mg [Eutrema salsugineum]
 gb|ESQ29877.1| hypothetical protein EUTSA_v10011283mg [Eutrema salsugineum]
Length=680

 Score =   160 bits (404),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 92/250 (37%), Positives = 134/250 (54%), Gaps = 16/250 (6%)
 Frame = -2

Query  1922  LCSMLQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAV  1743
             L S L R  FC           S  +  G + +K VT+SNF   LND+ + +  +DF+A+
Sbjct  12    LASALARSRFC-----------SSAAAAGAFPLKHVTRSNFEMTLNDLRSHVKAADFVAI  60

Query  1742  SLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSL--RESKLIASPYN  1569
              L+ TG  S+PW+  L FD  ++ YLK K +AE++ ++QF VCPF    R    ++ P+N
Sbjct  61    DLEMTGVTSAPWRDSLEFDRYDVRYLKVKDSAEKFAVVQFGVCPFRWDSRTQSFVSHPHN  120

Query  1568  FHLFPRDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRS  1389
             F +FPR EL    P++ F CQ++ +  +A+  FDFNACI++GISYLSR QE  A      
Sbjct  121   FFVFPRQELTFDPPAHEFLCQTTSMDFLAKYQFDFNACIHEGISYLSRRQEEEASKRYDE  180

Query  1388  PSAGSCTVPSPASR-SVADSIFINRIKSRVKHWRNACTDQSKKTEDVLISSLRKMISATE  1212
              S  S           +AD +F  R+K R   WR+A    S  +E   ISS     + T 
Sbjct  181   ESVDSVVETEDLKLVRLADLLFSERMKKRFNEWRSALLHGS--SESPGISSGSTESAETV  238

Query  1211  VHGSRPCLNI  1182
              +  RP L++
Sbjct  239   FYHMRPALSL  248


 Score = 70.1 bits (170),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 80/311 (26%), Positives = 131/311 (42%), Gaps = 61/311 (20%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR+V+DL+S  +K +V HN   D   ++SKF+ PLPST ++F  S+   FP+I+D K L
Sbjct  319   GFRQVIDLLSSEKKLIVGHNCFLDIAHVYSKFVGPLPSTAEKFVASIHDHFPYIVDTKIL  378

Query  846   MK---------------------------ELGSQKNLNNIYVATSYLNSRFFAPVDVELP  748
             +                            EL S+        + S L  R    +DVE+ 
Sbjct  379   LNVNPMLHQRMKKSSTSLSSAFSLLCPQIELSSRS-------SDSILQQR--VKIDVEVD  429

Query  747   HQAIST-KADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIF  571
             +   S   A      G++      +FA+ CS L  D K     E+  Q    L++Y N  
Sbjct  430   NVRCSNWNAGGKHEAGYDAFMTGCIFAQACSHLGFDFKHHSESENLAQ-NEKLDKYINRL  488

Query  570   DPCSTSYQDPPINEEDVRVRAKSCKRVSSK--NVVFLWGFQSGISTGQVKSLV---YGKH  406
                 T  +   I+       A++ +  +SK  N+V +W F   +   ++K  +    G  
Sbjct  489   YLSWT--RGDIIDLRTSNSNAENWRVSNSKYENIVLIWNFPQKLKAREIKECICKALGST  546

Query  405   EVFSSEFDIRLVDESCAVLVFSSPGLSEVLL---EALDSGS--------LEEMVSEG-IR  262
              V S    +  +D +   ++F +  L    L   + L+S          L +++  G   
Sbjct  547   SVTS----VYHLDNTAVFVLFKNSELVSNFLKLKQQLESDDGPVRILHPLSKILKGGNTG  602

Query  261   AASYDAYVKVC  229
             AA YDAY ++C
Sbjct  603   AADYDAYKEIC  613



>ref|XP_010273434.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Nelumbo 
nucifera]
Length=724

 Score =   159 bits (403),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 117/195 (60%), Gaps = 13/195 (7%)
 Frame = -2

Query  1832  WGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKR  1653
             + +K+VTK+NF  AL D+   + ++DF++  L+ TG  S+PW+    FD  ++ YLK K 
Sbjct  35    FSVKKVTKTNFESALEDLRRHVRDADFVSFDLEMTGVTSAPWRDSFEFDRFDVRYLKVKD  94

Query  1652  AAERYQILQFAVCPFSLRESK--LIASP-YNFHLFPRDELKTGMPSYSFSCQSSYLISIA  1482
             +AE++ ++QF VCPF    SK   +A P +NF++FPR EL    P+Y F CQ+S +  +A
Sbjct  95    SAEKFAVVQFGVCPFRWDASKESFVAHPRHNFYIFPRKELTVDGPAYEFLCQTSSIDFLA  154

Query  1481  REGFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPS---------PASRSVADSI  1329
             +  FDFNACI++GISYLSRAQE  +  C+     G  +            P  R+ AD +
Sbjct  155   KHQFDFNACIHEGISYLSRAQEAESLRCLNLAHGGEISNSGSHLEDFKDIPLVRT-ADIL  213

Query  1328  FINRIKSRVKHWRNA  1284
             F  R+K+R   WR+ 
Sbjct  214   FTERMKNRFSEWRDG  228


 Score = 79.7 bits (195),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 80/315 (25%), Positives = 144/315 (46%), Gaps = 52/315 (17%)
 Frame = -1

Query  1038  KCVRGFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILD  859
             K   GFR+V+DL+S  +K +V HN   D   I++KF  PLP+T++EF  S+   FP+I+D
Sbjct  330   KNALGFRQVIDLLSSEKKLLVGHNCFLDIAHIYNKFFGPLPATVEEFVSSVHENFPYIID  389

Query  858   VKHLM------KELGSQKNLN----------NIYVA--TSYLNSRFFAPVDVELPHQAIS  733
              KHL+      + L  +K+ +           I  A  +S L S  F  V+V++     S
Sbjct  390   TKHLLNVESVIQHLMKKKSTSLSSAFSLLCPQIAFASRSSALASHPFVKVEVQVDEMRSS  449

Query  732   TKADSVKSH-GHNVLKISELFAKVCSILKVDPKA---PEAIEHCGQLPPALERYANIF--  571
                   K   G++      +FA+VC  L ++ +    P  + +  +    L+++ N+   
Sbjct  450   NWNSGAKHEAGYDAFMTGCVFAQVCRHLDINFQVLSLPTELVNSEK----LQKHINLLYL  505

Query  570   -----DPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVK---SLVY  415
                  D  + S +D            +   ++   N+V +WGF S +  G+++   + V+
Sbjct  506   SWNNGDVINLSSRDISSQSFVSHNHIRRYPKIVFSNIVLIWGFPSKLKPGELRECVTKVF  565

Query  414   GKHEVFSSEFDIRLVDESCAVLVFSSPGLS---EVLLEALDSGS--------LEEMVSEG  268
             G   V S    I  +D++ A + F+         VL E L+  +        L +++  G
Sbjct  566   GPGSVTS----IYYLDKTAAFIQFNKEEFVFDFLVLKETLERNNDPISILHPLSKLLEGG  621

Query  267   -IRAASYDAYVKVCK  226
                AA+Y+ Y ++C+
Sbjct  622   KTGAATYEVYKEICR  636



>ref|XP_010480146.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Camelina 
sativa]
Length=678

 Score =   159 bits (401),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 86/243 (35%), Positives = 134/243 (55%), Gaps = 6/243 (2%)
 Frame = -2

Query  1895  FCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYS  1716
             FC++ +E      +  +    + +K VT+SNF + LND+   +  +DF+A+ L+ TG  S
Sbjct  17    FCSSAAERVSTSTASAAATAAFPLKHVTRSNFEKTLNDLRALVKAADFVAIDLEMTGVTS  76

Query  1715  SPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSL--RESKLIASPYNFHLFPRDEL  1542
             +PW+  L FD  ++ YLK K +AE++ ++QF VCPF    R    ++ P+NF +FPR EL
Sbjct  77    APWRDSLEFDRYDVRYLKVKDSAEKFAVVQFGVCPFRWDSRTQSFVSHPHNFFVFPRQEL  136

Query  1541  KTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRS--PSAGSCT  1368
                 P+Y F CQ++ +  +A+  FDFN CI++GISYLSR QE  A   + +     G  T
Sbjct  137   TFDPPAYEFLCQTTSMDFLAKYQFDFNTCIHEGISYLSRRQEEEASKRLETLYSEEGIET  196

Query  1367  VPSPASRSVADSIFINRIKSRVKHWRNACTDQSK-KTEDVLISSLRKMISATEVHGSRPC  1191
                   R +AD +F  R+K+ +  WRN         +E   IS+     + T  H  RP 
Sbjct  197   EDLKLVR-LADVLFAERMKNMLNEWRNGLLHGGNVSSESPRISNGSTQSTETVFHHMRPA  255

Query  1190  LNI  1182
             L++
Sbjct  256   LSL  258


 Score = 66.2 bits (160),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 71/302 (24%), Positives = 126/302 (42%), Gaps = 43/302 (14%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR+V+DL++  +K +V HN   D   ++SKF+ PLPST ++F  S+   FP+I+D K L
Sbjct  329   GFRQVIDLLASEKKLIVGHNCFLDIAHVYSKFVGPLPSTAEKFVASINSHFPYIVDTKIL  388

Query  846   ----------MKELGSQKNLNNIYV----------ATSYLNSRFFAPVDVELPHQAIST-  730
                       MK+  +  +     +          + S+L  R    +DVE+ +   S  
Sbjct  389   LNVNPMLHQRMKKSSTSLSSAFSSLCPQIEFSSRSSDSHLQQR--VKIDVEVDNIRCSNW  446

Query  729   KADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDPCSTSY  550
              A      G++      +FA+ C+ L  D       ++       LE+Y N      T  
Sbjct  447   NAGGKHEAGYDAFMTGCIFAQACNHLGFDFTQHSQSDNLAH-NEKLEKYINRLYLSWTRG  505

Query  549   QDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLV---YGKHEVFSSEFDI  379
                 +             +   +N+V +W F   +   ++K  +   +G   V S    +
Sbjct  506   DIIDLRTGHSNADNWRVSKFKYENIVLIWNFPRKLKAREIKECICKAFGSVSVIS----V  561

Query  378   RLVDESCAVLVFSSPGLSEVLLE---ALDSGS--------LEEMVSEG-IRAASYDAYVK  235
               +D+S   ++F +  L    L+    L+S          L +++  G   AA Y+AY +
Sbjct  562   YHIDDSAVFVLFKNSELVCDFLKLKRQLESSDGPVSVLHPLSKILEGGNTGAADYEAYKE  621

Query  234   VC  229
             +C
Sbjct  622   IC  623



>emb|CBI39748.3| unnamed protein product [Vitis vinifera]
Length=715

 Score =   159 bits (402),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 81/208 (39%), Positives = 117/208 (56%), Gaps = 10/208 (5%)
 Frame = -2

Query  1832  WGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKR  1653
             + +K VTKSNF  +L D+   + ++DF+A+ L+ TG  S+PW+    FD  ++ YLK K 
Sbjct  38    FALKNVTKSNFESSLADLRRHVRDADFVAIDLEMTGVTSAPWRESFEFDRFDVQYLKVKD  97

Query  1652  AAERYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAR  1479
             +AE++ ++QF VCPF    S+   +A P+NF++FPR EL    PSY F CQ++ +  +A+
Sbjct  98    SAEKFAVVQFGVCPFRWDSSRHCFVAHPHNFYVFPRQELPVDGPSYEFLCQTTSIDFLAK  157

Query  1478  EGFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCT--------VPSPASRSVADSIFI  1323
               FDFNACI +GISYLSR QE     C+ S      +        V      SVAD +F 
Sbjct  158   YQFDFNACIYEGISYLSREQENEMLRCLNSECDDEMSLLWRNMKEVRDTPLVSVADVLFS  217

Query  1322  NRIKSRVKHWRNACTDQSKKTEDVLISS  1239
              R+K+R   WR       K     L +S
Sbjct  218   ERMKNRFNEWRKELLQDRKGGSQFLETS  245


 Score = 80.1 bits (196),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 89/318 (28%), Positives = 149/318 (47%), Gaps = 60/318 (19%)
 Frame = -1

Query  1038  KCVRGFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILD  859
             K   GFR V+DL+S  QK +V HN L D   I++KF  PLP T ++F  S+ + FP+++D
Sbjct  331   KTAVGFRHVIDLLSSEQKLIVGHNCLLDIAHIYNKFFGPLPLTAEDFVSSIHKYFPYMID  390

Query  858   ----------VKHLMKELGSQKNLNNIY------VATSYLNSRF-FAP-VDVELPHQAI-  736
                       +KHLMK      +L+  +      +A+S  NS   F P V+VE+    + 
Sbjct  391   TKILLNTNNVLKHLMK--NGSTSLSKAFASLCPQIASSSKNSGLAFQPWVEVEVQVDDMR  448

Query  735   STKADSVKSH--GHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYAN--IFD  568
             S+  +S   H  G++      +FA+ CS L +D K   +  +       L+++ N   F 
Sbjct  449   SSNWNSGAKHEAGYDAFMTGCVFAQACSNLGIDFKKHSSSANLAH-NKNLQKHVNHLYFS  507

Query  567   PCSTSYQDPPINEEDVRVRAKS-CKRVSSK-------NVVFLWGFQSGISTGQVKSLV--  418
               +    D        R+ A + C  +  +       N+V +WGF S +S+ +++  +  
Sbjct  508   WVNGDIIDLGTGN---RIAATTVCYNLKRRYPKILFSNIVIVWGFPSQLSSKKIRECISK  564

Query  417   -YGKHEVFSSEFDIRLVDESCAVLVFSSPGLSE---VLLEALDSGSLEEMVS--------  274
              +G   V +    I  +DE+   + FS P L     VL E L+  ++++ +S        
Sbjct  565   AFGPISVTT----IYHLDETAVFVQFSKPELVADFLVLKETLE--TIQDPISVLHPLSVL  618

Query  273   -EGIR--AASYDAYVKVC  229
              EG    AASY+ Y ++C
Sbjct  619   LEGGNTCAASYETYKEIC  636



>ref|XP_009348053.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X3 
[Pyrus x bretschneideri]
 ref|XP_009348066.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X3 
[Pyrus x bretschneideri]
Length=606

 Score =   157 bits (398),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 83/194 (43%), Positives = 114/194 (59%), Gaps = 16/194 (8%)
 Frame = -2

Query  1826  IKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAA  1647
             +K VTKSNF  AL D+   +  +DF+A+ L+ TG  SSPW+  L FD A++ YLK K +A
Sbjct  42    LKNVTKSNFEPALADLRRHVAAADFVAIDLEMTGITSSPWRDSLEFDRADVCYLKVKDSA  101

Query  1646  ERYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
             E++ +LQF VCPF    SK   IA P+NF++FPR EL    P Y F CQ++ +  +A+  
Sbjct  102   EKFAVLQFGVCPFRWDSSKRSFIAHPHNFYIFPRQELPLAGPPYEFLCQTTSIDFLAKYQ  161

Query  1472  FDFNACINDGISYLSRAQE--------LAAKDCIRSPSAGSCTVPSPASRSV---ADSIF  1326
             FDFN CI++GISYLSR QE        LA  D +    A    +  P    V   AD++F
Sbjct  162   FDFNVCIHEGISYLSREQESEALRRLSLAYDDELL---ARCSNLKEPMHMPVVKMADTLF  218

Query  1325  INRIKSRVKHWRNA  1284
               R+K+    WR+ 
Sbjct  219   AERMKNSFTEWRDG  232



>ref|XP_009379459.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Pyrus x bretschneideri]
Length=725

 Score =   159 bits (402),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 115/192 (60%), Gaps = 12/192 (6%)
 Frame = -2

Query  1826  IKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAA  1647
             +K VTKSNF  AL D+   +  +DF+A+ L+ TG  S+PW+  L FD A++ YLK K +A
Sbjct  37    LKNVTKSNFEPALADLRRHVAAADFVAIDLEMTGITSAPWRDSLEFDRADVCYLKVKDSA  96

Query  1646  ERYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
             E++ +LQF VCPF    SK   IA P+NF++FPR EL    P+Y F CQ++ +  +A+  
Sbjct  97    EKFAVLQFGVCPFCWDSSKRSFIAHPHNFYIFPRQELPVAGPTYEFLCQTTSIDFLAKYQ  156

Query  1472  FDFNACINDGISYLSRAQELAA---------KDCIRSPSAGSCTVPSPASRSVADSIFIN  1320
             FDFN CI++GISYLSR QE  A          + +   S     V  P  + +AD++F  
Sbjct  157   FDFNVCIHEGISYLSRGQESEALRRLSLTYDDELLTRYSNLKEPVHMPMVK-IADTLFAE  215

Query  1319  RIKSRVKHWRNA  1284
             R+K+    WR+ 
Sbjct  216   RMKNTFTEWRDG  227


 Score = 71.6 bits (174),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 67/258 (26%), Positives = 115/258 (45%), Gaps = 34/258 (13%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL+S  QK +V HN   D   I++KFL PLPST +EF  ++ + FPHI+D K L
Sbjct  334   GFRHVIDLLSSEQKLIVGHNCFLDLAHIYNKFLGPLPSTAEEFVSAVNKYFPHIIDTKVL  393

Query  846   MKE---LGSQKNLNNIYVATSY--------LNSRFFAP-----VDVELPHQAI-STKADS  718
             +     L  +   +   +++++        L  +   P     V VE+    + S+  +S
Sbjct  394   LNTDNVLQQRMKKSRTSLSSAFALLCPEIALGKKSTDPEVQLCVKVEVQVDDLRSSNWNS  453

Query  717   VKSH--GHNVLKISELFAKVCSILKVDPKA---PEAIEHCGQLPPALE----RYANIFDP  565
                H  G++      +FA+ CS L +D +A    E   H  +L   +      ++N  D 
Sbjct  454   GAKHEAGYDAFMTGCVFAQTCSHLGIDFQACLSSEKFPHNEKLQKQINLLYLSWSN-GDI  512

Query  564   CSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVK---SLVYGKHEVFS  394
                +               K   ++  +N+  +WGF S +    ++   + V+G   V S
Sbjct  513   IDLTTGKKKAMSSGYNNHKKRYAQIMFENIALIWGFPSKLKARDIRECITKVFGPTSVTS  572

Query  393   SEFDIRLVDESCAVLVFS  340
                 +  +DE+   + FS
Sbjct  573   ----VYHLDETAVFIQFS  586



>ref|XP_009348051.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009348064.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X1 
[Pyrus x bretschneideri]
Length=729

 Score =   159 bits (401),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/200 (43%), Positives = 116/200 (58%), Gaps = 16/200 (8%)
 Frame = -2

Query  1826  IKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAA  1647
             +K VTKSNF  AL D+   +  +DF+A+ L+ TG  SSPW+  L FD A++ YLK K +A
Sbjct  42    LKNVTKSNFEPALADLRRHVAAADFVAIDLEMTGITSSPWRDSLEFDRADVCYLKVKDSA  101

Query  1646  ERYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
             E++ +LQF VCPF    SK   IA P+NF++FPR EL    P Y F CQ++ +  +A+  
Sbjct  102   EKFAVLQFGVCPFRWDSSKRSFIAHPHNFYIFPRQELPLAGPPYEFLCQTTSIDFLAKYQ  161

Query  1472  FDFNACINDGISYLSRAQE--------LAAKDCIRSPSAGSCTVPSPASRSV---ADSIF  1326
             FDFN CI++GISYLSR QE        LA  D +    A    +  P    V   AD++F
Sbjct  162   FDFNVCIHEGISYLSREQESEALRRLSLAYDDELL---ARCSNLKEPMHMPVVKMADTLF  218

Query  1325  INRIKSRVKHWRNACTDQSK  1266
               R+K+    WR+     SK
Sbjct  219   AERMKNSFTEWRDGLLRSSK  238


 Score = 77.0 bits (188),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 70/260 (27%), Positives = 118/260 (45%), Gaps = 38/260 (15%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL+S  QK +V HN   D   ++SKFL PLPST +EF  ++ + FPH++D K L
Sbjct  337   GFRHVIDLLSSEQKLIVGHNCFLDIAHVYSKFLGPLPSTAEEFVSTVNKYFPHVIDTKVL  396

Query  846   M--------KELGSQKNLNN--------IYVATSYLNSRFFAPVDVELPHQAI-STKADS  718
             +        +   S+ +L++        I +     +S     V VE+    + S+  +S
Sbjct  397   LNTDTVLQQRIKKSRTSLSSAFALLCPQIALGKKSTDSEVQMCVKVEVQVDDLRSSNWNS  456

Query  717   VKSH--GHNVLKISELFAKVCSILKVDPKA---PEAIEHCGQLPPALERY------ANIF  571
                H  G++      +FA+ CS L +D +A    E + H  +L   +          +I 
Sbjct  457   GAKHEAGYDAFMTGCVFAQTCSHLGIDFQACSSSEKLAHNEKLQKQINHLYLSWSNGDII  516

Query  570   DPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVK---SLVYGKHEV  400
             D  +           + + R     ++ S+NV  +WGF S +    ++   S V+G   V
Sbjct  517   DLTTGKKNAMSSGSNNHKKRY---SQIMSENVALIWGFPSKLKARDIRECISKVFGSTSV  573

Query  399   FSSEFDIRLVDESCAVLVFS  340
              S    +  +DE+   + FS
Sbjct  574   TS----VFHLDETAVFVQFS  589



>ref|XP_010644585.1| PREDICTED: poly(A)-specific ribonuclease PARN [Vitis vinifera]
 ref|XP_010644586.1| PREDICTED: poly(A)-specific ribonuclease PARN [Vitis vinifera]
Length=734

 Score =   158 bits (400),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 117/208 (56%), Gaps = 10/208 (5%)
 Frame = -2

Query  1832  WGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKR  1653
             + +K VTKSNF  +L D+   + ++DF+A+ L+ TG  S+PW+    FD  ++ YLK K 
Sbjct  38    FALKNVTKSNFESSLADLRRHVRDADFVAIDLEMTGVTSAPWRESFEFDRFDVQYLKVKD  97

Query  1652  AAERYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAR  1479
             +AE++ ++QF VCPF    S+   +A P+NF++FPR EL    PSY F CQ++ +  +A+
Sbjct  98    SAEKFAVVQFGVCPFRWDSSRHCFVAHPHNFYVFPRQELPVDGPSYEFLCQTTSIDFLAK  157

Query  1478  EGFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCT--------VPSPASRSVADSIFI  1323
               FDFNACI +G+SYLSR QE     C+ S      +        V      SVAD +F 
Sbjct  158   YQFDFNACIYEGVSYLSREQENEMLRCLNSECDDEMSLLWRNMKEVRDTPLVSVADVLFS  217

Query  1322  NRIKSRVKHWRNACTDQSKKTEDVLISS  1239
              R+K+R   WR       K     L +S
Sbjct  218   ERMKNRFNEWRKELLQDRKGGSQFLETS  245


 Score = 80.1 bits (196),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 90/318 (28%), Positives = 149/318 (47%), Gaps = 60/318 (19%)
 Frame = -1

Query  1038  KCVRGFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILD  859
             K   GFR V+DL+S  QK +V HN L D   I++KF  PLP T ++F  S+ + FP+++D
Sbjct  331   KTAVGFRHVIDLLSSEQKLIVGHNCLLDIAHIYNKFFGPLPLTAEDFVSSIHKYFPYMID  390

Query  858   ----------VKHLMKELGSQKNLNNIY------VATSYLNSRF-FAP-VDVELPHQAI-  736
                       +KHLMK      +L+  +      +A+S  NS   F P V+VE+    + 
Sbjct  391   TKILLNTNNVLKHLMK--NGSTSLSKAFASLCPQIASSSKNSGLAFQPWVEVEVQVDDMR  448

Query  735   STKADSVKSH--GHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYAN--IFD  568
             S+  +S   H  G++      +FA+ CS L +D K   +  +       L+++ N   F 
Sbjct  449   SSNWNSGAKHEAGYDAFMTGCVFAQACSNLGIDFKKHSSSANLAH-NKNLQKHVNHLYFS  507

Query  567   PCSTSYQDPPINEEDVRVRAKS-CKRVSSK-------NVVFLWGFQSGISTGQVK---SL  421
               +    D        R+ A + C  +  +       N+V +WGF S +S+ +++   S 
Sbjct  508   WVNGDIIDLGTGN---RIAATTVCYNLKRRYPKILFSNIVIVWGFPSQLSSKKIRECISK  564

Query  420   VYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSE---VLLEALDSGSLEEMVS--------  274
              +G   V +    I  +DE+   + FS P L     VL E L+  ++++ +S        
Sbjct  565   AFGPISVTT----IYHLDETAVFVQFSKPELVADFLVLKETLE--TIQDPISVLHPLSVL  618

Query  273   -EGIR--AASYDAYVKVC  229
              EG    AASY+ Y ++C
Sbjct  619   LEGGNTCAASYETYKEIC  636



>emb|CAN76999.1| hypothetical protein VITISV_007764 [Vitis vinifera]
Length=720

 Score =   158 bits (400),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 117/208 (56%), Gaps = 10/208 (5%)
 Frame = -2

Query  1832  WGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKR  1653
             + +K VTKSNF  +L D+   + ++DF+A+ L+ TG  S+PW+    FD  ++ YLK K 
Sbjct  38    FALKNVTKSNFESSLADLRRHVRDADFVAIDLEMTGVTSAPWRESFEFDRFDVQYLKVKD  97

Query  1652  AAERYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAR  1479
             +AE++ ++QF VCPF    S+   +A P+NF++FPR EL    PSY F CQ++ +  +A+
Sbjct  98    SAEKFAVVQFGVCPFRWDSSRHCFVAHPHNFYVFPRQELPVDGPSYEFLCQTTSIDFLAK  157

Query  1478  EGFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCT--------VPSPASRSVADSIFI  1323
               FDFNACI +G+SYLSR QE     C+ S      +        V      SVAD +F 
Sbjct  158   YQFDFNACIYEGVSYLSREQENEMLRCLNSECDDEMSLLWRNMKEVRDTPLVSVADVLFS  217

Query  1322  NRIKSRVKHWRNACTDQSKKTEDVLISS  1239
              R+K+R   WR       K     L +S
Sbjct  218   ERMKNRFNEWRKELLQDRKGGSQFLETS  245


 Score = 80.1 bits (196),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 85/302 (28%), Positives = 142/302 (47%), Gaps = 42/302 (14%)
 Frame = -1

Query  1038  KCVRGFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILD  859
             K   GFR V+DL+S  QK +V HN L D   I++KF  PLP T ++F  S+ + FP+++D
Sbjct  331   KTAVGFRHVIDLLSSEQKLIVGHNCLLDIAHIYNKFFGPLPLTAEDFVSSIHKYFPYMID  390

Query  858   ----------VKHLMKELGS--QKNLNNI--YVATSYLNSRF-FAP-VDVELPHQAI-ST  730
                       +KHLMK   +   K  +++   +A+S  NS   F P V+VE+    + S+
Sbjct  391   TKILLNTNNVLKHLMKNGSTSLSKAFSSLCPQIASSSKNSGLAFKPWVEVEVQVDDMRSS  450

Query  729   KADSVKSH--GHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYAN--IFDPC  562
               +S   H  G++      +FA+ CS L +D K   +  +       L+++ N   F   
Sbjct  451   NWNSGAKHEAGYDAFMTGCVFAQACSNLGIDFKKHSSSANLAH-NKNLQKHVNHLYFSWV  509

Query  561   STSYQDPPINEEDVRVRAKS-CKRVSSK-------NVVFLWGFQSGISTGQVK---SLVY  415
             +    D        R+ A + C  +  +       N+V +WGF S +S+ +++   S V+
Sbjct  510   NGDIIDLSTGN---RIAATAVCYNLKRRYPKILFSNIVIVWGFPSQLSSKKIRECISKVF  566

Query  414   GKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDSGSLEEMVSEGIRAASYDAYVK  235
             G   V      I  +DE+   + FS P L    L  + S    ++  E +   SY+ Y +
Sbjct  567   GPISVTM----IYHLDETAVFVQFSKPELVADFLFCIPSQYCWKV--ETLVLPSYETYKE  620

Query  234   VC  229
             +C
Sbjct  621   IC  622



>ref|XP_010675952.1| PREDICTED: poly(A)-specific ribonuclease PARN [Beta vulgaris 
subsp. vulgaris]
Length=711

 Score =   158 bits (399),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 114/188 (61%), Gaps = 6/188 (3%)
 Frame = -2

Query  1832  WGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKR  1653
             + +K VTKSNF E L D+ T +  +DF+A+ L+ TG  SSPW+    FD  ++ YLK K 
Sbjct  33    FSLKNVTKSNFEETLIDLTTHVKSADFVAIDLEMTGITSSPWRESFEFDRHDVRYLKMKD  92

Query  1652  AAERYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAR  1479
             +AE++ ++QF VCPF    SK   +A P+NF++FPR  L    PSY F CQ++ +  +A+
Sbjct  93    SAEKFAVVQFGVCPFRWDSSKNSFVAHPHNFYIFPRQVLPADGPSYEFLCQTTSIDFLAK  152

Query  1478  EGFDFNACINDGISYLSRAQELAAKDCIRSPSAG----SCTVPSPASRSVADSIFINRIK  1311
               FDFNACI++G+SYLSR QE  A   + S   G    S  V      +VAD +F  R+K
Sbjct  153   YQFDFNACIHEGVSYLSRRQEDEALSRLNSVYNGKWANSNEVRDLPLGNVADILFSERMK  212

Query  1310  SRVKHWRN  1287
              R+  W +
Sbjct  213   IRLSDWHD  220


 Score = 76.3 bits (186),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 89/311 (29%), Positives = 135/311 (43%), Gaps = 52/311 (17%)
 Frame = -1

Query  1038  KCVRGFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILD  859
             K   GFR V+DL++  +K +V HN   D   I+ KF  PLPST++EF   +   FPH++D
Sbjct  320   KAAAGFRHVLDLLAAEKKLIVGHNCFLDMAHIYHKFFGPLPSTVEEFVLEIHNYFPHVVD  379

Query  858   VKHLMKELGS-QKNLNNIYVATSYLNSRF--FAP---------------VDVELPHQAI-  736
              K L+    S QK LN    A++ L S F    P               V VE+    + 
Sbjct  380   TKILLNADTSLQKFLNK---ASTSLASAFSLLCPEIASGQSSNGGVHPCVKVEVQVDDMR  436

Query  735   STKADSVKSH--GHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIF---  571
             S+  +S   H  G++      +FA+ C  L VD  +   I         + +YAN+    
Sbjct  437   SSNWNSGAKHEAGYDAFMTGCVFAQACHNLGVDFSSENLIA-----SENIHKYANLLYLS  491

Query  570   ----DPCSTSYQDPPINEEDVRVRAK-SCKRVSSKNVVFLWGFQSGISTGQVKSLVYGKH  406
                 D  + S  D  +NE  V   AK     +   N+V +WGF   +    +K  +    
Sbjct  492   WNSGDVINLSTGD--MNEIPVISSAKRRFLNILHPNIVLIWGFSPKLKASDIKQCICKVF  549

Query  405   EVFSSEFDIRLVDESCAVLVFSSPGLS-------EVLLEALDSGSLEEMVS---EGIR--  262
              ++S    I  +DE+   + FS   L+       + L  + DS SL   +S   EG +  
Sbjct  550   GIYSVAC-IYNLDETAVFVQFSKADLAVNFLALKDRLETSDDSISLLHPLSKLLEGGKTC  608

Query  261   AASYDAYVKVC  229
             AA Y+ Y  +C
Sbjct  609   AAGYEVYKDIC  619



>ref|XP_010942841.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Elaeis 
guineensis]
Length=716

 Score =   157 bits (396),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 112/190 (59%), Gaps = 12/190 (6%)
 Frame = -2

Query  1829  GIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRA  1650
              +K+VT SNF  AL ++  R+ E+DF+A+ L+ TG  S+PW+    FD +++ YLK K +
Sbjct  34    AVKKVTNSNFEPALEELRVRVREADFVAIDLEMTGIMSAPWRDAFEFDRSDVRYLKVKDS  93

Query  1649  AERYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIARE  1476
              E++ ++Q  VCPF    +K   IA P+NF++FPR EL    PSY F CQ++ +  +AR 
Sbjct  94    VEKFAVVQVGVCPFRWDGAKGSFIAHPHNFYVFPRKELPVDGPSYEFLCQTTSMDFLARY  153

Query  1475  GFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCT---------VPSPASRSVADSIFI  1323
              FDFNACI++GISYLSRAQE  A   + S                V  P   S AD +F 
Sbjct  154   QFDFNACIHEGISYLSRAQEAEALQTLSSAYKDEFNDSLHNLEEHVEIPL-LSTADLLFT  212

Query  1322  NRIKSRVKHW  1293
              R+K+R   W
Sbjct  213   ERMKNRFHQW  222


 Score = 69.7 bits (169),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 77/309 (25%), Positives = 131/309 (42%), Gaps = 56/309 (18%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL++  +K +V HN   D   I+ KF  PLPS++ EF  ++ +  P I+D KHL
Sbjct  331   GFRHVIDLLTSEEKLIVGHNCFLDIAHIYCKFFGPLPSSMVEFALAVHKNLPRIIDTKHL  390

Query  846   MKELGSQKNLNNIYVATSYLNSRFFAPVDVELPHQAIST--------KADSVKS------  709
             +      + L      +         P  V  P Q +++        +AD   S      
Sbjct  391   LNSSHIIQYLMKRSSKSLSSAFSVLCP-RVSSPSQHVASNSYVKVEVQADETGSCCFNSG  449

Query  708   ----HGHNVLKISELFAKVCSILKVDPKA-PEAIEHCGQLPPALERYANIFDP-------  565
                  G++      +FA+ CS L +  +   ++I+        ++ Y N+  P       
Sbjct  450   AKHEAGYDAFMTGCVFAQACSHLGMKFELHSQSIDFSKN--DKIQNYMNLLYPSWNSGTV  507

Query  564   --CSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSL---VYGKHEV  400
                ST  ++P     D   + +  + V S N+V +WGF S I    +K     V+G+  +
Sbjct  508   IDLSTGMENP-----DSSYKRRYPQIVFS-NIVLVWGFPSNIKPKDLKECVCKVFGRDSI  561

Query  399   FSSEFDIRLVDESCAVLVFSSPGLSE---VLLEALDSGS--------LEEMVSEG-IRAA  256
              S    I  +D + A++ FS   L     +L   L+S          L +++  G   AA
Sbjct  562   TS----IFFLDSTAALIQFSKEELVNDFLILKYKLESNDDPISVLHPLAKLLEGGNTCAA  617

Query  255   SYDAYVKVC  229
             +Y+ Y  +C
Sbjct  618   NYETYRDIC  626



>ref|XP_004296331.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Fragaria 
vesca subsp. vesca]
Length=717

 Score =   157 bits (396),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 113/186 (61%), Gaps = 5/186 (3%)
 Frame = -2

Query  1826  IKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAA  1647
             +K VTKSNF + L ++   +  +DF+AV L+ +G  S+PW+  L FD  +++YLK K +A
Sbjct  32    LKNVTKSNFEQVLAELRRHVAAADFVAVDLEMSGVTSAPWRDSLEFDRPDVSYLKVKDSA  91

Query  1646  ERYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
             E++ +LQF VCPF    SK   IA P+NF++FPR EL    P+Y F CQ++ +  +A+  
Sbjct  92    EKFAVLQFGVCPFRWDSSKKSFIAHPHNFYIFPRQELPVESPTYEFLCQTTSIDFLAKYQ  151

Query  1472  FDFNACINDGISYLSRAQELAAKDCIR---SPSAGSCTVPSPASRSVADSIFINRIKSRV  1302
             FDFN CI++GISYLSR QE  A   +R      +    V       +AD++F  R+K+  
Sbjct  152   FDFNVCIHEGISYLSRGQESKALRRLRLAYEDESNLKEVRDAPLVKMADTLFTERMKNTF  211

Query  1301  KHWRNA  1284
               WR+ 
Sbjct  212   TEWRDG  217


 Score = 81.6 bits (200),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 81/315 (26%), Positives = 134/315 (43%), Gaps = 63/315 (20%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL+S  +K +V HN   D   I+SKF+ PLPST +EF  S+   FPHI+D K L
Sbjct  323   GFRHVIDLLSSEKKLIVGHNCFLDIAHIYSKFVGPLPSTAEEFVSSVNEWFPHIIDTKLL  382

Query  846   M--------KELGSQKNLNNIYVA----------TSYLNSRFFAPVDVELPHQAISTKAD  721
             +        +   SQ +L++ + +          ++ L  +    V+V++     S    
Sbjct  383   LNANTVLQQRMKKSQTSLSSAFASLCPQMSLGAKSTDLAFQLCVKVEVQVDDLRSSNWNS  442

Query  720   SVKSH-GHNVLKISELFAKVCSILKVDPKA---PEAIEHCGQLPPALE------RYANIF  571
               K   G++      +FA+ C  L +D +A    E + H  +L   +          ++ 
Sbjct  443   GAKHEAGYDAFMTGCVFAQACGHLGIDFEACLPSEKLAHNEKLKQHINLLFLSWNKGDVI  502

Query  570   DPCSTSYQDPPINEEDVRVRAKSCKR---VSSKNVVFLWGFQSGISTGQVK---SLVYGK  409
             D  +        N+  + V +K  +R   +S + +  +WGF S +   +++   S V+G 
Sbjct  503   DLTTG-------NKNAMSVGSKKKQRYSEISFEKIALIWGFSSKVKAQEIRECISKVFGP  555

Query  408   HEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDS---------------GSLEEMVS  274
               V S    I  +DES   + F    L    L   D+               G LE    
Sbjct  556   SSVVS----IYHLDESAVFVQFKKQKLVSDFLSLKDTLERNNGPVAVLHPFAGLLE---G  608

Query  273   EGIRAASYDAYVKVC  229
                RAA Y+ Y ++C
Sbjct  609   GNTRAADYETYKEIC  623



>ref|XP_008363350.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Malus domestica]
Length=724

 Score =   156 bits (395),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 80/197 (41%), Positives = 116/197 (59%), Gaps = 10/197 (5%)
 Frame = -2

Query  1826  IKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAA  1647
             +K VTKSNF  AL D+   +  +DF+A+ L+ TG  S+PW+  L FD A++ YLK K +A
Sbjct  37    LKNVTKSNFEPALADLRRHVAAADFVAIDLEMTGITSAPWRDSLEFDRADVCYLKVKDSA  96

Query  1646  ERYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
             E++ +LQF VCPF    SK   IA P+NF++FPR EL    P++ F CQ++ +  +A+  
Sbjct  97    EKFAVLQFGVCPFRWDSSKRSFIAHPHNFYIFPRQELPLAGPAFEFLCQTTSIDFLAKYQ  156

Query  1472  FDFNACINDGISYLSRAQE--------LAAKDCIRSPSAGSCTVPSPASRSVADSIFINR  1317
             FDFN CI++GISYLSR QE        LA  D + +  +            +AD++F  R
Sbjct  157   FDFNVCIHEGISYLSREQESEALRRLSLAYDDELLARCSNLKEHTHMPVVKMADTLFAER  216

Query  1316  IKSRVKHWRNACTDQSK  1266
             +K+    WR+     SK
Sbjct  217   MKNSFTEWRDRLLRSSK  233


 Score = 81.6 bits (200),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 85/312 (27%), Positives = 140/312 (45%), Gaps = 56/312 (18%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL+S  QK +V HN   D   ++SKFL PLPST +EF  ++ + FPH++D K L
Sbjct  332   GFRHVIDLLSSEQKLIVGHNCFLDIAHVYSKFLGPLPSTAEEFVSTVNKYFPHVIDTKVL  391

Query  846   M--------KELGSQKNLNN--------IYVATSYLNSRFFAPVDVELPHQAI-STKADS  718
             +        +   S+ +L++        I +     +S     V+VE+    + S+  +S
Sbjct  392   LNTDDVLQQRMKKSRXSLSSAFALLCXQIALGKKSTDSEVQMCVNVEVQVDDLRSSNWNS  451

Query  717   VKSH--GHNVLKISELFAKVCSILKVDPKA---PEAIEHCGQLPPALERY------ANIF  571
                H  G++      +FA+ CS L +D +A    E + H  +L   +          +I 
Sbjct  452   GAKHEAGYDAFMTGCVFAQTCSHLGIDFQACSSSEKLAHNEKLQKQINHLYLSWSNGDII  511

Query  570   DPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVK---SLVYGKHEV  400
             D  +           + + R     ++ S+N+  +WGF S +    V+   S V+G   V
Sbjct  512   DLTTGKKNAMSSGSNNHKKRY---LQIMSENIALIWGFPSKLKARDVRECISKVFGPTSV  568

Query  399   FSSEFDIRLVDESCAVLVFSSPG-LSEVL-----LEALD---------SGSLEEMVSEGI  265
              S    +  +DE+   + FS    +SE L     LE  D         +G LE       
Sbjct  569   TS----VFHLDETAVFVQFSKETFVSEFLALKETLERSDGPVSVLHPLAGLLE---GGSA  621

Query  264   RAASYDAYVKVC  229
             RAA+Y+ Y ++C
Sbjct  622   RAANYETYKEIC  633



>ref|XP_007020484.1| Poly(A)-specific ribonuclease PARN isoform 1 [Theobroma cacao]
 ref|XP_007020485.1| Poly(A)-specific ribonuclease PARN isoform 1 [Theobroma cacao]
 gb|EOY12009.1| Poly(A)-specific ribonuclease PARN isoform 1 [Theobroma cacao]
 gb|EOY12010.1| Poly(A)-specific ribonuclease PARN isoform 1 [Theobroma cacao]
Length=726

 Score =   156 bits (394),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 85/220 (39%), Positives = 128/220 (58%), Gaps = 14/220 (6%)
 Frame = -2

Query  1907  QRRLFCTAISETAFRPNSG--GSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQ  1734
             +R L  + +   AF  N+    S    + +K VT+SNF  AL ++ + +  +DF+A+ L+
Sbjct  9     KRALILSRVLSRAFFSNTSTSASPSPTFPLKHVTRSNFDSALVELRSHVRAADFVAIDLE  68

Query  1733  TTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPF---SLRESKLIASPYNFH  1563
              TG  S+PW+    FD  +I YLK K +AE++ ++QF VCPF   SL++S  IA P+NF 
Sbjct  69    MTGVTSAPWRESFEFDRFDIRYLKVKDSAEKFAVVQFGVCPFRWDSLKQS-FIAHPHNFF  127

Query  1562  LFPRDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPS  1383
             +FPR E+    PS  F CQ++ +  +A+  FDFNACI++G+SYLSR QE  A+  ++S  
Sbjct  128   VFPRQEIPLDGPSNEFLCQTTSMDFLAKYQFDFNACIHEGVSYLSRGQEDEARRRLKSLY  187

Query  1382  AGSCTVPSPASRS--------VADSIFINRIKSRVKHWRN  1287
                 T  S   R         VAD +F  R+K R+  WR+
Sbjct  188   KEQLTNSSHNLRETMDVPLVRVADVLFTERMKKRLSEWRD  227


 Score = 80.1 bits (196),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 83/322 (26%), Positives = 138/322 (43%), Gaps = 74/322 (23%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL+S   K +V HN + D   IHSKFL PLP T +EF   + + FP+I+D K L
Sbjct  333   GFRHVIDLLSSENKLIVGHNCILDIAHIHSKFLGPLPLTAEEFVSCVNKYFPNIIDTKIL  392

Query  846   MKELGSQKNLNNIY----------------VATSYLNSRFFAPVDVELPHQAISTKADSV  715
             +       N +NI                 +    L   F + V    P   +    D +
Sbjct  393   L-------NADNILQQRMKKSSTSLSSAFSLLCPELAHGFKSKVQSSQPCVKVEVHVDEM  445

Query  714   KS----------HGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDP  565
             +S           G++      +FA+VCS L +D +     E+  Q    L+++ N+   
Sbjct  446   RSPDWNSGAKHEAGYDAFMTGCVFAQVCSHLGIDFQLYSTSENLVQ-NEKLQKHMNLL--  502

Query  564   CSTSYQDPPINEE--DVRVRAKSCK------------RVSSKNVVFLWGFQSGISTGQVK  427
                S+    IN +  D+R  +++ +            R+  +N+V +WGF S +    ++
Sbjct  503   -YLSW----INGDVIDLRTGSRTAEFLGSNILRKRFPRILYENIVLIWGFPSKLKPSVIR  557

Query  426   SLV---YGKHEVFSSEFDIRLVDESCAVLVFSSPGLSE---VLLEALDSGS--------L  289
               +    G   V S    I  +D++   + FS   L     +L E+L+           L
Sbjct  558   ECICKTLGPTSVIS----IYRMDQTAVFVQFSKAELVSDFLILKESLERSDDAISVLHPL  613

Query  288   EEMVSEG-IRAASYDAYVKVCK  226
              +++  G  RAASY+ Y  +C+
Sbjct  614   SQLLEGGNTRAASYETYKDICE  635



>ref|XP_008384548.1| PREDICTED: LOW QUALITY PROTEIN: poly(A)-specific ribonuclease 
PARN-like [Malus domestica]
Length=725

 Score =   156 bits (394),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 114/192 (59%), Gaps = 12/192 (6%)
 Frame = -2

Query  1826  IKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAA  1647
             +K VTKSNF  AL D+   +  +DF+A+ L+ TG  S+PW+  L FD A++ YLK K +A
Sbjct  37    LKNVTKSNFEPALADLRRHVAAADFVAIDLEMTGITSAPWRDSLEFDRADVCYLKVKDSA  96

Query  1646  ERYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
             E++ +LQF VCP     SK   IA P+NF++FPR EL    P+Y F CQ++ +  +A+  
Sbjct  97    EKFAVLQFGVCPXRWDSSKRSFIAHPHNFYIFPRQELPVAGPTYEFLCQTTSIDFLAKYQ  156

Query  1472  FDFNACINDGISYLSRAQELAA---------KDCIRSPSAGSCTVPSPASRSVADSIFIN  1320
             FDFN CI++GISYLSR QE  A          + +   S     V  P  + +AD++F  
Sbjct  157   FDFNVCIHEGISYLSRGQESEALRRLSLTYDDELLTRCSNLKEPVHMPVVK-IADTLFAE  215

Query  1319  RIKSRVKHWRNA  1284
             R+K+    WR+ 
Sbjct  216   RMKNTFTEWRDG  227


 Score = 77.4 bits (189),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 83/311 (27%), Positives = 138/311 (44%), Gaps = 54/311 (17%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL+S  QK +V HN   D   I++KFL PLPST +EF  ++ + FPHI+D K L
Sbjct  334   GFRHVIDLLSSEQKLIVGHNCFLDIAHIYNKFLGPLPSTAEEFVSAVNKYFPHIIDTKVL  393

Query  846   M--------KELGSQKNLNN--------IYVATSYLNSRFFAPVDVELPHQAI-STKADS  718
             +        +   S+ +L++        I +     +S     V VE+    + S+  +S
Sbjct  394   LNTDNVLQQRMKKSRTSLSSAFALLCPQIALGKKSTDSEVQLCVKVEVQVDDLRSSNWNS  453

Query  717   VKSH--GHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLP--PALERYANIF-------  571
                H  G++      +FA+ CS L +D +A  + E   +LP    L++  N+        
Sbjct  454   GAKHEAGYDAFMTGCVFAQTCSHLGIDFQACLSSE---KLPHNEKLQKQINLLYLSWSNG  510

Query  570   DPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLVYGKHEVF--  397
             D    +               K   ++  +N+  +WGF S +    ++  +    +VF  
Sbjct  511   DIIDLTTGKKKAMSSGYNNHKKRYAQIMFENIALIWGFPSKLKARDIRECIT---KVFGP  567

Query  396   SSEFDIRLVDESCAVLVFSSPG-LSEVL-----LEALD---------SGSLEEMVSEGIR  262
             +S   +  +DE+   + FS    +SE L     LE  D         +G LE       R
Sbjct  568   TSVTXVYHLDETAVFIQFSKEKFVSEFLALKETLERSDGPVSVLHPLTGLLE---GGSTR  624

Query  261   AASYDAYVKVC  229
             AA+Y+ Y ++C
Sbjct  625   AANYETYKEIC  635



>ref|XP_008219726.1| PREDICTED: poly(A)-specific ribonuclease PARN [Prunus mume]
Length=683

 Score =   155 bits (391),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 116/192 (60%), Gaps = 12/192 (6%)
 Frame = -2

Query  1826  IKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAA  1647
             +K VTKSNF  AL ++   +  +DF+A+ L+ TG  S+PW+  L FD A++ YLK K +A
Sbjct  34    LKNVTKSNFEPALAELRRHVAAADFVAIDLEMTGITSAPWRDSLEFDRADVCYLKVKDSA  93

Query  1646  ERYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
             E++ +LQF VCPF    SK   IA P+NF++FPR E+    P+Y F CQ++ +  +A+  
Sbjct  94    EKFAVLQFGVCPFRWDSSKHSFIAHPHNFYIFPRQEISATNPAYEFLCQTTSIDFLAKYQ  153

Query  1472  FDFNACINDGISYLSRAQELAA---------KDCIRSPSAGSCTVPSPASRSVADSIFIN  1320
             FDFN CI++GISYLS+ QE+ A          + +   S     V  P  + +AD++F  
Sbjct  154   FDFNICIHEGISYLSKGQEIEALRHLSLAYEDELLAKWSNLKEPVHMPVVK-MADTLFTE  212

Query  1319  RIKSRVKHWRNA  1284
             R+K+    WR+ 
Sbjct  213   RMKNIFTEWRDG  224


 Score = 80.9 bits (198),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 83/310 (27%), Positives = 140/310 (45%), Gaps = 52/310 (17%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL+S  QK +V HN   D   I+SKF+ PLPST +EF  S+ + FP+++D K L
Sbjct  330   GFRHVIDLLSSEQKLIVGHNCFLDIAHIYSKFVGPLPSTAEEFVSSVNKCFPYVVDTKML  389

Query  846   M--------KELGSQKNLNN--------IYVATSYLNSRFFAPVDVELPHQAI-STKADS  718
             +        +   SQ +L++        I +     +  F + V VE+    + S+  +S
Sbjct  390   LNANNVLQQRMKKSQTSLSSAFAMLCPQIALGKKSTDLAFQSCVKVEVQVDDLRSSNWNS  449

Query  717   VKSH--GHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYAN----------I  574
                H  G++      +FA+ CS L +D ++    EH       L+++ N          I
Sbjct  450   GAKHEAGYDAFMTGCVFAQTCSHLGIDFQSFLPSEHLAH-NEKLQKHINLLYLSWSNRDI  508

Query  573   FDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVK---SLVYGKHE  403
              D  S       +   + +   K C  +  +N+  +WGF S +    ++   S V+G   
Sbjct  509   IDLTSGKKNAVSLGYTNHK---KRCPEILFENIALIWGFPSKLKARDIRECISKVFGPTS  565

Query  402   VFSSEFDIRLVDESCAVLVFSSPG-LSEVLL--EALDSGS--------LEEMVSEG-IRA  259
             V S    I  +DE+   + F+    +SE L+  E L+           L  ++  G  +A
Sbjct  566   VTS----IYHLDETAVFVQFNKEKFVSEFLILKETLERSDGPVSVLHPLAGLLEGGNTQA  621

Query  258   ASYDAYVKVC  229
             A+Y+ Y  +C
Sbjct  622   ANYETYKGIC  631



>ref|XP_008808745.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X2 [Phoenix 
dactylifera]
Length=723

 Score =   155 bits (392),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 110/183 (60%), Gaps = 12/183 (7%)
 Frame = -2

Query  1808  SNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQIL  1629
             SNF  AL D+  R+ E+DF+A+ L+ TG  S+PW+    FD +++ YLK K +AE++ ++
Sbjct  48    SNFEPALEDLRLRVREADFVAIDLEMTGITSAPWRDAFEFDRSDVRYLKVKDSAEKFAVV  107

Query  1628  QFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGFDFNAC  1455
             QF VCPF    +K   IA P+NF++FPR EL    PSY F CQ++ +  +A+  FDFNAC
Sbjct  108   QFGVCPFRWDGAKGSFIAHPHNFYVFPRKELPVDGPSYEFLCQTTSIDFLAKYQFDFNAC  167

Query  1454  INDGISYLSRAQELAAKDCIRSPSAGSCT---------VPSPASRSVADSIFINRIKSRV  1302
             I++GISYLSRAQE  A   + S                V  P  R+ AD IF  R+K+R 
Sbjct  168   IHEGISYLSRAQEAEALQTLSSAYKDEFNNSLYNLEEHVEIPLLRT-ADLIFTERMKNRF  226

Query  1301  KHW  1293
               W
Sbjct  227   HQW  229


 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 79/309 (26%), Positives = 132/309 (43%), Gaps = 56/309 (18%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKH-  850
             GFR V+DL++  +K +V HN   D   I+ KF  PLPS++ EF  ++ + FP I+D +H 
Sbjct  337   GFRHVIDLLTSEEKLIVGHNCFLDIAHIYCKFFGPLPSSMVEFALAVHKNFPRIIDTRHL  396

Query  849   ---------LMKELGSQKNLN------NIYVATSYLNSRFFAPVDVELPHQAISTKADSV  715
                      LMK      +         I   + ++ S  +  V+V+      S      
Sbjct  397   VNSSHVIQYLMKRSSKSLSSIFSLLCPRISSPSLHVASNSYVKVEVQADETGSSCFNSGA  456

Query  714   KSH-GHNVLKISELFAKVCSIL--KVDPKAPEAIEHCGQLPPALERYANIFDP-------  565
             K   G++      +FA+ CS L  K +  +P +I+        ++ Y N+  P       
Sbjct  457   KHEAGYDAFMTGCVFAQACSHLGMKFELHSP-SIDFSKN--DKIQNYMNLLYPSWNSGTV  513

Query  564   --CSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSL---VYGKHEV  400
                ST  ++P     D   + +  + V S N+V +WGF S I    +K     V+G   +
Sbjct  514   IDLSTGIENP-----DSSYKRRYPQIVFS-NIVLVWGFPSNIKPKDLKECVCKVFGPDSI  567

Query  399   FSSEFDIRLVDESCAVLVFSSPGLSE---VLLEALDSGS--------LEEMVSEG-IRAA  256
                   I  VD + A++ FS   L     +L + L+S          L +++  G   AA
Sbjct  568   TL----IFFVDSTAALIQFSKEDLVNEFLILKDNLESNDDPISVLHPLAKLLEGGNTHAA  623

Query  255   SYDAYVKVC  229
             +Y+ Y  +C
Sbjct  624   NYETYRDIC  632



>ref|XP_008808744.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Phoenix 
dactylifera]
Length=724

 Score =   155 bits (392),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 110/183 (60%), Gaps = 12/183 (7%)
 Frame = -2

Query  1808  SNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQIL  1629
             SNF  AL D+  R+ E+DF+A+ L+ TG  S+PW+    FD +++ YLK K +AE++ ++
Sbjct  48    SNFEPALEDLRLRVREADFVAIDLEMTGITSAPWRDAFEFDRSDVRYLKVKDSAEKFAVV  107

Query  1628  QFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGFDFNAC  1455
             QF VCPF    +K   IA P+NF++FPR EL    PSY F CQ++ +  +A+  FDFNAC
Sbjct  108   QFGVCPFRWDGAKGSFIAHPHNFYVFPRKELPVDGPSYEFLCQTTSIDFLAKYQFDFNAC  167

Query  1454  INDGISYLSRAQELAAKDCIRSPSAGSCT---------VPSPASRSVADSIFINRIKSRV  1302
             I++GISYLSRAQE  A   + S                V  P  R+ AD IF  R+K+R 
Sbjct  168   IHEGISYLSRAQEAEALQTLSSAYKDEFNNSLYNLEEHVEIPLLRT-ADLIFTERMKNRF  226

Query  1301  KHW  1293
               W
Sbjct  227   HQW  229


 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 79/309 (26%), Positives = 132/309 (43%), Gaps = 56/309 (18%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKH-  850
             GFR V+DL++  +K +V HN   D   I+ KF  PLPS++ EF  ++ + FP I+D +H 
Sbjct  338   GFRHVIDLLTSEEKLIVGHNCFLDIAHIYCKFFGPLPSSMVEFALAVHKNFPRIIDTRHL  397

Query  849   ---------LMKELGSQKNLN------NIYVATSYLNSRFFAPVDVELPHQAISTKADSV  715
                      LMK      +         I   + ++ S  +  V+V+      S      
Sbjct  398   VNSSHVIQYLMKRSSKSLSSIFSLLCPRISSPSLHVASNSYVKVEVQADETGSSCFNSGA  457

Query  714   KSH-GHNVLKISELFAKVCSIL--KVDPKAPEAIEHCGQLPPALERYANIFDP-------  565
             K   G++      +FA+ CS L  K +  +P +I+        ++ Y N+  P       
Sbjct  458   KHEAGYDAFMTGCVFAQACSHLGMKFELHSP-SIDFSKN--DKIQNYMNLLYPSWNSGTV  514

Query  564   --CSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSL---VYGKHEV  400
                ST  ++P     D   + +  + V S N+V +WGF S I    +K     V+G   +
Sbjct  515   IDLSTGIENP-----DSSYKRRYPQIVFS-NIVLVWGFPSNIKPKDLKECVCKVFGPDSI  568

Query  399   FSSEFDIRLVDESCAVLVFSSPGLSE---VLLEALDSGS--------LEEMVSEG-IRAA  256
                   I  VD + A++ FS   L     +L + L+S          L +++  G   AA
Sbjct  569   TL----IFFVDSTAALIQFSKEDLVNEFLILKDNLESNDDPISVLHPLAKLLEGGNTHAA  624

Query  255   SYDAYVKVC  229
             +Y+ Y  +C
Sbjct  625   NYETYRDIC  633



>ref|XP_007207137.1| hypothetical protein PRUPE_ppa002362mg [Prunus persica]
 gb|EMJ08336.1| hypothetical protein PRUPE_ppa002362mg [Prunus persica]
Length=682

 Score =   154 bits (390),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 116/192 (60%), Gaps = 12/192 (6%)
 Frame = -2

Query  1826  IKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAA  1647
             +K VTKSNF  AL ++   +  +DF+A+ L+ TG  S+PW+  L FD A++ YLK K +A
Sbjct  33    LKNVTKSNFEPALAELRRHVAAADFVAIDLEMTGITSAPWRDSLEFDRADVCYLKVKDSA  92

Query  1646  ERYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
             E++ +LQF VCPF    SK   IA P+NF++FPR E+    P+Y F CQ++ +  +A+  
Sbjct  93    EKFAVLQFGVCPFRWDSSKQYFIAHPHNFYIFPRQEILATNPAYEFLCQTTSIDFLAKYQ  152

Query  1472  FDFNACINDGISYLSRAQELAA---------KDCIRSPSAGSCTVPSPASRSVADSIFIN  1320
             FDFN CI++GISYLS+ QE+ A          + +   S     V  P  + +AD++F  
Sbjct  153   FDFNICIHEGISYLSKGQEIEALRHLSLAYEDELLAKWSNLKEPVHMPVVK-MADTLFTE  211

Query  1319  RIKSRVKHWRNA  1284
             R+K+    WR+ 
Sbjct  212   RMKNIFTEWRDG  223


 Score = 77.4 bits (189),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 85/309 (28%), Positives = 142/309 (46%), Gaps = 50/309 (16%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL+S  QK +V HN   D   I+SKF+ PLPST +EF  S+ + FP+++D K L
Sbjct  329   GFRHVIDLLSSEQKLIVGHNCFLDIAHIYSKFVGPLPSTAEEFVSSVNKCFPYVVDTKML  388

Query  846   M--------KELGSQKNLNN--------IYVATSYLNSRFFAPVDVELPHQAI-STKADS  718
             +        +   SQ +L++        I +     +  F + V VE+    + S+  +S
Sbjct  389   LNANNVLQQRMKKSQTSLSSAFAMLCPQIALGKKSTDLAFQSCVKVEVQVDDLRSSNWNS  448

Query  717   VKSH--GHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDPCSTSYQD  544
                H  G++      +FA+ CS L +D ++    EH       L+++ N+    S S +D
Sbjct  449   GAKHEAGYDAFMTGCVFAQTCSHLGIDFQSFLPSEHLAH-NEKLQKHINLL-YLSWSNRD  506

Query  543   PPINEEDVRVRAKSCKRVSSK---------NVVFLWGFQSGISTGQVK---SLVYGKHEV  400
               I+    +  A S    + K         N+  +WGF S +    ++   S V+G   V
Sbjct  507   -IIDLTSGKKNAVSLGYTNHKKRYPEILFENIALIWGFPSKLKARDIRECISKVFGPTSV  565

Query  399   FSSEFDIRLVDESCAVLVFSSPG-LSEVLL--EALDSGS--------LEEMVSEG-IRAA  256
              S    I  +DE+   + F+    +SE L+  E L+           L  ++  G  +AA
Sbjct  566   TS----IYHLDETAVFVQFNKEKFVSEFLILKETLERSDGPVSVLHPLAGLLEGGNTQAA  621

Query  255   SYDAYVKVC  229
             +Y+ Y  +C
Sbjct  622   NYETYKDIC  630



>gb|KDP25970.1| hypothetical protein JCGZ_22700 [Jatropha curcas]
Length=706

 Score =   155 bits (391),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/190 (44%), Positives = 116/190 (61%), Gaps = 10/190 (5%)
 Frame = -2

Query  1826  IKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAA  1647
             +K VTKSNF  AL  +++ +  +DFIA+ L+ TG  S+PW+  L +D  ++ YLKAK +A
Sbjct  29    LKHVTKSNFESALAKLKSHVGAADFIAIDLEMTGITSAPWRESLEYDRFDVRYLKAKDSA  88

Query  1646  ERYQILQFAVCPF---SLRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIARE  1476
             E++ I+QF VCPF   S R S  IA P+NF +FPR EL T  PSY F CQ++ +  +A+ 
Sbjct  89    EKFAIVQFGVCPFRWDSHRHS-FIAHPHNFFIFPRQELATDGPSYEFLCQTTSMDFLAKY  147

Query  1475  GFDFNACINDGISYLSRAQELAAKDCI--RSPSAGSC----TVPSPASRSVADSIFINRI  1314
              FDFNACI +G+SYLSR QE  A   +  R  S G       V      SV + +F  R+
Sbjct  148   QFDFNACIYEGVSYLSRGQEEEALRRLYSRYESDGMLDNLNDVRDLPLASVTNILFSERM  207

Query  1313  KSRVKHWRNA  1284
               R++ WR+ 
Sbjct  208   TKRLREWRDG  217


 Score = 75.9 bits (185),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 75/279 (27%), Positives = 124/279 (44%), Gaps = 46/279 (16%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL+S +QK +V HN   D   I+SKF  PLP T +EF  S+ + FPHI+D K L
Sbjct  323   GFRHVIDLLSSAQKLIVGHNCFLDIAHIYSKFFGPLPLTAEEFVASVNKHFPHIVDTKIL  382

Query  846   MKELGSQKNLNNIYVATSYLNS--RFFAP-------------------VDVELPHQAIST  730
             +    +   L  +  + + L+S  R   P                   V+V++     S 
Sbjct  383   LN--ANDVLLRRMKKSRTSLSSAFRLLCPEIALGSNDSSDIAFDRQVNVEVQVDDTRFSK  440

Query  729   KADSVKSH-GHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDPCSTS  553
              +  VK   G++      +FA+ CS L +D     + ++       L+++ N+     + 
Sbjct  441   LSSGVKHEAGYDAFMTGCVFAQACSHLGIDFDLQLSSDNLAH-NEKLQKHVNLL--YLSW  497

Query  552   YQDPPINEEDVRVRAKSC---------KRVSSKNVVFLWGFQSGISTGQVKSL---VYGK  409
             +    IN       A+S           ++  +N+V +W F S +   +++     V+G+
Sbjct  498   FNGDIINLRTGNRIAESLVTNNIKKRHTKILFENIVLIWRFPSTLKASEIRECICKVFGQ  557

Query  408   HEVFSSEFDIRLVDESCAVLVFSSPGLSE---VLLEALD  301
             + V S    I  VDE+  ++ FS   L     VL E LD
Sbjct  558   NSVTS----IYKVDETAVLVQFSKSELVSDFLVLKEELD  592



>gb|EPS70287.1| hypothetical protein M569_04472 [Genlisea aurea]
Length=593

 Score =   152 bits (385),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 114/184 (62%), Gaps = 7/184 (4%)
 Frame = -2

Query  1826  IKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAA  1647
             +  VT++NFS AL ++   + ++DF+++ L+ TG  S+PW+  L FD ++I YLK K +A
Sbjct  40    VNDVTETNFSTALTELRRLVRDADFVSIDLEMTGVTSAPWREALEFDRSDIQYLKIKDSA  99

Query  1646  ERYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
             ER+ ++QF VCPF         +A PYNF+LFPR E+        F CQ+S L  +A+  
Sbjct  100   ERFSVVQFGVCPFRWDTHSHCFVAHPYNFYLFPRQEVSIDGFWNDFLCQTSSLEFLAKHQ  159

Query  1472  FDFNACINDGISYLSRAQELAA----KDCIRSPSAGSCTVPSPASRSVADSIFINRIKSR  1305
             FDFN CI  GISYLSR+QEL A     D   +PS G+ T+ +  S  ++D +F+ R+K+ 
Sbjct  160   FDFNTCIYKGISYLSRSQELEALNKFPDSSPTPS-GTTTMDTMQSTRMSDILFVERMKNT  218

Query  1304  VKHW  1293
             +  W
Sbjct  219   IDEW  222


 Score = 80.1 bits (196),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 80/307 (26%), Positives = 139/307 (45%), Gaps = 51/307 (17%)
 Frame = -1

Query  1038  KCVRGFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILD  859
             K   GFR V+DL+S  +K +V HN   D+  ++ KF  PLP T++EF   L   FPHI+D
Sbjct  283   KAAIGFRHVIDLLSSEKKLIVGHNCFLDWAHVYRKFFGPLPPTVEEFASELQAYFPHIID  342

Query  858   VKHLMKELGSQKNLNNIYVATSYLN---SRFFAP-----------VDVELPHQAIST-KA  724
              K ++        L+ +  A + L+   SR  +P           V+V++  + +S   +
Sbjct  343   TKVMLN--SDDALLHTVGRAGTSLSKAFSRLCSPASGRINGLLVKVEVQVDDRRVSNWNS  400

Query  723   DSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDPCSTSYQD  544
              S    G++      +F++ C  L +D           +    L +Y N+      S+ +
Sbjct  401   GSKHEAGYDAFMTGSVFSQACLHLGIDLGMDSVDLRRNE---KLGKYLNLL---YLSWAN  454

Query  543   PPINEEDVRV-RAKSCKRVSSKN-----VVFLWGFQSGISTGQVK---SLVYGKHEVFSS  391
               +   D++  RA + K    K+     +V LWG  S + T  ++   S  +G   V S+
Sbjct  455   GDV--VDLKTGRATAAKSRYPKDRDFSKMVVLWGEPSRLKTKDIRECFSKTFGTSAVTSA  512

Query  390   EFDIRLVDESCAVLVFSSPGLSEVLLEALDS------GSLEEM-----VSEG--IRAASY  250
                 R +DE+ A++ FS   L E  LE  D+      G +  +     + +G  +RA +Y
Sbjct  513   ----RHLDETAALVQFSGEELVEKFLEWKDALRRDGGGPISSLHPLTRIFDGGTVRAGTY  568

Query  249   DAYVKVC  229
             + Y ++C
Sbjct  569   ETYKEIC  575



>emb|CDP13712.1| unnamed protein product [Coffea canephora]
Length=716

 Score =   153 bits (386),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 77/193 (40%), Positives = 115/193 (60%), Gaps = 10/193 (5%)
 Frame = -2

Query  1832  WGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKR  1653
             + IK VTKSNF  ALND+   + ++DF+AV L+ TG  S+PW+     D  +I YLK K 
Sbjct  35    FAIKNVTKSNFESALNDLRLYVKDADFVAVDLEMTGVTSAPWRESFELDRFDIQYLKVKD  94

Query  1652  AAERYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAR  1479
             +AE++  +QF VCPF     +   +A P+NF++FPR E+K    SY F CQ++ +  +A+
Sbjct  95    SAEKFAAVQFGVCPFRWEPHRQSFVAHPHNFYIFPRQEIKGDDTSYEFLCQTTSINFLAK  154

Query  1478  EGFDFNACINDGISYLSRAQE------LAAKDCIRSPSAGSCTVPSPASR--SVADSIFI  1323
               FDFN CI +G+SYLSR+QE      L A+   R   + SC      ++   VAD +F 
Sbjct  155   YQFDFNLCIREGVSYLSRSQEKEALGRLNARYKDRLLDSSSCWREGVDTKLVRVADILFS  214

Query  1322  NRIKSRVKHWRNA  1284
              R+K+++  W + 
Sbjct  215   ERLKNKIAEWHDG  227


 Score = 78.6 bits (192),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 84/320 (26%), Positives = 141/320 (44%), Gaps = 64/320 (20%)
 Frame = -1

Query  1038  KCVRGFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILD  859
             K   GFR V+DL+S  +K +V HNS  D   I+ KF+ PLPST  E   S+ + FP+I+D
Sbjct  328   KAAIGFRHVIDLLSSEKKLIVGHNSFLDIAHIYRKFIGPLPSTAKECVISIQKFFPYIVD  387

Query  858   VKHLMKE--------LGSQKNLNNIY----------VATSYLNSRFFAPVDVELPHQ-AI  736
              K L+            S  +L+  +          V TS L  +    V+V++ ++ ++
Sbjct  388   TKVLLNASTVCQKILKKSSTSLSKAFALLCPQIASGVKTSGLADKRLVKVEVQVDNKRSL  447

Query  735   STKADSVKSHGHNVLKISELFAKVCSILKVD----PKAPEAIEHCGQLPPALERYANIFD  568
             +  + +    G++      +FA+ CS L VD    P + +   H       L+ Y N+  
Sbjct  448   NWNSGAKHEAGYDAFMTGCVFAQACSHLGVDFTLNPSSVDLSHH-----EKLQEYINLL-  501

Query  567   PCSTSYQDPPINEEDVRVRAKSCKRVSSK------------NVVFLWGFQSGISTGQVKS  424
                 S+ +  I   D++   +    + SK            N V LWGF + +   +++ 
Sbjct  502   --YLSWINGDII--DLKTGERKTDSICSKGFKAHHSKILFSNTVLLWGFPAKLKASEIRE  557

Query  423   L---VYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSE---VLLEALDSGS--------LE  286
                 V+G     SS   I  +D++   + FS   L     VL E L+  +        L 
Sbjct  558   CFCKVFGS----SSITFIYHLDKTAVFIQFSKEELVSDFLVLKETLERSNDPISVLHPLS  613

Query  285   EMVSEG-IRAASYDAYVKVC  229
             +++  G  RAASY+ Y ++C
Sbjct  614   KVLQGGRTRAASYEVYKQIC  633



>ref|XP_010240011.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X2 [Brachypodium 
distachyon]
Length=691

 Score =   152 bits (384),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/202 (39%), Positives = 118/202 (58%), Gaps = 14/202 (7%)
 Frame = -2

Query  1859  NSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTA  1680
              +G S  G   +KQVT+ N +EAL ++  R+ ++ F+ + L+ +G  S+PW+     D A
Sbjct  36    GAGSSRVGGVAVKQVTRGNLAEALEELRARVRDAAFVGLDLEMSGVTSAPWRDTFELDRA  95

Query  1679  EIAYLKAKRAAERYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQ  1506
             ++ YLK + +A+R+  LQ  VCPF    +K   +A P+NF +FPR EL   + S+ F CQ
Sbjct  96    DVRYLKLRDSAQRFAALQLGVCPFRWDPAKSAFVAHPHNFFIFPRKELPDDISSHEFLCQ  155

Query  1505  SSYLISIAREGFDFNACINDGISYLSRAQELAA--------KDCIRSP-SAGSCTVPSPA  1353
             ++ +  +A+  FDFN C ++GISYLSRAQE  A         D I SP ++    VP   
Sbjct  156   TTSIDFLAKYQFDFNTCFHEGISYLSRAQEEEALQKLNVLYHDGIASPNTSEEEDVP---  212

Query  1352  SRSVADSIFINRIKSRVKHWRN  1287
              RS AD +F  R+K + K WR+
Sbjct  213   LRSTADLLFTERMKIKFKEWRD  234


 Score = 84.7 bits (208),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 88/314 (28%), Positives = 137/314 (44%), Gaps = 58/314 (18%)
 Frame = -1

Query  1038  KCVRGFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILD  859
             K   G R V+DL++  +K +V H+   D   ++SKF+ PLPST+ EF   + ++ P+I D
Sbjct  299   KSAVGIRHVIDLLASERKLIVGHSCFLDIAQVYSKFIGPLPSTVKEFALGIHKILPYIAD  358

Query  858   VKHLMKELGS--------QKNLNNIY------VATSYLNSRFFAPV--DVELPHQAISTK  727
              +HLM    S         K+L++++        ++       +PV  +VE     +S  
Sbjct  359   TRHLMSASDSVQYLMRQKSKSLSSVFSLLCPAFHSTVAEPSTLSPVRIEVEADETMLSCF  418

Query  726   ADSVKSH-GHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPP--------ALERYANI  574
             A   K   G++      +FA++C  L V        EH   LPP         L++Y N+
Sbjct  419   ASGAKHEAGYDAFMTGCVFAQLCDHLDV------KFEH---LPPRDNLAMNNKLQKYINL  469

Query  573   FDPCSTSYQDPPINEEDVRVRAKSCKR---VSSKNVVFLWGFQSGISTGQVKSL---VYG  412
               P   S     ++    R      +R   V   NVV +WG+QS +    +K     V+G
Sbjct  470   LSPSFNSGTSLDLSTGMERPDTGYKRRYPTVLYDNVVLIWGYQSELRPRDIKDCICKVFG  529

Query  411   KHEVFSSEFDIRLVDESCAVLVFSSPGLS-------EVLLEALDSG-----SLEEMVSEG  268
                V ++ F I    +S AVLV  S   S       +  LE  DS       L  ++  G
Sbjct  530   PASV-TTIFSI----DSTAVLVQFSKQESVNDFMDLKAALEKTDSAISVLHPLSTILEGG  584

Query  267   -IRAASYDAYVKVC  229
               RAA+YD Y  +C
Sbjct  585   KTRAANYDTYRDIC  598



>ref|XP_003581331.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Brachypodium 
distachyon]
Length=729

 Score =   152 bits (384),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 118/203 (58%), Gaps = 14/203 (7%)
 Frame = -2

Query  1859  NSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTA  1680
              +G S  G   +KQVT+ N +EAL ++  R+ ++ F+ + L+ +G  S+PW+     D A
Sbjct  36    GAGSSRVGGVAVKQVTRGNLAEALEELRARVRDAAFVGLDLEMSGVTSAPWRDTFELDRA  95

Query  1679  EIAYLKAKRAAERYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQ  1506
             ++ YLK + +A+R+  LQ  VCPF    +K   +A P+NF +FPR EL   + S+ F CQ
Sbjct  96    DVRYLKLRDSAQRFAALQLGVCPFRWDPAKSAFVAHPHNFFIFPRKELPDDISSHEFLCQ  155

Query  1505  SSYLISIAREGFDFNACINDGISYLSRAQELAA--------KDCIRSP-SAGSCTVPSPA  1353
             ++ +  +A+  FDFN C ++GISYLSRAQE  A         D I SP ++    VP   
Sbjct  156   TTSIDFLAKYQFDFNTCFHEGISYLSRAQEEEALQKLNVLYHDGIASPNTSEEEDVP---  212

Query  1352  SRSVADSIFINRIKSRVKHWRNA  1284
              RS AD +F  R+K + K WR+ 
Sbjct  213   LRSTADLLFTERMKIKFKEWRDV  235


 Score = 84.7 bits (208),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 88/314 (28%), Positives = 137/314 (44%), Gaps = 58/314 (18%)
 Frame = -1

Query  1038  KCVRGFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILD  859
             K   G R V+DL++  +K +V H+   D   ++SKF+ PLPST+ EF   + ++ P+I D
Sbjct  337   KSAVGIRHVIDLLASERKLIVGHSCFLDIAQVYSKFIGPLPSTVKEFALGIHKILPYIAD  396

Query  858   VKHLMKELGS--------QKNLNNIY------VATSYLNSRFFAPV--DVELPHQAISTK  727
              +HLM    S         K+L++++        ++       +PV  +VE     +S  
Sbjct  397   TRHLMSASDSVQYLMRQKSKSLSSVFSLLCPAFHSTVAEPSTLSPVRIEVEADETMLSCF  456

Query  726   ADSVKSH-GHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPP--------ALERYANI  574
             A   K   G++      +FA++C  L V        EH   LPP         L++Y N+
Sbjct  457   ASGAKHEAGYDAFMTGCVFAQLCDHLDV------KFEH---LPPRDNLAMNNKLQKYINL  507

Query  573   FDPCSTSYQDPPINEEDVRVRAKSCKR---VSSKNVVFLWGFQSGISTGQVKSL---VYG  412
               P   S     ++    R      +R   V   NVV +WG+QS +    +K     V+G
Sbjct  508   LSPSFNSGTSLDLSTGMERPDTGYKRRYPTVLYDNVVLIWGYQSELRPRDIKDCICKVFG  567

Query  411   KHEVFSSEFDIRLVDESCAVLVFSSPGLS-------EVLLEALDSG-----SLEEMVSEG  268
                V ++ F I    +S AVLV  S   S       +  LE  DS       L  ++  G
Sbjct  568   PASV-TTIFSI----DSTAVLVQFSKQESVNDFMDLKAALEKTDSAISVLHPLSTILEGG  622

Query  267   -IRAASYDAYVKVC  229
               RAA+YD Y  +C
Sbjct  623   KTRAANYDTYRDIC  636



>ref|XP_009600219.1| PREDICTED: poly(A)-specific ribonuclease PARN [Nicotiana tomentosiformis]
Length=721

 Score =   152 bits (384),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/191 (40%), Positives = 112/191 (59%), Gaps = 10/191 (5%)
 Frame = -2

Query  1832  WGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKR  1653
             + +K VTKSNF  ALND+   + ++DF+AV L+ TG  S+PW+    FD  +I YLK K 
Sbjct  43    FALKNVTKSNFESALNDLRGLVRDADFVAVDLEMTGVTSAPWRDSFDFDRYDIRYLKVKD  102

Query  1652  AAERYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAR  1479
             +AE++ ++QF VCPF     K   +A P+NF++FPR E+     SY F CQ++ L  +A+
Sbjct  103   SAEKFAVVQFGVCPFRWDSHKQSFLAHPHNFYIFPRQEIPGSNQSYEFLCQTASLDFLAK  162

Query  1478  EGFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRS--------VADSIFI  1323
               FDFN CI +G+SYLSR+QE  A + I S      +      R         +AD +F 
Sbjct  163   YQFDFNVCIREGVSYLSRSQEEEALERISSTFMDESSDSVYGLREDAEFPLIRMADVLFA  222

Query  1322  NRIKSRVKHWR  1290
              R+K+ ++ W 
Sbjct  223   ERMKNTIREWH  233


 Score = 80.5 bits (197),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 78/314 (25%), Positives = 143/314 (46%), Gaps = 52/314 (17%)
 Frame = -1

Query  1038  KCVRGFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILD  859
             K   GFR V+DL+S  +K +V HN   D   I+SKF+ PLP T++++  S+ + FP I+D
Sbjct  337   KSAVGFRHVIDLLSSERKLIVGHNCFLDMAHIYSKFIGPLPLTVEDYVSSIQKYFPCIID  396

Query  858   VKHLMKELGS-QKNLNN---------IY--------VATSYLNSRFFAPVDVEL-PHQAI  736
              K L+   G  Q+ +N          +Y        V TS L  R    V+V++  ++ +
Sbjct  397   TKILLNANGVFQQRVNKSSTSLSRAFVYICPQIALGVKTSGLADRPCVEVEVQVDENRFL  456

Query  735   STKADSVKSHGHNVLKISELFAKVCSILKVD----------PKAPEAIEHCGQLPPALER  586
             +  + +    G++      +FA+ C+ L +D          PK  +   +  +L  +   
Sbjct  457   NWNSGAKHEAGYDAFMTGCIFAQACNHLGIDFTLHVLAGGLPKETKLQNYINRLYLSWVS  516

Query  585   YANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSL---VY  415
               +I D  +           +++ R    + +S  ++V LWG  S +   ++K+    V+
Sbjct  517   -GDIIDLSTGKCTTDTSASSNLKSRY---QEISFPSIVLLWGLPSKLKAREIKACIVKVF  572

Query  414   GKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDSGS-----------LEEMV-SE  271
             G + + S    I  +DES   + FS P +    LE  ++ S           L +++ ++
Sbjct  573   GPNSISS----IYHLDESAVFIQFSKPEMVSKFLEIKETLSRNSDPISVLHPLSDILNAD  628

Query  270   GIRAASYDAYVKVC  229
                AA+YD Y ++C
Sbjct  629   CTHAANYDVYQQIC  642



>ref|XP_002891857.1| Poly(A)-specific ribonuclease [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68116.1| Poly(A)-specific ribonuclease [Arabidopsis lyrata subsp. lyrata]
Length=689

 Score =   151 bits (381),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/223 (35%), Positives = 123/223 (55%), Gaps = 8/223 (4%)
 Frame = -2

Query  1826  IKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAA  1647
             +K VT+SNF   LND+ + +  +DF+A+ L+ TG  S+PW+  L FD  ++ YLK K +A
Sbjct  38    LKHVTRSNFETTLNDLRSLVKAADFVAIDLEMTGVTSAPWRDSLEFDRYDVRYLKVKDSA  97

Query  1646  ERYQILQFAVCPFSL--RESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
             E++ ++QF VCPF    R    ++ P+NF +FPR EL    P++ F CQ++ +  +A+  
Sbjct  98    EKFAVVQFGVCPFRWDSRTQSFVSHPHNFFVFPRQELTFDPPAHEFLCQTTSMDFLAKYQ  157

Query  1472  FDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRS-----VADSIFINRIKS  1308
             FDFN CI++GISYLSR QE  A   +         V S  +       +AD++F  R++ 
Sbjct  158   FDFNTCIHEGISYLSRRQEEEASKRLEMLHGEEGIVSSGETEDLKLVRLADTLFAVRMEK  217

Query  1307  RVKHWRNACTDQSKKTEDV-LISSLRKMISATEVHGSRPCLNI  1182
              +  WR+        + +   IS+       T  H  RP L++
Sbjct  218   MLNEWRSGLLHGGNASSEFPRISNGSTQSMETVFHHMRPALSL  260


 Score = 73.9 bits (180),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 77/307 (25%), Positives = 134/307 (44%), Gaps = 53/307 (17%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR+V+DL++  +K +V HN   D   ++SKF+ PLPST ++F  S+   FP+I+D K L
Sbjct  331   GFRQVIDLLASEKKLIVGHNCFLDIAHVYSKFVGPLPSTAEKFVASINSHFPYIVDTKIL  390

Query  846   ----------MKELGSQKNLNNIYV----------ATSYLNSRFFAPVDVELPHQAIST-  730
                       MK+  +  +     +          + S+L  R    +DVE+ +   S  
Sbjct  391   LNVNPMLHQRMKKSSTSLSSAFSSLCPQIEFSSRSSDSFLQQR--VNIDVEIDNVRCSNW  448

Query  729   KADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDPCST--  556
              A      G++      +FA+ C+ L  D K    +++  Q    LE+Y N      T  
Sbjct  449   NAGGKHEAGYDAFMTGCIFAQACNHLGFDFKQHSQLDNFAQ-NEKLEKYINRLYLSWTRG  507

Query  555   ---SYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLV---YGKHEVFS  394
                + +    N ++ RV      +   +N+V +W F   +   ++K  +   +G   V S
Sbjct  508   DIINLRTGHSNADNWRV-----SKFKYENIVLIWNFPRKLKAREIKECICKAFGSASVTS  562

Query  393   SEFDIRLVDESCAVLVFSSPGLSEVLL---EALDSGS--------LEEMVSEG-IRAASY  250
                 +  VD+S   ++F +  L    L     L+S          L +++  G   AA Y
Sbjct  563   ----VYHVDDSAVFVLFKNSELVWDFLTLKRQLESSDGPVSVLHPLSKILEGGNTGAADY  618

Query  249   DAYVKVC  229
             +AY ++C
Sbjct  619   EAYKEIC  625



>ref|XP_010501213.1| PREDICTED: poly(A)-specific ribonuclease PARN [Camelina sativa]
Length=690

 Score =   151 bits (381),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 79/223 (35%), Positives = 123/223 (55%), Gaps = 8/223 (4%)
 Frame = -2

Query  1826  IKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAA  1647
             +K VT+SNF   LND+   +  +DF+A+ L+ TG  S+PW+  L FD  ++ YLK K +A
Sbjct  39    LKHVTRSNFETTLNDLRALVKAADFVAIDLEMTGVTSAPWRDSLEFDRYDVRYLKVKDSA  98

Query  1646  ERYQILQFAVCPFSL--RESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
             E++ ++QF VCPF    R    ++ P+NF +FPR EL    P++ F CQ++ +  +A+  
Sbjct  99    EKFAVVQFGVCPFRWDSRTQSFVSHPHNFFVFPRQELTFDPPAHEFLCQTTSMDFLAKYQ  158

Query  1472  FDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRS-----VADSIFINRIKS  1308
             FDFN CI++GISYLSR QE  A   + +  +      S  +       +AD +F  R+K+
Sbjct  159   FDFNTCIHEGISYLSRRQEEDASKRLETLYSEEGIDSSGETEDLKLVRLADVLFAERMKN  218

Query  1307  RVKHWRNACTDQSK-KTEDVLISSLRKMISATEVHGSRPCLNI  1182
              +  WR          +E   IS+     + T  H  RP L++
Sbjct  219   MLNEWRTGLLHGGNVSSESPRISNGSTQSTETVFHHMRPALSL  261


 Score = 66.6 bits (161),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 71/302 (24%), Positives = 126/302 (42%), Gaps = 43/302 (14%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR+V+DL++  +K +V HN   D   ++SKF+ PLPST ++F  S+   FP+I+D K L
Sbjct  332   GFRQVIDLLASEKKLIVGHNCFLDIAHVYSKFVGPLPSTAEKFVASINSHFPYIVDTKIL  391

Query  846   ----------MKELGSQKNLNNIYV----------ATSYLNSRFFAPVDVELPHQAIST-  730
                       MK+  +  +     +          + S+L  R    +DVE+ +   S  
Sbjct  392   LNVNPMLHQRMKKSSTSLSSAFSSLCPQIEFSSRSSDSHLQQRL--KIDVEVDNIRCSNW  449

Query  729   KADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDPCSTSY  550
              A      G++      +FA+ C+ L  D       ++       LE+Y N      T  
Sbjct  450   NAGGKHEAGYDAFMTGCIFAQACNHLGFDFTQHSQSDNLAH-NEKLEKYINRLYLSWTRG  508

Query  549   QDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLV---YGKHEVFSSEFDI  379
                 +             +   +N+V +W F   +   ++K  +   +G   V S    +
Sbjct  509   DIIDLRTGHTNADNWRVSKFKYENIVLIWNFPRKLKAREIKECICKAFGSVSVIS----V  564

Query  378   RLVDESCAVLVFSSPGLSEVLLE---ALDSGS--------LEEMVSEG-IRAASYDAYVK  235
               +D+S   ++F +  L    L+    L+S          L +++  G   AA Y+AY +
Sbjct  565   YHIDDSAVFVLFKNSELVCDFLKLKRQLESSDGPVSVLHPLSKILEGGNTGAADYEAYKE  624

Query  234   VC  229
             +C
Sbjct  625   IC  626



>ref|XP_010462450.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Camelina 
sativa]
Length=690

 Score =   151 bits (381),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 82/246 (33%), Positives = 132/246 (54%), Gaps = 9/246 (4%)
 Frame = -2

Query  1895  FCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYS  1716
             FC++ +E      +  +    + +K VT+SNF + LND+   +  +DF+A+ L+ TG  S
Sbjct  17    FCSSAAERVSNSTAAAATVA-FPLKHVTRSNFEKTLNDLRALVKAADFVAIDLEMTGVTS  75

Query  1715  SPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPF--SLRESKLIASPYNFHLFPRDEL  1542
             +PW+  L FD  ++ YLK K +AE++ ++QF VCPF    R    ++ P NF +FPR EL
Sbjct  76    APWRDSLEFDRYDVRYLKVKDSAEKFAVVQFGVCPFRWDARTQSFVSHPQNFFVFPRQEL  135

Query  1541  KTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVP  1362
                 P++ F CQ++ +  +A+  FDFN CI++GISYLSR QE  A   + +         
Sbjct  136   TFDPPAHEFLCQTTSMDFLAKYQFDFNTCIHEGISYLSRRQEEEASKRLETLYREEGIDS  195

Query  1361  SPASRS-----VADSIFINRIKSRVKHWRNACTDQSK-KTEDVLISSLRKMISATEVHGS  1200
             S  +       +AD +F  R+K+ +  WR    +     +E   IS+     + T  H  
Sbjct  196   SGETEDLKLVRLADVLFAERMKNMLNEWRTGLLNGGNVSSESPRISNESTRSTETVFHQM  255

Query  1199  RPCLNI  1182
             RP L++
Sbjct  256   RPALSL  261


 Score = 67.8 bits (164),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 75/307 (24%), Positives = 131/307 (43%), Gaps = 53/307 (17%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR+V+DL++  +K +V HN   D   ++SKF+ PLPST ++F  S+   FP+I+D K L
Sbjct  332   GFRQVIDLLASEKKLIVGHNCFLDIAHVYSKFVGPLPSTAEKFVASINSHFPYIVDTKIL  391

Query  846   ----------MKELGSQKNLNNIYV----------ATSYLNSRFFAPVDVELPHQAIST-  730
                       MK+  +  +     +          + S+L  R    +DVE+ +   S  
Sbjct  392   LNVNPMLHQRMKKSSTSLSSAFSSLCPQIEFSSRSSDSHLQQR--VKIDVEVDNFRCSNW  449

Query  729   KADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDPCST--  556
              A      G++      +FA+ C+ L  D       ++       LE+Y N      T  
Sbjct  450   NAGGKHEAGYDAFMTGCIFAQACNHLGFDFTQHSQSDNLAH-NEKLEKYINRLYLSWTRG  508

Query  555   ---SYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLV---YGKHEVFS  394
                  +    N ++ RV      +   +N+V +W F   +   ++K  +   +G   V S
Sbjct  509   DIIDLRTGHSNADNWRV-----SKFKYENIVLIWNFPRKLKAREIKECICKAFGSVSVIS  563

Query  393   SEFDIRLVDESCAVLVFSSPGLSEVLLE---ALDSGS--------LEEMVSEG-IRAASY  250
                 +  +D+S   L+F +  L    L+    L+S          L +++  G   AA Y
Sbjct  564   ----VYHIDDSAVFLLFKNSELVWDFLKLKRQLESSDGPVSVLHPLSKILEGGNTGAADY  619

Query  249   DAYVKVC  229
             +AY ++C
Sbjct  620   EAYKEIC  626



>ref|XP_006304676.1| hypothetical protein CARUB_v10011913mg [Capsella rubella]
 gb|EOA37574.1| hypothetical protein CARUB_v10011913mg [Capsella rubella]
Length=689

 Score =   151 bits (381),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 83/225 (37%), Positives = 127/225 (56%), Gaps = 12/225 (5%)
 Frame = -2

Query  1826  IKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAA  1647
             +K VT+SNF   LND+   +  +DF+A+ L+ TG  S+PW+  L FD  ++ YLK K +A
Sbjct  38    LKHVTRSNFETTLNDLRALVKAADFVAIDLEMTGVTSAPWRDSLEFDRYDVRYLKVKDSA  97

Query  1646  ERYQILQFAVCPFSL--RESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
             E++ ++QF VCPF    R    ++ P+NF +FPR EL    P++ F CQ++ +  +A+  
Sbjct  98    EKFAVVQFGVCPFRWDSRTHSFVSHPHNFFVFPRQELTFDPPAHEFLCQTTSMDFLAKYQ  157

Query  1472  FDFNACINDGISYLSRAQELAAKDCI-------RSPSAGSCTVPSPASRSVADSIFINRI  1314
             FDFN CI++GISYLSR QE  A   +       R+ S+G  T      R +AD +F  R+
Sbjct  158   FDFNTCIHEGISYLSRRQEEEASQRLERLHGEERNDSSGE-TEDLKLVR-LADVLFAERM  215

Query  1313  KSRVKHWRNACTDQSK-KTEDVLISSLRKMISATEVHGSRPCLNI  1182
             K+ +  WR+         +E   IS+     + T  H  RP L++
Sbjct  216   KNMLNDWRSGLLHGGNVSSESPKISNGSTQSTETVFHHMRPALSL  260


 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 73/302 (24%), Positives = 125/302 (41%), Gaps = 43/302 (14%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR+V+DL++  QK +V HN   D   ++SKF+ PLPST ++F  S+   FP+I+D K L
Sbjct  331   GFRQVIDLLASEQKLIVGHNCFLDIAHVYSKFVGPLPSTAEKFVASINSHFPYIVDTKIL  390

Query  846   ----------MKELGSQKNLNNIYV----------ATSYLNSRFFAPVDVELPHQAIST-  730
                       MK+  +  +     +          + S+L  R    +DVE+ +   S  
Sbjct  391   LNVNPMLHQRMKKSSTSLSSAFSSLCPQIEFSSRSSDSFLQQR--VKIDVEVDNIRCSNW  448

Query  729   KADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDPCSTSY  550
              A      G++      +FA+ C+ L  D K     ++  +    LE+Y N      T  
Sbjct  449   NAGGKHEAGYDAFMTGCIFAQACNHLGFDFKQHSQSDNLAR-NEKLEKYINRLYLSWTRG  507

Query  549   QDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLV---YGKHEVFSSEFDI  379
                 +             +   +N+V +W F   +   ++K  +   +G   V S    +
Sbjct  508   DIIDLRTGHSNADNWRVSKFKYENIVLIWNFPRKLKAREIKECICKTFGSASVIS----V  563

Query  378   RLVDESCAVLVFSSPGLSEVLL---EALDSGS--------LEEMVSEG-IRAASYDAYVK  235
               +D+S   + F +  L    L     L+S          L +++  G   AA Y AY +
Sbjct  564   YHIDDSAVFVFFKNSELVWDFLTLKRQLESSDGPVSVLHPLSKILEGGNTGAADYKAYKE  623

Query  234   VC  229
             +C
Sbjct  624   IC  625



>ref|XP_010061446.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X2 [Eucalyptus 
grandis]
Length=722

 Score =   151 bits (382),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 112/189 (59%), Gaps = 12/189 (6%)
 Frame = -2

Query  1826  IKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAA  1647
             IK VT+SNF  AL  +   +  +D++AV L+ TG  S+PW+    FD  ++ YLK K +A
Sbjct  37    IKNVTRSNFEPALESLREHVRAADYVAVDLEMTGVTSAPWRESFEFDRYDVRYLKVKDSA  96

Query  1646  ERYQILQFAVCPFSLRESKL--IASPYNFHLFPRDELKTGMPS-YSFSCQSSYLISIARE  1476
             E++ ++QF VCPF     +L  +A P+NF++FPR EL    PS Y F CQ++ +  +A+ 
Sbjct  97    EKFAVVQFGVCPFRWDPQELCFVAHPHNFYIFPRQELSFDDPSAYEFLCQTASVDFLAKY  156

Query  1475  GFDFNACINDGISYLSRAQE------LAAKDCIRSPSAGSCTVPSPASRSVADSIFINRI  1314
              FDFN CI +GISYLSR QE      L    C R+       VP     S+AD +F  RI
Sbjct  157   QFDFNMCIREGISYLSREQENELLRHLEESSCSRNKHKEFRDVPLI---SIADVLFSERI  213

Query  1313  KSRVKHWRN  1287
             K+R+K W +
Sbjct  214   KNRIKEWHD  222


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 101/235 (43%), Gaps = 40/235 (17%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL+S  QK +V HN   D   I+ KF   LP T +EF  S     P+I+D K L
Sbjct  329   GFRHVIDLLSSEQKLIVGHNCFLDVAHIYRKFFGELPFTAEEFVSSANEHLPYIVDTKVL  388

Query  846   MKE--------LGSQKNLNNIYV----------ATSYLNSRFFAPVDVELPH-QAISTKA  724
             +            S+ +L++ +V           ++ L S+    V+V++   +A S  A
Sbjct  389   LNSSDILKYWMRRSKTSLSSSFVRLCPQIALGYTSTDLASKACVKVEVQVDDLRASSWNA  448

Query  723   DSVKSHGHNVLKISELFAKVCSIL--KVDPKAPEAIEHCGQLPPALERYAN---------  577
              +    G++      +FA+ CS L  K  P +   I    ++   LE+Y N         
Sbjct  449   GAKHEAGYDAFMTGCVFAQACSHLGIKFHPHSSSEILARDEI---LEKYVNRLYLSWNNR  505

Query  576   -IFDPCSTSYQDPPINEEDVRVRAKS-CKRVSSKNVVFLWGFQSGISTGQVKSLV  418
              I D  + S     +    +   +K  C++     ++ +WGF   +   ++K  +
Sbjct  506   DIIDFSTGSVTGNSVGSTYLNQYSKFLCEK-----IILIWGFPPKLKAREIKECI  555



>ref|XP_006346129.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Solanum tuberosum]
Length=715

 Score =   151 bits (381),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 81/194 (42%), Positives = 118/194 (61%), Gaps = 12/194 (6%)
 Frame = -2

Query  1832  WGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKR  1653
             + IK VTKSNF  AL D+   + ++DF+AV L+ TG  S+PW+    +D  +I+YLK K 
Sbjct  37    FDIKNVTKSNFESALKDLRGLLRDADFVAVDLEMTGVTSAPWRESFDYDRYDISYLKVKD  96

Query  1652  AAERYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAR  1479
             +AE++ ++QF VCPF     K   IA P+NF++FPR E+     S  F CQ++ L  +A+
Sbjct  97    SAEKFAVVQFGVCPFRWDSHKQSFIAHPHNFYIFPRQEIPGSNQSREFLCQTTSLDFLAK  156

Query  1478  EGFDFNACINDGISYLSRAQELAAKDCIRS----PSAGSCTVPS-----PASRSVADSIF  1326
               FDFN C+ +GISYLSR+QE  A + I S     S+ S    S     P  R +AD +F
Sbjct  157   YQFDFNLCVREGISYLSRSQEKEALERISSIYMDESSDSVFGLSEDADFPLVR-MADVLF  215

Query  1325  INRIKSRVKHWRNA  1284
               R+KS ++ WR++
Sbjct  216   AERMKSTIREWRDS  229


 Score = 83.2 bits (204),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 77/310 (25%), Positives = 135/310 (44%), Gaps = 52/310 (17%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL+S  +K +V HN   D   ++SKF+ PLPST +++  SL ++FP I+D K L
Sbjct  335   GFRHVIDLLSSERKLIVGHNCFLDVAHMYSKFIGPLPSTAEDYVSSLQKLFPTIVDTKIL  394

Query  846   MKELG--------SQKNLNNIYVA----------TSYLNSRFFAPVDVELPHQAISTKAD  721
             +   G        S  +L+  +V+          TS L  R    V+V++  +  S    
Sbjct  395   LNANGVFRQTLNKSNTSLSRAFVSICPHIALGIKTSSLADRPCVEVEVQVDEKRSSNWNS  454

Query  720   SVKSH-GHNVLKISELFAKVCSILKVD----------PKAPEAIEHCGQLPPALERYANI  574
               K   G++      +FA+ C+ L +D           K  +   +  +L  +     N+
Sbjct  455   GAKHEAGYDAFMTGCIFAQACNHLGIDFTLHVLGGDLAKETKLQNYINRLYLSWVS-GNV  513

Query  573   FDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLV---YGKHE  403
              D  S           +++ R +    +S  +++ LWG  S +   ++++ +   +G + 
Sbjct  514   IDLSSGKCTPDSSASSNLKSRYQD---ISFPSIILLWGLPSKLKAREIRAYIAQAFGPNS  570

Query  402   VFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDSGSLEE------------MVSEGIRA  259
             V S    +  +DES   + FS P L    LE  ++ S               +  E   A
Sbjct  571   VSS----VYHLDESAVFIQFSKPELVSKFLELKETLSRNSDPISVLHPLSNILNGENTHA  626

Query  258   ASYDAYVKVC  229
             A+YD Y ++C
Sbjct  627   ATYDVYQQIC  636



>ref|XP_011097756.1| PREDICTED: poly(A)-specific ribonuclease PARN [Sesamum indicum]
Length=725

 Score =   150 bits (380),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 112/190 (59%), Gaps = 10/190 (5%)
 Frame = -2

Query  1829  GIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRA  1650
              +K VTKSNF  AL ++   + E+DF+AV L+ TG  S+PW+    FD ++I YLK K +
Sbjct  37    ALKNVTKSNFEPALAELRHHVREADFVAVDLEMTGVTSAPWRESFEFDRSDIQYLKIKDS  96

Query  1649  AERYQILQFAVCPFSL--RESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIARE  1476
             AE++ ++QF VCPF         +A P+NF++FPR E+     SY F CQ+S L  +A+ 
Sbjct  97    AEKFAVVQFGVCPFRWDPHSRSFVAHPHNFYIFPRQEIVGDGLSYEFLCQTSSLEFLAKY  156

Query  1475  GFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASR--------SVADSIFIN  1320
              FDFNAC+ +GISYLSR+QE  A   + S      +  S   R        S+AD +F  
Sbjct  157   QFDFNACVYEGISYLSRSQEEEALRRLDSLYKDDSSNASSNFRNGVETQLISMADILFAE  216

Query  1319  RIKSRVKHWR  1290
             R+K+ V  WR
Sbjct  217   RMKNMVSEWR  226


 Score = 68.2 bits (165),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -1

Query  1038  KCVRGFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILD  859
             K   GFR+V+DL+S  +K +V HN   D   +++KF+APLPST +EF  +    FPH++D
Sbjct  330   KAAIGFRQVIDLLSSERKLIVGHNCFLDLAHVYNKFIAPLPSTAEEFVSAFQTYFPHVID  389

Query  858   VKHLM  844
              K L+
Sbjct  390   TKVLL  394



>ref|XP_004244040.1| PREDICTED: poly(A)-specific ribonuclease PARN [Solanum lycopersicum]
Length=711

 Score =   149 bits (377),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/193 (42%), Positives = 117/193 (61%), Gaps = 12/193 (6%)
 Frame = -2

Query  1832  WGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKR  1653
             + IK VTKSNF  AL D+   + ++DF+AV L+ TG  S+PW+    +D  +I+YLK K 
Sbjct  37    FDIKNVTKSNFESALKDLRGLLRDADFVAVDLEMTGVTSAPWRESFDYDRYDISYLKVKD  96

Query  1652  AAERYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAR  1479
             +AE++ ++QF VCPF     K   IA P+NF++FPR E+     S  F CQ++ L  +A+
Sbjct  97    SAEKFAVVQFGVCPFRWDPHKQSFIAHPHNFYIFPRQEIPGSNQSREFLCQTTSLDFLAK  156

Query  1478  EGFDFNACINDGISYLSRAQELAAKDCIRS----PSAGSCTVPS-----PASRSVADSIF  1326
               FDFN CI +GISYLSR+QE  A + I S     S+ S    S     P  R +AD +F
Sbjct  157   YQFDFNLCIREGISYLSRSQEKEALERISSIYMDESSDSVFGLSEDADFPLVR-MADVLF  215

Query  1325  INRIKSRVKHWRN  1287
               R+K+ ++ WR+
Sbjct  216   AERMKNTIREWRD  228


 Score = 85.9 bits (211),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 79/310 (25%), Positives = 136/310 (44%), Gaps = 52/310 (17%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL+S  QK ++ HN   D   ++SKF+ PLPST +++  SL ++FP I+D K L
Sbjct  335   GFRHVIDLLSSEQKLIIGHNCFLDVAHMYSKFIGPLPSTAEDYVSSLQKLFPTIVDTKIL  394

Query  846   MKELG--------SQKNLNNIYVA----------TSYLNSRFFAPVDVELPHQAISTKAD  721
             +   G        S  +L+  +V+          TS L  R    V+V++  +  S    
Sbjct  395   LNANGVFRQTLNKSNTSLSRAFVSICPHIALGIKTSSLADRPCVEVEVQVDEKRSSNWNS  454

Query  720   SVKSH-GHNVLKISELFAKVCSILKVD----------PKAPEAIEHCGQLPPALERYANI  574
               K   G++      +FA+ C+ L +D           K  +   +  +L  +     N+
Sbjct  455   GAKHEAGYDAFMTGCIFAQACNHLGIDFTLHVLGGDLAKDTKLQNYINRLYLSWVS-GNV  513

Query  573   FDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLV---YGKHE  403
              D  S           +++ R +    +S  +++ LWGF S +   ++K+ +   +G + 
Sbjct  514   IDLSSGKCTPDSSASSNLKSRYQD---ISFPSIILLWGFPSKLKAREIKACITQAFGPNP  570

Query  402   VFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDSGSLEE------------MVSEGIRA  259
             V S    +  +DES   + FS P L    LE  ++ S               +  E   A
Sbjct  571   VSS----VYHLDESAVFIQFSKPELVSKFLEMKETLSRNSDPISVLHPLSNILNGEHTHA  626

Query  258   ASYDAYVKVC  229
             A+YD Y ++C
Sbjct  627   ATYDVYKQIC  636



>ref|XP_002300380.2| CAF1 family ribonuclease family protein [Populus trichocarpa]
 gb|EEE85185.2| CAF1 family ribonuclease family protein [Populus trichocarpa]
Length=674

 Score =   149 bits (376),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 111/185 (60%), Gaps = 4/185 (2%)
 Frame = -2

Query  1826  IKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAA  1647
             +K VT+SNF  A+ D++T +  +DF+A+ L+ TG  S+PW+  L FD  ++ YLK K +A
Sbjct  27    LKHVTQSNFETAVADLKTHLKAADFVAIDLEMTGVTSAPWRESLEFDRFDVKYLKVKDSA  86

Query  1646  ERYQILQFAVCPFSLRESKL--IASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
             E++ ++Q  VCPF     +L  IA P+NF +FPR E+     SY F CQ++ +  +A+  
Sbjct  87    EKFAVVQLGVCPFRWDPLRLSFIAHPHNFFIFPRQEVPIDSSSYEFLCQTTSIDFLAKYH  146

Query  1472  FDFNACINDGISYLSRAQELAAKDC--IRSPSAGSCTVPSPASRSVADSIFINRIKSRVK  1299
             FDFN CI  G+SYLSR QE  A     +R  +  S         S+ D +F  R+K+R++
Sbjct  147   FDFNVCIRQGVSYLSRGQEDEALRLLNLRYENELSEQARDVPLVSITDILFSERMKNRLR  206

Query  1298  HWRNA  1284
              WR+ 
Sbjct  207   EWRDG  211


 Score = 91.7 bits (226),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 93/325 (29%), Positives = 142/325 (44%), Gaps = 74/325 (23%)
 Frame = -1

Query  1038  KCVRGFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILD  859
             K   GFR V+DL+S  +K +V HN   D   IHSKFL PLP   +EF +S+ + FP+I+D
Sbjct  314   KAAIGFRHVIDLLSSEKKLIVGHNCFLDLAHIHSKFLGPLPLEAEEFVYSVNKCFPYIID  373

Query  858   VKHLMKELGSQKNLNNI------------------------YVATSYLNSRFFAPVDVEL  751
              K L+       N NNI                        + +    N  F + V VE+
Sbjct  374   TKILL-------NTNNILKQRMKKSKTSLSSAFLSLCPQIAFASNESCNLTFSSSVKVEV  426

Query  750   PHQAISTKADSVKS-----HGHNVLKISELFAKVCSILKVDPK--APEAIEHCGQLPPAL  592
               Q   T++ S  S      G++      +FA+ C++L +D K  +P     C +    L
Sbjct  427   --QVDDTRSSSWISGVKHEAGYDAFMTGCVFAQACNLLGIDFKLYSPSENLACNE---RL  481

Query  591   ERYANIFDPCSTSYQDPPI--------NEEDVRVR--AKSCKRVSSKNVVFLWGFQSGIS  442
             +++AN+      S+ +  I          E +R R   KS   +  +N+V +WGF S + 
Sbjct  482   QKHANLL---YLSWINGDIIDLSTGHRTAESLRCRDLKKSQTGILFENIVLIWGFPSKLK  538

Query  441   TGQVK---SLVYGKHEVFSSEFDIRLVDESCAVLVFSSPGL-------SEVLLEALDSGS  292
             T  +K   S V+G   V S    I  +DE+   + FS   L        E L  + D+ S
Sbjct  539   TAVIKDRISKVFGPTSVTS----ICRLDETAVFVQFSKLKLVADFLVVKETLERSNDAFS  594

Query  291   ----LEEMVSEGIRAASYDAYVKVC  229
                 L  ++     AASY+ Y  +C
Sbjct  595   VLHPLSTILGGNTCAASYETYKDIC  619



>ref|XP_010552367.1| PREDICTED: poly(A)-specific ribonuclease PARN [Tarenaya hassleriana]
Length=708

 Score =   149 bits (376),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 115/189 (61%), Gaps = 9/189 (5%)
 Frame = -2

Query  1826  IKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAA  1647
             +K VT+SNF   L+D+ + +  +DF+A+ L+ TG  S+PW+  L FD  ++ YLK K +A
Sbjct  46    LKHVTRSNFETTLSDLRSHVHAADFVAIDLEMTGVTSAPWRESLEFDRFDVRYLKVKDSA  105

Query  1646  ERYQILQFAVCPF---SLRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIARE  1476
             E++ ++QF VCPF   SL  S  +A P+NF +FPR EL    P++ F CQ++ +  +A+ 
Sbjct  106   EKFAVVQFGVCPFRWDSLSHS-FVAYPHNFFVFPRQELTFDPPAHEFLCQTTSMDFLAKY  164

Query  1475  GFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSV-----ADSIFINRIK  1311
              FDFNAC+++GISYLSR QE  A   +           +  +R +     AD +F  R+K
Sbjct  165   QFDFNACVHEGISYLSRLQEEEATKRLEMQYEDGDMDSAVEARELKLVRMADILFAERMK  224

Query  1310  SRVKHWRNA  1284
             + +  WR+A
Sbjct  225   NTLSEWRSA  233


 Score = 84.7 bits (208),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 85/313 (27%), Positives = 130/313 (42%), Gaps = 52/313 (17%)
 Frame = -1

Query  1038  KCVRGFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILD  859
             K   GFR V+DL+S   K +V HN   D   +++KF+ PLPST +EF  S+   FPHI+D
Sbjct  335   KSAIGFRHVIDLLSSEPKLIVGHNCFLDIAHVYNKFVGPLPSTAEEFVSSINECFPHIID  394

Query  858   VKHL-----MKELGSQKNLNNIYVATSYL--NSRF-FAPVDVELPHQA---ISTKADSVK  712
              K L     M  L  +K   ++  A S L   + F FA +  +L  Q    I  + D+V+
Sbjct  395   TKVLLNVNQMLHLKMKKCSTSLSSAFSLLCPQTAFSFASIGSDLVSQQRVRIEVEVDNVR  454

Query  711   ----------SHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIF---  571
                         G++      +FA+ CS L VD       ++       L+ Y N     
Sbjct  455   YSNWSSGAKHEAGYDAFMTGCIFAQACSHLGVDFGGQRLAQN-----ETLQNYINRLYLS  509

Query  570   ----DPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSL---VYG  412
                 D    S          +    K   ++  +NVV +WGFQ  +   ++K     V+G
Sbjct  510   WTNGDIIDLSTGQTTAEHRLINSVPKRFSKIKYENVVLIWGFQPKLKAREIKECICKVFG  569

Query  411   KHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDSGS-----------LEEMVSEG-  268
                V S    I  VD++   ++F +P      LE                 L +++  G 
Sbjct  570   PTSVTS----IYHVDDTAVFVMFKNPEFVSDFLELKQQLQKNDGPVAVLHPLSKLLEGGN  625

Query  267   IRAASYDAYVKVC  229
               AA Y+ Y +VC
Sbjct  626   TCAADYEVYKEVC  638



>ref|XP_006857781.1| hypothetical protein AMTR_s00061p00208140 [Amborella trichopoda]
 gb|ERN19248.1| hypothetical protein AMTR_s00061p00208140 [Amborella trichopoda]
Length=716

 Score =   148 bits (374),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 113/191 (59%), Gaps = 10/191 (5%)
 Frame = -2

Query  1826  IKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAA  1647
             IK+VT++NF+ +  ++   + E+DF+A+ L+ +G  S+PW+    FD + I YLK K +A
Sbjct  32    IKKVTRNNFTSSFEELRHHVREADFVALDLEMSGITSAPWRESFEFDHSTIRYLKIKDSA  91

Query  1646  ERYQILQFAVCPFSLRES--KLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
             E++ ++QF VCPF    S   LIA P++F++FPR EL    PS  F CQ++ +  +AR  
Sbjct  92    EKFAVVQFGVCPFRYDNSTKTLIAYPHSFYIFPRKELPIDFPSCEFLCQTTSIEFLARHQ  151

Query  1472  FDFNACINDGISYLSRAQE--------LAAKDCIRSPSAGSCTVPSPASRSVADSIFINR  1317
             FDFNACI++GISYLSRAQE        LA  D +                S  D +F  R
Sbjct  152   FDFNACIHEGISYLSRAQEAEALHQLGLADVDHLPYSECNPKETREMPLVSFGDILFTER  211

Query  1316  IKSRVKHWRNA  1284
             +K ++  WR++
Sbjct  212   MKIKLSEWRDS  222


 Score =   100 bits (248),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 91/307 (30%), Positives = 143/307 (47%), Gaps = 47/307 (15%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL+S   K +V HN L D   +HSKFL PLPSTL EF  S+ ++ P+I+D K L
Sbjct  328   GFRHVIDLLSSEGKVIVGHNCLLDIAHVHSKFLGPLPSTLAEFASSIHKLLPYIIDTKRL  387

Query  846   M-KELGSQKNL----NNIYVATSYLNS-------------RFFAPVDVELPHQAISTKAD  721
             +  EL  Q+ +     ++  A S+L S             R F  V+V    ++ S +++
Sbjct  388   LISELAIQRLMKKTGTSLSSAFSFLCSQMVSSSDTSSSNSRPFFKVEVLTDEESSSNQSN  447

Query  720   SVKSH--GHNVLKISELFAKVCSILKVD---PKAPEAIEHCGQLPPALERYANI--FDPC  562
                 H  G++      +FA++C +L +D    K  + +EH       L+++ N+      
Sbjct  448   PGAKHEAGYDAFMTGCVFAQICHLLGIDFSIYKGSDVVEH-----EKLQKHLNLLYLGWN  502

Query  561   STSYQDPPINEE----DVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLVYGKHEVFS  394
             S +  D    +E     V    K   ++   N+V +WGFQ      ++K +V  K    S
Sbjct  503   SGTMVDMKTGQEIAHSTVTNLKKRYPKIQFSNIVLVWGFQKKFKPWEMKDIV-TKVLGIS  561

Query  393   SEFDIRLVDESCAVLVFSSPGLSEVLLEALD-----SGSLEEM-----VSEG--IRAASY  250
             S   +  +DE+ A + FS     +  L   D     SG L  +     + EG   RAA Y
Sbjct  562   SVTSVFYLDETAAFVQFSKEQYVQDFLVLKDTVERESGPLSVLHPLGKLLEGGNTRAAKY  621

Query  249   DAYVKVC  229
             D Y ++C
Sbjct  622   DIYKEIC  628



>ref|XP_011038803.1| PREDICTED: poly(A)-specific ribonuclease PARN [Populus euphratica]
Length=675

 Score =   147 bits (371),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 110/185 (59%), Gaps = 4/185 (2%)
 Frame = -2

Query  1826  IKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAA  1647
             +K VT+SNF  A+ D++T +  +DF+A+ L+ TG  S+PW+  L FD  ++ YLK K +A
Sbjct  27    LKHVTQSNFESAVADLKTHLKAADFVAIDLEMTGVTSAPWRESLEFDRFDVKYLKVKDSA  86

Query  1646  ERYQILQFAVCPFSLRESKL--IASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
             E++ ++Q  VCPF     +L  IA P+NF +FPR E+     SY F CQ++ +  +A+  
Sbjct  87    EKFAVVQLGVCPFRWDPLRLSFIAHPHNFFIFPRQEVPIDSSSYEFLCQTTSIDFLAKYH  146

Query  1472  FDFNACINDGISYLSRAQELAAKDC--IRSPSAGSCTVPSPASRSVADSIFINRIKSRVK  1299
             FDFN CI  G+ YLSR QE  A     +R  +  S         S+ D +F  R+K+R++
Sbjct  147   FDFNVCIRQGVPYLSRGQEDEALRLLNLRYENELSEQARDVPLVSITDILFSERMKNRLR  206

Query  1298  HWRNA  1284
              WR+ 
Sbjct  207   EWRDG  211


 Score = 89.4 bits (220),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 94/326 (29%), Positives = 147/326 (45%), Gaps = 75/326 (23%)
 Frame = -1

Query  1038  KCVRGFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILD  859
             K   GFR V+D++S  +K +V HN   D   IHSKFL PLP   +EF  S+ + FP+I+D
Sbjct  314   KAAIGFRHVIDVLSSEKKLIVGHNCFLDLAHIHSKFLGPLPLEAEEFVSSVNKCFPYIID  373

Query  858   VKHLMKELGSQKNLNNIY----------VATSYL--------------NSRFFAPVDVEL  751
              K L+       N NNI           +++++L              N  F + V VE+
Sbjct  374   TKILL-------NTNNILKQRMKKSKTSLSSAFLSLCPQIAFASKESCNLTFSSSVKVEV  426

Query  750   PHQAISTKADSVKS-----HGHNVLKISELFAKVCSILKVDPK--APEAIEHCGQLPPAL  592
               Q   T++ S  S      G++      +FA+ C++L +D K  +P     C +    L
Sbjct  427   --QVDDTRSSSWISGVKHEAGYDAFMTGCVFAQACNLLGIDFKLYSPSENLACNE---RL  481

Query  591   ERYANIFDPCSTSYQDPPI--------NEEDVRVR--AKSCKRVSSKNVVFLWGFQSGIS  442
             +++AN+      S+ +  I          E +R R   KS   +  +N+V LWGF S + 
Sbjct  482   QKHANLL---YLSWINGDIIDLSTGHRTAESLRCRDLKKSQTGILFENIVLLWGFPSKLK  538

Query  441   TGQVK---SLVYGKHEVFSSEFDIRLVDESCAVLVFSSPGL-------SEVLLEALDSGS  292
             T  +K   S V+G   V S    I  +DE+  ++ FS   L        E L  + D+ S
Sbjct  539   TAVIKDRISKVFGPTSVTS----IFRLDETAVLVQFSKLKLVADFLVVKETLERSNDAFS  594

Query  291   LEEMVSEGIR-----AASYDAYVKVC  229
             +   +S  +      AASY+ Y  +C
Sbjct  595   VLHPLSTILEGGNTCAASYETYKDIC  620



>ref|XP_002447992.1| hypothetical protein SORBIDRAFT_06g019420 [Sorghum bicolor]
 gb|EES12320.1| hypothetical protein SORBIDRAFT_06g019420 [Sorghum bicolor]
Length=719

 Score =   147 bits (371),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 108/192 (56%), Gaps = 10/192 (5%)
 Frame = -2

Query  1829  GIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRA  1650
              +KQVT+ N +EAL  +  R+ E+ F+ V L+ +G  S+PW+    FD A++ YLK + +
Sbjct  44    AVKQVTRGNMAEALEKLRGRVREAAFVGVDLEMSGVTSAPWRDTFEFDRADVRYLKLRDS  103

Query  1649  AERYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIARE  1476
             AER+  LQ  VCPF    +K   +A P+NF +FPR EL +   S+ F CQ++ +  +A+ 
Sbjct  104   AERFAALQLGVCPFRWDPAKSAFVAHPHNFFIFPRKELPSDCSSHEFLCQTTSIDFLAKY  163

Query  1475  GFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPAS--------RSVADSIFIN  1320
              FDFN C  +GISYLSRAQE  A     +   G     S  S        +S +D +F  
Sbjct  164   QFDFNTCFREGISYLSRAQEEEALQKFNTLHHGQTATSSTNSEEDGDIPLKSASDILFTE  223

Query  1319  RIKSRVKHWRNA  1284
             R+K   K WR+ 
Sbjct  224   RMKMNFKEWRDV  235


 Score = 81.3 bits (199),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 78/305 (26%), Positives = 139/305 (46%), Gaps = 40/305 (13%)
 Frame = -1

Query  1038  KCVRGFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILD  859
             K   G R V+DL+S  +K ++ H+   D   ++SKF+ PLPS++ EF  S  ++FPHI D
Sbjct  337   KSAIGIRHVIDLLSSERKLIIGHSCFLDIAQVYSKFVGPLPSSIKEFALSFHKIFPHIAD  396

Query  858   VKHLM------KELGSQKNLN-----NIYVATSYLNSR---FFAPVDVELP-HQAISTKA  724
              +HL+      +EL  QK+ +     ++    SY ++      +PV +E+   +  S+  
Sbjct  397   TRHLLSVNQAVQELMKQKSKSLSSAFSLLCPASYSSAEKASSHSPVTIEVEGDETTSSSF  456

Query  723   DSVKSH--GHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDPCSTSY  550
              S   H  G++      +FA++C+ L +  +    ++        L+++ N   P   S 
Sbjct  457   ISGAKHEAGYDAYMTGCIFAQLCAYLGIKFEQFSPLDDLAT-NTRLQKHINFLSPSWNSG  515

Query  549   QDPPINEEDVRVRAKSCKRVSS---KNVVFLWGFQSGISTGQVKSL---VYGKHEVFSSE  388
                 ++    R      +R  +    N+V +WGF S +   ++K     V+G   V +  
Sbjct  516   TVIDLSTGMERPDPGYMRRYPAAVYDNIVVIWGFMSKVRPKEIKDCICKVFGSGSVTT--  573

Query  387   FDIRLVDESCAVLVF-SSPGLSEVL-----LEALDSGSL----EEMVSEG--IRAASYDA  244
               +  +D + A++ F     +++ L     LE  DS  L       + EG   RAA YD 
Sbjct  574   --VFSIDSTAALVQFKKQESVNDFLDLKSALERADSAVLILHPLSTILEGGQTRAAKYDT  631

Query  243   YVKVC  229
             Y  +C
Sbjct  632   YRDIC  636



>gb|EMT26628.1| Poly(A)-specific ribonuclease PARN [Aegilops tauschii]
Length=761

 Score =   147 bits (371),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/203 (36%), Positives = 114/203 (56%), Gaps = 10/203 (5%)
 Frame = -2

Query  1856  SGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAE  1677
             +G  +     +KQVT+ N +EAL ++  R+ ++ F+ + L+ +G  S+PW+     D A+
Sbjct  46    AGDGSVAGVAVKQVTRGNLAEALEELRARVRDAAFVGIDLEMSGVTSAPWRDTFELDRAD  105

Query  1676  IAYLKAKRAAERYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQS  1503
             + YLK + +A+R+ +LQ  VCPF    +K   +A P+NF +FPR EL     S+ F CQ+
Sbjct  106   VRYLKLRDSAKRFAVLQLGVCPFRWDPAKSAFVAHPHNFFIFPRKELPYDSSSHEFLCQT  165

Query  1502  SYLISIAREGFDFNACINDGISYLSRAQELAA--------KDCIRSPSAGSCTVPSPASR  1347
             + L  +A+  FDFN C ++GISYLSRAQE  A         D I +    S        +
Sbjct  166   TSLDFLAKHQFDFNTCFHEGISYLSRAQEEEALQKLNVLHHDGISAFPNTSKQEEDVQLK  225

Query  1346  SVADSIFINRIKSRVKHWRNACT  1278
             S AD +F  R+K R   WR+A +
Sbjct  226   STADLLFSERMKIRFNEWRDAIS  248


 Score = 97.1 bits (240),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 93/311 (30%), Positives = 147/311 (47%), Gaps = 60/311 (19%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             G R V+DLI+  +K +V H+   D   ++SKF+ PLPS++ EF  ++ R+FPH++D +HL
Sbjct  352   GIRHVIDLIASERKLIVGHSCFLDIAQVYSKFIGPLPSSIKEFALAINRIFPHVVDTRHL  411

Query  846   M------KELGSQKNLNNIYVATSYLNSRFF---------APV--DVELPHQAISTKADS  718
             M      + L  QK+   +  A S L   F          APV  +VE     +S  A  
Sbjct  412   MSASDAVQHLMRQKS-KALSSAFSLLCPAFHSTAGEASIPAPVRIEVEADETTLSCFASG  470

Query  717   VKSH-GHNVLKISELFAKVCSILKV---DPKAPEAIEHCGQLPPALERYANIFDPCSTSY  550
              K   G++      +FA++C+ + V   D    E +E    +   +++Y N+  P   S+
Sbjct  471   AKHEAGYDAFMTGCVFAQLCAHIGVKFEDFTPKENLE----MNKKMKKYINLLPP---SF  523

Query  549   QDPPINEEDVRV---RAKSCKRVS-----SKNVVFLWGFQSGISTGQVKSL---VYGKHE  403
                 +   D+R    RA +C ++        N+V +WGFQSG+S   +K     V+G   
Sbjct  524   NSGTV--LDLRTGMERADACYKLRYPAAVHDNIVLIWGFQSGLSAKDMKGCICKVFGPAS  581

Query  402   VFSSEFDIRLVDESCAVLVFSSPGLS-------EVLLEALDSG-----SLEEMVSEG-IR  262
             V ++ F I    +S AVL+  S   S       +  LE  DS       L  ++  G  R
Sbjct  582   V-TTVFSI----DSTAVLIQFSKQESVNDFMDLKATLEKQDSAISLLHPLSTILEGGQTR  636

Query  261   AASYDAYVKVC  229
             AA+YD Y  +C
Sbjct  637   AANYDTYRDIC  647



>ref|XP_001765586.1| predicted protein [Physcomitrella patens]
 gb|EDQ69636.1| predicted protein [Physcomitrella patens]
Length=487

 Score =   144 bits (363),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 83/232 (36%), Positives = 125/232 (54%), Gaps = 23/232 (10%)
 Frame = -2

Query  1838  GKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKA  1659
             G   +  VT+ NF E+L  +  ++  +DF+AV L+ TG  S+ W+R L  D+ E  Y   
Sbjct  3     GLISMANVTRRNFVESLEQLRGQLAGADFVAVDLEMTGVESTKWRRNLELDSYETRYQNL  62

Query  1658  KRAAERYQILQFAVCPFSLRES--KLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISI  1485
             K +AE++ + Q  VCPF   E+  K +A PYNF +FPR+EL+  +P+ SF  Q++ L  +
Sbjct  63    KHSAEKFAVWQCGVCPFKWDEAHNKWVAYPYNFFIFPRNELQLELPARSFFAQTTSLEFL  122

Query  1484  AREGFDFNACINDGISYLSRAQELAAKDCIRS-------PSAGSCTVPSPASRSVADSIF  1326
              +  FDFNACI DGISYLS  QE  A+  + S       PS    +   P ++   D  F
Sbjct  123   TKHRFDFNACIYDGISYLSHEQEAVARVLMGSVSVKQNFPSGVHNSSEIPLTKP-GDVAF  181

Query  1325  INRIKSRVKHWRNACTDQSKKTEDVLISSLRKMISATEVHGSRPCLNIDICS  1170
             + +I++++  WR           D L+ + +K     E    RP LNID+ S
Sbjct  182   VEKIRTQIGRWR-----------DELLFNRQKWQVVNE--NLRPSLNIDVTS  220


 Score = 69.7 bits (169),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 55/186 (30%), Positives = 86/186 (46%), Gaps = 37/186 (20%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR+V+D I+ +  PVV HN + D T I+SKF+ PLP+T  EF  SL + FP ++D K+L
Sbjct  290   GFRKVLDAIAEAGLPVVGHNCILDMTHIYSKFVGPLPATSAEFSSSLRQQFPCVIDTKYL  349

Query  846   MKE-------LGSQ--------KNLNNIYVATSYLNSRF-----------FAPVDVELPH  745
             ++        L S+         ++  ++   +  + RF           F  V VE+  
Sbjct  350   LRAEPTLRGILASRSTSLAVVFTHICQVFADKAVASGRFYFGKGKILNNAFTKVAVEVAE  409

Query  744   --QAISTKADSVKSH--GHNVLKISELFAKVCSILKVDP----KAPEAIEHCGQLPPALE  589
               Q      D+   H  G +      +FA+ C +L VD     K P+A++   Q      
Sbjct  410   EFQRYGGTKDTGLKHEAGFDAYMTGSVFAQACHLLHVDAATIRKIPDAVKVGEQ---GFA  466

Query  588   RYANIF  571
              YAN+ 
Sbjct  467   SYANLL  472



>ref|NP_175983.5| poly(A)-specific ribonuclease PARN [Arabidopsis thaliana]
 sp|Q9LG26.2|PARN_ARATH RecName: Full=Poly(A)-specific ribonuclease PARN; AltName: Full=Polyadenylate-specific 
ribonuclease; Short=AtPARN; AltName: 
Full=Protein ABA hypersensitive germination 2 [Arabidopsis 
thaliana]
 dbj|BAD98514.1| poly(A)-specific ribonuclease [Arabidopsis thaliana]
 gb|AEE33311.1| poly(A)-specific ribonuclease PARN [Arabidopsis thaliana]
Length=689

 Score =   146 bits (369),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/223 (34%), Positives = 122/223 (55%), Gaps = 8/223 (4%)
 Frame = -2

Query  1826  IKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAA  1647
             +K VT+SNF   LND+ + +  +DF+A+ L+ TG  S+PW+  L FD  ++ YLK K +A
Sbjct  38    LKHVTRSNFETTLNDLRSLVKAADFVAIDLEMTGVTSAPWRDSLEFDRYDVRYLKVKDSA  97

Query  1646  ERYQILQFAVCPFSL--RESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
             E++ ++QF VCPF    R    ++ P+NF +FPR EL    P++ F CQ++ +  +A+  
Sbjct  98    EKFAVVQFGVCPFRWDSRTQSFVSYPHNFFVFPRQELTFDPPAHEFLCQTTSMDFLAKYQ  157

Query  1472  FDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRS-----VADSIFINRIKS  1308
             FDFN CI++GISYLSR +E  A   ++          S  +       +AD +F  R++ 
Sbjct  158   FDFNTCIHEGISYLSRREEEEASKRLKMLHGEDGIDSSGETEELKLVRLADVLFAARMEK  217

Query  1307  RVKHWRNACTDQSKKTEDV-LISSLRKMISATEVHGSRPCLNI  1182
              +  WR+        + +   IS+       T  H  RP L++
Sbjct  218   LLNEWRSGLLHGGNASSEFPRISNGSNQSMETVFHHMRPALSL  260


 Score = 71.6 bits (174),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 74/302 (25%), Positives = 126/302 (42%), Gaps = 43/302 (14%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR+V+DL++  +K +V HN   D   ++SKF+ PLPST ++F  S+   FP+I+D K L
Sbjct  331   GFRQVIDLLASEKKLIVGHNCFLDIAHVYSKFVGPLPSTAEKFVASINSHFPYIVDTKIL  390

Query  846   ----------MKELGSQKNLNNIYV----------ATSYLNSRFFAPVDVELPHQAIST-  730
                       MK+  +  +     +          + S+L  R    +DVE+ +   S  
Sbjct  391   LNVNPMLHQRMKKSSTSLSSAFSSLCPQIEFSSRSSDSFLQQR--VNIDVEIDNVRCSNW  448

Query  729   KADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDPCSTSY  550
              A      G++      +FA+ C+ L  D K    ++   Q    LE+Y N      T  
Sbjct  449   NAGGKHEAGYDAFMTGCIFAQACNHLGFDFKQHSQLDDFAQ-NEKLEKYINRLYLSWTRG  507

Query  549   QDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLV---YGKHEVFSSEFDI  379
                 +             +   +N+V +W F   +    +K  +   +G   V S    +
Sbjct  508   DIIDLRTGHSNADNWRVSKFKYENIVLIWNFPRKLKARGIKECICKAFGSASVTS----V  563

Query  378   RLVDESCAVLVFSSPGLSEVLL---EALDSGS--------LEEMVSEG-IRAASYDAYVK  235
               VD+S   ++F +  L    L     L+S          L +++  G   AA Y+AY +
Sbjct  564   YHVDDSAVFVLFKNSELVWDFLALKRQLESSDGPVSVLHPLSKILEGGNTGAADYEAYKE  623

Query  234   VC  229
             +C
Sbjct  624   IC  625



>ref|XP_009147470.1| PREDICTED: poly(A)-specific ribonuclease PARN [Brassica rapa]
Length=680

 Score =   146 bits (368),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/220 (37%), Positives = 125/220 (57%), Gaps = 10/220 (5%)
 Frame = -2

Query  1826  IKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAA  1647
             +K VT+SNF   LND+ T +  +DF+A+ L+ TG  S+PW+  L FD  ++ YLK K +A
Sbjct  39    LKHVTRSNFETTLNDLRTHVKAADFVAIDLEMTGVTSAPWRDSLEFDRYDVRYLKVKDSA  98

Query  1646  ERYQILQFAVCPF---SLRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIARE  1476
             E++ ++QF VCPF   SL  S  ++ P+NF +FPR EL      + F CQ++ +  +A+ 
Sbjct  99    EKFAVVQFGVCPFRWDSLTHS-FLSHPHNFFVFPRQEL--AFDHHEFLCQTTSIDFLAKY  155

Query  1475  GFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSV--ADSIFINRIKSRV  1302
              FDFN CI++GISYLSR QE  A             V +   + V  AD +F  R+K+++
Sbjct  156   QFDFNTCIHEGISYLSRRQEEDASKRFEMLYHEEGMVEAEDFKLVRLADVLFAQRMKTKL  215

Query  1301  KHWRNACTDQSKKTEDVLISSLRKMISATEVHGSRPCLNI  1182
               WR+      K + +   SS +   + T  +  RP L++
Sbjct  216   NEWRSDLLHGGKASSESPGSSTQS--TETVFYHMRPALSL  253


 Score = 72.0 bits (175),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 84/308 (27%), Positives = 128/308 (42%), Gaps = 57/308 (19%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL+S  +K +V HNS+ D   ++SKF+ PLPST +EF  S+   FPHI+D K L
Sbjct  325   GFRHVIDLLSSEKKLIVGHNSILDIAHVYSKFVGPLPSTAEEFVASIRDHFPHIVDTKIL  384

Query  846   MKELGSQKNLNNIYVATSYLNSRFFAPVDVELPHQA----------ISTKADSVK-----  712
             +               +         P  VELP +           I  + D+V+     
Sbjct  385   VNVNPMLHQRMKKSSTSLSSAFSSLCP-QVELPSRGSDLFLQQRVKIDVQVDNVRCSKWN  443

Query  711   -----SHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDPCSTSYQ  547
                    G++      +FA+ CS L  D   P    +  Q    LE+Y N       S+ 
Sbjct  444   AGGKHEAGYDAFMTGCIFAQACSHLGFDFNHPSV--NFAQ-NEKLEKYIN---RLYLSWA  497

Query  546   DPPI--------NEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLV---YGKHEV  400
                I        N E+ RV      +   + +V +W F   +   ++K  +   +G   V
Sbjct  498   RGDIIDLRASHSNAENWRV-----SKFKYEKIVLIWNFPRKLKAREIKECICKAFGSTSV  552

Query  399   FSSEFDIRLVDESCAVLVFSSPGLSEV--LLEALDSGS--------LEEMVSEG-IRAAS  253
              S      L D +  VL  +S  +SE   L E L+S          L +++  G   AA 
Sbjct  553   TSV---YHLDDTAVFVLFKNSELVSEFLKLKEQLESDDGPVTVIHPLSKILEGGKTGAAD  609

Query  252   YDAYVKVC  229
             Y+AY ++C
Sbjct  610   YEAYKEIC  617



>emb|CDY52905.1| BnaA06g00130D [Brassica napus]
Length=680

 Score =   146 bits (368),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 89/252 (35%), Positives = 139/252 (55%), Gaps = 15/252 (6%)
 Frame = -2

Query  1922  LCSMLQRRLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAV  1743
             L S L R  F ++ +E A  P +  +    + +K VT+SNF   LND+ T +  +DF+A+
Sbjct  12    LASALIRSRF-SSTAEIATTPTTTEA----FPLKHVTRSNFETTLNDLRTHVKAADFVAI  66

Query  1742  SLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPF---SLRESKLIASPY  1572
              L+ TG  S+PW+  L FD  ++ YLK K +AE++ ++QF VCPF   SL  S  ++ P+
Sbjct  67    DLEMTGVTSAPWRDSLEFDRYDVRYLKVKDSAEKFAVVQFGVCPFRWDSLTHS-FLSHPH  125

Query  1571  NFHLFPRDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIR  1392
             NF +FPR EL      + F CQ++ +  +A+  FDFN CI++GISYLSR QE  A     
Sbjct  126   NFFVFPRQEL--AFDHHEFLCQTTSIDFLAKYQFDFNTCIHEGISYLSRRQEEDASKRFE  183

Query  1391  SPSAGSCTVPSPASRSV--ADSIFINRIKSRVKHWRNACTDQSKKTEDVLISSLRKMISA  1218
                     V +   + V  AD +F  R+K+++  WR+      K + +   SS +   + 
Sbjct  184   MLYHEEGMVEAEDFKLVRLADVLFAQRMKTKLNEWRSDLLHGGKASSESPGSSTQS--TE  241

Query  1217  TEVHGSRPCLNI  1182
             T  +  RP L++
Sbjct  242   TVFYHMRPALSL  253


 Score = 72.0 bits (175),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 84/308 (27%), Positives = 128/308 (42%), Gaps = 57/308 (19%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL+S  +K +V HNS+ D   ++SKF+ PLPST +EF  S+   FPHI+D K L
Sbjct  325   GFRHVIDLLSSEKKLIVGHNSILDIAHVYSKFVGPLPSTAEEFVASIRDHFPHIVDTKIL  384

Query  846   MKELGSQKNLNNIYVATSYLNSRFFAPVDVELPHQA----------ISTKADSVK-----  712
             +               +         P  VELP +           I  + D+V+     
Sbjct  385   VNVNPMLHQRMKKSSTSLSSAFSSLCP-QVELPSRGSDLFLQQRVKIDVQVDNVRCSKWN  443

Query  711   -----SHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDPCSTSYQ  547
                    G++      +FA+ CS L  D   P    +  Q    LE+Y N       S+ 
Sbjct  444   AGGKHEAGYDAFMTGCIFAQACSHLGFDFNHPSV--NFAQ-NEKLEKYIN---RLYLSWA  497

Query  546   DPPI--------NEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLV---YGKHEV  400
                I        N E+ RV      +   + +V +W F   +   ++K  +   +G   V
Sbjct  498   RGDIIDLRASHSNAENWRV-----SKFKYEKIVLIWNFPRKLKAREIKECICKAFGSTSV  552

Query  399   FSSEFDIRLVDESCAVLVFSSPGLSEV--LLEALDSGS--------LEEMVSEG-IRAAS  253
              S      L D +  VL  +S  +SE   L E L+S          L +++  G   AA 
Sbjct  553   TSV---YHLDDTAVFVLFKNSELVSEFLKLKEQLESDDGPVTVIHPLSKILEGGKTGAAD  609

Query  252   YDAYVKVC  229
             Y+AY ++C
Sbjct  610   YEAYKEIC  617



>ref|XP_009784553.1| PREDICTED: poly(A)-specific ribonuclease PARN [Nicotiana sylvestris]
Length=708

 Score =   146 bits (368),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 109/188 (58%), Gaps = 10/188 (5%)
 Frame = -2

Query  1823  KQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAE  1644
             K VTKSNF  ALND+   + ++DF+AV L+ TG  S+PW+    FD  +I YLK K +AE
Sbjct  39    KNVTKSNFESALNDLRGLVRDADFVAVDLEMTGVTSAPWRDSFDFDRYDIRYLKVKDSAE  98

Query  1643  RYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGF  1470
             ++ ++QF +CPF     K   +A P+NF++FPR E+     S  F CQ++ L  +A+  F
Sbjct  99    KFAVVQFGICPFRWDSHKKSFLAHPHNFYIFPRQEIPGSNQSCEFLCQTASLDFLAKYQF  158

Query  1469  DFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRS--------VADSIFINRI  1314
             DFN CI +G+SYLSR+QE  A + I S      +      R         +AD +F  R+
Sbjct  159   DFNVCIREGVSYLSRSQEEEALERISSTFMDESSDSVYGLREDAEFPLVRMADVLFAERM  218

Query  1313  KSRVKHWR  1290
             K+ ++ W 
Sbjct  219   KNTIREWH  226


 Score = 78.6 bits (192),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 77/314 (25%), Positives = 140/314 (45%), Gaps = 52/314 (17%)
 Frame = -1

Query  1038  KCVRGFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILD  859
             K   GFR V+DL+S  +K +V HN   D   I+SKF+  LP T +++  S+ + FP I+D
Sbjct  330   KSAVGFRHVIDLLSSERKLIVGHNCFLDMAHIYSKFIGTLPLTAEDYVSSIQKYFPCIID  389

Query  858   VKHLMKELG--------SQKNLNNIYVA----------TSYLNSRFFAPVDVELPHQ-AI  736
              K L+   G        S  +L+  +V+          TS L  R    V+V++  + ++
Sbjct  390   TKILLNANGVFQQRVNKSSTSLSRAFVSICPQIALGVKTSGLADRPCVEVEVQVDEKRSL  449

Query  735   STKADSVKSHGHNVLKISELFAKVCSILKVD----------PKAPEAIEHCGQLPPALER  586
             +  + +    G++      +FA+ C+ L +D          PK  +   +  +L  +   
Sbjct  450   NWNSGAKHEAGYDAFMTGCIFAQACNHLGIDFTLHVLAGGLPKETKLQNYINRLYLSWVS  509

Query  585   YANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSL---VY  415
               +I D  +           +++ R    + +S  ++V LWG  S +   ++K+    V+
Sbjct  510   -GDIIDLSTGKCTTDTSASSNLKSRY---QEISFPSIVLLWGLTSKLKAREIKACIVKVF  565

Query  414   GKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDSGS-----------LEEMVSEG  268
             G + + S    +  +DES   + FS P L    LE  ++ S           L +M++  
Sbjct  566   GPNSISS----VYHLDESAVFIQFSKPELVSKFLEIKETLSRNSDPISVLHPLSDMLNAN  621

Query  267   -IRAASYDAYVKVC  229
                AA+YD Y ++C
Sbjct  622   CTHAANYDVYHQIC  635



>ref|XP_006847463.1| hypothetical protein AMTR_s00163p00015730 [Amborella trichopoda]
 gb|ERN09044.1| hypothetical protein AMTR_s00163p00015730 [Amborella trichopoda]
Length=227

 Score =   137 bits (344),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 113/184 (61%), Gaps = 15/184 (8%)
 Frame = -1

Query  735  STKADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLP---PALERYANIFDP  565
            S   D   +HGH+VL+I+ +FAK+CSILK+ P         GQLP    ++  + N F P
Sbjct  12   SVSEDIDVTHGHDVLRIAYVFAKLCSILKIFPST-------GQLPIGYRSMMDFENAFYP  64

Query  564  CSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLVYGKHEVFSSEF  385
            C  S Q+P   E  +++     K+VS+++++FLWG+++GIS  +++ L+   H+ F   F
Sbjct  65   CCVSIQEPLDAEPTIQIDKNKSKQVSTEDLIFLWGYENGISPDRLRKLLCDVHDAFHGGF  124

Query  384  DIRLVDESCAVLVFSSPGLSEVLLEALDSGSLE-----EMVSEGIRAASYDAYVKVCKLG  220
             +R++D+ CAV+ F   G +E  L+ ++SG +E     +++  G+R A Y+AY +VCKLG
Sbjct  125  QVRIIDDGCAVVGFEKSGSAERFLKDVESGEVESGALLDLIVGGLRVAGYNAYERVCKLG  184

Query  219  LWKA  208
            +W+ 
Sbjct  185  VWEG  188



>ref|XP_010061447.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X3 [Eucalyptus 
grandis]
Length=696

 Score =   144 bits (362),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 113/201 (56%), Gaps = 24/201 (12%)
 Frame = -2

Query  1826  IKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAA  1647
             IK VT+SNF  AL  +   +  +D++AV L+ TG  S+PW+    FD  ++ YLK K +A
Sbjct  37    IKNVTRSNFEPALESLREHVRAADYVAVDLEMTGVTSAPWRESFEFDRYDVRYLKVKDSA  96

Query  1646  ERYQILQFAVCPFSLRESKL--IASPYNFHLFPRDELKTGM------------PS-YSFS  1512
             E++ ++QF VCPF     +L  +A P+NF++FPR EL   +            PS Y F 
Sbjct  97    EKFAVVQFGVCPFRWDPQELCFVAHPHNFYIFPRQELSFDVYIFPRQELSFDDPSAYEFL  156

Query  1511  CQSSYLISIAREGFDFNACINDGISYLSRAQE------LAAKDCIRSPSAGSCTVPSPAS  1350
             CQ++ +  +A+  FDFN CI +GISYLSR QE      L    C R+       VP    
Sbjct  157   CQTASVDFLAKYQFDFNMCIREGISYLSREQENELLRHLEESSCSRNKHKEFRDVPLI--  214

Query  1349  RSVADSIFINRIKSRVKHWRN  1287
              S+AD +F  RIK+R+K W +
Sbjct  215   -SIADVLFSERIKNRIKEWHD  234


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 101/235 (43%), Gaps = 40/235 (17%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL+S  QK +V HN   D   I+ KF   LP T +EF  S     P+I+D K L
Sbjct  303   GFRHVIDLLSSEQKLIVGHNCFLDVAHIYRKFFGELPFTAEEFVSSANEHLPYIVDTKVL  362

Query  846   MKE--------LGSQKNLNNIYV----------ATSYLNSRFFAPVDVELPH-QAISTKA  724
             +            S+ +L++ +V           ++ L S+    V+V++   +A S  A
Sbjct  363   LNSSDILKYWMRRSKTSLSSSFVRLCPQIALGYTSTDLASKACVKVEVQVDDLRASSWNA  422

Query  723   DSVKSHGHNVLKISELFAKVCSIL--KVDPKAPEAIEHCGQLPPALERYAN---------  577
              +    G++      +FA+ CS L  K  P +   I    ++   LE+Y N         
Sbjct  423   GAKHEAGYDAFMTGCVFAQACSHLGIKFHPHSSSEILARDEI---LEKYVNRLYLSWNNR  479

Query  576   -IFDPCSTSYQDPPINEEDVRVRAKS-CKRVSSKNVVFLWGFQSGISTGQVKSLV  418
              I D  + S     +    +   +K  C++     ++ +WGF   +   ++K  +
Sbjct  480   DIIDFSTGSVTGNSVGSTYLNQYSKFLCEK-----IILIWGFPPKLKAREIKECI  529



>ref|XP_010061445.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Eucalyptus 
grandis]
 gb|KCW68391.1| hypothetical protein EUGRSUZ_F02044 [Eucalyptus grandis]
Length=734

 Score =   144 bits (362),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 113/201 (56%), Gaps = 24/201 (12%)
 Frame = -2

Query  1826  IKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAA  1647
             IK VT+SNF  AL  +   +  +D++AV L+ TG  S+PW+    FD  ++ YLK K +A
Sbjct  37    IKNVTRSNFEPALESLREHVRAADYVAVDLEMTGVTSAPWRESFEFDRYDVRYLKVKDSA  96

Query  1646  ERYQILQFAVCPFSLRESKL--IASPYNFHLFPRDELKTGM------------PS-YSFS  1512
             E++ ++QF VCPF     +L  +A P+NF++FPR EL   +            PS Y F 
Sbjct  97    EKFAVVQFGVCPFRWDPQELCFVAHPHNFYIFPRQELSFDVYIFPRQELSFDDPSAYEFL  156

Query  1511  CQSSYLISIAREGFDFNACINDGISYLSRAQE------LAAKDCIRSPSAGSCTVPSPAS  1350
             CQ++ +  +A+  FDFN CI +GISYLSR QE      L    C R+       VP    
Sbjct  157   CQTASVDFLAKYQFDFNMCIREGISYLSREQENELLRHLEESSCSRNKHKEFRDVPLI--  214

Query  1349  RSVADSIFINRIKSRVKHWRN  1287
              S+AD +F  RIK+R+K W +
Sbjct  215   -SIADVLFSERIKNRIKEWHD  234


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 101/235 (43%), Gaps = 40/235 (17%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL+S  QK +V HN   D   I+ KF   LP T +EF  S     P+I+D K L
Sbjct  341   GFRHVIDLLSSEQKLIVGHNCFLDVAHIYRKFFGELPFTAEEFVSSANEHLPYIVDTKVL  400

Query  846   MKE--------LGSQKNLNNIYV----------ATSYLNSRFFAPVDVELPH-QAISTKA  724
             +            S+ +L++ +V           ++ L S+    V+V++   +A S  A
Sbjct  401   LNSSDILKYWMRRSKTSLSSSFVRLCPQIALGYTSTDLASKACVKVEVQVDDLRASSWNA  460

Query  723   DSVKSHGHNVLKISELFAKVCSIL--KVDPKAPEAIEHCGQLPPALERYAN---------  577
              +    G++      +FA+ CS L  K  P +   I    ++   LE+Y N         
Sbjct  461   GAKHEAGYDAFMTGCVFAQACSHLGIKFHPHSSSEILARDEI---LEKYVNRLYLSWNNR  517

Query  576   -IFDPCSTSYQDPPINEEDVRVRAKS-CKRVSSKNVVFLWGFQSGISTGQVKSLV  418
              I D  + S     +    +   +K  C++     ++ +WGF   +   ++K  +
Sbjct  518   DIIDFSTGSVTGNSVGSTYLNQYSKFLCEK-----IILIWGFPPKLKAREIKECI  567



>ref|NP_001169499.1| hypothetical protein [Zea mays]
 gb|ACN33924.1| unknown [Zea mays]
 gb|AFW58530.1| hypothetical protein ZEAMMB73_225129 [Zea mays]
Length=693

 Score =   143 bits (361),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 106/192 (55%), Gaps = 10/192 (5%)
 Frame = -2

Query  1829  GIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRA  1650
              +KQVT+ N  EAL  +  R+ E+ F+ + L+ +G  S+PW+     D A++ YLK + +
Sbjct  36    AVKQVTRGNMEEALEKLRGRVREAAFVGLDLEMSGVTSAPWRDTFELDRADVRYLKLRDS  95

Query  1649  AERYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIARE  1476
             AER+  LQ  VCPF    +K   +A P+NF +FPR EL +   S+ F CQ++ +  +A+ 
Sbjct  96    AERFAALQLGVCPFRWDPAKSAFVAHPHNFFIFPRKELPSDCSSHEFLCQTTSIEFLAKY  155

Query  1475  GFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPAS--------RSVADSIFIN  1320
              FDFN C  +GISYLSRAQE  A         G     S  S        +S +D +F  
Sbjct  156   QFDFNTCFREGISYLSRAQEEEALQKFNMLHHGRTVTSSTNSEEDGDMPLKSASDILFTE  215

Query  1319  RIKSRVKHWRNA  1284
             R+K   K WR+A
Sbjct  216   RMKMNFKEWRDA  227


 Score = 76.3 bits (186),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 79/308 (26%), Positives = 137/308 (44%), Gaps = 46/308 (15%)
 Frame = -1

Query  1038  KCVRGFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILD  859
             K   G R V+DL+S  +K +V H+   D   ++SKF+ PLPS++ EF  S  + FPHI D
Sbjct  329   KSAIGIRHVIDLLSSERKLIVGHSCFLDIAQVYSKFVRPLPSSIKEFALSFHKFFPHIAD  388

Query  858   VKHLMK-ELGSQKNLNNIYVATSYLNSRFF----------------APVDVELP-HQAIS  733
              +HLM      QK + +    +  L+S F                 +PV +E+   + +S
Sbjct  389   TRHLMSVNQAVQKLMKH---KSKSLSSAFLLLCPASYSSVEKPSSHSPVTIEVEGDETMS  445

Query  732   TKADSVKSH--GHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDPCS  559
             ++  S   H  G++      +FA++C+ L +  +    +++       L+++ N   P  
Sbjct  446   SRFISGAKHEAGYDAYMTGCIFAQLCAYLGIQFEQFSPLDNLAT-NTKLQKHINFLSPSW  504

Query  558   TSYQDPPINEEDVRVRAKSCKRVSS---KNVVFLWGFQSGISTGQVKSL---VYGKHEVF  397
              S     ++           +R  +    N+V +WGF S +   ++K     V+G   V 
Sbjct  505   NSGTVLDLSTGMETPDPGYTRRYPAAVYDNIVVIWGFLSKVRPKEIKDCICKVFGSGSV-  563

Query  396   SSEFDIRLVDESCAVLVF-SSPGLSEVL-----LEALDSG-----SLEEMVSEG-IRAAS  253
             ++ F I   D + A++ F     +++ L     LE  DS       L  ++  G  RAA 
Sbjct  564   TTVFSI---DSTAALVQFKKQESVNDFLDLKAVLERADSAISILHPLSTILEGGQTRAAK  620

Query  252   YDAYVKVC  229
             YD Y  +C
Sbjct  621   YDTYRDIC  628



>ref|XP_004516095.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Cicer arietinum]
Length=721

 Score =   143 bits (361),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/203 (36%), Positives = 119/203 (59%), Gaps = 15/203 (7%)
 Frame = -2

Query  1823  KQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAE  1644
             K VT SNF  +L ++   +  SDF+A+ L+ TG  S+PW+    FD +++ YLK + +A 
Sbjct  38    KTVTVSNFEPSLAELRHHVRSSDFVAIDLEMTGVTSAPWRESFEFDRSDVRYLKVRDSAS  97

Query  1643  RYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGF  1470
             R+ ++QF VCPF    S    +A PYNF++FPR EL    P   F CQ++ +  +A+  F
Sbjct  98    RFAVVQFGVCPFRWDPSNQSFVAYPYNFYVFPRPELAGFGPCNDFLCQTTSMDFLAKYQF  157

Query  1469  DFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASR----------SVADSIFIN  1320
             DFNACI++GISYLSR QE   ++ +RS ++   +  S  S+          ++AD +F  
Sbjct  158   DFNACIHEGISYLSREQE---REAVRSLNSTHDSDWSDISKLNDVRDIPNVNMADILFTA  214

Query  1319  RIKSRVKHWRNACTDQSKKTEDV  1251
             R+K++   WR+    +  +++ +
Sbjct  215   RMKNKFSEWRDGLLQEQTQSDHI  237


 Score = 81.6 bits (200),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 83/307 (27%), Positives = 138/307 (45%), Gaps = 46/307 (15%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+D++S  QK +V HN   D   ++SKF+ PLP T +EF  S+ + FPHI+D K L
Sbjct  332   GFRHVIDVLSSEQKLIVGHNCFLDMAHVYSKFIGPLPGTPEEFVASVNKCFPHIIDTKIL  391

Query  846   M--------KELGSQKNLNNIYVA----------TSYLNSRFFAPVDVELPHQAISTKAD  721
             +        +   S+K+L + +            ++ L S     V++E+     S+   
Sbjct  392   LNTNYMLQERMKKSRKSLASAFSMFCPLIAAGSNSTGLISASLVKVNIEVDDSRSSSWNP  451

Query  720   SVKSH-GHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIF-------DP  565
               K   G++      +FA++CS L VD K  E+ +        L+ Y N         D 
Sbjct  452   GGKHEAGYDAFMTGCIFAQLCSDLGVDFKLHESSKQLAS-NEKLQNYINHLYLSWLHGDI  510

Query  564   CSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVK---SLVYGKHEVFS  394
                +  D   N        K    +  +N+V +WGF + +   +V+   S V+G   V S
Sbjct  511   IDLNTGDKVANTLPSYNLKKRYPNILFENIVIIWGFPTKLKANEVRECISKVFGLTSVVS  570

Query  393   SEFDIRLVDESCAVLVFSSPGL-SEVLL--EALDSGS--------LEEMVSEGIR-AASY  250
                 +  +D +   + FS   L S+ LL  E L++ +        L +++  G   AA+Y
Sbjct  571   ----VYHLDATAVFVQFSKTELVSDFLLLKEKLETSNGPILVLHPLAKLLDGGNTCAANY  626

Query  249   DAYVKVC  229
             D Y ++C
Sbjct  627   DTYKEIC  633



>ref|XP_006602126.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X6 
[Glycine max]
Length=479

 Score =   140 bits (353),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/200 (36%), Positives = 113/200 (57%), Gaps = 9/200 (5%)
 Frame = -2

Query  1823  KQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAE  1644
             K VT +NF  +L ++   +  SDF+A+ L+ TG  S+PW+ LL FD +++ YLK + +A 
Sbjct  35    KTVTTANFEPSLAELRRHVRTSDFVAIDLEMTGVTSAPWRELLEFDRSDVRYLKVRDSAT  94

Query  1643  RYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGF  1470
             ++ ++QF VCPF    S    +A P+NF++FPR +L    P   F CQ++ +  +A+  F
Sbjct  95    KFAVVQFGVCPFRWDPSNHSFVAYPHNFYVFPRQQLAGLGPCDEFLCQTTSMDFLAKYQF  154

Query  1469  DFNACINDGISYLSRAQELAAKDCIRSPSAGSCT-------VPSPASRSVADSIFINRIK  1311
             DFNACI++GISYLSR QE  A   + S      +       V      S AD +F  R+K
Sbjct  155   DFNACIHEGISYLSREQERKALRSLNSTYDSEWSDIGKLKDVRDIPLLSAADILFTARMK  214

Query  1310  SRVKHWRNACTDQSKKTEDV  1251
             ++   WR+    +  + + +
Sbjct  215   NKFSEWRDGLFQEQNQEDQI  234


 Score = 66.6 bits (161),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 73/144 (51%), Gaps = 19/144 (13%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL+S  QK +V +N   D   ++SKF+ PLP T +EF  S+ + FPHI+D K L
Sbjct  327   GFRHVIDLLSSEQKLIVGYNCFLDIAHVYSKFIGPLPGTPEEFVASVSKCFPHIVDTKIL  386

Query  846   M--------KELGSQKNLNNIYVA----------TSYLNSRFFAPVDVELPH-QAISTKA  724
             +        K   S+K+L + + +          ++ L S     V+VE+   ++ S   
Sbjct  387   LSTNLMFQEKMKRSRKSLASAFTSFCPQIAAGSRSTDLGSLSHVKVNVEVDDSRSCSWSP  446

Query  723   DSVKSHGHNVLKISELFAKVCSIL  652
                   G++      +FA++CS L
Sbjct  447   GGKHEAGYDAFMTGCIFAQLCSDL  470



>ref|XP_008465474.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Cucumis melo]
Length=208

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 95/136 (70%), Gaps = 3/136 (2%)
 Frame = -1

Query  1050  NKHNKCVRGFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFP  871
             ++ +K  RGFREV+++IS SQ P+V+++SL++FT IHSKFLAPLP+++DEF  SL  VFP
Sbjct  72    DEESKKFRGFREVIEMISASQNPIVSYSSLHEFTFIHSKFLAPLPTSIDEFASSLHLVFP  131

Query  870   HILDVKHLMKELGSQKNLNNIYVATSYLNSRFFAPVDVELPHQAISTKADSVKSHGHNVL  691
              +L+VK LM ++G      +I  A SYL   ++AP  +++P   I    +  K  GHN +
Sbjct  132   QVLEVKQLMSKIGGLSKPMSIAAALSYLKKHYYAPTYLDIP---IEAPGNDHKPQGHNAI  188

Query  690   KISELFAKVCSILKVD  643
             ++  LFAKVCS+LK+D
Sbjct  189   RLCHLFAKVCSLLKID  204



>ref|XP_009358966.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Pyrus x bretschneideri]
Length=136

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = -1

Query  1143  ANGGGTQIVRVVLTSSQedkkllekelqemENKHNKCVRGFREVVDLISCSQKPVVAHNS  964
             A GGGTQ VRVVLTSSQ DK L E+ELQ +E + NK VRGFREV+DLIS SQKPVV+HNS
Sbjct  32    AKGGGTQAVRVVLTSSQADKDLFERELQNLEEEQNKRVRGFREVIDLISASQKPVVSHNS  91

Query  963   LNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHLMKELG  832
             LNDFT IHS+FL+PLP+ +DEF  SL  VFPHILDV HL++ L 
Sbjct  92    LNDFTVIHSEFLSPLPTNVDEFMGSLHSVFPHILDVNHLIRILA  135



>ref|XP_006602125.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X5 
[Glycine max]
Length=488

 Score =   140 bits (353),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/200 (36%), Positives = 113/200 (57%), Gaps = 9/200 (5%)
 Frame = -2

Query  1823  KQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAE  1644
             K VT +NF  +L ++   +  SDF+A+ L+ TG  S+PW+ LL FD +++ YLK + +A 
Sbjct  35    KTVTTANFEPSLAELRRHVRTSDFVAIDLEMTGVTSAPWRELLEFDRSDVRYLKVRDSAT  94

Query  1643  RYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGF  1470
             ++ ++QF VCPF    S    +A P+NF++FPR +L    P   F CQ++ +  +A+  F
Sbjct  95    KFAVVQFGVCPFRWDPSNHSFVAYPHNFYVFPRQQLAGLGPCDEFLCQTTSMDFLAKYQF  154

Query  1469  DFNACINDGISYLSRAQELAAKDCIRSPSAGSCT-------VPSPASRSVADSIFINRIK  1311
             DFNACI++GISYLSR QE  A   + S      +       V      S AD +F  R+K
Sbjct  155   DFNACIHEGISYLSREQERKALRSLNSTYDSEWSDIGKLKDVRDIPLLSAADILFTARMK  214

Query  1310  SRVKHWRNACTDQSKKTEDV  1251
             ++   WR+    +  + + +
Sbjct  215   NKFSEWRDGLFQEQNQEDQI  234


 Score = 66.6 bits (161),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 73/144 (51%), Gaps = 19/144 (13%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL+S  QK +V +N   D   ++SKF+ PLP T +EF  S+ + FPHI+D K L
Sbjct  327   GFRHVIDLLSSEQKLIVGYNCFLDIAHVYSKFIGPLPGTPEEFVASVSKCFPHIVDTKIL  386

Query  846   M--------KELGSQKNLNNIYVA----------TSYLNSRFFAPVDVELPH-QAISTKA  724
             +        K   S+K+L + + +          ++ L S     V+VE+   ++ S   
Sbjct  387   LSTNLMFQEKMKRSRKSLASAFTSFCPQIAAGSRSTDLGSLSHVKVNVEVDDSRSCSWSP  446

Query  723   DSVKSHGHNVLKISELFAKVCSIL  652
                   G++      +FA++CS L
Sbjct  447   GGKHEAGYDAFMTGCIFAQLCSDL  470



>emb|CDY53757.1| BnaCnng25490D [Brassica napus]
Length=669

 Score =   141 bits (355),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 76/214 (36%), Positives = 121/214 (57%), Gaps = 22/214 (10%)
 Frame = -2

Query  1916  SMLQRRLFC-TAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVS  1740
             ++++ R FC ++ +E A  P +       + +K VT+SNF   LND+ T +  +DF+A+ 
Sbjct  15    ALIRSRFFCLSSAAEIATTPTTEA-----FPLKHVTRSNFERTLNDLRTHVKAADFVAID  69

Query  1739  LQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSL--RESKLIASPYNF  1566
             L+ TG  S+PW+  L FD  ++ YLK K +AE++ ++QF VCPF         ++ P+NF
Sbjct  70    LEMTGVTSAPWRDSLEFDRYDVRYLKVKDSAEKFAVVQFGVCPFRWDSHTHSFVSHPHNF  129

Query  1565  HLFPRDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSP  1386
              +FPR E         F CQ++ +  +A+  FDFN CI++GISYLSR QE    D I+  
Sbjct  130   FIFPRQE---------FLCQTTSIDFLAKYQFDFNTCIHEGISYLSRRQE---DDAIKML  177

Query  1385  SAGSCTVPSPASRSV--ADSIFINRIKSRVKHWR  1290
                   V +   + V  A  +F  R+K+++  WR
Sbjct  178   YDEEGLVEADDFKLVRLAHVLFAERMKNKLNEWR  211


 Score = 72.0 bits (175),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 84/309 (27%), Positives = 134/309 (43%), Gaps = 59/309 (19%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR+V+DL+S  +K +V HNS+ D   ++SKF+ PLPST +EF  S+   FP+I+D K L
Sbjct  314   GFRQVIDLLSSEKKLIVGHNSILDIAHVYSKFVGPLPSTAEEFVASIRDHFPYIVDTKIL  373

Query  846   ----------MKELGSQKNLNNIYV----------ATSYLNSRFFAPVDVELPHQAIST-  730
                       MK+  +  +     +          + S+L  R    +DV++ +   S  
Sbjct  374   VNVNPMLHQRMKKSSTSLSSAFSSLCPQVELPSRGSDSFLQQR--VKIDVQVDNVRCSKW  431

Query  729   KADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDPCSTSY  550
              A      G++      +FA+ CS L  D   P    +  Q    LE+Y N       S+
Sbjct  432   NAGGKHEAGYDAFMTGCIFAQACSHLGFDFNHPSV--NIAQ-DEKLEKYIN---RLYLSW  485

Query  549   QDPPI--------NEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLV---YGKHE  403
                 I        N E+ RV      +   + +V +W F   +   ++K  +   +G   
Sbjct  486   ARGDIIDLRASHSNAENWRV-----SKFKYEKIVLIWNFPRKLKAREIKECICKAFGSTS  540

Query  402   VFSSEFDIRLVDESCAVLVFSSPGLSEVL--LEALDSGS--------LEEMVSEG-IRAA  256
             V S      L D +  VL  +S  +SE L   E L+S          L +++  G   AA
Sbjct  541   VTSV---YHLDDTAVFVLFKNSELVSEFLKIKEQLESDDGPVTVIHPLSKILEGGKTGAA  597

Query  255   SYDAYVKVC  229
              Y+AY ++C
Sbjct  598   DYEAYKEIC  606



>ref|XP_006602123.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X3 
[Glycine max]
Length=596

 Score =   140 bits (352),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 71/200 (36%), Positives = 113/200 (57%), Gaps = 9/200 (5%)
 Frame = -2

Query  1823  KQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAE  1644
             K VT +NF  +L ++   +  SDF+A+ L+ TG  S+PW+ LL FD +++ YLK + +A 
Sbjct  35    KTVTTANFEPSLAELRRHVRTSDFVAIDLEMTGVTSAPWRELLEFDRSDVRYLKVRDSAT  94

Query  1643  RYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGF  1470
             ++ ++QF VCPF    S    +A P+NF++FPR +L    P   F CQ++ +  +A+  F
Sbjct  95    KFAVVQFGVCPFRWDPSNHSFVAYPHNFYVFPRQQLAGLGPCDEFLCQTTSMDFLAKYQF  154

Query  1469  DFNACINDGISYLSRAQELAAKDCIRSPSAGSCT-------VPSPASRSVADSIFINRIK  1311
             DFNACI++GISYLSR QE  A   + S      +       V      S AD +F  R+K
Sbjct  155   DFNACIHEGISYLSREQERKALRSLNSTYDSEWSDIGKLKDVRDIPLLSAADILFTARMK  214

Query  1310  SRVKHWRNACTDQSKKTEDV  1251
             ++   WR+    +  + + +
Sbjct  215   NKFSEWRDGLFQEQNQEDQI  234


 Score = 67.4 bits (163),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 74/147 (50%), Gaps = 19/147 (13%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL+S  QK +V +N   D   ++SKF+ PLP T +EF  S+ + FPHI+D K L
Sbjct  327   GFRHVIDLLSSEQKLIVGYNCFLDIAHVYSKFIGPLPGTPEEFVASVSKCFPHIVDTKIL  386

Query  846   M--------KELGSQKNLNNIYVA----------TSYLNSRFFAPVDVELPH-QAISTKA  724
             +        K   S+K+L + + +          ++ L S     V+VE+   ++ S   
Sbjct  387   LSTNLMFQEKMKRSRKSLASAFTSFCPQIAAGSRSTDLGSLSHVKVNVEVDDSRSCSWSP  446

Query  723   DSVKSHGHNVLKISELFAKVCSILKVD  643
                   G++      +FA++CS L  D
Sbjct  447   GGKHEAGYDAFMTGCIFAQLCSDLVKD  473



>ref|XP_006602122.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X2 
[Glycine max]
Length=676

 Score =   140 bits (353),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/200 (36%), Positives = 113/200 (57%), Gaps = 9/200 (5%)
 Frame = -2

Query  1823  KQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAE  1644
             K VT +NF  +L ++   +  SDF+A+ L+ TG  S+PW+ LL FD +++ YLK + +A 
Sbjct  35    KTVTTANFEPSLAELRRHVRTSDFVAIDLEMTGVTSAPWRELLEFDRSDVRYLKVRDSAT  94

Query  1643  RYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGF  1470
             ++ ++QF VCPF    S    +A P+NF++FPR +L    P   F CQ++ +  +A+  F
Sbjct  95    KFAVVQFGVCPFRWDPSNHSFVAYPHNFYVFPRQQLAGLGPCDEFLCQTTSMDFLAKYQF  154

Query  1469  DFNACINDGISYLSRAQELAAKDCIRSPSAGSCT-------VPSPASRSVADSIFINRIK  1311
             DFNACI++GISYLSR QE  A   + S      +       V      S AD +F  R+K
Sbjct  155   DFNACIHEGISYLSREQERKALRSLNSTYDSEWSDIGKLKDVRDIPLLSAADILFTARMK  214

Query  1310  SRVKHWRNACTDQSKKTEDV  1251
             ++   WR+    +  + + +
Sbjct  215   NKFSEWRDGLFQEQNQEDQI  234


 Score = 86.7 bits (213),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 82/307 (27%), Positives = 142/307 (46%), Gaps = 47/307 (15%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL+S  QK +V +N   D   ++SKF+ PLP T +EF  S+ + FPHI+D K L
Sbjct  289   GFRHVIDLLSSEQKLIVGYNCFLDIAHVYSKFIGPLPGTPEEFVASVSKCFPHIVDTKIL  348

Query  846   M--------KELGSQKNLNNIYVA----------TSYLNSRFFAPVDVELPH-QAISTKA  724
             +        K   S+K+L + + +          ++ L S     V+VE+   ++ S   
Sbjct  349   LSTNLMFQEKMKRSRKSLASAFTSFCPQIAAGSRSTDLGSLSHVKVNVEVDDSRSCSWSP  408

Query  723   DSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDPCSTSYQD  544
                   G++      +FA++CS L +D K  ++ +    L   L++Y N     S  ++D
Sbjct  409   GGKHEAGYDAFMTGCIFAQLCSDLGIDFKLHDSSKPLA-LNEKLQKYVNRL-YLSWMHRD  466

Query  543   -------PPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVK---SLVYGKHEVFS  394
                      + +  +R   K   ++  +N+V +WGF S +   +++   S V+G   V S
Sbjct  467   IIDLNTGNKVADSSLRSLTKRYPKIMFENIVIIWGFSSKLKANEIRECISKVFGPTSVVS  526

Query  393   SEFDIRLVDESCAVLVFSSPGLSEVLLEALDS-----GS------LEEMVSEG-IRAASY  250
                 +  +D + A + FS   L    L   DS     G+      L +++  G    A+Y
Sbjct  527   ----VFHLDATAAFVQFSKTELVSDFLLVKDSLERSGGAISVLHPLSKLLEGGNTCGANY  582

Query  249   DAYVKVC  229
             D Y ++C
Sbjct  583   DTYREIC  589



>ref|XP_003552994.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X1 
[Glycine max]
Length=714

 Score =   140 bits (353),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/200 (36%), Positives = 113/200 (57%), Gaps = 9/200 (5%)
 Frame = -2

Query  1823  KQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAE  1644
             K VT +NF  +L ++   +  SDF+A+ L+ TG  S+PW+ LL FD +++ YLK + +A 
Sbjct  35    KTVTTANFEPSLAELRRHVRTSDFVAIDLEMTGVTSAPWRELLEFDRSDVRYLKVRDSAT  94

Query  1643  RYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGF  1470
             ++ ++QF VCPF    S    +A P+NF++FPR +L    P   F CQ++ +  +A+  F
Sbjct  95    KFAVVQFGVCPFRWDPSNHSFVAYPHNFYVFPRQQLAGLGPCDEFLCQTTSMDFLAKYQF  154

Query  1469  DFNACINDGISYLSRAQELAAKDCIRSPSAGSCT-------VPSPASRSVADSIFINRIK  1311
             DFNACI++GISYLSR QE  A   + S      +       V      S AD +F  R+K
Sbjct  155   DFNACIHEGISYLSREQERKALRSLNSTYDSEWSDIGKLKDVRDIPLLSAADILFTARMK  214

Query  1310  SRVKHWRNACTDQSKKTEDV  1251
             ++   WR+    +  + + +
Sbjct  215   NKFSEWRDGLFQEQNQEDQI  234


 Score = 86.7 bits (213),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 82/307 (27%), Positives = 142/307 (46%), Gaps = 47/307 (15%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL+S  QK +V +N   D   ++SKF+ PLP T +EF  S+ + FPHI+D K L
Sbjct  327   GFRHVIDLLSSEQKLIVGYNCFLDIAHVYSKFIGPLPGTPEEFVASVSKCFPHIVDTKIL  386

Query  846   M--------KELGSQKNLNNIYVA----------TSYLNSRFFAPVDVELPH-QAISTKA  724
             +        K   S+K+L + + +          ++ L S     V+VE+   ++ S   
Sbjct  387   LSTNLMFQEKMKRSRKSLASAFTSFCPQIAAGSRSTDLGSLSHVKVNVEVDDSRSCSWSP  446

Query  723   DSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDPCSTSYQD  544
                   G++      +FA++CS L +D K  ++ +    L   L++Y N     S  ++D
Sbjct  447   GGKHEAGYDAFMTGCIFAQLCSDLGIDFKLHDSSKPLA-LNEKLQKYVNRL-YLSWMHRD  504

Query  543   -------PPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVK---SLVYGKHEVFS  394
                      + +  +R   K   ++  +N+V +WGF S +   +++   S V+G   V S
Sbjct  505   IIDLNTGNKVADSSLRSLTKRYPKIMFENIVIIWGFSSKLKANEIRECISKVFGPTSVVS  564

Query  393   SEFDIRLVDESCAVLVFSSPGLSEVLLEALDS-----GS------LEEMVSEGIR-AASY  250
                 +  +D + A + FS   L    L   DS     G+      L +++  G    A+Y
Sbjct  565   ----VFHLDATAAFVQFSKTELVSDFLLVKDSLERSGGAISVLHPLSKLLEGGNTCGANY  620

Query  249   DAYVKVC  229
             D Y ++C
Sbjct  621   DTYREIC  627



>ref|XP_006586143.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X2 
[Glycine max]
Length=479

 Score =   137 bits (344),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/201 (35%), Positives = 112/201 (56%), Gaps = 10/201 (5%)
 Frame = -2

Query  1823  KQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAE  1644
             K VT +NF  +L ++   +  SDF+A+ L+ TG  S+PW+  L FD +++ YLK + +A 
Sbjct  35    KTVTTANFEPSLAELRHHVRCSDFVAIDLEMTGVTSAPWRESLAFDRSDVRYLKVRDSAA  94

Query  1643  RYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGF  1470
             ++ ++QF VCPF    S    +A P+NF++FPR E+    P   F CQ++ +  +A+  F
Sbjct  95    KFAVVQFGVCPFRWDPSNHSFVAHPHNFYVFPRQEIAGLGPCDEFLCQTTSMDFLAKYQF  154

Query  1469  DFNACINDGISYLSRAQELAAKDCIRSPSAGS--------CTVPSPASRSVADSIFINRI  1314
             DFNACI++GISYLSR QE  A   + S    S          V      S AD +F  R+
Sbjct  155   DFNACIHEGISYLSREQEREALRSLNSTYDSSEWSDIGKLKNVRDIPLLSTADILFTARM  214

Query  1313  KSRVKHWRNACTDQSKKTEDV  1251
             K++   WR+    +  + + +
Sbjct  215   KNKFGEWRDGLFQEQNQEDQI  235


 Score = 65.1 bits (157),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 71/144 (49%), Gaps = 19/144 (13%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL+S  QK +V +N   D   ++SKF+ PLP + DEF  S+ + FPHI+D   L
Sbjct  328   GFRHVIDLLSSEQKLIVGYNCFLDIAHVYSKFIGPLPGSPDEFVASVNKCFPHIVDTIIL  387

Query  846   M--------KELGSQKNLNNIYV----------ATSYLNSRFFAPVDVELP-HQAISTKA  724
             +        K   S+K+L + +            ++ L S     VDVE+   ++ S   
Sbjct  388   LNTNLMFQEKMKRSRKSLASAFTLFCPQIAAGSRSTDLGSLSHVKVDVEVDGSRSCSWNP  447

Query  723   DSVKSHGHNVLKISELFAKVCSIL  652
                   G++      +FA++CS L
Sbjct  448   GGKHEAGYDAFMTGCIFAQLCSDL  471



>ref|XP_003530802.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X1 
[Glycine max]
Length=718

 Score =   137 bits (344),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/201 (35%), Positives = 112/201 (56%), Gaps = 10/201 (5%)
 Frame = -2

Query  1823  KQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAE  1644
             K VT +NF  +L ++   +  SDF+A+ L+ TG  S+PW+  L FD +++ YLK + +A 
Sbjct  35    KTVTTANFEPSLAELRHHVRCSDFVAIDLEMTGVTSAPWRESLAFDRSDVRYLKVRDSAA  94

Query  1643  RYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGF  1470
             ++ ++QF VCPF    S    +A P+NF++FPR E+    P   F CQ++ +  +A+  F
Sbjct  95    KFAVVQFGVCPFRWDPSNHSFVAHPHNFYVFPRQEIAGLGPCDEFLCQTTSMDFLAKYQF  154

Query  1469  DFNACINDGISYLSRAQELAAKDCIRSPSAGS--------CTVPSPASRSVADSIFINRI  1314
             DFNACI++GISYLSR QE  A   + S    S          V      S AD +F  R+
Sbjct  155   DFNACIHEGISYLSREQEREALRSLNSTYDSSEWSDIGKLKNVRDIPLLSTADILFTARM  214

Query  1313  KSRVKHWRNACTDQSKKTEDV  1251
             K++   WR+    +  + + +
Sbjct  215   KNKFGEWRDGLFQEQNQEDQI  235


 Score = 80.9 bits (198),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 81/307 (26%), Positives = 134/307 (44%), Gaps = 46/307 (15%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL+S  QK +V +N   D   ++SKF+ PLP + DEF  S+ + FPHI+D   L
Sbjct  328   GFRHVIDLLSSEQKLIVGYNCFLDIAHVYSKFIGPLPGSPDEFVASVNKCFPHIVDTIIL  387

Query  846   M--------KELGSQKNLNNIYV----------ATSYLNSRFFAPVDVELP-HQAISTKA  724
             +        K   S+K+L + +            ++ L S     VDVE+   ++ S   
Sbjct  388   LNTNLMFQEKMKRSRKSLASAFTLFCPQIAAGSRSTDLGSLSHVKVDVEVDGSRSCSWNP  447

Query  723   DSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIF-------DP  565
                   G++      +FA++CS L +D K  ++      L   L++Y N         D 
Sbjct  448   GGKHEAGYDAFMTGCIFAQLCSDLGIDFKLRDSSNQLA-LNEKLQKYVNRLYLSWIHGDI  506

Query  564   CSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVK---SLVYGKHEVFS  394
                +  +   +        K    +  +N+V +WGF S +   +V+   S  +G   V S
Sbjct  507   IDLNTGNKVADSSPSHSLKKRYPTILFENIVIIWGFPSKLKANEVRECISKAFGPTSVVS  566

Query  393   SEFDIRLVDESCAVLVFSSPGLSEVLLEALDS-----GS------LEEMVSEGIR-AASY  250
                 +  +D + A + FS   L    L   DS     G+      L +++  G   AA+Y
Sbjct  567   ----VFHLDATAAFVQFSKTELVSDFLLVKDSLERSDGAISVLHPLSKLLEGGNTCAANY  622

Query  249   DAYVKVC  229
             D Y ++C
Sbjct  623   DTYNEIC  629



>ref|XP_002985556.1| hypothetical protein SELMODRAFT_424560 [Selaginella moellendorffii]
 gb|EFJ13430.1| hypothetical protein SELMODRAFT_424560 [Selaginella moellendorffii]
Length=603

 Score =   135 bits (341),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 108/198 (55%), Gaps = 11/198 (6%)
 Frame = -2

Query  1817  VTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAERY  1638
             VT+SN+ EAL +    I ++ F+AV L+ TG  ++PW+     D     YL  + +AE++
Sbjct  4     VTRSNWEEALVEARAHIRQAAFVAVDLELTGVQTTPWRGATEVDNLHTRYLNLRDSAEKF  63

Query  1637  QILQFAVCP--FSLRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGFDF  1464
              ++QF +CP  +     K IA PYNF LFPR EL+  MP+  F CQ++ L  +A+  FDF
Sbjct  64    AMIQFGLCPVLWDAAGGKFIAYPYNFCLFPRHELQIEMPARDFLCQATSLEFLAKHQFDF  123

Query  1463  NACINDGISYLSRAQELAAKDCIRSPSAGSC--------TVPSPASRSVADSIFINRIKS  1308
             NACI DGISYLS  QE  A+  ++   A            +  P +R+ AD IF   ++ 
Sbjct  124   NACIYDGISYLSHEQEKLARHKLKLTDADGAPRELESFSALEIPLNRT-ADVIFSESVRV  182

Query  1307  RVKHWRNACTDQSKKTED  1254
             +   WR+    + K   +
Sbjct  183   QAGEWRDKVLQREKDAHE  200


 Score = 79.3 bits (194),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 74/299 (25%), Positives = 134/299 (45%), Gaps = 34/299 (11%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR+++D +  S+KPVV HN   D   I++KF A LP +  EF  S+ + FP I D K+L
Sbjct  277   GFRQLIDALVESKKPVVGHNCFLDIAHIYNKFFATLPLSCSEFCSSIHQHFPCIFDTKYL  336

Query  846   MKELGSQKNL---NNIYVATSYLN-SRFFAPVDVELPHQAISTKADSVKSH--GHNVLKI  685
             +K   + + +       +   + N  +    V +E    ++     +   H  G++    
Sbjct  337   LKADSAAQEMLGKGGTTLGPVFSNVGKLPNKVQIEFGSSSLCRYDGTEMKHEAGYDAYMT  396

Query  684   SELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDPCSTSY--------QDPPINE  529
             + +FA +C  +K+DP    ++  C Q     E  + +    +  Y         D    +
Sbjct  397   AAVFANICQFMKMDPANLPSL--CEQAKEGEEERSGLGSHANHLYLGWRGHFVLDLSTGQ  454

Query  528   EDVRVR----AKSCKRVSSKNVVFLWGFQSGISTG-QVKSLVYGKHEVFSSE----FDIR  376
             E    R    ++S +R  +K+V  +WG  S  S     +SL       F+++     ++ 
Sbjct  455   EATGPRSLKSSRSIEREKAKSVALMWGSGSTRSLEVDSRSLEADVKACFTAKSPPHVEVV  514

Query  375   LVDESCAVLVFSSPGLSEVLLEALD-SG--------SLEEMVSEGIRAASYDAYVKVCK  226
              +DES A +VF      E L++A + SG         +  +V+ G + A Y+ + K+C+
Sbjct  515   RIDESSAFVVFRRKESLESLVQAFECSGHHDKVGVCDVSGLVARGWKIARYEFFEKLCE  573



>ref|XP_004975901.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Setaria italica]
Length=692

 Score =   136 bits (343),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/196 (38%), Positives = 109/196 (56%), Gaps = 11/196 (6%)
 Frame = -2

Query  1829  GIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRA  1650
              +KQVT+ N +EAL ++  R+ E+ F+ + L+ +G  S+PW+     D  ++ YLK + +
Sbjct  35    AVKQVTRGNLAEALEELRGRVREATFVGLDLEMSGVTSAPWRDTFELDRDDVRYLKLRDS  94

Query  1649  AERYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIARE  1476
             AER+  LQ  VCPF    +K   +A P+NF +FPR EL +   S+ F CQ++ +  +A+ 
Sbjct  95    AERFAALQLGVCPFRWDPAKSAFVAYPHNFFIFPRKEL-SDCSSHEFLCQTTSIDFLAKY  153

Query  1475  GFDFNACINDGISYLSRAQELAA--------KDCIRSPSAGSCTVPSPASRSVADSIFIN  1320
              FDFN C  +GISYLSRAQE  A        +D   S SA S        +  AD +F  
Sbjct  154   QFDFNTCFREGISYLSRAQEEEALQKLNFFHQDRPFSSSATSEGDGDMPLKRTADILFTE  213

Query  1319  RIKSRVKHWRNACTDQ  1272
             R+K   K WR+    Q
Sbjct  214   RMKMNFKVWRDVIISQ  229


 Score = 79.7 bits (195),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 80/319 (25%), Positives = 134/319 (42%), Gaps = 68/319 (21%)
 Frame = -1

Query  1038  KCVRGFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILD  859
             K   G R V+DL+S  +K +V H+   D   ++SKF+ PLPS++ EF  S+ ++FPHI D
Sbjct  325   KSAIGIRHVIDLLSSERKLIVGHSCFLDIAQVYSKFVGPLPSSIKEFALSIHKIFPHIAD  384

Query  858   VKHLMK-ELGSQKNLNNIYVATSYLNSRF----------------FAPVDVELPHQAIST  730
              +HLM      QK + +    +  L+S F                 +PV +E+     ++
Sbjct  385   TRHLMNVNQAVQKLMKH---KSKSLSSAFSLLCPSSHSYAEKPSSLSPVRIEVGGDETTS  441

Query  729   K---ADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPA--------LERY  583
                 + +    G++      +FA++C+ L V  +         QL P         L+++
Sbjct  442   SCFVSGAKHEAGYDAYMTGCVFAQLCAYLDVKFE---------QLSPQDNLATNNKLQKH  492

Query  582   ANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSS---KNVVFLWGFQSGISTGQVKSL---  421
              N+  P   S     ++    R      +R  +    N+V +WGF S +   ++K     
Sbjct  493   INLLSPSWNSGTVLDLSSGQERPDPGYMRRYPAAVYDNIVLIWGFMSKVRPKEIKDCICK  552

Query  420   VYGK---HEVFSSEFDIRLVDESCAVLVFSSPGLS------EVLLEALDSG-----SLEE  283
             V+G      VFS       +D + A++ F            + LLE  DS       L  
Sbjct  553   VFGSGSIKTVFS-------IDSTAALVQFKKQKTVNEFLDLKALLEKTDSAISILHPLST  605

Query  282   MVSEG-IRAASYDAYVKVC  229
             ++  G  RA  YD Y  +C
Sbjct  606   ILEGGQTRAVKYDTYRDIC  624



>ref|XP_002987014.1| hypothetical protein SELMODRAFT_446815 [Selaginella moellendorffii]
 gb|EFJ11857.1| hypothetical protein SELMODRAFT_446815 [Selaginella moellendorffii]
Length=603

 Score =   134 bits (338),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 71/198 (36%), Positives = 109/198 (55%), Gaps = 11/198 (6%)
 Frame = -2

Query  1817  VTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAERY  1638
             VT+SN+ EAL +    I ++ F+AV L+ +G  ++PW+     D     YL  + +AE++
Sbjct  4     VTRSNWEEALVEARAHIRQAAFVAVDLELSGVQTTPWRGATEVDNLHTRYLNLRDSAEKF  63

Query  1637  QILQFAVCP--FSLRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGFDF  1464
              ++QF +CP  +     K IA PYNF LFPR EL+  MP+  F CQ++ L  +A+  FDF
Sbjct  64    AMIQFGLCPVVWDAASVKFIAYPYNFCLFPRHELQIEMPARDFLCQATSLEFLAKHQFDF  123

Query  1463  NACINDGISYLSRAQELAAKDCIRSPSAGSC--------TVPSPASRSVADSIFINRIKS  1308
             NACI DGISYLS  QE  A+  ++   A            +  P +R+ AD IF   ++ 
Sbjct  124   NACIYDGISYLSHEQEKLARHKLKLTDADGAPRELESFSVLEIPLNRT-ADVIFSESVRV  182

Query  1307  RVKHWRNACTDQSKKTED  1254
             +   WR+    + K  ++
Sbjct  183   QAGEWRDKVLQREKDAQE  200


 Score = 79.3 bits (194),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 75/299 (25%), Positives = 134/299 (45%), Gaps = 34/299 (11%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR+++D +  S+KPVV HN   D   I+SKF A LP +  EF  S+ + FP I D K+L
Sbjct  277   GFRQLIDTLVESKKPVVGHNCFLDIAHIYSKFFATLPLSCSEFCSSIHQHFPCIFDTKYL  336

Query  846   MKELGSQKNL---NNIYVATSYLN-SRFFAPVDVELPHQAISTKADSVKSH--GHNVLKI  685
             +K   + + +       +   + N  +    V +E     +     +   H  G++    
Sbjct  337   LKADSAAQEMLGKGGTTLGPVFSNVGKLPNKVPIEFGSSNLCRYDGTEMKHEAGYDAYMT  396

Query  684   SELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDPCSTSY--------QDPPINE  529
             + +FA +C  +K+DP    ++  C Q     E  + +    +  Y         D    +
Sbjct  397   AAVFANICQFVKMDPANLPSL--CEQAKEGEEERSGLGSHANHLYLGWRGHFVLDLSTGQ  454

Query  528   EDVRVR----AKSCKRVSSKNVVFLWGFQSGISTG-QVKSLVYGKHEVFSSE----FDIR  376
             E    R    ++S +R  +K+V  +WG  S  S+    +SL       F+++     ++ 
Sbjct  455   EATGPRSLKSSRSIEREKAKSVALMWGSGSTRSSEVDSRSLEADVKACFTAKSPPHVEVV  514

Query  375   LVDESCAVLVFSSPGLSEVLLEALD-SG--------SLEEMVSEGIRAASYDAYVKVCK  226
              +DES A +VF      E L++A + SG         +  +V+ G + A Y+ + K+C+
Sbjct  515   RIDESSAFVVFRRKESLESLVQAFECSGHHDKVGVCDVSGLVARGWKIARYEFFEKLCE  573



>ref|XP_010088438.1| Poly(A)-specific ribonuclease PARN [Morus notabilis]
 gb|EXB36053.1| Poly(A)-specific ribonuclease PARN [Morus notabilis]
Length=754

 Score =   135 bits (339),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 81/210 (39%), Positives = 115/210 (55%), Gaps = 36/210 (17%)
 Frame = -2

Query  1823  KQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAE  1644
             K VT+SNF  AL ++   +  +DF+AV L+ +G  S+PW+  L FD +++ YLK K +AE
Sbjct  39    KLVTRSNFEAALAELRRHVRAADFVAVDLEMSGVTSAPWRESLGFDRSDVLYLKVKHSAE  98

Query  1643  RYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKT-GMPSYSFSCQSSYLISIAREG  1473
             ++ ++QF VCPF    SK   +A P+NF++FPR EL T    SY F  Q+  +  +AR  
Sbjct  99    KFAVIQFGVCPFRWDSSKQTFVAYPHNFYIFPRQELPTIDRSSYEFIWQTGSIDFLARYQ  158

Query  1472  FDFNACIND---------------GISYLSRAQE------LAAKD-------CIRSPSAG  1377
             FDFNACI +               GISYLSR QE      L + D       C  S  AG
Sbjct  159   FDFNACIREEMLSVCEFEPNWVISGISYLSRRQEDEALRRLNSGDEDESSATCYNSKDAG  218

Query  1376  SCTVPSPASRSVADSIFINRIKSRVKHWRN  1287
                +P  A   +AD +F  R+K+R+  W +
Sbjct  219   D--IPLVA---MADILFSERMKNRLSEWHD  243


 Score = 90.5 bits (223),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 81/302 (27%), Positives = 134/302 (44%), Gaps = 41/302 (14%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR VVDL+S  +K +V HN   D   +++KF+ PLPST +EF  S+ + FPHI+D K L
Sbjct  350   GFRHVVDLLSSERKLIVGHNCFLDIAHVYNKFIGPLPSTAEEFVSSVSKYFPHIIDTKIL  409

Query  846   MK--------------ELGSQKNLNNIYVATSYLNSRFFAPVDVELPHQAISTKADSVK-  712
             +                L S   L   +++ S+     +  V+VE+     S+     K 
Sbjct  410   LNTHQVLRQRMKKSKTSLSSAFTLLCPHISLSFAALESYVKVEVEVDDLRSSSWNSGAKH  469

Query  711   SHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDPCSTSYQDPPI-  535
               G++      +FA+ C  + +D K     E   +    L+++ N+      S+ +  I 
Sbjct  470   DAGYDAFMTGCIFAQACGYIGIDFKLHSPSESLAE-NEKLQKHINLL---YLSWTNADII  525

Query  534   -----NEEDVRVRAKSCKRVSS---KNVVFLWGFQSGISTGQVKSLVYGKHEVFSSEFDI  379
                  N+    V     KR S+   +NVV +WGF S +    ++        V S  F +
Sbjct  526   DLTNGNKVTASVEYSQKKRYSNVVFENVVLIWGFPSELKARHIRECFSKTFGVTSVTF-V  584

Query  378   RLVDESCAVLVFSSPGLSE---VLLEALDSGS--------LEEMVSEG-IRAASYDAYVK  235
               +D +   + FS   L      L+E L+  +        L E++  G  RAA+Y+ Y +
Sbjct  585   YQMDPTAVFVQFSKTKLVSDFLSLMETLEKNNDPISVLHPLSELLKGGNTRAATYETYKQ  644

Query  234   VC  229
             +C
Sbjct  645   IC  646



>ref|XP_006474884.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X2 
[Citrus sinensis]
Length=673

 Score =   133 bits (334),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/189 (37%), Positives = 106/189 (56%), Gaps = 12/189 (6%)
 Frame = -2

Query  1826  IKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAA  1647
             +K V KSNF  AL+ +   I  +DF+A+ L+ TG  S+PW+    FD  ++ YLK K +A
Sbjct  27    LKHVKKSNFDSALSSLRHHIQAADFVAIDLEMTGITSAPWRDSFEFDRFDVRYLKVKDSA  86

Query  1646  ERYQILQFAVCPFS---LRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIARE  1476
             E++ ++QF V PF    L++S  I  P+NF +F R EL     +Y F CQ++ +  +A+ 
Sbjct  87    EKFAVIQFGVSPFRWDPLKQS-FITHPHNFFIFQRQELPLDGAAYEFLCQTTSMDFLAKY  145

Query  1475  GFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSVADS--------IFIN  1320
              FDFNACI++G+SYLSR QE  A   + S           + + + D+        +F  
Sbjct  146   QFDFNACIHEGVSYLSREQEDKALKHVNSTYKDESLDSWHSLKEIRDTHLFNIPDILFAE  205

Query  1319  RIKSRVKHW  1293
             R+K R+  W
Sbjct  206   RMKDRLSEW  214


 Score = 81.3 bits (199),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 84/312 (27%), Positives = 133/312 (43%), Gaps = 56/312 (18%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL+S  +K +V HN   D   I+SKF  PLP T +EF  S+ + FPHI+D K L
Sbjct  285   GFRHVIDLLSSEKKLIVGHNCFLDIAHIYSKFFGPLPLTAEEFISSVNKYFPHIIDTKIL  344

Query  846   MKELGSQKNLNNIYVATSYLNSRFFAPVDVEL------------PHQAISTKADSVKSH-  706
                L S   L      +S   S+ F+ +  ++            P   +  + D ++S  
Sbjct  345   ---LNSNSILQQRMKKSSTSLSKAFSVLCPQIALGSKSTHLSLQPSVKVEVEVDDIRSSN  401

Query  705   ---------GHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDPCSTS  553
                      G++      +FA+ CS L +D K   + E+       L  + N+     T+
Sbjct  402   WNSGVKHEAGYDAFMTGCVFAQACSHLGIDFKQQSSSENLAH-NEKLREHVNLLYLSWTN  460

Query  552   YQDPPINEEDVRVRAKSCKRVSSKN---------VVFLWGFQSGISTGQVK---SLVYGK  409
              +   IN       ++S      KN         +V +WGF S +    ++   S VYG 
Sbjct  461   GE--IINLSTGNRTSESLASNKRKNHYPKILFECIVIVWGFPSHLKAWDIRECISKVYGP  518

Query  408   HEVFSSEFDIRLVDESCAVLVFSSPGLSEVLL---EALDSGS--------LEEMVSEGIR  262
               V S    +  VDE+   + FS   +    L   E+LD  +        L +++  G  
Sbjct  519   TSVIS----VYHVDETAVFVQFSRAEMVSKFLDLKESLDRNNDPISVLHPLAKLLEGGNT  574

Query  261   -AASYDAYVKVC  229
              AASY+ Y ++C
Sbjct  575   CAASYETYKEIC  586



>ref|XP_006474883.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X1 
[Citrus sinensis]
Length=711

 Score =   133 bits (334),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/189 (37%), Positives = 106/189 (56%), Gaps = 12/189 (6%)
 Frame = -2

Query  1826  IKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAA  1647
             +K V KSNF  AL+ +   I  +DF+A+ L+ TG  S+PW+    FD  ++ YLK K +A
Sbjct  27    LKHVKKSNFDSALSSLRHHIQAADFVAIDLEMTGITSAPWRDSFEFDRFDVRYLKVKDSA  86

Query  1646  ERYQILQFAVCPFS---LRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIARE  1476
             E++ ++QF V PF    L++S  I  P+NF +F R EL     +Y F CQ++ +  +A+ 
Sbjct  87    EKFAVIQFGVSPFRWDPLKQS-FITHPHNFFIFQRQELPLDGAAYEFLCQTTSMDFLAKY  145

Query  1475  GFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSVADS--------IFIN  1320
              FDFNACI++G+SYLSR QE  A   + S           + + + D+        +F  
Sbjct  146   QFDFNACIHEGVSYLSREQEDKALKHVNSTYKDESLDSWHSLKEIRDTHLFNIPDILFAE  205

Query  1319  RIKSRVKHW  1293
             R+K R+  W
Sbjct  206   RMKDRLSEW  214


 Score = 81.3 bits (199),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 84/312 (27%), Positives = 133/312 (43%), Gaps = 56/312 (18%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL+S  +K +V HN   D   I+SKF  PLP T +EF  S+ + FPHI+D K L
Sbjct  323   GFRHVIDLLSSEKKLIVGHNCFLDIAHIYSKFFGPLPLTAEEFISSVNKYFPHIIDTKIL  382

Query  846   MKELGSQKNLNNIYVATSYLNSRFFAPVDVEL------------PHQAISTKADSVKSH-  706
                L S   L      +S   S+ F+ +  ++            P   +  + D ++S  
Sbjct  383   ---LNSNSILQQRMKKSSTSLSKAFSVLCPQIALGSKSTHLSLQPSVKVEVEVDDIRSSN  439

Query  705   ---------GHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDPCSTS  553
                      G++      +FA+ CS L +D K   + E+       L  + N+     T+
Sbjct  440   WNSGVKHEAGYDAFMTGCVFAQACSHLGIDFKQQSSSENLAH-NEKLREHVNLLYLSWTN  498

Query  552   YQDPPINEEDVRVRAKSCKRVSSKN---------VVFLWGFQSGISTGQVK---SLVYGK  409
              +   IN       ++S      KN         +V +WGF S +    ++   S VYG 
Sbjct  499   GE--IINLSTGNRTSESLASNKRKNHYPKILFECIVIVWGFPSHLKAWDIRECISKVYGP  556

Query  408   HEVFSSEFDIRLVDESCAVLVFSSPGLSEVLL---EALDSGS--------LEEMVSEGIR  262
               V S    +  VDE+   + FS   +    L   E+LD  +        L +++  G  
Sbjct  557   TSVIS----VYHVDETAVFVQFSRAEMVSKFLDLKESLDRNNDPISVLHPLAKLLEGGNT  612

Query  261   -AASYDAYVKVC  229
              AASY+ Y ++C
Sbjct  613   CAASYETYKEIC  624



>ref|XP_006452602.1| hypothetical protein CICLE_v10007611mg [Citrus clementina]
 gb|ESR65842.1| hypothetical protein CICLE_v10007611mg [Citrus clementina]
Length=711

 Score =   132 bits (333),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 106/189 (56%), Gaps = 12/189 (6%)
 Frame = -2

Query  1826  IKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAA  1647
             +K V KSNF  AL+ +   +  +DF+A+ L+ TG  S+PW+    FD  ++ YLK K +A
Sbjct  27    LKHVKKSNFDSALSSLRHHVQAADFVAIDLEMTGITSAPWRDSFEFDRFDVRYLKVKDSA  86

Query  1646  ERYQILQFAVCPFS---LRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIARE  1476
             E++ ++QF V PF    L++S  I  P+NF +F R EL     +Y F CQ++ +  +A+ 
Sbjct  87    EKFAVIQFGVSPFRWDPLKQS-FITHPHNFFIFQRQELPLDGAAYEFLCQTTSMDFLAKY  145

Query  1475  GFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSVADS--------IFIN  1320
              FDFNACI++G+SYLSR QE  A   + S           + + + D+        +F  
Sbjct  146   QFDFNACIHEGVSYLSREQEDKALKHVNSTYEDESLDSWHSLKEIRDTHLFNIPDILFAE  205

Query  1319  RIKSRVKHW  1293
             R+K R+  W
Sbjct  206   RMKDRLSEW  214


 Score = 79.7 bits (195),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 83/312 (27%), Positives = 133/312 (43%), Gaps = 56/312 (18%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL+S  +K +V HN   D   I+SKF  PLP T +EF  S+ + FPHI+D K L
Sbjct  323   GFRHVIDLLSSEKKLIVGHNCFLDIAHIYSKFFGPLPLTAEEFISSVNKYFPHIIDTKIL  382

Query  846   MKELGSQKNLNNIYVATSYLNSRFFAPVDVEL------------PHQAISTKADSVKSH-  706
                L S   L      +S   S+ F+ +  ++            P   +  + D ++S  
Sbjct  383   ---LNSNSILQQRMKKSSTSLSKAFSVLCPQIALGSKSTHLALQPSVKVEVEVDDIRSSN  439

Query  705   ---------GHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDPCSTS  553
                      G++      +FA+ CS L +D K   + E+       L  + N+     T+
Sbjct  440   WNSGVKHEAGYDAFMTGCVFAQACSHLGIDFKQQSSSENLAH-NEKLREHVNLLYLSWTN  498

Query  552   YQDPPINEEDVRVRAKSCKRVSSKN---------VVFLWGFQSGISTGQVK---SLVYGK  409
              +   IN       ++S      KN         +V +WGF S +    ++   S VYG 
Sbjct  499   GE--IINLSTGNRTSESLASNKRKNHYPKILFECIVIVWGFPSHLKAWDIRECISKVYGP  556

Query  408   HEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLE---ALDSGS--------LEEMVSEGIR  262
               V S    +  VDE+   + FS   +    L+   +LD  +        L +++  G  
Sbjct  557   TSVIS----VYHVDETAVFVQFSRAEMVSKFLDLKGSLDRNNDPISVLHPLAKLLEGGNT  612

Query  261   -AASYDAYVKVC  229
              AASY+ Y ++C
Sbjct  613   CAASYETYKEIC  624



>ref|XP_002970869.1| hypothetical protein SELMODRAFT_451150 [Selaginella moellendorffii]
 gb|EFJ28195.1| hypothetical protein SELMODRAFT_451150 [Selaginella moellendorffii]
Length=648

 Score =   131 bits (330),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/206 (35%), Positives = 114/206 (55%), Gaps = 21/206 (10%)
 Frame = -2

Query  1901  RLFCTAISETAFRPNSGGSNYGKWGIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGA  1722
             RLFC+A+     R +S            +T+ NF  A   ++  + E+DF+A+ L+ +G 
Sbjct  19    RLFCSAV----VRDSSHA----------ITRQNFGAAFQRLKGLLREADFVAMDLEMSGV  64

Query  1721  YSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRE--SKLIASPYNFHLFPRD  1548
             +S+PW++ +  DT E  Y   + +AE++ +LQ  +C F   +  SK +  P+NF LFPR+
Sbjct  65    HSAPWRKSMELDTLETRYHNVRDSAEKFSLLQCGLCLFRYDQASSKFLGHPFNFFLFPRN  124

Query  1547  ELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCT  1368
             EL   +    F CQ+S L  +A+  FDFNACI +GISYLSR +E   +  +     G   
Sbjct  125   EL---VLERDFLCQTSSLEFLAKHHFDFNACIYNGISYLSRKEEGKLRALL--AKKGEDE  179

Query  1367  VPSPASRSVADSIFINRIKSRVKHWR  1290
             +P  + R  +D IF  R++ +V  WR
Sbjct  180   LPEVSMRKTSDLIFSERVRLQVGLWR  205


 Score = 81.3 bits (199),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 76/298 (26%), Positives = 136/298 (46%), Gaps = 32/298 (11%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR+V+D IS S+KP+V HN + D   I++KF+ PLP     F + +  +FP ++D K++
Sbjct  309   GFRQVIDAISESKKPIVGHNCVLDLAHIYNKFIGPLPDNYSGFCNVIHELFPAVIDTKYM  368

Query  846   MKELGSQKNLNNIYVATSYL---------NSRFFAPVDVELPHQAISTKADSVKSH--GH  700
             +K L +  +  ++Y   SY           ++  + V+VE+        +D+   H  G 
Sbjct  369   LKVLRTSISTTSLYPVYSYYFGEDAKKNTKTKAHSTVNVEIA-DGFHKYSDAELKHEAGF  427

Query  699   NVLKISELFAKVCSILKVDPKAPEAI-EHCGQLPPALERYANIFDPCSTSY--QDPPINE  529
             +      +FA++   +  +P    A+ +   +   A+  ++N+       +   D    +
Sbjct  428   DAYMTGAIFAQLWRTVVSNPTEFYALSKKILRGTHAISEFSNLLYMGWAGHFVLDLKTGK  487

Query  528   EDVRVRA------KSCKRVSSKNVVFLWGFQSGISTGQVKSLVYGKHE--VFSSEFDIRL  373
             E    +A       S +R +S   V +W      S+ Q++ LV    E   FSSE ++  
Sbjct  488   EAKGSKALPERESYSARRPASDAAVIVWSQDPVGSSRQLQKLVKSCFEETQFSSEVEVIP  547

Query  372   VDESCAVLVFSSPGLSEVLLEALDSGSLE---------EMVSEGIRAASYDAYVKVCK  226
             V E+ A L F S   SE   +AL+S   +          + S G+  A +  + K+CK
Sbjct  548   VSENAAFLAFKSLRSSEEFSQALESIKTKRKKLNTIAARLSSSGLEGARFGTFEKLCK  605



>ref|XP_002522771.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39622.1| conserved hypothetical protein [Ricinus communis]
Length=699

 Score =   130 bits (326),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 68/185 (37%), Positives = 104/185 (56%), Gaps = 12/185 (6%)
 Frame = -2

Query  1826  IKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAA  1647
             +K V KSNF+ +L D++  +  +DFIA+ L+ TG  ++PW+    +D  ++ YLK K +A
Sbjct  32    LKHVVKSNFNSSLADLKRHVIAADFIAIDLEMTGITTAPWRESFEYDRFDVRYLKVKDSA  91

Query  1646  ERYQILQFAVCPFSL--RESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
             E++ ++QF VCPF         IA PYNF +F  D          F CQ++ L  +A+  
Sbjct  92    EKFAVVQFGVCPFRWDSDHHSFIAHPYNFFIFRED--------CEFLCQATSLEFLAKYQ  143

Query  1472  FDFNACINDGISYLSRAQELAA--KDCIRSPSAGSCTVPSPASRSVADSIFINRIKSRVK  1299
             FDFN CI +G+SYLSR QE  A  +  +R   +    V      S+ D +F  R+K+R+ 
Sbjct  144   FDFNTCILEGMSYLSRRQEEEALRRLNLRYEDSNLNDVGDVPLASITDILFSERMKNRLS  203

Query  1298  HWRNA  1284
              WR+ 
Sbjct  204   EWRDG  208


 Score = 88.2 bits (217),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 87/308 (28%), Positives = 137/308 (44%), Gaps = 47/308 (15%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL+S +QK +V HN   D   IHSKFL PLP T +EF  ++ + FPHI+D K L
Sbjct  304   GFRHVIDLLSSAQKLIVGHNCFLDIAHIHSKFLGPLPPTAEEFVSAVNKYFPHIIDTKIL  363

Query  846   MKELG-----SQKNLNNIYVATSYL--------------NSRFFAPVDVELPHQAISTKA  724
             +          +K+  ++  A S L               SR    V+V++     S  +
Sbjct  364   LNANNVLLQRMKKSGTSLSAAFSLLCPQLATSSNKGINWASRPCVNVEVQVDDTRSSNWS  423

Query  723   DSVKSH-GHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANI-------FD  568
               VK   G++      +FA+ C+ L VD K   + E+       L++  N+       +D
Sbjct  424   SGVKHEAGYDAFMTGCVFAQACNHLGVDFKLKSSSENLAH-NEKLQKLINLLYISWINWD  482

Query  567   PCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSLV---YGKHEVF  397
                    +            K    +  KN+V +W F S +  G+++  +   +G + V 
Sbjct  483   IIDLRTGNRVAESLGFNYLRKQRPNILFKNIVLIWRFPSRLKAGEIRECICKAFGLNSVT  542

Query  396   SSEFDIRLVDESCAVLVFSSPGL-SE--VLLEALDSGS--------LEEMVSEGIR-AAS  253
             S    I  VDE+   + FS   L SE  VL E+LD  +        L +++  G   AA 
Sbjct  543   S----IYHVDETAVFVQFSKAELVSEFLVLKESLDRSNDPISVLHPLSKLLDGGNTCAAD  598

Query  252   YDAYVKVC  229
             Y+ Y ++C
Sbjct  599   YETYKEIC  606



>ref|XP_002969601.1| hypothetical protein SELMODRAFT_410403 [Selaginella moellendorffii]
 gb|EFJ29689.1| hypothetical protein SELMODRAFT_410403 [Selaginella moellendorffii]
Length=648

 Score =   128 bits (322),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/178 (36%), Positives = 104/178 (58%), Gaps = 7/178 (4%)
 Frame = -2

Query  1817  VTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAERY  1638
             +T+ NF  A   ++  + ++DF+A+ L+ +G +S+PW++ +  DT E  Y   + +AE++
Sbjct  33    ITRQNFGAAFQRLKGLLRDADFVAMDLEMSGVHSAPWRKSMELDTLETRYHNVRDSAEKF  92

Query  1637  QILQFAVCPFSLRE--SKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGFDF  1464
              +LQ  +C F   +  SK +  P+NF LFPR+EL   +    F CQ+S L  +A+  FDF
Sbjct  93    SLLQCGLCLFRYDQASSKFLGHPFNFFLFPRNEL---VLERDFLCQTSSLEFLAKHHFDF  149

Query  1463  NACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSVADSIFINRIKSRVKHWR  1290
             NACI +GISYLSR +E   +  +     G   +P  + R  +D IF  R++ +V  WR
Sbjct  150   NACIYNGISYLSRKEEGKLRALL--AKKGEDELPEVSMRKTSDLIFSERVRLQVGLWR  205


 Score = 81.3 bits (199),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 78/298 (26%), Positives = 137/298 (46%), Gaps = 32/298 (11%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR+V+D IS S+KP+V HN + D   I++KF+ PLP     F + +  +FP ++D K++
Sbjct  309   GFRQVIDAISESKKPIVGHNCVLDLAHIYNKFIGPLPDNYSGFCNVIHELFPAVIDTKYM  368

Query  846   MKELGSQKNLNNIYVATSYL-------NSRFFA--PVDVELPHQAISTKADSVKSH--GH  700
             +K L +  +  ++Y   SY        N++  A   V+VE+        +D+   H  G 
Sbjct  369   LKVLRTSISTTSLYPVYSYYFGEDAKKNTKMKAHSTVNVEIA-DGFHKYSDAELKHEAGF  427

Query  699   NVLKISELFAKVCSILKVDPKAPEAI-EHCGQLPPALERYANIFDPCSTSY--QDPPINE  529
             +      +FA++   +  +P    A+ +   +   A+  ++N+       +   D    +
Sbjct  428   DAYMTGAIFAQLWRTVVSNPTEFYALSKKILRGTHAISEFSNLLYMGWAGHFVLDLKTGK  487

Query  528   EDVRVRA------KSCKRVSSKNVVFLWGFQSGISTGQVKSLVYGKHE--VFSSEFDIRL  373
             E    +A       S +R +S   V +W      S+ Q++ LV    E   FSSE ++  
Sbjct  488   EAKGSKALPERESYSARRPASDAAVIVWSQDPVGSSRQLQKLVKSCFEETQFSSEVEVIP  547

Query  372   VDESCAVLVFSSPGLSEVLLEALDSGSLE---------EMVSEGIRAASYDAYVKVCK  226
             V E+ A L F S   SE   +AL+S              + S G++ A +  + K+CK
Sbjct  548   VSENAAFLAFKSLRSSEEFSQALESIKTNRKKLNTIAARLSSSGLQGARFGTFEKLCK  605



>ref|XP_007146650.1| hypothetical protein PHAVU_006G058000g [Phaseolus vulgaris]
 gb|ESW18644.1| hypothetical protein PHAVU_006G058000g [Phaseolus vulgaris]
Length=712

 Score =   128 bits (322),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 107/189 (57%), Gaps = 9/189 (5%)
 Frame = -2

Query  1823  KQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAE  1644
             K VT +NF  +L ++   +  SDF+A+ L+ +G  S+PW+  L FD +++ YLK + +A 
Sbjct  33    KTVTTANFEPSLAELRRHVRSSDFVAIDLEMSGITSAPWRESLEFDRSDVRYLKVRDSAT  92

Query  1643  RYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGF  1470
             ++ ++QF VCPF    S    +A P++F++FPR E     P   F  Q++ +  +A+  F
Sbjct  93    KFAVVQFGVCPFRWDSSNNSFVAYPHSFYVFPRQEHAGLGPCDEFLWQTTSMDFLAKYQF  152

Query  1469  DFNACINDGISYLSRAQELAAKDCIRSPSAGSCT-------VPSPASRSVADSIFINRIK  1311
             DFNACI++GISYLSR QE  A   + S      +       V      S AD +F  R+K
Sbjct  153   DFNACIHEGISYLSREQERKALRSLNSTYDSEWSDICKLKDVRDMPLLSAADILFTARMK  212

Query  1310  SRVKHWRNA  1284
             ++ + WR+ 
Sbjct  213   NKFREWRDG  221


 Score = 73.6 bits (179),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 84/316 (27%), Positives = 135/316 (43%), Gaps = 64/316 (20%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             G R V+DL+S  QK +V HN   D   ++SKF+ PLP T +EF  S+ + FPHI+D K L
Sbjct  325   GLRHVIDLLSSEQKLIVGHNCFLDLAHVYSKFIGPLPDTPEEFVTSVNKCFPHIVDTKIL  384

Query  846   M--------KELGSQKNLNNIYVA----------TSYLNSRFFAPVDVELPHQAISTKAD  721
             +        K   S+K+L   + +          +SY  S         L H  +  + D
Sbjct  385   LNTNFMLHEKMKRSRKSLAAAFTSFCPQIAAGSTSSYPGS---------LSHVKVEVEVD  435

Query  720   SVKSH----------GHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIF  571
              V+S           G++      +FA++CS L +D K  ++ +    L   L+ Y N  
Sbjct  436   DVRSSSWNPGGKHEAGYDAFMTGCIFAQLCSDLGIDYKLHDSSKQLA-LDEKLQNYVNRL  494

Query  570   -------DPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVK---SL  421
                    D    S  +   +        K   ++  +N+V +WGF S +   +V+   S 
Sbjct  495   YLSWMHGDIIDLSTGNKVGDSSPSYSLRKRYPKILFENIVIIWGFPSKLKANEVRECISK  554

Query  420   VYGKHEVFSSEFDIRLVDESCAVLVFSSPGL-SEVL-----LEALDSG-----SLEEMVS  274
             V+G   V S    +  +D +   + FS   L S+ L     LE  D        L +++ 
Sbjct  555   VFGPTSVVS----VFHLDATAVFVQFSKTELVSDFLSLKNTLEGSDGALLVLHPLSKLLE  610

Query  273   EG-IRAASYDAYVKVC  229
              G   AA+Y  Y ++C
Sbjct  611   GGNTCAANYGTYKEIC  626



>gb|AFW58529.1| hypothetical protein ZEAMMB73_225129 [Zea mays]
Length=686

 Score =   122 bits (307),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 99/192 (52%), Gaps = 17/192 (9%)
 Frame = -2

Query  1829  GIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRA  1650
              +KQVT+ N  EAL  +  R+ E+ F+ + L+ +G  S+PW+     D A++ YLK + +
Sbjct  36    AVKQVTRGNMEEALEKLRGRVREAAFVGLDLEMSGVTSAPWRDTFELDRADVRYLKLRDS  95

Query  1649  AERYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIARE  1476
             AER+  LQ  VCPF    +K   +A P+NF +FPR EL +   S+ F CQ++ +  +A+ 
Sbjct  96    AERFAALQLGVCPFRWDPAKSAFVAHPHNFFIFPRKELPSDCSSHEFLCQTTSIEFLAKY  155

Query  1475  GFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPAS--------RSVADSIFIN  1320
              FDFN C  +       AQE  A         G     S  S        +S +D +F  
Sbjct  156   QFDFNTCFRE-------AQEEEALQKFNMLHHGRTVTSSTNSEEDGDMPLKSASDILFTE  208

Query  1319  RIKSRVKHWRNA  1284
             R+K   K WR+A
Sbjct  209   RMKMNFKEWRDA  220


 Score = 76.3 bits (186),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 80/314 (25%), Positives = 136/314 (43%), Gaps = 58/314 (18%)
 Frame = -1

Query  1038  KCVRGFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILD  859
             K   G R V+DL+S  +K +V H+   D   ++SKF+ PLPS++ EF  S  + FPHI D
Sbjct  322   KSAIGIRHVIDLLSSERKLIVGHSCFLDIAQVYSKFVRPLPSSIKEFALSFHKFFPHIAD  381

Query  858   VKHLMK-ELGSQKNLNNIYVATSYLNSRFF----------------APVDVELP-HQAIS  733
              +HLM      QK + +    +  L+S F                 +PV +E+   + +S
Sbjct  382   TRHLMSVNQAVQKLMKH---KSKSLSSAFLLLCPASYSSVEKPSSHSPVTIEVEGDETMS  438

Query  732   TKADSVKSH--GHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDP--  565
             ++  S   H  G++      +FA++C+ L +  +    +++       L+++ N   P  
Sbjct  439   SRFISGAKHEAGYDAYMTGCIFAQLCAYLGIQFEQFSPLDNLAT-NTKLQKHINFLSPSW  497

Query  564   -------CSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSL---VY  415
                     ST  + P           +        N+V +WGF S +   ++K     V+
Sbjct  498   NSGTVLDLSTGMETPDPG------YTRRYPAAVYDNIVVIWGFLSKVRPKEIKDCICKVF  551

Query  414   GKHEVFSSEFDIRLVDESCAVLVF-SSPGLSEVL-----LEALDSG-----SLEEMVSEG  268
             G   V ++ F I   D + A++ F     +++ L     LE  DS       L  ++  G
Sbjct  552   GSGSV-TTVFSI---DSTAALVQFKKQESVNDFLDLKAVLERADSAISILHPLSTILEGG  607

Query  267   -IRAASYDAYVKVC  229
               RAA YD Y  +C
Sbjct  608   QTRAAKYDTYRDIC  621



>gb|EYU33709.1| hypothetical protein MIMGU_mgv1a003022mg [Erythranthe guttata]
Length=614

 Score =   114 bits (285),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 87/157 (55%), Gaps = 10/157 (6%)
 Frame = -2

Query  1730  TGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLR--ESKLIASPYNFHLF  1557
             TG  S+PW+    FD  +I YLK K +AE++ ++QF VCPF         +A P+NF++F
Sbjct  2     TGVTSAPWRESFDFDRPDIQYLKIKDSAEKFAVVQFGVCPFRWDPLSHSFLAHPHNFYIF  61

Query  1556  PRDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQELAAKDCIRSPSAG  1377
             PR E+     S  F CQ+S L  +A+  FDFN CI +GISYLSR+QE  A   + S    
Sbjct  62    PRQEIPGDGLSNEFLCQTSSLEFLAKYQFDFNKCIYEGISYLSRSQEEEALRQLDSLYND  121

Query  1376  SCTVPSPASRS--------VADSIFINRIKSRVKHWR  1290
             +    S  SR+        +AD +F  R+K  V  WR
Sbjct  122   NSGYSSSNSRNDADAQLVRMADILFTERMKYTVSEWR  158


 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 79/311 (25%), Positives = 127/311 (41%), Gaps = 57/311 (18%)
 Frame = -1

Query  1038  KCVRGFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILD  859
             K   GFR V+DL+S  +K +V HN   D   ++SKF  PLP T +EF  ++ + FP+I+D
Sbjct  262   KSAIGFRHVIDLLSSEKKLIVGHNCFLDLAHVYSKFFGPLPLTAEEFVSAVRKYFPNIID  321

Query  858   VKHLMKE-----LGSQKNLNNIYVA-------------TSYLNSRFFAPVDVELPHQAIS  733
              K L+       L  +K   ++  A             +S +  +    V+V++  Q  S
Sbjct  322   TKVLINSNDELFLLMRKGSTSLSKAFGVLCPPIGPGGTSSDVAGKPRVKVEVQVDDQRFS  381

Query  732   TKADSVKSH-GHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPP--ALERYANIFDPC  562
                   K   G++      +F++ C  L +D            LP    L++Y N     
Sbjct  382   NWNSGAKHEAGYDAFMTGSVFSQSCRNLGID------FNSVLNLPQNEKLQKYINHLYLS  435

Query  561   STSYQDPPINEEDVRVRA------KSCKRVSSK----NVVFLWGFQSGISTGQVKSL---  421
               +     +    + V +       S KR + K    N V LWG  S +    ++     
Sbjct  436   WNNKDIIDLKTGKILVESLGSNNNTSTKRRNPKFVFSNTVLLWGPPSKLRAKDIRDCVCK  495

Query  420   VYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDSGSLEE-----------MVS  274
             V+G   + S    I  +DE+ A + FS   L    LE  DS   E+            + 
Sbjct  496   VFGVGSIVS----ICHLDETAAFVQFSKEELVSDFLELKDSLEREKNSPVSILHPLSKIL  551

Query  273   EG--IRAASYD  247
             EG  +RAA+Y+
Sbjct  552   EGGFVRAANYE  562



>gb|AAF79314.1|AC002304_7 F14J16.11 [Arabidopsis thaliana]
Length=660

 Score =   112 bits (281),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/221 (31%), Positives = 110/221 (50%), Gaps = 20/221 (9%)
 Frame = -2

Query  1826  IKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAA  1647
             +K VT+SNF   LND+ + +  +DF+A+ L+ TG  S+PW+  L FD  ++ YLK K +A
Sbjct  97    LKHVTRSNFETTLNDLRSLVKAADFVAIDLEMTGVTSAPWRDSLEFDRYDVRYLKVKDSA  156

Query  1646  ERYQILQFAVCPFSL--RESKLIASPYNFHLFPRDELKTGMPSYSFSCQSS---YLISIA  1482
             E++ ++QF VCPF    R    ++ P+NF +FPR EL    P++ F CQ++   +L    
Sbjct  157   EKFAVVQFGVCPFRWDSRTQSFVSYPHNFFVFPRQELTFDPPAHEFLCQTTSMDFLAKYQ  216

Query  1481  REGFDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSVADSIFINRIKSRV  1302
             RE  + +           R + L  +D I S    S          +AD +F  R++  +
Sbjct  217   REEEEAS----------KRLKMLHGEDGIDS----SGETEELKLVRLADVLFAARMEKLL  262

Query  1301  KHWRNACTDQSKKTEDV-LISSLRKMISATEVHGSRPCLNI  1182
               WR+        + +   IS+       T  H  RP L++
Sbjct  263   NEWRSGLLHGGNASSEFPRISNGSNQSMETVFHHMRPALSL  303


 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/171 (29%), Positives = 80/171 (47%), Gaps = 24/171 (14%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR+V+DL++  +K +V HN   D   ++SKF+ PLPST ++F  S+   FP+I+D K L
Sbjct  374   GFRQVIDLLASEKKLIVGHNCFLDIAHVYSKFVGPLPSTAEKFVASINSHFPYIVDTKIL  433

Query  846   ----------MKELGSQKNLNNIYV----------ATSYLNSRFFAPVDVELPHQAIST-  730
                       MK+  +  +     +          + S+L  R    +DVE+ +   S  
Sbjct  434   LNVNPMLHQRMKKSSTSLSSAFSSLCPQIEFSSRSSDSFLQQR--VNIDVEIDNVRCSNW  491

Query  729   KADSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYAN  577
              A      G++      +FA+ C+ L  D K    ++   Q    LE+Y N
Sbjct  492   NAGGKHEAGYDAFMTGCIFAQACNHLGFDFKQHSQLDDFAQ-NEKLEKYIN  541



>ref|NP_001173974.1| Os04g0467400 [Oryza sativa Japonica Group]
 dbj|BAH92702.1| Os04g0467400 [Oryza sativa Japonica Group]
Length=207

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 78/130 (60%), Gaps = 2/130 (2%)
 Frame = -2

Query  1829  GIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRA  1650
              +KQVT+ N +EAL ++  R+  + F+ + L+ +G  S+PW+  L  D A++ YLK + +
Sbjct  45    AVKQVTRGNLAEALEELRARVRGAAFVGIDLEMSGVTSAPWRDTLGLDRADVRYLKLRDS  104

Query  1649  AERYQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIARE  1476
             AER+  LQ  VCPF    +K   +A P+NF +F R+E      ++ F CQ++ +  +A+ 
Sbjct  105   AERFAALQLGVCPFRWDPAKSAFVAHPHNFFIFSRNEPLNDCSTHEFLCQTTSIDFLAKY  164

Query  1475  GFDFNACIND  1446
              FDFN C  +
Sbjct  165   QFDFNTCFRE  174



>ref|XP_006653504.1| PREDICTED: poly(A)-specific ribonuclease PARN-like, partial [Oryza 
brachyantha]
Length=659

 Score =   111 bits (277),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 58/168 (35%), Positives = 88/168 (52%), Gaps = 12/168 (7%)
 Frame = -2

Query  1754  FIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAERYQILQFAVCPFSLRESK--LIA  1581
             F+ V L+ +G  S+PW+  L  D A++ YLK + +AER+  LQ  VCPF    +K   +A
Sbjct  2     FVGVDLEMSGVTSAPWRDTLELDRADVRYLKLRDSAERFAALQLGVCPFRWDPAKSAFVA  61

Query  1580  SPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGFDFNACINDGISYLSRAQE-----  1416
              P+NF +FP ++L     S+ F CQ++ +  +A+  FDFN C  +GI YLSR QE     
Sbjct  62    HPHNFFIFPHNKLLNDCSSHEFLCQTTSIDFLAKYQFDFNTCFREGIYYLSRTQEEKALQ  121

Query  1415  ----LAAKDCIRSPSAGSCTVPSPASRSVADSIFINRIKSRVKHWRNA  1284
                 L   +    P+        P  +S AD +F  R+K +   W  +
Sbjct  122   KLYALHNNETSAYPNTSEEEEDVPL-KSAADILFTERMKIKFNEWHKS  168


 Score = 85.5 bits (210),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 85/313 (27%), Positives = 136/313 (43%), Gaps = 54/313 (17%)
 Frame = -1

Query  1038  KCVRGFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILD  859
             K   G R V+DL++  +K +V H+   D   I+SKF+ PLPS++++F  S+ ++FPHI D
Sbjct  269   KSAVGIRHVIDLLASERKLIVGHSCFLDIAQIYSKFVGPLPSSMEDFALSINKIFPHIAD  328

Query  858   VKHLM--------------KELGSQKNLNNIYVATSYLNSRFFAPV--DVELPHQAISTK  727
              +HLM              K L S  +L    +     NS    PV  +VE     +S  
Sbjct  329   TRHLMSVNEAVQYRMRHKSKSLSSAFSLLCPTLHAPNENSSTLPPVKIEVEADETVLSCF  388

Query  726   ADSVKSH-GHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDPC----  562
                 K   G++      +F ++C+ L +  +    +E+       L+++ N+  PC    
Sbjct  389   TSGAKHEAGYDAFMTGCVFVQLCACLGIKFEHLSPLENLAT-NINLKKHINLLAPCFNSG  447

Query  561   -----STSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVKSL---VYGKH  406
                  ST  + P   +   + R  +       N V +WGFQS +    +K     V+G+ 
Sbjct  448   TVLDLSTGMERP---DPGYKFRYPA---AVYDNAVLIWGFQSKVRPKDIKDCICKVFGRD  501

Query  405   EVFSSEFDIRLVDESCAVLVFSSPGLS-------EVLLEALDSG-----SLEEMVSEG-I  265
              V +  F I    +S AVLV  S   S       +  LE  D+       L  ++  G  
Sbjct  502   SV-TLVFPI----DSTAVLVQFSKQESVNSFLDLKATLEGADTAISVLHPLSTILEGGKT  556

Query  264   RAASYDAYVKVCK  226
             RAA YD Y  +C+
Sbjct  557   RAAKYDTYRDICR  569



>ref|XP_009358967.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Pyrus x bretschneideri]
Length=113

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 55/130 (42%), Positives = 75/130 (58%), Gaps = 24/130 (18%)
 Frame = -1

Query  606  LPPALERYANIFDPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVK  427
            L P +E YANI +PCS S Q+     ED+RV  K+ ++VS   +VFLWGF+SG++   +K
Sbjct  8    LAPTIEEYANISNPCSDSPQES--TNEDIRVWIKNMRKVSCDQLVFLWGFRSGMTAAMIK  65

Query  426  SLVYGKHEVFSSEFDIRLVDESCAVLVFSSPGLSEVLLEALDSGSLEEMVSEGIRAASYD  247
            SL+   H +FS E D+R  +E C                     SL E+ SEGIRA+SY 
Sbjct  66   SLLCKSHALFSEEIDVR--EEIC--------------------DSLMEIASEGIRASSYG  103

Query  246  AYVKVCKLGL  217
             Y +VC+LGL
Sbjct  104  TYKRVCRLGL  113



>emb|CAH66773.1| OSIGBa0115M15.11 [Oryza sativa Indica Group]
Length=703

 Score =   104 bits (259),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 95/191 (50%), Gaps = 32/191 (17%)
 Frame = -2

Query  1829  GIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRA  1650
              +KQVT+ N +EAL ++  R+  + F+ + L+ +G  S+PW+  L  D A++ YLK + +
Sbjct  45    AVKQVTRGNLAEALEELRARVRGAAFVGIDLEMSGVTSAPWRDTLELDRADVRYLKLRDS  104

Query  1649  AERYQILQFAVCPFSLRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGF  1470
             AER                      +NF +F R+E      ++ F CQ++ +  +A+  F
Sbjct  105   AER----------------------HNFFIFSRNEPLNDCSTHEFLCQTTSIDFLAKYQF  142

Query  1469  DFNACINDGISYLSRAQELAAKDCIRS---------PSAGSCTVPSPASRSVADSIFINR  1317
             DFN C  +GI YLSR QE  A   + +         P+       +P  +S AD +F  R
Sbjct  143   DFNTCFREGIYYLSRTQEEEALQKLYTLHNNETSAYPNTSEEEEDAPL-KSAADVLFTER  201

Query  1316  IKSRVKHWRNA  1284
             +K +   WRN+
Sbjct  202   MKIKFNEWRNS  212


 Score = 91.7 bits (226),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 85/307 (28%), Positives = 137/307 (45%), Gaps = 42/307 (14%)
 Frame = -1

Query  1038  KCVRGFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILD  859
             K   G R V+DL++  +K +V H+   D   I+SKF+ PLPS+++EF  S+ R+FPH+ D
Sbjct  313   KSAVGIRHVIDLLASERKLIVGHSCFLDIAQIYSKFVGPLPSSMEEFALSINRMFPHMAD  372

Query  858   VKHLMK-----ELGSQKNLNNIYVATSYLNSRFFAPVD--VELPHQAISTKADSV-----  715
              +HLM      +   +    ++  A S L     AP +    LP   I  +AD       
Sbjct  373   TRHLMSVNDAVQYRMRHKSKSLSSAFSLLCPALHAPDEKSSTLPSVRIEVEADETVLSCF  432

Query  714   -----KSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDPCSTSY  550
                     G++      +F ++C+   +  +    +E        L+++ N+  PC  S 
Sbjct  433   TSGAKHEAGYDAFMTGCVFVQLCAYHGIKFEQLSPLEDLAT-NINLKKHINLLPPCWNSG  491

Query  549   QDPPINEEDVRVRAKSCKRVSS---KNVVFLWGFQSGISTGQVKSL---VYGKHEVFSSE  388
                 ++    R  A   +R  +    NV+ +WGFQS +    +K     V+G+  V +S 
Sbjct  492   TVLDLSTGTERPDAGYKRRYPAAVYDNVILIWGFQSKVRPKDIKDCICKVFGRASV-TSV  550

Query  387   FDIRLVDESCAVLVFSSPGLS-------EVLLEALDSG-----SLEEMVSEG-IRAASYD  247
             F I    +S AVLV  S   S       +  LE+ DS       L  ++  G  RAA YD
Sbjct  551   FPI----DSTAVLVQFSKQESVNDFLDLKATLESADSAISVLHPLSTILEGGKTRAAKYD  606

Query  246   AYVKVCK  226
              Y  +C+
Sbjct  607   TYRDICR  613



>emb|CAH67368.1| OSIGBa0128P10.2 [Oryza sativa Indica Group]
Length=702

 Score = 99.4 bits (246),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 93/191 (49%), Gaps = 33/191 (17%)
 Frame = -2

Query  1829  GIKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRA  1650
              +KQVT+ N +EAL ++  R+  + F+ + L+ +G  S+PW+  L  D A++ YLK + +
Sbjct  45    AVKQVTRGNLAEALEELRARVRGAAFVGIDLEMSGVTSAPWRDTLELDRADVRYLKLRDS  104

Query  1649  AERYQILQFAVCPFSLRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGF  1470
             A                        +NF +F R+E      ++ F CQ++ +  +A+  F
Sbjct  105   AR-----------------------HNFFIFSRNEPLNDCSTHEFLCQTTSIDFLAKYQF  141

Query  1469  DFNACINDGISYLSRAQELAAKDCIRS---------PSAGSCTVPSPASRSVADSIFINR  1317
             DFN C  +GI YLSR QE  A   + +         P+       +P  +S AD +F  R
Sbjct  142   DFNTCFREGIYYLSRTQEEEALQKLYTLHNNETSAYPNTSEEEEDAPL-KSAADVLFTER  200

Query  1316  IKSRVKHWRNA  1284
             +K +   WRN+
Sbjct  201   MKIKFNEWRNS  211


 Score = 91.7 bits (226),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 85/307 (28%), Positives = 137/307 (45%), Gaps = 42/307 (14%)
 Frame = -1

Query  1038  KCVRGFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILD  859
             K   G R V+DL++  +K +V H+   D   I+SKF+ PLPS+++EF  S+ R+FPH+ D
Sbjct  312   KSAVGIRHVIDLLASERKLIVGHSCFLDIAQIYSKFVGPLPSSMEEFALSINRMFPHMAD  371

Query  858   VKHLMK-----ELGSQKNLNNIYVATSYLNSRFFAPVD--VELPHQAISTKADSV-----  715
              +HLM      +   +    ++  A S L     AP +    LP   I  +AD       
Sbjct  372   TRHLMSVNDAVQYRMRHKSKSLSSAFSLLCPALHAPDEKSSTLPSVRIEVEADETVLSCF  431

Query  714   -----KSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDPCSTSY  550
                     G++      +F ++C+   +  +    +E        L+++ N+  PC  S 
Sbjct  432   TSGAKHEAGYDAFMTGCVFVQLCAYHGIKFEQLSPLEDLAT-NINLKKHINLLPPCWNSG  490

Query  549   QDPPINEEDVRVRAKSCKRVSS---KNVVFLWGFQSGISTGQVKSL---VYGKHEVFSSE  388
                 ++    R  A   +R  +    NV+ +WGFQS +    +K     V+G+  V +S 
Sbjct  491   TVLDLSTGTERPDAGYKRRYPAAVYDNVILIWGFQSKVRPKDIKDCICKVFGRASV-TSV  549

Query  387   FDIRLVDESCAVLVFSSPGLS-------EVLLEALDSG-----SLEEMVSEG-IRAASYD  247
             F I    +S AVLV  S   S       +  LE+ DS       L  ++  G  RAA YD
Sbjct  550   FPI----DSTAVLVQFSKQESVNDFLDLKATLESADSAISVLHPLSTILEGGKTRAAKYD  605

Query  246   AYVKVCK  226
              Y  +C+
Sbjct  606   TYRDICR  612



>gb|AAH73682.1| Unknown (protein for IMAGE:5572400), partial [Xenopus laevis]
Length=517

 Score = 95.9 bits (237),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 99/191 (52%), Gaps = 16/191 (8%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             ++T+SNF + L  +   I E+DF+A+  + +G    P    L   FDT E  Y K K+ +
Sbjct  2     EITRSNFKDTLPKVYKAIEEADFLAIDGEFSGISDGPSVSTLTNGFDTPEERYTKLKKHS  61

Query  1646  ERYQILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F+    E+K +   +NF++FP+       P   F CQSS +  +A +G
Sbjct  62    MEFLLFQFGLCTFNYDNTEAKYLMKSFNFYIFPK-PFNRNSPDKKFVCQSSSIDFLANQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKDCI---RSPSAGSCTVP--SPASRSVADSI------F  1326
             FDFN    +GI YL++ +E   +D     RS S G+ T+   SP S     SI      F
Sbjct  121   FDFNKVFRNGIPYLNQEEERVLRDQYEDRRSQSNGASTMSYISPNSSKTPVSIPDEQKGF  180

Query  1325  INRIKSRVKHW  1293
             I+++  RV+ +
Sbjct  181   IDKVVERVEDF  191



>ref|XP_010731915.1| PREDICTED: poly(A)-specific ribonuclease PARN [Larimichthys crocea]
Length=683

 Score = 95.9 bits (237),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 95/190 (50%), Gaps = 17/190 (9%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             +VT+ NF E LN + T I E+DF+A+  + +G    P    L    DT E  Y K K+ +
Sbjct  2     EVTRRNFKECLNTVYTAIEEADFLAIDGEFSGISDGPNVSALTNGLDTPEERYTKLKKHS  61

Query  1646  ERYQILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F     +SK I  P+NF++FP+   +T  P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDHTKSKYIIKPFNFYIFPKPFNRTS-PDIKFICQSSSIDFLASQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKDCI---RSPSAGSCTVPS---------PASRSVADSI  1329
             FDFN    +GI YL++ +E   ++     R+  A     PS         PA        
Sbjct  121   FDFNKVFCNGIPYLNQDEEAQLREQTEERRNQHANGVGTPSYISPSSSKGPAHVPDEHKD  180

Query  1328  FINRIKSRVK  1299
             FINR+  +V+
Sbjct  181   FINRVIEKVE  190



>sp|Q90ZA1.1|PARN_XENLA RecName: Full=Poly(A)-specific ribonuclease PARN; AltName: Full=Deadenylating 
nuclease; AltName: Full=Deadenylation nuclease; 
AltName: Full=Polyadenylate-specific ribonuclease; AltName: 
Full=parn-A [Xenopus laevis]
 gb|AAK64218.1|AF309688_1 poly(A)-specific ribonuclease [Xenopus laevis]
Length=631

 Score = 95.5 bits (236),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 99/191 (52%), Gaps = 16/191 (8%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             ++T+SNF + L  +   I E+DF+A+  + +G    P    L   FDT E  Y K K+ +
Sbjct  2     EITRSNFKDTLPKVYKAIEEADFLAIDGEFSGISDGPSVSTLTNGFDTPEERYTKLKKHS  61

Query  1646  ERYQILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F+    E+K +   +NF++FP+       P   F CQSS +  +A +G
Sbjct  62    MEFLLFQFGLCTFNYDNTEAKYLMKSFNFYIFPK-PFNRNSPDKKFVCQSSSIDFLANQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKDCI---RSPSAGSCTVP--SPASRSVADSI------F  1326
             FDFN    +GI YL++ +E   +D     RS S G+ T+   SP S     SI      F
Sbjct  121   FDFNKVFRNGIPYLNQEEERVLRDQYEDRRSQSNGASTMSYISPNSSKTPVSIPDEQKGF  180

Query  1325  INRIKSRVKHW  1293
             I+++  RV+ +
Sbjct  181   IDKVVERVEDF  191



>ref|NP_001081143.1| poly(A)-specific ribonuclease PARN [Xenopus laevis]
 gb|AAH68919.1| Parn-A protein [Xenopus laevis]
Length=631

 Score = 95.5 bits (236),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 99/191 (52%), Gaps = 16/191 (8%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             ++T+SNF + L  +   I E+DF+A+  + +G    P    L   FDT E  Y K K+ +
Sbjct  2     EITRSNFKDTLPKVYKAIEEADFLAIDGEFSGISDGPSVSTLTNGFDTPEERYTKLKKHS  61

Query  1646  ERYQILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F+    E+K +   +NF++FP+       P   F CQSS +  +A +G
Sbjct  62    MEFLLFQFGLCTFNYDNTEAKYLMKSFNFYIFPK-PFNRNSPDKKFVCQSSSIDFLANQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKDCI---RSPSAGSCTVP--SPASRSVADSI------F  1326
             FDFN    +GI YL++ +E   +D     RS S G+ T+   SP S     SI      F
Sbjct  121   FDFNKVFRNGIPYLNQEEERVLRDQYEDRRSQSNGASTMSYISPNSSKTPVSIPDEQKGF  180

Query  1325  INRIKSRVKHW  1293
             I+++  RV+ +
Sbjct  181   IDKVVERVEDF  191



>ref|XP_004348604.1| ribonuclease, putative [Acanthamoeba castellanii str. Neff]
 gb|ELR22146.1| ribonuclease, putative [Acanthamoeba castellanii str. Neff]
Length=546

 Score = 94.7 bits (234),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 69/226 (31%), Positives = 108/226 (48%), Gaps = 21/226 (9%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAER  1641
             +VTKSNF+  L D++  I  SDF++  L+ TG     +    P D  E  Y K K  +  
Sbjct  2     EVTKSNFAAVLPDVKEAIAASDFLSFDLEFTGLTLGGYLDNHPVDLLEERYKKLKENSSA  61

Query  1640  YQILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGFD  1467
             + I QF +  F+    E+K +A  +NF+LFPR     G     F+CQ++ L  +    FD
Sbjct  62    FTITQFGLSAFTWDATENKYVARTWNFYLFPR---PYGWCDRRFTCQAASLQFLLEHKFD  118

Query  1466  FNACINDGISYLSRAQELAAKDCIRSP------SAGSCTVPSPASRSVADSIFINRIKSR  1305
             FN  I +G+ YLSR  E   +  +         +A    +P     +  D  F+  IK+ 
Sbjct  119   FNKFIYEGVGYLSRYVEGKMRPQVEEEIQKLLDAASQEALPDIVPTNPRDVEFVAGIKAS  178

Query  1304  VKHWRNACTDQSKKTEDVLI----SSLRKMISATEVHGSRPCLNID  1179
             +  W      Q   +E +L+    S LR+++   EV G+ P LN++
Sbjct  179   IDGWL-----QGDGSEPLLLIAPNSFLRRLVY-QEVRGNYPELNVE  218


 Score = 55.8 bits (133),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 45/82 (55%), Gaps = 6/82 (7%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR+V + +S S+KPVV HN L D    +  F   LPS+   F+ ++ +VFP I D KH+
Sbjct  257   GFRQVWEAMSASRKPVVGHNLLLDLLYSYFHFEDRLPSSFRNFKVAINKVFPTIFDTKHI  316

Query  846   MKELGSQKN------LNNIYVA  799
                  + K+      L ++Y A
Sbjct  317   AATDPAYKDRLLSTGLGDVYAA  338



>ref|XP_010792702.1| PREDICTED: poly(A)-specific ribonuclease PARN [Notothenia coriiceps]
Length=368

 Score = 91.7 bits (226),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 96/189 (51%), Gaps = 16/189 (8%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             +VT+ NF ++L  + + I E+DF+A+  + +G    P    L    DT E  Y K K+ +
Sbjct  2     EVTRQNFKDSLKTVYSAIEEADFLAIDGEFSGISDGPNVSALTNGLDTPEERYTKLKKHS  61

Query  1646  ERYQILQFAVCPFSLRE--SKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F+  +  SK I  P+NF++FP+   +T  P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGICTFTYDQAKSKYIIKPFNFYVFPKPFNRTS-PDLKFICQSSSIDFLASQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKD-----------CIRSPSAGSCTVPSPASRSVADSIF  1326
             FDFN     GI YL++ +E   ++            I + S  S +   PA        +
Sbjct  121   FDFNKVFCHGIPYLNKEEEAQLREQTEERRNQQANGINNQSFTSPSSKGPAHVPQEHKDY  180

Query  1325  INRIKSRVK  1299
             INR+ ++V+
Sbjct  181   INRVIAKVE  189



>gb|KGL77093.1| Poly(A)-specific ribonuclease PARN, partial [Tinamus guttatus]
Length=622

 Score = 93.2 bits (230),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 94/195 (48%), Gaps = 24/195 (12%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             +VT+SNF + LN +   I E+DF+A+  + +G    P    L   FDT E  Y K K+ +
Sbjct  2     EVTRSNFKDNLNKVYEAIEEADFLAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHS  61

Query  1646  ERYQILQFAVCPFSL--RESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F     E K I   +NF++FP+       P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDHEEEKYIMKSFNFYIFPK-PFNRSSPDVKFVCQSSSIDFLANQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKDCIR---------------SPSAGSCTVPSPASRSVA  1338
             FDFN    +GI YL++ +E   ++                  SP+A  C V  P  +   
Sbjct  121   FDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYISPNATKCPVTVPEDQKK-  179

Query  1337  DSIFINRIKSRVKHW  1293
                FI++I  +++ +
Sbjct  180   ---FIDKIVEQIEDF  191



>ref|XP_010212713.1| PREDICTED: poly(A)-specific ribonuclease PARN [Tinamus guttatus]
Length=638

 Score = 93.2 bits (230),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 94/195 (48%), Gaps = 24/195 (12%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             +VT+SNF + LN +   I E+DF+A+  + +G    P    L   FDT E  Y K K+ +
Sbjct  2     EVTRSNFKDNLNKVYEAIEEADFLAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHS  61

Query  1646  ERYQILQFAVCPFSL--RESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F     E K I   +NF++FP+       P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDHEEEKYIMKSFNFYIFPK-PFNRSSPDVKFVCQSSSIDFLANQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKDCIR---------------SPSAGSCTVPSPASRSVA  1338
             FDFN    +GI YL++ +E   ++                  SP+A  C V  P  +   
Sbjct  121   FDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYISPNATKCPVTVPEDQKK-  179

Query  1337  DSIFINRIKSRVKHW  1293
                FI++I  +++ +
Sbjct  180   ---FIDKIVEQIEDF  191



>ref|XP_006257909.1| PREDICTED: poly(A)-specific ribonuclease PARN [Alligator mississippiensis]
Length=638

 Score = 92.4 bits (228),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 60/207 (29%), Positives = 97/207 (47%), Gaps = 24/207 (12%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             +V +SNF + LN +   + E+DF+A+  + +G    P    L   FDT E  Y K K+ +
Sbjct  2     EVIRSNFKDTLNKVYDAVEEADFLAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHS  61

Query  1646  ERYQILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F     E K I   +NF++FP+       P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDHTEEKYIMKSFNFYIFPK-PFNRSSPDVKFVCQSSSIDFLANQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKDCIR---------------SPSAGSCTVPSPASRSVA  1338
             FDFN    +GI YL++ +E   ++                  SP+A  C V  P  +   
Sbjct  121   FDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGASSLSYISPNATKCPVTIPEDQKK-  179

Query  1337  DSIFINRIKSRVKHWRNACTDQSKKTE  1257
                FI R+  R++ +     ++S + E
Sbjct  180   ---FIERVVERIEDFLKKEENESLELE  203



>ref|XP_005150742.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Melopsittacus 
undulatus]
Length=638

 Score = 92.4 bits (228),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 86/164 (52%), Gaps = 10/164 (6%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             +VT+SNF + LN +   I ESDF+A+  + +G    P    L   FDT E  Y K K+ +
Sbjct  2     EVTRSNFKDNLNKVYEAIEESDFLAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHS  61

Query  1646  ERYQILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F     E K I   +NF++FP+       P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDHTEEKYIMKSFNFYIFPK-PFNRSSPDVKFVCQSSSIDFLANQG  120

Query  1472  FDFNACINDGISYLSRAQELAAK---DCIRSPS--AGSCTVPSP  1356
             FDFN    +GI YL++ +E   +   D  RS +  AGS +  SP
Sbjct  121   FDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGSLSYISP  164



>gb|EPZ32187.1| Ribonuclease CAF1 domain-containing protein, partial [Rozella 
allomycis CSF55]
Length=470

 Score = 91.3 bits (225),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 79/136 (58%), Gaps = 6/136 (4%)
 Frame = -2

Query  1817  VTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAERY  1638
             VT+SNF + +  I   I +S F+++  + TG  +S       FD+ +  Y K K +A  +
Sbjct  3     VTRSNFKQTIPLILDAIDKSAFLSIDTELTGLQTSKNMSYRVFDSLQQRYSKFKDSASNF  62

Query  1637  QILQFAVCPFSLRES-KLIASPYNFHLFPR--DELKTGMPSYSFSCQSSYLISIAREGFD  1467
             QILQ+ +C F L++  KL+A P+NF+LFPR  + LKT +    FSCQS  +  +    FD
Sbjct  63    QILQYGICTFELQDDKKLLAKPFNFYLFPRSNELLKTDLV---FSCQSGSIDFLVNHNFD  119

Query  1466  FNACINDGISYLSRAQ  1419
             FN    DGI ++S+ +
Sbjct  120   FNKTFYDGIPFMSQEE  135



>ref|XP_009090176.1| PREDICTED: poly(A)-specific ribonuclease PARN [Serinus canaria]
Length=638

 Score = 92.0 bits (227),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 86/165 (52%), Gaps = 10/165 (6%)
 Frame = -2

Query  1817  VTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAAE  1644
             +TK+NF + LN +   I ESDF+A+  + +G    P    L   FDT E  Y K K+ + 
Sbjct  3     ITKANFKDNLNKVYEAIEESDFLAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSM  62

Query  1643  RYQILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGF  1470
              + + QF +C F     E K I   +NF++FP+       P   F CQSS +  +A +GF
Sbjct  63    DFLLFQFGLCTFKYDDTEEKYIMKSFNFYIFPK-PFNRNSPDVKFVCQSSSIDFLANQGF  121

Query  1469  DFNACINDGISYLSRAQELAAK---DCIRSPS--AGSCTVPSPAS  1350
             DFN    +GI YL++ +E   +   D  RS +  AGS +  SP S
Sbjct  122   DFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGSLSYISPNS  166



>dbj|BAG91080.1| unnamed protein product [Oryza sativa Japonica Group]
Length=502

 Score = 91.3 bits (225),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 85/307 (28%), Positives = 137/307 (45%), Gaps = 42/307 (14%)
 Frame = -1

Query  1038  KCVRGFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILD  859
             K   G R V+DL++  +K +V H+   D   I+SKF+ PLPS+++EF  S+ R+FPH+ D
Sbjct  112   KSAVGIRHVIDLLASERKLIVGHSCFLDIAQIYSKFVGPLPSSMEEFALSINRMFPHMAD  171

Query  858   VKHLMK-----ELGSQKNLNNIYVATSYLNSRFFAPVD--VELPHQAISTKADSV-----  715
              +HLM      +   +    ++  A S L     AP +    LP   I  +AD       
Sbjct  172   TRHLMSVNDAVQYRMRHKSKSLSSAFSLLCPALHAPDEKSSTLPSVRIEVEADETVLSCF  231

Query  714   -----KSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDPCSTSY  550
                     G++      +F ++C+   +  +    +E        L+++ N+  PC  S 
Sbjct  232   TSGAKHEAGYDAFMTGCVFVQLCAYHGIKFEQLSPLEDLAT-NINLKKHINLLPPCWNSG  290

Query  549   QDPPINEEDVRVRAKSCKRVSS---KNVVFLWGFQSGISTGQVKSL---VYGKHEVFSSE  388
                 ++    R  A   +R  +    NV+ +WGFQS +    +K     V+G+  V +S 
Sbjct  291   TVLDLSTGTERPDAGYKRRYPAAVYDNVILIWGFQSKVRPKDIKDCICKVFGRASV-TSV  349

Query  387   FDIRLVDESCAVLVFSSPGLS-------EVLLEALDSG-----SLEEMVSEG-IRAASYD  247
             F I    +S AVLV  S   S       +  LE+ DS       L  ++  G  RAA YD
Sbjct  350   FPI----DSTAVLVQFSKQESVNDFLDLKATLESADSAISVLHPLSTILEGGKTRAAKYD  405

Query  246   AYVKVCK  226
              Y  +C+
Sbjct  406   TYRDICR  412



>ref|XP_008292118.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X1 
[Stegastes partitus]
Length=682

 Score = 92.0 bits (227),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 64/206 (31%), Positives = 103/206 (50%), Gaps = 21/206 (10%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             +VT+ N+ ++L+ + + I E+DF+A+  + +G    P    L    DT E  Y K K+ +
Sbjct  2     EVTRRNYKDSLSTVYSAIEEADFLAIDGEFSGISDGPNVSALTNGLDTPEERYTKLKKHS  61

Query  1646  ERYQILQFAVCPFSLRE--SKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F   +  SK I  P+NF++FP+   +T  P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDQTKSKYITKPFNFYIFPKPFNRTS-PDIKFICQSSSIDFLASQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKDCI---RSPSAGSCTVPS---------PASRSVADSI  1329
             FDFN    +GI YL++ +E   ++     R+  A     PS         PA        
Sbjct  121   FDFNKVFCNGIPYLNQEEEAQLREQTEERRNQHANGVGTPSYISPSSSKGPAHVPEEHKD  180

Query  1328  FINRIKSRVKHWRNACTDQSKKTEDV  1251
             FINR+  +V+    A    S+KT D+
Sbjct  181   FINRVVEKVE----ALFSNSEKTLDL  202



>ref|XP_003972409.1| PREDICTED: LOW QUALITY PROTEIN: poly(A)-specific ribonuclease 
PARN-like [Takifugu rubripes]
Length=559

 Score = 91.7 bits (226),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 94/189 (50%), Gaps = 16/189 (8%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             ++T+ NF E LN + + I E+DF+A+  + +G    P    L    DT E  Y K K+ +
Sbjct  2     ELTRRNFKECLNTVYSAIEEADFLAIDGEFSGISDGPNVSALTNGLDTPEERYTKLKKHS  61

Query  1646  ERYQILQFAVCPFSLRE--SKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F   +  SK I  P+NF++FP+   +T  P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDQTKSKYIIKPFNFYVFPKPFNRTS-PDKKFICQSSSIDFLASQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKDCI--RSPSAGSCTVPS---------PASRSVADSIF  1326
             FDFN    +GI YL++ +E   ++    R   A     PS         PA        F
Sbjct  121   FDFNKVFCNGIPYLNQEEEAQLREQTEERRSQANGVGTPSYISPSSSKGPAHVPEEHKEF  180

Query  1325  INRIKSRVK  1299
             IN++  +V+
Sbjct  181   INKVIEKVE  189



>ref|XP_008292120.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X2 
[Stegastes partitus]
Length=681

 Score = 92.0 bits (227),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 64/206 (31%), Positives = 103/206 (50%), Gaps = 21/206 (10%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             +VT+ N+ ++L+ + + I E+DF+A+  + +G    P    L    DT E  Y K K+ +
Sbjct  2     EVTRRNYKDSLSTVYSAIEEADFLAIDGEFSGISDGPNVSALTNGLDTPEERYTKLKKHS  61

Query  1646  ERYQILQFAVCPFSLRE--SKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F   +  SK I  P+NF++FP+   +T  P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDQTKSKYITKPFNFYIFPKPFNRTS-PDIKFICQSSSIDFLASQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKDCI---RSPSAGSCTVPS---------PASRSVADSI  1329
             FDFN    +GI YL++ +E   ++     R+  A     PS         PA        
Sbjct  121   FDFNKVFCNGIPYLNQEEEAQLREQTEERRNQHANGVGTPSYISPSSSKGPAHVPEEHKD  180

Query  1328  FINRIKSRVKHWRNACTDQSKKTEDV  1251
             FINR+  +V+    A    S+KT D+
Sbjct  181   FINRVVEKVE----ALFSNSEKTLDL  202



>ref|XP_008436164.1| PREDICTED: poly(A)-specific ribonuclease PARN [Poecilia reticulata]
Length=683

 Score = 91.7 bits (226),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 98/195 (50%), Gaps = 17/195 (9%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             +VT+ NF + L+ + + I E+DF+A+  + +G    P    L    DT E  Y K K+ +
Sbjct  2     EVTRQNFKDCLSTVYSAIEEADFLAIDGEFSGISDGPNVSALTNGLDTPEERYTKLKKHS  61

Query  1646  ERYQILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F     +SK I  P+NF++FP+   +T  P   F CQSS +  +A +G
Sbjct  62    MDFLMFQFGLCTFRYDSAKSKYITKPFNFYVFPKPFSRTS-PDIKFICQSSSIDFLASQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKDCI---RSPSAGSCTVP---SPASRSVADSI------  1329
             FDFN     GI YL++ +E   ++     R+  A     P   SP+S  V   +      
Sbjct  121   FDFNKVFGHGIPYLNQDEEAQLREQTEERRNQHANGLGTPSFISPSSSKVPAHVPDEQKD  180

Query  1328  FINRIKSRVKHWRNA  1284
             FIN++  +V+   N 
Sbjct  181   FINKVVEKVERLFNG  195



>ref|XP_007549755.1| PREDICTED: poly(A)-specific ribonuclease PARN [Poecilia formosa]
Length=683

 Score = 91.7 bits (226),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 98/195 (50%), Gaps = 17/195 (9%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             +VT+ NF + L+ + + I E+DF+A+  + +G    P    L    DT E  Y K K+ +
Sbjct  2     EVTRQNFKDCLSTVYSAIEEADFLAIDGEFSGISDGPNVSALTNGLDTPEERYTKLKKHS  61

Query  1646  ERYQILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F     +SK I  P+NF++FP+   +T  P   F CQSS +  +A +G
Sbjct  62    MDFLMFQFGLCTFRYDSAKSKYITKPFNFYVFPKPFSRTS-PDIKFICQSSSIDFLASQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKDCI---RSPSAGSCTVP---SPASRSVADSI------  1329
             FDFN     GI YL++ +E   ++     R+  A     P   SP+S  V   +      
Sbjct  121   FDFNKVFGHGIPYLNQDEEAQLREQTEERRNQHANGLGTPSFISPSSSKVPAHVPDEQKD  180

Query  1328  FINRIKSRVKHWRNA  1284
             FIN++  +V+   N 
Sbjct  181   FINKVVEKVERLFNG  195



>ref|XP_002197536.1| PREDICTED: poly(A)-specific ribonuclease PARN [Taeniopygia guttata]
Length=638

 Score = 91.3 bits (225),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 87/166 (52%), Gaps = 10/166 (6%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             +V +SNF + LN +   I ESDF+A+  + +G    P    L   FDT E  Y K K+ +
Sbjct  2     EVIRSNFKDNLNKVYEAIEESDFLAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHS  61

Query  1646  ERYQILQFAVCPFSLRES--KLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F   E+  K I   +NF++FP+       P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDETEEKYIMKSFNFYIFPKP-FNRNSPDVKFVCQSSSIDFLANQG  120

Query  1472  FDFNACINDGISYLSRAQELAAK---DCIRSPS--AGSCTVPSPAS  1350
             FDFN    +GI YL++ +E   +   D  RS +  AGS +  SP S
Sbjct  121   FDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGSLSYISPNS  166



>gb|AAI69159.1| Unknown (protein for IMAGE:8898488) [Xenopus (Silurana) tropicalis]
Length=525

 Score = 90.9 bits (224),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 97/191 (51%), Gaps = 16/191 (8%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             ++T+SNF + L  +   I E+DF+A+  + +G    P    L   FDT E  Y K K+ +
Sbjct  2     EMTRSNFKDNLPKVYKAIEEADFLAIDGEFSGISDGPSVSTLTNGFDTPEERYTKLKKHS  61

Query  1646  ERYQILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F+    E+K     +NF++FP+       P   F CQSS +  +A +G
Sbjct  62    MEFLLFQFGLCTFNYDNTEAKYFMKSFNFYIFPK-PFNRNSPDKKFVCQSSSIDFLANQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKDCI---RSPSAGSCTVP--SPASRSVADSI------F  1326
             FDFN    +GI YL++ +E   +D     RS S G+  +   SP +     SI      F
Sbjct  121   FDFNKVFRNGIPYLNQEEEKQLRDQYEERRSQSNGASAMSYVSPNASKTPVSIPDEQKGF  180

Query  1325  INRIKSRVKHW  1293
             I+++  RV+ +
Sbjct  181   IDKVVERVEDF  191



>ref|XP_006134193.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Pelodiscus 
sinensis]
Length=638

 Score = 91.3 bits (225),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 97/189 (51%), Gaps = 16/189 (8%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             ++ +SNF + LN +   I E+DF+A+  + +G    P    L   FDT E  Y K K+ +
Sbjct  2     EIVRSNFKDNLNKVYEAIEEADFLAIDGEFSGISDGPSVSTLTNGFDTPEERYQKLKKHS  61

Query  1646  ERYQILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F     E+K I   +NF++FP+       P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCSFKYNHTEAKYIMKSFNFYIFPKP-FNRSSPDVKFVCQSSSIDFLANQG  120

Query  1472  FDFNACINDGISYLSRAQELAAK---DCIRSPSAGSCTVP--SPASRSVADSI------F  1326
             FDFN    +GI YL++ +E   +   D  RS S G+ T+   SP +     +I      F
Sbjct  121   FDFNKVFRNGIPYLNQEEERQLREQYDEKRSQSNGAGTLSYISPNATKCPVTIPEDQKKF  180

Query  1325  INRIKSRVK  1299
             I+R+  +++
Sbjct  181   IDRVVEQIE  189



>ref|XP_002606119.1| hypothetical protein BRAFLDRAFT_125118 [Branchiostoma floridae]
 gb|EEN62129.1| hypothetical protein BRAFLDRAFT_125118 [Branchiostoma floridae]
Length=490

 Score = 90.5 bits (223),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 78/149 (52%), Gaps = 5/149 (3%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAER  1641
             ++T+ NF + ++ +   + E+ F+ +  + TG  + P   L  FDT +  Y K ++ +  
Sbjct  2     EITRHNFKQVIDQVSEAVDEASFLCIDGEFTGLNNGP--ALHGFDTPQERYDKLRKGSLD  59

Query  1640  YQILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGFD  1467
             +  +QF +C F     ES+ +A P+NF++FPR  L    P   F CQ+S L  +A +G D
Sbjct  60    FLFVQFGLCAFKYETEESRFVARPFNFYIFPR-PLNRNAPDCRFLCQASSLHFLASQGMD  118

Query  1466  FNACINDGISYLSRAQELAAKDCIRSPSA  1380
             FN    DGI YLS   E   +D +    A
Sbjct  119   FNKVFRDGIPYLSPVDEQQMRDTLDQKHA  147



>ref|XP_003228705.2| PREDICTED: poly(A)-specific ribonuclease PARN [Anolis carolinensis]
Length=897

 Score = 91.7 bits (226),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 76/135 (56%), Gaps = 5/135 (4%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             +VT+SNF + LN +   I E+DF+A+  + +G    P    L   FDT E  Y K K+ +
Sbjct  2     EVTRSNFKDNLNKVYAAIEEADFLAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHS  61

Query  1646  ERYQILQFAVCPF--SLRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F   L ESK I   +NF++FP+   +T  P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDLAESKYIMKSFNFYIFPKPFNRTS-PDVKFVCQSSSIDFLANQG  120

Query  1472  FDFNACINDGISYLS  1428
             FDFN    +GI YL+
Sbjct  121   FDFNKVFRNGIPYLN  135



>emb|CAL49352.1| poly(A)-specific ribonuclease (deadenylation nuclease) [Xenopus 
(Silurana) tropicalis]
Length=519

 Score = 90.5 bits (223),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 97/191 (51%), Gaps = 16/191 (8%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             ++T+SNF + L  +   I E+DF+A+  + +G    P    L   FDT E  Y K K+ +
Sbjct  2     EMTRSNFKDNLPKVYKAIEEADFLAIDGEFSGISDGPSVSTLTNGFDTPEERYTKLKKHS  61

Query  1646  ERYQILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F+    E+K     +NF++FP+       P   F CQSS +  +A +G
Sbjct  62    MEFLLFQFGLCTFNYDNTEAKYFMKSFNFYIFPK-PFNRNSPDKKFVCQSSSIDFLANQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKDCI---RSPSAGSCTVP--SPASRSVADSI------F  1326
             FDFN    +GI YL++ +E   +D     RS S G+  +   SP +     SI      F
Sbjct  121   FDFNKVFRNGIPYLNQEEEKQLRDQYEERRSQSNGASAMSYVSPNASKTPVSIPDEQKGF  180

Query  1325  INRIKSRVKHW  1293
             I+++  RV+ +
Sbjct  181   IDKVVERVEDF  191



>ref|XP_009475558.1| PREDICTED: poly(A)-specific ribonuclease PARN [Nipponia nippon]
Length=638

 Score = 90.9 bits (224),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 85/163 (52%), Gaps = 10/163 (6%)
 Frame = -2

Query  1817  VTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAAE  1644
             +TK+NF + LN +   I ESDF+A+  + +G    P    L   FDT E  Y K K+ + 
Sbjct  3     ITKANFKDNLNKVYEAIEESDFLAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSM  62

Query  1643  RYQILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGF  1470
              + + QF +C F     E K I   +NF++FP+       P   F CQSS +  +A +GF
Sbjct  63    DFLLFQFGLCTFKYDHTEEKYIMKSFNFYIFPKP-FNRSSPDVKFVCQSSSIDFLANQGF  121

Query  1469  DFNACINDGISYLSRAQELAAK---DCIRSPS--AGSCTVPSP  1356
             DFN    +GI YL++ +E   +   D  RS +  AGS +  SP
Sbjct  122   DFNKVFRNGIPYLNQEEEKQLREQYDEKRSQANGAGSLSYISP  164



>ref|XP_005420477.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Geospiza 
fortis]
Length=638

 Score = 90.9 bits (224),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 86/166 (52%), Gaps = 10/166 (6%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             +V +SNF + LN +   I ESDF+A+  + +G    P    L   FDT E  Y K K+ +
Sbjct  2     EVIRSNFKDNLNKVYEAIEESDFLAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHS  61

Query  1646  ERYQILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F     E K I   +NF++FP+       P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDDTEEKYIMKSFNFYIFPKP-FNRNSPDVKFVCQSSSIDFLANQG  120

Query  1472  FDFNACINDGISYLSRAQELAAK---DCIRSPS--AGSCTVPSPAS  1350
             FDFN    +GI YL++ +E   +   D  RS +  AGS +  SP S
Sbjct  121   FDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGSLSYISPNS  166



>ref|XP_009637874.1| PREDICTED: poly(A)-specific ribonuclease PARN [Egretta garzetta]
Length=638

 Score = 90.9 bits (224),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 85/163 (52%), Gaps = 10/163 (6%)
 Frame = -2

Query  1817  VTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAAE  1644
             +TK+NF + LN +   I ESDF+A+  + +G    P    L   FDT E  Y K K+ + 
Sbjct  3     ITKANFKDNLNKVYEAIEESDFLAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSM  62

Query  1643  RYQILQFAVCPF--SLRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGF  1470
              + + QF +C F     E K I   +NF++FP+       P   F CQSS +  +A +GF
Sbjct  63    DFLLFQFGLCTFKYDYTEEKYIMKSFNFYIFPKP-FNRSSPDVKFVCQSSSIDFLANQGF  121

Query  1469  DFNACINDGISYLSRAQELAAK---DCIRSPS--AGSCTVPSP  1356
             DFN    +GI YL++ +E   +   D  RS +  AGS +  SP
Sbjct  122   DFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGSLSYISP  164



>gb|EEC77442.1| hypothetical protein OsI_16244 [Oryza sativa Indica Group]
Length=931

 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 85/307 (28%), Positives = 137/307 (45%), Gaps = 42/307 (14%)
 Frame = -1

Query  1038  KCVRGFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILD  859
             K   G R V+DL++  +K +V H+   D   I+SKF+ PLPS+++EF  S+ R+FPH+ D
Sbjct  541   KSAVGIRHVIDLLASERKLIVGHSCFLDIAQIYSKFVGPLPSSMEEFALSINRMFPHMAD  600

Query  858   VKHLMK-----ELGSQKNLNNIYVATSYLNSRFFAPVD--VELPHQAISTKADSV-----  715
              +HLM      +   +    ++  A S L     AP +    LP   I  +AD       
Sbjct  601   TRHLMSVNDAVQYRMRHKSKSLSSAFSLLCPALHAPDEKSSTLPSVRIEVEADETVLSCF  660

Query  714   -----KSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDPCSTSY  550
                     G++      +F ++C+   +  +    +E        L+++ N+  PC  S 
Sbjct  661   TSGAKHEAGYDAFMTGCVFVQLCAYHGIKFEQLSPLEDLAT-NINLKKHINLLPPCWNSG  719

Query  549   QDPPINEEDVRVRAKSCKRVSS---KNVVFLWGFQSGISTGQVKSL---VYGKHEVFSSE  388
                 ++    R  A   +R  +    NV+ +WGFQS +    +K     V+G+  V +S 
Sbjct  720   TVLDLSTGTERPDAGYKRRYPAAVYDNVILIWGFQSKVRPKDIKDCICKVFGRASV-TSV  778

Query  387   FDIRLVDESCAVLVFSSPGLS-------EVLLEALDSG-----SLEEMVSEG-IRAASYD  247
             F I    +S AVLV  S   S       +  LE+ DS       L  ++  G  RAA YD
Sbjct  779   FPI----DSTAVLVQFSKQESVNDFLDLKATLESADSAISVLHPLSTILEGGKTRAAKYD  834

Query  246   AYVKVCK  226
              Y  +C+
Sbjct  835   TYRDICR  841



>gb|EEE61153.1| hypothetical protein OsJ_15114 [Oryza sativa Japonica Group]
Length=893

 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 85/307 (28%), Positives = 137/307 (45%), Gaps = 42/307 (14%)
 Frame = -1

Query  1038  KCVRGFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILD  859
             K   G R V+DL++  +K +V H+   D   I+SKF+ PLPS+++EF  S+ R+FPH+ D
Sbjct  503   KSAVGIRHVIDLLASERKLIVGHSCFLDIAQIYSKFVGPLPSSMEEFALSINRMFPHMAD  562

Query  858   VKHLMK-----ELGSQKNLNNIYVATSYLNSRFFAPVD--VELPHQAISTKADSV-----  715
              +HLM      +   +    ++  A S L     AP +    LP   I  +AD       
Sbjct  563   TRHLMSVNDAVQYRMRHKSKSLSSAFSLLCPALHAPDEKSSTLPSVRIEVEADETVLSCF  622

Query  714   -----KSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDPCSTSY  550
                     G++      +F ++C+   +  +    +E        L+++ N+  PC  S 
Sbjct  623   TSGAKHEAGYDAFMTGCVFVQLCAYHGIKFEQLSPLEDLAT-NINLKKHINLLPPCWNSG  681

Query  549   QDPPINEEDVRVRAKSCKRVSS---KNVVFLWGFQSGISTGQVKSL---VYGKHEVFSSE  388
                 ++    R  A   +R  +    NV+ +WGFQS +    +K     V+G+  V +S 
Sbjct  682   TVLDLSTGTERPDAGYKRRYPAAVYDNVILIWGFQSKVRPKDIKDCICKVFGRASV-TSV  740

Query  387   FDIRLVDESCAVLVFSSPGLS-------EVLLEALDSG-----SLEEMVSEG-IRAASYD  247
             F I    +S AVLV  S   S       +  LE+ DS       L  ++  G  RAA YD
Sbjct  741   FPI----DSTAVLVQFSKQESVNDFLDLKATLESADSAISVLHPLSTILEGGKTRAAKYD  796

Query  246   AYVKVCK  226
              Y  +C+
Sbjct  797   TYRDICR  803



>emb|CAF98128.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=614

 Score = 90.5 bits (223),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 92/186 (49%), Gaps = 17/186 (9%)
 Frame = -2

Query  1808  SNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAAERYQ  1635
             ++F E LN + + I E+DF+A+  + +G    P    L    DT E  Y K K+ +  + 
Sbjct  1     TDFKECLNTVYSAIEEADFLAIDGEFSGISDGPNVSALTNGLDTPEERYTKLKKHSMDFL  60

Query  1634  ILQFAVCPFSLRE--SKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGFDFN  1461
             + QF VC F   +  SK I  P+NF++FP+   +T  P   F CQSS +  +A +GFDFN
Sbjct  61    LFQFGVCTFKYDQTKSKYIIKPFNFYIFPKPFNRTS-PDKKFICQSSSIDFLASQGFDFN  119

Query  1460  ACINDGISYLSRAQELAAKDCI---RSPSAGSCTVPS---------PASRSVADSIFINR  1317
                 +GI YL++ +E   ++     R+  A     PS         PA        FIN+
Sbjct  120   KVFCNGIPYLNQEEEAQLREQTEERRNQHANGVGTPSYISPSSSKGPAHVPDEHKDFINK  179

Query  1316  IKSRVK  1299
             +  RV+
Sbjct  180   VIERVE  185



>ref|XP_005054114.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Ficedula 
albicollis]
Length=638

 Score = 90.5 bits (223),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 86/166 (52%), Gaps = 10/166 (6%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             +V +SNF + LN +   I ESDF+A+  + +G    P    L   FDT E  Y K K+ +
Sbjct  2     EVIRSNFKDNLNKVYEAIEESDFLAIDGEFSGISDGPSVSELTNGFDTPEERYQKLKKHS  61

Query  1646  ERYQILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F     E K I   +NF++FP+       P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDDTEEKYIMKSFNFYIFPK-PFNRNSPDVKFVCQSSSIDFLANQG  120

Query  1472  FDFNACINDGISYLSRAQELAAK---DCIRSPS--AGSCTVPSPAS  1350
             FDFN    +GI YL++ +E   +   D  RS +  AGS +  SP S
Sbjct  121   FDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGSLSYISPNS  166



>ref|NP_001184102.1| poly(A)-specific ribonuclease (deadenylation nuclease) [Xenopus 
(Silurana) tropicalis]
Length=632

 Score = 90.5 bits (223),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 97/191 (51%), Gaps = 16/191 (8%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             ++T+SNF + L  +   I E+DF+A+  + +G    P    L   FDT E  Y K K+ +
Sbjct  2     EMTRSNFKDNLPKVYKAIEEADFLAIDGEFSGISDGPSVSTLTNGFDTPEERYTKLKKHS  61

Query  1646  ERYQILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F+    E+K     +NF++FP+       P   F CQSS +  +A +G
Sbjct  62    MEFLLFQFGLCTFNYDNTEAKYFMKSFNFYIFPK-PFNRNSPDKKFVCQSSSIDFLANQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKDCI---RSPSAGSCTVP--SPASRSVADSI------F  1326
             FDFN    +GI YL++ +E   +D     RS S G+  +   SP +     SI      F
Sbjct  121   FDFNKVFRNGIPYLNQEEEKQLRDQYEERRSQSNGASAMSYVSPNASKTPVSIPDEQKGF  180

Query  1325  INRIKSRVKHW  1293
             I+++  RV+ +
Sbjct  181   IDKVVERVEDF  191



>ref|XP_005813387.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Xiphophorus 
maculatus]
Length=682

 Score = 90.5 bits (223),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 98/195 (50%), Gaps = 17/195 (9%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             +VT+ NF + L+ + + I E+DF+A+  + +G    P    L    DT E  Y K K+ +
Sbjct  2     EVTRQNFKDCLSTVYSAIEEADFLAIDGEFSGISDGPNVSALTNGLDTPEERYTKLKKHS  61

Query  1646  ERYQILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F     +SK I  P+NF++FP+   +T  P   F CQSS +  +A +G
Sbjct  62    MDFLMFQFGLCTFRYDSSKSKYITKPFNFYVFPKPFSRTS-PDIKFICQSSSIDFLASQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKDCI---RSPSAGSCTVP---SPASRSVADSI------  1329
             FDFN     GI YL++ +E   ++     R+  A     P   SP+S  V   +      
Sbjct  121   FDFNKVFGHGIPYLNQDEEAQLREQTEERRNQHANGLGTPSFISPSSSKVPAHVPDEQKD  180

Query  1328  FINRIKSRVKHWRNA  1284
             +IN++  +V+   N 
Sbjct  181   YINKVVEKVERLFNG  195



>gb|EXX68717.1| hypothetical protein RirG_102580 [Rhizophagus irregularis DAOM 
197198w]
Length=296

 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/218 (27%), Positives = 100/218 (46%), Gaps = 14/218 (6%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAER  1641
             ++ K+NF E    ++  I  +DFIA+  + TG   S  +R+  FD  +  Y K + AA +
Sbjct  2     EIIKNNFHELFPIVQEAIEGADFIAIDTELTGLNES-IERIKTFDDPQSRYTKVRIAATK  60

Query  1640  YQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGFD  1467
             + I+QF +C F+  E++   IA P+NF++FP +  +       F C  S L  ++  GFD
Sbjct  61    FLIIQFGICTFTYSEAENTFIARPFNFYIFPANSDRKDYHDICFMCSGSSLHFLSNCGFD  120

Query  1466  FNACINDGISYLSRAQELAAKDCIRSPSAGSCTVPSPASRSVADSIFINRIKSRVKHWRN  1287
             FN  I  GI +L++  E+  K   R        + +P         F+ +  S +  W  
Sbjct  121   FNKLIAQGIPFLNKTDEI--KLIQRRADIAQRQIDNPLDNET--KAFVEKTMSTIDKWLC  176

Query  1286  ACTDQ-------SKKTEDVLISSLRKMISATEVHGSRP  1194
                ++       S K + ++    R+  S      SRP
Sbjct  177   DTNEENLTVETPSMKQKRLVFQEYRQRFSGLASAESRP  214



>ref|XP_005522951.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Pseudopodoces 
humilis]
Length=638

 Score = 90.1 bits (222),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 96/189 (51%), Gaps = 16/189 (8%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             +V +SNF + LN +   I ESDF+A+  + +G    P    L   FDT E  Y K K+ +
Sbjct  2     EVIRSNFKDNLNKVYEAIEESDFLAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHS  61

Query  1646  ERYQILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F     E + I   +NF++FP+       P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDDTEERYIMKSFNFYIFPK-PFNRNSPDVKFVCQSSSIDFLANQG  120

Query  1472  FDFNACINDGISYLSRAQELAAK---DCIRSPS--AGSCTVPSPASRSVADSI------F  1326
             FDFN    +GI YL++ +E   +   D  RS +  AGS +  SP S     +I      F
Sbjct  121   FDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGSLSYISPNSTKCPVTIPEDQKKF  180

Query  1325  INRIKSRVK  1299
             ++++  +++
Sbjct  181   VDKVVEQIE  189



>ref|XP_008314795.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Cynoglossus 
semilaevis]
Length=686

 Score = 90.1 bits (222),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 94/190 (49%), Gaps = 17/190 (9%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             +VT+ N+   LN + + I E+DF+A+  + +G    P    L    DT E  Y K K+ +
Sbjct  2     EVTRKNYKSCLNTVYSAIEEADFLAIDGEFSGISDGPNVSALTNGLDTPEERYTKLKKHS  61

Query  1646  ERYQILQFAVCPFSLRE--SKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F+  +  SK I  P+NF++FP+   +T  P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFTYDQTNSKYIIKPFNFYVFPKPFNRTS-PDIKFICQSSSIDFLASQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKDCI---RSPSAGSCTVPS---------PASRSVADSI  1329
             FDFN     GI YL++ +E   ++     R+  A     PS         PA        
Sbjct  121   FDFNKVFCHGIPYLNQEEEAHLREQTEERRNQHANGVGTPSYISPSSSKGPAHVPEEHKE  180

Query  1328  FINRIKSRVK  1299
             FI+R+  RV+
Sbjct  181   FISRVVDRVE  190



>ref|XP_008314796.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X2 [Cynoglossus 
semilaevis]
Length=685

 Score = 90.1 bits (222),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 94/190 (49%), Gaps = 17/190 (9%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             +VT+ N+   LN + + I E+DF+A+  + +G    P    L    DT E  Y K K+ +
Sbjct  2     EVTRKNYKSCLNTVYSAIEEADFLAIDGEFSGISDGPNVSALTNGLDTPEERYTKLKKHS  61

Query  1646  ERYQILQFAVCPFSLRE--SKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F+  +  SK I  P+NF++FP+   +T  P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFTYDQTNSKYIIKPFNFYVFPKPFNRTS-PDIKFICQSSSIDFLASQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKDCI---RSPSAGSCTVPS---------PASRSVADSI  1329
             FDFN     GI YL++ +E   ++     R+  A     PS         PA        
Sbjct  121   FDFNKVFCHGIPYLNQEEEAHLREQTEERRNQHANGVGTPSYISPSSSKGPAHVPEEHKE  180

Query  1328  FINRIKSRVK  1299
             FI+R+  RV+
Sbjct  181   FISRVVDRVE  190



>ref|XP_009348052.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X2 
[Pyrus x bretschneideri]
 ref|XP_009348065.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X2 
[Pyrus x bretschneideri]
Length=679

 Score = 89.4 bits (220),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 56/86 (65%), Gaps = 2/86 (2%)
 Frame = -2

Query  1826  IKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAA  1647
             +K VTKSNF  AL D+   +  +DF+A+ L+ TG  SSPW+  L FD A++ YLK K +A
Sbjct  42    LKNVTKSNFEPALADLRRHVAAADFVAIDLEMTGITSSPWRDSLEFDRADVCYLKVKDSA  101

Query  1646  ERYQILQFAVCPFSLRESK--LIASP  1575
             E++ +LQF VCPF    SK   IA P
Sbjct  102   EKFAVLQFGVCPFRWDSSKRSFIAHP  127


 Score = 77.4 bits (189),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 70/260 (27%), Positives = 118/260 (45%), Gaps = 38/260 (15%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL+S  QK +V HN   D   ++SKFL PLPST +EF  ++ + FPH++D K L
Sbjct  287   GFRHVIDLLSSEQKLIVGHNCFLDIAHVYSKFLGPLPSTAEEFVSTVNKYFPHVIDTKVL  346

Query  846   M--------KELGSQKNLNN--------IYVATSYLNSRFFAPVDVELPHQAI-STKADS  718
             +        +   S+ +L++        I +     +S     V VE+    + S+  +S
Sbjct  347   LNTDTVLQQRIKKSRTSLSSAFALLCPQIALGKKSTDSEVQMCVKVEVQVDDLRSSNWNS  406

Query  717   VKSH--GHNVLKISELFAKVCSILKVDPKA---PEAIEHCGQLPPALERY------ANIF  571
                H  G++      +FA+ CS L +D +A    E + H  +L   +          +I 
Sbjct  407   GAKHEAGYDAFMTGCVFAQTCSHLGIDFQACSSSEKLAHNEKLQKQINHLYLSWSNGDII  466

Query  570   DPCSTSYQDPPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVK---SLVYGKHEV  400
             D  +           + + R     ++ S+NV  +WGF S +    ++   S V+G   V
Sbjct  467   DLTTGKKNAMSSGSNNHKKRY---SQIMSENVALIWGFPSKLKARDIRECISKVFGSTSV  523

Query  399   FSSEFDIRLVDESCAVLVFS  340
              S    +  +DE+   + FS
Sbjct  524   TS----VFHLDETAVFVQFS  539



>dbj|BAE47488.1| polyA specific ribonuclease [Arabidopsis thaliana]
Length=131

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = -2

Query  1826  IKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAA  1647
             +K VT+SNF   LND+ + +  +DF+A+ L+ TG  S+PW+  L FD  ++ YLK K +A
Sbjct  38    LKHVTRSNFETTLNDLRSLVKAADFVAIDLEMTGVTSAPWRDSLEFDRYDVRYLKVKDSA  97

Query  1646  ERYQILQFAVCPF  1608
             E++ ++QF VCPF
Sbjct  98    EKFAVVQFGVCPF  110



>ref|XP_002129059.1| PREDICTED: poly(A)-specific ribonuclease PARN [Ciona intestinalis]
Length=642

 Score = 89.0 bits (219),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 58/201 (29%), Positives = 98/201 (49%), Gaps = 21/201 (10%)
 Frame = -2

Query  1817  VTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAERY  1638
             +T++NF+E L  +   I ES FI +  + TG  +  +  L  +D+ E  YLK     E +
Sbjct  3     ITRANFTETLPIVSKAIDESSFICIDGEFTGLTNHRYN-LTSYDSPEERYLKLHSNTENF  61

Query  1637  QILQFAVCPFSLRES--KLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGFDF  1464
              +LQF +C FS +E   K     +NF++FP      G+P   FSCQ+S L  +  + FDF
Sbjct  62    MLLQFGMCTFSWKEDEQKYQVDAFNFYIFPFRSSFPGVPDRIFSCQASSLDFLTLQDFDF  121

Query  1463  NACINDGISYLSRAQELAAKDCI-----------RSPSAGSCTVPSPASRSVADSI----  1329
             N  I +GI +L  ++E + +  I           +SP+       SP+S+  +  I    
Sbjct  122   NKAIKEGIPFLRPSEEASVRSAIEEKQAYRQSTYKSPAKFDGVGRSPSSKGPSTPITDQK  181

Query  1328  ---FINRIKSRVKHWRNACTD  1275
                F  ++ +++K++     D
Sbjct  182   TKDFTEKVVAKIKNFLENTED  202


 Score = 57.4 bits (137),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 60/113 (53%), Gaps = 8/113 (7%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GF ++V  +S SQK +V HN L D      +F+ PLP  L+EF+  +G VFP +LD K L
Sbjct  276   GFSKIVKKLSQSQKLIVGHNMLLDVFYTIQQFVCPLPDVLEEFKSLVGCVFPKLLDTK-L  334

Query  846   MKELGSQKNLNNIYVATSYLNSRF----FAPVDVELP--HQAISTKADSVKSH  706
             M  +   ++L +   A   +N+R     F P D+ +P  +   STK+     H
Sbjct  335   MGSMLPFRDLLST-TALGDMNARLREPPFQPPDITVPGKYNVGSTKSQDSNLH  386



>gb|EMP37329.1| Poly(A)-specific ribonuclease PARN [Chelonia mydas]
Length=265

 Score = 85.5 bits (210),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 93/186 (50%), Gaps = 16/186 (9%)
 Frame = -2

Query  1811  KSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAAERY  1638
             K +F + LN +   I E+DF+A+  + +G    P    L   FDT E  Y K K+ +  +
Sbjct  56    KRDFKDNLNKVYEAIEEADFLAIDGEFSGISDGPSVSTLTNGFDTPEERYQKLKKHSMDF  115

Query  1637  QILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGFDF  1464
              + QF +C F     E+K I   +NF++FP+       P   F CQSS +  +A +GFDF
Sbjct  116   LLFQFGLCSFKYDHTEAKYIMKSFNFYIFPK-PFNRSSPDVKFVCQSSSIDFLASQGFDF  174

Query  1463  NACINDGISYLSRAQELAAK---DCIRSPSAGSCTV----PS----PASRSVADSIFINR  1317
             N    +GI YL++ +E   +   D  RS + G+ T+    P+    PA+       FI R
Sbjct  175   NKVFRNGIPYLNQDEERQLREQYDEKRSQANGAATLSYISPNATKCPATIPEDQKKFIER  234

Query  1316  IKSRVK  1299
             +  +++
Sbjct  235   VVEQIE  240



>ref|XP_006637035.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Lepisosteus 
oculatus]
Length=815

 Score = 89.0 bits (219),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 96/195 (49%), Gaps = 16/195 (8%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             ++T+ NF E LN I + I E+DF+A+  + +G    P    L    DT E  Y K K+ +
Sbjct  2     EITRKNFKERLNAIYSAIEEADFLAIDGEFSGISDGPSVSALTNGLDTPEERYRKLKKHS  61

Query  1646  ERYQILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F     ESK +   +NF++FP+       P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDHSESKYVMKAFNFYIFPKP-FNRNSPDIKFVCQSSSIDFLANQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKDCI-----RSPSAGSCTVPSPASRSVADSI------F  1326
             FDFN    +GI YL++ +E   ++       +S  AG+ +  SP S     ++      F
Sbjct  121   FDFNKVFCNGIPYLNQEEESQLREQYEEKRSQSNGAGTPSFISPNSSKGPFNVPEEHKDF  180

Query  1325  INRIKSRVKHWRNAC  1281
             IN++   V+   N  
Sbjct  181   INKVVEEVEGLLNTA  195



>ref|XP_008919990.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Manacus 
vitellinus]
Length=638

 Score = 88.2 bits (217),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 94/188 (50%), Gaps = 16/188 (9%)
 Frame = -2

Query  1817  VTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAAE  1644
             V K+NF + L+ +   I ESDF+A+  + +G    P    L   FDT E  Y K K+ + 
Sbjct  3     VIKANFKDNLHKVYEAIEESDFLAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSM  62

Query  1643  RYQILQFAVCPFSL--RESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGF  1470
              + + QF +C F     E K I   +NF++FP+       P   F CQSS +  +A +GF
Sbjct  63    DFLLFQFGLCTFKYGDTEEKYIMKSFNFYIFPK-PFNRNSPDVKFVCQSSSIDFLANQGF  121

Query  1469  DFNACINDGISYLSRAQELAAK---DCIRSPS--AGSCTVPSPASRSVADSI------FI  1323
             DFN    +GI YL++ +E   +   D  RS +  AGS +  SP S     +I      FI
Sbjct  122   DFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGSLSYISPNSTKCPVTIPEDQKKFI  181

Query  1322  NRIKSRVK  1299
              ++  +++
Sbjct  182   EKVVEQIE  189



>ref|XP_010901706.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Esox lucius]
Length=754

 Score = 88.6 bits (218),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 52/159 (33%), Positives = 87/159 (55%), Gaps = 8/159 (5%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             +VT+ NF ++L  + + I E+DF+A+  + +G    P    L    DT E  Y+K K+ +
Sbjct  76    EVTRQNFKDSLTTVYSAIEEADFLAIDGEFSGISDGPNVSALTNGLDTPEERYMKLKKHS  135

Query  1646  ERYQILQFAVCPFSLRE--SKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F+  E  S+ +   +NF++FP+   +T  P   F CQSS +  +A +G
Sbjct  136   MDFLLFQFGLCTFTYDEAASEYVIKTFNFYIFPKPFNRTS-PDIKFICQSSSIDFLASQG  194

Query  1472  FDFNACINDGISYLSRAQELAAKDCI---RSPSAGSCTV  1365
             FDFN     GI YL++ +E+  ++     R+ S GS T 
Sbjct  195   FDFNKVFRHGIPYLNQEEEVQLREQYEERRNQSNGSGTT  233



>ref|XP_008063053.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X2 [Tarsius 
syrichta]
Length=395

 Score = 86.7 bits (213),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 93/201 (46%), Gaps = 20/201 (10%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             ++ +SNF   L+ +   I E+DF A+  + +G    P    L   FDT E  Y K K+ +
Sbjct  2     EIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVTALTNGFDTPEERYQKLKKHS  61

Query  1646  ERYQILQFAVCPFSLRE--SKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F   +  SK I   +NF++FP+       P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDDTDSKYITKSFNFYVFPK-PFNRSSPDVKFVCQSSSIDFLASQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKD---------------CIRSPSAGSCTVPSPASRSVA  1338
             FDFN   ++GI YL++ +E   ++                  SP+   C V  P  +   
Sbjct  121   FDFNKVFHNGIPYLNQEEERQLREQYDEKRSQANGAGVLAYVSPNTSKCPVTIPEDQKKF  180

Query  1337  DSIFINRIKSRVKHWRNACTD  1275
                 +++I+  +++  N   D
Sbjct  181   IDQVVDKIEDLLQNEENKNLD  201



>ref|XP_007663083.1| PREDICTED: poly(A)-specific ribonuclease PARN-like, partial [Ornithorhynchus 
anatinus]
Length=297

 Score = 85.5 bits (210),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 55/197 (28%), Positives = 94/197 (48%), Gaps = 20/197 (10%)
 Frame = -2

Query  1808  SNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAAERYQ  1635
             +NF + L+ +   I E+DF+A+  + +G    P    L   FDT E  Y K K+ +  + 
Sbjct  14    ANFKKNLSKVYQAIEEADFLAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFL  73

Query  1634  ILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGFDFN  1461
             + Q+ +C F     ESK +   +NF++FP+   +T  P   F CQSS ++ +A +GFDFN
Sbjct  74    LFQYGLCTFKYDHTESKYVMKSFNFYVFPKPFNRTS-PDVKFVCQSSSIVFLANQGFDFN  132

Query  1460  ACINDGISYLSRAQELAAKDCIR---------------SPSAGSCTVPSPASRSVADSIF  1326
                  GI YL++ +E   ++ +                SP+A  C V  P  +       
Sbjct  133   KVFRCGIPYLNQEEERQLREQLDEKRSQSNGAATLSYVSPNASKCPVTIPEDQKKFIDEV  192

Query  1325  INRIKSRVKHWRNACTD  1275
             + +I+  +++  N   D
Sbjct  193   VEKIEELLQNEENKNLD  209



>ref|XP_008063052.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Tarsius 
syrichta]
 ref|XP_008063054.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X3 [Tarsius 
syrichta]
Length=421

 Score = 87.0 bits (214),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 93/201 (46%), Gaps = 20/201 (10%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             ++ +SNF   L+ +   I E+DF A+  + +G    P    L   FDT E  Y K K+ +
Sbjct  2     EIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVTALTNGFDTPEERYQKLKKHS  61

Query  1646  ERYQILQFAVCPFSLRE--SKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F   +  SK I   +NF++FP+       P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDDTDSKYITKSFNFYVFPK-PFNRSSPDVKFVCQSSSIDFLASQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKD---------------CIRSPSAGSCTVPSPASRSVA  1338
             FDFN   ++GI YL++ +E   ++                  SP+   C V  P  +   
Sbjct  121   FDFNKVFHNGIPYLNQEEERQLREQYDEKRSQANGAGVLAYVSPNTSKCPVTIPEDQKKF  180

Query  1337  DSIFINRIKSRVKHWRNACTD  1275
                 +++I+  +++  N   D
Sbjct  181   IDQVVDKIEDLLQNEENKNLD  201



>ref|XP_010959415.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X3 [Camelus 
bactrianus]
 ref|XP_010981177.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X3 [Camelus 
dromedarius]
Length=560

 Score = 87.8 bits (216),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 96/189 (51%), Gaps = 16/189 (8%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             ++ +SNF   L+ +   I E+DF A+  + +G    P    L   FDT E  Y K K+ +
Sbjct  2     EIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVTALTNGFDTPEERYQKLKKHS  61

Query  1646  ERYQILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F     +SK I   +NF++FP+   K   P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDCTDSKYITKSFNFYVFPK-PFKRSSPDVKFVCQSSSIDFLASQG  120

Query  1472  FDFNACINDGISYLSRAQELAAK---DCIRSPS--AGSCTVPSPASRSVADSI------F  1326
             FDFN    +GI YL++ +E   +   D  RS S  AG+ +  SP +     SI      F
Sbjct  121   FDFNKVFRNGIPYLNQEEERQLREQYDEKRSQSNGAGALSYVSPNTSKCPVSIPEDQKKF  180

Query  1325  INRIKSRVK  1299
             I+++  +++
Sbjct  181   IDQVVEKIE  189



>ref|XP_006602124.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X4 
[Glycine max]
Length=502

 Score = 87.4 bits (215),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 82/307 (27%), Positives = 142/307 (46%), Gaps = 47/307 (15%)
 Frame = -1

Query  1026  GFREVVDLISCSQKPVVAHNSLNDFTSIHSKFLAPLPSTLDEFRHSLGRVFPHILDVKHL  847
             GFR V+DL+S  QK +V +N   D   ++SKF+ PLP T +EF  S+ + FPHI+D K L
Sbjct  115   GFRHVIDLLSSEQKLIVGYNCFLDIAHVYSKFIGPLPGTPEEFVASVSKCFPHIVDTKIL  174

Query  846   M--------KELGSQKNLNNIYVA----------TSYLNSRFFAPVDVELPH-QAISTKA  724
             +        K   S+K+L + + +          ++ L S     V+VE+   ++ S   
Sbjct  175   LSTNLMFQEKMKRSRKSLASAFTSFCPQIAAGSRSTDLGSLSHVKVNVEVDDSRSCSWSP  234

Query  723   DSVKSHGHNVLKISELFAKVCSILKVDPKAPEAIEHCGQLPPALERYANIFDPCSTSYQD  544
                   G++      +FA++CS L +D K  ++ +    L   L++Y N     S  ++D
Sbjct  235   GGKHEAGYDAFMTGCIFAQLCSDLGIDFKLHDSSKPLA-LNEKLQKYVNRL-YLSWMHRD  292

Query  543   -------PPINEEDVRVRAKSCKRVSSKNVVFLWGFQSGISTGQVK---SLVYGKHEVFS  394
                      + +  +R   K   ++  +N+V +WGF S +   +++   S V+G   V S
Sbjct  293   IIDLNTGNKVADSSLRSLTKRYPKIMFENIVIIWGFSSKLKANEIRECISKVFGPTSVVS  352

Query  393   SEFDIRLVDESCAVLVFSSPGLSEVLLEALDS-----GS------LEEMVSEGIR-AASY  250
                 +  +D + A + FS   L    L   DS     G+      L +++  G    A+Y
Sbjct  353   ----VFHLDATAAFVQFSKTELVSDFLLVKDSLERSGGAISVLHPLSKLLEGGNTCGANY  408

Query  249   DAYVKVC  229
             D Y ++C
Sbjct  409   DTYREIC  415



>gb|KFV66105.1| Poly(A)-specific ribonuclease PARN, partial [Picoides pubescens]
Length=551

 Score = 87.4 bits (215),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 90/193 (47%), Gaps = 20/193 (10%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             +V +SNF + L+ +   I ESDF+A+  + +G    P    L   FDT E  Y K K+ +
Sbjct  2     EVIRSNFKDTLSKVYEAIEESDFLAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHS  61

Query  1646  ERYQILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F     E K I   +NF++FP+       P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDHTEEKYIMKSFNFYIFPKP-FNRSSPDVKFVCQSSSIDFLANQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKDCIR---------------SPSAGSCTVPSPASRSVA  1338
             FDFN    +GI YL++ +E   ++                  SP++  C V  P  +   
Sbjct  121   FDFNKVFRNGIPYLNQEEERQLREQYEEKRSQANGTGSLSYISPNSAKCPVTIPDDQKKF  180

Query  1337  DSIFINRIKSRVK  1299
                 + +I+  +K
Sbjct  181   IEKVVEQIEDLLK  193



>ref|XP_005744604.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Pundamilia 
nyererei]
Length=676

 Score = 87.8 bits (216),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 84/161 (52%), Gaps = 8/161 (5%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             +VT+ N+ + LN + + I E+DF+A+  + +G    P    L    DT E  Y K K+ +
Sbjct  2     EVTRKNYKDCLNTVYSAIEEADFLAIDGEFSGISDGPNVSALTNGLDTPEERYTKLKKHS  61

Query  1646  ERYQILQFAVCPFSLRE--SKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F   +  SK I  P+NF++FP+   +T  P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDQAKSKYITKPFNFYIFPKPFNRTS-PDIKFICQSSSIDFLASQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKDCI---RSPSAGSCTVPS  1359
             FDFN     GI YL++ +E   ++     R+  A     PS
Sbjct  121   FDFNKVFCHGIPYLNQEEEAQLREQTEERRNQHANGVGTPS  161



>ref|XP_010981175.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Camelus 
dromedarius]
Length=638

 Score = 87.8 bits (216),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 96/189 (51%), Gaps = 16/189 (8%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             ++ +SNF   L+ +   I E+DF A+  + +G    P    L   FDT E  Y K K+ +
Sbjct  2     EIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVTALTNGFDTPEERYQKLKKHS  61

Query  1646  ERYQILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F     +SK I   +NF++FP+   K   P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDCTDSKYITKSFNFYVFPK-PFKRSSPDVKFVCQSSSIDFLASQG  120

Query  1472  FDFNACINDGISYLSRAQELAAK---DCIRSPS--AGSCTVPSPASRSVADSI------F  1326
             FDFN    +GI YL++ +E   +   D  RS S  AG+ +  SP +     SI      F
Sbjct  121   FDFNKVFRNGIPYLNQEEERQLREQYDEKRSQSNGAGALSYVSPNTSKCPVSIPEDQKKF  180

Query  1325  INRIKSRVK  1299
             I+++  +++
Sbjct  181   IDQVVEKIE  189



>ref|XP_006179128.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Camelus 
ferus]
 ref|XP_010959413.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Camelus 
bactrianus]
Length=638

 Score = 87.8 bits (216),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 96/189 (51%), Gaps = 16/189 (8%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             ++ +SNF   L+ +   I E+DF A+  + +G    P    L   FDT E  Y K K+ +
Sbjct  2     EIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVTALTNGFDTPEERYQKLKKHS  61

Query  1646  ERYQILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F     +SK I   +NF++FP+   K   P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDCTDSKYITKSFNFYVFPK-PFKRSSPDVKFVCQSSSIDFLASQG  120

Query  1472  FDFNACINDGISYLSRAQELAAK---DCIRSPS--AGSCTVPSPASRSVADSI------F  1326
             FDFN    +GI YL++ +E   +   D  RS S  AG+ +  SP +     SI      F
Sbjct  121   FDFNKVFRNGIPYLNQEEERQLREQYDEKRSQSNGAGALSYVSPNTSKCPVSIPEDQKKF  180

Query  1325  INRIKSRVK  1299
             I+++  +++
Sbjct  181   IDQVVEKIE  189



>ref|XP_003457808.1| PREDICTED: poly(A)-specific ribonuclease PARN [Oreochromis niloticus]
Length=679

 Score = 87.8 bits (216),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 84/161 (52%), Gaps = 8/161 (5%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             +VT+ N+ + LN + + I E+DF+A+  + +G    P    L    DT E  Y K K+ +
Sbjct  2     EVTRKNYKDCLNTVYSAIEEADFLAIDGEFSGISDGPNVSALTNGLDTPEERYTKLKKHS  61

Query  1646  ERYQILQFAVCPFSLRE--SKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F   +  SK I  P+NF++FP+   +T  P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDQAKSKYITKPFNFYIFPKPFNRTS-PDIKFICQSSSIDFLASQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKDCI---RSPSAGSCTVPS  1359
             FDFN     GI YL++ +E   ++     R+  A     PS
Sbjct  121   FDFNKVFCHGIPYLNQEEEAQLREQTEERRNQHANGVGTPS  161



>ref|XP_005947045.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Haplochromis 
burtoni]
Length=679

 Score = 87.8 bits (216),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 84/161 (52%), Gaps = 8/161 (5%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             +VT+ N+ + LN + + I E+DF+A+  + +G    P    L    DT E  Y K K+ +
Sbjct  2     EVTRKNYKDCLNTVYSAIEEADFLAIDGEFSGISDGPNVSALTNGLDTPEERYTKLKKHS  61

Query  1646  ERYQILQFAVCPFSLRE--SKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F   +  SK I  P+NF++FP+   +T  P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDQAKSKYITKPFNFYIFPKPFNRTS-PDIKFICQSSSIDFLASQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKDCI---RSPSAGSCTVPS  1359
             FDFN     GI YL++ +E   ++     R+  A     PS
Sbjct  121   FDFNKVFCHGIPYLNQEEEAQLREQTEERRNQHANGVGTPS  161



>gb|KFQ35206.1| Poly(A)-specific ribonuclease PARN, partial [Mesitornis unicolor]
Length=619

 Score = 87.4 bits (215),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/197 (29%), Positives = 90/197 (46%), Gaps = 20/197 (10%)
 Frame = -2

Query  1808  SNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAAERYQ  1635
             ++F + LN +   I ESDF+A+  + +G    P    L   FDT E  Y K K+ +  + 
Sbjct  3     ADFKDNLNKVYEAIEESDFLAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFL  62

Query  1634  ILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGFDFN  1461
             + QF +C F     E K I   +NF++FP+       P   F CQSS +  +A +GFDFN
Sbjct  63    LFQFGLCTFKYDHTEEKYIMKSFNFYIFPKP-FNRSSPDVKFVCQSSSIDFLANQGFDFN  121

Query  1460  ACINDGISYLSRAQELAAKD---------------CIRSPSAGSCTVPSPASRSVADSIF  1326
                 +GI YL++ +E   ++                  SP+A  C V  P  +       
Sbjct  122   KVFRNGIPYLNQEEERQLREQYDEKRSQANGAGSLSYVSPNATKCPVTIPEDQKKFIEKV  181

Query  1325  INRIKSRVKHWRNACTD  1275
             + +I+  +K+  N   D
Sbjct  182   VEQIEDLLKNEENESLD  198



>ref|XP_009884889.1| PREDICTED: poly(A)-specific ribonuclease PARN [Charadrius vociferus]
Length=638

 Score = 87.4 bits (215),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/192 (30%), Positives = 89/192 (46%), Gaps = 20/192 (10%)
 Frame = -2

Query  1817  VTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAAE  1644
             +TK+NF + L  +   I ESDF+A+  + +G    P    L   FDT E  Y K K+ + 
Sbjct  3     LTKANFKDNLKKVYEAIEESDFLAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSM  62

Query  1643  RYQILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGF  1470
              + + QF +C F     E K I   +NF++FP+       P   F CQSS +  +A +GF
Sbjct  63    DFLLFQFGLCTFKYDHTEEKYIMKSFNFYIFPKP-FNRSSPDVKFVCQSSSIDFLANQGF  121

Query  1469  DFNACINDGISYLSRAQELAAKD---------------CIRSPSAGSCTVPSPASRSVAD  1335
             DFN    +GI YL++ +E   ++                  SP+A  C V  P  +    
Sbjct  122   DFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGSLAYISPNATKCPVTIPEDQKKFI  181

Query  1334  SIFINRIKSRVK  1299
                + +I+  +K
Sbjct  182   EKVVEQIEDLLK  193



>ref|XP_006212136.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Vicugna 
pacos]
Length=638

 Score = 87.4 bits (215),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 96/189 (51%), Gaps = 16/189 (8%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             ++ +SNF   L+ +   I E+DF A+  + +G    P    L   FDT E  Y K K+ +
Sbjct  2     EIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVTALTNGFDTPEERYQKLKKHS  61

Query  1646  ERYQILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F     +SK I   +NF++FP+   K   P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDCTDSKYITKSFNFYVFPK-PFKRSSPDVKFVCQSSSIDFLASQG  120

Query  1472  FDFNACINDGISYLSRAQELAAK---DCIRSPS--AGSCTVPSPASRSVADSI------F  1326
             FDFN    +GI YL++ +E   +   D  RS S  AG+ +  SP +     SI      F
Sbjct  121   FDFNKVFRNGIPYLNQEEERQLREQYDEKRSQSNGAGALSYVSPNTSKCPVSIPEDQKKF  180

Query  1325  INRIKSRVK  1299
             I+++  +++
Sbjct  181   IDQVVEKIE  189



>ref|XP_006804394.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Neolamprologus 
brichardi]
Length=679

 Score = 87.4 bits (215),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 84/161 (52%), Gaps = 8/161 (5%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             +VT+ N+ + LN + + I E+DF+A+  + +G    P    L    DT E  Y K K+ +
Sbjct  2     EVTRKNYKDCLNTVYSAIEEADFLAIDGEFSGISDGPNVSALTNGLDTPEERYTKLKKHS  61

Query  1646  ERYQILQFAVCPFSLRE--SKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F   +  SK I  P+NF++FP+   +T  P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDQAKSKYITKPFNFYIFPKPFNRTS-PDIKFICQSSSIDFLASQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKDCI---RSPSAGSCTVPS  1359
             FDFN     GI YL++ +E   ++     R+  A     PS
Sbjct  121   FDFNKVFCHGIPYLNQEEEAQLREQTEERRNQHANGVGTPS  161



>ref|XP_006009665.1| PREDICTED: poly(A)-specific ribonuclease PARN [Latimeria chalumnae]
Length=637

 Score = 87.4 bits (215),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/158 (34%), Positives = 84/158 (53%), Gaps = 8/158 (5%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             ++ + NF  +LN +   I E+DF+A+  + +G    P    L    DT E  Y K K+ +
Sbjct  2     EIVRKNFKGSLNIVYEAIEEADFLAIDGEFSGISDGPSVSTLTNGLDTPEERYQKLKKHS  61

Query  1646  ERYQILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F     ESK +   +NF++FP+   +T  P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCSFKYNYTESKYVMKSFNFYVFPKPFNRTS-PDIKFVCQSSSIDFLASQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKDCI---RSPSAGSCT  1368
             FDFN    DGI+YL++ +E   ++     RS + GS T
Sbjct  121   FDFNKVFCDGIAYLNKEEERQLREQYEEKRSQTNGSGT  158



>ref|XP_007498687.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Monodelphis 
domestica]
Length=638

 Score = 87.4 bits (215),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 95/201 (47%), Gaps = 20/201 (10%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             ++ +SNF   L+ +   I E+DF+A+  + +G    P    L   FDT E  Y K K+ +
Sbjct  2     EMIRSNFKNNLHKVYQAIEEADFLAIDGEFSGISDGPSVTALTNGFDTPEERYHKLKKHS  61

Query  1646  ERYQILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F     +SK I   +NF++FP+   +T  P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDSTDSKYIMKSFNFYVFPKPFSRTS-PDVKFVCQSSSIDFLANQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKDCIR---------------SPSAGSCTVPSPASRSVA  1338
             FDFN    +GI YL++ +E   ++                  SP+A  C V  P  +   
Sbjct  121   FDFNKVFRNGIPYLNQEEERQLREQYDEKRSQSNGAGALSYISPNASKCPVIIPEDQKKF  180

Query  1337  DSIFINRIKSRVKHWRNACTD  1275
                 + +I+  +++  N   D
Sbjct  181   IDKVVEKIEDLIQNEENKNLD  201



>ref|XP_001634577.1| predicted protein [Nematostella vectensis]
 gb|EDO42514.1| predicted protein [Nematostella vectensis]
Length=640

 Score = 87.4 bits (215),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/179 (33%), Positives = 89/179 (50%), Gaps = 6/179 (3%)
 Frame = -2

Query  1826  IKQVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAA  1647
             + ++ +SNFS+ L  +   I E+ F+AV  + +G  +S W++    D+ +  Y K K  +
Sbjct  42    VMEILRSNFSQCLPIVSEAIEEASFLAVDAEFSGL-NSHWKQQNALDSPQERYTKLKNTS  100

Query  1646  ERYQILQFAVCPFSLRES--KLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + I+QF +C F   E+  K IA P+NF++FPR ++    P   F CQSS L  ++   
Sbjct  101   HDFIIVQFGLCAFIWNENLNKYIAKPFNFYIFPR-QIHRSTPDVRFLCQSSSLDFLSSHN  159

Query  1472  FDFNACINDGISYLSRAQELAAKDCIRSPSAGSCTVP--SPASRSVADSIFINRIKSRV  1302
             FDF   I  GISYL    E   +D  +   A     P  SP   S   S   N  K+ V
Sbjct  160   FDFQKWITQGISYLRPYDEQKLRDNFQERQAEHSFGPFTSPPVHSPTGSSTKNVYKTPV  218



>gb|KFQ87427.1| Poly(A)-specific ribonuclease PARN, partial [Phoenicopterus ruber 
ruber]
Length=332

 Score = 85.1 bits (209),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 82/160 (51%), Gaps = 10/160 (6%)
 Frame = -2

Query  1808  SNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAAERYQ  1635
             ++F + LN +   I ESDF+A+  + +G    P    L   FDT E  Y K K+ +  + 
Sbjct  3     ADFKDNLNKVYEAIEESDFLAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFL  62

Query  1634  ILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGFDFN  1461
             + QF +C F     E K I   +NF++FP+       P   F CQSS +  +A +GFDFN
Sbjct  63    LFQFGLCTFKYDHTEEKYIMKSFNFYIFPK-PFNRSSPDVKFVCQSSSIDFLANQGFDFN  121

Query  1460  ACINDGISYLSRAQELAAK---DCIRSPS--AGSCTVPSP  1356
                 +GI YL++ +E   +   D  RS +  AGS +  SP
Sbjct  122   KVFRNGIPYLNQEEERQLREQYDEKRSQANGAGSLSYISP  161



>ref|XP_009897136.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Picoides 
pubescens]
Length=637

 Score = 87.0 bits (214),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 74/139 (53%), Gaps = 5/139 (4%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             +V +SNF + L+ +   I ESDF+A+  + +G    P    L   FDT E  Y K K+ +
Sbjct  2     EVIRSNFKDTLSKVYEAIEESDFLAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHS  61

Query  1646  ERYQILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F     E K I   +NF++FP+       P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDHTEEKYIMKSFNFYIFPKP-FNRSSPDVKFVCQSSSIDFLANQG  120

Query  1472  FDFNACINDGISYLSRAQE  1416
             FDFN    +GI YL++ +E
Sbjct  121   FDFNKVFRNGIPYLNQEEE  139



>ref|XP_004454677.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform 1 
[Dasypus novemcinctus]
Length=638

 Score = 87.0 bits (214),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 84/164 (51%), Gaps = 10/164 (6%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             ++ +SNF   L+ +   I E+DF A+  + +G    P    L   FDT E  Y K K+ +
Sbjct  2     EIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVTALTNGFDTPEERYQKLKKHS  61

Query  1646  ERYQILQFAVCPF--SLRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F     +SK I   +NF++FP+       P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDYEDSKYITKSFNFYVFPK-PFSRSSPDVKFVCQSSSIDFLASQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKDC-----IRSPSAGSCTVPSP  1356
             FDFN    +GI YL++ +E   ++      ++S  AGS +  SP
Sbjct  121   FDFNKVFRNGIPYLNQEEERQLREQYDEKRLQSNGAGSLSYVSP  164



>ref|XP_001622538.1| hypothetical protein NEMVEDRAFT_v1g1365 [Nematostella vectensis]
 gb|EDO30438.1| predicted protein [Nematostella vectensis]
Length=459

 Score = 86.3 bits (212),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 88/177 (50%), Gaps = 6/177 (3%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAER  1641
             ++ +SNFS+ L  +   I E+ F+AV  + +G  +S W++    D+ +  Y K K  +  
Sbjct  2     EILRSNFSQCLPIVSEAIEEASFLAVDAEFSGL-NSHWKQQNALDSPQERYTKLKNTSHD  60

Query  1640  YQILQFAVCPFSLRES--KLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGFD  1467
             + I+QF +C F   E+  K IA P+NF++FPR ++    P   F CQSS L  ++   FD
Sbjct  61    FIIVQFGLCAFIWNENLNKYIAKPFNFYIFPR-QIHRSTPDVRFLCQSSSLDFLSGHNFD  119

Query  1466  FNACINDGISYLSRAQELAAKDCIRSPSAGSCTVP--SPASRSVADSIFINRIKSRV  1302
             F   I  GISYL    E   +D  +   A     P  SP   S   S   N  K+ V
Sbjct  120   FQKWITQGISYLRPYDEQKLRDNFQERQAEHSFGPFTSPPVHSPTGSSTKNVYKTPV  176



>ref|XP_003269351.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform 1 [Nomascus 
leucogenys]
Length=639

 Score = 87.0 bits (214),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/201 (28%), Positives = 91/201 (45%), Gaps = 20/201 (10%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             ++ +SNF   L+ +   I E+DF A+  + +G    P    L   FDT E  Y K K+ +
Sbjct  2     EIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHS  61

Query  1646  ERYQILQFAVCPF--SLRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F     +SK I   +NF++FP+       P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPK-PFNRSSPDVKFVCQSSSIDFLASQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKD---------------CIRSPSAGSCTVPSPASRSVA  1338
             FDFN    +GI YL++ +E   ++                  SP+   C VP P  +   
Sbjct  121   FDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVPIPEDQKKF  180

Query  1337  DSIFINRIKSRVKHWRNACTD  1275
                 + +I+  ++   N   D
Sbjct  181   IDQVVEKIEDLLQSEENKNLD  201



>gb|KFW94766.1| Poly(A)-specific ribonuclease PARN, partial [Phalacrocorax carbo]
Length=418

 Score = 85.5 bits (210),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 88/193 (46%), Gaps = 20/193 (10%)
 Frame = -2

Query  1808  SNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAAERYQ  1635
             ++F + LN +   I ESDF+A+  + +G    P    L   FDT E  Y K K+ +  + 
Sbjct  3     ADFKDNLNKVYEAIEESDFLAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFL  62

Query  1634  ILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGFDFN  1461
             + QF +C F     E K I   +NF++FP+       P   F CQSS +  +A +GFDFN
Sbjct  63    LFQFGLCTFKYDHTEEKYIMKSFNFYIFPKP-FNRSSPDVKFVCQSSSIDFLANQGFDFN  121

Query  1460  ACINDGISYLSRAQELAAKDCIR---------------SPSAGSCTVPSPASRSVADSIF  1326
                 +GI YL++ +E   ++                  SP+A  C V  P  +       
Sbjct  122   KVFRNGIPYLNQEEERQLREQYDEKRSQANGAGSLSYISPNATKCPVTIPEDQKKFIEKV  181

Query  1325  INRIKSRVKHWRN  1287
             + +I+  +K   N
Sbjct  182   VEQIEELLKDEEN  194



>gb|KFQ03489.1| Poly(A)-specific ribonuclease PARN, partial [Leptosomus discolor]
Length=619

 Score = 86.7 bits (213),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 89/193 (46%), Gaps = 20/193 (10%)
 Frame = -2

Query  1808  SNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAAERYQ  1635
             ++F + LN +   I ESDF+A+  + +G    P    L   FDT E  Y K K+ +  + 
Sbjct  3     TDFKDNLNKVYEAIEESDFLAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFL  62

Query  1634  ILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGFDFN  1461
             + QF +C F     E K I   +NF++FP+       P   F CQSS +  +A +GFDFN
Sbjct  63    LFQFGLCTFKYDHTEEKYIMKSFNFYIFPKP-FNRSSPDVKFVCQSSSIDFLANQGFDFN  121

Query  1460  ACINDGISYLSRAQELAAKD---------------CIRSPSAGSCTVPSPASRSVADSIF  1326
                 +GI YL++ +E   ++                  SP+A  C V  P  +       
Sbjct  122   KVFRNGIPYLNQEEERQLREQYDEKRSQANGAGSLSYVSPNATKCPVTVPEDQKKFIEKV  181

Query  1325  INRIKSRVKHWRN  1287
             + +I+  +K+  N
Sbjct  182   VEQIEDLLKNEEN  194



>gb|ERZ96763.1| hypothetical protein GLOINDRAFT_330565 [Rhizophagus irregularis 
DAOM 181602]
Length=689

 Score = 86.7 bits (213),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 76/138 (55%), Gaps = 3/138 (2%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLPFDTAEIAYLKAKRAAER  1641
             ++ K+NF E    ++  I  +DFIA+  + TG   S  +R+  FD  +  Y K + AA +
Sbjct  2     EIIKNNFHELFPIVQEAIEGADFIAIDTELTGLNESI-ERIKTFDDPQSRYTKVRIAATK  60

Query  1640  YQILQFAVCPFSLRESK--LIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGFD  1467
             + I+QF +C F+  E++   IA P+NF++FP +  +       F C  S L  ++  GFD
Sbjct  61    FLIIQFGICTFTYSEAENTFIARPFNFYIFPANSDRKDYHDICFMCSGSSLHFLSNCGFD  120

Query  1466  FNACINDGISYLSRAQEL  1413
             FN  I  GI +L++  E+
Sbjct  121   FNKLIAQGIPFLNKTDEI  138



>ref|XP_003417760.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Loxodonta 
africana]
Length=638

 Score = 86.7 bits (213),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 84/164 (51%), Gaps = 10/164 (6%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             ++ +SNF   L+ +   I E+DF A+  + +G    P    L   FDT E  Y K K+ +
Sbjct  2     EIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVTALTNGFDTPEERYQKLKKHS  61

Query  1646  ERYQILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F     ESK I   +NF++FP+       P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDHTESKYITKSFNFYVFPK-PFNRSSPDVKFVCQSSSIDFLASQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKDC-----IRSPSAGSCTVPSP  1356
             FDFN    +GI YL++ +E   ++      ++S  AG+ +  SP
Sbjct  121   FDFNKVFRNGIPYLNQEEERQLREQYDEKRLQSNGAGALSYVSP  164



>ref|XP_010595596.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X2 [Loxodonta 
africana]
Length=619

 Score = 86.7 bits (213),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 84/164 (51%), Gaps = 10/164 (6%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             ++ +SNF   L+ +   I E+DF A+  + +G    P    L   FDT E  Y K K+ +
Sbjct  2     EIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVTALTNGFDTPEERYQKLKKHS  61

Query  1646  ERYQILQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F     ESK I   +NF++FP+       P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDHTESKYITKSFNFYVFPKP-FNRSSPDVKFVCQSSSIDFLASQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKDC-----IRSPSAGSCTVPSP  1356
             FDFN    +GI YL++ +E   ++      ++S  AG+ +  SP
Sbjct  121   FDFNKVFRNGIPYLNQEEERQLREQYDEKRLQSNGAGALSYVSP  164



>ref|XP_004332390.1| PREDICTED: LOW QUALITY PROTEIN: poly(A)-specific ribonuclease 
[Tursiops truncatus]
Length=598

 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 95/189 (50%), Gaps = 16/189 (8%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             ++ +SNF   L+ +   I E+DF A+  + +G    P    L   FDT E  Y K K+ +
Sbjct  2     EIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVTALTNGFDTPEERYQKLKKHS  61

Query  1646  ERYQILQFAVCPF--SLRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F     +SK I   +NF++FP+       P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPK-PFNRSSPDVKFVCQSSSIDFLASQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKDC-----IRSPSAGSCTVPSPASRSVADSI------F  1326
             FDFN    +GI YL++ +E   ++      ++S  AG+ +  SP +     +I      F
Sbjct  121   FDFNKVFRNGIPYLNQEEERQLREQYDEKRLQSNGAGALSYASPNTSKCPVTIPEDQKKF  180

Query  1325  INRIKSRVK  1299
             I+++  +++
Sbjct  181   IDQVVEKIE  189



>gb|KFV08311.1| Poly(A)-specific ribonuclease PARN, partial [Tauraco erythrolophus]
Length=433

 Score = 85.5 bits (210),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 81/159 (51%), Gaps = 10/159 (6%)
 Frame = -2

Query  1805  NFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAAERYQI  1632
             +F + LN +   I ESDF+A+  + +G    P    L   FDT E  Y K K+ +  + +
Sbjct  1     DFKDNLNKVYEAIEESDFLAIDGEFSGISDGPSVSTLTNGFDTPEERYQKLKKHSMDFLL  60

Query  1631  LQFAVCPFSLR--ESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREGFDFNA  1458
              QF +C F     E K I   +NF++FP+       P   F CQSS +  +A +GFDFN 
Sbjct  61    FQFGLCTFKYDHTEEKYIMKSFNFYIFPKP-FNRSSPDVKFVCQSSSIDFLANQGFDFNK  119

Query  1457  CINDGISYLSRAQELAAK---DCIRSPS--AGSCTVPSP  1356
                +GI YL++ +E   +   D  RS S  AGS +  SP
Sbjct  120   VFRNGIPYLNQEEERQLREQYDEKRSQSNGAGSLSYISP  158



>ref|XP_004270210.1| PREDICTED: poly(A)-specific ribonuclease PARN [Orcinus orca]
Length=638

 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 95/189 (50%), Gaps = 16/189 (8%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             ++ +SNF   L+ +   I E+DF A+  + +G    P    L   FDT E  Y K K+ +
Sbjct  2     EIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVTALTNGFDTPEERYQKLKKHS  61

Query  1646  ERYQILQFAVCPF--SLRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F     +SK I   +NF++FP+       P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPK-PFNRSSPDVKFVCQSSSIDFLASQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKDC-----IRSPSAGSCTVPSPASRSVADSI------F  1326
             FDFN    +GI YL++ +E   ++      ++S  AG+ +  SP +     +I      F
Sbjct  121   FDFNKVFRNGIPYLNQEEERQLREQYDEKRLQSNGAGALSYASPNTSKCPVTIPEDQKKF  180

Query  1325  INRIKSRVK  1299
             I+++  +++
Sbjct  181   IDQVVEKIE  189



>ref|XP_007467023.1| PREDICTED: poly(A)-specific ribonuclease PARN [Lipotes vexillifer]
Length=638

 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 95/189 (50%), Gaps = 16/189 (8%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             ++ +SNF   L+ +   I E+DF A+  + +G    P    L   FDT E  Y K K+ +
Sbjct  2     EIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVTALTNGFDTPEERYQKLKKHS  61

Query  1646  ERYQILQFAVCPF--SLRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F     +SK I   +NF++FP+       P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPK-PFNRSSPDVKFVCQSSSIDFLASQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKDC-----IRSPSAGSCTVPSPASRSVADSI------F  1326
             FDFN    +GI YL++ +E   ++      ++S  AG+ +  SP +     +I      F
Sbjct  121   FDFNKVFRNGIPYLNQEEERQLREQYDEKRLQSNGAGALSYASPNTSKCPVTIPEDQKKF  180

Query  1325  INRIKSRVK  1299
             I+++  +++
Sbjct  181   IDQVVEKIE  189



>ref|XP_007188428.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Balaenoptera 
acutorostrata scammoni]
Length=638

 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 95/189 (50%), Gaps = 16/189 (8%)
 Frame = -2

Query  1820  QVTKSNFSEALNDIETRITESDFIAVSLQTTGAYSSPWQRLLP--FDTAEIAYLKAKRAA  1647
             ++ +SNF   L+ +   I E+DF A+  + +G    P    L   FDT E  Y K K+ +
Sbjct  2     EIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVTALTNGFDTPEERYQKLKKHS  61

Query  1646  ERYQILQFAVCPF--SLRESKLIASPYNFHLFPRDELKTGMPSYSFSCQSSYLISIAREG  1473
               + + QF +C F     +SK I   +NF++FP+       P   F CQSS +  +A +G
Sbjct  62    MDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPK-PFNRSSPDVKFVCQSSSIDFLASQG  120

Query  1472  FDFNACINDGISYLSRAQELAAKDC-----IRSPSAGSCTVPSPASRSVADSI------F  1326
             FDFN    +GI YL++ +E   ++      ++S  AG+ +  SP +     +I      F
Sbjct  121   FDFNKVFRNGIPYLNQEEERQLREQYDEKRLQSNGAGALSYTSPNTSKCPVTIPEDQKKF  180

Query  1325  INRIKSRVK  1299
             I+++  +++
Sbjct  181   IDQVVEKIE  189



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5916198060420